4IIVA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.5 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
SRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.5 A resolution
rcsb
source organism Escherichia coli
total genus 92
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iivA00
4HNHA 1HEUA 1LLQA 4CM4B 3K73O 1VPDA 5JMWA 1BHSA 1QR6A 4Q3DA 5L53A 4TVBA 3WYBA 1XQ6A 3PK0A 1JU9A 4UEKA 3CZRA 4GGPA 1XR3A 4OMUA 4R16A 3DFUA 3JD1A 1XEAA 4BKUA 3AU9A 2I65A 3DBHB 4RV9A 1I0ZA 1M2WA 4MO2A 3QP9A 4I1IA 2XXJA 4KQXA 2RBEA 2D5AA 1GV0A 4J1NA 3RSHA 5JS6A 1UJMA 3NDIA 1Q2XA 2Z5LA 1JKIA 4XB1A 4QX6A 1YBMA 1P3DA 4XRRA 3CTMA 3AJRA 4Z9XA 1N7GA 4IIVA 3NGLA 4WK6A 3VPFA 4IIUA 4OOFA 2W98A 3SC6A 4L4SA 2B4TO 4ZA2A 2HQ1A 4MIEA 5TX7A 3GN2A 1W73A 1F06A 4Y9DA 1L1FA 1T2EA 2QRJA 4BGUA 3PQEA 2NV6A 2G17A 4XJSA 1PJBA 3C85A 3LZ6A 4KTVE 2HU2A 4BNLA 4HBGA 1E5QA 1CRWG 3M2TA 1PGQA 2G0TA 1ONNA 1T24A 2NQTA 4WGGA 1X0VA 1XGKA 3QY9A 5DBFA 4TKMA 2I99A 4WJZA 1K6IA 3JQBA 3A9WA 2NU6A 1YONA 5KJFA 1JA9A 3EVTA 2Y68A 2GF2A 1M67A 4DQXA 5TJHA 2HMTA 4HX5A 1ISHA 4K26A 4O6VA 3N7UA 1B16A 2VZ0A 3S55A 3L4SO 2Q49A 1I3LA 1D4FA 3EUWA 4CM8B 3ITDA 1ARZA 2ILTA 5JDIA 1YDWA 4D3DA 4D42A 1RJWA 4GSLA 1M76A 1SOVA 1PQPA 2ZTVA 4AJ1A 2H63A 2DTXA 1MXHA 1EUZA 3LC1O 1LNQA 4CMGA 2JCXA 4XIJA 1GUFA 2IRWA 2HLPA 2FZWA 1T4DA 2O2YA 4NFYA 2DBRA 2YUTA 4FW8A 1HYGA 2XOXA 1V0JA 2OP0A 1XQ1A 4JK3A 2HO5A 1DFHA 3BIOA 3DZGA 4I8XA 3WGTA 3JQFA 2O3RA 5KJCA 4R1SA 4DIFA 2HK8A 3JQ8A 3COSA 2B4QA 3PQDA 4W9NA 2P5YA 4E33A 1EFKA 1XYGA 4OIMA 1PGJA 4RCVA 1J0XO 2Y0DA 3UAGA 5EIOA 1YJQA 2VWPA 3QV1A 3RJ9A 3R3SA 4B79A 1PL8A 1B8UA 5KJ1A 1T2AA 5F5LA 2B36A 3I9LA 3OETA 4GX1A 3BMOB 2DVMA 4FFOA 3RC7A 2UUOA 2C29D 2Z1MA 5FI5A 3HE3A 1GQYA 1MX3A 5HTOA 3H2SA 3ZWOA 3MJVA 1BXGA 4HV4A 4P38A 4PG8A 4CQMB 1TLTA 3TL2A 3LT2A 3CXRA 3PLNA 1HLDA 3SLKA 3AUUA 1IHXA 5BSFA 5U9CA 1MB4A 5ER6A 1NQAO 1U7HA 3QE3A 3RFXA 1Y7TA 1WW8A 2I6TA 1E3WA 4R5MA 3C1TA 2QHXA 1VJ0A 2X9VA 5ILGA 4Y67A 1NP3A 4C7JA 4R3WA 2WD7B 3K9QO 4BKRA 5AXBA 1KEUA 1LA2A 4HNGA 4K6CA 2AA3A 1X0XA 2NADA 3L07A 3QVTA 4L75A 1O94A 5JDCC 4RF4A 1J4AA 2FR8A 3F6YA 4WNCA 4Y8VA 4R9SA 2VYVD 4PLPA 3EZYA 4YJDA 1ADFA 1N92A 4E13A 1LSJA 3AI3A 5F1KA 4PLWA 4BNIA 1KEPA 1B15A 4ONEA 3TJRA 3K5PA 1I2CA 3RUEA 4D41A 1CYDA 3GDFA 3IC5A 3I3OA 3WFIA 1BXZA 3GRPA 3KEOA 2PGJA 3PYLA 3GDGA 3ZNOA 3ZU5A 3HADA 3RBZA 3PRJA 1GQQA 2C7GA 4ALNA 4RZHA 2VTDA 3JQ6A 4M55A 3I1JA 2VYVA 2GDZA 4UUMA 4XGKA 4AJNA 3EHEA 2DQ4A 2VT2A 3W8DA 3ROKA 4DPMA 3S1LA 1VL0A 1NXQA 4ZRMA 5IN4A 4ZQEA 3VDQA 1P1FA 1Y9EA 5BNFA 4KWHA 3PYXA 5LCXA 1T26A 2WE7A 5T8KC 1QORA 2O7SA 4CV3A 1U28A 3PJEA 4OXNA 1NFRA 4YTEA 3UKOA 2X5OA 4B7UA 3PP8A 4DWVA 2UVDA 3TZ6A 4DPLA 4MKRA 5DCUA 2BF7A 4RQUA 3AU8A 4D0SA 1EEHA 1XCBA 1EFLA 5TGDA 1S7CA 1TVEA 1JW9B 3ETEA 3L4BC 4FOSA 1NASA 4JBIA 2JL1A 4CV0A 3KO8A 1BW9B 3FHLA 1LDBA 2JD2A 3ZH2A 2QQ5A 5L7WA 2HAEA 2ZYAA 2EEZA 4CLDA 2XF8A 4FJ0A 1CJCA 1QMGA 4OJNA 1KVQA 5B4TA 1PSDA 5JMPA 1B3RA 3W6ZA 5IDXA 3E1KA 5TSDA 2E37A 4PG6A 4BB6A 6ADHA 3OMLA 5DP1A 3AI2A 5G4KA 4CMAA 1NPDA 2VTEA 3GPIA 4UUPA 4KMSA 3TOXA 1V9LA 3VZQA 5BSGA 1HDXA 4J0EA 3Q1LA 1LDYA 2OO5A 4D3SA 3KYDA 4IJUA 1BRMA 4J6FA 2RHCA 2VUTA 1OBFO 4J4BA 3GVHA 3PLRA 5C7IO 3DC2A 5G0TA 3VC7A 2NSDA 1KVSA 1DLJA 4NG5A 4Z3DA 4LVUA 2FSSA 2ZJ1A 3ANLA 4JJGA 4M89A 4XQCA 3D5TA 3ROQA 1DHRA 3HUDA 1H93A 4CMJA 3IQDB 4TMFA 2B5WA 1HZZA 1Y8QA 3OA0A 2AQHA 2IZZA 3ZWAA 1V3TA 2W4QA 4NJMA 4AJIA 3D3WA 1U7TA 5KKAA 2D2IA 3VOSA 2VWHA 1YL5A 4J4TA 5MDHA 3H65A 3GVPA 1PGNA 1UXHA 1GQ2A 2ZIZA 1ZJZA 2AEJA 3WXBA 3F5SA 1I24A 4YJHA 1IHYA 4BKQA 4ZICA 4M1QA 4PLFA 2V65A 4BL5A 3AWDA 2ZB7A 4CMBA 4FFRA 5JFOA 2Q1TA 1QXSA 1HYEA 4UVDA 2EW2A 2YV1A 1ONOA 4B8WA 4TRNA 4R41A 2ZKLA 1XU9A 3D7LA 1E92A 2AEFA 3AOEC 3H9JA 3PWKA 4J4HA 4JCOA 1EE2A 4BO8A 4UVHA 3UCXA 3ST7A 4JBHA 1DO8A 2C2YA 3RKRA 3KUXA 2BFMA 4TRMA 3U5TA 1B8VA 3P2YA 1NAHA 2QZZA 4YJGB 3NUGA 4JROA 2JKVA 3RD5A 1EBUA 1XA0A 2Q2WA 3ASUA 1PEDA 1DOHA 2GN9A 1LDEA 5TS3A 1NR1A 3ZHYA 3VPXA 1NR7A 3DHEA 2V6GA 2VYND 3ZWVA 3WG9A 4AJJA 1MG5A 2X5JO 2HK9A 1YJ8A 5CAEA 3OJEA 3E6AA 4CR6A 1UXGA 1P77A 3IAHA 1DAOA 3F46A 1LUAA 4KUHA 4JQCA 1PJ3A 2O3UA 3KSDO 4J90A 4II3A 1GPDG 3OEWA 3LLVA 1B7GO 4IGEA 3I6QA 3WGOA 2RH4A 4XGIA 3RQSA 4ND5A 1D8AA 3L6DA 4NU5A 4DVJA 3GK3A 5B4UA 2EF1A 3DL2A 4YT5A 3STHA 5JCJD 4J49A 2DM6A 3GT0A 3ZN2A 2HMUA 1I36A 1M6WA 1VE9A 5IZCC 3IJPA 4BV9A 5CEEA 3DFZA 1SOWA 4H16A 3ZZNA 5JDCA 5G4LA 2O48X 4I9UA 4YB8A 5JNLA 4W6ZA 2WSBA 4BNVA 2DPHA 8LDHA 1O95A 3F1KA 1WXDA 1VM6A 2PNFA 5AYVA 2GO1A 3I52A 1Y5MA 3JQGA 4RPGA 3WQQA 4ZQHA 2P2SA 1VL8A 2HKIA 3PZBA 2NVUA 4XYBA 5EQFA 4E5NA 3W6UA 2H6EA 3KSUA 5BSHA 1C0LA 4BNFA 4XYGA 3WQSB 3PDUA 1AGNA 4PLHA 3OQ1A 4G81A 4L4RA 1X1EA 1PQWA 3PEFA 3ZWPA 4L4XA 1H2HA 5TF4A 5EPOA 4TROA 4O5OA 3D1LA 1ZK4A 2AHRA 3O9ZA 4AJHA 4UAGA 4PG7A 4E5KA 2NACA 1WVGA 3WDSA 3BTOA 5B37A 3GY0A 3PFFA 3UUWA 1GD1O 3K2BA 2ZQYA 2DT5A 4MVJH 1RWBA 2O2SA 2RHRA 3ENNA 1LDGA 4BNMA 1N9GB 5TT0A 3L0DA 4R4JA 1A71A 4DL9A 4RQTA 3MZ0A 1J6UA 2CDCA 4DMMA 1LLCA 2B5VA 4JP3A 4LVCA 4R68A 3BZUA 1CETA 3ICCA 2Y1DA 3RUIA 6LDHA 1QYXA 3B70A 4NBRA 5DF1A 2Z1NA 1I3NA 3QVXA 2NTJA 3VH1A 1KETA 1Q7GA 4IQ0A 3NEPX 4NDNE 5AVOA 3RC9A 2X4GA 1ZCJA 1BW9A 5L4SA 1DHTA 2Y99A 5EL0A 3VTFA 5I9LA 1Z74A 3EAGA 3GAZA 1P1JA 4BOYA 1YBVA 3I9KA 5F1PA 2OBYA 1ZVMA 2QRKA 1H6BA 2HRZA 5L51A 3T7CA 3ZHBA 1AHIA 1BMDA 1GFSA 4WLOA 5FWNA 4CM6A 2AXQA 3VZSA 1E7QA 2HUNA 2Q50A 4RPJA 1ZZEA 2O3QA 2X0RA 3JD0A 3ZU2A 1AN9A 4RVDA 3SJUA 2J3KA 1IPFA 1NVGA 4I5EA 2X22A 4QUKA 1HDGO 4CPDA 4EW6A 1R12A 1UDAA 1N1EA 1P33A 1GPJA 1UP6A 1UAGA 1YDEA 2PKQP 4TZTA 3GFGA 1B8PA 2O3JA 2RAFA 4WLNA 4XRGA 1C14A 2X0JA 3PIDA 3AUTA 5CDGA 5JW6A 1DC5A 1I2BA 3JV7A 4H3VA 2HMVA 2PH5A 4OH1A 2PKQO 4JN6B 2HRBA 2AQKA 2G5CA 3KB6A 2GLXA 4LRSB 4M54A 4OSOA 3TZKA 5ICMA 1E3EA 3LT0A 1QKIA 4FBGA 2NTVA 3P19A 4U6SA 2Y67A 4WEQA 1G0NA 3EY4A 2BHLA 3RVDA 3GDOA 4RZIA 1PJQA 3G1TA 2H9IA 4CMKA 3IIEA 4DXHA 3H9UA 4TSKA 3AOEA 3IUPA 1YL6A 3MEQA 2FOIA 3FSRA 2O3TA 4FJ1A 1OZAA 4UVEA 2I9PA 4IDEA 3ZWWA 5HA5A 4DTIA 7MDHA 3F4LA 1ISJA 3D0OA 2IODA 2FSVA 5HM8A 3CH6A 5G0WA 2WJPA 1ZW1A 4XQEA 3AOGA 9LDTA 3HN7A 1HKUA 1NWHA 3E03A 3OH8A 3WOHA 5EN4A 1BTOA 4FOOA 3JQAD 3MJCA 1HTBA 2GGSA 3HB5X 1EUDA 4WLFA 2X7HA 3JD2A 1DC4A 3AM5A 4UREA 4BVAA 4BGIA 4XZ3A 4BO4A 1E6WA 4XYEA 3JQ8B 1ZSNA 3E9QA 3RUFA 3AY7A 3FTNA 1LRJA 4MKXA 4B4OA 5GZ3A 5ILOA 1U8FO 4RDHA 4W9NC 3JQAA 5C5IA 1JDJA 4YT4A 1HDRA 4L8VA 1YRLA 1Z6ZA 5T6BA 5IZCA 4BKPA 8ADHA 3GGOA 4II2A 4BKOA 3FPCA 3TNLA 1NYTA 3BMQB 1UAYA 2PK3A 1A7KA 4BS9A 1NTOA 4CLHA 1ENZA 1XWFA 3H5AA 4FPXA 1X7HA 3W1VA 3JYOA 3SXPA 2HCTA 1A27A 3OP4A 4GAEA 2VNSA 3MJTA 4HUJA 4U5QA 2GRAA 2EP7A 3JD3A 1E3WB 4ZRNA 4GQAA 3AM4A 3H2ZA 3UN1A 1LDNA 3ZGYA 1U3TA 1XG5A 2OXIA 2FMUA 1T4BA 1HDYA 1GCOA 2A94A 1Q0QA 2C07A 4GMFA 3RBXA 3WNVA 5DCYA 1Q1NA 4HFRA 1NQTA 2IZ1A 3ZNQA 4BO5A 1GZ3A 2OGUA 4YRAA 5JC1A 1K6XA 3M6IA 1NPTO 4F45A 3UCEA 4BGVA 3X2FA 3WGZA 5DBIA 2RCYA 2PGLA 3DO5A 3Q9NA 1HDOA 4PRKA 1QYDA 1ORRA 2HMSA 1ISGA 3IJRA 3KXDA 4GI2A 3BTSA 1GEEA 3IP3A 3B6ZA 4QQRA 3E82A 5TJ9A 3WLEA 2NUAA 5AQ1A 2VHYA 4WUVA 2FWMX 3WBBA 4RO0A 3Q2IA 3KBOA 3VPSA 4IY1A 4ESOA 1ENYA 5KJEA 1MP0A 3WR5A 1QG6A 2FZEA 2BMAA 1T2DA 4BNJA 2BH9A 2EKLA 4B4UA 5EINA 2CD9A 4M86A 4DA9A 2GR9A 2W90A 3DZBA 4PLGA 4CMIA 3CKYA 3ULKA 2E4AA 1OAAA 2WYVA 3AW9A 1D1TA 4PG4A 3PVZA 3WB9A 4MVJE 3ZV3A 2AQIA 3W8FA 1NQ5A 3WMXA 1JVBA 2Y93A 4FN4A 3EMKA 3BHMA 1IZ0A 1FK8A 1PQUA 2Y05A 3PPIA 2GSDA 4J2HA 5COBA 2I5PO 4CV1A 1WDKA 4AJKA 1I33A 1DRUA 4A26A 2AMFA 4A27A 4RVSA 1PTJA 2FR0A 1CWUA 1PJSA 3U4DA 1SC6A 1XDWA 2GNAA 5T57A 4R9RA 4XR4A 4RVGA 5G4KB 4CODB 2JFFA 1JQBA 2G82A 1MFZA 2BGLA 4B3JA 4D46A 3QVSA 1LRLA 4URFA 4BNGA 1AE1A 3KYDB 3HJAA 4PIVA 4K28A 5G0VA 2V6MA 4YAEA 3T7EA 2IXAA 2E49A 3VVCA 1U4OA 4DQUA 3OJFA 4BNYA 2UDPA 3NTOA 4OSPA 4BO9A 4ZD6A 4CR8A 4M8SA 3O26A 3PTZA 4FGSA 2G76A 4ND2A 4A5OA 3KYBA 1EBFA 1Y8QB 4D3FA 1O0SA 1PGPA 3G79A 3N58A 3OSUA 4NIMA 1HL3A 1EK6A 4NJMB 1I2ZA 1DFIA 2BGKA 3D3WB 2DKNA 3K92A 3HNPA 3KLPX 3X2EA 4BHTA 1H6AA 4OXYA 4BQRA 3RWBA 1E7WA 3DR3A 4U6QA 1ZKMA 3OIGA 5COAA 3S2GA 3ANMA 4MDHA 1K2WA 1WWKA 3VH3A 2D4AA 1UXKA 4YJHB 4RJTA 5IG2A 5EERA 4FQ8A 3H5RA 4BNUA 1I01A 3K96A 1LRKA 2NTNA 4YCAA 1N7HA 1N2SA 3U49A 3QHAA 5FFFA 3BHIA 4I5FA 3JQ7A 4B3IA 1K89A 1Z82A 1WDMA 4E6PA 5IXSA 2E6UX 3K31A 1Z7EA 2V6FA 1JTVA 3QJ5A 3SEFA 1ZK2A 2QG4A 3GR6A 5GY7A 3TOZA 2C54A 4B8ZA 5JO0A 5AOVA 1CF2O 1HSOA 3GVCA 4QFCA 4PRLA 2CUKA 4OGWA 4DIOA 4S1VA 4LN1A 1FXSA 4L74A 5BNTA 4RPLA 1XLTA 3HHPA 3L6EA 5L4NA 5CHEA 1M75A 4J7XA 5FYDA 4WKGA 4RDIA 2X86A 4E32A 4RORA 4UEJA 4MINA 4CMCA 4BNXA 4LK3A 4PLZA 3BMQA 1PL7A 5A1TA 4E2YA 1HZJA 2OL4A 5TQVA 4R69A 4JP2A 2D1YA 2NVWA 3VPHA 3RC2A 3UVEA 2CF6A 4Y98A 2CMDA 1EQUA 3OICA 3WIDA 1E0DA 4EUFA 1E7SA 5A02A 1E3IA 4YAIA 4D44A 2GPTA 3H6KA 1TA4A 4DYVA 4QEDA 3FCOA 4EI2A 2HJRA 2PFGA 3QWFA 3KETA 1YQGA 4OKNA 5CFZA 2OFPA 2ZYGA 4Q3BA 4XQ9A 5IZ4A 1MFPA 4YT8A 3UOGA 4TZKA 4WOJA 3E8XA 4U8GA 5JLAA 4NZ9A 5EQDA 2LDBA 3ZI0A 4BNNA 1H5QA 3VH2A 4F6LA 2JHGA 4GH5A 4IUYA 4KUGA 1HF3A 1K5HA 5KVQA 1MUUA 3DBRA 4A2CA 5CP8A 4YVFA 5DN9A 4IDAA 1MG0A 5ITVA 4E4YA 3CINA 4IDDA 3DAPA 1X7GA 3WNQA 3JQGB 2R6JA 4HXYA 4K6FA 3CIFA 4Z0PA 2Y66A 2PR2A 2NVUB 2PD3A 3GGGA 4MOWA 1PL6A 4PZDA 2YQ5A 1DIRA 2IYOA 5HS6A 4BNWA 1NVTA 1KC1A 3ITKA 1A9YA 3QSGA 4FC7A 4E5PA 4I08A 1G6KA 3B20A 1HETA 3OFSA 3WFJA 3A14A 5F3RA 1T25A 1IZ9A 1OMOA 4HWKA 4N54A 4BO7A 2A4KA 3W4JA 2GZ2A 5JYDA 2X8LA 3M2PA 2WD8A 1ZJYA 2W2LD 3FNHA 4YPOA 1E1LA 5JC8A 4XEHA 3K6JA 1DC6A 1ISFA 4FFLA 1ADCA 5KJ6A 1Q0HA 4Q39A 4UULA 2WWRA 3DAGA 4OM8A 5C37A 3G17A 4XB2A 2VRBA 1ZMOA 1DLIA 3LC7O 2CNBA 4CL8A 3UGKA 2J5RA 3TZQA 2H1SA 4XGNA 4P4NA 1U5AA 1E3SA 2AW5A 3GOHA 4AVYA 4Y6RA 5GMOA 1LEHA 4RPHA 4KOAA 2NLOA 3WGYA 3GUYA 1EDZA 2EIHA 3D4OA 3SC4A 4ND1A 2PH3A 3OA2A 1A7AA 1JWBB 3WJAA 1TT5B 2IDZA 1VC2A 4ALKA 3CE6A 3VTZA 3ZWYA 5GZ1A 3DZHA 2WTBA 2DFVA 1ZMTA 3FPLA 2C5AA 2DBZA 5CDYA 2ZYDA 1VKOA 4P4GA 4FDAA 5I7EA 4UUOA 1B2LA 1UP7A 4R1NA 4WEOA 3A06A 3S2EA 3PZRA 1GV1A 1TEHA 1JWAB 1U3WA 2EP5A 2J6IA 1WNTA 1P1RA 1VRWA 3WLFA 2PGDA 3JQCA 1QP8A 1X15A 4XD2A 4YWJA 4IJVA 5CDSA 3C1OA 3DMYA 3OM9A 4EUEA 4CLOA 3GF4A 4IJWA 4E3ZA 4FS3A 5L9AA 3CPSA 4XCVA 5BT9A 3I9OA 5KWEA 1YB5A 1M66A 3RROA 3RI3A 4BV8A 3NAQA 1BSVA 1IYZA 4BNTA 2WYUA 3LVFO 2X5KO 4OOEA 1I3MA 3BTUA 4BIIA 3FWNA 1PS0A 2I3GA 2HMWA 1W6UA 2NVBA 1NQOA 3C7CB 4W4TA 4WLEA 5MGBA 5JO9A 1HWYA 2GERA 3E5RA 1GZ4A 3FNEA 5L95A 4GWGA 3DOCA 2ZJ0A 2DTDA 3V1TC 3LLSA 1DEHA 1EDOA 3OIDA 3JQDA 4PVCA 1DC3A 4MJLA 5TRTA 1NBOA 3KOUA 3TZCA 1O8CA 2PD4A 4U0KA 3DOOA 1YB1A 3SJ7A 4CLRB 2YHIA 4EEXA 3WS7A 4Q3AA 2JD1A 1ZXBA 1O9BA 5G0SA 1X14A 3EVNA 2CZCA 1EVIA 4YAGA 3DMTA 5TC4A 2Q2VA 3ETDA 2YQ4A 1GR0A 1RM5A 4GGOA 4EDFA 5L4LA 1DSSG 3GMDA 3RKUA 1ID1A 3ZHZA 3L77A 3Q6IA 1LXCA 1Z73A 3HN2A 3L6OO 3MOIA 2QW8A 3FNGA 2JFGA 1S6YA 4BO2A 3ZV6A 4AJOA 4Z0HO 2VCYA 3GC6A 3TL3A 1QSGA 3JQAB 1C3VA 2O4CA 2WYWA 1GYPA 1XU7A 2P5UA 2VYNA 3GRKA 3RU7A 4ROSA 4A7PA 2NU7A 3I4FA 2F1KA 3RUHA 3QQPA 4CLEA 2OZPA 3DZKA 1DBVO 5F1OA 1B26A 1LBEA 5JAQA 5A9TA 1PIWA 4J9VA 1R4NA 3TWOA 1ADGA 2J3JA 3JQEA 4EYEA 2IZ0A 1B3BA 1ENPA 4J2OA 2OP1A 2VHXA 3U4HA 4WLVA 3C1AA 3G3EA 1U9JA 4TRJA 3D4PA 2DC1A 5KTKA 1GU7A 3ROPA 5KKCA 3TRIA 4PG5A 1U1IA 4B4WA 5J23A 2BGMA 3T4EA 1D3AA 2YV2A 4AJ2A 4MKZA 5JCJA 3VAZA 4OKIA 4MVJM 3ZU3A 1W0CA 2B0JA 2JJYA 2FN7A 3KYCA 4JNKA 4NMHA 2CVOA 1YO6A 2ET6A 2W2KB 4Z6KA 4QFDA 4IZIA 4N18A 5I9MA 3UXYA 2PZLA 4E2WA 5DT9A 1OFGA 4IXTA 4PCVA 4F6CA 4O59O 5FI3A 1Y8RA 2Z95A 3UHAA 4U7WA 3R3JA 4IDGA 1V3UA 2R00C 3AM3A 3AY6A 1HE4A 2OHXA 3NDRA 4NHEA 4BNZA 1GL3A 1LX6A 1P9LA 4JJIA 4ZQFA 4J91A 1IPEA 2GUGA 4YR9A 2CDAA 3LYLA 3U4CA 5DOVA 1KEWA 4JXKA 1JKJA 4E30A 1WZIA 4B4VA 4RF3A 5A5EA 1CERA 4W99A 3W4IA 3PFWO 4BGEA 1XSEA 4C4OA 3BYZA 4OXKA 1C0IA 1Q0LA 1UUFA 1NHGA 3WJ7A 2P9GA 3VZRA 4AL4A 2P9EA 3UW3A 2I67A 3GEDA 3ZWCA 5JY1A 1U2GA 5JSFA 2YHUA 4ZJUA 2CSUA 4QSMA 2P4HX 2DLDA 1OC4A 4J7CA 4NQZA 2C7VA 4NBVA 1V3VA 2CVQA 3DDNA 3GA0A 3M1AA 4CMIB 1TT5A 1LQTA 4ND3A 2FP4A 5I8ZA 1ML3A 2O23A 4OHUA 5C7OO 3OECA 2EV9A 3V8BA 4ZQBA 1ZEJA 1YBAA 4HFMA 4EUHA 1VSUA 1ZEMA 1GTMA 1UZNA 4IDFA 5K9ZA 3ONEA 2TMGA 4PLCA 3WGIA 3GQVA 3ZCXA 1VJ1A 4MVJD 2Q4EA 1RYEA 1CDOA 1ZIDA 4GPD1 3DQPA 4JGBA 3PWZA 1R15A 3IUSA 4NH4A 4BNHA 4EZBA 3G1UA 1KVRA 3GNSA 1QLHA 2EG9A 3WICA 1ULSA 2D3TA 4OQYA 4PVDA 4B7XA 2PTGA 3TDKA 1AXGA 1E5LA 2Y1CA 4EBFA 3U3XA 4OQZA 3DOJA 4ZU3A 4OL9A 1YKFA 3CSDA 5F21A 3WQRA 1U3VA 1DIHA 4Z9FA 2PD6A 1I5RA 4FC6A 2DFDA 2YW9A 3GUCA 3GVXA 4MVJA 1CIVA 5IDYA 3F4BA 1MV8A 2X6TA 3DWFA 1K6JA 1YOVA 3NTQA 3B1FA 3ZWXA 4IXWA 1LJ8A 5BNIA 3LU1A 3GZ4A 4YXFA 3B1JA 3EZLA 2YFQA 3WTCA 3QWBA 2V6BA 1EE9A 3KHUA 3QVWA 1IUKA 5A3VA 4QT0A 3UICA 5DCWA 4IGFA 2DTEA 3GFBA 3I83A 1FMCA 2GN6A 1PZHA 5DP2A 2FPIA 4NU6A 1ZXLA 4I9HA 4EJ0A 1EK5A 1LDMA 1PWZA 4CLRA 4A0SA 4IS2A 3Q2KA 3L9XA 3AFNA 4IMRA 2E82A 5CG2A 3HQ4O 4J3FA 4MPDA 4DIBA 1VKNA 1KY5A 2QZ9A 4DPKA 1IY8A 3JQ7B 3F3SA 5IF3A 3ZW9A 3WYEA 3FNFA 2W8ZA 2QRLA 2Q2QA 2FY8A 2JAPA 2OOSA 2QIOA 1T2FA 3QW2A 3L9WA 4CQLA 5TNXA 2GYYA 3O4RA 4IDCA 3BXXA 5I8WA 1ZK3A 3AY3A 2OMEA 1ZO8A 1EVJA 4MIYA 4TQGA 3GMSA 1WDLA 3VH4A 2VOEA 4K9DA 1AHHA 1RYDA 3QVOA 3ZV5A 4DLBA 2VZ9A 4LISA 2TMDA 1LQUA 3AK4A 1I8TA 2VHZA 2F00A 2WM3A 4CUKA 3IL2A 2PWZA 2JCYA 3LC2O 5KOIA 4LCEA 4GLLA 1NNUA 1YL7A 2AG5A 2X58A 4HKTA 3VDRA 4XR9A 4YACA 2ZTMA 2P4QA 1K3TA 3ASVA 5A05A 1ISMA 1PS8A 1ZBQA 3CEAA 4PLYA 1XHLA 2CFCA 3CUKA 4J43A 1ADBA 4BO6A 4K1LA 4FR5A 4MVJP 2Y0CA 1NFFA 4CM3A 4IZHA 3N74A 3NYWA 4PGFA 3RUCA 1JAYA 1QYWA 5KVVA 1KOLA 3UF0A 3H9EO 4W7HA 5BSEA 5L45A 4R1TA 4DLLA 4R1UA 3TQHA 3GH3A 3TSCA 1HSZA 1YWGO 3FF4A 1PJ2A 3GG9A 1IOLA 2W2KA 4GL4A 4R54A 1GEGA 4BNKA 4M49A 3PGJA 1GDHA 3NKLA 3KM0A 3ZWNA 3PGXA 2P91A 1F17A 5LDGA 1K0UA 2R00A 3DBRB 2CF5A 4Q3EA 5L3ZA 1P44A 5IN5A 1DIBA 4N5MA 4XYMA 2C59A 1X7DA 1SMKA 3ETGA 3MJSA 2LDXA 1IL0A 1SAYA 1GZ6A 1V35A 4EITA 1ZH8A 4CM5A 1YB4A 4RVHA 3HDQA 5LC1A 1LC0A 3MOGA 4JBGA 1R4MA 2RH8A 2VWQA 1KIFA 3H4VA 3DTYA 1BVUA 1H6DA 4AFNA 1Z75A 3PJGA 2UAGA 2NWQA 4NI5A 4RLSA 5KNLA 4FJ2A 3DBLA 1KC3A 5FF9A 2PY6A 3KZVA 2YYYA 4GX2A 4OAQA 4FB5A 1PGOA 2J3IA 5CPBA 4TRRA 5B12A 5KVSA 3V2GA 4AJLA 5A4DA 1GADO 4FD3A 2J5QA 3R1IA 4HFNA 4YJFB 3MWDB 3DZJA 3P2OA 3NT4A 3A28A 4JLWA 1PX0A 1FDUA 4XJTA 1C0KA 3CMCO 1SB8A 4NJOA 1G1AA 4Q3CA 4JX8A 4G5HA 3WX0A 3MTJA 3DB2A 1P1KA 4QO7A 3LT4A 3WWYA 2WMDA 3PJDA 2JFHA 3HWRA 3KEQA 1E77A 4CLXA 2G1UA 2B37A 2X0IA 1WMBA 4LRTB 4R3NA 1PJ4A 3BTVA 4FFNA 5GZ6A 5A04A 3KRTA 1DAPA 1VSVA 2P68A 1J49A 4J1TA 3B1KA 1JKFA 1P45A 4BB5A 4HP8A 2VWGA 3SX2A 1AXEA 1HE2A 2FPPA 3FBGA 2X0NA 2AG8A 1Y6JA 4DUPA 4KP7A 3ZHXA 3H9QA 1I30A 1CEQA 3C7DB 3ONDA 1L7EA 3OJOA 4KTTE 1D7OA 1DB3A 1E1MA 3IKTA 1OOEA 1R16A 2QX7A 4IDBA 4XWYA 4L76A 5H81A 1MC4A 3A1NA 3RIHA 1IULA 2IYPA 1SCUA 1E7YA 3JQ9C 4E5MA 4BO1A 2C5EA 4MVJI 4A03A 3OHSX 1SBYA 1BG6A 2CVZA 5AXCA 3WMWA 5HBRA 4TVOA 2O50A 5C3MA 3PIIA 3NJ8A 3WSVA 5HS4A 3D64A 5C7LO 3V2HA 1Z45A 3HFSA 2Y1GA 3DZFA 4RLHA 5EJ2A 4CLOB 2FRDA 5A06A 1F14A 3K8ZA 3OF2A 3Q9UA 3KLMX 5U1PA 3O03A 1PR3A 3RU9A 4J7UA 5T67A 4GKVA 1HT0A 2R2GA 4UVIA 1E1KA 3WWZA 5AXDA 3ZWMA 4G2NA 1U5CA 4EGFA 3QA9A 4LMRA 3WGQA 2VOJA 1HXHA 2A9FA 2D8AA 4FFPA 4JIGA 4ND4A 2EW8A 4D0RA 1LLUA 3WGHA 1FDVA 3PHJA 3BAZA 3K2EA 1C0PA 4YRBA 3FR8A 3ANNA 1P1HA 2DUUA 3RJ5A 4P4LA 5ENDA 3GEMA 2DUWA 3JSAA 3E48A 1PS9A 2YHIB 2Y1EA 1QRRA 3GEGA 3MJEA 3OEYA 5LDHA 4ALJA 4NBWA 1ZK0A 1Z7BA 1BDBA 1ZNQO 3BMNB 4J16A 5A3JA 1W8DA 5HRUA 1Y9AA 3DMTC 1FJHA 4YBZA 1HE3A 3DONA 4Q9NA 4CM9D 5T5QA 4ZN6A 1YH3A 1E6UA 5A9SA 2B35A 2YDXA 3P5SA 5L7TA 3TZHA 1VLLA 2BFPA 1QV6A 3GGPA 4KWIA 4BMVA 2J8ZA 1UXIA 1ZK1A 4FSHA 4DC0A 1SO8A 3F5QA 4CMEA 5IFLA 4WCFA 1SB9A 2Q45A 3VKUA 2IEDA 1WLYA 1UDBA 5KCZA 3PYMA 3V5NA 3JD4A 4CM9A 1EZ4A 3LF2A 4ILKA 4TWRA 4E2ZA 1I32A 1NVMB 4XYLA 3GNQA 1PJLA 1R4NB 3FWZA 4KZPA 3GG2A 2O7QA 3I5MA 4XQGA 3KTDA 4DRYA 3NT2A 1DRWA 1JAXA 4NPCA 2FR1A 3GAFA 3KSZO 4D79A 4BO0A 1NWCA 1BVRA 4KQWA 1H94A 3IDSA 4XDZA 2X23A 3BA1A 2GCGA 3H3FA 4CJXA 3MJ4A 4MIOA 5ES3A 3KYCB 4GSKA 1P1IA 2C20A 4DGSA 1D1SA 1E3JA 3WBFA 2QYSA 3E18A 4RPKA 1DJNA 3U0BA 2HSDA 1WPQA 3RFTA 3DXFA 4NR0A 1EUCA 4HFJA 5JXWA 4L73A 1H9AA 3QIVA 4YAKA 1Y8RB 2O3SA 2DPGA 4Z0TA 4KUEA 2PZKA 1NHWA 1NPYA 1PZFA 3AUAA 2GN8A 3C8MA 1HLPA 3HSKA 4LW8A 4BQPA 1GYRA 3EK2A 4OYRA 2BD0A 1FF9A 1ZSYA 1I3KA 3F9IA 4RF5A 4L9RA 1OC2A 2VN8A 4WPGA 4YJFA 4DC1A 2AEMA 4GVLA 1C1XB 3W4KA 2UV8A 3E9MA 2HJSA 1H6CA 5T64A 1DDOA 1BDMA 3AUSA 1Y1PA 2V7PA 3RUDA 4WECA 2YV3A 4INAA 2Y1FA 1KVTA 5B4VA 2POQX 3FR7A 2W2LA 5EMHA 2PKRA 2ZCVA 1B0AA 3H8VA 3MCVA 1RKXA 2VQ3A 1YQXA 4CM4A 4EEZA 5I7SA 4D7AA 1F0YA 3QWIA 2Q1UA 3DEYX 5IDQA 2NQ8A 4MP8A 5AXAA 1CQIA 3CZMA 3FN4A 3OQ6A 2OBNA 2PZMA 3DBHA 4ALLA 3ZV4A 3D5QA 5KIAA 1UXJA 4WOKA 4XDYA 4IQGA 2VHVA 5DULA 5IDWA 5BR7A 3H3JA 3JQ9A 4ALMA 3IKVA 1XELA 1ENOA 3INRA 1Y5RA 1P0FA 4GMGA 3ADPA 5ADHA 3GHHA 2IXBA 3AFMA 4Z9YA 1KS9A 5JBIA 1WP4A 4N5LA 2BI8A 2EHDA 3BMCB 4BMNA 1LC3A 4JJFA 5CG1A 3FI9A 1JLLA 1U2DA 3H7AA 2I66A 3U09A 3IOYA 3G0OA 1QYCA 3MTGA 5IAAA 1KYQA 3ORFA 4AJEA 2WE8A 4HY3A 4E0BA 4GWKA 3H9GA 2EKPA 3M1LA 3TFQA 3V1YA 1BGVA 1DIGA 1PJCA 3PWSA 4Y6PA 4I9NA 1N8KA 1YOVB 1O6ZA 1HRDA 3FTPA 1MC5A 3GZNB 5TLSA 3NV9A 4WCDA 5U4QA 4GX0A 3LQFA 1U3UA 4IMPA 3NX4A 3MWEB 2PZJA 4OO3A 3PI7A 1HDZA 4ZQGA 3DAFA 1EQ2A 5CEFA 4IBOA 3RC1A 3U62A 4CL3A 3LT1A 2DU8A 3C3XA 2ZB3A 5B1YA 2RIRA 1SZJG 3D4NA 4CM8A 4J1SA 3JYPA 2X1HA 5H83A 2EJVA 4NK4A 5JE8A 2AQ8A 2GD1O 2VUUA 3C7AA 1MXFA 2ZQZA 3O38A 2B69A 3QWHA 1PWXA 4X54A 4RF2A 2YY7A 5COQA 3I6IA 1MA0A 1A9ZA 3HB4X 1DRVA 4IM7A 2Q99A 4CUJA 4A10A 3BHJA 4I5DA 3ZNPA 5JYEA 3O8QB 3UCFA 3BMNA 2A92A 3I9JA 4UUNA 2A35A 2GZ1A 3D3EA 4LCJA 4A73A 1J5PA 1EVYA 4ITUA 3I4CA 4BMSA 4CQLB 5DNAA 1F8GA 4BO3A 1MLDA 7ADHA 5I7FA 2EGGA 2JHFA 1E6EA 3PHHA 3SBOA 3NDJA 3JYQA 5IXYA 4Y6SA 1KERA 4XA8A 3OJLA 4G65A 1A5ZA 1BXKA 3WYCA 1KVUA 3OJ0A 4F46A 4EJMA 1DPGA 4DBZA 4CUZA 4CQMD 1N1GA 1T1RA 3F1LA 4NFHA 5TT1A 3G49A 3AI1A 3GVIA 4KDEA 3PHGA 1NX6A 3I9MA 3CMMA 5THQA 1V8BA 3BMOA 3FD8A 1QYVA 1R66A 1HYHA 4YQYA 1U8XX 2Q3EA 2VUSA 4ZGWA 1B14A 1O5IA 5I9NA 1HDCA 2P9CA 4CQMA 2EGHA 1Q7BA 1C1DB 2Y0EA 1VJTA 4N5NA 3PDJA 3RAJA 1NM5A 1DFGA 1GUZA 3ICPA 3S8MA 4WNIA 2J3HA 3DBVO 5K6AC 2J5KA 4NBUA 5THKA 1ULUA 2DBQA 4ZVVA 2E48A 2WD7A 5BQFA 4GVXA 2HK7A 5JAIA 1QV7A 3WSWA 1LLDA 4NFSA 1F8FA 1H0KA 1RM3A 1BWSA 5H82A 3P7MA 5DBGA 1GAEO 5JPIA 1VL6A 3W8EA 1UDCA 4R5HA 4W82A 4WASA 4R51A 4LSMA 1I10A 3HDJA 2DBVO 3QRWA 2BFAA 3RFVA 3WIEA 3ENKA 4Z3KA 2BELA 1PZEA 2H5LA 1E3LA 2CDBA 3E9NA 3HZZA 2PLAA 4XIYA 3GNTA 4ZHSA 5G2OA 2GZ3A 4J0FA 1C1XA 1R4MB 2D0IA 3H5NA 5F5NA 4AJPA 4RGBA 1PJTA 1YE3A 1PZGA 2ZTUA 4M87A 2BFOA 1A4UA 1ONPA 1G0OA 4PLVA 3DBLB 2X9GA 5A03A 3JYNA 3I9NA 3OBBA 1DIAA 4IPTA 2UYYA 5TIIA 4QECA 1GY8A 1GCUA 1UZLA 4F3YA 4Q3NA 3SVTA 1OI7A 5I7VA 5T8KA 3VVBA 3QLJA 5K0ZA 2JCVA 2C2XA 2WDZA 3EC7A 4YAJA 1E7MA 1GUYA 2B83A 3NJ4A 3JCZA 5EESA 1RM0A 3U4IA 1SNYA 1H2BA 2SCUA 4IS3A 4PLTA 3GN1A 4PZEA 4P22A 4LMPA 5CEJA 4J9UE 4D45A 3L4BA 3DHNA 5DOZA 1E7RA 2YJZA 3VHRA 4HADA 3V2UA 3U9LA 4FCCA 2ZCUA 4E31A 2ZK7A 1V6AA 3ZNNA 4MVJG 1YS4A 5ITWA 3PHLA 3GLQA 1KEVA 2EERA 2UUPA 4E2XA 1GYQA 1R37A 2EWMA 1W4ZA 3Q11A 4FFMA 2YZ7A 3LSYA 1LTHR 4FGWA 2XXBA 3BMCA 4NBTA 1UP4A 1P74A 2AE2A 2VT3A 3GHYA 4R01A 3ZDFA 3OIFA 1WMAA 2FHSA 3KV3O 3ON5A 4ID9A 4LSWA 1QLJA 5JAZA 3TFOA 1SEPA 1A4IA 1WZEA 4CM1A 2GASA 5DDIP 3VZPA 1P0CA 2BKAA 3GZNA 4J1QA 2I76A 3RBVA 2OORA 3JYLA 2NNLD 5IJZA 4PFJA 3E5MA 2Q4BA 4XKJA 1T1SA 4CR7A 3PXXA 4FIZA 2WEKA 4QO8A 1YQDA 4O63O 3INGA 4IINA 4DMLA 3GPDG 1Q7CA 4NK5A 3V1UA 5HWSA 2XAAA 3QWAA 3VKVA 5DZSA 4KDFA 4S3MA 4GKBA 4ALIA 3SLGA 3R0IA 3NGXA 2DAPA 3TPCA 1T2CA 1RPNA 1TB4A 3OQBA 3HFGA 4E21A 1P31A 4L0QA 1H9BA 4U0JA 1R0SA 3Q3CA 5ER9A 4WE3A 2VZ8A 4DREA 9LDBA 4WLUA 5ENVA 1EVZA 1YXMA 4RVFA 3JQBC 3LK7A 3NT5A 1X1TA 2VNAA 4PZCA 4AICA 3O8QA 2C0CA 3C24A 3ONFA 3RCBA 4NNJA 2C82A 4MP3A 1M6HA 2EKQA 1JN0A 1UZMA 3EGOA 2O4UX 2GN4A 1LSOA 1UH5A 4AJ4A 2CY0A 5A9RA 5JDIC 3PJFA 3RASA 1TXGA 3INTA 1YVEI 3HDHA 4TKLA 5CDTA 4YJGA 3TN7A 3A4VA 4W7IA 3DZIA 2IE0A 1ZUD1 2VRCD 4N7RA 1A72A 4UEOA 4CM7A 5JY6A 2QYTA 3FRJA 3KVOA 4H15A 4XX0A 1ZSVA 4B3HA 4EJ6A 1HE5A 1TI7A 1X13A 3S2IA 1TT7A 4B7CA 1NAIA 1ZFNA 1E1NA 1N5DA 1EMDA 1R6DA 4GLOA 2I3AA 4LGVA 2PA3A 2ZB4A 5A9SB 1LU9A 3HG7A 3EW7A 3ZW8A 1WAMA 1MGOA 2ZATA 3JQFC 1UR5A 3ZWBA 2VRCA 3K30A 1AUPA 3S2FA 1PR9A 2ZB8A 5JCXA 3NTRA 4H7PA 3UH1A 2YDYA 5JAMA 5KVCA 3RUAA 4IQ8A 4E5YA 2BI7A 4PN3A 4WCFB 4CMEC 2XPCA 4O1MA 4P8RA 1XIVA 4WCFC 3LF1A 1C1DA 3ROMA 4YDRA 2NM0A 5A5FA 4DYDA 5L40A 2ZTLA 3NRCA 2NU9A 4BUCA 5K6AA 1IB6A 1LSUA 4DLAA 2NU8A 3IS3A 3VPGA 3I23A 5CDUA 3TF5A 2D59A 4CV2A 2IEBA 1SPXA 3DTTA 1DJQA 4YEDA 4AG3A 2Y1OA 2Q46A 4MP6A 2PV7A 5FEUA 1R0KA 3EDMA 4RL6A 1SEVA 1BXGB 4IJKA 4RVUA 1PU2A 4DQVA 4C7KA 3ZU4A 3UFXA 4D43A 1XKQA 4DBVO 3PHIA 4CMHA 1JVSA 3T4XA 2Q1WA 1DXYA 1Y81A 2JAHA 1L7DA 1LSSA 2X9NA 2B4RO 2JD0A 3IP1A 1F12A 2EXXA 3EYWA 1ISIA 2VHWA 1RM4A 1YGYA 2D5CA 1NFQA 3WTBA 1VI2A 4QTZA 5ICSA 3HDYA 1O89A 4O0LA 4QXMA 5L7YA 3F47A 2YFHA 4YT2A 4UVGA 4YQZA 1IE3A 3Q0EA 1R0LA 2FPGA 2AE1A 4YYZA 3LDHA 4YA6A 4GBJA 1FDWA 4GX5A 1N9GA 3ADOA 4E12A 3R6DA 2BLLA 3JTMA 4YRDA 1LI4A 2EJWA 2HDHA 1FDSA 3IMFA 3FBTA 2OUIA 1KY4A 3DHYA 4MVJF 5G0UA 2Q1SA 3ABIA 1FDTA 3WGGA 1U4SA 2BRUA 3PQFA 5CPFA 4I5GA 1KBZA 1CQJA
chains in the Genus database with same CATH superfamily
4RABA 3I12A 5FWXB 2VDWB 3PD0A 3ESDA 4MPJA 3ORRA 4MQUA 1VPDA 4Q3DA 3ZI7A 4OGFA 1V7CA 3WYBA 3PK0A 3V7YA 1NJFA 5F7JA 3GFSA 2Y6UA 2R8PA 3N28A 1U28C 2H4WA 3KJFA 3UATA 2ZWPA 2CW5A 3IAAA 3DC7A 2R751 3OLCX 3HCEA 3DFUA 3OUTA 4OMUA 5JZSA 4BKUA 3H99A 2G1JA 1F9EA 2I65A 3UB2A 2RG1A 4W5JA 1ZVJA 3UTDA 1UC5B 1M2WA 1ZU5A 2FWBA 3QP9A 2QJFA 2RHGB 2KW5A 1YRBA 2CV1A 1HC7A 4DOMA 3IILA 5ALXA 3IAS1 4B48A 1UMCB 4TWZA 1SU6A 3VOTA 4ZCMA 1PL0A 1A77A 2WBLC 4MEJA 3GT7A 4ZAGA 2I7XA 3KXKA 2XLCA 2W2NA 2RBGA 4PC1A 2RB4A 2WJ6A 4XB1A 4NX2A 1A50B 2R84A 1P3DA 3VYUB 2ODBA 1UJBA 2FPOA 4PNHA 2AMVA 2WUDA 3TD2A 1H4VB 1SCBA 3RTAA 4DLYA 2JLVA 1N7GA 2G72A 4WK6A 4BC0A 1YMUA 4FKZA 3ZOZA 5I4IA 1YDHA 3SC6A 4L4SA 1MNQA 4ZA2A 2HQ1A 1YZQA 2GX6A 2L69A 4KIUA 3B13B 5EP4A 4ZT5A 1NJ1A 1T0BA 1W73A 1HE8B 4Y9DA 1L1FA 2O5VA 3NBFA 1T2EA 3SHVA 3AONB 2IBTA 2G17A 3LQ2A 1VHLA 3LZ6A 4H6XA 2P3LA 2QLFA 2YZGA 3TG2A 1CUWA 1E5QA 3C4JA 1GTSA 3E3AA 4UNIA 3DR5A 2G0TA 5DBFA 3P4UA 4WGGA 3QU4A 1X0VA 2G1KA 4O2BF 4PSVA 3HB7A 1EB8A 3DEHA 3JQBA 1LBSA 2XQKA 1H1LB 2GF2A 4JL8A 4FHCA 5EE0A 4RW0A 1USKA 5IAGA 2R4UA 2JFZA 1EP3B 4HQFA 5TJHA 4DQXA 2HMYB 1AX9A 1BXRB 1N2JA 2VK2A 1A4RA 2WVHA 3E2PA 2QSYA 1XVVA 3GCDA 3FCYA 1BROA 2PPVA 2WFLB 3BDIA 3IGFA 1SUFA 4G97A 2JVKA 2Q49A 3NHRA 3A1VA 2Z6AA 1YZ3A 3ONVA 4CIDA 3T06B 1EFCA 2Z1DA 1ARZA 5A6VA 1O3YA 5FB3A 2LCQA 5B2FA 1V3QE 5JDIA 3I6MA 1FP6A 3E9CA 4DJFC 5BSRA 2VJBA 1FYXA 1KPIA 4JUCA 3DMDA 5DLYA 3MCUA 4Y1FA 4BPRA 1VZ2A 4LQ4A 3U44B 1EUZA 1EGAA 5DHQA 5EWJA 3QMVA 2CNDA 1C3OB 1ZIPA 2V7GA 3RVQA 1EYZA 5B36A 1FX1A 4XIJA 5BW4A 2REOA 4FLFA 1STOA 2VNKA 2XX3A 4CWAA 1UC9A 1E0SA 2IYWA 4DV7B 4D9FA 4PBTA 2DHEA 3W34A 3K1YA 2DSTA 5UKDA 5IAEA 1XQ1A 4JK3A 1QX4A 3FLMA 4TV8A 4B3GA 1UPUA 4Y7DA 3K32A 4KV9A 2O1XA 3DZGA 3E7DA 1FNCA 2BISA 3FAZA 2XT0A 4P81A 1A82A 1SM4A 1EFDN 3VR0A 2BDEA 2O3RA 1H22A 2MDTA 2RC5A 2NX2A 2GEKA 1C7QA 3JQ8A 3RYIB 4GPTA 2B4QA 3N3BC 1IQPA 3SQNA 3NBQA 1FQWA 4DLXA 3ZDBA 3U4AA 3FMFA 1X7ZB 1CUCA 4Q21A 2YN4A 4P08A 1EFKA 2DFNA 4HQKA 1XYGA 2A9QA 4OIMA 4ZAFA 3U3RA 7YASA 1J0XO 2DLNA 3PF9A 2D06A 2F64A 4QXRA 2QN1A 1UOEA 2FEAA 2WOJA 4DJAA 1YJQA 1LCIA 2H2HA 2VWPA 3GJ4A 2WJJA 5DM4A 2WF8A 2HBYA 4F04A 5F5LA 4C2BA 1SUBA 5HQ3A 2DVMA 1HL7A 2UUOA 1NBMA 2C29D 5PGMA 4BVJA 4YALA 4GXNA 5HTOA 3SC3A 1M1ZA 2IP4A 4HV4A 4UARA 5J2TF 4U7JA 2X5NA 1L8OA 3T9AA 5KBYA 5AR1A 1XDGA 4OL0A 3TL2A 3OE1A 3CXRA 3K70D 1ORVA 2OAP1 3GI1A 3PLNA 1HLDA 1HNZB 1EZ1A 2FFBA 3QNMA 4RKRA 5ER6A 2ZWVA 4RTSA 5D87A 3RFXA 3P0JA 3LV8A 2I6TA 3C1TA 4O4IB 1GAXA 2NSLA 5FLKA 2RGXA 1NP3A 1T0HB 5BW5A 2Z56A 3OQOA 2WV9A 3M6MD 4C76A 2P30A 5B5SA 2I03A 3EQ9A 1C7ZA 4MKGA 5TQJA 1O94A 5J4VA 2IEGA 3OU2A 2JPDA 3F2IA 2G08A 2I6UA 3WC4A 3X1JA 1WZ2A 4FONA 5JRDS 2I9KA 1ST3A 2W6ID 3A6KA 4DHWA 4L8FA 1U8YA 3EIQA 3EZYA 5L3QB 5IKPA 2XNSA 4TTVA 1YFLA 1JYSA 1VYTA 4KJXA 1VP3A 3IR6A 3D5EA 3H2HA 4PLWA 4BNIA 1Z18A 2NPIA 1B15A 3AL3A 1KZ1A 4ZT3A 5SZKB 5KYWA 2IU4A 3PKIA 3FLEA 4H17A 4Q9AA 5K20A 4RTMA 2B20A 1U0TA 3RUEA 3THWA 4Y6LA 3IC5A 3EDOA 4XSHA 2XB6A 2IIQA 1F4LA 1KZ4A 2P5TB 1YS1X 1KMMA 2WSSA 1PSZA 1XTKA 3IFSA 4RK1A 3WFIA 3ZU5A 3P45A 3GDGA 3MC1A 1J8FA 4K6KA 4DRZA 4W1SA 1N0VC 3HADA 3QVLA 2C99A 2AI3A 2C7GA 3VC2A 4DVGA 5EIAA 2F4NA 4RZHA 2VP5A 3EZ7A 2ZUDA 3I1JA 2GDZA 1OQAA 1NMXA 1MOPA 2J09A 3W8DA 3L7BA 2H4JA 3TMKA 2HSZA 2WHPB 1MC8A 3N7AA 4OU5A 5ERGB 3UUGA 5IN4A 1RQRA 1RLUA 2VDWA 3BGVA 4RMIA 5E6RB 3PYXA 4RETA 4AZ0B 4UE3S 5DI3A 2WE7A 5T8KC 2ZW9A 1FBNA 2FF5A 1EVEA 1R0RE 3HB1A 1NFRA 3N8DA 3DL7A 4OXNA 4YTEA 2IEIA 4B7UA 3PP8A 2HADA 2ASVA 1MQAA 3JVIA 5CLJA 2FWNA 3TZ6A 1JPUA 2R6DA 3R23A 4KRYA 2Q9BA 3WK9A 1VLMA 2GD0A 4RVNA 5EJ4A 2NUBA 4N40A 1EFLA 4L5YA 1YFJA 1JW9B 3PX7A 2JIQA 3G6WA 4NWIA 3DYIA 4IX1A 4PYOA 4FOSA 3PUZA 3NHYA 1UMCA 1DAIA 1QQ5A 3KO8A 3IEVA 4JA0A 2QXUA 4EVRA 3MD9A 2ZYAA 1SCQA 2XF8A 4RLQA 3N2IA 2YJTD 1QDLB 4L08A 1XCMA 4OQQA 1PSDA 4IIDA 1B3RA 4NULA 2OVFA 5JMPA 3TEFA 3ZI4A 3E1KA 1QP7A 1M1XB 3AF2A 3MPOA 4X7PA 5JJCA 3EXG2 1ZUNA 1TM1E 2VQ6A 1VGQA 2QX6A 1UBMS 3OM0A 4ISCA 2QZSA 3AI2A 1RRGA 3QBEA 2VTEA 4NYJQ 4UUPA 3FLBA 3VZQA 1UBHS 1KMCA 4J0EA 3Q1LA 1T6ZA 3KOZA 4Q4JA 2JH8A 4FZRA 2OO5A 1RPAA 2ENWA 2RG7A 3UQZA 4HLCA 1KEZA 4BECA 1GKIA 2RHCA 4PYIA 3RHFA 3QFTA 3T35A 5CTAA 5A6SA 2SKCA 2Z2YA 1GTL1 1Q21A 3UWMA 5F7OA 4Z3DA 5K3AA 2FSSA 2ZJ1A 3FJ1A 3K1JA 3V4FA 4XQCA 1H1LA 1JHYA 1DMSA 1ZVKA 3AGPA 2ZUBA 1KP9A 4L4YA 4BBAA 3F4KA 2O8CB 5BSWA 4J2TA 3WKCA 5GGYA 4TS3A 1BXRA 5JV5A 1RBQA 2B5WA 1HZZA 3V00A 3OA0A 3PENA 2VJKA 1T1IA 2QIPA 2P2DA 3FFAA 3P32A 4MAFA 4AJIA 4WA8A 5KCMA 5H59A 5KKAA 4DR2B 1TTQB 3GA7A 5PNTA 1YL5A 2ID4A 5MDHA 3H65A 5AKIA 4KDCA 1G6Q1 3BL6A 3F5SA 1SOUA 1I24A 4MQ6A 1XTPA 4Z4FA 5K3EA 4PLFA 3EXFA 4CYMA 3B9PA 2KE5A 1C3OA 3H2YA 3W2TA 5B3LA 3A2KA 1ZI9A 4HJXA 2IE8A 2YV1A 2ANCA 3ZDQA 1ONOA 2FGKA 4W6QA 2BSQA 4JYAB 2VA8A 4FR2A 1L8XA 4R41A 1ZL2A 4EATA 3H9JA 2WPDD 4JUBA 2GBPA 3PWKA 4J4HA 1RKBA 4JCOA 1EE2A 5F33A 2M2IA 4BO8A 1T13A 3UCXA 4M0FA 2CLCX 4JBHA 4K6OA 4K9SA 5HF5A 5KDDA 1T3HA 4RMGA 4BLPA 3BHNA 2BFMA 5CDHA 2BHNA 4JJKA 1FFDA 1MOQA 3IP7A 1QG0A 3RTDA 3OIYA 4YJGB 2VYCA 3CHYA 3VMMA 1NRXA 1FUYB 1XN1A 1VCOA 3L92A 1DOHA 3MM4A 4HSGA 3GFVA 2GN9A 2WJWA 2WD9A 3NHAA 3I0ZA 1LDEA 1GCIA 3QOWA 2OB2A 4XX0B 1NR1A 2XMBA 1AZLA 4ZTUB 1E0AA 1QAMA 3AF6A 1NR7A 1RI2A 2Q6VA 1GTVA 1XPOA 3A1SA 4OHBA 1QH1B 4AJJA 2Q7OE 3ABSB 4HG2A 2HK9A 1X80B 3KVYA 4OQPA 4CR6A 1TRHA 4JASB 2Q29A 4BX8A 2PX2A 2XUIA 1DAOA 3EMDA 3IAHA 4OMCA 4URUR 1JALA 3W5DA 5A1JA 2CXHA 1FQKA 3GUZA 4TS9A 2I34A 1IJEA 1PJ3A 1A8IA 1Y3IA 5CH5A 2XZLA 2YFYA 2YASA 3KQSA 1E2KA 2OAQ1 4KWTA 3JARB 1Q1ZA 4XGIA 1UK7A 1Z5NA 1JYFA 1D8AA 2GO7A 3OI7A 4FNMA 4NU5A 4QWWA 3WRXA 2C8KA 4DVJA 2NU9B 5KOHB 5JJIA 3EZ6A 4YT5A 1JHAA 4Y2RA 1JPJA 4WBXC 1W5EA 3ELBA 5BNWA 3FFXA 2HMUA 1O5TA 1GCAA 2ZB2A 1I7QB 1I36A 5F2OA 1JIUA 5IZCC 5I9IA 3I01A 3IJPA 5EXEA 1CUUA 1AKRA 2WHXA 1K27A 4JU8A 3ZZNA 3IBCA 4NFLA 2O48X 3REGA 5JNLA 3D54D 2QX9A 3QYJA 2QT9A 1WKBA 4ARVA 1W0JD 4N6NA 1E9SA 1RWPA 1K8QA 1RBMA 3HEBA 5EWMA 3UIEA 3NIWA 5L3QA 3HDGA 2PNFA 1ECBA 1YT5A 2PHZA 5ULLA 4F3RA 3RC8A 3AKCA 1SCIA 2P2SA 5KX5A 4WINA 2NVUA 4E5NA 2XJ4A 1OLOA 3O92A 3W6UA 4MRPA 1WY5A 1CRZA 1CE8A 2EG5A 2GH1A 4QRHA 3WL5A 3ZX5A 2GJ9A 4HMQA 4F8YA 4W1QA 3PF8A 4G81A 4B2YA 2EBUA 3BXZA 3A6JA 1EINA 1DQYA 2L2QA 3ZWPA 4L4XA 3RADC 1EXDA 1NJ6A 3IA2A 3OJWA 5TDHA 3O1LA 1D2EA 1XPRA 3VJRA 1U11A 4L8WB 4O5OA 3M83A 3D1LA 1O4VA 1DWPA 1SVLA 4UAGA 3TO5A 2REXB 4E5KA 1O58A 4I2NA 4CTOA 2XUPA 4QE3A 4TKUB 1X94A 3TQCA 4V0OA 2ZQYA 5E6RA 4F5DA 5I7UA 1TQHA 1RWBA 3U48A 2OWEA 4A92A 5C2JB 1I4LD 1RAGA 3M3DA 3HXKA 3T1VA 4YAFA 4B3SB 1DBWA 2QD4A 5D1NA 3CVYA 1A71A 1ZGCA 4YAWA 4PEVA 5M34A 2PMDA 1T3SA 1R0XA 3FF1A 3MZ0A 4RQTA 4BWGA 2HO4A 5CB8A 2BZGA 2B5VA 4JP3A 1OGJA 3BZUA 3ICCA 6LDHA 1P7CA 3KU4A 2P9HA 3EPHA 1QYXA 2QTVA 1YCDA 4M8NE 4NENB 1HO3A 2A5LA 5DF1A 2NTJA 5EZ6B 5FPKA 2NYVA 1JR3D 1HYBA 4NDNE 1E64A 3CF4A 4M9RA 1NI4B 4B3XA 2V1UA 2PZBA 3TSZA 3KU1A 1TM7E 1EX1A 4ZO6A 2PL5A 3DOIA 4TMKA 4FHFA 3HNRA 3QFRA 5JAUA 1Z5ZA 2UKDA 1OLXB 1P1JA 5EJMA 5HFJA 3ROTA 3KQQA 4IGAA 5IK2A 2Z2ZA 1ZVMA 4QC2A 2HRZA 4ZZ2A 2A4MA 3BXEA 2WU1A 4TTAA 1X8XA 4OLHA 3R0VA 2FCAA 4U2GA 1CJKC 3ZHBA 1WD5A 2NT3A 4AK9A 5B7QA 1JHRA 3L0PA 2C1XA 4WRRA 5FWNA 1SKBA 4LHVA 1E7QA 3JD0A 1SC9A 2DWCA 2YJGA 1YB6A 3N8GA 5DTIA 1BN7A 2CFTA 3PD1A 5TGZA 2UYOA 4Q03A 1IPFA 3G8CA 3SJUA 3WRWA 3OWOA 4EJ2A 1ECPA 1HDGO 2MR6A 3HXPA 4OIFA 4C07A 3LFTA 4EW6A 1UDAA 2VK1A 2ZCJA 3G0HA 1UP6A 4EH1A 1UAGA 1DG9A 1KFKB 1P1CA 1Y9DA 1CUAA 2MU1A 5FKJA 4TZTA 1V2GA 2C1EA 4ECAA 1UXOA 4ETNA 3GFGA 1B8PA 4O2RA 3ESCA 3W5AA 2O8CA 1HFKA 3G0DA 3CLSC 3PIDA 3BWDD 5BRJA 2EGUA 1DC5A 1I2BA 3SCZA 4R8RA 3RS9A 3R5FA 2JAOA 3D81A 4KHZA 4MKHA 3A4NA 4I4IA 4GOJA 2BBTA 2OQIA 1EE1A 2V1XA 2ZANA 4HB4A 4LRSB 1KH2A 1NTRA 5CFLA 3KWLA 4A8JB 5SYMA 2HCJB 1W4LA 2IELA 1A8QA 3P19A 4TL6A 4U6SA 1QHYA 2VEDA 3TQRA 1V96A 2WV7A 2PUWA 3PUKA 1J39A 1RE0A 4Z53A 4EX6A 3RVDA 2BZSA 3GDOA 1XTIA 4EELA 1QG4A 3KPWA 2G9RA 3A6ZA 4Z9BA 2P3QA 3G1TA 3R41A 4OXQA 4XPZA 5EXSA 4GEKA 3HEMA 4A0HA 4CMKA 2J9RA 4S1WA 4DXHA 3H9UA 3WIVA 5GONA 1A8SA 1C30A 3AOEA 2HIGA 3RREA 2FOIA 2O3TA 1N7IA 1Z08A 3IPRA 3VPCA 1SUCA 1FMFA 1SBIA 4DTIA 3F4LA 1PI3A 5J47A 3WJ2A 4V3BA 5GAJA 1XTJA 1F1JA 3E7XA 5HM8A 3CH6A 4BLVA 3NBKA 1MDBA 4XQEA 5HYVA 1I6KA 4N9QA 1K88A 4P34A 4N03A 4XFKA 1NWHA 3EAQA 1FNDA 2E6KA 1EB9A 3AF3A 2PM8A 4OFZA 1PCXA 4RZUA 2C3UA 2C42A 2Z5VA 3HU3A 3LUAA 5BOSA 1WD7A 3GJ7A 3HB5X 2YZKA 1ZH2A 5D86A 4QNNA 4W9RA 4WLFA 2CNKA 1H8HD 2J67A 3GQBB 3WLNA 4BVAA 4M9QA 4BO4A 4XYEA 4XJXA 5LQAA 3H84A 3AF4A 1ZSNA 2G9QA 4Y3UA 1WXHA 1QRDA 5ILOA 3EGCA 2P9JA 1U8FO 2F43B 3VYWA 1SUIA 4HLDA 1GSOA 4UTOA 4JNCA 1S8OA 3OLWA 1L7RA 3GNLA 4EY6A 2R60A 3IRUA 2YYSA 2AOTB 3BRWD 1S89A 3KOXA 4IV5A 2KPOA 4N76A 4F7DA 1GZDA 1T91A 5T6BA 5IJ9A 2GZAA 4BWVA 3I04A 2ORWA 4KIGA 4KAJA 2HMAA 3M6UA 5DNUA 3HZRA 3BMQB 5CT5A 1UAYA 4UAUA 5D3MA 4KN8A 5C8DA 4BS9A 4DUGD 1GL7A 1NTOA 4YRCA 3WAGA 3KYIB 4H9GA 3L1UA 3H5AA 3HBNA 1CFJA 2ONZA 1C5KA 5EQTA 2CC2A 5ALUA 1W9MA 1A27A 3QTTA 4GAEA 4F6RB 1DARA 1U3DA 2VNSA 2ZRBA 3MJTA 4FSDA 4YP5A 1C29B 1MHTA 4RLFA 2ZDGA 1BHQ1 3A37A 2GZHA 3L06A 5HVNA 3EXIB 2I4NA 3CT6A 3Q5EA 1CKEA 3KEFA 4GQAA 2I1WA 2WY2D 1I3OA 4JGIA 2JB9A 5J63A 2ATCA 5A5VA 3UN1A 4KGXA 1LDNA 1VJ5A 3ROEA 3ZGYA 3LW7A 3CVVA 1F0KA 1HBJA 2FMUA 4MUAA 5ESXA 5FWDA 3B3AA 2X7JA 3GV0A 1PJZA 2ZUCA 3D8BA 3OPXA 1W5TA 2QW0X 1EFAA 5HIIA 5EIFA 2B9EA 3PR1A 2D7DA 3OQHA 3IIIA 4G0MA 1K98A 1H42A 5EHNA 4QYTA 3TLBA 3ZNQA 1DXHA 3WL8A 1HOTA 1GZ3A 4Q1CA 1Z6YA 2QE6A 3GLUA 4QOJA 4RDCA 1K6XA 1G21B 1I3CA 4YLGA 2VAVA 1MJHA 5E7IA 1L8QA 4P0PB 5KWVA 1IAVA 3UCEA 2IU6A 2XGSA 4L5AA 2J0UB 1S2LA 5IBQA 2SBTA 3Q9NA 4WBNB 3NHLA 1QYDA 2C3YA 2WT8A 3KKOA 1C9MA 1TZMA 4FKBA 4LS3A 5EEGA 2XWJI 3PKJA 3U2QA 1C0EA 3BTSA 3BD9A 5LZ9A 1NYRA 2AG1A 3A3PA 3E82A 5AQ1A 2FF7A 1W2GA 2FWMX 1T5HX 2XVAA 4B3TB 3Q2IA 1OI4A 1P2GA 3H2IA 4IY1A 5D7NA 3K20A 4NENA 3DE6X 3K0SA 2F1OA 1RAEA 4NEGA 3WR5A 1AQUA 1EKXA 1I9CA 4RHCA 1TK3A 1ZUHA 1QG6A 3DVRX 3N6XA 3OAAA 3WWOA 1U02A 4BNJA 5JS1A 2BJWA 5FUBA 4RGQA 4BLUA 1PK7A 1JIIA 2FSFA 2CD9A 4WXEA 2TYSB 2W11A 1QGAA 1SIWA 5CYOA 3RFFA 4DA9A 2FEKA 2GR9A 3PT5A 4CMIA 3R9XB 2VLBA 4EGCB 3DDWA 3GUHA 5LB4A 2QSUA 3TB6A 2B7BA 2CJFA 3DTNA 3LA6A 4ODIA 1YS9A 4LZJA 4C5BA 2QUBA 3T9DA 3KKPA 1AVTA 3OE5A 1N5LA 3CLSD 3OZDA 3ZCQA 4UBKA 1D07A 1R9MA 1N9KA 3HKBA 4UTZA 3Q10A 2Q6IA 3D7KA 1JVBA 3L7YA 2GT1A 1L0BA 4HXEB 4AULA 1PQUA 3MHTA 2GSDA 3KXLA 5JS7A 1G2PA 2X4LA 1GTRA 4MLCA 2GWHA 1LVGA 4JI3B 4KK4A 1SUPA 2AMFA 2FFHA 1G5RA 4FGJA 3LTNC 1WPRA 2H4XA 2JKYA 4P2BA 4KKXB 2WKQA 2E0IA 2CFOA 3L1VA 1L5KA 2OSVA 1PJSA 2FZ5A 2GEFA 2PANA 1WF3A 2C5HA 2A5GA 2FZGA 2QR5A 4TTQA 4NV0A 1VPVA 4X3CA 5CD9A 1GG2A 3R6WA 4XR4A 5D7BA 3EVDA 1T4MA 3AETA 3CRNA 2FFRA 4FQ7A 4DE5A 3VR3D 4BNGA 3SF0A 5CB4B 2VHCA 2XHZA 4K28A 1NT4A 4ZCSA 4NP6A 4Q4LA 3DF9A 2QU7A 1O6FA 2P2CA 1FNBA 2PV0A 3KZNA 4I66A 4UZFA 5E7JA 3EGIA 3T7EA 1YOBA 4A8JA 3T1NA 3V34A 4QGBA 5JD6A 3AKZA 4KRXA 4ZT2A 3FDZA 4RXTA 2I4LA 5C4MA 4RH3A 2XYVA 2W37A 3D3KA 1NZJA 5EKSA 5H3CA 4CR8A 3DLCA 1QB8A 4LJ4A 2QQEA 4Z4QA 4FGSA 4ND2A 3AF0A 4BCCA 4CKBB 2PUEA 1PGPA 1G8KA 3N58A 3OSUA 4G2TA 1E2HA 1HL3A 1SBHA 2BGKA 2F8TA 2Q9CA 4DABA 3K92A 3EVCA 3HNPA 3KLPX 3X2EA 3PFGA 3I2KA 2IPMA 1YZTA 4OXYA 4YQFA 3RWBA 4ZZ3A 3DVAB 4ETMA 5JQGA 4HB2A 4MS4B 4IDHA 2C8LA 1TQ4A 2E4VA 4J76A 4OD0A 3NPMA 5JS2A 1E3TA 4H31A 3GGSA 4UHJA 5DWQA 4YJHB 1SVNA 5IG2A 4JLOA 4G5RA 1U90A 3NWOA 1I01A 1MORA 2KJQA 4YCAA 2NTNA 3T9FA 4O3MA 4L8LA 5LZ2A 2DJ5A 5JNTA 1ZJ5A 4NATA 2I71A 3AYXB 3BHIA 3QG1A 5DHSA 5FV7A 5JBNA 4B3IA 3HCBA 1KJIA 2IU3A 1K89A 3QPUA 3VC3A 5AUNB 5FDFA 2E4ZA 1I94B 4KXYA 3M4ZA 3T38A 3PEUA 2E6UX 5IXSA 1Z7EA 1FLVA 9MHTA 1DBQA 2VTBB 2JVJA 1KOJA 5FBKA 3SEFA 3KP1A 1MAHA 1UADA 4BLWA 1G2OA 3DEFA 1PEAA 3FVWA 3U7GA 2GAFA 4ZCQA 3RS4A 2GARA 1HSOA 2R96A 2V58A 3GVCA 1H5UA 4PRLA 3SZMA 2CUKA 5E3HA 4DIOA 1XXHE 2YZ2A 3BIJA 4LN1A 3O74A 5BNTA 2VAPA 5DTQA 2ODPA 1F3LA 1XMSA 3T3IA 5L4NA 5CHEA 1KO4A 4BLRA 5EZYB 3E5HA 4FEGA 4P80A 1HE1C 4L6CA 5K1ZA 1ZOSA 3BXPA 2PRSA 4RORA 5LQNA 2VCEA 4MINA 5DMHA 1YAJA 5AVYA 4LK3A 4PLZA 2A5JA 1PFVA 3BMQA 4RESA 3AVVA 4E2YA 2IUEA 3AIOA 4DC9A 2D1YA 3OZRA 2XDQB 4I6EA 1LS6A 2FN8A 3O82A 4GOLD 2CF6A 2JIMA 4EUFA 3WIDA 1E0DA 4MGIR 4PX3A 4LSZA 4CXMA 1A04A 4D44A 4DIDA 4E5DA 3TRKA 4EZEA 1E61A 1KARA 3FPFA 4K1XA 2HJRA 3F6CA 3ZDEA 3KETA 1OFUA 4FNGA 1YQGA 1RFGE 2TECE 5D2CA 2PT5A 4EZIA 5HOQA 3R0XA 5CFZA 2I4MA 4EI7A 2AX3A 5IZ4A 1XQYA 3U37A 4YT8A 3WAJA 3AM1A 4G25A 2XA1A 3CEMA 4Z8YA 4XLLA 4ZT6A 4B40A 2ZP1A 4Z54A 4PHFA 4QDKA 3AGQA 2O9JA 1AMOA 3L4EA 3ZI0A 3CO5A 2QJRA 1H5QA 3ICQB 2XZPA 2XUHA 4KUGA 2O5RA 2I2XB 2ALJA 4HAZA 1NUTA 3RRJA 3VI3B 4HTFB 4LJAA 4BMPB 1T8TA 2JI7A 1XU4A 3D6MA 1E2MA 3LUKA 3P0IA 2REBA 4IDDA 4IDAA 5DN9A 1X7GA 5IC5A 3TW6A 5ITVA 1N32B 4K6FA 1CBUA 4MW6A 4RIHA 4ENVA 3HP7A 2PR2A 4DM7A 1HDEA 4NZPA 3V32A 5IT0A 2N46A 2XUOA 1MVLA 4PZDA 5ALVA 2I8LA 1JB1A 4KOEC 2QM3A 3ITKA 4UPDA 4LNUB 4R40A 4D56A 5C1PA 3GWZA 2LNDA 4QPJC 5HRCA 1ABEA 1VA5A 5E8RA 4HWKA 2P78A 4YRNA 3GMTA 1C9EA 2RHJA 4BO7A 4OHYA 4ZOLF 2IK8A 2AK2A 2GZ2A 4TTSA 5FL7A 2X8LA 4Y2TA 4D5EA 4W1PA 2W93A 3M2PA 3ZTTA 4NEHB 4DQKA 3HNOA 4BJ3A 3RLIA 3QKWA 2ECOA 5DLEA 1E1LA 4RM2A 5ALGA 5K0NA 5LQSA 1VKZA 3E84A 2Z3ZA 1DC6A 4YP9A 4FFLA 2JGIA 2Z3WA 4Q39A 5FD8A 5HF6A 2H48A 2IHZA 3MWDA 1IN5A 1F6WA 2UU9B 4KXLA 1KAGA 2HHAA 1W46A 4RACA 5REQB 1GL9B 2HZ7A 3M4YA 3VO2A 3D3NA 2CXOA 4I1UA 5ICFA 5EXPA 4Q7JB 3FJYA 4CL8A 2FLWA 3F3MA 2HX1A 4A0QA 5LKAA 3AERB 3KLBA 1KK2A 1J7JA 4MWZA 2H1SA 1G291 2QE7A 3ZDDA 4NTZA 3FYHA 5F2KA 1E3SA 1UMDA 1ZJWA 2AYXA 2PKYX 2BDTA 3SHTA 5GMOA 5ALEA 5HJ2A 3WLAA 3ZE1B 1L4UA 1C4KA 2NLOA 5JXJA 1X1QA 2SNIE 3FSGA 3AJEA 4NOKA 2EIHA 5ESWA 1Z0ZA 3A9TA 1A7AA 4LA4A 1ZM4A 2IOQA 3WJAA 3U4GA 3NWJA 1TT5B 3M9LA 2J6HA 3SY8A 1SHTX 4X00A 4ALKA 2GBLA 3N76A 3AZPA 4JB8A 1E2DA 1G3RA 1NMYA 2EP8A 5K6TA 3VISA 4LF4B 3WLJA 2WHQA 1E62A 3N9IA 3P2EA 4XD7A 4ZXPA 1M8GA 2C5AA 1H2AS 3IVCA 3O94A 4YCCA 3OZTA 3TX2A 3X44A 1CUYA 2A6PA 1YDFA 1VKOA 5CB4A 1N2OA 4CG0A 4R1NA 2QF7A 3SFVA 2CLHB 4AZWA 1BE1A 4Q9HA 1WR8A 3HY4A 1KORA 1U3WA 2UVPA 5JISA 4XUEA 2NPFA 2DHDA 1WNTA 4D9EA 1XD9A 3PS9A 1YULA 1UBTS 4RCZA 1QE5A 2PGDA 2OAGA 3JQCA 1RD4A 1X15A 1E5XA 3L5OA 3BSWA 4XD2A 4YWJA 3X1WA 5CDSA 4WA7A 4D1YA 5CX1B 1KJWA 2PUVA 2LCFA 3OM9A 4ENSA 4CLOA 4DV6B 2WG0A 4GNRA 3UJ3X 4V0RA 4ZI7B 1R0ZA 5BT9A 3TR6A 1G2QA 1ZVQA 4HS4A 3I9OA 2UYHA 1YB5A 1M66A 4I55A 3RI3A 2RJNA 4BAGA 4C9BA 5AVKA 1BSVA 1IYZA 2NT4A 4BNTA 4XTCS 4DG9A 2H4HA 3WGLA 3EEBA 1I3MA 3BTUA 2TSYB 2I3GA 2X6RA 3LECA 3EH1A 3TUJC 1R8QA 1GRRA 1SXGA 4DMKA 5B58C 4KGDA 4BJ5A 2NVBA 2PPLA 1VL5A 5MGBA 2FDXA 1Q5PA 4NCNA 5JO9A 2GERA 2Q5QA 3E5RA 4L5CA 4EA9A 4X45A 5DX0A 4ERXA 4GWGA 2DTDA 1U0JA 4YRJA 4Z51A 2V3CC 1DKPA 1EDOA 3UK6A 4TYYA 1HT1E 3QVVA 2CFIA 1P6QA 4AKTA 1XZKA 1D6JA 1NBOA 3C3BA 4M36A 5TRTA 3ZCRA 4LBZA 4B09A 2PD4A 4G0OA 3FWKA 4U0KA 4GUDA 2FSVC 1BOOA 2R6GA 5MFPA 1W36D 4G9BA 3RRMA 1E96A 4EEXA 4ETWA 3O8DA 1EVKA 2CZGA 3DE3X 4HWPA 2RGGA 1VMDA 4GNKA 4IHJB 4JAVC 1U7UA 4HPXB 4QUAA 1KYIA 1L4EA 3NQ41 4K87A 3RW9A 3V97A 4EX7A 1EVIA 4XOIA 4C88A 1GR0A 3L0CA 4GGOA 5L4LA 2X1LA 4TZ0A 4PC3A 3RKUA 4DR7B 1RRFA 3Q6IA 2HSJA 1SK8A 1Z73A 1VSTA 4QXPA 3TLXA 2J9GA 1TYCA 3VR2D 4UUBA 1S6YA 2QM0A 3URMA 2Q8QA 1RI1A 4V3CA 3OZVA 2P2YA 4AY5A 3NOOA 3SJBA 3GCZA 1OASA 2IF0A 3R3YA 1C3VA 1Z4KA 2O4CA 2ZITA 2GKOA 1GYPA 2K87A 5EUMA 4OHRA 2P5UA 4HDQB 1SXJC 4I81A 1UJ5A 2ZS8A 5IAKA 3GLIB 4CLEA 1NJ2A 4MA5A 1DBVO 4WNYA 1B26A 1BE8A 5HCIA 5A9TA 3WV5A 3W0LB 1YJBA 4RA9B 2CE2X 4PY2A 4A23A 3TG8A 3W04A 3FMPB 3FWHA 5CHYA 1U1FA 2HJHA 4EIWA 2VPQA 4XASA 2JLQA 3C1AA 4TRJA 4XUGB 3D4PA 2OD9A 3TLKA 3DCJA 3TRIA 1U1IA 1T9GR 4KQFA 2BGMA 3AUXA 4Q4HB 1T5TA 1D3AA 2YV2A 3T4EA 5JCJA 5HSGA 4OKIA 1HK7A 1OWPA 3MTQA 4QBKA 2X1MA 2JJYA 4S2EA 2VKQA 4NMHA 4JVSB 4X9XA 4NYIQ 2CVOA 2JFOA 1QB7A 2R5NA 4WNAA 1DAHA 1TF5A 2PQMA 3CNQS 4CT5A 4TYMA 4N18A 4J03A 3QUTA 3UXYA 2ZIAA 4RHXA 3U60B 5DT9A 4QJIA 1FJXA 4G8CA 4F6CA 2WK1A 4BC1A 4D4KA 1UEXC 1M7GA 2SKEA 4RCYA 3AHEA 4U63A 4JL5A 1JFFA 3H6HA 4IDGA 2GNPA 1V3UA 2CKDA 2HD4A 3H9CA 3AM3A 3AY6A 5IJ0A 1HE4A 2G6BA 3FZQA 4I3GA 5BVGA 2AL7A 1WV0A 1SQGA 3FPGA 4JQZA 3E22A 5DB4A 3AEQA 5JARA 3QX3A 3U13A 1K8YB 2WIAA 3JWHA 4YV0A 4UASA 2GEBA 2V0CA 4DJJA 4FCTA 2HOQA 1QANA 1QVRA 4F9FA 1PR0A 3T0GA 1MCZA 2CDAA 2R5FA 3A8TA 4YR9A 1A7UA 3LYLA 4J3JA 1DI0A 4ZVMA 3NHBA 4JXKA 4QU8A 3WNZA 3OTQA 1NUSA 1ZN8A 2O5CA 4NCXA 5BNZA 5A5EA 3W4IA 2WOOA 4C4OA 4OXKA 1ISRA 1UUFA 3N1UA 4OVKA 4WN9B 3K9FC 4DV0B 3WJ7A 2H8GA 2JZNA 1CUHA 2QMUA 3GEDA 1NN1A 2DCUA 4P33A 2X19A 2WZDA 5D85A 1L5VA 5EXTA 2JLYA 3T5DA 1YQEA 3WKDA 3Q3JB 1U2GA 1SJ9A 4UBLA 2C4HA 2YHUA 1OGIA 3NANA 4MPPA 2A5DA 1FYWA 1GFWA 2P4HX 3B7PA 1MW9X 1PZXA 2GHQA 4K46A 4AYWA 2C7VA 1PT8A 2B7CA 3IBGA 5K0JA 5G02A 2DUMA 3N2LA 3SS9X 1TT5A 3A27A 1GILA 5LOVB 1RNLA 2VI5A 4HAIA 3OD1A 3MF4A 4QDXA 5CITA 5M29A 4C2TA 4CU5A 3U61B 5HKAA 4LFBB 4OHUA 2GBCA 1W4RA 5M3BA 5J2UB 4EPRA 5AW1A 5CX4A 2J45A 4N0MA 1SUWA 2VJOA 5B64A 1YBAA 4C0WA 4DYHA 1FTYA 1CIJA 1GTMA 4KBGA 3I64A 1AB5A 3ONEA 3C3PA 1AHNA 4HSEA 4BX2A 5JZ9A 3WGIA 3EWAA 3P0HA 2Y9PB 4M6WB 1OYWA 2RB5A 1QQAA 4HNQA 1RYEA 3HBMA 2WKWA 4QJ4A 4XOUA 2VP4A 3D59A 3DQPA 4FQ5A 1L4KA 4DGQA 4R98A 1R6VA 1ZESA 4R71A 3ZJVA 2AKAB 3WICA 1ULSA 5C1BA 2RGCA 2D3TA 3AR5A 3VNAA 2PTGA 1JNYA 1I9GA 3EEFA 1GAWA 3HLTA 3NORA 3U3XA 4ZKEA 5IBCA 5HQJA 3AEYA 1JVNA 4OL9A 2OXRA 1OA1A 1U3VA 2A1TR 4IW3B 3I1FA 2J0VA 4FC6A 4GPAA 4KNYA 3GUCA 1LNZA 4WV3A 1BGWA 1PV1A 2EOAA 3F4BA 5CH3A 2GKSA 3ES9A 1MV8A 2OFOA 4Y2HA 1YOVA 3ZWXA 4IXWA 5I4BA 1UFKA 3PQ4A 1H1DA 4K6MA 2VG8A 3B1JA 3EZLA 4AIIA 2FA9A 3H1EA 3BB1A 4GHWA 4I2VA 3MINA 2ZIUB 2HCBA 2V6BA 3FM9A 3KHUA 4QRDA 1IUKA 2IH5A 2FRDC 1GO2A 5AVQA 2R6ZA 1OFVA 3RV4A 3ZXIA 5CVCA 4MQLA 3Q8MA 3LQYA 4QYMA 2DTEA 2AYZA 3C6BA 4BWYA 1FMCA 4OLBA 1PZHA 1HPLA 2FPIA 4NU6A 5KNBH 3H11B 5SICE 2FSIA 4I9HA 4YJKA 1KSJA 3CUTA 3LL7A 2AC4A 3WL4A 1HEIA 3OKFA 1CULC 1IBRA 3UH0A 4J8PA 3ZKWA 1SIOA 2R6FA 4TLLB 3F97A 1PW7A 3C15C 3KNZA 3RM3A 4IS2A 3P8ZA 1MQ8B 3Q2KA 4K9NA 4JMPA 3AFNA 3FSJX 3QMWA 4IMRA 4RTOA 3I1IA 2BCJQ 2JVIA 5CG2A 1C2YA 3AXSA 2CJPA 4MPDA 4URXR 3UQYS 4KAAA 2QZ9A 3KWJA 4XGRA 2QOEA 3NAGA 3IAXA 5IF3A 4DLTA 3WYEA 5ALIA 3C87A 4ETIA 4BYMA 2Q21A 1FVOA 3TIFA 2FY8A 2IBSA 4LV8B 4FYPA 5DN6D 3KDAA 2H1VA 3KKEA 3UWPA 5EMNA 3ZGXA 4GO1A 1ZNZA 4NV3A 3BXXA 1NUQA 5IM4F 1ZI6A 2OMEA 2GEUA 1NVFA 3GMSA 3VH4A 3ZZ0A 2HGZA 2L17A 3QVOA 3ZV5A 1D2MA 3WYFA 2VZ9A 4DLBA 1SHLA 3REQB 3G0BA 3QELB 4IH9A 2WM3A 1JMVA 2F00A 1X2BA 1BC5A 3FTQA 2MT9A 3C4QA 3IL2A 1XHFA 1C3EA 4QT4A 1XTZA 1Z29A 5KOIA 1N2GA 2KQUA 3DKIA 5IX8A 2YS7A 2D5IA 1O57A 3VDXA 2A14A 2AFIE 4Y6GB 5AKGA 5ALQA 4YMUA 5JCZA 1V8FA 4YACA 2O5EA 1TYBE 4YUWA 2ZTMA 5A05A 3GJ6A 4BMCA 3UNXA 1ISMA 1ZBQA 2DSNA 3THYB 4ZVOA 3FLAA 3QEOA 2CFCA 1E1RA 3CUKA 4J43A 2XT6A 4I8DA 4BO6A 4ZK6A 3OQIA 5CMLA 1NFFA 1QVWA 4Q48A 4IZHA 2IHKA 4ZFNA 3N74A 5B57C 3OOSA 5JI2E 4L02A 1QCYA 2DFPA 1KOLA 1Z39A 1UM8A 1L5OA 2FW7A 3IT2A 1KGDA 4R1TA 2Q3BA 3EDQA 1ATZA 4IJ6A 4C4SA 4OLAA 3A4LA 3A10A 1ZJ6A 1PJ2A 3ACBA 3GG9A 5BQOA 4D8UA 2NGRA 2X1VA 5LD2C 3KQYA 2HH9A 1NGSA 4GOOD 3T3PB 3NKLA 2IVZA 4QQNA 3P9ZA 2BW0A 5EIWA 4DSZA 1Q74A 1P4JA 3D02A 2V9ZA 5B1IA 1L5QA 1ZD4A 5LDGA 2BGNA 1N6NA 2R00A 1Y1LA 2C96A 4Q3EA 3HZOA 3RNLA 4P3NA 4DJEC 1P44A 5IN5A 3UWDA 3H6GA 1MH9A 5LQDA 4US2R 3ETGA 1X7DA 1JLHA 1SAYA 1XDZA 3NZEA 4YBRA 2BCGY 4QODA 4CM5A 1U8AA