4IIVA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.5 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
b'SRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.5 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iivA00
3HN2A 1LRJA 4PLWA 3JYNA 5JDIA 3EDMA 1PJTA 4KTTE 1WDMA 3MJTA 5KVSA 3C85A 3ZZNA 1GCOA 5DOZA 5AXDA 1Z6ZA 2PZJA 4EYEA 1U5AA 1UXIA 5FFFA 1T2EA 2HUNA 4MO2A 4YXFA 1LC3A 1PJQA 2VQ3A 3PJFA 4KTVE 4O6VA 5KCZA 3BZUA 1P1IA 4TSKA 1ARZA 4K28A 2OL4A 3L9XA 1FDSA 1SB9A 1BXGB 4ND3A 2VN8A 2QQ5A 5J23A 2X9VA 2B36A 5EL0A 4K1LA 4LVCA 1WP4A 1WAMA 1HDXA 2HJSA 4GX2A 1DSSG 1E7WA 3ZW9A 1KVRA 3Q2IA 1KVSA 1GEEA 1E3SA 2V6MA 3ON5A 4RPHA 2EGGA 5JY6A 4W9NC 5AOVA 1N5DA 4GX5A 1Y7TA 1YXMA 3AM3A 1Z7BA 1R4MB 4IM7A 2J8ZA 1EEHA 3AOGA 2J3HA 1EVZA 5F5LA 3KYDB 3ZWYA 1U8XX 3BHIA 4CLRB 2FMUA 3K9QO 3GFBA 4PLVA 1ISMA 1W4ZA 3JQAA 4QO7A 4UUOA 4R54A 3ZWWA 2OGUA 3B70A 4N5LA 2G82A 2NU7A 3JQCA 2OP0A 3E6AA 3PVZA 1YH3A 4UVIA 4E31A 1JW9B 2NACA 4CMGA 2O3TA 1N9GA 4ZQHA 1LDGA 2IRWA 1OI7A 2P4QA 3DWFA 1LA2A 2EXXA 2NQTA 2GF2A 3H9GA 3C1TA 4YJHB 1DAOA 4N7RA 1T1SA 4JLWA 1EDOA 4AICA 1E7RA 2QX7A 3COSA 3QLJA 2I5PO 4GWGA 4J4BA 3TN7A 1BHSA 1N8KA 3RUEA 3UW3A 1PWXA 1G6KA 3ROKA 4EJ6A 1IYZA 3JQ7A 4WUVA 4J1TA 3KSZO 5IF3A 1ONPA 4BVAA 4PLYA 4NBRA 3JCZA 2PH5A 4J0EA 1UP7A 1I3KA 1OAAA 4UVHA 4RL6A 4MKZA 4YTEA 1PGJA 1K5HA 4TRMA 1ONOA 4HADA 4LISA 1HDRA 1PZHA 5L7YA 3ROMA 2I76A 4OJNA 3WG9A 8ADHA 3QE3A 5F21A 2C82A 3PZBA 4J2OA 1XU7A 2DPGA 1JDJA 4WEQA 1Q0QA 3QW2A 1LRKA 4EUHA 3DOJA 4OXYA 2EIHA 2FPIA 1G0OA 1ADGA 3I9JA 3M6IA 3UFXA 3KUXA 3ZWPA 5CDUA 1YGYA 3GDFA 1DO8A 4K26A 4BO7A 2JCXA 1JN0A 1W8DA 4BNHA 2OFPA 1GL3A 3PWKA 4J9VA 4FGSA 5AYVA 3BAZA 3S2EA 3ZWNA 1NM5A 4INAA 3OBBA 4HFRA 1QYCA 1RYEA 2YFHA 1OBFO 3IS3A 3TOZA 1MXFA 1MP0A 3FBGA 4FIZA 4DQXA 4W82A 2GN6A 3UN1A 1K6JA 3JQDA 1N1EA 3ZU5A 1QSGA 1MLDA 3WS7A 3QIVA 4HP8A 4BHTA 1X13A 3UICA 5K0ZA 3H5RA 4R01A 2C7VA 5B4TA 1M66A 4ND1A 3LT2A 2C29D 1HZZA 1H9BA 4RPKA 5JMWA 3WSVA 4D0RA 4LVUA 4Y67A 4BNVA 3LF1A 2CDCA 5T67A 3W6UA 3OJFA 4GMGA 5DF1A 3ZNQA 4RPGA 4M54A 5IFLA 5JC8A 5JE8A 4CM7A 4RZIA 2DUUA 2DTXA 2HK7A 2NU8A 2YQ5A 5FI5A 3GZNB 1XA0A 4YJFA 1Q0LA 3JD0A 1AN9A 3M1AA 4L4XA 4W4TA 3WGZA 4BNMA 3TFQA 3DL2A 1VKNA 1X1EA 2YQ4A 2GDZA 2HSDA 1R16A 5TRTA 3KXDA 3PGXA 3PHHA 3V1UA 2VTDA 3MJCA 5KJFA 3WFIA 4PZCA 3ZH2A 1PL7A 1E7QA 2J6IA 2R6JA 4BO6A 2ZKLA 4WCFB 4DC1A 3NDRA 3EUWA 1LRLA 2FZEA 4GKBA 3X2FA 1QYWA 4QUKA 3TZCA 5A3JA 4IUYA 3PJGA 3DAPA 3U0BA 3KYBA 4MVJP 2UUPA 4NBUA 1QYVA 3VH2A 3EAGA 3QVWA 4MJLA 2OUIA 5IZCA 3JD3A 1BXGA 3S2FA 4AJ4A 1DRUA 5A5EA 3PQDA 1JVSA 3NAQA 4CR7A 2BRUA 3P2YA 7ADHA 1QRRA 5KKAA 1E3WB 3PK0A 1Q7CA 5DBIA 2ILTA 1GQQA 3TSCA 3I9KA 1L7DA 3UKOA 3CZMA 3FTNA 4QFCA 4IDEA 3GRKA 3RFTA 5JLAA 2NLOA 3NT2A 1Z75A 3EVNA 3TQHA 5L7WA 3LSYA 1XQ6A 5A9TA 3M2PA 1X1TA 1XQ1A 3KYDA 4CUJA 3PQEA 4CLRA 1D1SA 1P44A 3WWZA 3ZHBA 3QV1A 4U7WA 3SLKA 3KOUA 4FFLA 4P22A 4QECA 1JAXA 4PLZA 4PLTA 5GZ3A 3ANLA 4HUJA 3GR6A 3IKVA 4BNIA 2J3IA 1QP8A 4YEDA 2CMDA 2EWMA 4W99A 5JAZA 4YT5A 3RCBA 4RCVA 3AUAA 3B6ZA 5I7EA 1DIHA 3ZV6A 1X0VA 1PJBA 3AI1A 2VWQA 4BQRA 4Y8VA 4FR5A 3AM5A 4YJHA 3OEYA 2I66A 5EMHA 5LCXA 2Y0CA 4M49A 3JQ6A 1P45A 3DEYX 4GL4A 2Q4EA 3WTBA 3I4FA 2NSDA 5L7TA 3QQPA 4ALMA 1GZ3A 4Q3BA 4LCEA 2FR8A 3NV9A 4RF4A 2NVUA 1DRWA 4FDAA 2VT2A 3RI3A 1P1RA 5I8ZA 3CH6A 2Z95A 4L0QA 4II2A 1BMDA 1HKUA 1R4NB 3BMQB 1E1MA 3DMYA 4DTIA 1R0SA 2CVZA 3DC2A 1PGPA 3OQBA 2NADA 4CMKA 4MVJI 1XWFA 2P5UA 2ZATA 3ASUA 1PGNA 2BFMA 3VH1A 5A9SB 5CPBA 1X7HA 5H83A 5TT0A 4DYDA 3GQVA 2D5CA 4IXTA 1ZK1A 3MWDB 2WJPA 1T1RA 4CMEC 3LLSA 1NP3A 2WTBA 1AE1A 1NAIA 5TX7A 1O8CA 1DC6A 3P19A 4NK4A 4AJEA 4YJGB 2IYPA 1UUFA 1ORRA 3PGJA 4IJKA 4DPMA 4H3VA 4O63O 3K2BA 3MWEB 1GZ6A 2JHFA 3D1LA 4HKTA 1FMCA 1P0FA 5DNAA 3GEGA 3LVFO 1X7GA 4HFNA 3GUCA 4RQUA 3U62A 3DHNA 3HSKA 4GVXA 1Q1NA 1JWAB 1PS8A 4BKPA 4RF2A 4ZRNA 4XGIA 1NR1A 5HWSA 3VKVA 4YACA 2W2KB 2SCUA 3FI9A 2IZZA 3ENNA 3NEPX 2BGLA 4J4HA 4KUHA 3B1KA 4RV9A 3IIEA 4MVJD 4IIUA 3F1KA 4E3ZA 4GKVA 2Q2VA 1YQXA 2W2LA 3KLMX 3PJDA 1CWUA 4OM8A 4J90A 4OYRA 5KOIA 1DEHA 1UAYA 1Z73A 1ZW1A 4P4LA 4EUEA 3JQFA 1PQWA 1QORA 2Q1WA 3O9ZA 5GZ1A 2I99A 3E5MA 3DQPA 1PZGA 3DBRB 1YOVA 5JXWA 3TF5A 4ZQFA 1U4OA 3I9LA 4BUCA 2GNAA 4XKJA 5BQFA 1QKIA 2FPPA 3QVTA 4NU6A 1E3JA 2CDAA 2IXBA 3CMMA 1LLCA 3NUGA 4XQCA 3PFWO 2PK3A 4I5FA 5TIIA 4U0KA 3B1JA 4UEOA 4BGVA 3U4CA 3ETDA 1HDOA 1J0XO 2PKQO 3BTUA 1CYDA 1IZ0A 4JXKA 4QTZA 3RBZA 4OHUA 3LQFA 4WCFA 3RROA 1FDVA 2YV3A 2NNLD 2CD9A 2CY0A 4EGFA 3U4HA 3A28A 4WE3A 3VHRA 1BSVA 4AJ1A 2D0IA 4KWIA 4Q9NA 3OJEA 4I9UA 5JNLA 2IDZA 1VJTA 3RUHA 5CDYA 4DMLA 1E7MA 2DQ4A 1GU7A 1HSZA 1Y81A 4UEJA 3FWZA 2ZQZA 1EK5A 4G5HA 2ZTLA 4BNLA 1OOEA 1VJ0A 3WX0A 4AJNA 1NBOA 2WYUA 4CQMD 5DP2A 3RKRA 2A35A 3GHHA 1LBEA 4DL9A 2JCVA 4L8VA 2Q50A 2I6TA 3QWAA 2OORA 4WPGA 3IUSA 3RJ5A 4XDYA 3G17A 3CZRA 1F06A 2Q4BA 5T57A 2NUAA 3OIGA 4CM9D 2VRCA 4JP2A 4Q39A 4FC7A 3JQGB 2HLPA 4FC6A 1KYQA 6ADHA 2FSVA 3MOGA 4WNCA 4FD3A 2CNBA 4ZQGA 2HMSA 1I2CA 2NQ8A 1HEUA 4CLHA 4MIYA 4WGGA 3VAZA 1JKJA 3WLEA 2JD2A 3AUSA 4Y6RA 5A9RA 1NWCA 1RWBA 4BOYA 1SAYA 1FK8A 3ZNOA 1ZK0A 2JFFA 3KSUA 1CF2O 1ENPA 3BHMA 3ONEA 3QWFA 1XDWA 4DIBA 2R2GA 5H81A 3KEOA 2FHSA 3GEDA 2VHXA 1BW9B 4P4NA 3ZV5A 3WYBA 7MDHA 3G3EA 3RFVA 2Y93A 4JN6B 4F6CA 3OP4A 2VOJA 1EVYA 4NIMA 1LNQA 1AXEA 4A26A 1S6YA 3ZGYA 3I9NA 1IZ9A 3GAFA 3LDHA 1PU2A 2G0TA 1PR3A 4BV9A 3HDHA 5EPOA 1R4NA 3BMQA 4KQWA 3Q9UA 3ZWBA 1C0PA 5HA5A 1YJQA 1NXQA 1BG6A 1UP6A 2V65A 3FD8A 2C2XA 4FFMA 3EGOA 5JDIC 3NKLA 3WGOA 1NYTA 3GT0A 2H6EA 2P9GA 3H7AA 3IMFA 5A9SA 3TFOA 3CKYA 3SXPA 4TROA 3GN1A 1K89A 3W6ZA 4E5NA 4E5MA 1ZUD1 1NX6A 1O0SA 2HRZA 3MJVA 3RQSA 5JMPA 3ZN2A 1MA0A 1PJLA 1PGOA 3JYLA 1N9GB 3F4BA 3HB4X 4M86A 3ENKA 5G4KA 1LDMA 3KETA 3H8VA 2FRDA 1LDEA 3IJRA 3PRJA 3RBVA 3ZWCA 4E5KA 3VKUA 1HRDA 2AQHA 4YJGA 3DDNA 1VRWA 5IZ4A 4TKMA 1PWZA 2DM6A 2GGSA 3IOYA 3JD1A 3QHAA 1FF9A 1P0CA 4F6LA 3QVOA 4YYZA 1UH5A 5GZ6A 5LDGA 1IE3A 2JJYA 1O5IA 3V2UA 5BR7A 1GD1O 2Y1FA 2XXBA 4Z3KA 5F3RA 3BXXA 4B3JA 1A72A 4GWKA 3U4IA 1B0AA 4J7XA 3E1KA 4B7UA 2RIRA 2YW9A 4JROA 1P1HA 1IY8A 3ICPA 4BS9A 5JAMA 1P33A 5HRUA 2JFHA 3R3SA 2Y1CA 3JTMA 3I6QA 1BTOA 4YDRA 1T4DA 3ZU2A 1BXZA 4WK6A 4YRBA 1MXHA 3JQ8B 3VZRA 1NQTA 1I3MA 1GPDG 1WWKA 4K6CA 1Z82A 3LF2A 4N54A 4RVUA 1L1FA 2Y1OA 3DTTA 4TRRA 3QRWA 2PKQP 3DBRA 1KVUA 4N5NA 5COQA 3PI7A 3I52A 3L6DA 2O3RA 3HDJA 5HS4A 5CDTA 4MPDA 1V35A 5T5QA 3HN7A 4E5PA 4FSHA 2TMDA 2YDYA 4FGWA 4GAEA 1UAGA 1LU9A 3AM4A 4NH4A 2HAEA 5MDHA 3V5NA 1DPGA 2B4TO 4YT4A 1OC4A 1X14A 4CLEA 4RF5A 4PLHA 4UUMA 1X15A 1SOWA 4WKGA 1VL0A 2BGMA 1F17A 1TLTA 2D1YA 5ILOA 3AFNA 2WYWA 1W6UA 3PYLA 1O95A 2GZ3A 4IZHA 1WNTA 2RBEA 4BNJA 1BRMA 1PS0A 4LRTB 3QA9A 2DFDA 3LU1A 4J91A 5L51A 5AXBA 5EERA 3HE3A 4A10A 3DFZA 3W4IA 1HLPA 1ZK4A 3K73O 3KM0A 2X8LA 1WVGA 1QMGA 2HRBA 2Y1EA 2O3QA 1RM4A 2YUTA 4YJFB 1J6UA 1UP4A 2D4AA 3TWOA 3ZWAA 4ZJUA 2UVDA 2GYYA 2O2YA 4ALNA 5KKCA 1QV7A 4JIGA 3X2EA 4D45A 2GD1O 1JKFA 3ETGA 2JHGA 3KBOA 3DZJA 3JSAA 4NI5A 1MGOA 5COAA 2X86A 4FPXA 3DMTA 3SBOA 5BNIA 1U3WA 4E30A 3AUUA 4CM5A 4FOOA 3JQGA 2QZZA 5G0TA 2QRKA 3CIFA 3RUIA 2H1SA 1LLQA 2AXQA 2EF1A 2DLDA 5JCJD 3SJ7A 1E1KA 1GFSA 1PJSA 2QYSA 4IBOA 3DZGA 1BDBA 1E0DA 2ZIZA 3K6JA 3BA1A 3VH4A 2CSUA 3DZBA 3VTZA 2YFQA 3DAGA 4IXWA 5I7SA 4B7XA 1XEAA 1KVTA 3GRPA 1WW8A 5TNXA 4AJOA 3VPXA 1KERA 4BO2A 1YB5A 3EYWA 3RASA 1BW9A 1E6EA 3WR5A 3GLQA 1ZSYA 3G49A 5KTKA 1U2GA 2RCYA 2E4AA 1LX6A 2EV9A 5AXAA 3ROPA 1DIRA 4GX0A 3HG7A 4MIEA 4DBZA 5L4LA 1N7HA 2BMAA 4R41A 1NWHA 2X1HA 5B4VA 1EUDA 1I2BA 4NJMB 3A1NA 5A04A 1MFZA 3HDYA 2A94A 4R1TA 3EZYA 4LMPA 4E0BA 3H5NA 4L74A 1UDCA 2VYVA 4GGPA 3ZW8A 2W98A 1Y9AA 3ASVA 4HX5A 4TRJA 1Y5MA 2FR1A 5ADHA 1BGVA 4E2WA 4D3DA 2GZ2A 4CODB 5C7LO 1V0JA 4ZVVA 3VDQA 2V6FA 2BD0A 4B4OA 1YS4A 4XGKA 2EKLA 1U8FO 2O4UX 4E2YA 1I10A 4HXYA 4J1SA 4R1NA 3ZU3A 3NT4A 1H6BA 4PGFA 2BHLA 4AL4A 3OM9A 4PRLA 2X7HA 3D3EA 4UULA 1YONA 1NQAO 3GNQA 4IJVA 1KEWA 2P68A 4ILKA 4AG3A 3D4NA 4DRYA 2VWPA 2NVUB 4KP7A 1GZ4A 4P4GA 1I24A 2JL1A 5JYDA 5CDSA 1C14A 5CEEA 1GCUA 3KYCB 1WZIA 1HYGA 3O8QB 4RGBA 1YB1A 4O1MA 1ZSNA 2PZKA 1U4SA 3AWDA 3FPLA 2YZ7A 3GEMA 3JQ8A 3GNTA 3VTFA 2D2IA 1HT0A 4J0FA 1JVBA 2XPCA 1F14A 4S3MA 5A4DA 1GYQA 1K0UA 3PPIA 1CETA 1ZCJA 1YJ8A 2CVOA 4YT2A 1KIFA 1LQUA 3OEWA 5HTOA 2VUSA 4NBVA 1T2DA 3WICA 5TC4A 4MVJA 1UXKA 3O38A 4XYEA 1B26A 3A9WA 1WZEA 1E92A 3L6EA 2WMDA 1HDCA 2XF8A 4JP3A 1P1KA 2J5RA 1BWSA 3UUWA 4B8ZA 1H2BA 4U0JA 3E48A 2H63A 4GSLA 4DPKA 1O6ZA 4J1NA 4WLNA 4DIFA 1Y5RA 5CHEA 3VDRA 4CLXA 3H2ZA 5ER9A 1I8TA 2P2SA 3P7MA 2HMWA 1H94A 2DU8A 5JDCA 1XGKA 4BNFA 1W0CA 2AHRA 3Q3CA 1Y8QB 3DONA 3GA0A 3W8DA 4GLOA 2GN8A 3QVXA 2WE7A 3KO8A 4IS2A 3LT1A 4JGBA 5EESA 2IEDA 4MVJF 1KOLA 3C1AA 2DPHA 3PXXA 4I5DA 2YV2A 2LDXA 3GGGA 3ZDFA 3H9JA 4OSOA 4LN1A 3G79A 4PLGA 5ITWA 3CUKA 3KHUA 2OBYA 2I9PA 5JC1A 1NASA 1GYPA 2V6BA 1C0KA 2PY6A 2PLAA 3RC7A 2CVQA 3HJAA 2WSBA 3CMCO 1E7SA 4DQUA 2WDZA 5K6AA 3JYQA 5JPIA 5L45A 4HNGA 1V8BA 4FFNA 4ALKA 4Z6KA 4CUZA 1TT5B 3FNFA 2C5AA 1YOVB 3ZNPA 1YL7A 3WQRA 4ESOA 1DHRA 5JSFA 3NJ4A 4CM1A 1KEVA 3BMOB 1U28A 2H9IA 2WEKA 3PP8A 1RM5A 5CDGA 1GYRA 1SNYA 2ZYGA 2B37A 3RUFA 2BH9A 2A4KA 4WOKA 5T8KA 5A06A 3D5TA 4FB5A 2IODA 4YRDA 1YDWA 2PGDA 2QRJA 3D5QA 2ZYAA 4AJLA 1ID1A 4B3HA 4AJJA 5AQ1A 1D4FA 4ZGWA 1JLLA 4FFOA 4BO1A 1I3NA 1E1LA 1I30A 1JAYA 4L76A 3WGYA 1UXGA 2Z1MA 3VPHA 5HM8A 4OOFA 2ZB4A 4LK3A 3DHEA 3Q6IA 3S8MA 1I0ZA 4GMFA 4ZICA 1ZSVA 4NNJA 2ZJ1A 4RVGA 1LSOA 3U4DA 4AJKA 4MVJG 3C1OA 5G4LA 4E4YA 2PWZA 4DLLA 1E7YA 3OJ0A 4CLOB 1Y8RA 1U2DA 5L4SA 4CV0A 1NFQA 2EP5A 3L4BC 3GVCA 3FWNA 2OXIA 3RVDA 1Z7EA 3FBTA 3R0IA 2Q1TA 4UVDA 3U9LA 2JFGA 3OA0A 5F1OA 3MZ0A 2FSSA 3VPFA 2X5OA 5KJEA 4DMMA 3JQFC 1KETA 5TJHA 4J4TA 2C54A 1SCUA 1JA9A 3QY9A 1GR0A 1IHXA 9LDTA 4OKNA 1PIWA 4NJMA 3EW7A 3DZIA 3PHLA 3TDKA 3ROQA 1D1TA 3LYLA 3A14A 3KZVA 3F4LA 4E21A 3FN4A 4ZRMA 1P74A 1CERA 1DIGA 1JKIA 1CQIA 3UVEA 4ROSA 3WBFA 4L4RA 1PJ2A 3ZHYA 2P4HX 4WCFC 5KJ1A 3HFSA 4U8GA 4NU5A 1K2WA 2PFGA 3Q1LA 3OECA 1A27A 2CDBA 5I7VA 3H9UA 5CEFA 1EFKA 1HTBA 3ZHXA 4J43A 4DVJA 3OICA 4MKRA 4WLUA 4PFJA 1OC2A 5TSDA 2GN4A 3UXYA 1SMKA 4URFA 4MP3A 1AUPA 3WDSA 3W4JA 3JQEA 4WNIA 3HHPA 4XR9A 1OFGA 1E5QA 5KNLA 4WEOA 5BSHA 1CQJA 4GPD1 3PHJA 3ZI0A 3FR7A 2J3KA 3ONDA 4Z9YA 3SX2A 4DPLA 3PDUA 4L9RA 5L3ZA 4MINA 4JBIA 4J7UA 3DO5A 3QP9A 2P5YA 4DREA 3ICCA 3V1TC 5L53A 3JD4A 3E5RA 5ICMA 1EE9A 2VHWA 4G65A 4IDFA 2UYYA 1RJWA 1VSUA 2NWQA 4AJPA 4XIYA 4II3A 3INGA 3AUTA 1YBVA 4R3WA 3KYCA 1UDAA 3GDGA 3RC1A 3HZZA 3O8QA 4OXNA 1PJ4A 1ZFNA 2O23A 2HDHA 4IDBA 3I9MA 1B14A 2EKPA 1MFPA 4P8RA 4EJMA 1ZH8A 2Y66A 1U7TA 3K96A 4YPOA 2AW5A 4XQGA 1FDUA 3JQAD 3ITDA 4M87A 3AI2A 2R00A 1C0IA 2BLLA 4OMUA 1SBYA 2RHRA 4L73A 3CE6A 4XIJA 4UREA 1LDYA 3JQ9A 2AE1A 3RC2A 4E2ZA 2OOSA 2X0NA 1V3VA 2Y0EA 4KZPA 3RSHA 5G4KB 1MUUA 3AI3A 2VT3A 3W8EA 1DC5A 4F46A 4YA6A 1JWBB 3AOEC 4DLBA 1CRWG 5I8WA 4BKOA 3IAHA 4ALLA 2BKAA 4RQTA 5DT9A 3PIIA 2FPGA 1XSEA 4CV3A 3GPDG 2B4RO 2I3AA 4E12A 1KEUA 1ZZEA 1QG6A 5AXCA 5CFZA 2X23A 1Y8QA 1VL6A 4G81A 1DLIA 5JO9A 2E6UX 4CM4B 4MVJE 2J3JA 4FW8A 1MG5A 2G5CA 3C24A 3K2EA 4OH1A 3G0OA 4ZQEA 5IDWA 3ZV3A 4RVDA 2EKQA 4HFMA 1VL8A 3ITKA 2BFPA 1GQ2A 4IGEA 2CUKA 4BNGA 4HNHA 3VH3A 4OSPA 2OP1A 4DGSA 3GY0A 4N5MA 3GK3A 2PGLA 2ZJ0A 3I6IA 3H65A 2FP4A 2GUGA 1P3DA 4BMSA 4OKIA 3DXFA 4C7KA 1LC0A 1TT5A 3IP3A 1YWGO 3W4KA 3OMLA 2O3SA 1F8FA 5TS3A 5G0WA 3STHA 2A9FA 2O3UA 1DHTA 3BMOA 5THKA 4NPCA 1ZNQO 1D8AA 1TI7A 5L9AA 5LC1A 4CL3A 3K31A 4BB5A 4QSMA 3I83A 4XJSA 1LTHR 4J3FA 4TMFA 4CLDA 1DXYA 4ITUA 1NFFA 3RUAA 1UJMA 1Y1PA 5BSFA 4XQ9A 1GTMA 3BMNB 4JCOA 1H2HA 3E9NA 4XB2A 4F45A 4DYVA 1GDHA 2DBQA 1N92A 1Q7BA 5C7OO 4NR0A 1Y9EA 2HMTA 3P5SA 4PLCA 3JD2A 2VNSA 3ZHZA 4NK5A 4PRKA 4BNYA 2QRLA 3OHSX 3ZWOA 4JNKA 1Q7GA 1VKOA 4CLOA 3CEAA 1SPXA 1BVUA 1HDYA 1H5QA 1U1IA 3WQQA 3KTDA 3RBXA 2G17A 4PLPA 4BO8A 4NDNE 1T2AA 4IQ0A 1J49A 3GAZA 5EIOA 3RU7A 1O94A 2Q2QA 5DBFA 5ICSA 4YBZA 1WDLA 2O4CA 2JCYA 1ZMTA 4EZBA 3GFGA 3L9WA 1HF3A 1MG0A 3UF0A 2BI7A 4Z0PA 1M75A 1LLUA 4XA8A 5GY7A 2HMVA 4GSKA 2ET6A 1W73A 2NU9A 3DBVO 3FNGA 4K6FA 4YJDA 3GC6A 1ML3A 3FSRA 4FQ8A 2C5EA 3B20A 4KMSA 3UCXA 1CEQA 1HZJA 3CSDA 3UGKA 1TT7A 1U3TA 3V8BA 4BL5A 2UDPA 1ZMOA 2VWGA 3INTA 5TGDA 1HLDA 4JBHA 4TRNA 4A2CA 1UR5A 2IYOA 5HBRA 3GF4A 1QYDA 1SC6A 3JYPA 3RWBA 1E3IA 1R6DA 2I3GA 1WLYA 3WXBA 3MJEA 4B4VA 4BO4A 1M67A 2Q1SA 4CM6A 1X7DA 1GADO 3N58A 3HWRA 1KBZA 4Z9XA 4Q3CA 4XX0A 1TB4A 3ANNA 4I9NA 4NG5A 4Q3NA 3ZU4A 3I1JA 1S7CA 4Q3DA 2IXAA 3FTPA 5TT1A 4RZHA 2B35A 1B15A 3D7LA 1UDBA 4IJWA 1EMDA 1RM0A 1YL5A 4OL9A 5EQFA 1KY5A 2G76A 3GVIA 3UH1A 4D0SA 4GH5A 3VZSA 4EEXA 1P9LA 1H9AA 4OIMA 4RPJA 3TRIA 4YAKA 4NHEA 4CUKA 4WLOA 2DBVO 2X0IA 3WQSB 3GPIA 2WD7B 2PZLA 4N18A 4EDFA 3C7CB 3U5TA 1C1XB 2ZCVA 4ND4A 4XWYA 3KSDO 4XYBA 2I67A 2O7QA 2DTDA 2BELA 2WE8A 2B5WA 5ER6A 2NM0A 5C3MA 3WTCA 1FXSA 2RAFA 2Z5LA 3E9QA 2D8AA 3FCOA 1YBAA 3EC7A 4QFDA 2AQIA 2PGJA 2Y05A 3QJ5A 3LC2O 5TQVA 1HE5A 3SC4A 4RVHA 2CFCA 3EMKA 4ZQBA 2AG5A 5DOVA 5CG1A 5IXYA 1ADCA 1RM3A 4JJGA 4ALIA 1DB3A 3T7CA 2BGKA 4R9RA 3ST7A 1Q0HA 2HCTA 2Q1UA 5FYDA 3D64A 1SB8A 4Z0TA 3MJSA 2Q99A 4EITA 5U9CA 1ADBA 2O7SA 5BT9A 1BXKA 4XGNA 1BDMA 2WYVA 4E5YA 4J7CA 2Q46A 1XHLA 3M1LA 4BO9A 2X5KO 2GRAA 4CM4A 1SEVA 4KUGA 5JCXA 1KY4A 1A5ZA 1ZO8A 1WDKA 1K3TA 3FF4A 5GMOA 1T26A 1CIVA 1I36A 3IUPA 1ISHA 3WJ7A 1PX0A 1HDZA 1V3UA 1ZEJA 2B5VA 3H9QA 3N7UA 4XRGA 1EUCA 1HETA 1ZXLA 4EBFA 2UAGA 3H6KA 3IJPA 4FFRA 3O03A 4I5GA 5JW6A 3DZFA 2DKNA 2VZ9A 1PL6A 4RVSA 3BTOA 4NMHA 4E2XA 1U5CA 3PWZA 2Q2WA 5BSGA 3U09A 3H3FA 1H6CA 1I32A 1TVEA 2GN9A 2ZCUA 3TJRA 3ORFA 1EVIA 4FFPA 5C7IO 2FZWA 4R1SA 3AJRA 5EINA 5BSEA 8LDHA 2NTJA 1GV1A 4GQAA 3S2IA 1SEPA 4DWVA 3D4OA 1CJCA 4K9DA 1TXGA 1LDNA 3OA2A 4NBTA 4XCVA 4B3IA 1EQUA 4G2NA 2PZMA 1VC2A 3HQ4O 1LSJA 3F5SA 1N7GA 1PR9A 3BMNA 4BNUA 3BTVA 1NPTO 9LDBA 4A5OA 3MCVA 3IDSA 1PZFA 2WWRA 4DIOA 2VOEA 4WCDA 4XDZA 3V2HA 2OZPA 3RKUA 3BYZA 4IS3A 1P1FA 4DQVA 3OJOA 4M55A 4NJOA 3VC7A 3SEFA 3WMWA 4XR4A 3ZWVA 1GUYA 2E37A 1OMOA 2E82A 3T4XA 1EBFA 4LCJA 5CPFA 2YV1A 5DCUA 3EK2A 2EG9A 2Z1NA 1KEPA 1ISIA 3HNPA 2EW2A 3DBLB 4JK3A 1DFGA 1QXSA 1UXJA 3IP1A 2B69A 4XYMA 2VZ8A 3NT5A 1I2ZA 4IMPA 1PL8A 1DOHA 4XD2A 4KQXA 2VCYA 4CQMB 2OBNA 4DC0A 1F8GA 4F3YA 3NGXA 3AY3A 1ZBQA 1GY8A 3QWBA 2YYYA 4O5OA 5MGBA 3V2GA 1TA4A 5IDXA 3HDQA 1V3TA 1UZNA 3TNLA 4I1IA 3DBHB 3KLPX 5JBIA 3LZ6A 3VVCA 5ES3A 3MTGA 1V6AA 2IZ1A 3ETEA 2AE2A 3O4RA 2JD1A 2EHDA 1NPDA 3BIOA 3IC5A 5FWNA 4O0LA 1N2SA 2AEFA 3AW9A 2VYND 4BIIA 4FN4A 5CEJA 5JY1A 2OHXA 3UCEA 1C1DA 1DDOA 1MC5A 1Y8RB 5DBGA 4BB6A 2P9EA 3LLVA 2UV8A 2PD4A 4IIVA 5H82A 5I9NA 2C2YA 1R12A 1LXCA 4A7PA 5K6AC 1VM6A 3E82A 1E3EA 4HBGA 3E8XA 4M8SA 1E6UA 3JQBA 3ABIA 5I9LA 2OO5A 2WD7A 4LGVA 4B79A 3BMCB 4PCVA 1HL3A 3T4EA 5KVVA 1C1XA 1ZJYA 4R4JA 1NNUA 2PA3A 5DP1A 2PD3A 3EZLA 4NQZA 5T8KC 4CMCA 4R5MA 5DDIP 3IKTA 4KOAA 4CMBA 2VNAA 1YE3A 4B7CA 1HE2A 3Q0EA 3GG2A 5L95A 2VRCD 1YQDA 1Z45A 1H0KA 4GBJA 1LDBA 3HUDA 3H5AA 1QLJA 4IMRA 3GZ4A 4YVFA 3RAJA 1IPEA 1EUZA 1DIAA 5AVOA 4AFNA 3H4VA 5IZCC 4P38A 2C0CA 2P91A 1ZVMA 1ZXBA 6LDHA 2GLXA 3CINA 4QQRA 1B8UA 1I01A 4GLLA 3B1FA 3CTMA 3PZRA 3H9EO 4R5HA 3AU9A 3WNQA 3F9IA 3ZWXA 1GUFA 3L4SO 4RDIA 2VZ0A 2D59A 1B16A 1AXGA 3ZCXA 2FOIA 2HQ1A 2IE0A 1AHHA 4UEKA 4E13A 5DULA 4Y98A 2C20A 4I8XA 4MIOA 3I9OA 1LSSA 4BGUA 4U6SA 1NVMB 3D0OA 4Z3DA 2LDBA 3LT4A 4UVEA 4YAEA 4D42A 1EFLA 3KRTA 3IL2A 2PKRA 2X0RA 5KVQA 4X54A 4Q3EA 2Y67A 2Q3EA 5F1PA 1VE9A 5CG2A 1XYGA 4NFSA 4D44A 3A06A 4EEZA 1ZK3A 1GAEO 2RHCA 3F47A 3PFFA 3L0DA 4WLFA 1DJQA 4CM8B 2DTEA 3GMDA 4D43A 3OSUA 5C5IA 2O48X 4C7JA 2ZYDA 4J16A 4YR9A 3PTZA 3RUDA 3NJ8A 3NTQA 1LUAA 2W8ZA 1QYXA 1XR3A 4R69A 1EZ4A 4LW8A 2PNFA 3RD5A 3TZHA 2PV7A 4XYLA 1T2CA 2F00A 4A73A 1XLTA 2X5JO 3TZQA 2X4GA 1P77A 1BVRA 3AU8A 4J2HA 1K6IA 1NPYA 1GQYA 2DBRA 3UHAA 1ZIDA 4E6PA 5F5NA 5JFOA 2NVWA 4AJ2A 4FCCA 3VPGA 3N74A 3BHJA 5L4NA 1N1GA 3FR8A 4J9UE 1XG5A 4RF3A 4YQYA 3S55A 5A02A 4QT0A 5JS6A 2QYTA 1JTVA 2AMFA 2IZ0A 1L7EA 1HXHA 3GHYA 1E3LA 4CMIB 5FEUA 3K92A 3GGOA 2EEZA 4RVFA 4WASA 2DBZA 2IEBA 1MC4A 4PG8A 3DBLA 5I9MA 3VZQA 2R00C 2VHVA 4ZA2A 2HK8A 5T6BA 3JQ9C 4CQLB 4QXMA 3F5QA 3OFSA 4TKLA 1QLHA 1NAHA 1YRLA 5A05A 3GVPA 2X6TA 1PGQA 4BKQA 4CQMA 1PQUA 2YY7A 2WD8A 4LSMA 1IPFA 4CMAA 3PLNA 3MJ4A 3R3JA 5CP8A 4W9NA 2V6GA 5CAEA 3D3WA 3DZKA 2RH8A 3WWYA 2YDXA 2VHYA 4B8WA 3GMSA 4BMVA 4WLEA 1G1AA 1I5RA 1PJCA 2XAAA 3DBHA 3WIEA 2J5KA 4CM9A 1PEDA 3LC7O 1U3VA 1HDGO 4OAQA 2X22A 2VTEA 1EVJA 2Q45A 4DXHA 1XELA 4D3SA 5ILGA 1YO6A 3NRCA 4ND5A 1B7GO 4CMJA 5KIAA 1WPQA 3AFMA 2I65A 5IXSA 4CV1A 2BF7A 1KC1A 1DRVA 4BNNA 5L40A 3OETA 1ISJA 5IG2A 1D3AA 4BMNA 2GSDA 1Q2XA 3R6DA 1WMAA 2JD0A 2B4QA 2E49A 4S1VA 1YQGA 3TL2A 1NHWA 1Z74A 2OMEA 3W1VA 4AJIA 3O26A 2AQKA 3WIDA 4RPLA 3OF2A 4FJ0A 5U4QA 4NZ9A 3BMCA 4YB8A 4NFYA 3GG9A 3WFJA 4GX1A 3JV7A 4R9SA 3UOGA 3K5PA 1G0NA 4TZTA 3C3XA 3DHYA 4RORA 4U5QA 3QVSA 2AG8A 2CZCA 1WXDA 1IULA 1X0XA 5KVCA 5DCWA 3S1LA 3WGQA 5COBA 4QO8A 3ULKA 4AVYA 4UUNA 4HV4A 1R4MA 5FI3A 4BNWA 4ZU3A 1E5LA 4XRRA 1H93A 1PTJA 4QEDA 4MKXA 4PG6A 4GGOA 4DLAA 2O3JA 4CL8A 3GVXA 4XJTA 1IHYA 4RLSA 4UAGA 4XQEA 3TZKA 1PQPA 3WGIA 4OQZA 1IB6A 2POQX 3SJUA 2DUWA 1M6HA 2YHIB 4TVBA 3PHIA 3WMXA 3RUCA 3OQ6A 1R0LA 4KDEA 3GOHA 3H3JA 2HMUA 2QW8A 1U3UA 4I5EA 3F46A 1P31A 4WJZA 5IDQA 1H6AA 3ZV4A 1B2LA 4YRAA 4FBGA 3E03A 4RJTA 1HYEA 1NHGA 4TWRA 4W6ZA 3CXRA 3W8FA 5DZSA 2GR9A 3AY6A 3PEFA 3DR3A 1EDZA 4IY1A 4M89A 4CM3A 4L75A 3QWHA 4NBWA 4YAGA 2DAPA 2GZ1A 3DFUA 1C0LA 4RDHA 1YDEA 4RO0A 2QIOA 3C7AA 2JKVA 3JYOA 2VYVD 4A03A 4WOJA 4YAJA 4BGIA 1ISGA 3LC1O 1ENZA 2HKIA 3WNVA 1GEGA 2EJVA 3OJLA 4IDAA 5IJZA 1DC3A 3I5MA 4CM8A 1LQTA 1DIBA 3DTYA 4GI2A 3PWSA 3L77A 4FS3A 3RJ9A 1NVTA 1VLLA 5TF4A 4KUEA 3T7EA 5EQDA 4LSWA 4L4SA 4ND2A 3NDIA 1A9ZA 2FY8A 4XB1A 1A4UA 1ADFA 3GNSA 1YVEI 4CJXA 4E33A 1R37A 1KS9A 4BNKA 1CDOA 3VVBA 2XXJA 1QV6A 5B4UA 2W90A 3A4VA 2ZB8A 4ZHSA 1H6DA 3ZWMA 2VUUA 4FOSA 4M1QA 2NTNA 3WGTA 1DLJA 2DT5A 2Y1GA 1GUZA 5BNTA 4BQPA 5ENDA 2ZK7A 3ANMA 2X58A 4IQGA 5JAQA 1VSVA 2P9CA 3OIFA 4BV8A 3CPSA 3LK7A 4LRSB 2VWHA 4XZ3A 3OIDA 2CF6A 4CMIA 1A4IA 3DB2A 4XYGA 3RC9A 4R68A 1ENOA 3NYWA 5DCYA 4H7PA 1SOVA 3I4CA 4JBGA 4D3FA 1DJNA 4E32A 2JAPA 4CQLA 3QSGA 3I23A 2JAHA 3OH8A 4IDCA 4ZD6A 4OGWA 4IJUA 4MDHA 2AEMA 2QHXA 4ID9A 1DAPA 4JJIA 3L4BA 5LDHA 3H2SA 5IDYA 2ZB3A 2X9NA 3PLRA 4EI2A 5KJ6A 1C3VA 4EUFA 4IQ8A 1MB4A 5TJ9A 4A0SA 1M76A 3GH3A 4WECA 3GZNA 2VRBA 4HFJA 3WJAA 2C7GA 3S2GA 5KWEA 4JJFA 4TQGA 1ULUA 3FPCA 2WM3A 2ZQYA 1RYDA 3KV3O 4CR6A 1XCBA 5G0SA 3U49A 3TL3A 3VZPA 3L6OO 4PIVA 3SC6A 4IDGA 3WOHA 2DC1A 2PR2A 1F12A 2ZTUA 3TPCA 1EE2A 2Y1DA 1MX3A 3ADPA 1E77A 3EVTA 3SVTA 3PQFA 5JCJA 1KC3A 2NTVA 3AK4A 3PDJA 3WYCA 4R3NA 3WSWA 2W4QA 1NTOA 1IL0A 1UZMA 5ITVA 4IGFA 2VYNA 3QWIA 1NQ5A 1ENYA 3FNEA 3GGPA 4I08A 1NVGA 4IZIA 1E1NA 1R15A 2NV6A 4JQCA 1E6WA 3GN2A 2XOXA 2G1UA 5DN9A 3NGLA 3D4PA 4RLHA 3HFGA 3HADA 4R51A 5A5FA 1YB4A 2PH3A 2AA3A 3OQ1A 3PIDA 4YT8A 2B0JA 1E3WA 4DBVO 2VHZA 4U6QA 4ALJA 3L07A 1YBMA 3ADOA 4PN3A 4BO0A 2Y0DA 4BNXA 1JU9A 4OQYA 3F3SA 4ZN6A 4BNZA 1UXHA 3ONFA 5FF9A 4YAIA 3VOSA 1B8VA 2F1KA 3RU9A 4YWJA 3RIHA 1K6XA 1SZJG 1VJ1A 3WGHA 5T64A 3GDOA 4PLFA 2D5AA 1RKXA 1C1DB 1HSOA 3NTOA 1YL6A 3P2OA 4H15A 4EJ0A 2QZ9A 5A1TA 4W7IA 1M6WA 3WYEA 1DBVO 2GASA 5B37A 3K30A 2YHIA 1HE4A 2FR0A 2EW8A 4CMEA 2GERA 2TMGA 2YJZA 4H16A 4NFHA 2GPTA 1AHIA 4XEHA 3RFXA 2AQ8A 1KVQA 3AOEA 1MV8A 4MVJM 1A7KA 5B12A 3BTSA 1ZK2A 1LSUA 1A71A 3DMTC 2A92A 3FRJA 3V1YA 5IN4A 2DVMA 1LJ8A 4B4UA 1TEHA 1GV0A 5IN5A 5EJ2A 2NVBA 1EQ2A 2QG4A 4DA9A 1DFHA 2D3TA 1XU9A 2C07A 1EK6A 2HO5A 3KEQA 1R66A 4LMRA 3WB9A 4D79A 1P1JA 1A7AA 3GVHA 3R1IA 1R0KA 4J6FA 4GVLA 4WLVA 1T2FA 2HK9A 4UUPA 4YCAA 4IINA 3Q9NA 2ZTVA 1DC4A 4BNTA 1B8PA 4OXKA 3DZHA 4MP6A 4AJHA 2RH4A 4PG5A 1HE3A 2O2SA 4Y6PA 3JQAB 4CV2A 1M2WA 3IQDB 1D7OA 3NTRA 3F1LA 2UUOA 1HWYA 2B83A 1ISFA 4FJ2A 2DFVA 4YQZA 4IPTA 4PVDA 4BKUA 3F6YA 1B3RA 5F1KA 4OOEA 3UAGA 4B4WA 5G0VA 5C37A 3JQBC 2FN7A 1LEHA 1WMBA 2Q49A 1B3BA 3EY4A 3KB6A 4R1UA 5I7FA 2J5QA 4TVOA 4PG4A 1XIVA 1AGNA 2BI8A 4J1QA 1NR7A 4O59O 1SO8A 4D7AA 1LI4A 1ONNA 1IOLA 1HYHA 5JO0A 4HY3A 1PS9A 2ZB7A 3JQ7B 4UVGA 5JYEA 2X0JA 1OZAA 1GPJA 3KVOA 4J49A 3WGGA 5BNFA 3ZNNA 3M2TA 5U1PA 4DUPA 2W2KA 5KJCA 3PYXA 2EP7A 1FDTA 2CF5A 2PD6A 3MOIA 2AEJA 2VUTA 3GUYA 4MOWA 1DFIA 1IUKA 3Q2KA 1LLDA 3DAFA 1J5PA 4EW6A 5K9ZA 4Q3AA 2HU2A 3PYMA 5THQA 1U9JA 1NQOA 3TOXA 1PSDA 2H5LA 3SLGA 3DOCA 3K8ZA 1RPNA 4HWKA 3Q11A 4TZKA 4QX6A 4BO3A 3DOOA 4JX8A 3FNHA 3NX4A 5HS6A 4ONEA 1T24A 4R16A 3TZ6A 2ZTMA 2V7PA 4PZDA 2PTGA 4A27A 4BGEA 3E18A 5A3VA 4BO5A 1UZLA 3C8MA 2HJRA 5A03A 2NU6A 3FHLA 1VPDA 1EBUA 2BFOA 1F0YA 3VPSA 1ZEMA 3I3OA 4Z9FA 2YHUA 4Z0HO 5IAAA 4D41A 2EJWA 4CPDA 2O50A 5EN4A 3C7DB 1I3LA 1O9BA 3WBBA 2W2LD 5G0UA 3U3XA 1QR6A 1T4BA 4Y9DA 1O89A 3G1TA 5ENVA 4W7HA 1U7HA 2FWMX 4IDDA 2GCGA 4FJ1A 1ZJZA 4KDFA 4PG7A 4BKRA 1PJ3A 1Y6JA 2Y99A 2EERA 3PHGA 4I9HA 2X9GA 3LT0A 2Y68A 4KWHA 4CMHA 1ZKMA 4CR8A 4C4OA 2C59A 1YKFA 3INRA 4D46A 1NFRA 3HB5X 5TLSA 3AY7A 1VI2A 5JAIA 4MVJH 1XKQA 3NDJA 3D3WB 4Y6SA 3E9MA 3MTJA 1A9YA 5B1YA 5JDCC 1J4AA 3PJEA 4PVCA 4MP8A 2E48A 5G2OA 1ULSA 4PZEA 3G1UA 1JQBA 2EGHA 1V9LA 1FJHA 3UCFA 3EHEA 1I33A 1T25A 4OO3A 1PZEA 3WLFA 1FDWA 3MEQA 2GO1A 2BFAA
chains in the Genus database with same CATH superfamily
3LY8A 5IKXA 4P7GA 4QU5A 1RMQA 2C4UA 1KDZA 5JDIA 3GAMA 3QW4B 3EDMA 2R7MA 2A88A 4H18A 4KTTE 4LTMA 3IEXA 3AJAA 1WDMA 4II7A 4NG4A 4DS3A 1XAHA 3S1SA 1XTTA 1V6CA 4DTCA 4MWSA 5K7SA 8GPBA 1S8OA 5DOZA 1JSZA 5LMNB 4OI4A 4Y2VA 2W83A 1YZFA 4MRNA 1MDFA 2OZEA 1E2JA 4G67A 5M3BA 1P0MA 1T2EA 2B30A 3CT6A 3K3PA 5FFFA 1PEYA 3PJFA 3T9BA 1O57A 4TSKA 1C1HA 4K28A 1U28C 3UGQA 1M8FA 3JW8A 3UV7A 1Z39A 3OTGA 3U6BA 2B36A 4GU5A 4LVCA 5YASA 3T3DA 4R8SA 1CT9A 2W22A 2RB5A 4YHBA 4PSDA 1GGEA 1KVRA 3Q2IA 4BFWA 1GEEA 1E3SA 5FOUA 1NN1A 5D87A 2EGGA 2J4CA 4ZYZA 5JY6A 3S4YA 4AZ3B 4QXAA 4KQ6A 1HGXA 3QV2A 4F9FA 1NUSA 4OHCA 1YI8A 3AWIA 4KXUA 1L9KA 5KQGA 4M9ZA 5BV1A 1Z7BA 2VJNA 3CPEA 4BJ1A 2J8ZA 1XMQB 3U7QB 5F5LA 3KYDB 5GTDA 1EDEA 4ARAA 2E0IA 3WAKA 1H2RS 3H19A 1ISMA 2GVNA 1QO9A 4X00A 3WHPA 4BMOB 1NA5A 2PYIA 3W5UA 1UJCA 3ZXSA 3DKIA 3D8UA 1DKQA 2IZ5A 3GJ5A 4AECA 2NP7A 2HU8A 2NO0A 4UNPA 1RTKA 4RX1A 2CKMA 4PGAA 4Q9JA 4G0ZA 4E08A 4MXDA 3G6KA 2OP0A 3E6AA 2RGBA 3C5EA 5DE3A 3P94A 4UVIA 4YCSA 3RHSA 1JW9B 3K1TA 2NACA 2HQOA 4O08A 1JEOA 1U63A 1A8QA 1N9GA 4ZQHA 4GNRA 1LBSA 2OFWA 2YWJA 3DWFA 3IO5A 3L92A 1SIOA 1XAIA 3L8ZA 5TQ0A 5KNBH 1YS2X 4KQ9A 3QEMB 4MQEA 3FSEA 1W75A 2NQTA 3RHFA 1QFYA 1H85A 3VR6H 3P9CA 3DDUA 3VX3A 4LJ9A 1T91A 1DAOA 5LPNA 1T1SA 3QGMA 2QX7A 3N2YA 3QLJA 1BHSA 1N8KA 1PWXA 4DN6A 5JZBA 3DYBA 2I7CA 4EJ6A 2CGEA 3CWQA 3GWZA 2WYHA 5B6IA 4HDMA 4IEFB 1KO5A 3NVAA 3KSZO 4J1TA 5ETJA 2YS7A 5JADA 3D4LA 3W5DA 4UM9D 1XNQB 1T0UA 3NB0A 4CGZA 4NBRA 3G0BA 3M4XA 5FFMA 2RHTA 2QE6A 4KXVA 4B40A 1I3KA 3DR5A 3IAAA 4YTEA 5HTOA 1ONOA 2BF4A 4LISA 1K7XB 1X7YB 2I76A 1PTJC 5IBCA 1XTRA 2HC9A 2VH2A 1E2FA 4UARA 1NYRA 2ZPUA 1JJIA 4J2OA 3WO1A 5JALA 4WEQA 2HDWA 2FN3A 3QW2A 3B7PA 2O57A 3VGJA 1MA3A 3W5CA 4MGIR 4OXYA 3DHVA 4YV7A 5BSKA 4X91A 1GNSA 1G0OA 1WSDA 3ZWPA 3EOZA 3EXG1 3UFXA 4DRXB 4NEQA 4K26A 1LI5A 5JXGA 4BO7A 2JCXA 3WB0A 1W8DA 3CEMA 3DVRX 5GJCA 2OFPA 3SS9X 3ILSA 4MDFA 3AKDA 1P2FA 2W4MA 1ZI6A 4DLYA 2PZ8A 3JQPA 4B84A 2FPSA 3ZDXB 4BFTA 4WZZA 1ZGZA 4D8UA 2O52A 2QU7A 4UQLA 3I8SA 3QELA 4N0PA 3ZY2A 4DDWA 4FE7A 1FFEA 5DI3B 3TXYA 4F93B 1RYEA 2ZS7A 3HXPA 3AP2A 1OBFO 1WRBA 3TOZA 2Z2KA 3SG0A 1MP0A 2A9OA 4FIZA 4G85A 2GN6A 3ZHVA 1L7RA 4FLEA 2BBSA 1O08A 2ILVA 1TEXA 3F5FA 3P97A 2IV3A 2JFYA 1MLDA 4K3UA 3ZU5A 1NR5A 2FETA 3C41J 4HP8A 3HCBA 1PHPA 3R77A 4IGAA 5HCUA 3VMFA 4UQOA 3UK0A 3D8SA 4HC4A 2YXBA 1QTQA 3OE1A 2C7VA 2SCUB 4IIJB 3RS8A 2ZRMA 4KDRA 2WU3A 1M66A 4EABA 5A4KA 5JNSA 4MSUA 5T4HA 4C0AC 4DKXA 4ABTA 1P4JA 3QMMA 1Z15A 3MTAA 2JHAA 5SY6A 3UV6A 2IYLD 2RMKA 2OHGA 2YJ6A 4YP7A 4NF2A 1SCQA 3IILA 3WSVA 4MR7A 2QD2A 3W6UA 4RJIA 4FFSA 1YQWA 5DF1A 1LPAB 4U5XA 1TLLA 2A67A 3IDOA 4CM7A 3EIEA 3EQ9A 5DYWA 2CW5A 4AZVA 2HLHA 2JLCA 1NDQA 3S5JA 2HB6A 1EX9A 1Q0LA 4BNMA 4W4TA 3TFQA 3DL2A 4EA7A 2HSDA 3LL4A 1E8DA 3JVDA 1EXDA 5GWXA 2YJ5A 2V45A 2VTDA 1XVAA 3CR7A 4DNXA 3CWZA 4BQOA 5HQ3B 5KJFA 1WXQA 3I3SR 4PZCA 4GG1A 1FTNA 1PV2A 4L9SA 1EGHA 4FCWA 1E7QA 3LHSA 4BO6A 4MMXB 4WCFB 1IY1A 3I8OA 1A04A 5HQJA 1C3JA 3J7AC 3TH5A 3JWIA 4I7EA 1BX1A 3IOBA 5EXDA 3RYFB 3TZCA 2GKOA 3WSTA 1PFKA 1MW9X 3BFPA 3DAPA 4AUMA 4WV3A 3KVNA 5JS2A 4EKEA 1TZMA 1XPRA 3BWXA 1JNYA 1UFRA 5K8VA 4PXAA 4NXMB 2IEYA 2EDCA 4NBUA 3RVKA 4KFRA 2FSUA 3U2QA 3KWJA 1YIDA 5IZCA 3ZVKA 2ACWA 1CUJA 1M8GA 1Z9BA 4PC7A 2R6FA 2IPXA 4JITA 3LKDA 1TAGA 3OZCA 3SQXA 2CB9A 4EHAA 4F2WA 2P7IA 2BRUA 1QRRA 2VATA 2Z9CA 3L7BA 5F2OA 3VYWA 2DH6A 3GIWA 5KKAA 1IH8A 4ZI2A 2AI2A 4K9NA 4L5YA 5C8XA 2MHCA 1ECFA 2XUHA 4LTDA 4Q12A 2VJBA 4AZ3A 3QYJA 3CZMA 3Q10A 4QFCA 3ZK8A 5BMVB 2H4FA 3UPUA 2YWFA 3GRKA 4OQDA 4Y2QA 5EIBC 3C3MA 3N9IA 5REQB 5JLAA 2NLOA 3RFTA 1VBKA 5LLTA 3NT2A 4D4JA 3U7QA 1XQ6A 2XGOA 1TJ5A 2AC2A 2C95A 2QV7A 1XQ1A 1UBEA 3GXOA 3KYDA 4LWQA 4PQRA 1SVLA 2XCUA 4CUJA 1NT2A 4KE7A 5HNKA 1ZCZA 3HWX1 3ZY3A 4K1XA 2YIJA 1J23A 3MERA 4ZI5A 3ZHBA 3C3EA 3P9IA 3V7YA 4U7WA 3L7KA 4ZANA 4ARZB 4E6EA 5GZ3A 4QECA 4Z9BA 2EL7A 3DXYA 3OKAA 3P9QA 4G8BA 4Z8XA 4JLMA 2RK4A 3EMDA 2B9EA 1RRKA 2FU5C 2J3IA 3IKVA 4BNIA 3HBMA 4CHGA 4ZVNA 2MOKA 3PC6A 1M6VB 2HBRA 1QGUB 3DLPX 3X0DA 1QAMA 2E4UA 3UC5A 4RCVA 4LNUB 3KHKA 3B6ZA 5A5DA 3UEOA 3ND7A 1X0VA 2C5SA 3KXIA 3QEMA 1B41A 4RC9A 4YJ2F 3V4LA 3W2EA 4OD0A 5AD1A 2F8SA 1T6ZA 4WNAB 1W5EA 1QH0A 2VWQA 3KTFA 2CLKB 3FPAA 3AM5A 1Y0BA 3F7OA 3OEYA 3RJMA 1ND5A 2I66A 4PO9A 4M49A 3O93A 1EM8B 2GFHA 2Y27A 5FOQA 2JI8A 5AUNB 1RAEA 2Q4EA 3HFJA 4FZJA 2XR1A 4UE2A 1CE8B 3WTBA 3I4FA 1NZDA 3QQPA 5L7TA 1EJ6A 2VHCA 4LCEA 2JI4A 2NVOA 2AJ8A 3NV9A 4NAHA 5L8VA 3IJEB 2NVUA 2E18A 2QPTA 2HWXA 3OAAA 4FDAA 4UDNA 3RI3A 4BTLA 3WNDA 1V95A 4MQ5A 5I8ZA 1GDDA 3EQ7A 3CH6A 1M2HA 4L0QA 4II2A 1KJIA 3C3YA 1X7YA 3KPVA 4OHYA 1SQFA 3HEAA 3LPMA 1R0XA 2H17A 1UBJS 1QF7A 4PSUA 4ZXPA 4AS1A 4CMKA 1ULTA 1Z0SA 2OAP1 3TLEA 2JC3A 3O94A 4MVJI 4HNRA 5EXPA 3ZX4A 4LTNA 4BMDA 4HH1A 1EFVB 2ETXA 3ASUA 3LYUA 5BSUA 1O4WA 3ZHOA 4RTQA 1JEDA 1SC9A 3B6JA 1PGNA 6PFKA 3VH1A 1E0JA 1YQ9A 4WFKA 3C48A 1U9IA 4EB0A 1XZGA 5H83A 3U31A 4AN0A 4HBZA 1YDGA 2ASEA 3GQVA 3B3QA 3OIYA 4DRXA 5KVAA 1JPJA 2IZOA 2WJPA 3I5AA 2BMFA 2GA9A 4GLFA 3VR0A 3L7LA 3HB1A 4E09A 3ETNA 5LQDA 1NP3A 2D74A 1NYLA 1PZNA 1NAIA 5TX7A 2PMCA 3THXB 2QQGA 2IBSA 4GYKA 1UZAA 1ODTC 4YJ3B 3UJBA 1R3DA 1ORRA 3PGJA 4LSGA 4EHJA 1OXBB 4D4MA 1KO1A 1P62B 1GLGA 2OCYC 4AJ9A 4GEKA 2DERA 3S5UA 3LVFO 3AQ4A 4LWPA 2PN1A 4HFNA 4RTPA 1Z38A 3OX4A 4R7ZA 3WLNA 3FM9A 3R5FA 4BKPA 1W25A 3P9ZA 1EZ1A 4XGIA 3SZLA 1NR1A 2UYHA 5HWSA 1BMFA 5HEKA 3FI9A 2SCUA 4IIJA 4RY8A 3ENNA 4B45A 1A9QA 3NEPX 2WJ6A 4D8YA 4BKMA 5NULA 2J5BA 1PP4A 2BGLA 5EI5A 3I34X 3OPYB 5HSGA 4MVJD 4KDCA 4BLQA 2QZSA 3ISJA 3DDCA 4GKVA 2W2LA 3KLMX 2XODA 2QN2A 3FFBA 4Y9UA 2NMVA 4RAOA 4J90A 5KOIA 1E2KA 1UAYA 1Z73A 3AHEA 3RPEA 2O2EA 2PU7A 3CH5A 3JQFA 4OHPA 3DQPA 4QHYA 1T15A 1PD0A 1QFSA 5JXWA 3W9UA 2KX7A 1U4OA 2GNAA 4XKJA 2PZFA 3OEED 1E3JA 1H1DA 4IWXA 3ZOKA 1P39A 4Y9TA 1LLCA 3PE4A 4XQCA 4B3CA 4G01B 4R8MA 1H8HD 2PK3A 4U0KA 1FYXA 3B1JA 4UEOA 4EEKA 5HQ3A 2FDXA 5F76A 3NBQA 2ZUVA 1X1RA 3DW1X 3UENA 3EGXB 1J0XO 1Q2UA 3HBLA 1MT3A 3IT3A 1RP1A 4Y1EA 1CYDA 2GTIA 3WA7A 1OHHD 3DEHA 3EEFA 3PWTA 4WBXC 4WCFA 1ZN8A 1JLKA 4EAQA 3NGMA 3RYFA 1DQSA 4EGFA 3A28A 2ZJZA 4GT1A 3C7TA 3ORRA 1BSVA 4B6GA 3UA3A 4D8XA 2HIAA 4CKZA 5BWCA 2E4YA 3TAHA 2XVXA 2W6JA 4F85A 2FWIA 1VXOA 4Q9NA 4Z1OA 1HLGA 1U7DA 2GEJA 4I9UA 1SK8A 3PENA 3BE8A 1YFJA 5CDYA 1X8LA 2R8YA 3AI7A 1E7MA 1TF5A 2DQ4A 3EZ9A 1Y81A 4K03A 5CNMA 5TV2A 4XWKA 4G5HA 2A9KA 1YR2A 4UHEA 3TIVA 2ZTLA 3PUKA 3B9RA 3V4RA 2VF5X 4BNLA 4D4HA 3GRVA 5KREA 1U4NA 2DE0X 3CG4A 4CKEA 2WU0A 5AP9A 3WX0A 2AMVA 3IPLA 1OSNA 3INNA 2BM9A 1D0VA 2P30A 4NV0A 4CQMD 3WLLA 5DP2A 3GNLA 1UMKA 3IEUA 5BMVA 1SUFA 3MS7A 5REQA 1T1GA 3LT5A 4Q1DA 3NYRA 1Q0SA 4S12A 1T5SA 2VPXA 3BXOA 1MIHA 1KNQA 5FCDA 4PYJA 1MVNA 3QU7A 3Q7PA 2C97A 3IUSA 4WXEA 4OMCA 3GFTA 2UVPA 3CZRA 2R8RA 2WJAA 1G38A 1HNWB 4X7BA 1F3OA 3FMOB 4KJZA 1Z26A 3SX0A 3UXHA 3RODA 1TLFA 3X1JA 4CM9D 2VRCA 1S96A 2E89A 2PUVA 3NOVA 3GP5A 1ZRNA 2ZANA 4UCFA 4FC7A 1G291 3DEZA 4H77A 4ARZA 1WY5A 3A6FA 4JVLA 1U99A 1BU5A 3A37A 2WWIA 4WNCA 4A8TA 2CNBA 3ME5A 2OXTA 2OD7A 2HMSA 4FFVA 1QGUA 1HEUA 2R6DA 1E4EB 2XTAA 4LE0A 4MIYA 5DIFA 4KBYA 5K6RA 2PUDA 4HQKA 3WLEA 5KU7A 1WZCA 1YCDA 1N5LA 4Y6RA 1RWBA 4AB1A 4LNUA 3AIOA 1IJBA 1X3SA 2JFFA 3IXLA 3B53X 3KSUA 4L22A 4NYMQ 4RKFA 3ONEA 4UBMA 4N6OA 2P40A 1LNZA 4KSYA 3UZUA 2R2GA 4DIBA 4WNAA 2JS7A 5H81A 2RAUA 3WC4A 2NZWA 2FHSA 3B9QA 3A3NA 4JUAA 4LEIA 1AC5A 1RS0A 3M6LA 1EM8A 1AQLA 4GR4A 4U2FA 3RFVA 3KE9A 5C31A 1WOMA 4PZ0A 4UNNA 2FN9A 1CE8A 3EVDA 2COUA 1ZC4A 2GVDC 3ANXA 1PVOA 1AXEA 3KZXA 4FBMA 1DRKA 3PGMA 4G41A 3I9NA 4Z8YA 3LDHA 3GDWA 4UAJA 4EW3A 4LF6B 4N6GA 3VMMA 2VJQA 1CUHA 1JSLA 2R87A 3L49A 3SJBA 2HQBA 1CX9B 1IBCA 2WICA 4LVNA 4B33A 4W5TA 1X94A 5HA5A 4RGYA 2XMCA 4F6RA 3GO4A 3MTIA 1UP6A 3R7FA 3K8YA 1J07A 4AY4A 2C2XA 3LRXA 5AVJA 1F60A 2P2GA 3CF6R 5JDIC 1EFVA 3GROA 4EYGA 1R0ZA 1NN5A 3H7AA 4C0WA 1EUYA 3ESAA 1L7AA 3MGBA 1OTHA 1KEEA 1REQB 2YV5A 3TLBA 3S8EA 2QL5A 1BC5A 3ABOB 2BCGY 3SIPA 3W6ZA 1NX6A 4N5HX 4U7FA 3ZN2A 4E5MA 4INOA 3HYRA 5E3IA 2R62A 3ABQB 1JFSA 3HCOA 2FWJA 1JTEA 5BQXA 1O6GA 1ANKA 1IG3A 2YBEA 5G4KA 2SECE 2IDJA 2MSLA 3HM9A 1GPMA 3THXA 3IRUA 3EZNA 4WERA 3ZWCA 5IVPA 4S05A 4JJ6A 4M8KA 3PC2A 5HILA 3VKUA 2IFTA 2JASA 3DDNA 1VRWA 4YJ3A 3HP7A 4C30A 4CN9A 4TKMA 1M1NA 3DA8A 2CXHA 5CIWA 4P4SA 1DARA 1N3IA 5IMBA 5AVZA 4BPRA 1AX9A 4LY9A 5LDGA 3RGGA 3CUUA 4YUAA 4OREX 4WESB 5JAHA 3BK7A 1N75A 3NNDA 4XGQA 1R74A 3V2UA 1BXRB 1GD1O 1NQWA 4DUYB 2ZREA 3BQNB 4CIYA 2XXBA 4JY7A 1QVAA 3IBCA 4H7KA 4XH9B 4B3JA 2LD4A 4QU0A 4W1PA 3IBYA 4FHCA 4B7UA 2YW9A 2A5LA 5JQGF 3URKA 2Y4OA 4BS9A 3EIHA 4X90A 3OPYA 3R3SA 1JDBB 2PGXA 4TXNA 4F72A 1NJFA 2VAMA 2ZRGA 3R5TA 3ZU2A 4HI0E 2VYCA 2E7ZA 3T5DA 3T7RA 1MXHA 3LPDA 4E94A 2HYIC 5MFZA 3FIJA 1GPDG 1WWKA 2ZRIA 3G2QA 2W48A 4I1VA 4TUYB 1TYCA 2FW6A 1MQAA 3NRBA 1BN6A 1G3IA 3QRWA 4TL7A 3T06B 5COQA 5NLLA 4MHSA 4E22A 5IVKA 1G4AE 2REQB 5FIUA 1OYWA 4ENWA 4MPDA 2M6SA 2OHVA 4MVWA 3H5VA 2ZTHA 4QOSA 4U2EA 3K0CA 3VGPA 1YVUA 4FGWA 3FPFA 1PX2A 1UAGA 4ZT3A 1XF9A 1U9YA 2YWGA 4XJXA 2WYIA 5CVTA 1OD6A 1GKLA 3N70A 4ARIA 2Q6TA 1ZD4A 3EC2A 4R9NA 2ONKA 1R88A 2B4TO 1OC4A 3MAGA 2HADA 2PWAA 2ZM6B 1DL5A 3UG7A 3IKLA 3BJRA 2CUZA 3R24A 4RF5A 1AB5A 3FW1A 4M9QA 1X15A 4PLHA 1WJGA 3J81k 1VL0A 5ALGA 2D1YA 4JBLA 5KNDA 2B8JA 1H1LB 3AFNA 4KGDA 1JFRA 3AVOA 4G6ZA 1O95A 4OP2A 4U4AA 4F92B 2FQWA 1VHTA 4Q9KA 1CZHA 1EYZA 3ZW7A 4UZSA 4LRTB 4PYKA 2BBOA 3Q0TA 3QA9A 4JKOA 3X1YA 4IIEA 2C4MA 5CB4B 1V8ZA 3YASA 2NPOA 3NDBB 3FNIA 4J16C 3KQYA 5FJJA 3G9QA 1P5HA 3Q3EA 2IE8A 4U00A 4UW9A 4V2IA 5G1PA 4ZTUB 1Q92A 3SCZA 3DFZA 2HMAA 3NC1C 4OTZA 1N2JA 2BEUB 2O1SA 3PXUA 4RLFA 3OQJA 4JYPA 3W4IA 3QE0A 4D8TA 4GC5A 3ODGA 2BM1A 2WIGA 1IAVA 2D2XA 2HRBA 2Y1EA 4S1PA 5EJ4A 1RM4A 2YUTA 4RK0A 3WJ1A 4LF9B 4IDPA 3O8LA 4YJFB 1K7SN 2D4AA 3KR0A 3TWOA 3MQFA 5JNVA 1TM4E 3IEPA 2GYYA 1NW8A 3EAQA 1U6JA 1TUBB 1P2UA 1TQ2A 1XLTC 2GD1O 3ETGA 5K3DA 2DQZA 2FVXA 3V00A 3DZJA 4D9HA 4FT2A 2OESA 5HBGA 3KQKA 1MO4A 1DELA 1QNFA 3DMTA 2GXQA 1SXHA 5MF6A 2VXYA 3KWFA 4E30A 3L1VA 1XK7A 4KLNA 4M2LA 2D1RA 3R7SA 3CURA 5G0TA 1B6SA 3AZQA 2HNKA 1KDYA 1JLLB 1GCIA 1LLQA 1R6XA 4ISBA 2O8FB 4BFLA 2EF1A 1E4EA 3NHYA 2HYDA 4P08A 1D09A 2XOKA 3OKCA 1Z4KA 2QYSA 3ESDA 3HY6A 4FHFA 3ZUPA 4TSRA 5DGDA 1CD5A 5H8WA 2ZIZA 2XHZA 2QP3A 3VH4A 3WFZA 2CSUA 1E98A 3DZBA 2YFQA 5EHZA 2I80A 4LOKA 5F9FA 4NBNA 1X1QA 3M70A 4J76A 3CW8X 5TNXA 1WW8A 3UO8B 4AJOA 4OBWA 2J9YB 3NJRA 3NHPA 2OD9A 2OQ2A 4HD8A 3GLQA 3V32A 1JEEA 1LPPA 1RYNA 2ENWA 4MKFA 4QDZA 4DJFC 1QRUA 4FWBA 4JODA 2E4AA 2G1KA 2P2NA 4GX0A 4DBZA 3G5LA 1IQRA 5LQSA 1GG8A 3IQGX 1NZFA 4DWJA 3MFYA 5B4VA 1I2BA 2J7KA 4URXR 1ONSA 3SHWA 4LZZA 4EG8A 5A04A 1H2EA 5EKSA 1T9DA 2Q5OA 3AXSA 1GZ7A 1V8OA 2JI7A 3FGPA 3LBNA 4OQQA 3WJ2A 4C4YA 3H5NA 4U9IS 4M37A 2I62A 1Y3DE 1LK5A 2XWJI 5HKOA 1GXSB 2W98A 5D7BA 1XZCA 4G1FA 3DE0X 4QJBA 1Y5MA 3GL9A 2FR1A 2J41A 5ADHA 2OBBA 3HP4A 1J90A 4TV9B 2QMQA 4D3DA 2GHIA 4GWLA 1X80B 4MWTA 5K3AA 3EHDA 3EXHB 3V1NA 1J8DA 1ECLA 4OX9B 5KTTA 2O19A 1NL3A 5DHQA 5P8WA 5A4IS 1AHPA 1YS4A 3O91A 3L8EA 4WZAE 3W1EA 1KQ3A 2ZIVB 1Q6ZA 3ZCVA 2VBGA 4M98A 1TPYA 4OVKA 5EMLA 3S0JA 4YRTA 2LKCA 3HKDB 3ZU3A 3DP7A 3L0BA 1C8LA 1CQJB 1HQDA 2K7FA 2AC7A 3D6AA 5FPKA 4XUCA 1K06A 2PS9A 1KU6A 3OM9A 1V4NA 3NPMA 4MULA 4LUCA 1UKCA 5I7AA 5DM1A 3SYLA 1YONA 5IARA 1NQAO 2LWIA 5BSMA 3GNQA 1KMQA 1G8GA 1E1CA 1BXRA 2MSEB 4GC9A 2P68A 1YQUA 2R2AA 1FUKA 3D4NA 2I8AA 1OGYA 3PEEA 4DRYA 2IX9A 2VWPA 4GI3A 4YDSA 2WUGA 1Y6RA 5KPDA 1GA4A 2V3WA 1G8AA 1P61B 1MJ5A 4OPMA 1ZVQA 1W36D 2VPQA 4ZO9A 4NULA 5CDSA 4AYXA 1KK1A 2QY9A 3HB9A 3UK6A 4DA6A 1HYGA 2DPXA 3QE4A 3SNHA 4D02A 1YB1A 3LTEA 3N5KA 4JWTA 1OZGA 3A6DA 1U4SA 1K63A 1WEKA 3AWDA 4I8DA 3UWSA 5BR8B 1W7AA 4JA0A 3JYHA 4YMUA 3IVAA 4EX7A 5GADl 4GPIB 1JYFA 3OLZA 4TUYA 1GYQA 1TZKA 2Q0HA 1ZA2A 1AZWA 2Q4RA 4JBYA 3RV4A 2C84A 1LQUA 2QLNA 1OAOC 3FCEA 4DLXA 2HLNA 4Z4IA 2WR8A 1BHQ1 4NBVA 1PR1A 5TC4A 4N7BA 3USES 4A92A 3EAFA 3FVWA 1L8AA 1E64A 5KYYB 3NAGA 4QLAA 3D6TB 5IUNC 2X40A 3UTDA 1N5KA 3DKPA 3ELWA 4D2IA 2PO7A 2KBFA 2PKCA 2WMDA 2AOXA 3RK1A 4JP3A 2HBYA 2P4SA 1P1KA 2ZSKA 4MW7A 3TAXA 2UUAB 3RRMA 2IXGA 2K2WA 2WWVD 4U0JA 5HKBA 2UZIR 5AVWA 1Z0JA 4UPVA 2HJ9A 4J1NA 1YRBA 2R6GA 4WLNA 5FO1A 4ZVRA 5DM2A 3Q8WA 1JF8A 4RV5A 1WXFA 2HMWA 5BUSA 1H94A 3LVRE 4E15A 5BR1A 1QPZA 1WXIA 1WV0A 1KS2A 1I80A 2FX3A 2AR0A 2PTHA 3R5HA 3ZY5A 4BNFA 2FK7A 3GJ0A 1H1LA 3DONA 4P7KA 4TQUS 2AIRA 4GLOA 3QVXA 4O29A 3W8DA 4BX0A 3PR1A 5JZMA 4IS2A 1UBLS 5EESA 1TU3A 2HA5A 3JVUA 1LX7A 4BQQA 4DV2B 4G5QA 2DPHA 4I5DA 3PC4A 2YV2A 1Z2EA 2LDXA 2XAUA 5B6JA 5KHOC 2W0SA 4JP8A 2GJ9A 2GXSA 3LRPA 2B3TA 2ESRA 3E8MA 3HR4A 4LRYA 5CB4A 4V1CB 1VE1A 3KHUA 5DW0A 4TQAA 3T15A 2I9PA 1P7VA 5JPCA 2GFIA 2P65A 3OC6A 4FYVA 4HUQB 1K8QA 4XPIB 3W2TA 3HJAA 1XHEA 2G8NA 4CFSA 3EG5A 3PPVA 3IKJA 5K6AA 1U1EA 2BEUA 4CG2A 1VJRA 1NW3A 2I0FA 3L43A 3VSEA 3WGKA 4KNVA 1TT5B 3LP6A 3A6KA 4ER6A 3QEOA 1YL7A 4ESOA 1DHRA 4ZC1A 3WK4A 4GOJA 3KU1A 4BZWA 2OCIA 2VNKA 1TUBA 1RBMA 1BO6A 4HN4B 3PP8A 5CA1B 2W6ID 3EQZA 1F51E 4L7QA 2B37A 1PT5A 3GUZA 4GOXA 1BQ4A 4WOKA 2WJWA 5HZGA 1Q84A 3B2QA 1I2AA 1L4BA 1T0HB 4KYTA 3T3IA 5EUBA 4AX8A 4ZVOA 1YC2A 2C8JA 1P6UA 2C2HA 3NKFA 3D7NA 4G23A 3EASA 3KJGA 4JI0B 3IP6A 4QG7A 1JLLA 1DBWA 3JWJA 4ZGWA 2O8FA 3HEBA 3E3LA 2KPOA 5FUMA 2CE7A 2H00A 1W2WB 3WGYA 8OHMA 1UXGA 1BDJA 1JKXA 4Z4QA 4PFSA 1JDPA 3K5HA 3DE1X 4LK3A 3DHEA 3IQHX 4F2GA 5KC9A 1I0ZA 2WHQA 4CIBA 5K2OA 1M1UA 2ODQA 1ZSVA 3KQTA 3QJGA 2IU0A 4RVGA 1HY3A 4JLSA 4KU4A 1THZA 2DFNA 1B6TA 3COWA 3OPXA 2B21A 1DAFA 3CU5A 3OJ0A 4YCCA 1UBKS 4FDLA 4CLOB 2XNSA 1Y8RA 4X20B 4CF5A 5L4SA 3GEIA 3L4BC 4G9BA 3G6WA 5AKHA 3FWNA 3Q7EA 3QTBA 2JCSA 3LP8A 1T9BA 2Q1TA 3Q8XB 1TDJA 3IQIX 2JFGA 1RD4A 2FSSA 5KJEA 1R0RE 1WPRA 2JK0A 3JQFC 3KKOA 3LE8A 4J4TA 5TJHA 4DMMA 2C54A 2GILA 3G7NA 1JMKC 4MI1A 3RRZA 5CYPA 4AZ0B 4B80A 3SM9A 3SAJA 5ABPA 4Y2PA 2B1GA 4M1TA 1L0BA 1RXEA 5LQCA 3TTXA 3PFBA 1IY0A 1PIWA 5F78A 2HV9A 4OHOA 4KO8A 3DL7A 3EW7A 4WL0A 5JI2E 5JYBA 2JLVA 3KJXA 5TQ2B 3LYLA 1XP5A 2FPMA 3OE4A 1FE8A 2D2VA 2WABA 1QQ7A 4WK2B 3TJMA 4Z49A 3FN4A 4J2TA 4ZRMA 5JVDF 5MHTA 4K9SA 2HRDA 2JF0A 4WKCA 4Q9AA 4GLJA 4Q3LA 2DJIA 1VG9B 2GI4A 5IUKC 1GXSA 2EP8A 4L4RA 5EMJA 1PJ2A 2P4HX 1DQZA 4BCCA 4WCFC 4KFSA 4RXUA 4MUAA 4KK4A 5BWLA 3HFSA 1F8XA 1G5QA 2PGAA 2XDYA 4GO1A 1RI4A 4TV9A 5LFAA 1X80A 2HFJA 3IMKA 3EXHA 2HU7A 3H9UA 5CEFA 1EFKA 1GNRA 2FE1A 3B6IA 3CUWA 4O25A 2ZBRA 1FYFA 1RBQA 1C81A 3EG9B 1OC2A 2GN4A 3MXOA 4RS3A 1W59A 4KGXA 1HFJA 4XX0B 2PUWA 3TUIC 2Z2XA 4GSYA 4WNIA 2ZSHA 3HKDA 4HF7A 3CF4G 3L8FA 2E9SA 5BSHA 1CQJA 2RGEA 4JI7B 2QTWB 5F3WB 4BBJA 4YREA 5KSWB 3NIGB 4DB4A 3SX2A 1FW6A 5AK3A 2PKWA 5L3ZA 3QJYA 4QGSA 1S2LA 3THYB 4MINA 3DO5A 3RTBA 2ZQ5A 4G1CA 4F8JA 3T1YB 4EPRA 4XLTA 3BKXA 4PZ9A 5H1YA 5DI9A 2PXAA 2CMGA 3KT0A 4IDFA 1GPBA 3UHJA 1KMCA 1RJWA 3PIRA 2WDPA 4F1JA 3D0KA 1UBGA 1MC8A 2L2QA 1BIFA 4G0NA 3NHKA 1ZD8A 1F4LA 5LD2B 3EXFB 5BNZA 1CUUA 1PJ4A 1PE0A 1CQPA 1ZFNA 2PAFA 2HDHA 2YIVX 3I9MA 3V8VA 2EKPA 4UM9B 4MV7A 1FQWA 1XTPA 3OY2A 1U7TA 3N8KA 2AW5A 3ACDA 1FDUA 1SCJA 2CLMB 1DQRA 3ITDA 2FMXA 3AI2A 2BLLA 3NALA 4MQFA 4XIJA 4FEYA 1FY2A 3CE6A 5I7SA 1NBWB 1LDYA 1PFWA 5FEMA 5B2EA 2C8KA 3FI0A 2A1TS 3MMNA 1Z5WA 1Z63A 2CYBA 3OJWA 5KYYA 2IYWA 4AYTA 1AMOA 1QHEA 2FWBA 2ZI9A 3BCRA 1MUUA 3EVZA 5CCBA 2VT3A 3W8EA 1SKUA 2VRWA 3QPCA 4RY2A 3R76A 2C5GA 2GQ0A 5IASA 1JWBB 4O33A 2O1WA 2FG7C 4DLBA 4R6WA 3IEVA 1KMNA 1WU7A 1BDIA 1UBOS 3LUPA 3UQYS 2ZDGA 1ESDA 2CL5A 2BKAA 3HCRA 4MX8A 2KBEA 4QICA 1D9ZA 3B48A 1XSEA 2QUJA 3RYIB 5J1SB 3ADCA 2B4RO 5IK2D 2OYRA 2NSYA 2Q5CA 4ARCA 1N3LA 2I3AA 3VNVA 1F2DA 1JQDA 3B6KA 3BSFA 1NLUA 1S9DA 2G5TA 4CKWB 1SVKA 5AXCA 5CFZA 2XVZA 2O2CA 4LOJA 4MJ7A 4KJXA 1FA9A 1KR5A 2QRMA 3K6SB 2GD2A 1HDIA 2OLEA 2XUJA 4MVJE 4FW8A 2QW1A 4HVTA 1MG5A 4Q4LA 5AM4A 3KSAC 1EJ2A 3K2EA 3G0OA 4C6TB 1D6JA 2X7JA 4RVDA 2G83A 4RKWA 5CXSA 3R40A 3HRHA 4AZWA 4EKGA 1ODIA 4HFMA 3M9LA 5J2UB 1VL8A 2IGTA 3WK5A 1TYEB 1ZWLA 4IGEA 1FNDA 4YASA 2HJGA 2Z98A 2WINI 2HSWA 2Q9CA 4HUQA 3SI7A 3AO0B 3UYLA 2JLXA 2ZJ0A 3IBTA 4PNEA 1RWVA 3W34A 3JY6A 1TTQB 2FP4A 4UAUA 4BRWA 4BMSA 5D84A 4AG6A 3DXFA 1F0PA 1LC0A 1TT5A 3AVQA 4X7PA 1JG2A 2O3SA 1F8FA 2GT1A 2XKBA 3STHA 2PA0A 3L1IA 4UU8A 1X7ZB 2O3UA 3WYAA 4B31A 1DHTA 2JAWA 3BKWA 1PBNA 5THKA 5CA1A 1EDDA 3LDAA 5ECGC 3LCUA 3PXCX 5LQKA 4RY9A 2FW1A 1XMXA 2GK3A 4G4JA 4JZYA 2VHEA 5LC1A 3W05A 4P58A 3FDXA 3B3GA 1G17A 4QSMA 4TKZA 3CBGA 3ROTA 3F3MA 3UGTA 4XJSA 2VEOA 2MSDB 4F6LA 2R5NA 4CLDA 1LY1A 1PFYA 5TMEA 5BVHA 3AQIA 1UJMA 1QIHA 3W04A 1NMQA 4XB2A 3BMNB 3H99A 5EE5B 4DCJA 4GR9A 3O21A 4UMVA 3WXMA 2Z6UA 3SSNA 4IHKA 2QLJA 2OBMA 2BONA 1RQ7A 4OBXA 2YRFA 1B00A 1YAHA 4FBLA 1MRSA 3WGLA 4P4UA 2I2AA 3QUCA 2VNSA 2NV0A 2HNBA 1AK1A 1L5VA 2WM2A 1VKOA 4CLOA 4X20A 1SPXA 1BVUA 4FFDA 1CHNA 5DNUA 1V4VA 3Q7SA 5C18A 2G17A 4PLPA 4NDNE 1T2AA 4O2AF 2V03A 3PHCA 5EIOA 2G9QA 2UZ1B 1O94A 3HA7A 2H9YA 2RSLA 1NNSA 1IM2A 2P4EA 5H02A 2O4CA 2JCYA 1S3SA 4AZ0A 2I6SA 3GFGA 1Y6ZA 3OVMA 3QVJA 3U7EB 5JEEA 2VTBB 1MG0A 5E6SB 5JJCA 3A1FA 3HXQA 4XASA 4Z0PA 1M75A 1VCHA 3MBIA 4YUVA 5J9FA 4AX4A 1SQ5A 4MW4A 1NJ1A 4PANA 2ET6A 1L5GB 1W73A 5TQ2A 1D6SA 4IXMA 1VFPA 3IAFA 3K0CC 1D4AA 4K6FA 4FQ8A 4QOFA 4YJDA 4ZOAA 4KMSA 2DH5A 1XZEA 2ZR9A 2IWRA 2Y71A 5AHXA 3AEYA 1XF1A 3VR2A 3CSDA 1YASA 2CK3A 1TT7A 3FHOA 3UGKA 5DTEA 2PJRA 2UDPA 1FJXA 2CC2A 1WB9A 3INTA 4DJJA 3ND9A 2YZMA 3BORA 1U81A 4GI5A 2H0QA 4A2CA 1ZCBA 1UR5A 2Y0PA 3VTAA 5ESDA 1L3BA 1QYDA 1Y6FA 1ORDA 3V8PA 2HDNB 3LYAA 1OLXB 3A1WA 2P9TA 2BKUA 4B4VA 2VDLB 1M67A 2Q1SA 3F6RA 3GFVA 1GADO 1U7XA 2BN4A 3EG9A 2N3ZA 4L6AA 4D81A 4ERXA 4KYIB 5KQPA 1OH7A 2IXDA 4KQFA 4X71A 4Z9XA 4XX0A 2VUHB 1TB4A 4Q3NA 3WBJA 2CYCA 4YRNA 3QI2A 3FPKA 2H08A 5ALUA 3JWEA 5EXTA 2H1IA 4AMZA 2IPAB 2IDMA 5TT1A 5F7XA 1WY7A 1Y1LA 2WAMA 1B15A 4OL9A 1UDBA 4RZHA 1Z07A 4BWGA 3THYA 2QT1A 3F73A 3SGLA 5LZ9A 1QGDA 2OXCA 2JAQA 4IIGA 3GZJA 4EGSA 1U8CB 2L82A 3A6JA 3OIWA 2PQ6A 1U6KA 3NAZA 3VZSA 1FMTA 2XD4A 1YIOA 4YAKA 3FVQA 4RE5A 3U40A 4GP9A 1TJYA 4TS4A 4WLOA 4LY6A 4JC0A 1HC7A 5E4JA 2W2TA 3T52A 5ADUS 3E9YA 2I55A 2PZLA 8ATCA 3RTAA 1J0CA 4HDAA 1DWPA 3C7CB 3U5TA 2ZCVA 4XWYA 4CT0A 2DX7A 2VO1A 4XTRA 3OZEA 2DTDA 2WE8A 3EXFA 2GBLC 5J58A 2B5WA 4Y2HA 5BORA 4OHMA 4MEAA 4BATA 1FXSA 1I0LA 2J08A 2RAFA 5HCIA 4C7BA 3ZE0B 1ZGCA 4NS1A 3VPCA 3E9QA 5ERXA 4YV2A 3Q4GA 1UINA 3FRHA 3D3JA 2ZRLA 1XL0A 4BQIA 1BH2A 3I6MA 3VU9B 4BV2A 2W2VA 1ZUNB 2PIAA 1DX6A 4FXPA 3H5LA 4JNCA 3RS2A 1MB3A 3TO5A 2AVDA 5IXYA 1ADCA 2JIBA 1G55A 3ONNA 1C4OA 2BGKA 5JISA 1Q0HA 3TVDA 1SVSA 1F0NA 5FYDA 4FDMA 1PR2A 1SB8A 3MJSA 4G0XA 4F9GA 1QUFA 2D2EA 3OOWA 2IU6A 4IHJF 1L4EA 1ADBA 3QBVA 4OHRA 5AK4A 3W6OA 5K0SA 3RYIA 2OTCA 3DEIA 2BFBB 2QDXA 2JI6A 4LDQA 4C7OB 1BXKA 3STVA 2FZKA 2WYVA 3SX4A 2YNMD 3LM8A 5KTNA 3EC1A 1J8YF 2C9YA 4J7CA 2DJ5A 1XFDA 1NP6A 1U31A 2M9MA 4TX1A 5H70A 2WJ3A 4CKWA 3M1LA 4DSUA 2X5KO 4PR0A 2GRAA 1Z8NA 2IEZA 3FSGD 3K6SA 3BCSA 1QZ3A 1XV5A 1T0PA 2WSMA 1NF3A 2YJ4A 4HZIA 1JB1A 3A2LA 2UXBB 2ZYUX 4LZAA 1K3TA 3RFCA 3TBFA 5GMOA 5BYAA 1T26A 1ZUIA 1CIVA 4KO1S 3IUPA 4CIDA 1EFPB 1PX0A 4MYTA 5J2UA 5EGNA 5B3JA 2FPOA 1HDZA 4W1RA 3C5WP 4DR3B 3C6YA 2QVLA 3PCRB 3MLEA 5FQOA 1JR2A 2Z09A 5BWMA 4MPRA 3TRFA 4LQDA 2VZ9A 1UKBA 4P0TA 2WT9A 3CW9A 3L05A 2Q2WA 1BFDA 3PWZA 1NQUA 1Z4PX 3H3FA 4HDKB 2QMHA 1FBNA 1H6CA 1S9HA 2YBDA 5GONB 3RLIA 2G6TA 4WGFA 1DBSA 1EVIA 1X7ZA 1BX3A 1ZD1A 4UMFA 4QDUA 4NATA 4M76B 4DCVA 3AJRA 1JE0A 5BSEA