4IIVA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.5 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
SRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.5 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iivA00
4RDIA 3LLVA 3PHGA 4CMIB 1ZK4A 2EXXA 4UULA 3QE3A 3VH1A 3GVXA 1YL7A 4QXMA 5EERA 2PKQO 3TRIA 4IIVA 1YL5A 4ZA2A 5A3VA 4Q3EA 1UZMA 4A73A 4B3IA 1MA0A 4RVUA 2GZ1A 3E6AA 3KUXA 1YGYA 5I8WA 4RCVA 3K73O 1ADCA 2TMDA 4DMLA 1FDWA 1I5RA 3GMDA 4CL3A 1E6EA 1VSVA 1CQIA 2ZYAA 2HUNA 4OXYA 2D59A 2VOEA 1PS8A 3LQFA 3N74A 3OA2A 1E3IA 3LK7A 3LVFO 3H5AA 2FSVA 3JQDA 4NBVA 1HE2A 1I2ZA 2B35A 1PGOA 1I3NA 2WM3A 3H2ZA 2ZK7A 3E18A 1LDBA 1A27A 4ND5A 5DNAA 3ROKA 4IS2A 3ZWPA 1KIFA 1X14A 4GMFA 4PLFA 3PFFA 4W7IA 2J3IA 3CE6A 1QYCA 1BTOA 1VL0A 3PHHA 3GQVA 2J5KA 5BSFA 3JQCA 2O23A 4DWVA 1EUDA 1V3TA 4LRTB 4DIOA 5DDIP 5A03A 3DBVO 4PRLA 2C5AA 2D2IA 3NDRA 2VQ3A 3VKUA 4Y6PA 1HWYA 1QRRA 3DDNA 5A5FA 2VWQA 1D1SA 4BB6A 4XR9A 4WASA 4D41A 4B3JA 5A9RA 3KVOA 4RVSA 5K6AC 4TKMA 4Z0TA 3TOZA 1EVZA 2DBVO 2W2LD 3EW7A 1VJ0A 1UXJA 2X1HA 3DMTC 3JYLA 4NBWA 3RROA 4MKXA 2VZ0A 3BMQB 5I9LA 2VRBA 3FR7A 4LVCA 4WKGA 3BTOA 1IPFA 3E5RA 1H9BA 1IYZA 5BSHA 4NK4A 5HRUA 1B16A 5B37A 3ZNNA 2Q2WA 1MC4A 1BMDA 1TT5A 1J5PA 2ZJ1A 3OJ0A 2E4AA 3QVXA 3L6EA 1YL6A 2PV7A 3DMTA 5IFLA 2PR2A 1Z73A 4S1VA 1C3VA 4Y6RA 3RJ9A 1BVRA 3PDJA 4IUYA 3ON5A 1YO6A 4IBOA 3KOUA 4G5HA 3JQ7A 3RD5A 3ZWXA 2EKQA 3EC7A 1P1KA 1U2GA 2PGDA 5DCYA 5KJ6A 5IDQA 2ZKLA 5COAA 4E2ZA 3I4CA 5KIAA 4PLVA 2OUIA 4D43A 1ULUA 2ZCUA 4CLXA 3L9WA 3FNFA 1ZKMA 4O0LA 1J0XO 1HDOA 3HWRA 2ZQZA 1FDTA 2Y05A 2DC1A 1ISIA 3WGGA 3AUUA 2P9EA 4IJKA 1E3JA 3V1YA 1H2BA 4KUGA 4ZRMA 2OXIA 4WOKA 1QLJA 5F21A 2C7GA 1ONNA 1UXKA 4GI2A 4NZ9A 3WGZA 4AJNA 2G17A 1SEPA 1LSSA 4J7XA 3F1LA 3Q2IA 4B7CA 5IN4A 3QWHA 3X2EA 5DULA 3L0DA 4PG7A 1H6BA 2XXBA 1U3UA 1EEHA 1E92A 2AG8A 2C0CA 2YYYA 3UFXA 1SOWA 4ZD6A 1ZEMA 1XDWA 2AQHA 2BLLA 3TFOA 1KERA 1JA9A 3IKVA 3MWDB 3WDSA 3GOHA 2EGGA 4PZDA 1TT5B 1LX6A 3PLNA 1A5ZA 2NTNA 2DPHA 4OM8A 2DAPA 2V6FA 3D0OA 3TWOA 4ALMA 3A28A 4KUHA 1NFRA 3W4JA 3BHMA 2VWHA 2WE7A 4FW8A 1PJTA 2QRKA 4JJIA 4CLHA 4GWGA 5ADHA 1XYGA 1PJSA 3OJOA 3X2FA 2AE2A 4M86A 3H9QA 3NTRA 1P1JA 2X7HA 1KEWA 3T7CA 2HK7A 4EW6A 1ONOA 2R2GA 3VC7A 5JMWA 3L4SO 2QYTA 1K2WA 2G76A 4BGIA 4NU6A 3VPGA 4CLEA 2DBRA 2VTEA 5JY1A 4KQWA 1ZSVA 1YQGA 4X54A 1X1TA 4YWJA 1SO8A 1C1XA 1B8UA 1P9LA 2Z1NA 3GHYA 2Q1SA 4A2CA 3KV3O 3MJSA 1PJLA 4R1SA 2RAFA 2VT2A 1ZCJA 3EMKA 3LU1A 1V0JA 4P4GA 1XQ6A 2OZPA 3ZW8A 1DAOA 1P74A 3RUFA 1WDMA 2BRUA 3CMMA 4BNXA 3Q9UA 3ZHYA 4XYMA 3DHNA 4XQGA 1A72A 2NSDA 3S2IA 1X7GA 1ZSYA 1Y5RA 3ETGA 4PLHA 1KVSA 3PYLA 1B15A 2WD8A 1ZIDA 3A14A 1RYEA 4R3WA 1HF3A 1NM5A 1RPNA 2WD7B 3GA0A 3KLMX 3VVBA 2ZB3A 1R6DA 5ENVA 4XIJA 1A4IA 4GLOA 4RQUA 3JQ8A 1LDGA 2UAGA 2Y66A 5C7LO 1NWHA 4PVDA 4E5KA 1E3SA 1UXGA 4F6LA 1R15A 4LMPA 4HFJA 1FXSA 4HX5A 1ZZEA 4R01A 4YEDA 2I5PO 2YFQA 3EK2A 2CY0A 4I08A 3ZWCA 4WUVA 1QG6A 4LMRA 1JAXA 2GDZA 4WJZA 4DLAA 2D1YA 4Z3KA 3QV1A 5JYEA 5T5QA 4CLOA 1KEVA 3HG7A 5A1TA 2JCXA 4BL5A 4O59O 2O3RA 5CDUA 1GV0A 1VL8A 3I9LA 3WXBA 2NU7A 4WNCA 1C1XB 4OMUA 3CUKA 3W6UA 4XJTA 4LVUA 4L74A 3V2GA 2JFHA 4GKBA 3GAFA 4ZQGA 4D7AA 4BQRA 5CEFA 1DO8A 5COBA 4E5YA 3FCOA 1QMGA 4XD2A 2NWQA 1ENOA 4L75A 3WNVA 1HDRA 4Z9FA 1E77A 1U7TA 1E7RA 3VAZA 3WGYA 4J3FA 4FBGA 1PS9A 3H65A 3ZU2A 5L7TA 1CWUA 1I33A 4ND3A 4K6CA 4BNKA 4PZCA 2A4KA 4FPXA 4HUJA 1KS9A 3JQ8B 1ZJZA 3V8BA 3DBRA 4U0JA 4XCVA 1XCBA 5AYVA 1PR3A 5IJZA 1AXGA 4FFRA 4DTIA 1X0XA 1MG0A 3GDOA 4AJEA 5ER9A 3EUWA 1DB3A 2G82A 3QJ5A 4RVHA 3GVCA 2DQ4A 1Q2XA 4TQGA 4BKUA 4CLOB 1YJ8A 3PIDA 1FDVA 2ZB4A 4WOJA 2CMDA 3ZH2A 1NTOA 4XJSA 3WNQA 4FFNA 4EGFA 1G6KA 4BNZA 2C2XA 2HMSA 3COSA 2PGJA 2RBEA 7ADHA 3HDJA 3EY4A 2FN7A 1ZXBA 5HBRA 2H6EA 5AQ1A 4FIZA 4K9DA 1R4NA 4CMCA 5CG2A 3TZHA 3F4LA 4FQ8A 4B4WA 4EJMA 1HLPA 4WLVA 2X86A 1P45A 2NV6A 1ZJYA 1J4AA 3IUSA 4I9NA 5B12A 2R00C 1UDBA 3GDGA 3TN7A 3CZRA 5F5NA 2PWZA 4D44A 3JYNA 3UH1A 1LC0A 1N5DA 2QZZA 1G0OA 3A1NA 3RVDA 5KNLA 2X0JA 3DO5A 4A03A 5FI3A 4Q9NA 4J9VA 1EK5A 4L4RA 2YDYA 5I7EA 5T67A 1JWAB 2R00A 3OBBA 5DCWA 1AN9A 3NUGA 3G17A 1E7QA 2BD0A 1B8VA 4XGKA 2XPCA 1U8FO 4R69A 2W98A 4XYEA 4CV3A 3ZDFA 1NYTA 2ZQYA 4A26A 5HWSA 1IHXA 3PJDA 2PZKA 3NDJA 4PIVA 1AXEA 2Q2QA 3VZQA 2BF7A 3FBTA 3UN1A 4XIYA 3LYLA 4KQXA 4EUFA 4ZGWA 3WB9A 1YS4A 2IZ1A 3WGOA 2B4TO 2Y0CA 2XAAA 1E3WA 3STHA 4AJPA 1Y1PA 2QIOA 3BHJA 3W4KA 4TMFA 4RVGA 4DPKA 1KVRA 3AY3A 4YT8A 1V9LA 5IXYA 2CVZA 3ZU4A 4BMVA 5AXBA 1R16A 4J7CA 2I76A 4HFRA 4YB8A 1ZK0A 1E7YA 3WG9A 4EI2A 1T2CA 3JD3A 4I8XA 4MKZA 3DBHA 1EVIA 4B8ZA 3OJEA 4E33A 3ZW9A 1NHWA 1LLQA 4Y9DA 4PG6A 4NBRA 3LT2A 1RM3A 4XZ3A 4I5EA 3JQAD 4UVIA 1WMAA 2Y67A 5I9MA 5CDSA 4CMBA 4UREA 5JBIA 1TVEA 1V6AA 1IL0A 3FTNA 4EBFA 3WTBA 3E48A 2BHLA 1ZXLA 1NPTO 3O9ZA 4QECA 4DYVA 5EPOA 1LA2A 3FD8A 3KYBA 4AJ4A 3ZV4A 5EINA 4N5NA 4NFSA 4II2A 3K31A 3P2OA 1PZFA 2C5EA 1C1DA 1NWCA 1DIBA 4IDDA 3PEFA 3WBBA 3GR6A 2OO5A 2VRCD 1T1SA 1HDZA 4I1IA 3VH2A 4R16A 4ALJA 1QKIA 3Q2KA 4YAEA 5T6BA 1XWFA 1T2FA 3TJRA 2B4RO 1Z6ZA 2CZCA 1E5LA 3S8MA 3OQ1A 2ILTA 4IDEA 4WCFC 4WLFA 3RAJA 4U0KA 1ZK2A 3KZVA 1E1KA 3MZ0A 4OXKA 4R54A 1M76A 3V2HA 1GUYA 3H3FA 1W6UA 1Z74A 1JU9A 3ZNOA 4D3SA 3GMSA 3AOGA 4CQLA 1A7KA 4PN3A 3WGTA 1JW9B 3ETEA 2YFHA 3TZ6A 1LSOA 1T2EA 1U4OA 4MKRA 5HA5A 3WIEA 1QYVA 5LCXA 1OAAA 2VHWA 4U8GA 2JHFA 4LSWA 5IF3A 2FR8A 5ENDA 1BXKA 1YB1A 4K1LA 3NEPX 3GZNA 4HWKA 1LRJA 4J1SA 1IZ0A 4CMEC 1E6WA 1C1DB 4YPOA 1R4MA 2BKAA 1DC5A 2CDBA 2X6TA 3ZHXA 2HMWA 2O3JA 1CYDA 1EQ2A 1NHGA 1GYQA 1GD1O 4U6QA 3OETA 4BUCA 2YQ4A 1MUUA 3KSZO 1A9YA 1N1GA 3DMYA 1X0VA 4DL9A 1NAHA 3JQBA 1BGVA 1GU7A 5TS3A 4TRRA 2HMUA 3GAZA 3I1JA 3TL3A 5L9AA 1UP7A 1DIGA 2GPTA 1KC3A 1LRLA 1HT0A 1H2HA 1OC2A 1RJWA 4JBIA 2DBZA 3KHUA 1YE3A 1IB6A 2AMFA 3RJ5A 3OIDA 1BW9B 4OHUA 3GZ4A 1NVGA 2V6MA 4CQLB 2F00A 2YV3A 4BKPA 2VRCA 4M87A 3HDYA 1SPXA 3AOEA 3GNQA 3ONFA 4L73A 2RCYA 5JYDA 4FR5A 4OAQA 4CLRA 3IKTA 1P1RA 5F1KA 3GFGA 2O4UX 3PXXA 1PR9A 4TRJA 4BV8A 5BNTA 3L6OO 3H5RA 1HRDA 3ZWBA 3PK0A 2VNSA 5AXCA 4J4BA 1IHYA 2YY7A 5L45A 3GZNB 3KEQA 1BXGA 1X13A 3W6ZA 3WS7A 1ID1A 1R4MB 5A9SA 1CIVA 2ZATA 4YJFA 2C20A 4CV1A 2HLPA 1KC1A 2EGHA 3FWZA 5A4DA 4II3A 4BMNA 1SBYA 1F8GA 4D0RA 1HDYA 1GTMA 1Z7EA 2QQ5A 4AJ1A 3TNLA 3H8VA 3S2EA 5DCUA 3UVEA 1ORRA 5G4KA 4BO6A 3QVSA 3KXDA 3AY6A 4YR9A 2Q1WA 1UDCA 2IYOA 4PG8A 1EK6A 5DF1A 2JL1A 3FNGA 1MLDA 1KBZA 4MP3A 5IAAA 4Y6SA 3C3XA 3RC7A 4XWYA 2CF6A 2Z1MA 3SC6A 3U4CA 4CM8A 4GPD1 3T4XA 1V3VA 1TA4A 4W9NC 3BYZA 2X22A 3L4BA 4S3MA 4J0EA 2D3TA 3GDFA 4EEZA 1XU7A 2GN6A 4CLRB 1LDEA 2DUWA 3GNSA 1FDUA 4FGSA 4YCAA 3ZZNA 1CERA 2FP4A 4J1QA 4MJLA 4O63O 5TQVA 4CM5A 1ZUD1 1NBOA 1QV7A 1XG5A 3GH3A 4JCOA 1Q0QA 2PD4A 5A02A 3U09A 1I30A 1IPEA 1BXGB 1HEUA 4R5MA 1VSUA 3QA9A 4W9NA 2QHXA 1DEHA 1O8CA 1WZEA 4UEJA 1E3EA 3CXRA 5A9SB 5KVCA 4OKNA 4YJFB 3DR3A 1Q0LA 3ASVA 5KVVA 3LLSA 3QWIA 4EZBA 2H1SA 4IQGA 2AG5A 4BOYA 4HV4A 4YAJA 3RBZA 3FTPA 3WGQA 4R5HA 4Z0HO 1I3MA 3G0OA 3PYXA 5G0WA 5KJEA 5C3MA 1I32A 2PFGA 5G4KB 1EVYA 3N7UA 3PJEA 2BFPA 3OA0A 3GF4A 5IDXA 2X0IA 5TJ9A 2Q3EA 4QFCA 1PGQA 2GN8A 1GQYA 5I8ZA 4HADA 4F3YA 1TLTA 1MGOA 2NUAA 4CM8B 3F1KA 1EDOA 1JVSA 1QYWA 4NI5A 1HTBA 5CDTA 1BRMA 4FB5A 2OMEA 1GFSA 1PQWA 3BMQA 1KEUA 4DQVA 1V3UA 3T4EA 4CM1A 4PLZA 1LI4A 2DT5A 2JKVA 1NP3A 3TL2A 3GY0A 4IM7A 4OSOA 3HFSA 5KVSA 4JX8A 5KVQA 4GH5A 4Y67A 3WOHA 4PLPA 3L07A 4YTEA 4RLSA 4LCJA 4KTTE 3GFBA 3QWAA 1VC2A 2ZCVA 4E2YA 4WEQA 4MVJE 1NAIA 4IJUA 1PZGA 4HY3A 2ZIZA 5ER6A 4D46A 2NVWA 4JGBA 4DRYA 1AE1A 1MP0A 2Y1EA 3Q6IA 3JQFC 4MIOA 1VPDA 1PTJA 2Y1GA 4NJOA 4RGBA 5TIIA 1LDMA 1F8FA 2B5VA 3MOGA 4AJLA 2CSUA 4D79A 9LDTA 2DLDA 4J91A 3QVTA 3W8FA 1O5IA 4FFMA 2B37A 2EV9A 2CNBA 4ALLA 2Y93A 2GZ2A 3DZGA 4B4OA 1EE9A 1W0CA 2HKIA 3ENNA 1PGPA 3ZWMA 4CMGA 1K5HA 4WE3A 1Z75A 3UAGA 4TVOA 3F5QA 3OIGA 2PZMA 1F14A 2OGUA 4HP8A 2JCVA 4RPLA 3SBOA 1T26A 1CRWG 3O26A 3BHIA 1YDEA 4E5NA 4GLLA 1GEGA 4PCVA 2I66A 4XB1A 2HK8A 3F9IA 1LQUA 2GRAA 3KO8A 4RF4A 2JD1A 4XGNA 4JP2A 3PJFA 4CMKA 2LDBA 5K6AA 1T4DA 2P4HX 4ESOA 1HL3A 5IZCC 2CVQA 2FRDA 1B0AA 3KSUA 2E6UX 3KRTA 3UKOA 4BNIA 3ANLA 4B4UA 4XKJA 4NFHA 4H16A 4AJHA 4A0SA 4R9RA 3AFNA 2DUUA 1NVTA 3V5NA 2O3SA 3BMCA 5HM8A 1KVTA 3P7MA 2BI8A 1BWSA 2NU6A 3M6IA 4MVJG 4YJHB 2Q46A 3ZV3A 3EVNA 4FFLA 3I9KA 2AA3A 1OFGA 4N5LA 5CFZA 5IZCA 4GVLA 1DJNA 2B4QA 1JN0A 1UP4A 3MTJA 1CQJA 1PJQA 1YQXA 1AHIA 3I23A 1H9AA 1R37A 1LLUA 1BSVA 4FC7A 1BVUA 3OECA 4XRRA 3HQ4O 4E2WA 4ALKA 3LC2O 3WGHA 2DTDA 2I3AA 5KJFA 1PJCA 4ZU3A 4QTZA 2EEZA 1JLLA 3GPIA 5GZ6A 1KVQA 4CJXA 3ZWYA 2EKLA 3VZPA 4L4SA 1CF2O 7MDHA 1WNTA 4QUKA 1PWZA 1GADO 2X4GA 3NRCA 3DZBA 3RASA 2I99A 4RPGA 3MTGA 3PPIA 4GL4A 4OIMA 8LDHA 3WR5A 2P5UA 1ZEJA 2NNLD 2WD7A 3ADPA 5EMHA 4YBZA 3UCXA 3UW3A 1Q1NA 5TRTA 2IXAA 3DAPA 4OQYA 1T2DA 3IC5A 5JC1A 3GG9A 5CP8A 2FZWA 4R3NA 5DP2A 3RUEA 3BMCB 4BO7A 4P4NA 3MJEA 4IY1A 4O1MA 2NQ8A 1B26A 4E6PA 5F5LA 4UVHA 1NNUA 3D3EA 4CM4A 4A27A 1XEAA 4FC6A 3NT5A 3ZHBA 4BNFA 1P1IA 5U1PA 1DHTA 1EZ4A 2EJVA 3O03A 3UXYA 4JJGA 3PDUA 3I5MA 1IOLA 3HUDA 3QW2A 4DVJA 3SJ7A 4M54A 3VH3A 2VYVA 1WAMA 2GLXA 2C7VA 2D5CA 1FDSA 1O6ZA 2G5CA 4J9UE 5CPBA 1PS0A 2GZ3A 2EJWA 2YDXA 5GZ1A 2W90A 3IP3A 3UF0A 4UVGA 3JQGA 3C8MA 1YB4A 1MFPA 4YT4A 2DFVA 3M2PA 3QY9A 5DN9A 4J2OA 1DFGA 5EESA 3DAFA 3TFQA 4EYEA 4YRAA 4W7HA 4JN6B 3DTTA 5GMOA 3VHRA 2VWPA 3RU9A 2FR0A 3WYEA 2BGKA 4H15A 1SOVA 4JROA 3MCVA 4ILKA 3H4VA 3PQDA 4F45A 2VYNA 4A7PA 2FMUA 2X5KO 2VOJA 2FY8A 4DA9A 2J6IA 1FJHA 4WCDA 2QX7A 3AWDA 3Q11A 4R1UA 3W1VA 3INRA 4CM7A 2G0TA 3VH4A 3PRJA 5JY6A 3D4PA 4CM4B 1PU2A 2PK3A 1K0UA 4R51A 3ANMA 2NTVA 1M75A 1ZBQA 2EW2A 4C4OA 1F0YA 4TWRA 4MVJH 2H5LA 4C7KA 1SB8A 3SJUA 4MVJI 2OORA 3DBLA 4E21A 1A9ZA 5TT0A 1GR0A 5ILGA 3LT0A 4YJGA 1GZ3A 4LK3A 2CDCA 2VHYA 1T2AA 2IRWA 3DZKA 2IEBA 3K92A 3ADOA 5BNFA 2AXQA 5KCZA 2IE0A 3R3JA 4EJ6A 3JQGB 2WMDA 4RDHA 2VHXA 1PQUA 3A4VA 4HFMA 1XGKA 4I5FA 4QO8A 5A05A 3VDQA 1RM4A 3NJ8A 4NG5A 2I67A 1YXMA 2O50A 5T57A 2QRJA 1R12A 2DFDA 1T4BA 1M6WA 3UCEA 4JLWA 4BQPA 3ITDA 1VL6A 1U3TA 3CSDA 3UHAA 1C0PA 4GWKA 5AVOA 3OP4A 4FGWA 5GZ3A 1CETA 3VVCA 4BS9A 3F47A 3SLKA 2GSDA 2O7QA 1EMDA 2D5AA 3H9GA 4E0BA 3RQSA 1N1EA 2VTDA 3JD0A 2POQX 3DZFA 2O7SA 4Q3NA 5KJ1A 2ZTLA 5H82A 1MC5A 5T64A 3VPFA 4E4YA 5KKCA 4CUZA 3U5TA 1DIRA 1P77A 5L4LA 4GGOA 4FFPA 3DBLB 5JNLA 1GY8A 2FSSA 3LT1A 1UJMA 4WPGA 3CZMA 4YJGB 2Q50A 6LDHA 1VLLA 4LGVA 3WGIA 1Y8RA 1WDLA 3D7LA 4MP6A 1GEEA 3GNTA 2GCGA 2UYYA 3L77A 3PFWO 4RO0A 4DGSA 3ZU3A 1GDHA 3B1KA 4L8VA 2Q4EA 2HSDA 5J23A 5B1YA 3FRJA 3V1TC 4GKVA 4GSLA 2GD1O 3WICA 4EUHA 2IYPA 4UEKA 1KOLA 2EW8A 2C54A 3ICPA 4WLNA 3EVTA 4WLOA 5CG1A 1RWBA 4CL8A 4PG4A 5CEEA 2EG9A 3OICA 3AI2A 1PGJA 3D3WB 4RPJA 4WEOA 2WJPA 2Y99A 3I4FA 5CPFA 2JCYA 2A92A 3ZNQA 5H83A 1P0FA 4CMJA 4CR7A 2UUPA 4GAEA 2OBNA 3ZWAA 3ZHZA 1L7DA 4DLBA 1U7HA 2BFAA 5A06A 3PHIA 3UUWA 4N5MA 2CFCA 5MDHA 2HCTA 3OM9A 5JLAA 2HAEA 4M55A 2UV8A 1WVGA 5A5EA 1WLYA 1J6UA 2AQKA 2O3TA 3W8DA 2W2KA 3WFJA 4I9HA 3RU7A 3HB5X 4KP7A 4CQMA 1B3RA 4TZKA 2RHRA 1T24A 3IIEA 3DHEA 3DTYA 3HNPA 1IUKA 4ID9A 1GZ6A 3GGOA 4N54A 4UVEA 2A35A 3TDKA 5KJCA 1PJ2A 1U3WA 3RUDA 3G79A 1LRKA 4JBHA 3IAHA 5FYDA 4EUEA 2QRLA 3EZLA 1Y8RB 1B7GO 3LC1O 2J5QA 5EIOA 4J2HA 3CH6A 1F06A 3QVWA 5L4SA 3OEYA 4YA6A 3E9NA 2PTGA 3ROMA 1O9BA 4RLHA 1LQTA 1UZNA 2JFGA 4PLWA 4ITUA 5BNIA 1H6CA 4IDGA 1I3LA 4LN1A 3V2UA 4R1NA 1LDNA 5I7SA 1GPJA 2X0RA 1XIVA 2HQ1A 2QZ9A 1LDYA 4CUKA 4QFDA 3DEYX 4M49A 2ZTUA 4Z0PA 2X58A 3BIOA 2HO5A 5L40A 1NFFA 3BAZA 2DM6A 1RKXA 2XXJA 5GY7A 1JQBA 3AM5A 2PLAA 1TB4A 4FJ1A 4GSKA 3I9MA 4MINA 4BO9A 4PRKA 5DP1A 4K26A 5G0TA 4XGIA 3SEFA 4BNWA 3WQSB 3RUAA 1H94A 4U5QA 4DXHA 4IGFA 4J90A 4EJ0A 2W2KB 1DC3A 8ADHA 4CQMB 4YAIA 3RUIA 2F1KA 1O89A 3VPXA 2WSBA 1UZLA 4OSPA 2NVBA 4YDRA 5TGDA 5L53A 1SC6A 3L9XA 1Y8QA 1Y7TA 1D8AA 4BO3A 4JXKA 3DQPA 5G4LA 2GUGA 1ZO8A 3IOYA 1Y81A 3K6JA 5A9TA 3UOGA 1E7SA 1QV6A 3DFUA 1XA0A 4NBUA 4WK6A 3DOOA 3QVOA 1RM5A 1PSDA 2C29D 1IE3A 4Z6KA 2PKQP 4J16A 5AXAA 2AW5A 2QW8A 2Q45A 4AJ2A 3JQEA 5ITWA 1DLIA 3HDQA 4PLTA 3D64A 3GN2A 1ADFA 3AU9A 3H5NA 3HSKA 1AGNA 2AEFA 3ONDA 2ZB7A 1W4ZA 4KWHA 1UP6A 1YBAA 2ZTMA 4FD3A 4IJWA 4UUPA 5JO9A 1BW9A 4J4HA 3H2SA 3RC2A 4NK5A 1A71A 4KMSA 3WJ7A 1N7GA 4CPDA 4E2XA 1RYDA 1P31A 3NGXA 4WLUA 4ZICA 4W4TA 1N8KA 5G0SA 5HS4A 3FPLA 4WCFA 1N7HA 3PWSA 1BXZA 2Q49A 3T7EA 3I9JA 1WPQA 2VNAA 5FF9A 3QRWA 3L6DA 5ES3A 4FOSA 1KYQA 1Y5MA 2GGSA 4DIBA 3NJ4A 3SVTA 2BFMA 1ISFA 1SCUA 3GRPA 3GG2A 1TT7A 4N18A 3NKLA 4IIUA 4QX6A 1ISGA 3KLPX 1Y8QB 3NT2A 4GX0A 5TT1A 4W6ZA 3EZYA 4OOFA 4E5MA 3PWKA 3HB4X 4MOWA 2O3UA 3E5MA 4FN4A 2VUUA 4XYBA 3RFXA 1PJBA 3OF2A 4YT2A 2TMGA 2DKNA 2V6BA 4DBZA 4YAKA 1GCOA 5COQA 1QLHA 1SEVA 1DXYA 1MV8A 2PZLA 4CMEA 5T8KC 1JKIA 3MWEB 3PP8A 4IXWA 1DPGA 2DBQA 5JCJA 2B69A 4J43A 4RL6A 3DC2A 1E1MA 1BDBA 4NH4A 2WYWA 1K6XA 3DZIA 4NR0A 1D4FA 4TSKA 1LEHA 3RWBA 3INGA 4E31A 4XQCA 4RZHA 1E5QA 2YW9A 1ADGA 3TQHA 3MEQA 1QYXA 4MIEA 4G2NA 4WCFB 1I01A 3W8EA 5CHEA 3I9NA 4HBGA 3WMXA 1MXHA 3QSGA 3PVZA 2OBYA 2A94A 4BNTA 5BSGA 3AK4A 2JAPA 3WLFA 4E5PA 1V8BA 2YHIB 5JC8A 3NV9A 2JJYA 2FR1A 1NPDA 1I24A 1NR1A 1JTVA 3FR8A 3AUAA 4AJIA 3RC1A 2WWRA 3ETDA 5EJ2A 5MGBA 4PGFA 5THQA 1LXCA 4EDFA 5CDYA 4MIYA 4AFNA 5ITVA 1XSEA 2ZJ0A 3WSVA 1WZIA 3BMOA 2X9GA 3SX2A 1PL6A 4ZQFA 5EL0A 5A04A 5LDHA 1L7EA 1E3LA 4IPTA 5L3ZA 4MPDA 1JDJA 3VPSA 2HDHA 3NTOA 1OOEA 1ENYA 1HYHA 3WQQA 2OP0A 1WXDA 1WWKA 1ML3A 4KOAA 4PLYA 4WGGA 5JMPA 2YUTA 4L0QA 1YRLA 4BNHA 2FWMX 5LDGA 4HKTA 4RPHA 5TLSA 1E1NA 2CUKA 3I52A 1W73A 3JD2A 4MVJF 2AEJA 2FOIA 2P91A 1LU9A 3F6YA 2HU2A 4MO2A 4ONEA 1WDKA 3O38A 3ULKA 5CAEA 3EGOA 5C7IO 4O5OA 3MJTA 3PGJA 3IL2A 3ZU5A 3FI9A 1XR3A 5ILOA 1GPDG 3OMLA 2E49A 4MP8A 1HSZA 3PJGA 4Z9XA 2OP1A 3ICCA 2X0NA 2AE1A 4BO4A 3RBVA 1HDXA 3JQ6A 1YVEI 4IZIA 3ZWOA 4CLDA 3U4IA 4ZQEA 3RUCA 3BMOB 4JIGA 3U4HA 1O94A 1ZH8A 1PL7A 4IMPA 3M1AA 2C59A 1O95A 5JPIA 1WP4A 4W99A 1EFLA 4P8RA 2P9CA 3TPCA 3VZSA 1FK8A 4JQCA 2P2SA 1AHHA 3VDRA 1CEQA 3KBOA 4OJNA 4J1TA 4ND2A 5BR7A 2WE8A 1EQUA 3JD4A 3AM3A 1S7CA 2JD2A 3OFSA 4CUJA 3GGGA 4RF5A 1Z7BA 1TEHA 4TZTA 2PD3A 3C7DB 4BKQA 1VKNA 1ZW1A 5U4QA 4DQXA 3PHJA 2B83A 3R0IA 2G1UA 5HS6A 4RORA 3IS3A 4ZN6A 3GK3A 1OBFO 4U6SA 2Y0EA 3GGPA 3ST7A 4PLCA 1HKUA 1N2SA 4RV9A 4HXYA 1SB9A 3VTZA 4UUNA 5G0UA 1ZMOA 4W82A 4URFA 3OEWA 2HK9A 3GVPA 3D5TA 3G1UA 4JNKA 3ABIA 3E9MA 4INAA 4BKOA 4XQ9A 5BT9A 1PZHA 1W8DA 2PGLA 4L4XA 5DOVA 2YHUA 4R41A 3WYCA 1ENZA 5IXSA 4KDEA 1U4SA 4KTVE 3QIVA 4UUMA 2BI7A 3ASUA 3PTZA 1LLCA 4YJHA 4IS3A 4H7PA 3CMCO 1L1FA 1U5CA 3RKUA 1QR6A 3RC9A 3OQ6A 2SCUA 4D45A 3AI1A 1NQOA 1U2DA 4DPMA 2YQ5A 4FJ2A 3C7AA 3JQFA 2WYUA 4BNJA 1T25A 1LTHR 2J5RA 1LNQA 3B6ZA 1C0IA 4MDHA 4CM9D 4BO2A 1JWBB 4HNGA 4GQAA 3HJAA 1RM0A 1DIAA 5EQFA 3FPCA 2VT3A 4JJFA 2GN4A 4BB5A 3S55A 1CJCA 1AUPA 5JDCC 5IN5A 3LZ6A 1EDZA 6ADHA 4B4VA 3DONA 1ULSA 4DREA 4RF3A 1SNYA 4XDZA 2OL4A 4RVDA 5JXWA 2YV1A 2VYVD 3GLQA 3RFVA 3JQ9C 2Y1OA 4ZRNA 3ROPA 2UUOA 1EUCA 3PQFA 4CR6A 1B14A 5K9ZA 3DB2A 3B1JA 3TZQA 4R9SA 2JHGA 2WYVA 3K96A 4BGEA 3H9JA 1GYRA 2NACA 5JDCA 4DC0A 3GEDA 2R6JA 2FPPA 4YACA 1PX0A 3JQ9A 4B8WA 4FSHA 3FWNA 5F1PA 1UAYA 3AUSA 3ORFA 3ZV5A 3W4IA 1X7HA 3G49A 1I36A 4L9RA 4DUPA 2AHRA 4RJTA 3IUPA 1GL3A 3KETA 3KSDO 3GVIA 1K6JA 4J1NA 5B4VA 5JFOA 1NR7A 2CVOA 3NGLA 4QO7A 3C7CB 3WMWA 1UR5A 1U8XX 2Q4BA 2WDZA 1KETA 3DOCA 2V7PA 2VYND 3WYBA 5ICMA 3HN7A 4NFYA 3A9WA 3NDIA 3AFMA 3I9OA 1P44A 1HZJA 3I6QA 3QP9A 3ZN2A 5CEJA 4I5GA 5JSFA 1EBFA 3FN4A 1LLDA 3H9UA 2CF5A 2NTJA 3IDSA 1HE3A 2PH5A 4OL9A 3RCBA 4Z9YA 4BV9A 2B0JA 3D4NA 3GUYA 4OKIA 1HYEA 3ZCXA 3EYWA 4M89A 1DRWA 1M67A 2I65A 1A7AA 1Y9EA 4R1TA 3IJPA 3MJCA 4YRDA 5EN4A 1WMBA 4EEXA 2NQTA 4BNUA 1LJ8A 4E30A 3P2YA 1U1IA 1HE5A 3QWBA 4M8SA 3VZRA 3HN2A 3QQPA 4RVFA 1DRVA 4DMMA 4CM9A 4KWIA 3BMNA 3VTFA 1UH5A 3WWYA 5JAMA 4RPKA 5DT9A 1MXFA 3F4BA 2Y1DA 3VKVA 5C7OO 1Y6JA 4BIIA 3OIFA 4UVDA 1SMKA 1VM6A 3E82A 5A3JA 4XEHA 2A9FA 4TRMA 1IZ9A 2Y1FA 4OGWA 1OZAA 3I3OA 3BA1A 3A06A 3JQ7B 3TOXA 5C37A 1HSOA 3WX0A 4QQRA 3CKYA 4A5OA 1P0CA 3ZWVA 3Q9NA 4BO8A 2W2LA 3TF5A 3RUHA 2C07A 2X23A 1PEDA 2GO1A 4A10A 1D3AA 4BO1A 1DSSG 2VN8A 3DZJA 4B79A 1DOHA 3PWZA 4AJJA 2AQ8A 3FF4A 4E13A 1Z82A 1NX6A 4YQZA 4IDBA 4OOEA 3FBGA 2IEDA 1VI2A 3UCFA 1F17A 3FHLA 1ONPA 4TROA 2W8ZA 2Q1UA 3Q3CA 2ET6A 4IDAA 1C0LA 1ZVMA 2GYYA 3FSRA 2D8AA 4AL4A 1I3KA 1DJQA 2Z95A 3KTDA 4E3ZA 1MB4A 3HHPA 5CDGA 3I83A 4ZJUA 2YV2A 4BMSA 5U9CA 2RH8A 3C24A 1SZJG 1VRWA 3BMNB 1V35A 4NHEA 2J8ZA 1XU9A 5ICSA 3R1IA 2BGMA 4NNJA 1B3BA 4CV0A 4XYGA 2I6TA 1MG5A 3NT4A 2JD0A 4Y8VA 2CDAA 1E7WA 1YBMA 5HTOA 4LSMA 4YXFA 3NYWA 4HNHA 1UAGA 2VHZA 3B1FA 3S2FA 1PL8A 5JCXA 1M2WA 1XKQA 1R0SA 4CV2A 4QSMA 3GVHA 3IQDB 5EQDA 4AVYA 4GVXA 2VUSA 1A4UA 3E9QA 5FWNA 4OXNA 2RH4A 3LSYA 5BSEA 3CPSA 3LF1A 3VPHA 4CQMD 3KYCA 3F3SA 1JAYA 2CD9A 4BO5A 5THKA 1DDOA 3JYQA 3K5PA 2HMVA 3HE3A 4ROSA 3WLEA 1JVBA 2GERA 2VCYA 4PZEA 3GEGA 3U4DA 1FMCA 1UXHA 3JYPA 1ZNQO 4XYLA 3D3WA 3I6IA 1D1TA 2HMTA 1ZFNA 1VJTA 2Q99A 3OSUA 3P19A 3Q0EA 4N7RA 4EITA 1HZZA 4P4LA 4Z3DA 1ISHA 4AJOA 5JAIA 3H9EO 1C0KA 1VE9A 4PVCA 2PZJA 4B7UA 4LISA 2EWMA 4CMHA 3HADA 1ENPA 1QSGA 4I5DA 3F46A 4UAGA 3KYDA 4GMGA 3AU8A 4RF2A 1K6IA 1B2LA 2JAHA 1EUZA 3QWFA 3ZNPA 3CIFA 3GPDG 2X5OA 1YBVA 3S1LA 2GR9A 4IINA 2BELA 4IMRA 4ZVVA 1YJQA 3U3XA 5JO0A 3GUCA 4WLEA 2B36A 5IG2A 2I9PA 3H3JA 3PZRA 2BGLA 4B3HA 1E1LA 5DOZA 1N92A 4NMHA 4D0SA 1D7OA 1R0LA 3ZI0A 2ZTVA 3KYCB 3H6KA 5JAZA 2EP5A 2FHSA 2HJSA 4YJDA 3WIDA 4BNGA 1PGNA 3GN1A 2E48A 2Y0DA 2DU8A 3D1LA 3SLGA 1IULA 1QORA 5IZ4A 5LC1A 3R6DA 2D4AA 2XOXA 3QLJA 3RBXA 5I9NA 4KUEA 3SXPA 2IDZA 3UICA 4BNNA 1K89A 2WEKA 4K6FA 2IXBA 3M1LA 3HFGA 1E0DA 4GX5A 1YWGO 1HE4A 2VUTA 1P1HA 4WNIA 4CODB 1UXIA 1FF9A 1OC4A 1ZK3A 2AEMA 4G65A 1Q0HA 1X7DA 1HDGO 2IZZA 3U0BA 3KYDB 1NVMB 3LT4A 3EDMA 4IDCA 3ZWNA 1J49A 4G81A 4CM6A 5BQFA 1H5QA 2PY6A 3DBRB 1JKFA 1QXSA 4DC1A 4F46A 1NQ5A 5JAQA 3D5QA 1G0NA 4WECA 2RHCA 1C14A 4BNYA 5DBFA 4E32A 3ONEA 5FFFA 3ANNA 2PH3A 2ZB8A 5DZSA 4XRGA 3U62A 3DOJA 1PWXA 4NPCA 1BG6A 4YYZA 3NX4A 4MVJP 1N9GA 2O48X 1I10A 3DAGA 1T1RA 4IQ0A 4BNMA 1YQDA 4R4JA 5G0VA 3RKRA 4PFJA 1M66A 3MJ4A 1LBEA 1NQTA 1TI7A 1UUFA 1XQ1A 2LDXA 4HFNA 3S2GA 1X1EA 5KKAA 3WTCA 4D3DA 2E37A 5TSDA 2X9NA 1P1FA 1R4NB 2PA3A 3TZCA 5L95A 2Q2VA 4H3VA 9LDBA 3UGKA 3WFIA 3AI3A 3GHHA 2H9IA 5JW6A 2DTEA 3IP1A 3LC7O 3JYOA 5G2OA 1HLDA 5JCJD 4TKLA 4QT0A 3AY7A 2J3JA 2X5JO 3CINA 4O6VA 4AG3A 1GYPA 5B4UA 4IDFA 3FNHA 4P38A 2ZYDA 1PQPA 4DLLA 1LSUA 2HRBA 3BTSA 5TX7A 2EHDA 3K8ZA 1KY5A 4I9UA 3GRKA 2B5WA 4XQEA 4Y98A 3N58A 4MVJD 1EFKA 1HETA 1ARZA 2YJZA 3OH8A 4ZQBA 2DTXA 4DQUA 3O8QA 4FS3A 4IXTA 4LW8A 4ALIA 2OFPA 1P33A 4U7WA 1EVJA 1N9GB 1R0KA 3G1TA 3LDHA 4BNLA 2UVDA 1ISMA 1JKJA 5TF4A 1QP8A 1HXHA 3PQEA 1ZMTA 2IZ0A 2NLOA 3E03A 1DBVO 4NBTA 1PJ4A 1E3WB 3K2EA 3WJAA 3F5SA 1BDMA 1I0ZA 3NAQA 1MFZA 3GC6A 1HDCA 5TC4A 3WQRA 5FEUA 1EE2A 4YAGA 1PJ3A 1I2CA 1LC3A 4Q3CA 3B70A 1DFHA 3AUTA 2FPIA 3DL2A 2VZ8A 3NTQA 4J4TA 4PLGA 4YT5A 4F6CA 1H93A 1OMOA 2C82A 4FFOA 1DLJA 3IJRA 2NU9A 2Y68A 3DZHA 1XHLA 2YHIA 1S6YA 2PD6A 5L51A 3DBHB 3FNEA 3GT0A 3D4OA 5DBGA 1WW8A 4BGUA 1M6HA 4GX2A 4J7UA 4K28A 4BKRA 3LF2A 1NFQA 1UDAA 2GNAA 4BGVA 1Y9AA 2AQIA 2EF1A 2FZEA 4FJ0A 3RSHA 2V65A 2PKRA 4TRNA 2P5YA 2VWGA 4DIFA 4P22A 3GEMA 2IODA 3AJRA 5DBIA 3VOSA 3O8QB 3WBFA 1E6UA 3BTUA 2ZYGA 1F12A 3QHAA 4NQZA 2Q1TA 3CTMA 3HDHA 4ND1A 2P68A 3TSCA 4OYRA 2J3HA 2NVUA 1Q7BA 2VZ9A 3MJVA 4OH1A 4OO3A 3U9LA 4ALNA 3PYMA 4JK3A 4D3FA 2BH9A 4TVBA 3RI3A 3ITKA 3WWZA 1VJ1A 5K0ZA 4J6FA 3JQBC 1O0SA 3CEAA 3JTMA 4YVFA 3JSAA 2P4QA 3K30A 3MOIA 3HZZA 1YDWA 4NJMA 3R3SA 1VKOA 1I8TA 1MX3A 1YKFA 4IQ8A 1U3VA 3JQAA 4MVJA 2V6GA 1H0KA 3K9QO 5I7FA 5T8KA 5L7YA 4CR8A 3ROQA 3DFZA 4XA8A 4BO0A 2D0IA 4Q3BA 2QG4A 2OHXA 4RZIA 3PZBA 4J0FA 1GAEO 3AOEC 1DFIA 1HYGA 1K3TA 1X15A 2JFFA 3KEOA 3P5SA 4FDAA 5F1OA 2EP7A 1YB5A 5KTKA 3OJFA 3C1OA 2HJRA 4UEOA 2J3KA 4XR4A 4Q3DA 1GQ2A 1IY8A 2BFOA 3BXXA 1YOVA 4OQZA 1DIHA 1H6DA 2EERA 1U5AA 4JBGA 1OI7A 3PI7A 1CDOA 3JCZA 2X8LA 1ZSNA 3EAGA 1DC6A 4FCCA 2NADA 2YZ7A 3DXFA 2NM0A 1YH3A 3EHEA 1B8PA 2DVMA 3PIIA 3BTVA 4GGPA 2NVUB 1GZ4A 3ZWWA 3JV7A 5AOVA 1Q7GA 2GN9A 3Q1LA 1P3DA 5C5IA 4FOOA 1DRUA 1LSJA 1NPYA 1NQAO 3BZUA 1U9JA 2Z5LA 4DBVO 3K2BA 1DAPA 5KWEA 1KY4A 1G1AA 1ISJA 1PZEA 4NJMB 1NXQA 1GV1A 1GUZA 3E1KA 3PHLA 2O4CA 3JQAB 1LUAA 1R66A 2WTBA 4BNVA 2GASA 4KZPA 4YQYA 2BMAA 3AW9A 4NU5A 3ENKA 5L4NA 3U49A 2UDPA 4ZQHA 5L7WA 4IJVA 3L4BC 2DPGA 1U28A 2RIRA 3INTA 3ZV6A 4J49A 1DC4A 2EKPA 5B4TA 3AM4A 3M2TA 3TZKA 2EIHA 1H6AA 1Q7CA 2PNFA 1I2BA 1GQQA 2O2SA 3O4RA 3RIHA 1NASA 4R68A 4CMIA 1YOVB 3B20A 1GCUA 2XF8A 3G3EA 3ZGYA 4M1QA 1SAYA 1KEPA 5FI5A 2C2YA 2O3QA 4LRSB 2E82A 3PLRA 5TNXA 5H81A 4AJKA 4Q3AA 1ZK1A 3OQBA 3DHYA 2I3GA 4XB2A 3C1AA 4GBJA 5AXDA 5JE8A 3IMFA 5JDIC 1GUFA 2Y1CA 2NU8A 4ND4A 1ADBA 1KVUA 3H7AA 4RQTA 5TJHA 4DYDA 3E8XA 5KOIA 5I7VA 4IZHA 4ZHSA 2FPGA 4CM3A 4UUOA 3JD1A 3V1UA 4PG5A 1TXGA 2H63A 2QYSA 4DPLA 5JS6A 1PIWA 4MVJM 3WSWA 2GF2A 1Z45A 4L76A 4QEDA 1YONA 4JP3A 3RFTA 4LCEA 4BVAA 5JDIA 3SC4A 4B7XA 3C1TA 3OJLA 1BHSA 3KB6A 4NDNE 3OHSX 4C7JA 4D42A 2HRZA 5IDWA 4XDYA 1XELA 2O2YA 5F3RA 2W4QA 1DHRA 4E12A 1E7MA 2X9VA 1XLTA 4AICA 4KDFA 3DWFA 4Q39A 4BHTA 3C85A 5IDYA 4CMAA 3KM0A 3PGXA 4XX0A 2P9GA 2VHVA 4YRBA 4IGEA 4NIMA 1QYDA 1EBUA 2OOSA 4GX1A
chains in the Genus database with same CATH superfamily
5CIQA 2QMQA 2WZBA 1NVEA 4S0XA 5IKPA 3IOMA 2EXXA 3BFJA 4YALA 1RS0A 5ECGC 2XNDD 3GVXA 2H4JA 4QXMA 4YCLA 3FCAA 3LP5A 2SBTA 5AM3A 3VNAA 4OFXA 1YL5A 5ARBA 1YQTA 2CBXA 3LY9A 5LBIA 2W83A 2DE0X 4RVUA 3FTFA 5EUQB 3GLGE 4AG6A 5TDHA 2FP4B 2XRFA 1J5EB 3K73O 1IZZA 4LY3A 1FDWA 1GUBA 1I5RA 3GMDA 5I9TA 1KFCB 3BERA 3AF5A 4MNTA 3PPVA 3O7WA 1VSVA 4XGQA 1SVUA 3LIIA 1SBNE 3AZOA 2G8LA 3N74A 4XUGB 1BFUA 4X20A 3LVFO 1H1TA 3FUWA 3H5AA 4NZZA 2OQVA 4B47A 4R2KA 1OLOA 4DB2A 1C3OB 3JQDA 4YNBA 3H2ZA 2ZK7A 3E18A 2JLSA 5LIPA 3RYFB 4IH9A 3HVUA 4FKMA 3ZWPA 1Y82A 1KIFA 4KYTA 3NVDA 3IHKA 3ZEIA 1Z7GA 4PYQA 1WXGA 4M1EA 4W7IA 4C07A 2AN1A 2EJUA 4AMZA 2A4MA 3CE6A 3NHZA 2V5AA 3E22B 3DGEC 1KP3A 2VNIA 3K0EA 3PHHA 1QX3A 4Q3OA 5C8YA 2O23A 1GQOA 2ENUA 3DBVO 1JHYA 4KBYA 1WQ1R 2D2IA 1P3JA 1WRBA 3GJTA 4IYJA 3NHWA 2C2BA 3OBIA 2X15A 3EXG2 2B8NA 3W06A 2VHTA 1C9JA 1D1SA 1XVIA 1J99A 3G5TA 4BB6A 2LTAA 4WASA 4B3JA 5A9RA 3EFOA 5A0TA 2CHQA 3KVOA 2WVHA 3EFHA 1EVZA 1FU8A 1WDTA 4BBJA 3NUQA 3RROA 5C81A 1J8MF 3L2OB 3T5MA 2VZ0A 2AV6A 3RKSA 4LF8B 1O6CA 4MEBA 2XECA 2KE5A 1VJDA 5I9LA 3UV6A 3KTOA 5KNBH 3VNUA 3FR7A 3Q98A 2ACVA 3DP7A 2Q28A 3MMXA 2JGLA 3MWDA 2JAUA 1B16A 1IQRA 5D6OA 4B6RA 4WINA 3VR6H 1RD4A 1U9CA 1YHZA 3DMTA 2A9RA 1FJ2A 2PIAA 4Q4LA 4X20B 2OK8A 4YBRA 2HGSA 3R40A 2CLOB 4Z4GA 2IIPA 2BGIA 2P69A 2C2ZA 3IQGX 3Q7TA 3PDJA 4IUYA 3ON5A 4QQFA 3UPTA 1ND5A 2Q5CA 5IBCA 3E15A 1VHTA 1EXMA 2AG1A 3IELA 3WWEA 2WKPA 4UFPA 1QGYA 3EC7A 2WWWA 5KJ6A 2IYWA 5IDQA 1XRNA 2ZKLA 1KQFA 4W5TA 4TZ6A 3V3TA 4AW9A 1QVAA 1ULUA 3SGLA 4CLXA 4PAWA 1HDOA 4B3RB 3B9PA 2A0KA 3C4VA 3ZHUA 2IHVA 2AN5A 3MCTA 4DBLC 2P9EA 3ZHSA 4L9SA 1ISSA 2Q6OA 1N6KA 3IEIA 2DLNA 4JAVC 1OI3A 4LHSA 4KUGA 5F2KA 3EIUA 4WOKA 4H2DA 1F0PA 3EFOB 3PR2B 4M99A 2G17A 1ZESA 4QJBA 4JP1A 3UIEA 1XJWA 2DQZA 1KJNA 3C8ZA 4H77A 3F1LA 1O87A 4KN8A 4YHBA 4KR0A 5D1HA 5EQTA 4B7CA 3X2EA 4MUMA 4H9GA 2YYSA 2R5FA 1H6BA 1JR4A 2NTEA 1JZQA 1E92A 1RMYA 3EQZA 4JLMA 3W1WA 1SOWA 2WNHA 3ZY4A 1YS9A 4RKYA 4ZD6A 4ZEWA 4A6EA 3OZEA 3EQ2A 3IKVA 3OURA 3MWDB 1BE6A 3GB9A 4EI8A 1BHQ1 1LX6A 4B6QA 1YZQA 5BVHA 2NTNA 4N65A 2DPHA 4OM8A 4ALMA 3CX6A 2GCIA 3IBFA 3T3MB 3LPDA 2VWHA 4W5NA 1Q1QA 5LJLA 2WE7A 3MJRA 4FUTA 4RADA 4CLHA 2H54A 3PC2A 1SUIA 4P08A 1P8JA 3DUWA 4W6QA 1LW6E 4A8JA 2GZSA 3X2FA 4M86A 4BFLA 4QWWA 5AH0A 1V48A 4M4SA 2X7HA 1KEWA 4HDSA 4PSVA 4EW6A 2P2GA 1DV1A 4DWJA 3ENZA 4G0PA 2E4XA 3FPKA 2JVKA 2XLCA 1G55A 2P5SA 1JFLA 1A2KC 1I1OA 3MM4A 4GOND 1IEVA 3VPGA 2UZ1B 5HEKA 5JQGA 3WHLA 4HNUA 4YWJA 1RWPA 3WP0A 2HV8A 2PIDA 1P9LA 2IW3A 2X3UA 3UMCA 3BHNA 2QLJA 2DCUA 2O2IA 4OBXA 5GVRA 4M37A 5AVJA 4G5FA 4F38A 3BIWA 1U80A 3KV3O 4X44A 4YLYA 3OE1A 2BWJA 1CY4A 3Q85A 1J2JA 2Q0HA 1PWEA 3DM5A 3LU1A 4KXWA 4M8NE 2J7KA 3MBOA 1CJTC 1G17A 1WDMA 2YVAA 3C41J 3GEPA 3PQ6A 3Q9UA 2WJ4A 1CNEA 4XYMA 3DHNA 2XSZD 3ZHYA 1WUTA 1XQWA 2H4ZA 1U7PA 1Y5RA 1ZSYA 3HB7A 4LC1A 2FWRA 4EPYA 5EJ9A 5HJ5A 3BPSA 1KVSA 2IYEA 3PYLA 4C0KA 3PKJA 5EKTA 3U5ZB 1PYDA 2WHPA 1SIUA 4P0PB 3HBAA 3DKPA 5DHRA 1HF3A 2IEGA 4V0RA 4OHXA 3DLBA 1FYVA 2JLYA 4RA9A 2YMMA 4ZCPA 2FV8A 4PQEA 1F7UA 2PT6A 1E9VA 2ZB3A 3CIOA 3EULA 4HNRA 4XIJA 4E2FA 5BVHB 4RQUA 2XUHA 5KEIA 4I9GA 3OJCA 1TJYA 2E0IA 2OM6A 2I3DA 1WB4A 2Y66A 4K6HA 4RGVA 1RYFA 1NWHA 1ZM3A 4I1YA 4PVDA 4HDKA 1UXGA 3VU9A 4E5KA 4F92B 4LMPA 2O07A 4HX5A 4CF5A 1ZZEA 3BZWA 3EDRA 4YEDA 2AZMA 1GR1A 2CY0A 3OCUA 3AL3A 4POAA 3ZWCA 5AKKA 3ZD7A 4M0LA 1Z5ZA 4HDSB 4B3FX 4LJ4A 2VF2A 3K1ZA 4CGZA 1SVSA 3SKVA 3ODPA 1FB5A 4EO9A 5A1TA 4O59O 5C8XA 3A6PC 5JH7F 3ONVA 3USZA 1GV0A 3UHOA 5CDUA 1UADA 3T5CA 3WXBA 3X1JA 3T0IA 4HLQB 1SIBE 2KPOA 2QVYX 3COYA 3K1TA 4TS1A 3S68A 2HBRA 1M2GA 4NZOA 5DEOA 3OLCX 4ZAZA 1A8SA 4L74A 1N0IA 3WLJA 2JFHA 2FK7A 4QNNA 1KJYA 1UXOA 5E1BA 3HVIA 1JJAA 1C30A 3CE9A 3GJ6A 1B43A 1S01A 4HS9A 5EVJA 3FWKA 1UIRA 4P5DA 4RJLA 4CNBA 3Q8KA 3GEBA 5TEVA 2BONA 4QDTA 3N8NA 4JJ6A 4Z9FA 1YF3A 1K68A 2X4LA 2WHPB 3PXAA 3WGYA 3KQTA 4J3FA 1CKEA 2PWPA 2I1QA 3IP7A 3B7WA 4D8VA 1VMKA 1CWUA 3FPEA 4RA9B 2GZHA 5E3JA 5GOTA 5L7TA 4LXUA 1NXOA 4Y6LA 4QEZA 5JALA 2LZ0A 4BX2A 4I4CA 3EIQA 5TEWA 5I7AA 2H85A 5JAHA 1KS9A 3OWOA 1J70A 2JRLA 3K9BA 4KC0A 4N7BA 4HDKB 4XCVA 1E0SA 2CL0X 1CR0A 1XCBA 4YCJA 3VU9B 3VZCA 2R7KA 4DTIA 5K3EA 3BCRA 4AJEA 1JQ3A 4YDQA 1LI7A 4I36A 2QTMA 4JC5A 3TAXA 1GUAA 4QOEA 1SOAA 1E9BA 2G82A 1U0HC 5GIPE 2N9UA 2DQ4A 1FYXA 2H11A 1XWWA 4B6GA 4LKRA 3C98A 4TQGA 3IMCA 4B71A 1EIWA 3PIDA 1FDVA 2O52A 4KMOA 4RABA 3ZH2A 4EGFA 4BVGA 3SLRA 3QYJA 2LE0A 2AUTA 4BNZA 4OXIA 3CF4G 3ITEA 4OYYA 3UV3A 5AM2A 3KB2A 3M83A 2RBEA 3BOSA 3QKUA 4KQJA 4QUGA 3OX2A 4DQ0A 1TC2A 5DASA 2PL3A 4ZJPA 2GTPA 1E1QD 1DKLA 1O8BA 1X74A 2FN7A 3IV7A 4FINA 5CVUA 4E08A 4ERNA 3Q9SA 1RRMA 3ABZA 4FIZA 1R4NA 3TZHA 3CNBA 4EYQA 4B4WA 5DPMA 1JU3A 3LW8A 1N32B 1IZYA 3HR7A 4QGBA 1D09A 2FG7C 4RCYA 4WLVA 1APBA 1EPUA 2XNKA 4AKHA 1P45A 2NV6A 1ZJYA 2I7DA 3H2GA 1QZTA 4TKVA 5JECA 3RG8A 3WC4A 1GZUA 5EQJB 4R1MA 3DDSA 5NLLA 3P0EA 5B12A 1E6CA 3TN7A 3AZQA 4N5IX 1J56A 5F5NA 1RW4A 3HJHA 2B2NA 4JSYA 3ORQA 3MFYA 2QTFA 4LECA 3UH1A 4DLYA 1V96A 2ZBRA 2E5LB 1U3CA 3A1NA 3O93A 4TL8A 4NHOA 3RVDA 2DULA 3VSEA 3ZPXA 5KNLA 3N2ZB 1ZKDA 3HMKA 5LKAA 3DO5A 3UMFA 5FI3A 2BEWA 2C84A 2AZ4A 4Q9NA 4JITA 2YDYA 2CVHA 3KAJA 4KW7A 5DCWA 2R00A 1YT5A 4F5YA 2XVXA 1AN9A 1QZ3A 4HEA1 4I1UA 3U3JA 2ONKA 2KS6A 2XPCA 2XYGA 3WNBA 3M3HA 4I1PA 2W98A 3P9NA 1AZTA 1RHMA 2DHRA 2IY7A 4DKJA 1NYTA 4QREA 2RGGA 3PJDA 1EGMB 5IASA 1UINA 5AVVA 2D0PB 1AXEA 2Q2QA 2RGRA 1WUHS 3WMGA 3QKWA 2BF7A 1THMA 1ISPA 4ZGWA 4OHOA 4FEEA 3QQ5A 4BDSA 2IE8A 1YS4A 2F62A 2IZ1A 1EESA 2R6DA 2B4TO 2XAAA 5J2UA 2RH5A 3MYRA 2IU6A 5JZMA 2QIOA 2Q5JA 2XHZA 3BHJA 1PLJA 3W4KA 1VSQA 1NF3A 4NTZA 1GPNA 4X6UA 5AKHA 1DQRA 3VR6A 2HQRA 4RVGA 3DE0X 3HCOA 3A9TA 3WGVA 3AY3A 3GLTA 2R8YA 1WF6A 5CTAA 3R7DA 4DG8A 4WDQA 4EY5A 1BDJA 1F8YA 3QKRA 3TBFA 1GP2A 4BMVA 3K71B 3LHSA 3V97A 3U3OA 2GA8A 4DLRA 3H0CA 3RABA 3TPFA 1M2FA 1AIPA 1GNTA 1ZK0A 4NJEA 1CFJA 4ZVMA 1T2CA 3ZGXA 3IMEA 4MKZA 4KSYA 4M1ZA 1NONA 3DBHA 2C2WA 1EVIA 4E33A 2AZTA 4Q66C 2VCEA 1YZLA 2XXAA 1TF7A 4PG6A 3MWLA 3LT2A 4OP2A 1SM4A 3OT1A 4XZ3A 5E7IA 4I5EA 1R4AA 3UK7A 4QYIA 2BEWB 4TOIA 3JATA 2BKVA 3ZKAA 3H5OA 1MDBA 3SMQA 4IFBA 1EK0A 2Q8PA 1BS2A 3KAQA 5IVPA 3NNNA 2OO5C 1UFQA 2FETA 3FTNA 3ND5A 4BP8A 1L5WA 5LYJF 1NPTO 2XZOA 4XOUA 1YAHA 4DYVA 5B3AA 4P58A 4WA7A 3ZIAA 1A96A 1IQ0A 1J1ZA 3D02A 3MS7A 1QANA 3ZV4A 3N5CA 4J16C 3UANA 2ODWA 3THWA 1WY5A 5HCNA 1U0RA 4DQDA 1JPJA 3FPJA 5IHPA 4RE5A 1KSGA 1U7XA 2JIZD 2C5EA 3A4NA 1CQZA 1NWCA 5J2UB 2HT1A 1YA8A 2ZSUA 1XL0A 2OCKA 5EE9A 1PQ4A 1A9OA 2E4UA 3FJ1A 1H4QA 1E18A 3AHIA 2B6NA 3LX5A 4L78A 4JEIA 3G2OA 1K3FA 3FYUC 4PYJA 2XBMA 1JIJA 4ER0A 5CLGA 3HV2A 3WISA 1E5LA 3CRNA 3S8MA 2X2OA 1HTWA 4NJEB 5JSUA 3I42A 4MV0A 5K3OA 2JVJA 4G4IA 4E5SA 4NH0A 1IBLB 2IYYA 4V1CB 5EOVA 1DCFA 2OAP1 1BX1A 3KZVA 5E6SA 3TGPA 4TTTS 3HYLA 4OXKA 1II9A 1ECLA 2NN3C 5LQMA 3WA7A 3NH6A 4Q82A 1JBKA 4BJHB 4QJIA 2IYSA 3OT1B 1DNPA 2VJNA 5KDDA 1C7EA 3T3PB 3JATB 5GONA 4PN3A 1THTA 4HAIA 1F8UA 4WOBA 3QE4A 2OXRA 1QUEA 4M2LA 4KR2A 1T2EA 5B55A 1R2QA 1W29A 1KI9A 2AT1A 5HR5A 5GADl 5LCXA 1TAHA 3PHCA 3QF4A 3ZVMA 2NSHA 1XNHA 2OFOA 3P20A 5FBHA 1ORIA 2M6SA 3R24A 3GGJA 2D4HA 4XVRA 2JHFA 2YXLA 4LSWA 2FPXA 3I4LA 2JH3A 3THWB 3A8TA 1K4YA 4PXAA 1IZ0A 4TLCA 5E7QA 1SU6A 2FX3A 4D81A 4OHKA 1R4MA 1DC5A 1WCIB 1Y9DA 1WXFA 2X6TA 3FETA 4HQFA 1CYDA 3DOIA 5BYKA 4RKWA 4ZO4A 3S28A 2ZR7A 1NZFA 1GYQA 3C4JA 4GI7A 2X0FA 5TVGA 4JJ8A 2GYWA 2H8KA 4JSRA 4RZUA 2YWXA 3OCJA 2I2XB 4A6XA 4JI1B 1X0VA 3H05A 4B0OA 1NAHA 4NARA 4PQFA 2H2GA 1BGVA 4KAFA 3ABOB 1ZITA 4GFDA 2NZYA 2VPZA 1UP7A 1SELA 5FLEX 4TQ9A 4YJ3F 1YK0A 3ROEA 1KC3A 1G7TA 1LRLA 1HT0A 4DUGD 3SSAA 2XCSB 3DV2A 4ZK2A 4C7OB 2AYZA 1RJWA 2VPPA 4QPZA 4DQLA 4NCBA 4KFTA 4BQSA 1AGXA 4JBYA 4O2AA 4X94A 3RJ5A 5ADUS 1OREA 1J22A 3QE0A 4OHUA 1W2WB 4XM1A 3C6ZA 1TQHA 5GONB 2R25B 1P7CA 2VRCA 3PGMA 3VHLB 1BNCA 1RABA 3KKZA 3NG1A 1CZRA 1F9AA 4MHOA 2DBYA 3EVDA 3RIMA 1NVVQ 1MD9A 3ORYA 4FR5A 4B80A 4BCCA 4YMHA 1P1RA 1P4HA 3AJEA 1KFJB 3QF4B 4BV8A 1HDEA 4D8YA 2Z2JA 1R6AA 3H5RA 5BW5A 1ECBA 3ZWBA 1XNQB 2ZXFA 3O9MA 2J0UA 3RG2A 2GPNA 2YY7A 5F4BA 4YYEA 1ZD3A 3V48A 5L45A 3KEQA 1N33B 3W8RA 3OD1A 3OQMA 1C7FA 4FWBA 1R4MB 1TFUA 2O8NA 2EVWX 3GLHA 3NBKA 1QCCA 1CIVA 1NI4A 2IH4A 3LXUX 2HLPA 3RTBA 2DR0A 2H7YA 1VGRA 1XP5A 4CV1A 4D0NA 3FWZA 3VHQA 3NO4A 3IP8A 3R3UA 4FNOA 4JQZA 4HYQA 1HFEL 1GG2A 2C61A 2I80A 1YB2A 3BKXA 4II3A 3NV7A 4LJ7A 2E9SA 3ESYA 3PNOA 3S1AA 1GTMA 4M9QA 4TT8A 3AR3A 2WJ3A 1RJDA 1Y8CA 3TNLA 2HOQA 3A1FA 3OIWA 1VCHA 1Z8HA 4M0EA 1IIRA 3V42A 4IIDA 4RBNA 4BO6A 5B6IA 3N0WA 4K40A 3AY6A 3IEKA 3QUSA 3ORHA 4EMSA 3FNGA 1TYAE 4RK5A 3VXKA 5IAAA 1P61B 3LCCA 4Y6SA 3RC7A 2P27A 4WNAA 1XVTA 2PV0A 2CF6A 5DLEA 3JTEA 2O8VA 4G07A 5HMLA 3T4XA 1V3VA 1X19A 3O3OB 3OC0A 3RUPA 3A05A 3STWA 2HPHA 2W8BA 4S3MA 4KPUA 3SZ3A 2BEKA 3ZC3A 4EMBA 5LWHA 1MEJA 3ZZNA 1T13A 3P1JA 4J1QA 4MJLA 4O63O 5LZ7A 2FCAA 1ZUD1 1XG5A 4ASUD 4NOJA 4AZVA 2J0UB 5FUBA 4OXXA 1I30A 3EXAA 4RANA 4Q4CA 1HEUA 3ASYA 4TSFA 3TQSA 3QA9A 3FGPA 4W9NA 5IEBA 3JWIA 3DDHA 3WIVA 2XYVA 2CWDA 1TCUA 1U0NA 3HPRA 1WZEA 1ICEA 5DE3A 1E3EA 1N2EA 3GLHB 4R2HA 4EMUA 4Z2AA 3CX3A 3FH0A 1BX3A 10MHA 1H8HA 1KO1A 1Q0LA 3RU3A 1OFUA 5KVVA 1IVNA 1KO7A 4HGQA 1W52X 3DMHA 2ATVA 3GPCA 4U4AA 5EJFA 4BC1A 3LI2A 4IQGA 2QTZA 3O3MB 1LV7A 1PL0A 1N6PA 2OSVA 3GRVA 3S1AB 4HV4A 3RBZA 1VPVA 3BH6A 2IUSA 3EIEA 4GR5A 4QATA 2QRMA 4R5HA 4UM5A 4Y18A 2J6BA 3ID6C 1LK7A 1EVYA 1MMFB 2BFPA 4OP1A 2PKEA 2G09A 2QD5A 5TJ9A 1UBRS 2Q3EA 3LPLA 4KXXA 4WT7A 3EVAA 4PE5B 5IAOA 4EYSA 1GNRA 5JSYA 4WNAB 4QDXA 5BVGA 2LKDA 4HADA 3AEUA 2J4DA 4LVNA 1TLTA 5IARA 4W7SA 4F3YA 3QFHA 4J0DA 4WY8A 5LNK1 1RYNA 1FFXA 4AF6A 2ZR8A 1V2GA 1RTTA 1EDOA 2GN1A 2XZDA 2OCGA 3CLRD 2AC2A 3NC4A 1I2MA 2W8BB 1BRMA 2A6PA 2IYFA 3BRQA 3L1HA 4KPUB 4FB5A 4E09A 4QC2A 4HDNA 2OMEA 3OU7A 1PQWA 3BB4A 3UM9A 3G9UA 4ADSG 3DR5A 4ZALA 1LI4A 2DT5A 2IEIA 1IK6A 2JKVA 1NP3A 4G3XA 2XUKA 4IM7A 4OSOA 2GOYA 3LRPA 3ML1A 3NJRA 4XWKA 2DF8A 2I1VB 4GH5A 2SKDA 2FLKA 4L2IB 4RLSA 2H0QA 4LCJA 3DMDA 5CA0F 3GFBA 1EFUA 4DLWA 4F12A 3NWEA 1FYEA 5NULA 2VJQA 1UPTA 3RVOA 5H3LA 1TUIA 3ECCA 3X1ZA 2APJA 1XAIA 3QMMA 4UUBA 1GRNA 2NVWA 5ER6A 1RI4A 2ANBA 3DF9A 4JGBA 2Q2NA 1PDOA 1BU5A 3ZI4A 1J2TA 4DRYA 1VPDA 2F55A 2NXNA 1L3BA 2IS6A 1JEDA 1LDMA 1OYWA 4HRAA 4AJLA 1A8QA 4ZEVA 2DLDA 4A5SA 1PSZA 5A2QA 4OHFA 5KI6A 4ETNA 3V80A 1NKVA 4JEMA 2EV9A 3H9CA 4MV6A 1QHEA 4R05A 2GZ2A 4LBVA 2NYRA 3QKTA 4LYDA 3EWNA 2JHAA 3ZWMA 3SR0A 4NPAA 4KQGA 1K5HA 4Q4HB 2ZCJA 4JB0A 1MO2A 3C3EA 1Z75A 1P80A 4CKWA 3AEUB 4TVOA 4FZ5A 4F8EA 1PFQA 3F5QA 1N57A 2LPMA 1FFXB 1T9AA 7REQA 3M81A 3CGWA 3HKEA 1SXQA 2FRDC 1DBIA 4RPLA 3SBOA 3SE7A 3LHKA 1GOTA 2LP4Y 3SXUA 1X7YB 4YUXA 1LVGA 3O26A 5BUZA 4HDNB 4TUYF 3CLSC 4YO8A 4RUKA 4LYAA 2ERXA 2B7LA 3EGEA 4D8WA 3FVWA 4PCVA 3ECAA 3TBKA 3FDJA 3AR8A 2RAVA 3ZCSA 2Y77A 4OGKA 2GKOA 5I51A 1LQUA 2NPOA 2ZSKA 3KO8A 3D6TB 3J80A 3PENA 4YRCA 1GGKA 2XMGA 2LDBA 3OPMA 3G8DA 4HLUA 1VP3A 1T4DA 5K6AA 2P4HX 5IZCC 2CVQA 3TVDA 2OQIA 3PUJA 1B4DA 3CVXA 3NHRA 1CRQA 4FFBA 5CD9A 2YVKA 1WL8A 2QG9A 2XADA 4DR6B 3N2KB 1ZGJA 4R9RA 4RD4A 4PNHA 1FZQA 2DUUA 1S0UA 5I3ZA 1OWPA 1Q0UA 2O3SA 2RC6A 3AP3A 3MJDA 1OBCA 3K94A 5HM8A 1KVTA 2HBZA 1Z4LA 2BI8A 4LUCA 4MI3A 4YJHB 3L7AA 2Q46A 5E7MA 4YMGA 4I14A 3RSSA 4FFLA 3VYWA 5JISA 1UPFA 2Q6VA 5CFZA 3T3IA 1SCBA 1DJNA 2B4QA 2QLFA 1UP4A 2I4NA 2RD2A 3GFSA 4EGJA 2EYUA 3G82C 2VF4X 1XTZA 1PJQA 4LZAA 1RBMA 3JY6A 1YQXA 4TXNA 1AHIA 4R8MA 5FQNA 4XRRA 1J09A 1BSVA 3HQ4O 1XF9A 4ALKA 1DVRA 4Y2UA 4Z51A 3WGHA 4CKWB 4UTRA 1E1DA 2DTDA 2NSYA 3UAWA 2I3AA 3RS5A 5KJFA 1TPZA 4IIXA 1S9DA 4BWVA 1JLLA 2BZGA 3HC7A 3HKEB 3F6RA 3SXUB 1UOQA 2Z8YA 2EKLA 2PEZA 2Q2OA 1JZSA 1GO2A 1GSAA 3C97A 3DOHA 3M1YA 4YMSA 2NO7A 3DG9A 3VZPA 3FUCA 4BWFB 5KYNA 1PWZA 1S7GA 2AKYA 1U0TA 3E9YA 3IPAA 4U7GA 2Y27A 3DZBA 4JY7A 4RPGA 3WLHA 5FH9A 5B36A 4NMXB 4GGMX 4Y1RA 2QTBA 2FZCA 5MHTA 3LRXA 2R4UA 3IHTA 3DXYA 2JBHA 2H2WA 2WD7A 5T41A 4IHKA 4CKCA 1REQA 3KYJB 1UWCA 2M1XA 4R31A 1HNXB 3AUXA 4IFIA 2GPYA 4C4RA 3EB9A 3G8AA 2IXAA 4O5AA 1JXMA 3RNLA 2XCLA 4IEFB 4FFBB 1WUJS 1JHPA 4MROA 3C3MA 3SHWA 4D25A 4FXPA 3IEPA 2RGWA 3GG9A 3NNDA 4R3NA 4LBYA 5JC1A 5DP2A 2Y3IA 1QB8A 5IC6A 5J5VA 2PT9A 3O3NB 4I3HA 2VRWA 2NQ8A 1JIQA 3F73A 4ZTZB 1RLUA 3OY7A 4E6PA 2PQ6A 1R0BA 4H7EA 4UVHA 2G70A 3RV4A 1YR1A 3BUSA 2XVMA 2Q3FA 1NNUA 3HCBA 3D3EA 4A27A 2CLMB 1N0HA 1NW7A 1HYBA 2WAOA 2YCBA 4BNFA 2P65A 3O03A 1T5TA 2J9ZB 2H1IA 2WWFA 3I5MA 1TQ4A 1IOLA 4JIMA 4DVJA 4WERA 4Q1BA 3VH3A 1WAMA 3W7VA 4ZIRA 5JH7A 2GVZC 4ARSA 3A1VA 3UY4A 2GLXA 2P9BA 1US8A 3UJHA 3I5YA 3B48A 3AFGA 3PVCA 2D5CA 3DKRA 5HF8A 2ATIA 2YY5A 1MO5A 1C9MA 1PS0A 5K0JA 2GZ3A 2YDXA 4IV0A 4CW7A 3UF0A 1AUQA 1O4VA 1SKYE 3CJTA 4U7HA 4XM2A 3UMBA 3C8MA 4FMCF 3FVVA 4RK7A 3IDQA 2DFVA 4MW2A 4ENPA 3M2PA 5A0FA 4I9FA 5BQXA 1KJIA 4J2OA 4PHHA 5EESA 1REQB 1XF1A 3G0CA 1U7ZA 3LDGA 1SJ9A 4DV2B 3MS4A 4P92A 4M0DA 2G1AA 4LJKA 3RU9A 2FR0A 2QTAA 3DS8A 3RAFC 2BGKA 1Z83A 3JVIA 3NFYA 5F33A 3RLFA 2VDVE 1OTXA 5DXJA 1V7PC 3IILA 2PAAA 4AY2A 1Q21A 3K72B 2PFKA 2ZULA 2CNLA 1EHYA 3O91A 4F45A 3QPVA 3OMXA 2F3QA 3RF6A 2X5KO 5CNKA 1RWOA 2D1QA 2VOJA 2FY8A 4DA9A 1D03A 5LP1A 5D3MB 3DKKA 2FGJA 4C7XA 4KLRA 2IUFA 3PRJA 5JY6A 3D4PA 4H7DA 2WTXA 1VKZA 1K0UA 4R51A 4UQOA 3FMPB 1VHQA 5FPQA 3ANMA 3QELA 6PFKA 4MUXA 1QH8A 1ZBQA 3HA3A 2IY9A 1F0YA 2IOYA 2JFWA 3A9UA 4QXOA 3RLIA 2PS9A 4MVJH 4B31A 4C7KA 2BI4A 3BB3A 3C6MA 3SJUA 4E21A 1QFJA 3DBLA 1A9ZA 5JH7B 2V03A 2WF9A 4JJ7A 4LZZA 4NDAA 5TT0A 4EB3A 2BEJA 4IR7A 1J9ZA 2I03A 2V9ZA 2E55A 4PS1A 5ILGA 1DCKA 1GPYA 1F2UA 1PQYA 4LK3A 2VG8A 2JHPA 2V58A 5BSUA 5KSYA 4B17A 4UBLA 1D2CA 1USWA 1R1DA 2TRSB 1M10A 1Y6RA 4ZT7A 2AXQA 1USVA 3B85A 1U6IA 1W4CA 3A4VA 1SK8A 2R2AA 4HFMA 3H5VA 3HU2A 2H4HA 3WKBA 1IHDA 2FEAA 3BGIA 1KA9H 2VZLA 3A1TA 4ZVPA 5IANA 1RM4A 1CC1S 2HLHA 1OR8A 2OM2A 4FSXA 3NETA 4PEVA 1J2RA 2XRYA 4NS4A 5EC8A 2GFQA 2WZDA 5FR2A 5TY0A 3T1NA 2N46A 4MQUA 1OZHA 3G9ZA 2YZ2A 5HGJA 3UCEA 1UPCA 1VL6A 3OKAA 3I37X 4RH3A 4AZWA 1BMTA 4Z4HA 4IDQA 1Y37A 4B1FA 3BWDD 2XIJA 4GWKA 3U4MA 1T0IA 2O1WA 1W47A 3QXXA 5KNBA 1AKYA 1LF5A 2ZXEA 2D5AA 3PFHA 2FTKE 1ZL0A 4TMWA 4G01B 3RQSA 2CJWA 1MT3A 2IY8A 1U1CA 2Y2VA 2POQX 1QVWA 2R8PA 3NVMB 4P80A 2XOKA 3QELB 2JCBA 4Q3NA 1MZVA 1QH8B 3PSHA 4UZEA 1MC5A 2HA2A 5H82A 4K3VA 3NTLA 5T64A 3IPYA 3LUBA 3VPFA 4D56A 4E4YA 3U5TA 1GAQA 4EG3A 5L4LA 3LIPA 2Y2UA 3OZBA 5IT9A 3DBLB 2LVBA 2NZVG 4FWIB 1PBTA 4DMHA 3ZD9A 3FNRA 3LT1A 1UJMA 2GO7A 1UBFA 4URUR 3EGVA 1F2UB 4LGVA 1J8DA 1DAGA 1E5TA 1GEEA 3GNTA 3TCKA 5KSZA 4FYXA 5IUNC 1N2XA 3LWNA 3CFYA 4XX1A 3ES9A 1KE2A 3ZU3A 5LL6P 1QPZA 2E5WA 4ZV7A 3K0CA 3B1KA 4L8VA 2Z9CA 2I7VA 4GP7A 3KAPA 5J23A 5AP9A 5B1YA 2C3OA 3Q3EA 4JOSA 5DV9A 3V1TC 2DZDA 3MN1A 3WK7A 1YJXA 3ICEA 4RPCA 3E23A 3TB4A 2C54A 4KQHA 1PX2A 4WLOA 5SY4A 5K8IA 3FFAA 5DEIA 3ZYCA 4CL8A 4O2LA 1JXQA 2J07A 2VNKA 3SYLA 5CEEA 4B81A 2GPAA 2EG9A 4TXJA 1K5PA 4Z2YA 4RPJA 2QG6A 2J3LA 3K3PA 1UBNA 3B5JA 1Q7RA 5CPFA 5BMVB 3E2IA 3N05A 3NLLA 1MORA 4I1VA 5H83A 2G0NA 1IEXA 4UFOA 1QMPA 5KMGA 5JWHA 1WMEA 1IFXA 1QO0A 2QLBA 2RIPA 3CKKA 4R1LA 3ZDXB 2X8WA 5IJWA 3ETHA 3OZXA 1VTKA 3BFKA 2VC2B 4N5MA 5JSQA 2AVDA 5JLAA 2C58A 4DA6A 4EDHA 4BFSA 1YZNA 2R6ZA 5E4TA 2O3TA 1RCFA 1ZGCA 2CJWB 3A70A 4S35A 4Y7DA 2VSNA 3A3OA 1YGPA 3SEQA 4UDOA 2YWDA 1KPHA 4C0HA 2YN2A 3I9V1 1QFYA 1VSBA 3DHEA 3HNPA 4I6JA 4LMAA 1QHXA 3OFND 5LYJA 3U3RA 3V34A 4UDXX 4ID9A 3GGOA 1AV6A 1MVOA 5KNCD 4KSCA 1VDMA 1YUNA 3CWCA 5KJCA 1PJ2A 1U3WA 3MINA 3G79A 4KO4S 4ZU6X 3VV3A 3RRFA 1JFRA 2D1SA 2QRLA 1DQPA 5AJUA 3IBYA 3A1DA 1SUSA 3AVQA 3S8YA 4AZ0A 2YOHA 1TE2A 3UB2A 5TGZA 3OLVA 3QTLA 4YA6A 3G2QA 4D1YA 2CB9A 1Y5NA 4X7MA 3E9NA 4Z8XA 5EE5B 3K20A 2YKGA 3BD6A 3AR2A 1JYSA 4RLHA 1LQTA 4KNWA 1NXVA 5DTEA 3G5AA 5IT0A 3AQ4A 4ITUA 3IMKA 2DQSA 1I3LA 1V8FA 5CJJA 4LN1A 5EJ5A 1XMIA 3I58A 3TRFA 3O94A 3RVRA 2X0RA 3V4VB 4ZEMA 3U39A 4H6VA 3ZQKA 3EH1A 1L1QA 1LDYA 1TCBA 3AHHA 4CUKA 2AI2A 2NZJA 2E4VA 5HF5A 4L02A 1GRCA 3PLAE 3BIOA 1DQZA 2VYCA 3I04A 3QTTA 2BMJA 1IXYA 1DAIA 1NFFA 1NYQA 1QQTA 2DM6A 3OZSA 1FFBA 2GD2A 2EZ4A 2REXB 3S0JA 4EI9A 3AM5A 4EL0A 3R8FA 5KMGB 2ZXUA 5DNCA 4LDJA 1NVKA 1DZIA 2PLAA 1HNZB 5K8LA 3OTGA 2YXBA 2I29A 1X87A 2OG2A 2EATA 1KAEA 3I9MA 2X0EA 2BFDA 4LG1A 2B8EA 4BO9A 4K26A 3SYKA 4H60A 2IF2A 4AD8A 1EWTA 3D3JA 3S5UA 5CW2A 4IGFA 3SNKA 4GZ6A 4GYYA 2P6PA 1FCJA 3TTXA 4A82A 3F3YA 2D8MA 4A0FA 3RYTC 4E5UA 2V98A 3T5BA 3EA5A 4RJKA 3PCRB 1RZRA 1AKWA 1DKQA 3BXPA 2OCPA 4UDNA 4HEHA 1O89A 5LYJB 3H1GA 2WSBA 1UZLA 1NXSA 4HRVA 2J45A 4V0OA 3BXOA 1RXSA 2BGNA 1XP8A 4GR4A 4M1YA 3MINB 2PS3A 2QE7D 3BJMA 2RJOA 1SVLA 2OO3A 3IAEA 4PQRA 3S27A 4AZ0B 1FFDA 4DLKA 1K97A 5A9TA 1LCIA 3DFUA 3W3AH 3T7KA 4WK6A 3QVOA 1VYTA 1NJFA 1R0CA 1PSDA 1RBQA 1IE3A 1T6YA 2AGVA 3DZ8A 1L4NA 4Z6KA 3OC6A 1G3UA 2QW8A 4AJ2A 3JQEA 5ITWA 1YE8A 1OFHA 3E7PA 3DYVA 3HDQA 4HEJA 2I91A 1FBTA 4N3AA 3D64A 3ESDA 1ADFA 2FWIA 2VAPA 3FJYA 2Q0SA 4MB0A 1ACMA 2XUIA 3AUFA 4CT0A 2FPOA 2G7ZA 3ABRB 3ONDA 3LP6A 1UP6A 2JLUA 5JMTA 4FD3A 2ZBVA 3AY0A 4YJ3A 5LLDA 4N48A 1WW2A 5JO9A 3H2SA 4OHWA 1R0YA 2YXEA 3C48A 4QGHA 1TYBE 3RC2A 4CPDA 3WA6A 5BSVA 4ZICA 5HS4A 4TTAA 3C3YA 1UM8A 3FPLA 4LXYA 3T34A 3PWSA 4UMFA 1J21A 2OAEA 1PEAA 4ICIA 1WPQA 2V9PA 2VNAA 4IKEA 5FF9A 1W4RA 3AH8A 3QRWA 2G07A 3OZCA 3QITA 5CFPA 2L19A 3DYBA 2PRYA 1KYQA 2GGSA 5KNDD 5LQCA 4PYMA 2O1XA 3NJ4A 2BFMA 3SVTA 3GT3A 3GG2A 2B4YA 1TT7A 2P6OA 4TL6A 4ZCTA 3MMPA 3NKLA 2ATXA 3GDHA 3HUFA 3KUDA 1ISGA 2OBMA 3KLPX 4AIRA 5TPZD 5TT1A 2PRSA 3IXLA 4OYHA 1H8EA 3H5TA 4W6ZA 3PWKA 3QLTA 4MOWA 5FBWB 2H8GA 3O2JA 4S2UA 4FN4A 5B7NA 2X77A 3IQZA 4OQFA 1ZM2A 3BILA 2VBIA 2EDAA 4MRPA 1FNMA 2WHXA 1PJBA 3IUYA 521PA 2HYIC 2UZAA 3L7IA 1V11A 2A1UA 2DKNA 2GS9A 2V6BA 3WKAA 5DW0A 4DBZA 2B78A 1GCOA 3G7NA 1DXYA 5IK2D 3D2AA 1RU3A 1L7RA 5DNUA 2PYZA 5T8KC 3H19A 3WK9A 3MWEB 3PP8A 1QGAA 3E9EA 3VSCA 5K0CA 1EWKA 2B69A 4RL6A 1IXSB 3OKPA 3K1AA 3MJHA 3OWXA 3F74A 3DZIA 1X86B 3FZNA 3GWZA 4HGRA 3H86A 4N9WA 4E31A 3WIBA 4DDWA 1YR3A 3NVAA 4KH0A 1GDDA 1BH2A 1RP7A 2WW8A 3DDOA 1FFWA 2YW9A 2FUEA 3OEED 4YASA 5BV8A 1J0BA 4UBOA 3BIFA 4QOFA 1Q19A 3T6KA 4B84A 3W8EA 1I4OA 4YR7A 3OVMA 2P2ZA 3D0RA 2A94A 4XOIA 5KQGA 2JAPA 4G5XA 4B32A 4E5PA 1PI3A 2JJYA 2FR1A 2Z4TA 4BVJA 5BR1A 1RQLA 2J48A 3FR8A 3NPAA 1PT8A 1KYTA 4AJIA 1F1JA 4ZI7F 1D6NA 1NT2A 2XBLA 4U5XA 3E27A 1VOTA 4PGFA 5CT6A 1YQEA 2YMLA 3C0KA 5FNVF 1WSAA 4XIIA 5THQA 5CYFA 4I46A 1DQNA 4PTYA 1T0HB 3GP8A 1UQUA 1VMEA 3H04A 5FOTA 2XZLA 1OFIA 1U9ZA 2I54A 4W63A 2ZJ0A 2DJIA 2J7PD 1V5GA 1UK6A 1Z7YA 3BMOA 3NRBA 4ID3A 2OVBA 3SX2A 3QV2A 1DCTA 5A04A 4FXOA 3SDSA 3V7WA 3ZJYA 1E9SA 2FQWA 1MCZA 2A1UB 3L0BA 1OOEA 2QVLA 2XUZA 2RSLA 3LA6A 1ENYA 3U7JA 2VEDA 5C9ZA 3HXOA 3FVTA 3WQQA 4FYPA 4UHEA 1H1LA 1HDIA 1T5SA 2BOVA 2YUTA 5CXSA 1MRZA 2FWMX 3DV0A 1ST3A 1PG0A 1WBJB 5LDGA 1RBYA 4BFZA 1E1NA 5TLSA 3K1AB 4H4EA 2CUKA 3OY2A 4JFRA 3TVTA 1Q17A 4D6YA 4BMDA 4KRFA 2RGBA 1COZA 4F7WA 1KBQA 1KP9A 1NZDA 3H6GA 1SQ0A 3NBXX 2FWJA 3HA5A 1XDGA 4ONEA 2J3EA 4X95A 5CAEA 4N0QA 5C5CA 3EGOA 2UYCA 4JXZA 2O8CB 1XRJA 3MJTA 4C2BA 4F8JA 3FKSD 1JJVA 5FBVB 4W8OA 3R7WA 1DMRA 1XR3A 3QU7A 1GPDG 3ZU5A 1LB1B 1XUOA 5ALIA 5DRYA 1P1CA 2E49A 2FMIA 3IIIA 3L8MA 5ERXA 3X2SA 4A2QA 1JQJC 1P9OA 2C95A 4Z9XA 3WWOA 3N2YA 3ICCA 4IF4A 1XEXA 4NE2A 1P2FA 2AE1A 3ZE6A 4PN7A 3Q8LA 2HV9A 1FQJA 4WN3A 1G5IA 5ISMA 4LWPA 2O05A 1K7YA 2W11A 1FTWA 2EFEB 2J87A 3PRYA 4J1TC 5DHSA 1EXNA 2NXJA 4TYYA 1GLVA 2BBOA 4BFYA 1YVEI 3P2MA 3ZWOA