4PO3X

Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
309
Chain Sequence
ADEEAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYEQSADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase B
publication title Crystal structure of a C4-C4 SN3 tributyrin phodphonate inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 122
structure length 309
sequence length 314
ec nomenclature
pdb deposition date 2014-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4po3X00
5EIAA 3NUZA 1XRRA 3WYNA 1GPKA 2AXEA 1X70A 5ALEA 1WPXA 4FOLA 1W52X 1CUSA 3VJKA 5AK5A 2JGJA 3QPDA 4G8DA 3RLIA 4X91A 4FLEA 5AHXA 1A8UA 1P0IA 2WG1A 2WQZA 4UBKA 3W2TA 4EHBA 2K2QB 1JJIA 3F97A 1MU0A 5T4BA 2OLEA 5AM2A 4ZRDA 2NW6A 1BE0A 4BAUA 1XZBA 2JEYA 2OQVA 4K6KA 2HFJA 5DWDA 1ZGCA 5AIBA 5BWCA 5DLPA 1B6GA 2AJLI 3T52A 4DM7A 3WQHA 4LXHA 4X6UA 1B41A 2QJRA 2WIGA 3DKKA 3A2NA 4PSDA 1TK3A 2ZYRA 1GPLA 2HRQA 5AKYA 4Y2YA 1LPBB 3AZQA 1SOMA 1JU4A 2ACEA 3GUUA 4Y2QA 1LBSA 4Y7DA 4FNGA 5ALHA 1TQHA 2RAUA 4I19A 1YA4A 3EBLA 3QYJA 2VF2A 5AM5A 4WY8A 3E0XA 1CUWA 4BTLA 3V1MA 4C4YA 3WMRA 4RGYA 5ALIA 3L1IA 2D5LA 3NOXA 3Q0TA 1CUHA 2YH2A 5K3EA 4N8SA 2G63A 4B0PA 4OPMA 2C0PA 3IUNA 5JALA 1ISPA 4FFVA 5HKAA 4RPCA 4ZGBA 1BRTA 1MJ5A 3K6KA 3FWHA 3AJAA 2OGZA 3C6ZA 1DX6A 1KU6A 1K5PA 1XLVA 2J3QA 2WJ6A 4HS9A 1OCEA 1ZIXA 5I8PA 1CUUA 3ILSA 4FKBA 2DQZA 2IITA 3R41A 5ALMA 1QTRA 2RI6A 1L7RA 2V97A 2WJ4A 4J0HA 2GZSA 5AOBA 4FDMA 2CZQA 3WYDA 1USWA 5DYWA 4QWWA 1ZD4A 3B5EA 3WI7A 5HQ3A 4OB8A 1XKTA 3H2JA 4Q3KA 4W1QA 2QR5A 1A8SA 2B20A 3VVMA 5ALOA 4Y2TA 5FLKA 1PV1A 4FLFA 3EF3A 3WK9A 4DNQA 4LKOA 5J3JA 3F98A 1L7QA 2DHCA 3S8YA 2PL5A 1U8EA 1VE6A 4M0EA 1XZJA 4C01A 1CFJA 4U2CA 3G9XA 4DGQA 1E8DA 1ZOIA 4UUQA 4QLOA 3FYUC 3ICVA 1ZD5A 5T4HA 5D3KA 2ZJ6A 3HACA 3STYA 2XQKA 2HA6A 2ORYA 2Z8XA 3OTQA 4QDTA 1VXOA 1Q0RA 2BAGA 4OYLA 4I4CA 5A62A 1RWQA 3KOOA 3BJMA 4ZV9A 1YR2A 1QJ4A 2AJDA 4H0CA 3DNMA 4JYMA 4BCCA 3G0IA 1CUIA 4UBJA 1AGYA 5JAOA 3ESBA 1PFQA 4HTAA 1R88A 2VT6A 2JF0A 1EDDA 1QONA 4J03A 1S8OA 5AIAA 4GW3A 4DNFA 1ODCA 3ZLUA 2C5GA 4ARBA 4P93A 5LZ9A 1E8MA 4JH0A 4MXDA 3SX4A 4ZV7A 1YB6A 4UBOA 3DQZA 4N5IX 3KWJA 1XZAA 2XI4A 2O2IA 2V98A 5HFNA 4KE8A 4C89A 1ODSA 4FBLA 3ZPXA 1ODTC 5AKIA 4FFWA 5FPPA 4C87A 3IUMA 3H17A 2XLCA 1LLFA 4AN1A 4C88A 5ALQA 2V9ZA 4WDRA 3G0DA 2WU4A 4J7AA 3IUQA 1VE7A 2O7RA 3FSGD 5IVDA 1CUCA 4EY7A 4MQMA 4GXNA 4X97A 4HXFB 1EDEA 4CIBA 1QFSA 4IH1A 1ZD3A 1D07A 1DT3A 1LPPA 4TGLA 5AK4A 4XJVA 4RE6A 2OPHA 5AICA 4F60A 1Y7IA 1MAHA 3OM8A 1H2WA 3ICWA 4BDSA 3EIOA 3FYTA 1W75A 1XKLA 3W9BA 5CURA 1GQSA 1W1IA 1DQZA 5A2GA 3TRDA 3GBSA 4QA9A 4DSZA 3BF8A 5JANA 3PDCA 5D6OA 3B12A 3H19A 4WCVA 3BJRA 5JIBA 5IH7A 4QNNA 4E46A 3AILA 3WKAA 5LZ2A 3GROA 3Q8WA 3FYUB 5AI0A 5LKAA 5K3DA 5CTAA 2XUPA 2HL6A 2ONCA 5LKRA 3G9ZA 3IVMA 1FSSA 3QZUA 2PBLA 4BE4A 2XUDA 2WHQA 1LPNA 5KWIA 5SYMA 2XMCA 1XQXA 5EIEA 4F21A 4BVKA 4UBLA 1IUOA 3VVLA 5A7GA 4ROTA 1E8NA 2WG0A 2X76A 1IZ7A 2WTNA 3K2IA 3NWOA 5AOCA 2GYWA 1JMKC 5AK3A 3WJ1A 2HHAA 4IH4A 4ITVA 2LIPA 2JEZA 3OC0A 2XMQA 4OD0A 1ORVA 3R3WA 1JT2A 2AJBA 5FV4A 3K9BA 4INZA 2WILA 4BBZA 4X85A 4U2FA 3C6XA 4BTVA 4QDOA 5CT5A 3C6YA 5C81A 2Z3ZA 5K3AA 3HYSA 4QEKA 5D7BA 1FFDA 1WHTA 1F8UA 5SYNA 4L3WA 3T4UA 2WU3A 4HVTA 1CUDA 2PPLA 4JEIA 4N5HX 1O6GA 3BF7A 5JD6A 1VZ3A 2X5XA 2WM2A 1W76A 5C8VA 1ZJ4A 1JJBA 5AKLA 2ECFA 2JGMA 4MJ3A 4PF1A 5E4JA 1UXOA 3C5VA 4DYHA 4AB1A 2GYUA 4G4IA 1UOQA 3OG9A 5ALDA 4DTCA 4A16A 2XUGA 4K6GA 1EVEA 4UBIA 2E3JA 5C8ZA 4DNPA 2H7YA 3PF9A 4KR0A 1H2ZA 3ZLVA 4A23A 4IHAA 5A7FA 4W9RA 4H7DA 5LZ7A 4F0JA 5CXUA 3FLAA 4NMWA 5CH8A 2XUJA 1UK7A 4ZI5A 2QM0A 4OCZA 3QPCA 4LHEA 5ALPA 4DNOA 2PSDA 3DS8A 1U4NA 2WIDA 5AM1A 4DLNA 1VA5A 1QTIA 2XQGA 3AUKA 1NX9A 1BEZA 4X71A 1BCSA 2OQIA 1QIDA 3VXKA 5AJHA 1GQRA 3D3NA 1YB7A 4Y2PA 4H18A 1K4YA 1QGED 1EX9A 5ESRA 5K3BA 5AKEA 4CG1A 3I2IA 4B83A 3G0BA 5JZBA 3HEAA 5C8XA 1GPNA 4V2IA 3HRHA 3O4JA 4AQDA 3BE8A 2PM8A 4BATA 4W1RA 4BVLA 3HSSA 1GT6A 4EBBA 2C0QA 3FAKA 3LLCA 5DTIA 3IDAA 5DYYA 4AO6A 4K6HA 5CW2A 4LXIA 4BP9A 5KBYA 3CXUA 4WFIA 3LCRA 3SC2A 1CIJA 2ROQA 2RHTA 2XMSA 1P0MA 1WB6A 1K63A 2PVSA 2WUGA 1H2YA 3ESAA 3STXA 3EQ8A 2HU7A 4ETWA 1Y37A 2O2GA 3M81A 1XZMA 3IB3A 3IBTA 1GZ7A 5HFAA 2FUKA 3RM3A 2ZVDA 1ETHA 2H9YA 2VJCA 1LNSA 2CEKA 3U1TA 2OXEA 1DU4A 3QITA 5LZ8A 3O0DA 5AKHA 2V96A 2C5FA 4CG2A 5IKXA 1ZI8A 3ZI7A 5YASA 2VSQA 1T4MA 5ALNA 3WA6A 5EGNA 4Y9SA 4W63A 4DMCA 3SWWA 2WHPA 1YS2X 3FLBA 1HPLA 3FOBA 3UUFA 2XUHA 4MQLA 1CV2A 4P92A 2HDWA 4OYYA 3G0GA 4CCYA 5LIPA 3WKDA 1R3DA 2BUBA 3D2CA 4C6HA 1P0PA 3WK7A 1G42A 1YCDA 1HDEA 1UT6A 4CI9A 4XWGA 2WFLA 5AKKA 5T4FA 1QOZA 3ZWQA 3QH4A 4B85A 5JARA 3F96A 1WPRA 2G5TA 4CG3A 4Y2UA 1U65A 3D0KA 4QLAA 4DMHA 3UMJA 3R3UA 4UHDA 4Q34A 2H1IA 1MNAA 1XLUA 1XRNA 2BUAA 4Q05A 1C7IA 2XLBA 3HZOA 4Z49A 2QUAA 3IA2A 4HAIA 4Y2RA 2GBCA 2WLSA 3HABA 1CUFA 3F9CA 4DMFA 4U2DA 2RIPA 2OAEA 4YX9A 1XZFA 5CT8A 3QMVA 1MPXA 1ACLA 1M33A 1LPSA 3A2LA 4WJLA 2QOEA 2R8BA 4A5SA 4J3JA 3S2ZA 3WK5A 3CCCA 2BUCA 2ZYHA 1AURA 5JD5A 2Z3WA 4UFPA 3VISA 2ES4A 5JAUA 1ZD2P 1L7AA 4HXEB 2I78A 1EB8A 1JMYA 3H18A 1LGYA 1XROA 1J06A 4OUKX 2X8BA 1JI3A 1KEZA 2HM7A 2I03A 4B80A 4K2AA 5IVHA 1CPYA 2CUTA 3DL4A 1RYYA 4WFJA 1K6EA 1JU3A 1HBJA 1X2BA 4L9AA 3WKEA 1XFDA 3MUOA 2VEOA 4UHEA 5AI5A 4KAFA 5CXXA 4IH9A 4CFSA 4EY8A 4KEAA 3IIIA 4PO3X 2WUDA 4N8EA 1GKKA 4ZXFA 2D0DA 7YASA 4UBNA 1BCRA 4YK7A 3BL8A 4U2EA 5JATA 1WB5A 1UKAA 2WHRA 1DINA 2Z5GA 1TCAA 3MUNA 2RHWA 2PUJA 5DNUA 5I9IA 1EH5A 1LPMA 4UHBA 4PSUA 1TAHA 1R50A 1F6WA 4H7KA 1AQLA 2QVBA 1NU8A 4PNZA 3H0CA 4O08A 4B7ZA 2DCMA 2WG2A 5FPQA 1Q0ZA 5CRIA 3AZPA 1AC5A 3ZV7A 5K3CA 3O9VA 1XRPA 3D4LA 3GA7A 1WOMA 4OU4A 4W1PA 4Q3LA 1MX1A 3V1KA 4MEAA 5E4YA 3FCYA 2Y6VA 1X2EA 3KSRA 5LYYA 5AM0A 5AI9A 1HKHA 4QE3A 1HQDA 3WK8A 4AN0A 4X93A 3WWEA 2XUOA 5AKJA 1DX4A 5ALKA 2PU7A 3V1LA 5AM3A 4BZWA 3I1IA 1ZJ5A 4BAGA 3DJYA 4C4ZA 4FTWA 3WKBA 4AXBA 3SK0A 4G5XA 1P0QA 5LZ4A 1EI9A 2FJPA 1VLQA 2I3ZA 2O7VA 3DCNA 1XRLA 5ALZA 1EXWA 4X7BA 3BIWA 1EB9A 3WZLA 4X94A 2EDCA 1YAJA 3PICA 5HQ3B 1N5MA 3PF8A 3BDIA 3WL7A 3D5EA 4Y2SA 1CUXA 1QLWA 1QO9A 5DTJA 2VJAA 3HXKA 4G9EA 1R4ZA 3ANSA 2J4FA 4H7FA 4P9NA 5AOAA 4J0JA 2QRUA 1XZLA 2YASA 3PFBA 3D2BA 4BAZA 1QE3A 1AKNA 2JIDA 3OPMA 4UFOA 4M0FA 1SCIA 2YYSA 3M3DA 4EY6A 1AMNA 3TEJA 4MEBA 2QKYA 5K3FA 3KD2A 2GYVA 5ALFA 3UUEA 1CUGA 2XE4A 4X95A 4G8CA 1UOOA 3H04A 1R9NA 1AUOA 2XQIA 3M82A 1QZ3A 2ZYIA 3H2KA 3DKRA 3LIIA 3PI6A 1TCCA 4NVRA 1XLWA 1DQYA 2XMBA 4G4JA 2Y2UA 5AI4A 4B6GA 5JAPA 3MGAA 1MX9A 2R11A 3WIOA 3CN7A 2IX9A 4E14A 5IVKA 1XQVA 3KDAA 4EZIA 3O4HA 1CUJA 1XQYA 5HF5A 2XUAA 1NU6A 4MYDA 3KWFA 2PKYX 2JGLA 5BWBA 2AJ8A 1XZCA 1DWPA 1YAHA 5JD4A 3FVTA 3DLTA 5CBKA 3P2MA 4UHCA 1GGVA 1LZKA 4LYEA 2Z8ZA 2VAXA 2DSNA 1PJAA 4B84A 1I6WA 3ANTA 4QZVA 3BWXA 2IIVA 4KAAA 4DIUA 2OGTA 5AI8A 3HJUA 4MYSA 4GWLA 2QUBA 2VAVA 3L1JA 1J07A 5T4EA 2OCGA 2W6CX 3O9MA 5E2IA 1EK1A 3BXPA 1EINA 3WL6A 4BCDA 4JNCA 3N0TA 4AZ0A 5HK8A 4QDZA 3FLEA 5AP9A 1Q84A 4OSEA 1QIFA 4B82A 4GDMA 3WWCA 5HF9A 5ALJA 1CQWA 3PFCA 3EQ7A 3I6MA 1CUVA 1QIGA 3R3VA 4HRXA 2OCKA 3QBJA 2XDWA 2OG1A 3W9UA 3X3HA 3CN9A 5KREA 2PU5A 3DD5A 4PQEA 1LZLA 3G02A 3GFFA 3WL8A 1XQWA 2AJCA 1BU8A 4BB0A 4PSCA 1XRQA 3EQ9A 4GEGA 2HFKA 5HCUA 1WHSA 3R3ZA 1QIIA 1H22A 1FFBA 2DHEA 4WFKA 2XQJA 3L1HA 5ALYA 3C43A 3I2JA 2B61A 5JZ9A 4RE5A 1U2EA 2WFZA 5EI5A 3D7RA 4ZREA 2CKMA 3C5WP 3WA7A 1UFOA 3HLKA 4W1SA 2C7BA 4FMPA 2EEPA 4FWBA 1XZIA 1SCQA 4X6YA 2XMZA 5EHZA 1THGA 2UZ0A 4OU5A 3D59A 3C45A 4EY4A 1RP1A 4GECA 4Q82A 4FLMA 1R1DA 5H3HA 4X90A 3JW8A 4KRXA 1BN7A 1CLEA 5F4ZA 3STUA 1DWOA 1A88A 2BGRA 3G8YA 3WIBA 4D9JA 4H77A 1SCKA 1J2EA 1QIEA 1YA8A 1W4LA 4YPVA 1VXRA 3VJMA 2QZPA 3LIPA 4G9GA 5AKXA 1BEEA 3DDUA 3V1NA 4M0MA 1EK2A 3YASA 1EHYA 3D2AA 4KAJA 1QIJA 5ALVA 3O95A 1UK9A 1XZEA 2HA3A 3FNBA 3IULA 3AZOA 4U2BA 2CJPA 2HA5A 3I6YA 1H23A 2XUKA 1YS1X 3TJMA 5JASA 1G4HA 2G4LA 4X3CA 2C4HA 4L0CA 1MT3A 1IVYA 2XUFA 5AI6A 5CH5A 1JKMA 3AIOA 3G7NA 1GXSA 2G5PA 3C6BA 3C87A 1ORWA 2OCIA 3A6ZA 3FCXA 1UKCA 3IURA 4G8BA 2HA7A 3DL7A 3C8DA 3WJ2A 1CVLA 2WFMA 3I1YA 3NGMA 3WZMA 5LZ5A 2H7XA 5DYTA 1CUEA 4Y2JA 4L72A 1E89A 2OGSA 5AO9A 3I28A 2ZSIA 4IQ4A 1O6FA 4J0DA 1DTEA 3R40A 4K5QA 3I2HA 1AZWA 3LS2A 5HKBA 5C7YA 1QIKA 4B81A 3V48A 4NZZA 2JBWA 2XMGA 3RKSA 5JZSA 5HF6A 4C4XA 1FFCA 1OILA 1XZGA 4KE6A 3C70A 4LYDA 1EVQA 1TIBA 2BGNA 4GBGA 1WCYA 4PV7A 4YASA 5ALTA 5A7HA 4B0OA 5I7UA 1E5TA 3QPAA 3R3YA 5ALXA 2WUFA 4LIPD 5IVIA 1SFRA 1XZKA 5HF8A 3ED1A 1ZIYA 5FP0A 1UOPA 4IO0A 1EA5A 1YSCA 1TCBA 3OURA 2XT0A 4RNCA 1IMJA 4H7JA 2GZRA 1LBTA 2PUHA 2VTVA 4BRSA 5CT6A 1TKRA 2WKWA 2BFNA 1SC9A 3HI4A 5CH3A 1UK6A 1QO7A 2PSFA 4BDTA 2EDAA 4FHZA 4EA6A 2PSJA 4B9AA 2QT9A 2YXPX 1E66A 1N5RA 5CT4A 2ZJ7A 2XUIA 3BIXA 2PSHA 4DMKA 3H2IA 1J1IA 2ZYSA 3N2ZB 4F5ZA 1F0PA 2WJ3A 2J3DA 3OOSA 1VJ5A 3QVMA 2CB9A 3FYUA 2WHPB 1QFMA 3VKFA 5KWJA 3QMMA 1AX9A 3GZJA 5ALRA 2BJHA 5AM4A 5A6VA 1JJFA 3H2HA 4CCYB 4HRYA 4AZ3A 3DOIA 3H1BA 3JYHA 5EHQA 2OCLA 4XIIA 1G66A 4AO7A 4AMYA 1MX5A 2WFLB 4AO8A 5AKGA 3V9AA 4BCBA 4P08A 1MNQA 4UHFA 1QIHA 4X92A 2HA2A 3I2GA 1KU0A 5HZGA 4U2GA 2VATA 3DYIA 2HIHA 2VA9A 4UBMA 4EY5A 1UK8A 2HRRA 5LLSA 1ZI9A 4E11A 3G0CA 5ALSA 2FJ0A 3DOHA 5BOVA 3H1AA 2W22A 3W06A 1XZDA 3R3XA 4BP8A 2DFPA 3I6ZA 1C4XA 1MAAA 4Y2XA 2VT7A 2QJWA 2DHDA 5DNWA 2B4KA 3A70A 3ESDA 4FNMA 4UHHA 5FDFA 2GBIA 4G4GA 1VZ2A 3AIKA 5ALLA 2Y1KA 3C8HA 2HADA 1HLGA 1JFRA 3GELA 4Q1VA 3WKCA 1TRHA 4ZWNA 1VA4A 5AH0A 2P8SA 4UPDA 4N8DA 5AKZA 2OAGA 5CT9A 3DYVA 1MN6A 4XX1A 4ARAA 1FFEA 4WDQA 4E15A 4CIAA 1CRLA 2HA4A 4H7HA 2QTBA 5FKJA 1Q83A 3W04A 3H2GA 5EHXA 2ZSHA 2WIJA 3I2FA 4KACA 4GHWA 2XMRA 4AX4A 1A8QA 2I3DA 3DEAA 2DR0A 5HK9A 5DJ5A 3TGLA 2HA0A 2VJDA 4WY5A 3O4GA 1HL7A 2ZJFA 4NS4A 1VKHA 1WB4A 2CMFA 3WK4A 4I3FA 3E3AA 2FX5A 1UWCA 2RGUA 1CQZA 4MWSA 3PE6A 4OB6A 4LXGA 1WM1A 2JGEA 1ZICA 2DQYA 2XB6A 1R9MA 3LP5A 5EIHA 5FOQA 4J0IA 1UKBA 4S0XA 4BZZA 5K5EA 4EUSA 1DT5A 3AINA 1ZGBA 5LP1A 4PW0A 3WWPA 4BVJA 2WSLA 3ESCA 2RONA 5BV7A 2QS9A 2JGIA 2WIFA 3WWOA 5ALGA 3VDXA 2PSEA 4DSAA 5DNVA 3QMWA 5D3ZA 2VQ6A 3ZLTA 1LPAB 5FXMA 4HZGA 2WUEA 2PX6A 1Y7HA 3E1GA 1G5FA 4KRYA 4Y2VA 5CMLA 4CCWA 2XQFA 3KXPA 1IUPA 1H2XA 4GI1A 2HU8A 4KE7A 4HXGA 3BDVA 4OB7A 1EDBA 2QXUA 2WIKA 1ACJA 4J0CA 3RARA 4TPKA 4BE9A 4BC1A 1LPOA 2BCEA 2VJBA 5EFZA 2QXTA 4FBMA 3FBWA 2ACKA 2Q0XA 4X6XA 3PUIA 4J0GA 2QMQA 2JGFA 3RK4A 3U0VA 2H7CA 1CUAA 4BYMA 1Z68A 1MO2A 3G9UA 4H7EA 4EB0A 2XMDA 1DWQA 2C58A 1QIMA 1BROA 2BKLA 2JGKA 2HU5A 1FJ2A 4H35A 3E4DA 3IUJA 5JYCA 3STWA 3FSGA 4BC0A 1CUZA 4AMZA 1N8SA 3JWEA 1MTZA 3WLAA 3QM1A 3WL5A 3PUHA 3STTA 3FVRA 5ISMA 1VOTA 5JADA 1THTA 1BN6A 4QWMA 5FUMA 1XRMA 1F0NA 1E3QA 4JUIA 4GLBA 4TVKA 4KYVA 2J4CA 5FRDA 5K3FB 5A71A 2GBGA 3A2MA 1ZI6A 2Y2VA 3I2KA 2O2HA 1CEXA 3HC7A 5AK6A 4X00A 5ALUA 1N1MA 1CUYA 5JAHA 1BS9A 4QDUA 4Q3OA 2B9VA 1XZHA 4J0KA 4UFNA 4XVCA 1T2NA 2GBFA 4G1FA 1CUBA 4MWTA 4H7IA 3F8SA 3W05A 4B9EA 1A7UA 3WWDA 1IZ8A 1K8QA 3AFIA 5E4TA 3STVA 3CCBA 1OXMA 3M83A 4JYPA 4KJXA 2CBGA 1UZAA 2Y6UA 4BRZA 1C7JA 3VJLA 3WK6A 3AIMA 1GKLA 1CR6A 1FFAA 3MVEA 5EHNA 4QDXA 2XUQA 3O4IA 3R0VA 5ALWA 1IUNA 6YASA 3F67A 1W6RA 3B3QA 3G9TA 4KE9A 2WTMA 1YASA
chains in the Genus database with same CATH superfamily
5EIAA 3ON5A 4CGYA 3E9CA 1GRNA 1K75A 1YQXA 3GCDA 3DTVA 1VKOA 5B5SA 3HNPA 5KOHB 1PVVA 2AV6A 3DLIA 2R44A 3H5LA 1JKJB 2V6MA 3L0YA 3LO8A 1MQ9A 2OCPA 5BR1A 4EUNA 3DB1A 1RM0A 4F97A 2Q6IA 4ZIRB 2BGTA 1P75A 3THYB 4QVGA 4C08A 2XXJA 1EVLA 1C1DA 5IC6A 1Z0JA 4LRTB 3BH7A 3KQQA 1C4KA 4G8DA 5EE5B 1JSZA 3L4BC 1SBZA 2YHSA 2QB5A 3D6JA 2WZQA 3L9WA 4FLEA 4NZOA 3RFVA 5BV8A 2WR8A 3PC3A 1E1CB 1VSBA 3IIMA 1IU9A 3PXEA 4JITA 1UPTA 1E77A 4Y0NA 1A8UA 1YR6A 3DKVA 4ZMBA 2PXAA 1HEYA 5FL3A 1GZVA 3UGQA 3ZE9A 4DBZA 3LQYA 4P34A 5FL7D 3DBOB 3W2TA 4A1FA 4YR7A 1R2QA 3I42A 5CX1A 4EHBA 4TRNA 1FQWA 2ZR9A 4TVSA 3W5UA 3HMKA 1GL9B 5FIUA 3WB2A 4PLFA 3TW8B 5TXGA 3SYNA 4U3JA 2FEPA 4KDFA 3ZU3A 3ZCPA 3A4YA 4ZRDA 1SPXA 1U9JA 4WL0A 1GTRA 2G17A 4DC9A 3TQHA 2IPXA 3U26A 6CHYA 2OZKA 2NW6A 1SHZA 2VHQA 3KJFA 1SHJA 5IMBA 1BE0A 4EKIA 2Q6OA 5E6UB 2ZR7A 1Z2NX 3H99A 3IOMA 1RI3A 1Z15A 3CB4A 3CEPB 3IRUA 3NBMA 4GMDA 1PJ2A 4HN9A 2IWRA 1VMEA 4FVTA 2P11A 1O87A 3WGZA 2XB8A 1ZGCA 2JIZA 5BRAA 2L18A 1QZZA 5JNWA 5BWCA 1II0A 1O1YA 2I2WA 3ROPA 4CLRB 1XKQA 3QVLA 2H9AA 4JQCA 1TJNA 4EHKA 2V1XA 1TYBE 3Q7EA 3RQSA 3CZRA 4HEQA 2ABWA 2BE9A 2QJOA 3B6KA 3MMSA 1VHJA 4HQOA 1B41A 2Q9UA 3K8ZA 4X6UA 3TECE 1U0RA 3DKKA 4PSDA 4WLFA 2WAXA 4Z3OA 2RHMA 3SSNA 1GPLA 1C0EA 2J4DA 3SFVA 3UM9A 4Y2YA 1TGYA 3BXZA 3T3DA 1LPBB 2FZVA 5IDWA 4I36A 4AMUA 2GCEA 4MCIA 2V7PA 5JXJA 1YBFA 1SOMA 4XLLA 4PHTA 2WMOB 3K09A 1QFJA 3NIBA 3TLGB 1WIWA 4UEKA 5K8IA 1N3YA 2B82A 4ML3A 4Y7DA 5C46F 1XR3A 4AXXA 2Q5HA 4FNGA 1XP5A 3OUZA 2OVFA 2HMYB 4I19A 3HDYA 3F3KA 1JBEA 3REFA 3SQDA 5EIXA 4F4FA 3ZNPA 2DJIA 1M2FA 2N46A 3PWSA 2FK7A 3FMIA 4IBOA 5LXTF 4HVCA 5C37A 4AS1A 3THOA 2XAAA 4MROA 3BKXA 1ZBQA 4BLRA 4P4UA 3EBLA 1LRLA 4WUTA 3WGGA 1WDMA 3WYAA 5HRAA 2D6FA 2IEGA 2FN8A 1XU4A 2ZSAA 4TYQA 4WI1A 5BPFA 1C50A 3V97A 3SQWA 2K7FA 1CY1A 1I1HA 4KIFA 1P2TA 3KETA 4L8YA 1H2RS 3V1MA 4BBJA 4O2AF 4WY2A 3WMRA 2HYIC 2YVAA 4TZ6A 2WSYB 1JSCA 3LM8A 1E2BA 4X0EA 1WZIA 1P0CA 3H86A 4X1OA 4X1IA 5COQA 4CL8A 1GTJ1 1PFGA 3PJFA 1ZAYA 4D26A 2DQ4A 3HJRA 3OHMA 2LCFA 3ACDA 4NESA 4WOJA 2FQYA 4WUVA 4X66B 2F55A 3OF3A 4RKQA 1ISPA 4FFVA 4Z1OA 1TUEA 1YI1A 4AY2A 1WBDA 3VI4B 2VPZA 3IQFA 4IGEA 3UANA 2DBVO 3T5AA 1BRTA 4JVMA 2BEUA 1ZM2A 1XHLA 5K0JA 3LVQE 1WXIA 3JZIA 4IX1A 1MX3A 3PB3A 4MRSA 3RFTA 4RFSA 1ZGGA 2OGZA 3U3ZA 5JQWA 2AFIB 1YIOA 1BHSA 3A0RB 5FORA 4QGHA 1NXSA 1L7OA 2B37A 3VU9A 3PXUA 1YZHA 1V11B 2D2IA 3SR4A 3OU7A 4HS9A 2FWPA 3V8PA 4XZ3A 1OCEA 4AJPA 4JKOA 3B1FA 3JD4A 4QTZA 1F1JA 5I6DA 1SXJC 4LHSA 2DEUA 4WW0A 3R0QA 2EHJA 2P0YA 3GMSA 3JALB 5I8PA 4HPWA 3TB4A 1P0FA 4NU5A 4Q5IA 4HDQB 4JNKA 3UKDA 1RTKA 4BWVA 3BL5A 3SJCA 4RTSA 3N0RA 2PWZA 3AB3A 1DHTA 1Z4JA 1A72A 4DLXA 4F1WA 5GOZA 2X2OA 2ZBEA 4XUCA 1QTQA 1LVHA 3EWIA 2M6KA 5KI6A 2HPAA 2IV7A 2WVAA 3QI2A 3X1KA 1OFGA 4M1ZA 4G0QA 3GLFA 2WWYA 4FDMA 2EATA 4V24A 4C21A 2CFIA 4EWLA 1UXJA 3TZKA 4QOIA 4D97A 4RQUA 3WYDA 4XWWA 2FN3A 1FTQA 1ODJA 4KBGA 4CTOA 1ZK2A 3SHTA 3WSTA 1UFKA 2C42A 3SDSA 3WI7A 4C2UA 4KLRA 4EO7A 2NO0A 2D59A 4OB8A 1M66A 1MOQA 2V7TA 1SJ9A 4BO5A 4H1TA 1NWCA 2EIXA 4N65A 2C5AA 3KSZO 3TCNA 3QV1A 1QC5B 2ZS7A 3RC8A 2F4VB 4YECA 4WIAA 4A6EA 4HD8A 5BUCA 1T9CA 2CF5A 4X1KB 2G1AA 1V48A 1QGYA 2PL1A 2Z30A 4RHFA 2BFPA 3VVMA 2XKJE 3NC4A 5ALOA 4Y2TA 4TKVB 3ZE8A 5FLKA 3RTGA 3R9WA 3UATA 1Y82A 3UBMA 5IT0A 2SKEA 3PRJA 1PV1A 3RT1A 4P83A 3I34X 4JBHA 4I50B 2C83A 2OVBA 4LKOA 2ID4A 5DNCA 3BSSA 3F98A 3U3XA 3OQVA 1L7QA 4HNVA 4WK0B 3S1LA 3S8YA 2PL5A 3GH1A 1TAUA 1YK0A 4C01A 4YRKA 1DC8A 3VZBA 1S96A 2DH5A 1XEWY 1TUGA 3FHLA 3PL1A 1VMAA 1XYVA 4I8IA 4U2CA 3U4GA 3TR6A 5IYZB 3NDRA 4BEWA 1I8TA 3EY4A 3RK0A 4QHSA 3CRW1 2W90A 3NETA 4KXVA 5EP3A 3TTVA 4MJXA 3FYUC 4YH1A 3VU0A 3SVZA 4ARVA 1B0UA 1NBWB 4YMTA 3G8DA 2ZJ6A 4Q7KA 1J8QA 1QKKA 2CDRA 2NUTB 2WV9A 2ZI4A 3STYA 4MRMA 1K6MA 1OFIA 2ZE5A 2XQKA 3KB8A 2XW6A 3HVHA 2VKTA 4XVRA 3G89A 2PUEA 1RPJA 1NOIA 1MOPA 1T13A 1GZ6A 1L5QA 1SEVA 3TXAA 2VFAA 16PKA 4GVPA 5A05A 3V8NA 3VUEA 2X9QA 1KTVA 4MGKR 3SZLA 1EIWA 2CB0A 1G3UA 1BD3A 5C3UA 4I4CA 3T99A 2Q1UA 2ZT6A 3DEKA 5I48A 3TPCA 4MGHA 3N86A 3P45A 2ANCA 1SVMA 2NZUG 4DBVO 2CVOA 1Y1LA 2RIRA 4C6TA 5KWEA 3D8NA 1M1UA 3O4VA 4MWEA 4UBJA 5F51A 1B8UA 3NALA 3CS3A 3KHSA 4PGMA 5H80A 1Y5IA 3CE6A 2M6LA 3VR4A 1OW3B 4D3ZA 3M1AA 4KWCA 2B7BA 1XLTC 2P75A 4M1MA 3E53A 3O83A 1UUFA 3FFAA 3OSZA 3QVSA 1WXDA 4PFKA 4U63A 5LCXA 1OIWA 3TKYA 2RE8A 1S3SA 3EH1A 1EDDA 2AUNA 4KH1A 3V2HA 2PWYA 1IPHA 1KK1A 2ZIVB 3AG5A 1RQLA 1HZJA 1KYZA 3BK7A 1V2GA 1JEYA 1OTHA 1Y1SA 1C7EA 1L5SA 5HUQA 1EGQA 1N2HA 1URPA 5C3MA 2OL4A 1GEGA 5LMUB 2C5GA 5DGHA 3UJAA 5L3RA 1QG4A 2EZTA 2JAPA 1ZN9A 5JSUA 5LZ9A 1U8YA 3T34A 3SX4A 3EA4A 4J4HA 2YS7A 4YRLA 4A2QA 3ELYA 1K89A 3JTMA 3CJRA 4R2JA 1PUXA 2P90A 1KDTA 3FFTA 3IH5A 4LF7B 5J59A 2QTLA 2F00A 2O2IA 4KMRA 2PMEA 3REOA 2YBEA 3IO5A 4BFCA 4EKYA 5HFNA 1M1NA 5BR4A 4IVPA 1RT9A 1HDGO 1QFZA 4S1OA 5FWYA 2A5GA 1UKVY 3N7AA 3EZXA 1ODTC 1DTWB 3MSCA 2ST1A 3KKKA 4FFWA 5H9WA 3WNDA 3BT7A 3OC6A 1XO1A 2R97A 3SLRA 4Z7NB 4CI0B 1VGRA 2VJKA 4G5YA 3RABA 4EEKA 1KZ1A 3P9PA 3QVOA 3WLKX 1UF9A 4C88A 5I4CA 3IX7A 3AHIA 1H2BA 4JR1A 4CEJA 4WDRA 1QG0A 2NYAA 4MUIA 1ZNQO 3G0DA 1WSWA 4OBWA 4B43A 4K0KB 1EUDA 1GPUA 2CJWB 2NTVA 3TLXA 5AVZA 2B7LA 2MR5A 1K1EA 3KE9A 3QIVA 1W8DA 5HW0A 1Z47A 4PZPA 1TL7C 4MS4A 4B73A 1VKNA 1P18A 1ZMXA 1W2HA 3DT6A 2Q8QA 3FF1A 4M2LA 4N7BA 1T9DA 4PLVA 4NBSA 4GXNA 3U17A 4O4JB 5LJIA 1AA9A 1WTAA 2C9YA 2YJ6A 1DOHA 1VTKA 2F62A 1EDEA 4N7RA 5FBWB 1H0KA 1QFSA 3IILA 3KQMA 4NJEB 5DX1A 5TS2A 2OYCA 3H3FA 5BYKA 3FIUA 1C80A 2HAEA 4YCAA 1KY5A 5EP4A 2PT7A 4IJ6A 3CW8X 1DJNA 1YRBA 3FR8A 3AY6A 3HKBA 2Y0PA 3KEOA 4JLAA 4XPZA 2BHNA 2IZ7A 2Y4OA 4QPDA 2P4HX 5KNBD 3NHZA 5IFLA 1BWRA 1M75A 3OM8A 4ZRNA 3RG2A 3IQZA 1YQGA 1KOFA 4IVRA 4B44A 1FDSA 3BTVA 3L4JA 2G4VA 3RH0A 3DD1A 1E7YA 3EWNA 3GH3A 4LJ7A 2JBAA 1GQSA 3TSAA 3E8XA 2BRUA 5A2GA 1U9YA 3GFPA 3I9NA 2DB3A 1SU7A 4G07A 1XX6A 4QA9A 1KJ9A 4IKEA 5JJ5A 3L93A 3UO8B 4YAJA 3DHEA 3HBMA 5LLDA 4XR9A 1ML4A 2AKYA 3N8IA 1JIXA 1NLUA 4YRMA 1W5BA 3BF8A 1Y3HA 5GVRA 3FCAA 3TG8A 3FOCA 2GHRA 1OGIA 3AR8A 4RZ3A 3ICPA 4IHJA 4XJXA 2G71A 2IXFA 1KDRA 2ZPTX 3UJ6A 2DC1A 2PUCA 1NR5A 4FMCB 4QLBA 3GRZA 1J5EB 1FTGA 4DQLA 5BNFA 3KHTA 5FA5A 4URVR 2D54A 5FJJA 1RFGE 5CLGA 1T43A 5F5XA 2MINA 3HXLA 4TXLA 5K3DA 3UKJA 2AOXA 3B38A 1F20A 4IZOA 1IL0A 2J3JA 5LKRA 2YMMA 2ZJ8A 2OOSA 2XE8A 3N8DA 1MGOA 4TT8A 2XPCA 3B9BA 5LP6F 2W37A 3FHJA 3COZA 3BEDA 2XUDA 4I2VA 5F1PA 4ZJZA 1E3WA 2FMTA 1ZVVA 2WTAA 2PXHA 1LK7A 3EW7A 3KPVA 3NP7A 3MWEA 3IL2A 4GO1A 1G5QA 2MYPA 1S4MA 3OM0A 2AWOA 5LB4A 2BM0A 2GD2A 4QBGB 3QPBA 2F1RA 4GI7A 2O59A 4B4WA 2DWQA 3AVYA 2QX8A 3IJ5A 4HPJB 1PQYA 4IEIA 4O2BA 5EYPA 5B7QA 4YA6A 1P4JA 1BDMA 1X9GA 2ODWA 4LY6A 5M2QA 1CZUA 1PZXA 3RB8A 3RSQA 2HRZA 4WK4B 3EG5A 3KD3A 4DQDA 1E8NA 2WG0A 2HXGA 3KT3A 3EZ7A 4Y9UA 5BSMA 2M9MA 4JASB 1XRJA 3OWOA 4EQZA 1WNTA 1QRUA 3NWOA 4HLNA 1RJFA 1XELA 3OF2A 1N2XA 1QG6A 1R10A 1RYZA 3CTMA 1DEHA 2ADMA 4W7SA 1MRZA 2FLWA 3TE6A 1JMKC 5AK3A 3VSEA 1CS4C 3ZVNA 2HHAA 1B0PA 1GQQA 1GTVA 4L78A 4ITVA 4MSUA 1E7RA 1N2CA 5AR1A 4BLQA 3NPMA 4MV1A 1H3NA 2QX9A 1PJCA 3KS9A 1ZHFA 4HR7A 4O4LB 4DCJA 2RHOA 3TZLA 5JCPA 1N6KA 3ZBQA 3K0SA 2X0RA 1E1RD 2V6BA 3IUBA 4GDFA 1XTTA 2I2FA 3SLGA 1ZJWA 3X2SA 3BD7A 3D8TA 5HUJA 2B1RA 3GPCA 4KQ2A 2PE5A 4BUJA 2Z8YA 3DOJA 1NJFA 1V8FA 4NENA 4C05A 2A59A 4INZA 3C4QA 1X7GA 4BBZA 2VDQB 3WLNA 1UIRA 1BXRB 1JSXA 1Q7RA 2A1TS 3KPWA 2IP1A 4L7VA 4O3MA 1SQ5A 3KZMA 3OZXA 1P1RA 2ZB2A 3A06A 4UQOA 5DEIA 4OVKA 3T5MA 5K1ZA 2UXDB 1ECLA 3P9QA 3HKDA 1TUBA 4FI3F 1U80A 1NQ5A 4A8JC 2C5EA 3CONA 2DUWA 1WW2A 1DO0A 4F96A 1WHTA 2YC2C 5J58A 3RYFB 5SYNA 1ZYUA 4YRSA 3KUUA 4F38A 1NUUA 3NUQA 3NHAA 4OHBA 2F8TA 4QFMA 3IEUA 3N2GB 1Y4ZA 4NYMQ 5FPHA 5KVQA 1UL1X 3FOWA 1CUDA 4QPCA 3LLVA 4Q3EA 4N5HX 5I9BA 1UDXA 4DA4A 4O3FA 1O6GA 1E5DA 3N2IA 3WLHA 4BVEA 3C4VA 4NEQA 4TKUB 1FZTA 4CLEA 4HDRA 4ZQCB 4R2WA 5JSHA 4JC4A 1DBVO 1KYIA 4EPXA 2DU8A 2W2KB 5TNXA 3MTGA 5FR2A 3HO1A 2PX2A 1ESCA 3MRXA 4LXQA 5JRJA 5TMPA 1PK8A 1NZDA 4R1NA 3CZ9A 1R37A 3K8YA 3MTAA 1QG2A 4DEXA 1UXOA 3UJ3X 3EVZA 3FTCA 1AGXA 1D2HA 3SFTA 1I7LA 4F85A 5JBQA 1BAPA 1E6KA 1BWSA 4C0XA 4XASA 2GYUA 5ICFA 3AM3A 3AHJA 1CR0A 2W6QA 4TXJA 5ALDA 5SICE 4E2FA 4DTCA 1YFLA 1Z6QA 3U49A 1EVEA 4R05A 1QCYA 5DKFA 2E3JA 4JJ8A 5E9WA 1YR9A 2PVCA 4H60A 1PTJA 2ZWVA 2IJGX 2HMUA 2P9JA 1KERA 4M7WA 5DHUA 4DNPA 1WP9A 3K0AA 4RW0A 4KFCA 1MOSA 3RFFA 2WWXA 3HDQA 2A4MA 2X0KA 3SHFA 1XP8A 3LXRA 1YFJA 4RH0A 3EA5A 4MJLA 2ODAA 2H16A 4N47A 2E87A 4KQKA 2XDQA 4GOKA 2YZGA 1BVYF 3ZU6A 2RC6A 1F2UB 5FI3A 3G82C 4TLBA 3ZCQA 2D2EA 3QF4B 4H7DA 5HPYB 1RJWA 4Q4AA 3U3RA 3NTXA 4KPGA 3OZFA 3ZGYA 4BWGA 3RWMB 1CR1A 3TLEA 4TKMA 3FLAA 1CY7A 1QVWA 4NMWA 1D0IA 3GJ4A 3T41A 5HGXA 1BVHA 1CZHA 3GDGA 1E0AA 1TF7A 2QM0A 5BRNA 2HPZA 1YDEA 3T12A 4HUTA 2PG3A 3QPCA 2PSDA 4CVNA 3TQTA 1H6BA 2ZUUA 1IULA 3I6BA 4PANA 2WIDA 1W1UA 3LJKA 2A9OA 1VA5A 4RKEA 3GG2A 5HCIA 4S3MA 1QYIA 1TVCA 2R6FA 4LJ6A 4W99A 3VR5H 2PX4A 1IQPA 2JFWA 3QU9A 4PPYA 4AJIA 3BFJA 4I6JA 4V0RA 4ZI3A 1R00A 1QIDA 2A9VA 3L46A 1DZIA 2RI1A 4Q9HA 4TTRA 5FYQA 1P1JA 2FH5B 2FX2A 4CCSA 5IU6A 1OAOA 4MCAA 4EB6B 3TR5A 1D2AA 4EHDA 4YMHA 2E5FA 1YB7A 1CU1A 2C7VA 1CQJB 5BR8B 3QYFA 4JI3B 4JLMA 3PYXA 2WAYA 5FPTA 4NRDA 5IBRA 3A9CA 1XTBA 3O8NA 2WWVD 4C4OA 1XNQB 1TEXA 2PVPA 3H4IA 2VYVA 2P9FA 4H18A 4IIFA 4C29A 3CNHA 2ZKIA 1Z5VA 1KH2A 1Y1KE 2D5AA 1UXGA 2JHAA 3P27A 1SQ6A 2B78A 4RF2A 4NU6A 1LQ2A 3L82B 5AKEA 1VSTA 2VP6A 2B8WA 1U7ZA 4HEJA 2H7VA 2I3AA 4LRUA 3WMWA 1HYGA 1Z0FA 3R1IA 1ZOSA 4BEJA 2DE0X 1ZGAA 2B5WA 3GLRA 1HE1C 1K8YB 3CURA 4JMPA 2DMRA 1KYXA 2Y9PB 4CKEB 1DAFA 4OQFA 1H69A 5EXEA 4DLAA 2XITA 2QRVA 3GJZA 4G01B 4O29A 3G8AA 3I9FA 5C8XA 2A9RA 5JAZA 1MIHA 5KNDH 1E9BA 5AW6A 3GQBB 1M6VA 3R4CA 4BNLA 3STHA 5JQGA 1BHJA 1RHQA 1NG1A 1YRAA 4IJUA 3PEFA 1NT2A 1NUTA 1PU2A 4KXUA 4ZAZA 4RV9A 1UWLA 4ER3A 4YV7A 1XTQA 1P7PA 5BSTA 5IUNC 5JPCA 2EGGA 2NM0A 4R5MA 3OQNA 4I08A 5JY1A 5JEDA 4BVLA 5G4KB 1GT6A 3LUJA 2NVUB 2AR9A 2WT8A 5A06A 3CH5A 1NW8A 2HGZA 4PHFA 1EUCA 1E2EA 4BNUA 3QYPA 3IDAA 4KLNA 4ZEOA 5G53C 2BZ1A 2EQ5A 3RV4A 4K6HA 2QRNA 5CW2A 4KQXA 4LUCA 5TR9A 4RDHA 2BLNA 3ZE7A 3CXUA 4ZMSA 4EHLA 1ORIA 1Q5PA 1N1GA 3LCRA 1C2TA 1O97D 4I8XA 3I4FA 5ER6A 4RVOA 1CIJA 1TMYA 3NNNA 3NZEA 5K6RA 1I9GA 5BVGA 2JVKA 2Q49A 3KUDA 3ROGA 2Q99A 3VOAA 2JGAA 4E5DA 4EJSC 1WKCA 1YB1A 3CM0A 1WB6A 3UIEA 5G3YA 1Y3FE 2ERYA 2PVSA 3OZ7A 2HRDA 2WUGA 4M9ZA 3MJRA 4DR5B 4BZPA 5GVSA 1C0IA 2EFEB 2Q46A 4YCSA 1OE0A 2CXPA 3NW9A 5EE3A 4F2WA 1O95C 4ES6A 3HPRA 3NHLA 1L8OA 1Q11A 4RTNA 4JXZA 2DTDA 5C5IA 1OV6A 5F9FA 1XMIA 3P71T 1I5EA 3W7AA 1TYAE 2J9GA 2ZVDA 1T4DA 2O1SA 1L5WA 4B8YA 5EIBC 1VPWA 1Z8DA 4G65A 1LNSA 3AEZA 1FS6A 1YL6A 2VWPA 2IW3A 1YR3A 3O4RA 2ZRMA 1PK9A 2A5YB 3SZOA 5J2TA 5G0TA 2H5JA 5LZ8A 4DR3B 1L1FA 3OO1A 3ENWA 1V9LA 5AKHA 1OMOA 2O3RA 3HU3A 1NM5A 2NXWA 3B1VA 4FSHA 1JJAA 3DF7A 4JB0A 5IKXA 3K5WA 1ZI8A 3KQYA 1E59A 1EVJA 3S5UA 4GI2A 5E8RA 2YL2A 3UMBA 4ERXA 1AQNA 1ADJA 3EVTA 3VC3A 1OZGA 2D1RA 4EYGA 1FDIA 1NMEA 4RSHA 2Q3CA 1SUSA 4R71A 5J9FA 2GTPA 5EGNA 1T0BA 4MV4A 1OH6A 1TJ5A 2GFIA 4Y9SA 3W1WA 3HHPA 3JRNA 5K4HA 4DDKA 1NRXA 1UEIA 2X0NA 3A1UA 3GN1A 3O92A 3MOIA 1UC5B 3UT0A 1SBCA 2I2XB 3ABQB 4JJEA 3CMMA 2Q62A 4G97A 3A9SA 2IDZA 3GRVA 4NATA 4ESOA 1T5BA 2E18A 3UUFA 1GFIA 2XA9A 2C8KA 5TQ0A 5KSWB 4AAYA 4QRIA 3IQXA 4L3VA 1ZVQA 4TTIA 1JAYA 4OYYA 1EDZA 5DXFA 4CDMA 4RF5A 3P1JA 1AMUA 3ZGZA 1FVHA 4RK7A 1QOPB 1KC3A 1RWOA 2IEIA 3KAPA 1E2QA 1M72A 1N7IA 2Y1EA 3DFIA 3IIEA 4PZEA 4A3SA 4B17A 2VBGA 5KYWB 2BUBA 2GOYA 3L6CA 1JAZA 1CJVC 2GNAA 5C51B 4U7HA 1GYRA 4XPIB 3QEOA 3PNMA 5C34B 1Z36A 2ONYA 2B36A 4KYIB 3GN2A 1G42A 1YCDA 5AVWA 4OXIA 5EMLA 3F73A 4HN2A 1UT6A 1IOZA 3DONA 4OIMA 4KIGA 5TEVA 4CI9A 2ZG6A 3ENKA 4KN5A 3NNDA 3QH4A 2DT5A 4IDQA 4LK2A 1EXMA 2HK7A 4G5QA 1Q3KA 1WPRA 2G5TA 2H2FA 4H08A 4DUZB 3CB2A 3L07A 3EXHB 3PFGA 2JASA 3ZK8A 2GXSA 4DY6A 1RI2A 4NNJA 1X1EA 4MGZR 4UHDA 4IZ6A 4Q34A 2NV2B 4ZVLA 2VHYA 3SJUA 2F3RA 5JRZA 2ZSFA 4G37A 1NNSA 1V1RA 1VJCA 1MNAA 1MXHA 1XLUA 3MT7A 2OV2A 2GF0A 3IAS6 1K9VF 4KO8A 3LC0A 1C7IA 3U4AA 5CFRA 4UNSA 1OI4A 5J2UF 1FQJA 3G5TA 4N9QA 4ZIRA 4IDBA 4Y2RA 2ZAIA 2CGEA 2HNKA 1OLUB 4NI5A 4TT3A 5CJ2A 1QAMA 3W5JA 1RWXA 2JJ1D 2AVNA 5I51A 1JHVA 3NT5A 3HABA 1XALA 3L6OO 1CUFA 1U2PA 4WLVA 1LW7A 3S2IA 4DMFA 1Z73A 1ZKDA 4KUGA 1XZFA 1KWKA 1J90A 3QG1A 3QMVA 4U7WA 5CT8A 4KO1S 3RYHB 3DMYA 2I9KA 1V6CA 1RRMA 2OC9A 3FGZA 3JQAD 1JHDA 4LJ9A 2ADFA 4OGGA 5JJBA 1G1AA 1LPSA 4QGSA 2AKAB 2IKQA 4WJLA 3TUZC 4CMHA 4F9EA 4PVDA 2G6BA 5KTSA 1FMJA 4M1QA 2O1EA 4N48A 2BUCA 3RLFA 3N2NA 2EU8A 4B7CA 3DT9A 5DE3A 1A8PA 5BPHA 2MHCA 4KPUA 2TSYB 2Z3WA 2WUVA 1SQ0A 4E94A 5JAUA 2I1QA 1LNQA 2IYOA 3E48A 1TU0A 1RNLA 3OD1A 5E6SB 3MSXA 1HLPA 1PKEA 2VJMB 3E9QA 3LGAA 3WGJA 2A9JA 2DLNA 1T25A 2CV0A 3QU5A 4KGZA 1EFDN 4R2MA 1LK5A 1Q1BA 1LV8A 3PBKA 4ER6A 2D8AA 2XTZA 3IMEA 3R5HA 4KIJA 1U11A 2AN5A 3IKVA 3UGTA 1TCUA 2R3SA 5BNIA 2R87A 3NP9A 2ZAGA 4FXPA 4R1UA 5AVXA 3ELWA 2DSTA 3VZDA 5CB0A 4FZ3A 1E6EA 3OIUA 1FUUA 3VQTA 3P9NA 2JGDB 4II3A 2Q4EA 4YFVA 5E7MA 2CCJA 5F7ZA 4G63A 5J4YA 4DYVA 1W34A 5THKA 4JELA 4PLTA 4I4IA 1Z4NA 2VUHB 3GMDA 4Q4LA 5H7XA 4N40A 2ZJ4A 4UDNA 3CW9A 3VHRA 1D1TA 3G2QA 1M10A 1K3FA 4F72A 2VSYA 4MW1A 1P39A 3OZTA 4PZAA 1ID8A 1O89A 1XFDA 3MUOA 2HCTA 4DABA 3HWX1 5LQUA 4JVSB 3QW4B 4RC9A 5HDBB 1PJBA 1C8KA 2ECKA 3DR5A 1HNNA 4UHEA 3S6JA 2D4AA 2RCYA 2RDMA 3SX0A 3VO9A 3AESB 2ILTA 4F86A 5GONB 4CFSA 4FFPA 1RYHA 4GZLA 3CLSD 3IUPA 3JY6A 1FBNA 1YOVA 2WD7B 1Z33A 3OE7D 4PZYA 4PZUA 3C4JA 2IZOA 4CLHA 1YQDA 3OQHA 3WRVA 1G38A 3BTSA 5CDYA 1CP3A 2J59A 4URFA 5G1NA 3F7NA 4ZXFA 1T9GS 1BCRA 4RHTA 1P31A 4YK7A 3K9LA 4XGKA 4B47A 2QBYA 3BL8A 3MB5A 4TN5A 4BUCA 4DIDA 3U81A 4GNKA 4DILA 4LVCA 2M32A 4FOOA 1UKAA 1BGWA 1C9EA 1Z0AA 3CO0S 2FPGB 3M6AA 4MRRA 1F9EA 3PI7A 5ANRB 2C9DA 5LQNA 1DG9A 5JI2E 1CVRA 1Z2EA 1KI2A 2QMYA 5C7LO 2QI9C 2QEQA 2AMFA 3D6VA 5DNUA 1Y8AA 5I9IA 1O6CA 4N0QA 4M88A 1B23P 3GT7A 1E1QA 1GSHA 4QBKA 3ANYB 3RJ9A 1DG3A 1K3UB 1R50A 2E4ZA 1RBQA 2H2DA 4MMYB 5F5NA 1XFAA 3M5WA 4FW8A 4N7JA 2R9VA 2CXHA 5ESDA 4L8GA 2JH8A 4FYKA 1PX2A 3T7TA 3RASA 4D4HA 1QK5A 1OZ0A 1E3EA 2BZSA 3EQ2A 3QXGA 3H0CA 1JHAA 4P33A 4PNZA 1FNDA 2Q2OA 4XI9A 3LY9A 4O08A 4B7XA 4DPMA 3ZXXA 2DCMA 3GCWA 2GO1A 1Y48E 1X15A 4YYZA 1Q0ZA 4Q24A 1N2SA 2FA9A 3LY5A 3E9YA 3UOWA 1GP2A 4D43A 3D7MA 2PQ6A 3NJ8A 4WJZA 4ZCRA 4V3CA 3ZV7A 3U6KA 2GSWA 3QWBA 3GEEA 4AY3A 3B60A 2JRLA 3GZNA 1NC1A 3ODGA 1NV9A 4DLLA 5KX5A 3BFVA 4F45A 2JARA 4K26A 2PKQP 5COAA 3BJZA 1WUIS 2Q3HA 3LRPA 3K5IA 3SG0A 2V7WA 4UAGA 2IVFA 2GI4A 4PINA 4D57A 3PSAA 3MINB 3PE4A 2HB6A 1ENZA 3OZSA 4AUMA 1VPDA 2RBEA 2OBFA 4MEAA 2YZNA 3G1WA 3A32A 1P2BA 2GCGA 1S3IA 4QQNA 1R9JA 3KB2A 5JFTA 3KFVA 4TUYA 3T7JA 2CYBA 4N41A 4GL4A 2E6UX 5FTMA 1GADO 3SQNA 1Z4MA 5FPSA 3ZE0B 5DM1A 2ZSDA 4QE3A 4E21A 4OHCA 3THXA 1E6MA 4XYEA 4C1BA 1SUFA 2XUOA 3B48A 9MHTA 5AKJA 2HDOA 4HLDA 5ALKA 5B57C 2QSUA 5IRCD 3K9HA 5AM3A 4PICA 1YU6A 1U1FA 3FDXA 1SUDA 3QKUA 4BZWA 5AW4A 1YZFA 1NQVA 4PCAA 3FYDA 4I8DA 2HQRA 1IG3A 1UP7A 3LPLA 2O5EA 4WACA 3WOVA 1E4YA 5J43A 1AUXA 4BV2A 3K9QO 3SK0A 5B36A 2EARA 4PCUA 1H6CA 2GPNA 4RMJA 2I3ZA 1L6RA 1RZVA 1S9HA 1NPYA 4JLNA 1XRLA 4NULA 5ALZA 4R2XA 4H0NA 3SKVA 4X7BA 4Y98A 3VMFA 4IXTA 4JVLA 1Y7PA 4RAQA 4AJ9A 4GM1A 1FJHA 1U2TA 3NR2A 3LKBA 4X94A 3GFVA 1QVZA 4NR0A 4M8LA 5LXTB 1THZA 5HQ3B 1P6QA 1QB8A 2XWQA 3PXDA 3WL7A 4O2RA 2VN8A 1P5ZB 1MPTA 3FZEA 3IT3A 3O5AA 4RXMA 4ZZ1A 3GLGE 3MGCA 2IZ0A 4L4SA 4COOA 1JKFA 5JS8A 1M7HA 1NVDA 1QO9A 2VL7A 2J33A 3WIVA 1Z2CA 1L7MA 3AY0A 4QOHA 4QKQA 4JIMA 4P4NA 1GU7A 1ZMRA 1N6OA 1QYRA 2HNAA 2HV9A 1RWVA 3AEUB 3HXKA 1E7SA 3IMGA 1CNMA 2X8JB 3NLLA 2BKUA 5FOWA 2VXBA 3D6HA 1E2KA 4O2AB 1H1LB 1WPGA 2B35A 1K7XB 3K73O 4IXNA 4HDAA 3SSOA 4MICA 1E0SA 5KDOA 4E5MA 2QRUA 3E7XA 2PV7A 5COBA 4ZYXA 1G55A 3VJRA 1OWLA 2BCJQ 1GV0A 4CMIB 4N9WA 3RHZA 4ZAVA 2BV3A 3VZRA 4E5UA 4P7KA 4R40A 4KSCA 4YV1A 1S1MA 4KQ1A 2YWJA 2H57A 1AKNA 1T5LA 4M0FA 2IOHA 5TY0A 3EIFA 2NG1A 4F9FA 1D9XA 3I6QA 2VF7A 1ZK3A 3EIEA 5DEOA 4IIYA 4ATNA 4D3XA 1IQ0A 3JD0A 3N0WA 2WJAA 2H9IA 2G8NA 2X5KO 3L8MA 4RF4A 1M2HA 3COVA 1CKEA 5GONF 4WPGA 3E2IA 2ALJA 4OHVA 3SJAA 5K3FA 3BMNB 3PTZA 5JNSA 3ZDYB 1W0CA 2GYVA 4FSDA 4AULA 1O8BA 5DRTA 1WE2A 3OA2A 4DSNA 3BX1A 3WXBA 1UZNA 1CUGA 2XGGA 4UHKA 4PG4A 2RKOA 4OJNA 3W6OA 4ZKEA 1A69A 3AL0C 1XUOA 1U28C 2ECQA 5TF4A 2NPFA 2SHKA 2X8WA 2ZZKA 1PTKA 3NBYC 3ZY6A 1J97A 4NTZA 9LDTA 1JGTA 4H59A 2HO4A 1OU0A 3M82A 1MVLA 4EABA 2E4XA 4GD3Q 3BAZA 4OYRA 1FNNA 1RPAA 1GQYA 721PA 3HFJA 1YFZA 4EW3A 5E3HA 3PI6A 3LIIA 4UULA 4QATA 4LWOA 4MW9A 4OHFA 4QD3A 1XLWA 3TWOA 5ADHA 4EZEA 1EZ4A 2I3GA 1EFKA 2AGVA 3PGJA 1S2GA 3O94A 2WWFA 1XWWA 3MWDA 1OBVA 1X3SA 5DHPA 3UPTA 1KE1A 4K88A 4EUEA 3B9PA 2B30A 3MGAA 2YWGA 2RB4A 5H16A 1JEQA 2R11A 3CN7A 4RELA 1J33A 1F2TA 4B2IA 4EL5A 5IVKA 1HV8A 2FWMX 2GUGA 1IHOA 4EZIA 1QP8A 3MA0A 1K7SN 1TF5A 1V9CA 1HM5A 2XUAA 3PGMA 3I5AA 2Q1WA 4AROA 5BXQC 3RBVA 3S2GA 1N3IA 5F35A 3UMVA 1W48A 5BSEA 1ID1A 3CKLA 4EG1A 3D4PA 3QA9A 3RIHA 3RUPA 2WZCA 121PA 1NBOA 2B9EA 3UTCA 3BRQA 1YAHA 3UGJA 3FVTA 1NC3A 2KB0A 3MMZA 4YC7A 4P2BA 1KHHA 1LZKA 4KQHA 4W82A 3G49A 4J2HA 1E2PA 4BZQA 2O2CA 1K27A 2R25B 2YY5A 4RF3A 5TE9A 4RBNA 3L7AA 4LZAA 4U7FA 2LCQA 3IVXA 3ANTA 1T5IA 3LQ4A 1UIMA 3TM5A 4DIUA 4KAAA 3AKYA 1UBKS 5G2OA 3K5PA 3U7EB 3C3DA 4AS3A 5A4AA 5C2JB 5DN6D 2RAPA 1R3UA 3NANA 4LTMA 2NXCA 3U4CA 5T4EA 2OK7A 1V4NA 1FP1D 1E2UA 3BC1A 3O9MA 2NVUA 4RS4A 2PLAA 1L0BA 4JZKA 4C5CA 2FRDA 3TLMA 3K9NA 3TSZA 3WL6A 1J5PA 4OL9A 5EZYA 1AV7A 2ZRBA 2PZMA 3HR7A 4BCDA 1WLYA 4HZIA 4B4KA 5JAQA 1SG9A 8ATCA 4BY9E 4AZ0A 1MA0A 4FQ8A 1QR6A 4K86A 2JGNA 4IIGA 5FTJA 5TJHA 5CA0B 1I7DA 3PUKA 1O9BA 1LC0A 4QQ8A 5AP9A 3HU5A 5K8TA 4PYRA 1X38A 3OH8A 2ZIUB 5IABA 3LF2A 3T5PA 3VI3B 3JQAB 4GDMA 3UHPA 1AU9A 4IXMA 1CYEA 3RHSA 4Y3UA 1MB2A 1RXCA 2WYHA 3CEHA 1WS6A 3R9IA 5DI9A 4TQ9A 3KE8A 2N9UA 4KR6A 3AERB 2DULA 3LL7A 3U1BA 1MQAA 1N5OX 2Y1FA 2J45A 1HLFA 4GP9A 2PL3A 3PFCA 1Q50A 3EQ7A 4LDNA 3KAKA 3Q3GE 1T1RA 4XJTA 3TINA 3ZWPA 3MBIA 3RG8A 1V5EA 4RSMA 3ZW8A 4XQCA 1V6AA 4Q7EA 3R7BA 1UADA 2WMNB 4HRXA 1G6Q1 3GFTA 3IP8A 3V34A 4EPWA 3B78A 2FF5A 2NQ8A 1NTOA 2Z58A 1KKLA 2O8NA 3I01M 4IIVA 4YRFA 8ABPA 1T3ZA 4YTEA 5A5DA 3W9UA 3MG9A 2CLHB 3PX3A 1LJUA 1PGPA 3MTDA 4P80A 4HUQA 4U6QA 3NMUF 3K0BA 4BMZA 4QOSA 4MVJP 1ZJ6A 4Y9TA 3CYFA 1YUMA 3KEMA 5BV2P 3TF5A 2JLQA 8LDHA 3EIHA 1CYDA 3GFFA 4Q9AA 2R1TB 1XQWA 2O2ZA 3PP8A 3QU4A 2R96A 3VNBA 4ENRA 4OJMX 1Z0SA 2V59A 4G2NA 3S99A 2I6SA 3D02A 4I6EA 3UFBA 4PPNA 4DG9A 5E95A 3EQ9A 1FRVA 4BP3A 2ZTVA 4NQRA 3BTUA 1QORA 1YJQA 2ZK7A 3UW1A 1E3MA 1M1YB 5HIMA 1E58A 2P69A 1WV1A 2CCKA 3C7DB 3X43A 4F4UA 2I66A 1K08A 1TMGE 2Q3DA 3GT3A 4OXYA 2I33A 1H22A 4GMKA 4HC4A 3LE8A 3UH0A 5MN5A 4NCHA 1E2DA 4RIFA 3REQB 1UMBA 2QIOA 3PK0A 4R2HA 1ZO8A 4OXKA 1GTSA 2ZWAA 4YCMA 3N2KA 3L8ZA 3UXEA 2CMKA 2H1HA 4PLPA 4HNQA 2WTXA 3M34A 4PO8A 4EFKA 4YP5A 4R3UC 4WZ6A 3ZNQA 1BZYA 4QICA 2QLMA 3W3AD 4DVJA 1DG1G 4B3SB 5C5CA 2HY7A 4XM2A 2BFMA 3ZHOA 2CN1A 1KPHA 5HMMA 2XX3A 1DIRA 3GPLA 2KPOA 1O94D 1S4QA 2CKMA 4AJEA 4ER5A 2DFKB 2QRGA 3TRFA 2Q3FA 2IY8A 2ODNA 5M29A 2NSLA 5C35A 3HUUA 2XT9A 3RE1A 2I91A 2WWWA 4MA5A 3HCCA 3H2BA 4HVAA 1FUIA 3ZDFA 1LBEA 2EEPA 1YDFA 4B09A 1AZSC 1I6MA 4YAFA 2QRMA 5DISB 4X6YA 3GJXC 3ZXSA 3COPA 2F1JA 2PZ8A 3DEFA 4X1YB 4A26A 1AK2A 1YIDA 2IE0A 2J7PD 4QYSA 3D59A 1CCWA 2IL1A 3ISJA 3MCUA 4IDFA 4EY4A 1RP1A 3QGMA 4RTOA 2QYHA 1W5EA 2JW5A 5CLIA 3DDZX 3K31A 1AKYA 2BHRA 1JKXA 1LRJA 5LWHA 3A9RA 1I3CA 4X90A 3ADKA 4YJ2F 1BS1A 1K6JA 2HEIA 2RGAA 4JV5B 3GCGA 5BUQA 1Z2DA 2DERA 2EL9A 3W5DA 1NBME 2XDAA 1DWOA 3SC6A 2B5VA 4ASUA 4E22A 3S4YA 1W73A 5KQLA 1R16A 1JZQA 1G7RA 1Z07A 3IIKA 4NMLA 3GL9A 3S1AB 1Y34E 4YMGA 4V1CB 5JTTA 1EU1A 5EE9A 4B3RB 1KI6A 4HNGA 2AW5A 3UWSA 1ADGA 1IC6A 5JCOA 5TV2A 1W4LA 1KBQA 3PWZA 2R6R1 2O0HA 3OFJA 2OA0A 2V7BA 3UWDA 2IYPA 3V80A 1TKBA 5ED4A 5K8VA 5TC4A 4FE7A 3LIPA 4LOIA 2HDHA 1IFXA 1XBTA 4NKRA 1BEEA 5I5GA 1T8YA 1PJQA 3T3NA 1G5HA 4RJJA 1PHRA 3DDUA 3I9OA 2O8FB 2FEWB 1TB4A 3EXFB 1VP9A 1AKWA 2J9XB 1PR1A 4NICA 3N53A 1OX6A 3DUFA 2A6PA 3CRVA 4FT2A 3R7DA 4EVSA 5LP6B 3R44A 1TYCA 4IGAA 5EMNA 1NOKA 1UK9A 2J5QA 3HCFA 4IVQA 5ITVA 4OH1A 5KTPA 2Y0CA 3BFXA 5ICMA 1YE5A 1Q0PA 2J09A 3UMCA 1T2DA 3F49S 5IZCA 4UJ3A 1U0GA 3EY9A 3D1LA 2GB4A 3FNBA 1SC3A 1G7CA 2GXUA 4U2BA 2QPLA 4WA8A 4ND2A 1H23A 4DDTA 3USES 2FG6C 4B3BA 1ZCZA 2XUKA 5DGIA 4RQTA 2GAIA 2GEBA 2W2XA 4G1VA 1G4HA 1R4NA 4IIUA 2WDPA 4KNVA 5JNRA 3E5HA 1D2NA 1NUQA 2M2IA 5EP1A 5HIJA 5BSGA 2O19A 2BI4A 3LPDA 3LD9A 1XJQA 1Z4LA 4DSOA 4ZK6A 4UDYX 3IELA 3ZIDA 1KI8A 1MT3A 1V95A 1IWBB 4GGPA 1EFVA 3CG0A 2IPNA 3WHPA 2DPYA 2XUFA 3NH9A 1HT3A 2AEFA 2PCLA 3RSLA 4C2AA 4JL8A 4CT0A 4NXNB 4HLUA 3PQ8A 1DAPA 4K1XA 4RDCA 2HMAA 1GXSA 1AXEA 5KTRA 3FBGA 3DPUA 4EPRA 5CGZA 3KJEA 5FNZA 3WGUA 1Z6GA 2J3KA 3BS4A 4R69A 5LN1A 1B8OA 1BKDR 1AJEA 2BMVA 5C8YA 1AHHA 2J67A 3BGVA 3I5XA 3DL7A 3TNJA 1V43A 2H2WA 4FN5A 2OFFA 2D2FA 2FMUA 3RAGA 1CVLA 3KQKA 5ICEA 1YBHA 4KXLA 4MVJD 4FYXA 4J7UA 3I8SA 1SXQA 4GLOA 3DEJA 1JLLB 1L4KA 3WZMA 1EZ1A 4ZDIA 4C0BA 3FTQA 2DG2A 1YJBA 2IS1A 1KQFA 1H4TA 2H7XA 3D7LA 1IBMB 1L4HA 1C9NA 3OTIA 5I45A 2XJ9A 2PMWB 5HFJA 1CF4A 3OLVA 3FNIA 3LPCA 2BTQB 1WQ3A 3WV4A 4M21A 2OM6A 5KUTA 4ANFA 1XCGB 2OGSA 2O2DA 4B45A 1UJBA 1FEZA 2WA1A 3RHTA 5JC8A 4CNQA 3JYLA 4FGWA 4QODA 3S2EA 4HNTA 1T0UA 3DFZA 2FPSA 2J9RA 3SXUA 4WZAE 2OV3A 1NPTO 1GFSA 2R2AA 1J0AA 3DAFA 3M6XA 4W5RA 4J0DA 2FPGA 1TQ4A 4AMVA 1DTEA 2B34A 1INLA 1P29A 3D8UA 1R5BA 1Y5NA 4K5QA 1AZWA 1FNSA 3AEKB 3HJHA 1P5FA 3KCQA 4IGFA 4QYXA 3TQOA 3FKJA 5EJ7A 2QAGB 1H8HA 3OCVA 5HKBA 3GLGB 4QNMA 3RVMA 5BWOA 3CTPA 3AEXA 3SXJA 3V48A 4F4IA 4NZZA 3ORHA 4ZI7A 5GINE 1YZQA 3WNQA 1A98A 1YE8A 4IDDA 4MRAA 4ZTZB 5E8JA 1Q19A 2F3SA 2HPVA 1E92A 2I2CA 3E18A 2O06A 1PGNA 4BNWA 5A9RA 4OLAA 5CCXA 5JJKA 5DBOA 2I8AA 4TV8F 4DZRA 1WKVA 1JHOA 3OT1B 2PIAA 4G81A 4Q4DA 2ID7A 3W5VA 3EEYA 4CIDA 3JQPA 2YJ5A 2OP1A 1XZGA 3KTFA 3ZDZB 1KVQA 1NLFA 4NOMA 4CUZA 3OY2A 5J23A 3PENA 4GBGA 2Z4TA 1E2FA 2JJQA 4YASA 5ALTA 2FEOA 2YQ5A 3TO5A 1D03A 1ISRA 3OMXA 5I7UA 2DR3A 4GWGA 4LIPD 1RKBA 4JI4B 1T34A 3MS4A 3OY7A 3W1VA 2GM5A 3RIEA 1SFRA 1XZKA 5JMTA 2F1IA 4NC9A 4OAQA 1YO6A 1YVRA 2KLHA 5DI3A 4C0KA 3KM0A 3T9FA 1U0LA 3UMMA 1TE2A 2HC9A 2WFAA 3BXGA 3EIXA 1TK9A 4QOGA 1V8ZA 3U60B 4MV0A 4IXDA 4IO0A 1YJAA 4FT4A 1XMPA 4OQMA 1TCBA 1OY1A 1S8NA 2Y0EA 3ZU4A 1TC2A 1C30B 2HIGA 4GSKA 4Y6GB 4RNCA 4DG8A 3PEVA 2QUKA 3HMQA 4MUJA 2ZYAA 4H7JA 1UMCA 1Z06A 3RVBA 1LBTA 4D9BA 2W6PA 1M3SA 3LDAA 3SGLA 2PUHA 3TBHA 1A7AA 2OXTA 3TQQA 3VKUA 4R16A 1LTHR 1C1HA 2VTVA 2QW0X 1J09A 5HXAA 4BRSA 4MUMA 5J1SB 1GNPA 1TKRA 5MN4A 2WKWA 3PDIB 4AUEA 4EVQA 2FWNA 2OFOA 1S3GA 2QL9A 3DL2A 3QE2A 2I7TA 2QN1A 3IPRA 3LCJA 4LQLA 2XECA 1UK6A 2DGDA 2CHVA 1FRQA 1Q2UA 2SCUA 3BWBA 2IP2A 3JZAA 3IP3A 2VNJA 3SC2B 1L5YA 3O26A 1X1SA 1T5SA 3D3QA 1XMJA 1QO7A 3E9MA 3JWIA 5L7TA 3Q3HA 1ISGA 4FQ7A 1JQLB 3NWJA 2G5GX 5ESXA 1GAWA 2ZI5A 4JQSA 2H2HA 4EPVA 2YV5A 4BFVA 4REQB 2JS7A 2P9CA 4B9AA 2WYUA 2VH1A 4JUAA 2QT9A 2Q4TA 5KKAA 3ISVA 1AQIA 1R0RE 2YXPX 1FSZA 2VDPB 1IOLA 1FDTA 2PGJA 3M8KA 5BXYA 1RZUA 1BDIA 1CRPA 4NCAA 1KF0A 1E98A 1MEEA 2H1FA 2ZJ7A 1RSZA 1AS3A 4KWIA 3RF6A 4JOBA 3A37A 2PRKA 3BIXA 4QOJA 1OQAA 5DNDA 4JBXA 1W47A 1KPGA 2PD3A 2R85A 3PR1A 2Z5FA 2GN1A 1XDDA 3OCZA 3PQ5A 4FM9A 3P0RA 2P79A 2PGLA 3AOEC 2ZJ1A 3ZX4A 3P4XA 2PAAA 3P9YA 3OAAD 1FFHA 1M0WA 4XIGS 1IHYA 4OATA 3CV3A 5K4AA 1J1IA 1NI4B 3L7YA 3KELA 2EJCA 4D9CA 3PDWA 2R751 1IJBA 4NCNA 1R12A 2UUPA 1T8TA 1HMYA 3G1UA 1GD1O 2C2ZA 4XKJA 3TLBA 5ES4B 3H4TA 1B43A 4PZCA 2OZPA 4ALLA 1TM3E 3U44B 3LBNA 1S6YA 3VR6D 1BG6A 3D31A 1SNYA 3ZY2A 4QX6A 2H11A 3Q3EA 3QVMA 4WV3A 4XGRA 2V8OA 3KYDA 1LKZA 1VJDA 2AMJA 3T4EA 3VAAA 2OO5A 2WJHA 3LWNA 4GLFA 2GD6A 3NHJA 1PD0A 1XHFA 5HR5A 5BQPA 2CNLA 4KO3S 3VKFA 2E5LB 2L2QA 3ZIAA 1AX9A 3GZJA 1EPUA 4D4MA 1MT0A 5KVAA 1X42A 2VHXA 2DLDA 8AT1A 4HDKB 3LT1A 1N3LA 4OI1A 5JUWA 1II8A 2XB4A 3MHPA 4JY7A 3T9AA 5KOJB 3GXOA 4A91A 1KI3A 1TVEA 2NPOA 1JHMA 1Y8RA 4EK9A 2L17A 3KT6A 5CD1A 4JBLA 2M1ZA 3ZWCA 4HRYA 4WXEA 4IZHA 4JJ7A 3AYZB 3C7KA 4XJSA 2FETA 5KQRA 3IEKA 5HWSA 4KQCA 3JYHA 5JOQA 1J2RA 4XIIA 1OVGA 3MERA 3VDQA 3FUVA 1E6WA 7REQB 2JJMA 2GVZC 1MX5A 4KO2S 2WFLB 4CMJA 1LLDA 4PBTA 2CDBA 3V9AA 4N3AA 5JO0A 3N0VA 1G8PA 2D1FA 2R86A 1SCJA 2OV4A 1U8AA 3FNRA 3QQPA 1UXKA 2R48A 2A3NA 3QVJA 2PRSA 1GGNA 2ZSUA 5HTKA 3ZWKA 3SAJA 4BQOA 4G24A 1DWUA 3OUTA 5IMSA 3K6SB 4LF6B 4JLVA 2I4RA 1AA6A 2WTUA 1M6EX 4C6SA 3E03A 3U4QA 4DR7B 1U9IC 1FE8A 2HA2A 1U1CA 1KU0A 2AFHE 5HZGA 2VA9A 4UBMA 1FFGA 2ZE6A 3B7PA 4PRLA 2VQDA 3A4LA 3JWPA 5IF3A 2CNKA 1YBAA 2XNDA 3G0CA 4D3SA 4N5NA 1KGDA 1UM9B 4LBYA 3BULA 2FJUA 5ALSA 4RA9B 4XGQA 4F3RA 3DOHA 2ZBDA 4R9RA 4BMSA 2WQ6A 2W22A 3X1XA 2JI4A 4QM6A 2J9FB 4HUJA 7ADHA 4BP8A 4R2LA 3COWA 3GJ0A 3LX5A 2QY6A 4DAEA 1HK7A 2VP2A 5AVJA 1QGAA 1QYXA 1R0KA 1RCFA 1KR2A 5CFLA 4GPTA 1MF7A 1VI2A 2EX1A 3H1TA 3LUGA 4PYJA 1ISIA 2DX7A 2OT3B 4AF6A 5GZ6A 2FP4A 1UBEA 2MMGA 4BXOB 2GNOA 3ZHVA 3BERA 3R7SA 4TWAA 4UHHA 4YDQA 2Y1OA 5IVPA 3JQQA 4G4GA 2YW9A 2AQ8A 3AIKA 4L8VA 4BQIA 1X7WA 1G4UR 5K2OA 1BHQ1 2UAGA 5FLYA 5TSDA 2Y1KA 5TGDA 4B8WA 1KGSA 4ZVQA 1EIZA 1HG0A 1HLGA 1NFRA 1XD8A 1EFUA 1MJNA 4CBVA 5G4LA 3VV3A 1TRHA 1ND5A 4ZWNA 4QDKA 2I4LA 3KTDA 4FEYA 4JSRA 4KZPA 1BJTA 2JH9A 3NDPA 3Q5GA 3QNUA 2OCBA 3C0KA 2H1RA 2HNBA 2D7JA 1KMNA 3KYCA 3NVAA 4MR9B 5HUHA 4TL8A 3OJWA 4IFTA 2OAGA 3BB3A 1I7PA 3SIPA 3AHEA 4EPYA 3QKSB 3ZZTA 4EHJA 4G5OA 4QUIA 3IB6A 2WB2A 3I1JA 1OAAA 2RAFA 3DMRA 3KKQA 4JSTA 4UAJA 1X7YA 4V0OA 4MPJA 2FZKA 1YR1A 3BBLA 5C18A 3W77A 3AJRA 5E0KB 2X9NA 1SIUA 2HA4A 1TKCA 1P4SA 2EF1A 3BE4A 4Q7LA 1Z5PA 3OJCA 1M2KA 3OFSA 1Z9BA 5HZMA 4JA2A 1Q83A 1T8WA 3W04A 1TLTA 4TVOA 3H2GA 3KKNA 5E6RA 4ZEXA 3VDNB 1AT1A 3I2FA 1JB1A 2WIJA 2IPAB 5DM0A 1N5IA 4K1LA 1Z0DA 1EMDA 3FPCA 2FW0A 3IBFA 3EDQA 1SHLA 2QXYA 3UCEA 3M70A 4HCJA 4OV6B 3TVDA 5CEJA 1TM7E 2VQEB 2ODEA 1AG9A 1DQRA 1RHJA 2VJNA 5HK9A 4R6WA 1Q7CA 2GEDA 4QTUB 2UVPA 4COKA 5GP1A 5JDCC 5ELMA 2GJSA 4JJIA 4PVCA 4WY5A 3NEAA 4LYAA 1FFSA 2BEWB 4R1LA 2ZJFA 5J2UB 1DOZA 2GZHA 3K30A 1EVYA 1X94A 3L04A 4HWRA 4NS4A 8MHTA 1NVTA 3GT4A 4KCGA 3WK4A 3SI7A 3DPSA 4F2PA 3ETLA 4G67A 4MHSA 4CTMA 2FX5A 3F6YA 3KZCA 3MYYA 3QKRA 1MDFA 4AIIA 3SQOA 4DXDA 5CITA 6ABPA 4P84A 3NYRA 4GL2A 3U3KA 5DFAA 1J9EA 2PBZA 2G80A 2ZCVA 3AR6A 1NUAA 1LQTA 1U0BB 3PE6A 4NZ9A 2JJYA 2NNWB 1B3BA 2WV7A 5B3JA 1GAQA 3BCSA 1DUVG 4IUYA 4R8SA 4YAEA 3M9WA 2LCIA 1L7BA 3SEAA 3DB2A 3B36A 2QDXA 2VDMB 1ZICA 4DUPA 1WUHS 2I62A 3EVNA 3WNZA 3PXAA 4NZNA 2H2AA 1QB7A 2PAFA 3RFUA 4DMGA 2WF5A 2OSBA 4KXQA 1USKA 1OASA 3SKYA 5DK4A 3GY0A 4C4AA 4IUBS 2O07A 1SKUA 2FOIA 3OCJA 1BQ4A 4PPGA 4K3UA 4NZMA 2VUSA 2VH2A 2QT1A 4HJRA 2CXNA 4LTNA 3FZNA 4OXRA 4S0XA 3UT6A 1NULA 4FQ5A 1JUDA 4LX8A 4UC0A 5DIZA 3RWBA 3NTRA 3VKWA 2QTFA 1PDVA 1IDOA 1BFUA 3VKVA 3WP1B 2XSZA 4X60A 4PW0A 4WXYB 3WWPA 2IYFA 1E1LA 3T9EA 1KXJA 2WSLA 1BWQA 4B87A 4BVJA 4Z1MD 1TW3A 2C78A 1Q77A 3QHPA 1VLMA 3W7BA 2RONA 5BV7A 1I4WA 5L3QB 2NAPA 4F3TA 4ZO7A 3ZCVA 1DGQA 2B2XA 2L0XA 2NU6A 3C6KA 4L8LA 4LBVA 3NOQA 4DSAA 1TVKB 1GNQA 3TIVA 5AFSA 1ZMTA 2G28A 3MQFA 1CRWG 1U1DA 5D3ZA 4RAOA 3EXG2 2ZWIA 4J9UE 4JN6B 2HXYA 4JWTA 3SN6A 1HNZB 3AT1A 5AUOB 1WUTA 3H13A 3UBTA 3H4VA 4GVXA 2GQ0A 4J94A 2Z83A 5AT1A 4DJEC 4AFNA 2A0YA 3ZW7A 4DFDA 1JL3A 2GCOB 2JJ2A 2VJOA 3JRWA 1CLUA 2PX6A 1M2OB 4Q1BA 3RKUA 2C59A 2QE6A 2R4UA 1E2GA 3S55A 4OI2A 3VYTB 2ZOSA 3KXPA 5D84A 5A9SA 4J1TC 1JFLA 3VSDA 2JIRA 4AMGA 3D8RA 2FDCA 3CNBA 2AYZA 2C1EA 3RW9A 2MYNA 2HU8A 1SUEA 4HXGA 3OPXA 4F8EA 4DV0B 5REQA 3AUAA 1NW9B 3PG5A 1EDBA 2QXUA 1GTMA 2WIKA 4CM8B 4J0CA 4X8OA 3HXPA 3LBAA 1R8XA 4DTIA 1DFHA 2LWIA 4WZAB 4BE9A 4H2DA 1YC2A 3F3MA 5KHOC 4KRFA 3CWQA 4WN3A 2JCXA 1DQSA 1QAQA 1MJGA 1MB4A 2FUCA 5FOXA 4ENSA 1LJLA 2OHIA 1BS2A 2R6ZA 4K9OA 1OPRA 1VYTA 4BNXA 5CBPB 4FBMA 3X0DA 1T10A 3FN4A 1E4OA 3HLYA 4RD2A 3H5TA 3B6MA 4CTKA 1ZL0A 2CDCA 2IIBA 1KAMA 4PZ9A 1LB1B 5TPZA 4OMUA 4BGIA 4DE5A 1YE3A 1W9MA 1Z5GA 2VPIA 3OIDA 4YRJA 1CXZA 2N42A 2ACKA 3FVWA 3GP5A 2Q0XA 4M0CA 3IGFA 3FZGA 1E2IA 4I1UA 4D8TA 2DLCX 1LC3A 3E0QA 4I9NA 1L5LA 5A3QA 5JEEA 3T3OA 4E2ZA 5LDDC 4WLOA 2B99A 4D9MA 1CUAA 4BYMA 4S05A 1G9TA 4JCOA 5BWMA 1MO2A 2ZITA 3MILA 2BGGA 3S7ZA 4S04A 4YJFB 2EZ4A 2TMKA 3V55A 3Q7PA 4GR4A 4I1SA 4ZOQI 2QBYB 1WNFA 4WZBE 4EB0A 4A8TA 5CW1A 2VNSA 4FEGA 1OH7A 3GOHA 2GPJA 3RAJA 2BKLA 1H94A 2QT0A 3DYBA 2XWSA 4KLCA 2HU5A 1JVBA 3OCUA 4TQUS 4F3YA 2PH3A 2QQFA 3VYSB 3W8RA 4BC0A 4FEAA 4YRQA 3SF8B 3K71B 4KDRA 1N8SA 1B73A 1N1EA 4GU5A 3TTSA 2EG9A 1CERA 1SC1A 4DHEA 4G5FA 1ABBA 2JDIA 1E1YA 1CHDA 5CD9A 5AVRA 5FWNA 2JA2A 3DP9A 1ECPA 3PUHA 4BFSA 5FUXA 3IR5A 4LQ4A 4TROA 2O6HA 4QVIA 1ES9A 2VDJA 4WOCA 3UMYA 4B6JA 2ZBQA 5DLQC 1BN6A 3TL2A 4BMYA 3GA5A 1V4BA 3TIXB 1SCUB 1YB5A 3DE3X 1Z8FA 4J1NA 5CA1A 5A0TA 2DFLA 3GJYA 1JHZA 2GNPA 3DMDA 3DKIA 3HZHA 4G85A 4ZQEA 4TVKA 1G0OA 1LEHA 2A67A 3JVUA 2ICAA 5KTTA 3CIFA 1Z5WA 5FH9A 5C5EA 2ZJBA 1H1DA 3BICA 2GBGA 3A2MA 3BWDD 3OZBA 5A71A 5CFQA 4ALJA 3BA6A 4FSXA 3GZ4A 2G9QA 3BGOS 5FX2A 1O58A 3B51X 4JFAA 3CUWA 3LKVA 1ADYA 3AF2A 2OB1A 3TOSA 3MRVA 4X00A 5ALUA 4B48A 5JAHA 3K4PA 3C15C 1GNTA 3R8CA 2GR9A 2XYGA 3KTAB 3DV9A 2BTOA 2EBWA 3L79A 3IMFA 4KUHA 4M86A 4X7MA 5ENZA 1XZHA 4IAOA 2MR6A 2HMSA 1AH2A 1YULA 4G0VA 4WXPA 2I6XA 1Y4DE 1YZNA 4PG6A 3CX3A 1CUBA 5D8DA 2PLRA 3Q0IA 1OFVA 1QR2A 3R7WB 1NYLA 2QRQA 3UF0A 1DAGA 5C1PA 4Z2AA 2PGXA 2FI1A 1R64A 1Z6PA 1SKYE 2LE0A 1VGQA 3EPPA 1RXYA 4R84A 1FCJA 3W05A 1A7UA 3VBEA 4B31A 5KYGA 1IH8A 1U6KA 2H4XA 3LDHA 3T35A 3WWDA 4YP6A 4EFDA 3TX6A 3QIAA 3N2YA 3KLNA 4M8KA 1OYOA 3CCBA 2F8MA 1IPFA 3HJTA 1GNLA 3FA2A 3KXDA 3F78A 3KDSE 3LZ6A 3M83A 4JYPA 4NARA 1USVA 2FFAA 3K0HA 4R51A 4RD0A 2CFCA 4RIGA 3ZWXA 5AW2A 3H5OA 2CBGA 3KAJA 4JAVC 3M3PA 3WBKA 4CLDA 3KT8A 3LUFA 1C14A 4TM8A 3GRFA 2BGMA 2R8XA 4PWZA 1SXJD 5TB5A 3CUUA 1N9KA 1ZH8A 4E03A 3EXHC 1E5QA 2ZJ3A 2AEEA 3NKVA 3P4UA 1GKLA 1CR6A 1Z88A 4RFVA