4IIVA

Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.5 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
SRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.5 A resolution
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 92
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iivA00
3MJCA 1P45A 1NFFA 1R6DA 2BELA 4TKLA 3K9QO 5DCUA 5G4KA 2B5VA 3KSUA 2RBEA 4NK5A 3AFMA 4CM7A 1NHGA 2GZ1A 4BB5A 1CDOA 2EERA 1KEWA 4IDDA 1ULUA 1U9JA 1MB4A 2X6TA 3AM3A 3WDSA 4W9NC 4Q3AA 1IOLA 1M66A 1PS8A 2HK7A 3IUSA 1SNYA 3KTDA 3H8VA 2I99A 4F45A 2CDAA 4Y6PA 4E5MA 4DQVA 3FNGA 5JO9A 4D3DA 3L4SO 5IZ4A 3AJRA 3V1UA 1NPTO 2P9CA 3FPCA 3AY3A 3T4EA 4GI2A 2P91A 3DAFA 4G5HA 3BTOA 3S8MA 3DFZA 4IQGA 1B3BA 4YBZA 3KRTA 4EUFA 1LC0A 3INGA 3KOUA 5JFOA 4NBWA 3M2PA 4LCEA 4J1QA 3D5QA 4ND2A 2QYTA 1FDWA 1JAXA 4KUEA 2JJYA 3DXFA 4B4WA 3I6QA 5EL0A 4E4YA 1DC4A 1B8VA 2C20A 4JJIA 3O8QA 1YBVA 3WOHA 2VRCD 4ZRMA 5CFZA 2EP7A 3VOSA 2DTXA 3KO8A 5KJ1A 1A72A 1ADFA 4RF5A 3K2BA 5I7EA 1PJCA 2EKLA 5KVSA 3GAFA 1P74A 1GZ4A 3O03A 1E0DA 3QVWA 4GSKA 1E3LA 3Q9UA 4NU5A 2B37A 4WOJA 4YAIA 4FW8A 4EZBA 3C3XA 1PJSA 2IYPA 4E0BA 1NQTA 2CF5A 2QRKA 2BGKA 4DIOA 1ZFNA 3C8MA 3ZHXA 4MP8A 2W2KB 1PS0A 1Y9AA 3R6DA 1EQ2A 3RBXA 5I7SA 3DMTA 2XXJA 4PG6A 2VUTA 3PGXA 3E5RA 1PQPA 3JYPA 1PR9A 2BHLA 4IY1A 3LC7O 2V6GA 3OA2A 2ZIZA 3OIFA 4BGVA 1HTBA 3PLRA 1GY8A 3C85A 1ZO8A 3BYZA 3E03A 3E9QA 4HFNA 3OJ0A 4D44A 5JO0A 3NGXA 2B83A 5JAMA 3WJAA 1GFSA 3GUCA 1R37A 1QP8A 4K6FA 1LRKA 2UAGA 4C7KA 2VWGA 4N5LA 4D41A 3WMXA 4A10A 3P19A 4EUHA 5K0ZA 1EDZA 1QSGA 1SEPA 2B69A 3L9XA 1P33A 4M55A 4O59O 4R3NA 1LNQA 1EDOA 4Y8VA 4CMIB 3F47A 3PFFA 3A28A 1X7HA 1Y1PA 3AUSA 4Q3EA 4CMKA 3KSDO 1D8AA 3IQDB 1HE5A 4XEHA 1LU9A 4CMGA 3AU8A 3GEMA 1AXGA 1PS9A 4EEXA 2AEFA 1PGNA 1QRRA 2VZ9A 3L6OO 3L6EA 4E5NA 3JYNA 5FFFA 4IDAA 1ONOA 2JCVA 3R0IA 2Z1MA 3E6AA 3WJ7A 2AA3A 3IKTA 1NX6A 4D46A 2E4AA 3HDJA 4Y6RA 4MKXA 4E32A 4OO3A 2BH9A 1HYHA 2ZCUA 3ROPA 1NP3A 1V3TA 2PFGA 5A5FA 4DL9A 3JQ7B 3D1LA 3KEQA 3JQBC 4IQ8A 3S2EA 4NHEA 3AM4A 2UUPA 4JXKA 5DNAA 5T64A 2IE0A 1D7OA 2OMEA 1WNTA 1LDYA 1SAYA 1SCUA 2AHRA 4K1LA 4BNFA 4HV4A 2BGMA 2IEDA 2OZPA 2HDHA 1UJMA 1VJ0A 4L74A 2BD0A 4WASA 2QG4A 4IIVA 5L4SA 5HM8A 3DONA 4JLWA 3ZWWA 5TX7A 4CMIA 3ROQA 1NQOA 3RCBA 4BO0A 1K0UA 2ET6A 1GQYA 1U3WA 5B4TA 1HYGA 3KYBA 3DZKA 3U9LA 3DHYA 3JQEA 4R16A 4BGIA 5JMWA 2X5OA 3WGZA 2X5JO 3WWZA 3AW9A 1F12A 3PTZA 4ZU3A 4NJMA 3VVCA 2V7PA 1IHXA 2A94A 2HRBA 5TF4A 3H2SA 3V1YA 3H3FA 2VWHA 3B1KA 4D3SA 2GERA 2YY7A 1NVGA 5C3MA 1RJWA 3GA0A 4CLRB 1U3TA 3U0BA 3QV1A 4OGWA 1WVGA 1W8DA 2G76A 4BKOA 3FTPA 1NR1A 4OYRA 1I36A 4UEOA 5KIAA 3MJ4A 4FB5A 1KS9A 2NADA 1P1IA 4PG5A 3WQRA 2JAPA 3VZSA 2YW9A 5G0TA 1MX3A 3GG9A 3RD5A 3BA1A 1RYEA 5EMHA 4A0SA 1WAMA 4WEQA 3ORFA 2C7GA 3JSAA 1A9ZA 1PJ4A 1Y7TA 3W6ZA 2OGUA 2FZWA 2NU7A 5A03A 2C2XA 4GWGA 4JN6B 3F9IA 1U5AA 2NU6A 4YJFA 1DIAA 1ZEMA 4BV8A 4R01A 1MLDA 2CMDA 3NYWA 4CM3A 2AQ8A 2QYSA 2Y66A 3OJLA 1B8PA 5DN9A 3JD1A 1SBYA 4BMNA 4IXTA 5JDIC 5F1OA 3AOEA 4HFRA 3ON5A 1DIRA 1LDNA 1X13A 1YE3A 1A4IA 4IXWA 1P3DA 2P5YA 4O5OA 3F1LA 3I9KA 4JIGA 2LDXA 3ZHBA 5KKCA 3NDRA 3DAPA 4FC6A 1JA9A 4BNWA 1H94A 4XJTA 1ML3A 4J7UA 4QX6A 4R1UA 2CDCA 4XYEA 4IDEA 4KUGA 4JBIA 5CPFA 5A9SA 2GD1O 2VHWA 3UKOA 4XRGA 3NKLA 1YDEA 3MJEA 2FSSA 1GPDG 1TT5A 1XLTA 2EG9A 3CXRA 3PGJA 4GKBA 2DU8A 5CEEA 2UUOA 2P4QA 1ZK3A 2X9NA 3HB5X 3WNVA 4AJPA 3V5NA 1ISJA 1Y6JA 4RPGA 3FD8A 5I9LA 2YHIB 2WTBA 1JVSA 4GSLA 4R5MA 3G49A 4PLZA 1B16A 3VKVA 4DWVA 3D4NA 3PLNA 2JAHA 4LVUA 3TOZA 5JBIA 1VSUA 4JCOA 4OSOA 1P31A 4BO5A 1UDBA 4E12A 5DT9A 1LBEA 3PXXA 3U49A 1NBOA 3DZFA 4B3IA 4MVJM 1I2ZA 4J9UE 4CQLA 2X1HA 4NBTA 5ITVA 1OOEA 3L4BA 4IZIA 1UH5A 1DHTA 2IXAA 1CQJA 3VVBA 4E5KA 3GMDA 2Y1FA 4JP3A 4R68A 1Q1NA 4DUPA 2PD6A 4BO9A 1Z75A 4XR9A 2J6IA 3ZV6A 5ADHA 1P0CA 2Y1GA 4UEKA 3UN1A 2WE7A 2FMUA 2NWQA 3D4OA 4E30A 1GYQA 1O94A 5JPIA 1HRDA 3FNHA 1U4OA 4B4UA 4FOSA 3FNEA 3QE3A 1HDCA 4YCAA 4Q39A 5B1YA 4E2WA 3RUEA 3MWDB 3DDNA 3NJ4A 2YHIA 2E37A 5JAIA 3GDFA 1J6UA 2DPHA 4QO8A 1CETA 4R1TA 2NNLD 2VYVA 5IG2A 4D79A 2Y0EA 1O6ZA 3ITDA 1C0KA 4RZIA 1N7GA 1W6UA 4LW8A 3ZDFA 4EYEA 1MG5A 3UFXA 4BNKA 1YONA 2AEMA 2W2LA 4J1NA 2Q1TA 3BMCB 2IDZA 3TQHA 3GNQA 1JQBA 2NVUB 2X23A 1KY5A 3HUDA 4MIOA 1LSSA 2HLPA 4B4OA 3BMNB 3K31A 3V1TC 1ZXLA 1DFGA 4B4VA 2PZJA 3OQ6A 4GLLA 4C7JA 4CV1A 3RJ9A 1QV6A 3OQBA 3VPSA 4FJ1A 2FWMX 4J4BA 5IAAA 4HWKA 1A9YA 3JQ9A 5I8ZA 1NVMB 4E5YA 1PZEA 5B4UA 4BGEA 1PQWA 4CPDA 1UZMA 4CM5A 1A71A 3DEYX 5GMOA 3VZPA 1R4NA 1V0JA 1SEVA 3RC7A 2NVWA 4W7HA 1AE1A 5AOVA 4RVSA 5COQA 1E3WA 2PLAA 2OOSA 1YB4A 4MPDA 3LVFO 3WWYA 4QFCA 4YJGA 3SLKA 4D45A 4ZICA 5KJFA 3PHJA 1X0VA 4ZGWA 3WGQA 3GVCA 3HN7A 2WYUA 4CMEA 4NIMA 5EN4A 3ZV5A 5CG1A 3GVHA 2R2GA 3PYLA 1A7KA 1VM6A 3IDSA 5AQ1A 1TB4A 4XYGA 1PX0A 4HUJA 4ZA2A 1E92A 4YT5A 2I76A 2Q4EA 4DIFA 4XQEA 5F1PA 5L45A 1N9GB 1RM3A 3QVOA 4J4HA 4PN3A 2GGSA 3H9JA 1Y5RA 2GYYA 3EW7A 5T8KA 1HSOA 1Y5MA 3BHIA 3OP4A 2NTJA 1JKJA 3F4LA 1HF3A 4OOFA 5C7LO 5G0SA 5DP1A 4KDEA 4GVLA 2F1KA 2JD1A 3TFQA 2VRBA 1YJQA 3ICPA 3FHLA 3IS3A 5COBA 3WMWA 4AJ4A 1R12A 2V65A 3ANNA 4YRDA 5EIOA 4ILKA 4XYMA 2E82A 4FJ2A 1KVQA 3EK2A 3ZWOA 3CMCO 4CMCA 3AUUA 2OBNA 5IN4A 3HDQA 1BGVA 2GN8A 1SOVA 1ZK4A 2EJWA 5G4LA 4IINA 3T7EA 4RJTA 1LRJA 4XDZA 2DFVA 2YZ7A 1IPFA 1LC3A 2CFCA 2FPPA 2CY0A 4LCJA 4RGBA 1O0SA 2PKQO 4PRKA 4TRMA 4UUMA 3TL2A 3SLGA 1HDRA 1K6IA 4JBGA 1LI4A 3GEGA 1H0KA 4OM8A 3H65A 4RPJA 1D1TA 4RVUA 1XWFA 3K6JA 1HYEA 3OIDA 4A5OA 2X5KO 3X2EA 4DVJA 3FPLA 3PK0A 4B3HA 1JAYA 4ND3A 3F46A 3DZGA 2OBYA 2FRDA 3LT2A 5HRUA 2J3HA 4WGGA 5JNLA 5JSFA 1I10A 2Y1EA 2TMDA 1YB5A 3W4IA 4IDGA 3VPGA 1DRUA 4J2HA 2CUKA 1U3UA 4EJ0A 1D3AA 3D0OA 1W0CA 1N9GA 3K73O 3JQ8B 3G17A 2PV7A 1D4FA 2WSBA 3PHLA 4OQZA 1KY4A 1KBZA 1S7CA 1MXFA 4WLEA 1V9LA 1JU9A 2YDYA 1GV1A 1HEUA 5K6AC 1WDLA 2PK3A 3RSHA 1LLDA 4K9DA 4ND4A 3WYEA 3MJTA 3NRCA 2PNFA 2GUGA 3FR7A 1YVEI 5G0UA 3C1AA 4NMHA 5I9MA 4O1MA 4QTZA 4H7PA 4IDBA 4XX0A 1EE2A 3C1TA 4L8VA 1K2WA 3RC2A 1E1NA 2DQ4A 4YAEA 5CDSA 1TXGA 1NTOA 3IJRA 4E6PA 3EY4A 3D3WB 4XKJA 4IS2A 3ZWPA 4J1TA 4BQRA 1R16A 3FBTA 1ZJZA 3RU7A 3CSDA 4Z6KA 1RKXA 3DR3A 5A05A 1HE2A 1KVSA 1T4BA 5BSFA 2GN4A 4I5EA 2VNAA 1ZNQO 2I65A 3ZWBA 1YH3A 4R3WA 4Z9YA 4HNGA 2Y0DA 3TOXA 3KYDA 3WX0A 3GRKA 2JHFA 2I5PO 4MO2A 4N54A 3JQ8A 5KVCA 1NAHA 3LDHA 4PLWA 5DCWA 4N18A 1KERA 3ZU3A 3LYLA 4N5NA 1P77A 4XQGA 4A03A 3E48A 1P9LA 4MDHA 5KJ6A 3OICA 1B15A 1H6BA 2NV6A 1C1DA 4GX5A 1BXGB 4UUPA 1XCBA 3WR5A 3LT1A 4PLGA 3LU1A 5BSEA 1P1HA 1P0FA 2P2SA 3ASVA 3S2GA 1K6JA 2H1SA 3GRPA 5JAQA 2NU9A 4YYZA 5JCJD 2IODA 4I9UA 5LCXA 5GZ1A 4OIMA 1Y8RB 1YB1A 5KCZA 1E6UA 3PP8A 4DC0A 3QVSA 5CDTA 3D3WA 1PL7A 3QRWA 4FIZA 1Z45A 2PY6A 3JTMA 3RFXA 5AXAA 4BNTA 1LA2A 1U28A 4YTEA 2NM0A 2J3IA 4L75A 3JQAD 1QXSA 4EEZA 3DBHB 2W98A 7MDHA 2AEJA 1ZCJA 4XGNA 2UVDA 3OJOA 2GPTA 2OORA 4I5DA 5TJHA 1I24A 2O48X 1PJBA 1R4MA 3JQFC 3MEQA 1UUFA 2P9GA 3FWNA 3I4FA 3RUAA 1SO8A 5KOIA 4Q3DA 4OMUA 2JKVA 1Q0LA 1T2AA 3GFGA 3VTFA 2HJSA 3B20A 3AI2A 4HNHA 1J49A 4CLDA 3O26A 2C5EA 4WLVA 1X7GA 4MVJD 1FDUA 5L51A 1BXGA 5L4NA 3PYMA 4MVJI 1O89A 3RUCA 4RDIA 4I9HA 4XQ9A 2W90A 5JLAA 3GG2A 5JC1A 4IGEA 1Y8RA 3H5RA 5IZCC 1SB9A 1VPDA 2Y99A 3IUPA 4UUNA 3E5MA 4PLFA 4BL5A 4HP8A 3UOGA 2ZTVA 1LLUA 4FFPA 2HRZA 3C7AA 4PLVA 3OIGA 1QYXA 1DEHA 3MTJA 3DBHA 1AUPA 3VTZA 5JE8A 3ROKA 1FMCA 3GAZA 1GU7A 4TMFA 4OH1A 3HN2A 4IJUA 1GPJA 3QIVA 1E1KA 3O8QB 1R66A 4M8SA 2ZCVA 3WBFA 1CIVA 3F4BA 4P4LA 2I3GA 1M2WA 1F17A 3GNSA 3HFSA 4IDFA 1GUYA 3MJVA 3QWBA 3CZMA 3UXYA 1E3IA 1GZ6A 4N5MA 3PHHA 4ZQBA 2AE2A 3DC2A 1JLLA 1NR7A 3ZW9A 2HJRA 1E3SA 1R15A 3EC7A 3RWBA 1DRVA 4WLFA 3ONEA 4U6QA 3VH1A 3OH8A 3JQGB 1FJHA 1UXJA 2X7HA 4TWRA 3QY9A 1ZEJA 1A5ZA 1Z74A 3Q2KA 3MOGA 5HS4A 8LDHA 5JC8A 2Q50A 3W4JA 1PSDA 4A73A 5JAZA 4RDHA 1ZBQA 1EUZA 1TT7A 2DPGA 4DPMA 4NFHA 3FWZA 5JCXA 1E7MA 3S2FA 1RM4A 1ZZEA 4R51A 5BNIA 3UICA 3F6YA 2DBZA 3D4PA 5GY7A 1FK8A 1VSVA 2O7QA 2V6BA 1LJ8A 2XOXA 2PKQP 2VYND 4JP2A 4LMPA 4NBVA 4GPD1 4WJZA 5ENDA 3WLFA 5JDCA 1VC2A 1ZXBA 1LXCA 3E8XA 4ZQGA 1UAGA 1IULA 3V2UA 3WS7A 4NPCA 4YAKA 4JX8A 4QQRA 2R6JA 2VT3A 4DPLA 3HB4X 2GZ2A 1H6DA 2BKAA 3NGLA 1T4DA 4PIVA 5CG2A 5HS6A 1T2EA 3NJ8A 1FDSA 1LUAA 4CUZA 4BQPA 3DZBA 3L0DA 3GQVA 4PGFA 4WUVA 1X14A 5B12A 2NTNA 1P44A 3RC9A 3ROMA 3ZNPA 1ISGA 3UF0A 1O5IA 1HE4A 4OOEA 1B14A 1HT0A 3JQGA 3U4IA 4H15A 3DL2A 3X2FA 2BMAA 3CMMA 3SJUA 1QLHA 3PI7A 5CDUA 4J0FA 2CVQA 5GZ3A 5F3RA 8ADHA 3W8DA 4YRAA 4BKRA 2P68A 2VHZA 2BI7A 1YOVA 3TDKA 4BMSA 2Q1WA 4PG7A 4J1SA 2YV2A 1MFPA 2OXIA 5BNFA 3Q0EA 4TRJA 4ZQFA 1N2SA 4ZJUA 1JKFA 4BO6A 3DMYA 4HFJA 3OEWA 3LQFA 4BNHA 2YFQA 1P1KA 1S6YA 3FSRA 2PTGA 3MJSA 5H81A 4AJHA 4E21A 2D8AA 2CF6A 4PG4A 3OA0A 3ETEA 3HADA 1Z7EA 2HSDA 4BNXA 5JDCC 2J3KA 2VN8A 3E9NA 4BNLA 4ZVVA 1DJNA 3BHMA 4FOOA 2WD8A 3COSA 5A06A 2LDBA 3K30A 1HDXA 2DM6A 4UVHA 3EYWA 2PZLA 2ZKLA 4NJMB 5IXYA 2OL4A 3DAGA 3UW3A 1CRWG 1UXGA 2NLOA 4FN4A 2IEBA 1P1RA 3P2OA 1HZZA 4XR4A 5A3VA 3PZRA 3IP1A 4GX2A 4L9RA 3ZHZA 3EGOA 3GZNA 2VTDA 1V3UA 5HA5A 3GH3A 5AYVA 4GX0A 3DMTC 3HSKA 3FTNA 3D3EA 4JJGA 4Z9XA 3ST7A 3OBBA 3RAJA 4FD3A 3NAQA 1LDMA 4M49A 3Q11A 3T4XA 3VDQA 1PZGA 3R1IA 3G1TA 5BQFA 2GF2A 1X1TA 2EV9A 4Z3DA 2CVOA 3ZWYA 3ZU2A 1C0IA 1MV8A 3H2ZA 4G81A 1NFRA 1BDMA 2RH4A 2E6UX 3RUIA 4BO7A 4U8GA 4RO0A 3SEFA 2QRLA 3BZUA 2X86A 1XA0A 2D4AA 3TSCA 5KVVA 1C3VA 4IM7A 5TT0A 1U3VA 1HDOA 1K6XA 3ZNOA 4OHUA 2FPIA 3N58A 3E1KA 4YJFB 1E3JA 1OFGA 4ONEA 1TA4A 1H5QA 3GEDA 3F3SA 3GOHA 3FCOA 4EGFA 1E5LA 1PWZA 3E18A 4Z0TA 4M1QA 4WKGA 3ZH2A 3KUXA 3D7LA 1E6WA 2B36A 1G0OA 1PJ2A 3WGYA 5FYDA 3JQCA 2J5RA 4W82A 2EW2A 1LSJA 3OM9A 3PHGA 3HFGA 1ZSYA 4HXYA 4MINA 4U7WA 2ZTLA 3QWFA 2X58A 3RFVA 1YGYA 1XGKA 4B7XA 2JHGA 2IYOA 2ZB3A 1U5CA 1WP4A 3RFTA 4J16A 4I08A 2NACA 4FBGA 4NZ9A 4DGSA 4ZQHA 3OEYA 1VRWA 1T2DA 3OECA 3HDHA 4BO3A 2P9EA 3CKYA 4BHTA 4O63O 4B7UA 2J8ZA 1H6CA 3LZ6A 4CV3A 5A9SB 1YL5A 3AY7A 4ZN6A 4FFLA 4G65A 1TT5B 4KMSA 4BUCA 5KJCA 3NV9A 1LLCA 4A27A 1C0PA 3RU9A 2RIRA 4HX5A 1EZ4A 4R41A 3DZHA 3DZIA 5BT9A 3K5PA 4RL6A 3CE6A 2H6EA 1EK6A 1RYDA 3AM5A 4GKVA 3IKVA 4NJOA 3U4HA 2O3QA 4BKQA 2QZZA 4CMAA 2Q2WA 3WTBA 4EITA 1JKIA 3JV7A 4L76A 3VKUA 3QJ5A 3G79A 5TLSA 1CF2O 3H6KA 4WLUA 4NBRA 4E5PA 4FGSA 1XSEA 2EP5A 2BI8A 3UCFA 4EI2A 1I3KA 3K2EA 4CQLB 2FR8A 1DHRA 4OXYA 2Q2QA 3EZLA 1N1GA 3HHPA 4YVFA 2XXBA 1YQDA 3LT4A 3I52A 4NU6A 4UVEA 4XD2A 3WLEA 1U8FO 3I3OA 4CV2A 3VC7A 4W4TA 5KKAA 3Q1LA 4II3A 4X54A 2EKQA 5H82A 3TZHA 2HU2A 3AK4A 3NT2A 1SZJG 2BRUA 4RVHA 1BXKA 3QP9A 3P7MA 2FN7A 2FP4A 1DC3A 1PJLA 5H83A 4MKRA 3JD0A 2C54A 2F00A 2X22A 3OETA 3K96A 4ITUA 3DFUA 2EF1A 2Y1CA 3DBRA 4J7CA 1VJ1A 2Z1NA 3INTA 4RQTA 3PQFA 1M6WA 3WFJA 3BTUA 2RH8A 5EJ2A 4EUEA 1J0XO 2A4KA 1ORRA 3KXDA 4DYVA 5AXCA 3T7CA 5A5EA 4HFMA 4Z0HO 1FF9A 3ITKA 4DXHA 2R00A 4E31A 4WLOA 1E7QA 1GR0A 2JFFA 1YXMA 2VOJA 3TL3A 1X7DA 1F06A 2ZK7A 5CEFA 1QG6A 2C07A 3H7AA 4OXKA 1T1SA 1QYWA 4AG3A 1XDWA 4CM6A 4I5GA 4FCCA 1ZK0A 3AOEC 2X0IA 4JK3A 1XQ6A 2YDXA 1E3EA 5IDYA 2QIOA 1IY8A 4INAA 3W4KA 3EHEA 4WCFB 5HBRA 1WXDA 3ZU4A 3L07A 4UAGA 3NX4A 4FDAA 2VWQA 1ZVMA 1R4NB 4J91A 1BMDA 2Q1SA 4CLEA 3BMQA 3EVNA 1UXKA 1E3WB 3GY0A 3NT5A 4FR5A 2YV3A 4L73A 4DPKA 4YJGB 4DMMA 4BKUA 1NQ5A 2CZCA 3JYLA 4CR8A 1I2BA 4IS3A 2HMUA 4LMRA 1FDVA 4L4SA 3U4CA 2VCYA 1HDYA 4CJXA 1EFKA 1LQUA 4J49A 3PZBA 3ICCA 4GH5A 5TSDA 4K6CA 4G2NA 4XCVA 3S1LA 2JFHA 3ETGA 2PZKA 3EMKA 3QSGA 3HDYA 3VH2A 3M1LA 4LSWA 1LRLA 1YQGA 1EQUA 1I30A 2Y0CA 3B6ZA 5F1KA 3FF4A 1M67A 3GLQA 4AJLA 4YXFA 3TZQA 1Q7BA 5CEJA 3IMFA 2A35A 2B4RO 2QRJA 4WCFA 1ISIA 3G0OA 3O4RA 1TLTA 1GL3A 3L4BC 4AJNA 2WDZA 1EEHA 3HZZA 3V2GA 2QW8A 2VZ8A 5CPBA 1I3NA 4LRTB 4DLAA 3ZWXA 2VUSA 4YB8A 2FY8A 1OC4A 1B26A 4IPTA 1C1XA 1ULSA 1PJ3A 1NWCA 2O3TA 2WWRA 1CQIA 4PCVA 4GBJA 4XIYA 3IJPA 2DBRA 4BNMA 1UAYA 4MJLA 4CQMA 4M54A 1PQUA 1I8TA 1QKIA 1CJCA 2Q4BA 4OL9A 1XU9A 1YRLA 1MGOA 2DC1A 2O23A 4CM8A 1N7HA 1ZMTA 4W7IA 1HDGO 5AXBA 2Q49A 5DBIA 1ZJYA 4KUHA 2JFGA 3GVIA 3JD2A 5A4DA 3BIOA 3I4CA 2QX7A 3B1JA 5TC4A 2J3JA 4R54A 3FNFA 1C14A 1BSVA 2VNSA 4QT0A 3ANMA 2WYWA 1DPGA 1A7AA 4TSKA 5L7WA 1LQTA 5AXDA 1QV7A 1E1MA 3O9ZA 3H3JA 3F1KA 3TN7A 4ESOA 1HLDA 1E7WA 3QHAA 4C4OA 4I9NA 1QORA 1L7DA 2AW5A 1M6HA 5FEUA 3WYBA 1SC6A 3JQ9C 1UXIA 2NSDA 3I23A 4XA8A 1T26A 1XG5A 4H16A 3GNTA 4F3YA 2Q3EA 1Z73A 1B2LA 2IRWA 4YQZA 1HWYA 4WNIA 1SOWA 2EKPA 3DWFA 3ZCXA 4HBGA 1H93A 4CM4A 1LDBA 2PGJA 4CL8A 4MOWA 2AQIA 1XEAA 1GUFA 2D5CA 1VLLA 4WE3A 3U09A 3KYDB 4NR0A 2VYVD 2YUTA 1ADCA 4J43A 2ILTA 3I9NA 4EBFA 4DRYA 2PA3A 4CMBA 4CMEC 1KVUA 4KTVE 4MP3A 2RHRA 1EUDA 3GN2A 3OF2A 3RUDA 2O4UX 3W8EA 2ZTUA 2VHXA 5G0VA 5U1PA 4QSMA 3OJEA 5KJEA 5T8KC 1VKOA 3NTRA 3WG9A 1C1DB 3A06A 2ZTMA 4TROA 3WIEA 3DTYA 2UYYA 5DOZA 1Q7CA 2O3UA 1KIFA 3WGIA 3VZRA 1WMBA 3BAZA 2X9GA 3PJFA 4XDYA 5AVOA 4U0JA 4ALLA 3HWRA 3SJ7A 1ZIDA 3MCVA 2I9PA 3TZKA 1NNUA 1Z82A 3S2IA 5HWSA 3ZWAA 5L40A 5IDXA 1PGPA 1JWBB 3SC4A 1GDHA 1AHHA 1H2HA 4AJIA 3I9MA 3C24A 2JCXA 4M86A 2C7VA 1CERA 3UAGA 4ZHSA 3MZ0A 5F21A 4BVAA 1YS4A 2G17A 1N92A 2C5AA 2DTEA 5JMPA 1VKNA 4CM9A 2Y93A 2QQ5A 1XQ1A 4L4XA 4AJOA 2OP1A 3PIDA 5C7OO 1R4MB 3ABIA 1BRMA 1I32A 2C82A 4XB2A 4UULA 3I9LA 2HK8A 3DO5A 3TJRA 3GVPA 3PQDA 4XJSA 1T2FA 3WFIA 2YQ5A 4YEDA 4R9RA 2VZ0A 5LC1A 1FXSA 3WSVA 2PKRA 3GR6A 3C7DB 4JROA 1NASA 4LGVA 5L9AA 2Z5LA 5J23A 1PWXA 5I9NA 2ZJ1A 1X0XA 4Q3NA 4RV9A 1GZ3A 1GUZA 4KDFA 1Q7GA 2YYYA 3CH6A 1DOHA 1Z7BA 1A4UA 1ZW1A 1WMAA 2C29D 3WBBA 5TIIA 4GGPA 4CR7A 5KTKA 3PJEA 4OKNA 2C2YA 2O2SA 4CV0A 5BNTA 4LRSB 2IZZA 3RASA 1B0AA 2D59A 4RQUA 1GCUA 2D5AA 4XZ3A 1XELA 4PVCA 3ZI0A 3MOIA 1GQ2A 3UCXA 1WPQA 5ICSA 4O0LA 1Q0HA 1F0YA 3KLPX 5ILOA 4CMHA 4YT2A 1UR5A 3P2YA 4WEOA 5EINA 3MTGA 4RORA 1DLIA 3ASUA 4GMGA 2X0JA 5DF1A 4YACA 5DULA 5DCYA 2TMGA 4LVCA 2VYNA 3U3XA 4ALJA 2DAPA 3WB9A 1B3RA 2HMSA 4Y98A 2VRCA 4OSPA 3GZ4A 1T1RA 1VL6A 2G5CA 3ZV4A 2HQ1A 2EJVA 4BNGA 3ZWVA 1MUUA 1U2DA 3TPCA 1ID1A 2CD9A 4UVDA 4ALKA 2X4GA 1F8FA 4W99A 4BO1A 4JNKA 3WGTA 4BNNA 2O50A 2FR1A 3K8ZA 5TS3A 3GDGA 3SX2A 4LSMA 4RPHA 4OAQA 4AJ1A 3NDJA 2WJPA 2P4HX 1G6KA 1PZHA 1KVTA 2PH3A 4NK4A 4EJ6A 4U6SA 4OJNA 1H9BA 3ENKA 3ZZNA 1YL7A 5DBGA 3BTSA 5IFLA 3QVTA 3BXXA 1KYQA 1GYRA 4PLHA 2RAFA 4BO8A 3ONFA 3SXPA 1OBFO 1V6AA 3CPSA 1PJTA 2P5UA 1OC2A 3ENNA 5DZSA 3GPDG 3KEOA 5IN5A 4AL4A 5L95A 2VUUA 4D3FA 3LK7A 4IUYA 1DDOA 5L7TA 3P5SA 4F46A 3ZNNA 1O8CA 4Z3KA 2Y1DA 2ZQYA 1YJ8A 2WE8A 4CUKA 1PEDA 1DFIA 1O95A 2DFDA 3PWZA 4Y6SA 1FDTA 2DTDA 2AG8A 3IL2A 3I6IA 2NU8A 2WMDA 4JGBA 1ZK1A 5KWEA 1T2CA 4KQXA 2VQ3A 1J4AA 3R3JA 4YT8A 3ZWCA 4FFMA 5TRTA 3EZYA 1BW9A 2ZYDA 4XYBA 5C37A 4RVGA 5F5NA 2VHYA 3RBZA 1DIBA 1RM0A 3DOJA 3QWHA 2OUIA 3RVDA 3GGOA 4IMRA 4TZTA 1JTVA 2PWZA 4CLHA 4DA9A 1DAPA 2OHXA 3AWDA 4LK3A 5U9CA 3KM0A 4DLBA 1YOVB 3JYQA 1PL8A 1R0LA 4TVOA 4PZDA 1EFLA 3H5AA 5IDWA 1WLYA 5TJ9A 3M2TA 1I5RA 1HL3A 1E6EA 2GNAA 4WPGA 3AU9A 4CLOB 4GLOA 4TRRA 3RUHA 1GV0A 3SC6A 1GEGA 3EVTA 4XRRA 3UH1A 4E33A 1DC5A 2D2IA 1HLPA 3DTTA 5I7VA 3U5TA 1EVJA 1WZEA 2XF8A 4U0KA 5G2OA 3HJAA 1ZK2A 3RI3A 4BNZA 1JW9B 5JXWA 4DBZA 3DOCA 3H9UA 3OHSX 3CINA 3L77A 4B8WA 2CNBA 4IMPA 1QLJA 1ARZA 1F8GA 1UP6A 2OP0A 3INRA 4GL4A 2RCYA 2VTEA 1DSSG 4I1IA 3LF2A 5IDQA 3BTVA 3KB6A 1RWBA 2JL1A 3HNPA 1PR3A 3OMLA 1E7SA 4RZHA 1DJQA 1YQXA 2VHVA 3GZNB 4J3FA 3WQQA 1AGNA 4BNUA 4YR9A 3VPFA 1ISMA 1QYVA 4JBHA 1ZUD1 1DIHA 4RPKA 4BNIA 4QEDA 3LSYA 3OFSA 4GMFA 1SMKA 4RF4A 2EGGA 5TGDA 1QYDA 4RVFA 2Y05A 5DBFA 3HQ4O 4CLOA 2J5KA 1YDWA 5ENVA 3PDUA 4DIBA 5THQA 1EBFA 4R69A 4Y67A 5EERA 1NPDA 4XQCA 2ZJ0A 2I3AA 3PDJA 4O6VA 3GGPA 3GGGA 3JQBA 1I01A 3D5TA 5A04A 4RF2A 2DKNA 1H6AA 2D3TA 4PLTA 1B8UA 3PJDA 4FFNA 3WYCA 3TFOA 1NHWA 2DBQA 4NFYA 4IJWA 5L7YA 3C7CB 2DUWA 1LX6A 4TQGA 1IB6A 4M87A 5LDGA 1SPXA 2OFPA 3QWIA 4D7AA 3F5SA 1OZAA 3L9WA 5CAEA 1DAOA 3ZW8A 4D0RA 3W8FA 4R1NA 4AFNA 1CWUA 2UDPA 4ALNA 1QYCA 2VOEA 1BHSA 3QLJA 4NQZA 1MP0A 4A26A 1Z6ZA 3PHIA 1OAAA 3DBVO 3STHA 1Y9EA 3TZ6A 4Q9NA 3GPIA 5T67A 2C0CA 2Q2VA 2GCGA 1CEQA 1IE3A 2GDZA 2W2KA 4YJDA 3WQSB 4QECA 3U62A 1UP4A 1IYZA 4H3VA 4CM1A 5DP2A 3KSZO 1Y81A 1U2GA 3KYCB 4P4NA 3KVOA 2BFMA 5U4QA 3IC5A 3AI3A 1GD1O 1GADO 4KQWA 2YFHA 3GDOA 3HE3A 1MA0A 3ZNQA 4CUJA 5IJZA 3UUWA 4GAEA 5MGBA 5JW6A 1NVTA 4HKTA 3PPIA 4BOYA 3ADPA 1I3LA 1I3MA 4J4TA 2PZMA 3H9GA 5TQVA 1NWHA 2FHSA 3DZJA 9LDBA 4YJHB 1EE9A 2UV8A 4KZPA 4AJJA 1NXQA 1U1IA 4M89A 1JN0A 1IUKA 1YBAA 3JCZA 4E2YA 2NTVA 3BMOB 3FN4A 3DB2A 3MWEB 2NUAA 3PFWO 3ZN2A 1T24A 2GZ3A 2DT5A 2JD2A 4BNYA 3W6UA 2EEZA 4P8RA 4D43A 4RF3A 1YKFA 4MVJG 2NVBA 1VE9A 1HSZA 2HUNA 3KLMX 3IAHA 3JYOA 1UZLA 3JQ6A 4HADA 1ZSNA 2SCUA 5JDIA 3KHUA 4MIEA 3Q3CA 1RPNA 3FI9A 1KOLA 5DOVA 1LDGA 5LDHA 4NFSA 1I0ZA 3FR8A 4W6ZA 4B3JA 1A27A 2EIHA 3RROA 1L1FA 4NG5A 3KYCA 3W1VA 4R4JA 3VPXA 4IIUA 3PIIA 4YAGA 4YPOA 3TF5A 3GT0A 1KC1A 1VL8A 4QO7A 4S1VA 2E48A 2EWMA 3VDRA 2BFOA 4AVYA 1HE3A 3F5QA 5JYDA 1UXHA 2EHDA 5FF9A 1V35A 2FSVA 3DBRB 1XU7A 2QZ9A 4CODB 3N7UA 4QXMA 5L3ZA 3I9OA 3M1AA 3JQ7A 4YJHA 1UDAA 5DDIP 3GN1A 1U8XX 4MVJH 5C5IA 1GYPA 2AQHA 3ZU5A 4YAJA 3BMOA 2YJZA 2GASA 5EQDA 5F5LA 5JS6A 2H5LA 3VHRA 4L4RA 4K26A 4FPXA 2I67A 4QFDA 9LDTA 2IZ1A 1E7RA 2OO5A 5JYEA 3JD4A 3IIEA 1NAIA 3Q9NA 1RM5A 3JQDA 3DQPA 3GC6A 2AQKA 1UDCA 1ENOA 2A9FA 4J6FA 4DTIA 1R0SA 5FWNA 4FGWA 3RBVA 3B70A 4IZHA 4MVJP 4IJKA 3FRJA 3RQSA 2NQ8A 4FC7A 4JJFA 1TI7A 1N1EA 3EUWA 4J2OA 4NNJA 2Y67A 3LF1A 2DVMA 3ZGYA 2PGDA 1G1AA 1HKUA 2WD7B 1G0NA 4IGFA 3BMQB 1UP7A 4AJ2A 3AI1A 3V8BA 2HMWA 1ONPA 3BHJA 4BKPA 3VZQA 4BB6A 1TVEA 1UZNA 2ZYAA 4R1SA 2CSUA 1IZ0A 1I33A 5KNLA 1WW8A 5A02A 4CLRA 4B79A 1DRWA 2HCTA 4J90A 4BIIA 2GLXA 4PZCA 4J7XA 1HXHA 2B4TO 1E5QA 1ENYA 2HK9A 4R5HA 3LC1O 3VAZA 1ONNA 1EVIA 2O3RA 5ICMA 5MDHA 1WWKA 1HETA 5T57A 3AUAA 4E2XA 4LN1A 4ALIA 4BO2A 4YA6A 3WNQA 2X0NA 4RCVA 4K28A 4NH4A 2X0RA 1T25A 5L4LA 1PIWA 4IQ0A 4S3MA 1NFQA 1H9AA 3CUKA 3CTMA 3QW2A 3NTQA 1GCOA 4LISA 4QUKA 2DLDA 3EDMA 3I1JA 4NI5A 4BO4A 2Q45A 5G0WA 3GK3A 4Z0PA 2B35A 1LEHA 5ER9A 3A4VA 3OQ1A 4PRLA 3GHYA 4UVGA 5KVQA 4E3ZA 2WD7A 1GEEA 1ZMOA 4J9VA 3G1UA 4MIYA 5CDYA 1KEVA 4Y9DA 2DBVO 1C1XB 3ZHYA 2AG5A 1DFHA 1PJQA 4RLSA 1LLQA 4URFA 1NM5A 3IOYA 4CQMB 2GN6A 3TWOA 4ZD6A 4CLXA 2HKIA 2B5WA 4I8XA 4PLCA 3TRIA 1DC6A 1P1FA 4CM8B 1VJTA 3LLSA 1MC5A 3L6DA 1LDEA 1QMGA 2WEKA 1Y8QB 3R3SA 3WGOA 3PYXA 3S55A 3WXBA 1XR3A 2EGHA 4TZKA 1IHYA 3TNLA 2YV1A 3PQEA 1K3TA 4B8ZA 4BV9A 3A9WA 3K92A 4P22A 4WCDA 3WICA 2GO1A 3WIDA 4D42A 2I6TA 1BVUA 1ZH8A 2R00C 4BNVA 2BF7A 2V6MA 1Q2XA 2IXBA 3H9QA 3OSUA 1EMDA 4ROSA 1PGOA 5BSGA 2JCYA 2O3SA 2ZB8A 5CP8A 3H4VA 1OI7A 2D0IA 2XAAA 2HMVA 3E9MA 5JY6A 1GTMA 1KEUA 1LSOA 5BSHA 2GRAA 3RC1A 4E2ZA 1EK5A 1SB8A 2X9VA 3I5MA 3Q6IA 1BVRA 2A92A 4CL3A 1BDBA 1EVYA 2Q99A 4XGKA 3VH3A 3A1NA 4GX1A 2Z95A 3H9EO 1PTJA 4P38A 2BGLA 3C1OA 4YT4A 4KWHA 5TT1A 2G1UA 5L53A 1JWAB 4B7CA 3ZV3A 3EAGA 2PD4A 2WYVA 1X1EA 3RJ5A 3CZRA 3ETDA 3ZWNA 2HMTA 1D1SA 4CM4B 2D1YA 3AFNA 3LT0A 4XGIA 5T5QA 4ZQEA 4MVJE 4XB1A 1R0KA 2AXQA 1Y8QA 1LTHR 2IZ0A 3GFBA 1WDKA 3B1FA 2GN9A 4DREA 1ISHA 3N74A 3JQAB 5ILGA 2HAEA 3AY6A 4YWJA 2EXXA 1HZJA 1U7HA 2I66A 4JQCA 5A9TA 1XIVA 3WSWA 3NT4A 4A2CA 2BLLA 3UCEA 4GGOA 5GZ6A 4GWKA 4DQUA 4FFOA 2ZATA 5TNXA 4IJVA 3LC2O 2V6FA 2BFPA 5K6AA 1H2BA 3GMSA 4F6LA 4MP6A 1AXEA 3BMCA 3A14A 3VPHA 5A3JA 1EBUA 1PGQA 4PLPA 4DYDA 2NVUA 4RPLA 1N8KA 1YL6A 1QR6A 4KWIA 4WCFC 4BS9A 4WK6A 4PG8A 3BMNA 2PR2A 2PH5A 2AMFA 3UVEA 5T6BA 1OMOA 3NEPX 5ER6A 3ULKA 1NYTA 1HDZA 3IP3A 4IBOA 2VWPA 3OJFA 4UREA 1DIGA 5JCJA 3JD3A 1W4ZA 3QA9A 1C0LA 4Q3BA 3UGKA 3AUTA 2XPCA 1VL0A 1X15A 1P1JA 4D0SA 3LLVA 4TRNA 5C7IO 3KETA 3WTCA 2W2LD 4ID9A 4EW6A 3JQAA 3PWKA 5EESA 2ZB7A 1B7GO 4RVDA 5BR7A 4RLHA 4FFRA 1WZIA 2RHCA 1N5DA 3KV3O 1GAEO 2PGLA 4FJ0A 4II2A 3RKRA 5B4VA 5A1TA 2EW8A 2HO5A 3KZVA 2W8ZA 1E1LA 5B37A 4NDNE 1DB3A 4GVXA 3O38A 4PLYA 2X8LA 3M6IA 2O4CA 1BXZA 1ISFA 3GF4A 3AOGA 4KOAA 4MVJA 4Q3CA 4TVBA 1ZKMA 2CDBA 5A9RA 4J0EA 2WM3A 3V2HA 2ZYGA 1M75A 3CIFA 2H9IA 1PU2A 1PGJA 3ANLA 2DUUA 4FQ8A 4CQMD 3UHAA 2FR0A 3PJGA 4KTTE 3HG7A 4WLNA 4EJMA 3H5NA 1E7YA 1L7EA 4EDFA 2W4QA 4BNJA 1YBMA 2ZB4A 4R9SA 1W73A 3DBLB 1O9BA 5FI5A 3I83A 3E82A 3JQFA 5K9ZA 1AHIA 4OXNA 3ONDA 4IDCA 2Y68A 4HY3A 2CVZA 3WGGA 3GHHA 2AE1A 4GQAA 1U4SA 4TKMA 5ITWA 4PFJA 3QQPA 4ALMA 4OKIA 4XYLA 1KVRA 1NQAO 2Q46A 3PWSA 2G82A 2PD3A 4FSHA 5I7FA 1U7TA 1EVZA 3SVTA 5CDGA 5IF3A 2JD0A 5THKA 4ZRNA 3GUYA 4P4GA 4CR6A 4WOKA 5COAA 1TEHA 1KETA 2Y1OA 1K89A 4N7RA 4UVIA 1F14A 1BWSA 3RIHA 1AN9A 2QHXA 2GR9A 4WNCA 4CMJA 3I9JA 2VT2A 2POQX 1NPYA 4MKZA 3U4DA 4Z9FA 3NUGA 5IZCA 1KC3A 1KEPA 3TZCA 1YWGO 2O3JA 1BG6A 1XHLA 1PZFA 1JDJA 1MC4A 1DO8A 4AICA 3RKUA 1BTOA 2O2YA 4I5FA 3PEFA 3CEAA 2B4QA 3DHEA 3DHNA 4UUOA 4PZEA 3DBLA 4FS3A 1I2CA 2Q1UA 3SBOA 3NTOA 4WECA 4ND5A 1ENZA 2FOIA 1M76A 4DBVO 4A7PA 4YRBA 1JVBA 2O7SA 4DMLA 1ZSVA 2YQ4A 4F6CA 3QVXA 3ZWMA 1DBVO 1MXHA 4W9NA 3D64A 3ADOA 1BW9B 4E13A 5G4KB 4MVJF 4DLLA 5JY1A 5FI3A 5IXSA 1V8BA 1XYGA 3Q2IA 3GVXA 4YQYA 3WGHA 7ADHA 3RUFA 3G3EA 4AJKA 1MG0A 4UEJA 4XIJA 1IL0A 1ENPA 4BGUA 4KP7A 3NDIA 1IPEA 1WDMA 4DQXA 2B0JA 5EQFA 4YDRA 2BFAA 1IZ9A 2C59A 2GSDA 1EUCA 2H63A 1DLJA 5CHEA 1LSUA 1GQQA 5EPOA 2E49A 4BMVA 4AJEA 1E77A 5I8WA 2FZEA 4XWYA 4OQYA 3KBOA 3DOOA 1ADBA 1J5PA 2NQTA 1V3VA 3QWAA 6ADHA 3VH4A 4CM9D 2G0TA 2J5QA 6LDHA 1MFZA 1DXYA 3PVZA 3FBGA 4DC1A 4ND1A 2FPGA 4NBUA 1Q0QA 4U5QA 1VI2A 1YO6A 1K5HA 2ZQZA 4L0QA 5ES3A 1XKQA 4PVDA 3PRJA 2YHUA 1PL6A 5HTOA 1CYDA 1ADGA
chains in the Genus database with same CATH superfamily
1K7XB 1KJ8A 1P5HA 1VCIA 3MJCA 1M6VB 1P45A 2WWFA 1P29A 4LE1A 3A4TA 5A4MS 2P3OA 3LUJA 3SE7A 4TKLA 1RHRA 5IT4A 4DUYB 2NO0A 3DL4A 1W19A 3WI7A 1FSFA 4NK5A 3LJKA 2ETVA 2RBEA 4URZR 1C9MA 1IH8A 1NHGA 4HLUA 3KD2A 3KL4A 4BB5A 2EWWA 3ZJ5A 1NP6A 4IDDA 3DM9B 2X6TA 1G2OA 4FWIB 5JNUA 3FZEA 4I3FA 4X45A 2JDIA 3UMJA 2HK7A 1JQ3A 3GFPA 5ESWA 2BC9A 2LIVA 3DA8A 3B1ZA 2H16A 1M7GA 2HHJA 5E7MA 4KPGA 3N6VA 1GPNA 5IVIA 1U2DC 1ZIXA 1MORA 4LI0A 1BQEA 4ON9A 4AU1A 2C2KA 2QR2A 1BCSA 1W59A 5JJIA 4F56A 2BZ1A 2PUEA 5BN5B 5B5SA 1W4LA 1Z5UA 1HV8A 5E4TA 5LQAA 2VZLA 5D51S 2QUBA 2Z09A 5IPFA 2P9CA 5JAUA 1TMOA 3HXOA 1DINA 4G5HA 5KWIA 1GFIA 3MNFA 1VG1A 3DOIA 1R0CA 4HZUB 4J75A 3FZNA 4BASA 3KOUA 3DULA 3M2PA 3W3AA 1QQBA 3C3BA 3WNBA 1B41A 1TJ4A 5IKEA 5HXAA 2TSYB 2G67A 2XI4A 3ZQJA 3SBDA 2ZE5A 2Q3DA 3GFRA 4KUEA 3COPA 1GJRA 3GX1A 2FW9A 3MCUA 3TTVA 3UENA 2VI5A 2QP4A 1YZQA 4X60A 3KNZA 4OX9B 1J9GA 1KF0A 3HKBB 3PFIA 3R5HA 2OGSA 1M6VA 1QH8A 4V1CI 2DECA 4QDZA 1WXEA 1O95C 3M6WA 1YBVA 1WVIA 3DCIA 3E27A 3WOHA 2VVTA 5L6LB 5CAEB 3VOSA 4EMBA 1M0SA 4QGSA 2C94A 3GQBB 1W9MA 2I7DA 1VCNA 4RM2A 1AQNA 4EABA 2JA1A 2MWMA 1NW3A 1N4AA 3ZW8A 2WIFA 3O03A 4HH3C 1E0DA 4U7HA 1GM5A 4A2WA 5IHXA 1NN1A 1TAGA 4NU5A 1UPFA 3RK0A 2NO5A 4BE9A 4JH0A 1SU4A 3LXRA 2MU1A 4IEFB 2H59A 4G25A 3IBGA 4WZAB 3PJRA 1B8NA 4RJJA 4LYJA 1L7BA 5C8VA 4L16A 3GEIA 4Q15A 1MX9A 4ROTA 3S70A 4RIFA 4DIOA 2QVYX 4F1WA 3C8MA 4HS9A 4MP8A 3ZGLA 1QJ4A 2ZSJA 3GEBA 1MX1A 1S8NA 2HR1A 1Y9AA 1BOFA 2ONKA 5ADWA 4RJ2A 5JADA 2P6PA 3DMTA 4S12A 3FMFA 5FUWA 3ZUGA 2EARA 2RGDA 1JTFA 5BR4A 4ND8B 1OFUA 3CR8A 1IWPB 4HZUA 2DRIA 2YXEA 2BZSA 2R8XA 1PQPA 1GSAA 2ZIVB 4E03A 5TMDA 2PX3A 4Y7DA 4HQFA 1M5TA 2VF2A 1JXQA 2QTBA 1QJCA 4M0EA 2REBA 4QT4A 2XRMA 1DCFA 1QZTA 4NSNA 1PCXA 2ZIZA 1MIHA 1N8TA 3HXTA 1T9DA 3GFQA 4L3WA 3I2YX 4BN4A 3A4YA 2XQGA 3BYZA 2AWOA 3HKBA 2ADFA 2A14A 2OQRA 1EP2B 4RY8A 3DKKA 1UDWA 4GRIA 3NGXA 5JO0A 5JAMA 4M6WB 5K2OA 3WWOA 5DB4A 1GPYA 3QE0A 1GFSA 3JZIA 2SNIE 4DV3B 1SHLA 1R37A 3FMVA 3IUYA 4K6FA 3RG8A 1R0BA 3MMXA 3SKXA 3PEEA 2B3TA 2VL7A 4D41A 3I6BA 4FFWA 4HNAB 2WU4A 5KNDA 5FEMA 5K0ZA 3N8KA 1RZUA 4BFVA 4O59O 2FW1A 1P33A 4LIPD 1W1UA 1LNQA 2BWJA 2XQJA 4FYYA 5FUBA 1EDOA 3B48A 3OZGA 2GJSA 4WZAA 3PFFA 1X92A 1QTIA 2GXQA 2SCUB 4WTOA 5FTWA 3ELYA 4I50B 1MO6A 2MR6A 3AUSA 4PZYA 4G1BA 1W7AA 4Q3EA 4CMKA 1GGKA 1D8AA 1HE5A 2P65A 4XEHA 4ZODA 2IZ6A 1AXGA 4RMJA 4DLSA 4EEXA 2AEFA 3GPLA 4Z4EA 2VZ9A 2OWDA 3SIXA 3U3KA 4DIKA 3E9CA 4V24A 2IHNA 3L7OA 2M1ZA 5FFFA 4JR0A 4IMJB 4BAGA 4RFSB 3R0IA 1XMPA 1MVNA 1UJ6A 2WJ6A 1T3ZA 3EIHA 3WJ7A 4EFLA 4RD3A 3IKTA 4EA7A 2GFIA 1HURA 1T5IA 3NIGB 1D9ZA 4MKXA 4YUAA 4YO8A 1Y7LA 4JL6A 4E32A 3SDZA 1MC1A 1TPZA 1Z13A 1I1QB 3FNIA 3ROPA 3EYAA 2QU8A 1GCIA 3W04A 4MLDA 2I2DA 4DL9A 4ZGBA 2J09A 3CBQA 3IT3A 3KEQA 1G20E 4EY4A 2R85A 5KSZA 2DKOA 1M3SA 4KQEA 4M4SA 1GG8A 1GDDA 5G53C 2BJVA 5T64A 2QLMA 3NUQA 3V7WA 5FLYA 1PD0A 1D7OA 3CU5A 4JB3A 3PUXA 4ZVOA 4L15A 4A8JB 1LDYA 4W63A 3SKYA 1NC1A 2QJRA 4HNAA 4K1LA 4HV4A 2JGJA 2BGMA 3VR4A 2OZPA 1IN1A 1VMDA 1VJ0A 1N2JA 2BD0A 3PNMA 4YJKA 3V8MA 4EP1A 2GBFA 1BDJA 1HOTA 2FLKA 3JU3A 1XZKA 3K9LA 4OTZA 4ASUD 1K0UA 3A1TA 2ZRNA 1GQYA 3EG5A 2XNDA 1HYGA 1N6PA 1E2MA 3SFTA 3AKYA 3WWZA 4ZU3A 5IUJC 1Q57A 3VVCA 1N6OA 2XUOA 1KIMA 4MX8A 2V7PA 1IHXA 2B9VA 2WWGA 2QRMA 2A94A 2O0KA 3QXJA 4JT9A 3LBAA 2BEKA 3N8HA 5TF4A 4BGDA 3SMQA 3OFJA 1ZYUA 3WGNA 3B5EA 4H35A 4OUKX 2D00A 3STXA 1RWOA 2HJGA 3THXB 3QW4B 3S6JA 3OU2A 1N9KA 2AD5A 1OYWA 5C3MA 1RJWA 1W0JA 3GBVA 2AMJA 1AU9A 4RQBA 2VHUA 1EXWA 1YC5A 1JB1A 3GJ3A 1U3TA 2NO9A 4TSFA 2WSLA 4G6ZA 3U0BA 2YNMC 3DP7A 1A2BA 1T9BA 1GNRA 4IZOA 1W88B 4WN9B 2G76A 3NEAA 2GZHA 3FTPA 2C9CA 3PEUA 4BKOA 1NR1A 5FOVA 1Z5VA 5FBHA 3QF4B 5LQDA 4FZJA 3AEZA 1XLUA 3HXKA 3KVNA 1P1IA 4PG5A 5CXXA 3UGJA 2JAPA 1DBPA 4OPMA 4U9IS 3F8WA 2VP0A 5G0TA 4HEA6 1AURA 5BVHB 1MX3A 3RD5A 4MQFB 4I14A 3BA1A 4FK8A 3TUJC 5EMHA 4PANA 5B2ZA 2XOKD 1ZM9A 3EGWA 2C7GA 4ZVTA 5AW5A 2J9FB 2OQVA 3ZQKA 3RRYA 3S1AB 5SZIA 1NQUA 4GXRA 4I4IA 3FGZA 3OCWA 4RNDB 3UMFA 2VNJA 2R6FA 3K16A 3KUCA 4DLWA 5LOVB 1QPBA 1D2HA 5L3SA 4IUBS 5HYVA 4R01A 3NP7A 1TK9A 1WMFA 1MLDA 2O0JA 5I01A 2NZJA 3HM2A 4JJZA 3ER6A 3NYWA 2AQ8A 2Y66A 3FVVA 3DS8A 3N53A 3JD1A 4JMPA 3AEXA 4BMNA 1YVPA 1MIOA 1RYFA 1TTHA 1UT6A 2R47A 2EJTA 3LOQA 3PUKA 2ZJ7A 3ON5A 1DKPA 1J56A 1W34A 5BYKA 3TRFA 3FLEA 4EHHA 1YE3A 1TMKA 4P3NA 2WR8A 4HLDA 5AI9A 2CXOA 5YASA 2FE1A 1P3DA 4EPVA 5F9FA 1X39A 3RS2A 4GPIB 1I2DA 6ABPA 3FOBA 1X38A 4XLZA 4GIBA 2BE7A 5I4BA 1X2BA 1ZPDA 3IXQA 3NDRA 4K3UA 1EFCA 2PPLA 3LFUA 3W8NA 1JA9A 1DWUA 1D6SA 1M1YE 1V8DA 3DQQA 2OECA 3AUJB 4BNWA 5LMUB 1W88A 2NXEA 4XJTA 1IQPA 3DNPA 1T9GS 1YS9A 4QX6A 4R1UA 4XYEA 4UD6A 1EESA 4IDEA 4KUGA 3AZOA 3HZHA 5EKUA 4LBZA 2GD1O 5A9SA 3AO0B 2HT1A 4K9LA 3UKOA 4G0OA 2WZCA 1NT2A 2J08A 3PC6A 2ZLBA 3LS2A 1TT5A 2EG9A 4W1PA 3R7NA 4LDAA 1U5BB 2P2ZA 4KLNA 3IR7A 3PGJA 4H7JA 2C96A 2X9NA 4AJPA 2I6XA 3BFVA 1P4AA 1ISJA 5J4KA 2IHVA 5DM2A 3JVVA 3Q7SA 2UUBB 2IKSA 4OFXA 1A9OA 3FD8A 2YHIB 3OD1A 3RIMA 3B3QA 2OO5C 3PEYA 1PV1A 2BSAA 4PG7A 1P9WA 4UCQA 3TVTA 3WB2A 4DWVA 2FP3A 4F3CA 1XTQA 4ML3A 5ALNA 3NRJA 5JBIA 4PNPA 3R7DA 4JCOA 1BH6A 1P31A 1JIUA 2RHLA 3VX4A 5ALOA 3RSSA 5JLJA 2V4ZA 3ADKA 5DT9A 1PF7E 3PXXA 3SXJA 5IS2A 1S3FA 2HUPA 2E7ZA 4MVJM 4YCSA 3PB3A 4OHRA 1I2ZA 2XGOA 4RZ2A 4CQLA 4D3XA 2JGNA 4NBTA 1U4NA 2Z5GA 3CPEA 1PLKA 2A5GA 4ZZ1A 5ITVA 3FRHA 3N0RA 2CCGA 4S0XA 4D4HA 2A0WA 1IZ8A 3DFMA 1OGIA 1UH5A 1GL7A 1YCHA 3MXOA 4IZIA 1Z5PA 4ZAVA 3WMRA 4A6DA 4I2NA 4LVOA 5E6SA 2Y1FA 4JP3A 1Q1NA 4V0MA 2ZULA 3T5MA 4Y6OA 5ADHA 1ETUA 2Y1GA 3UN1A 4ZIRB 3EVAA 1AQYA 1F0NA 4RBNA 5J4LA 4FWTA 1N8NA 3D6MA 2AOWA 3ODGA 4GDMA 2XLBA 3UXHA 4TT3A 2IPMA 4E30A 3ZHCA 2CNLA 5KOJA 4X00A 2XMRA 1U5BA 4B4UA 3QE3A 1HDCA 2P8SA 2Z8YM 2GPSA 3BBPA 4QATA 2H2DA 4R1LA 1CRPA 3ZHRA 2JLQA 1P8AA 3I9V1 3CH7A 4GXQA 4X94A 4P86A 3UB2A 5FB3A 2WYHA 2FUNB 4ZEMA 5JMTA 1ECFA 2XQFA 1WUTA 4HRYA 4YFYA 3RTCA 2WKQA 2YHIA 3NJ4A 3F73A 1V95A 2XZDA 3GDFA 1CETA 2B5OA 4RJIA 4D99A 2GM9A 2X76A 4M1EA 4RZIA 1C0KA 2PZBA 3ET4A 4EYEA 3LX6A 3AGQA 1MG5A 3V1LA 1YONA 2AEMA 4H2DA 5CU7A 1KO8A 3K9WA 3TQHA 1JQBA 3TDNA 3CRZA 2O2XA 2X23A 2WHPB 3OKAA 5I48A 1LSSA 1JKJB 1A1SA 1R88A 2ZSBA 2HZBA 2ABWA 3BMNB 3K0CC 1ZXLA 1WW2A 1ZIOA 4B4VA 1GT6A 2PZJA 2C9DA 3IAM6 1T13A 4GLLA 4CV1A 3RJ9A 1QV6A 5JNVA 2OLJA 4B3CA 4FJ1A 2FWMX 4UHEA 3OZ7A 3IEUA 2QD1A 3H9BA 1FTWA 5IAJA 1UKCA 1VLVA 5I8ZA 3SC3A 1BA3A 3VVLA 1Z2AA 2PSHA 4BGEA 1PQWA 4UQLA 3B3GA 4CM5A 2IW1A 3AXTA 1L5MA 4ZIRA 1F2VA 4Q93A 2OV4A 3EUFA 4F04A 5B2EA 1SEVA 3T0GA 4XIIA 1OH7A 4W7HA 4XD7D 1AE1A 4N0DA 5FWAA 1N32B 3HACA 1GSHA 4EI7A 4HYTA 2PLAA 1T1EA 2P3QA 1YB4A 1AHNA 1C4KA 1JR3E 4OMDA 1ZJ6A 4FFVA 3WWYA 5KJFA 4XARA 4H7KA 1AGYA 3PHJA 5BSKA 3AL2A 4M1ZA 2IVZA 4FE3A 4FBLA 4HH4A 4NIMA 4EY3A 4H4DA 5HF9A 3E3MA 3ZV5A 4F12A 1FYWA 1IEWA 1GPBA 2YIMA 4AMYA 1A7KA 1D2EA 2ZBDA 1W4AA 5LD2B 2H8KA 1E92A 1ZGAA 3FF1A 2Q4EA 3TIXB 4DIFA 4XQEA 5L45A 1N9GB 1B0PA 1RM3A 3QVOA 1IHUA 1DTSA 4J4HA 4KIJA 4PN3A 1Y5RA 5JZMA 3B7WA 1HSOA 2WHPA 3BHIA 2DG2A 3OP4A 1JKJA 1HF3A 1KZYC 4BFUA 5G0SA 1MAUA 3W1WA 1YNOA 1UPXA 4GVLA 4DSZA 3TFQA 2VRBA 1YJQA 1XJQA 5COBA 5TEVA 5TV2A 3EZXA 1U2TA 4YRDA 3EGDB 2ZU0C 4ILKA 4NYJR 1RIIA 2G40A 1KVQA 3ZWOA 4O4HA 4A0HA 1II9A 4CMCA 5HR5A 3WLTA 2ZUVA 1RRFA 4DEXA 2QXUA 5IN4A 1BGVA 1ECPA 1GNQA 1SOVA 2EJWA 2GN8A 5EIXA 3GGJA 2IX9A 1LRJA 5IP5A 2OV2A 1OASA 2PMBA 5C18A 2FPPA 2GBIA 5SYNA 3TBFA 1O0SA 2RAPA 1CRQA 2PKQO 2O9JA 1NNI1 3DZDA 4UBMA 4OLJA 4UNPA 3TL2A 3AB3A 2PJZA 4EHDA 1TM3E 4A6PA 3TKLA 3ORHA 2REXB 4A3SA 1M54A 3L0ZA 4EKGA 1XJ5A 1LI4A 3GEGA 4RPJA 4OM8A 4Q6WA 1QO9A 3RFCA 1Q50A 4MRMB 4MYTA 2X5KO 1ZJ4A 1ESMA 3F74A 2R4QA 1NJ5A 1Q44A 2AF3C 2XYPA 5I3CA 2P6NA 5J1SB 1FFYA 4ND3A 4GXNA 5ERYA 3F46A 3LT2A 4C3OB 5AVQA 3L0PA 4ZQIA 2QM3A 3H8SA 3Q0TA 2Y1EA 3LL4A 4IF4A 4KXLA 4N40A 4QPNA 3SMVA 5HUHA 4QREA 1DRUA 3QKUA 3LCVB 4J2HA 2EF0A 4C21A 1U3UA 4ARCA 1D3AA 4MTLA 1YZUA 1N9GA 2YFYA 3DEFA 3K73O 4AT1A 4H60A 3JQ8B 2B30A 4OQZA 4MV1A 3DYVA 4A9AA 2Y77A 1KBZA 3KFLA 1NMSA 2P2DA 3FPBA 1DKRA 3QLVC 2WJZB 3K1AA 4Q05A 3LKVA 4K9DA 4IEEA 4H1VA 5CGQB 3JZMA 2PNFA 3LI2A 3HCRA 4PE5B 1HY3A 3FR7A 2FMKA 1ZL2A 1GVHA 2CB0A 2NYAA 3C1AA 3KJEA 2PX0A 4NMHA 4O1MA 1OU4A 4OHXA 3HDVA 3I53A 1KMHB 2H7VA 2RMKA 4B5LA 4IIHA 4A5SA 2RD2A 2Q5CA 2QVCA 2JGDB 3MJFA 1BRTA 1K2WA 1UEXC 2OHIA 2REQA 4L8VA 1V3QE 1W29A 1K88A 4H27A 3D7MA 2WW8A 4UU0A 2LCIA 3DVAB 4UEWA 5KYWB 4CKEA 3RRMA 3ONWA 4AQDA 1Q1AA 5FD8A 4CL0A 4GP7A 3AJAA 3NRBA 4BQRA 1GUBA 3FBTA 3PKIA 3RU7A 4F92B 4MRMA 3OEEA 4Z6KA 3T0IA 3DR3A 4C5CA 3K0FB 1KAMA 4EO7A 3WBJA 4WNYA 2FSFA 4M76B 4DNXA 5EIFA 4GHWA 1ZNQO 2I65A 2B20A 3ZWBA 1Z7YA 5BQXA 2SKCA 4LBYA 2Y0DA 4IIYA 1CT9A 3W6PA 4INZA 1NY6A 4ZC8A 5HG0A 4WBNA 1XMJA 3P2EA 1V2GA 2X42A 4UU8A 3WX0A 3ZE1B 3CIOA 1U65A 1P0QA 2O54A 4MO2A 4WXMA 3U80A 3JQ8A 2SBTA 1NAHA 1PR0A 4HDMA 3FOEC 3VA7A 1YBHA 1L4UA 1KERA 3HY3A 4OP3A 4Q47A 3G7UA 3TRDA 1ZUIA 2IXTA 2QXTA 4G5SA 4KX3A 4EYQA 1SVOA 4BX2A 4RIHA 2NV6A 2ZDHA 3HLTA 3ND7A 4GX5A 4C2UA 4YAJA 4IX9A 4G5YA 3D2AA 1P1HA 3ASVA 3VR1A 2JGLA 1K6JA 1ZWKA 1E2JA 3GRPA 5C81A 5JCJD 2E87A 2JGDA 5LCXA 2WJYA 2H9AA 3TLYA 4XEUA 4OIMA 1Y8RB 3T61A 5IAOA 5KCZA 4ZYUA 1G3UA 4QVIA 1BJRE 5KYWA 3KKZA 2WICA 1J0EA 3AUKA 5EHXA 4G5GA 1QIFA 1XRJA 2OUKA 1PUIA 2OHFA 3QVUA 2DWPA 3I3SR 4FIZA 3W5VA 1DCTA 4PEVA 3NALA 2NM0A 1N2IA 2WG0A 3IKJA 3SEQA 5C4GB 1YK1A 1ODSA 3DBHB 4PSUA 3CX3A 1ZD5A 2AN5A 2Z5FA 4DNOA 1XPJA 1FC0A 3H8JA 1C3EA 2GJ9A 2GPTA 2H1VA 3T3GA 4I5DA 1F0KA 1TQ2A 1UK7A 5EWLB 2X0KA 4TXLA 1R4MA 5FAXA 1YRBA 3JQFC 4G5QA 3V4PB 3EPJA 5KC8A 2E4ZA 1NG9A 3VISA 3OE1A 3W77A 2P9GA 3C4VA 4JB2A 1E0JA 4KQ2A 4Q9HA 5FHQA 1U1EA 5KOIA 1CNMA 4OMUA 2JKVA 5AKKA 3Q8XB 2UVQA 1L4FA 3L1JA 3LYHA 2WAOA 4FDMA 4HNHA 5CB6A 1UAAA 3GCDA 3O26A 1P2GA 2OBXA 3JS5A 3QV2A 2XITA 3KK0A 4KO3S 4O2BF 4OU4A 4GT1A 5LB2A 3ADCA 5TE9A 3QSYA 1W4RA 2FG6C 3MQ2A 5A5GA 3VU0A 2XB8A 2H4FA 1USKA 1P5ZB 3KLOA 1G8MA 1WUHS 4C0SA 3K3PA 1SY7A 2W90A 2V7GA 1T9ZA 5BMVB 2DH5A 1ORDA 2QQGA 4IGEA 3WSTA 4M7WA 1Y8RA 4Q3OA 2BR5A 1SB9A 3B9BA 2Y99A 2GRUA 3L7CA 3PPVA 1XZDA 4TTJA 2Y71A 5ELMA 5FHRA 2I2CA 1XT6A 3C7AA 3AESB 1DEHA 1N2HA 4BLWA 4RY0A 1Y4DE 3DBHA 3JAKA 3N2KB 4FYVA 4JI3B 5C3UA 2VDVE 2ZRIA 1GU7A 3K94A 3TCXB 3M1YA 4TMFA 4YDSA 4Z1OA 4TTRA 1UWVA 4OH1A 4LOIA 3EXIB 3HN2A 5AJXA 2FWAA 3ZKAA 3MTEA 1OJ7A 1ACMA 5ESDA 4Q4CA 1HQCA 5CA1A 3ZGOA 2O1WA 3Q72A 4JA2A 1OWLA 1M5RA 1T8PA 3M5CA 4HNTA 5KYYB 3A6LA 5F98A 1SHZA 2OYRA 2H2AA 4DDUA 1F17A 2NX2A 3GNSA 5JCOC 3HFSA 2HDNB 3Q4GA 4IDFA 4TS3A 2G7MC 1WCWA 1CR1A 5FBLB 5DM0A 5CFQA 4ZQBA 4TLEA 1YZHA 3DC2A 5JFGA 4ZVQA 5HX7A 2IY8A 3ZW9A 2B21A 4W5WA 5DWQA 2QRZA 3G8YA 1E3SA 2PUVA 3FYCA 3ADBA 4KE9A 4AX8A 3EC7A 1N5MA 1SBNE 1DRVA 3DPUA 4BTVA 4CIXA 3IQXA 4QTTB 3TLCA 3ZTWA 1SVSA 2QPTA 2YVUA 4P92A 2QAGC 3NNSA 3TZLA 3W2EA 1UXJA 5BMVA 4EY8A 3BB4A 3NB0A 1ZEJA 4QFBA 1Z74A 3TH5A 3MOGA 5HS4A 4QHTA 3I8XA 4Q4AA 5DLQC 3W4JA 3GT4A 4A1FA 4DUGD 3GL9A 3EIUA 4KPUB 3T3DA 3CT6A 4Q21A 3RKSA 2QUAA 1S7GA 4HWTA 4KI7A 2GD6A 4PAMA 1VCMA 1CZNA 2RSLA 3CLSD 3FWZA 2IOQA 2Q29A 2WT9A 3N2KA 1ZZEA 3G13A 3R7SA 4ABTA 4CT4B 5BNIA 4MCHA 1EVQA 4TYWA 1OVGA 2R8PA 5GY7A 4AJ2A 4JP2A 4K46A 1U2ZA 1UBFA 1ZXBA 1TZCA 4WL0A 3DLAA 5CR9A 3TNDA 3OX1A 4L8FA 3V2UA 1Q92A 4K6OA 3MUOA 4KXFB 3QXSA 2Z8ZA 2HA2A 6Q21A 4QQRA 2R6JA 3CO5A 2ASVA 5J47A 2Z3ZA 4QVGA 4DLZA 4XVUA 1I14A 1Z3IX 2AD1A 1MENA 4E22A 3T8YA 3GJYA 2DQYA 4BQPA 4O5AA 1TF7A 2C95A 1GCAA 2ZBVA 3E0QA 1VSTA 4XXHA 3B6KA 5B7GA 3HV0A 2VJCA 1C9KA 3QH4A 5ANRB 2NTNA 1UIMA 3ZNPA 3UF0A 4OOEA 4UBKA 3U4IA 1PDVA 4MEJA 3C3YA 2DR2A 3AVTA 5BURA 3X2FA 4DV0B 3LG2A 3MFYA 1X87A 4OUDA 2R8OA 4J03A 5SZJA 3PI7A 3SJUA 1ZMBA 3W5UA 2H1CA 2CVQA 2HFJA 3OCUA 1QP7A 4L4UA 1EZZA 1A5AB 4LG1A 4PTYA 4KPUA 1SZPA 2JFXA 5AHRA 3IGFA 3K6KA 3TEJA 4ED9A 3CVVA 5MN5A 4M1WA 5TGTA 2WY2D 4HNUA 4UJ3A 3V3TA 2JEOA 1MFPA 4KO8A 2OXIA 4TRJA 1MD9A 2YYAA 1N2SA 3ESZA 1JKFA 1XC7A 5BR1A 1PD1A 3PXGA 4C04A 4BO6A 3QI7A 3CNOA 1O77A 1V4NA 1Y7IA 1ST3A 3W7BA 1K9SA 2EHJA 1B6TA 3LQFA 3P2KA 5F9HA 4BNHA 2V7XA 2ZRKA 3SXUB 1R6TA 2B34A 3UJBA 1ZY2A 4UAJA 2FN3A 5JJCA 2X6QA 2V54A 3OOJA 2FTKE 4GKAA 4PG4A 4PV7A 4B3FX 3FMGA 5JDCC 5B7QA 4DR1B 4OQDA 1YJXA 1UPCA 4IAOA 1ZVVA 3IVRA 1DJNA 3Q5EA 3H5TA 2JDID 4MR7B 1DELA 1FA9A 1HH4A 5C4IA 4NEQA 3HP1A 2LDBA 4GKKB 2JCBA 3VV3A 3EYWA 2C7PA 4LF5B 4IGAA 2Q1YA 4H7IA 2JGAA 2J45A 2VO1A 5IM5A 2B4KA 1CDDA 3A11A 2HSZA 4JJ7A 5FQNA 4XR4A 4IDQA 1CB0A 5HQJA 3TUZC 2ID9A 2Y1WA 3IP1A 3MMNA 1GGMA 4F2PA 4GX2A 121PA 3I45A 3CZQA 2QD5A 1DTWB 4J94A 5F2NA 2VTDA 3ZJTA 3QLTA 3X1XA 2HD4A 1YMUA 2ZJAA 3GH3A 4HYEA 5AYVA 2P7HA 4ARAA 4GX0A 2IHBA 2WHRA 4V0NA 3D3EA 2H1WA 3BGOS 3W3AD 3AEUB 3RU2A 3ST7A 3HA2A 3G23A 2O8FB 2V3CC 3NAQA 2SKEA 1G7SA 4JT2A 1XRMA 3AR9A 3FKSA 3R1IA 4ZCTA 5BQFA 4O3MA 5LYYA 3R9XB 1X9HA 6GPBA 2P1ZA 4IOLA 3IQIX 2CVOA 4ZI7F 3NBXX 1UJ5A 2EL9A 3SXUA 4UU1A 3O7MA 1YFJA 2VXCA 3BORA 1Q12A 1NFRA 3IDQA 4ENTA 1ECLA 2XMQA 2G07A 4U8GA 3SEFA 5KKNB 4RH0A 1BN6A 5CT4A 1C3VA 3COZA 2QKYA 4EKIA 2NTEA 1G5IA 3A2KA 2QV7A 3AY0A 4LF4B 3KWFA 4AKSA 2JI9A 3KKQA 4G86A 1F2TB 1K6XA 4MR7A 3ZNOA 4ECEA 5I5GA 4C2TA 4OYHA 4Y2VA 2OK8A 4ONEA 4WW0A 3C4JA 1TA4A 2WVAA 3GEDA 3T6KA 3U56A 3TVYA 3A3PA 5K51A 2I0FA 1LWNA 3ZH2A 2IGBA 4PLPA 4WKGA 2HBZA 4C2BA 1E6WA 3P0FA 4DVGA 3R5SA 1G0OA 1PJ2A 1IQRA 3EF1A 1TPYA 5AHKA 3W5CA 1X7YB 4L07A 2EW2A 3URKA 4JXJA 5EJFA 1DTWA 3Q1KA 1M8PA 1G20B 4MINA 1VHLA 4F97A 1P9OA 2VSYA 2X58A 1B00A 3MELA 2IYNA 3RFVA 3Q7PA 4HN4B 3JRWA 4HVTA 1E2GA 1E2FA 3NORA 1U5CA 1W75A 2AN3A 2CC2A 2PBLA 2X3YA 3EOBI 1WP4A 3RFTA 4ZK2A 5ARBA 3N9IA 4I08A 3QPCA 2JHPA 3UAVA 3NYIA 5F3WB 2I4TA 2ID8A 1H85A 3A0UA 4UHBA 3TGWA 4W5OA 1VRWA 3OECA 1MPTA 4JI8B 2P9EA 1AT1A 4A82A 1UBUS 4B7UA 3JSXA 2V9CA 3ZXXA 2KMLA 5L3QB 3R9XA 3LZ6A 2L17A 1JUDA 1NF3A 1YL5A 3MTQA 3NWEA 4KIFA 5GONB 3T9BA 2WABA 4ZN6A 2R48A 5J58A 1WU7A 4LHEA 3RIGA 2R7AA 4BUCA 4R84A 3B7PA 4A27A 5LIRA 3K4HA 3RU9A 4F5ZA 1VP3A 3BXFA 2RIRA 3GUUA 1XVTA 3W0LB 3VSBA 4BWVA 1O7JA 1NJ8A 5KNDD 3F0TA 3K4QA 5CJ2A 1AS3A 4LDNA 2ATCA 1TAHA 1F2TA 2XCLA 1USVA 2YWJA 4GKVA 4I66A 4PC7A 3IKVA 3GIDA 4NJOA 5AIBA 3U4HA 4FHEA 3B3FA 4BKQA 2HA0A 4CMAA 2Q2WA 1DS6A 4DQ0A 1SIUA 3EASA 3SQDA 4DF3A 3RBAA 2AOTB 2LKDA 5I9TA 1TIKA 3HBAA 5J2UF 1FSPA 2O2GA 3GD5A 4RKEA 3Q40A 4HTAA 5K0EA 1X7YA 3A04A 4LC9A 3RARA 1H5UA 1QCYA 2YIJA 3HJHA 4NBRA 3WKBA 3TBKA 1G20A 4E5PA 2GJKA 5B1DA 3IE2A 4HY3A 4GKJB 3RLIA 3V7NA 3QEAZ 4BQNA 4JI2B 3Q8WA 4MO9A 1JHMA 1YI0A 2FR8A 3CEJA 3QVVA 5T6MA 3TW8B 1DPFA 2XVZA 3HHPA 3W5DA 1UZUA 4LRQA 5D87A 1KYZA 3LT4A 5HJ2A 3CNQS 1U8CB 1VIYA 4N47A 5CXQA 4KO1S 2JIBA 3I3OA 4YP0A 3WLEA 4W4TA 3OT4A 3M6XA 1JEOA 3H2BA 1A95A 1GARA 3NT2A 5GONA 3FLMA 1JDNA 1J42A 5IT0A 1BXKA 1O4VA 1R5JA 3UG6A 1F0PA 4DB4A 3GT7A 1DC3A 1C8VB 5H83A 1RYBA 4JQOA 3TNYA 5TMPA 3KXKA 2X22A 3K96A 2F3TA 4ITUA 4UNIA 2LV8A 3EUAA 3LA8A 4L0QA 3OPYA 1W9HA 5AWFC 4V0LA 1M6WA 1VFPA 2AOXA 1HC7A 3BTUA 3KR0A 3R0VA 4RKWA 5EJ2A 5EQTA 5FWXB 3KR9A 5K3EA 4DYVA 2XNDD 5AXCA 2C2ZA 5C1BA 2AOTA 2CEAA 3A2NA 3ITKA 2FN8A 3F6PA 3UFXB 4E31A 4WLOA 1FLAA 2XY4A 1E7QA 1M1YB 1GR0A 1XZBA 4Y1RB 3U37A 4LKOA 3WGJA 5MHTA 3IAAA 1D6JA 4YECA 3RSOA 2PVPA 5AJWA 2FYTA 5CVJA 2WUEA 1X7DA 3HJFA 5T41A 1QG6A 2PRYA 3C5EA 3EVZA 1E6KA 3G88A 2K7FA 4JUAA 1T1SA 1QYWA 4M99A 4CM6A 5KYXB 2E6KA 4L7VA 1ODFA 4FCCA 4I5GA 3T5AA 4WZBB 2WOJA 1E4EB 2PU7A 2X0IA 3AOEC 3D7SA 4NCIA 4QGHA 1Q95A 2EDCA 2YDXA 3RE1A 5DNYB 5AKGA 4TSFD 4BFSA 5IDYA 3L7BA 2OCXA 1WB4A 5E0KB 4OI0A 1I0IA 1AO3A 2P6OA 3OO1A 5CYGA 3ZU4A 2VK8A 4UAGA 1G7RA 4X84A 3F2VA 1WQ1R 4PFQA 2ZTHA 1R4NB 1XXHE 3FCSB 2UZ1A 4OGKA 4RZUA 2WUFA 3AZPA 3ONNA 1GR1A 2EQBA 2YY6A 2FVXA 3VBEA 5ISMA 1DBSA 4OFWA 1YRHA 3GY0A 5E7QA 3IUJA 3NT5A 4FR5A 4HHEA 4TMYA 1KJ9A 1ORHA 3IQFA 3C3DA 1KRHA 3A3YA 1Y1TA 1NQ5A 1NT4A 1BE6A 2FWRA 1ND5A 1QH0A 2YWFA 3G9QA 4NWIA 1OXVA 3VM6A 4KE7A 5FOTA 4BUZA 2WIJA 5JBNA 2HMUA 2MOKA 1FDVA 3QFCA 4L4SA 4LMRA 4NECA 5FWXA 5KTSA 2GYWA 2HIAA 5AK3A 4CJXA 3Q41A 3KAJA 3UKJA 1LQUA 4J49A 2FEWB 4POAA 3PGLA 4W9MC 1OGJA 4DIUA 2CXNA 3HA5A 2ZYVX 2AK2A 2BHRA 4XCVA 3RSCA 1TFRA 3TTYA 3SICE 1UZAA 1Z6YA 2PZKA 3EMKA 4GGMX 3VJMA 1N34B 5FPKA 2D2XA 1DRKA 4REQB 4PXAA 4YCBA 4S2EA 4F3KA 1VL2A 3TLMA 1M1ZA 2IUEA 1UJNA 1M67A 3WDLA 5KYXA 2P2LA 1Q7BA 3CPJB 2FOXA 3A8TA 4WZBA 3SM3A 2KM1A 3FI0A 1K75A 4FHFA 3NTVA 2IS4A 2IBMA 3KUUA 4GNRA 2DBYA 3EMVA 3IMFA 4JBLA 1P9RA 3DVLA 2PMFA 1D1QA 1UPTA 2PQ0A 3OX4A 5EHIA 4BC0A 4IW3B 1II0A 1LPPA 1ISIA 3G0OA 4BJ6A 3TR5A 3ZWQA 3RG2A 4AJNA 2VCEA 5LFAA 3V2GA 3OTOB 2AYXA 3DE0X 2QW8A 1Z6PA 4OQNA 4ZOEA 1KU0A 4A8PA 2HIGA 4LRTB 4EFNA 4RIEA 2ZRPA 1KI9A 3OJWA 1TCBA 2IYEA 2P2CA 1YZFA 2ZETA 4YB8A 1OC4A 2FQQA 3ZWXA 3MJHA 1W5TA 2UZAA 2QGZA 4JR1A 4KN6A 4WXPA 4C3VA 3W5IA 9ABPA 3BWCA 4KWTA 4UXIA 8GPBA 1VBFA 1O94C 4GBJA 4XIYA 2KBEA 3IJPA 2DBRA 1KWGA 4G9GA 5EJGA 4KR9A 3C2QA 2GBCA 4UZSA 1CJCA 1T9HA 2Q4BA 1VHTA 5F76A 2O23A 4AO6A 3EWIA 4MKIA 4CM8A 5HHTA 1BVHA 3SJBA 3BN3A 4DXDA 3E7WA 1YR7A 2B4YA 5F2OA 4DCCA 4PNZA 4W7IA 4ZFNA 4AYWA 1D07A 5A4DA 3JD2A 5ALUA 3TG2A 1RLJA 1EVEA 2LR0A 4YS6A 4REQA 3AW8A 4ZJYA 2J3JA 3PGVA 1R5NA 4OHPA 1C14A 5E3IA 2QD3A 2H31A 2DFTA 1OIXA 4LFCB 3WK8A 2ZTSA 2GF0A 3W3AH 1VHDA 4TTTS 1PL0A 2PGAA 4ECAA 4EKYA 4XX0B 1RPJA 3GRFA 4JLNA 5HBGA 3BZBA 3B82A 3S3TA 1QV7A 5K6TA 1U80A 5AHOA 1QGDA 2RI1A 3QHAA 2X5NA 4L9WA 3U17A 4C4OA 5DYYA 1L7DA 1QZXA 3WL6A 5BR8B 3BK1A 2ZIWB 1SC6A 2WP8J 3DAOA 3WYBA 6AT1A 5K4HA 3I23A 1C29B 3UK0A 3IVGA 1XG5A 4TT3D 2YJ5A 4N01A 4GM1A 4OGLA 4ITRC 4ZZ3A 1LPMA 5JIBA 3G2PA 3WLRA 1LF0A 1L7XA 4LVNA 1J9ZA 1K5PA 2CN1A 1DZIA 2GCOB 2JLBA 4YQZA 3ZXUB 4B6RA 1KEZA 4WNIA 2WNIA 5JH7A 4PGHA 1SOWA 2PG3A 2BMEA 1C1YA 4FEEA 4CL8A 2GXSA 3RSZA 3G2LA 3KYDB 1IXSB 4AKHA 1POWA 1T15A 2Y1XA 4J43A 4J3JA 3ZBTA 1G38A 2HV9A 2PA3A 3U7RA 2PYIA 4WSOA 1KVUA 1QBGA 2JLCA 2JFPA 1R10A 1CX9B 1H1DA 3E84A 3TOCA 3VR5H 2ZZMA 3GN2A 3UUFA 2VAXA 5CCXA 3W8EA 2ZROA 2QJTA 4ENRA 2VHXA 2WMYA 3PE3A 4X6YA 2FA9A 3CYFA 1RZVA 3EF3A 2FDRA 2VDMB 3ROEA 1P0PA 5HIJA 3SHQA 5IVDA 5KJEA 3T7TA 4KACA 1VKOA 1TTTA 3UAWA 4X92A 2G3YA 1C41A 4DB2A 3WE7A 2FZCA 3KYJB 2ZTMA 3BF7A 4O4IF 3WIEA 3DTYA 1AUXA 3UAZA 5JG7A 3WGIA 3U1VA 1MF7A 1B6GA 1JQAA 4XDYA 2AH5A 2C1XA 4L5YA 3QOYA 3G5MA 5E6RB 3KJHA 3HC7A 3MCVA 1HQDA 1NNUA 3IO3A 2CJYA 3TGLA 3WB0A 3RV4A 1PGPA 1BNCA 2F17A 2QP9X 2XEXA 3T5PA 2OFWA 4HQKA 5KNDH 3I9MA 1G5RA 1U90A 3M1IA 1NY5A 3H11A 2B98A 2GCOA 1AK9A 2Q6TA 5BYJA 1E66A 1F9EA 2PEZA 4ZHSA 1YF3A 2RAUA 1BD3A 2I03A 3K7EA 5DX0A 1N92A 2C5AA 5CM2Z 2DTEA 5LUBA 3GAMA 3R0ZA 5T3UA 3LGXA 2A78A 4L4XA 1XQ1A 4AJOA 2YMQA 3OZAA 3PIDA 2REOA 4QJ4A 4CTOA 5CXUA 4XB2A 1I32A 2JIQA 1FDOA 4UULA 4Z53A 3CBGA 3B12A 1RBZA 3VUEA 2FRDC 1YACA 3ESYA 5F78A 4HQ0A 1E2UA 3V46A 2H3HA 2YQ5A 1C4OA 4C4PA 1EG7A 2YN2A 4ZCPA 1E18A 4YEDA 3LQRA 2VRWA 2XUZA 3VSAA 2IYVA 1H2YA 1SIBE 4ZOCA 4FSXA 1B8OA 2Q5JA 3BSSA 2I9KA 1CJMA 1NX9A 2KWIA 4PBRA 4WXHA 2ZJ1A 4B9AA 3H7IA 2C5GA 2OLEA 2QRVB 5HOQA 2J9RA 1VLHA 1Y80A 1I5EA 3KQWA 2Q4TA 1RQPA 3GI1A 4ARUA 3RHZA 4LJRA 3KQVA 3HYSA 3AB7A 4CG3A 4AO8A 4R2IA 2W6QA 1Y4AE 4HGZA 2QUKA 2WKSA 2XUKA 5TIIA 4UAVA 3UJAA 1XMOB 3AF3A 5CFNA 1IOVA 1H23A 4OKNA 4CV0A 5EIAA 4RYLA 2DP4E 4HDKB 3K5HA 1E1YA 5DHAA 1LBQA 1CZRA 1GPH1 3G2MA 3R4VA 4FYHA 2IZZA 2VNKA 3RASA 1TLLA 2ZR0A 3UFBA 1B0AA 2Q3LA 4RFLA 1YQ9A 5FOUA 4QNRA 1AGPA 4FOPA 4BKMA 2XSZA 2RK6A 3OIUA 1E64A 1HBJA 1GZVA 4GMXA 2C7BA 4PVCA 5CFRA 3UTCA 5LLTA 1PWHA 5H3CA 2P2GA 3K8YA 4X97A 2DGDA 4MYHA 5LMCA 1F0YA