4PO3X

Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
309
Chain Sequence
ADEEAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYEQSADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase B
publication title Crystal structure of a C4-C4 SN3 tributyrin phodphonate inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
total genus 122
structure length 309
sequence length 314
ec nomenclature
pdb deposition date 2014-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4po3X00
2VA9A 3V1NA 1EXWA 1CIJA 2GZRA 3WZLA 4UUQA 5AO9A 4H0CA 2XMRA 3HXKA 3R3VA 1CUFA 3GFFA 2ES4A 4W1RA 2QVBA 2C7BA 1XZMA 1LPNA 3DLTA 3FCYA 3OPMA 4G8BA 3W9UA 4E15A 1CUIA 4X71A 4KRXA 1UKCA 4JYPA 4DMHA 1MNQA 3JW8A 4OU4A 3I2IA 1CUDA 5BV7A 3DYVA 4WY5A 2QJRA 3DQZA 3G0GA 4NMWA 5DYWA 4F60A 2JGFA 4CCWA 4BE4A 4JUIA 1Y37A 2WUGA 4F5ZA 1XRRA 2CBGA 2BUBA 4U2DA 4W1QA 3QITA 3A2MA 4H77A 2EDAA 2PSFA 1MTZA 5A71A 2OGSA 3RKSA 1XZLA 1XZAA 4QEKA 1QIIA 3V9AA 1QIFA 3BF8A 4ZV9A 2I78A 1LZLA 1P0QA 1YCDA 2PX6A 5LZ4A 2WUFA 2GBGA 1EB9A 2I3DA 4DNQA 4P93A 5AKYA 2BKLA 2XI4A 3FNBA 1UWCA 4BTLA 4ROTA 1LLFA 4H7DA 2C4HA 1G4HA 4OPMA 5D7BA 2CKMA 4HRYA 4AXBA 4AN1A 2CJPA 2H1IA 5LZ7A 1QO7A 2VJDA 1QIDA 1JT2A 4E46A 4LXGA 2HFKA 1P0IA 4RE5A 4YASA 3WJ2A 2DCMA 3G9ZA 2ZJ7A 5ALUA 4OUKX 2J3QA 1USWA 4IQ4A 1HBJA 1QONA 1QGED 1QJ4A 3DDUA 4G4GA 3QMVA 4IO0A 3I6ZA 3ZLTA 1BCSA 2RONA 3BXPA 5AKIA 4X91A 2WIDA 4A16A 3RM3A 1E8DA 3H19A 5AM5A 3NOXA 1KEZA 4X94A 4AB1A 1FFBA 3QMMA 4KE9A 2G5PA 2QJWA 5DNUA 2O2IA 1Z68A 2W22A 4X95A 5LZ5A 1E5TA 1CFJA 3W06A 2YXPX 3NUZA 2BUCA 5ALLA 4L3WA 3VKFA 5AKZA 2WU4A 4EY6A 1UFOA 3VVLA 3GROA 4G4JA 4NVRA 4BP9A 4C4ZA 3CXUA 1Q0ZA 1H22A 2PU7A 1VOTA 1QFSA 2XLCA 1XFDA 5FUMA 4ARBA 3A70A 3WKCA 1K63A 4XX1A 5AI9A 2LIPA 2OG1A 3WKAA 3DD5A 3OC0A 4UHEA 1SCKA 3HC7A 5YASA 1UK8A 3WQHA 5FXMA 5ALJA 3DKKA 4B84A 5AKEA 4PNZA 4QDOA 2RAUA 3C70A 3WJ1A 4EY8A 1ZD3A 1W1IA 3R3XA 1FFAA 4G5XA 1KU6A 5EHXA 5C8XA 1ODTC 1CUCA 4X00A 3STTA 2XMQA 3IA2A 2HL6A 1LZKA 2PUJA 3WKDA 1YAHA 5JAOA 4G9GA 4DMFA 1VLQA 3G0BA 1EVEA 4F21A 2XUKA 4LXIA 6YASA 3HYSA 4H7KA 4CG1A 4J03A 4W1SA 2PM8A 1N5MA 3C6YA 3STXA 2ECFA 2RGUA 1XLUA 3H1AA 1CUVA 4EB0A 4MWTA 5CXXA 4X85A 3LCRA 1DWQA 3S2ZA 4HXGA 2K2QB 3D59A 4ZI5A 5ALSA 4IH9A 5C8VA 2QMQA 1TCAA 5HF6A 4ZWNA 3WKBA 1GPNA 5JD4A 5JASA 5FLKA 5LP1A 3V1LA 1BN7A 2XUHA 2ZJFA 5DJ5A 1F0PA 5SYNA 1XLWA 2OPHA 2C5GA 5HQ3B 1ZJ5A 5FOQA 3FLAA 4AO6A 4DMCA 1JJIA 3A2NA 1XZEA 5ALNA 1A8SA 1K8QA 2OAEA 3SX4A 3C5WP 2ORYA 4BE9A 5A6VA 4CFSA 2HA3A 3M82A 1UOPA 1FFEA 1XRNA 4C87A 5AOAA 2HA2A 5EFZA 2Y6VA 3R40A 4RPCA 1WB5A 4YX9A 2OLEA 4K6KA 4BCCA 3UUEA 2OAGA 4X93A 2OCIA 3WZMA 5AOCA 4Q3LA 2OCKA 3D2CA 4UBNA 1CEXA 2VJAA 2ZVDA 3BJRA 3CN7A 5AKKA 4U2GA 3ESCA 3PUHA 3WIOA 3QM1A 4KE7A 2PL5A 1ZI6A 4BAGA 1AMNA 2AJBA 5DTJA 5HQ3A 1XZHA 4B80A 4ZGBA 4QWMA 2AJCA 3WL8A 2XUGA 5IKXA 4MEAA 5CTAA 4MQLA 4B83A 1J1IA 3CN9A 2WHRA 3JWEA 4QZVA 1YA4A 2GZSA 5FV4A 1VJ5A 3O4JA 1EK2A 1SFRA 1A88A 3M81A 3FVRA 4KJXA 4I19A 4C88A 1L7QA 3DYIA 2Q0XA 4INZA 5AICA 1CUHA 1GQSA 1EB8A 4J0JA 3AZPA 1YSCA 1CLEA 1ORWA 1L7AA 3I2JA 4BP8A 4JNCA 5EIEA 1VE7A 4DYHA 3RLIA 2BAGA 5LLSA 3IVMA 3ILSA 3M83A 2YH2A 1Y7IA 3OOSA 2J3DA 4X6UA 4GEGA 3IUQA 3H17A 3H1BA 4B9AA 4CIBA 2HA4A 1E89A 2HRQA 4BTVA 2VJBA 2XUOA 4H7FA 1A8QA 3DCNA 4CIAA 2WU3A 4TPKA 3ZLUA 5KBYA 1EX9A 4H35A 3G0IA 4FNGA 2Z5GA 4L9AA 5AM0A 1GT6A 1THGA 3WK4A 4BZWA 4P08A 4J0IA 4N8DA 3ZLVA 1C7IA 1K5PA 3C87A 3FSGD 1TK3A 1W6RA 3PE6A 3RARA 1CRLA 2WIFA 3QYJA 1HKHA 3NGMA 3QZUA 2IX9A 2VSQA 5A7GA 5K3DA 4QE3A 2WTNA 5CH8A 3N2ZB 1LPPA 1EI9A 2JGIA 1F8UA 5CT5A 2DSNA 1D07A 2WJ3A 4AZ0A 5J3JA 2OQIA 2QUAA 1CR6A 3MGAA 3AIKA 4LIPD 3AIMA 2G63A 4QWWA 1C4XA 1K6EA 2VQ6A 4N5IX 2YASA 4X6XA 5SYMA 4EY7A 3HABA 2Y2VA 2B20A 4Y2TA 3ESBA 4C01A 5HF9A 5D3ZA 1CUGA 4MYDA 4J0KA 5T4EA 3D2BA 1C7JA 4KE6A 5AKJA 4UHHA 3EF3A 5JAPA 1XZGA 2VATA 4AMYA 2BGRA 4UHDA 3I2KA 4EY4A 2XB6A 1QZ3A 5JAUA 3WL5A 1WPRA 2BJHA 1UK9A 2QUBA 3WL7A 4DSAA 4QLAA 4PW0A 4GHWA 3H2JA 5EIHA 2XUQA 4HTAA 1CUBA 3ICWA 3E4DA 3MUNA 5JD5A 3VVMA 4U2BA 5JALA 4B85A 3FAKA 4HAIA 2PU5A 2XMBA 4X7BA 4FDMA 3AJAA 1F6WA 3WK9A 1B6GA 1UZAA 1BEEA 1ZJ4A 1ZI8A 2R11A 3OTQA 1EHYA 1H2XA 2ACKA 1QTRA 2WG0A 3LLCA 1A7UA 4J7AA 4FKBA 3F67A 4X6YA 5CURA 4U2EA 1W76A 1NU8A 5ALHA 1HLGA 4L0CA 1ZOIA 2XUPA 3D4LA 4RE6A 1ODCA 1JKMA 1ZIYA 2VJCA 2QR5A 4WFJA 5ESRA 3KWJA 3DEAA 3AZQA 3FVTA 4C89A 4B7ZA 4XVCA 3GA7A 1VZ2A 1ACJA 2PSHA 5C7YA 4QLOA 1CQZA 3F96A 1IZ8A 3R0VA 3UUFA 1KU0A 1DT3A 2XMGA 3QH4A 5K3AA 5BWCA 1TCCA 4C4XA 4FOLA 3Q0TA 3O4IA 4TVKA 1I6WA 2HU5A 3WKEA 3D7RA 2ROQA 4B81A 3ANSA 5AH0A 2GBFA 1WPXA 2JF0A 2ZYSA 3ANTA 2XMZA 3FYUB 4OYYA 1LGYA 1SOMA 2HA0A 4HXEB 5FP0A 3AZOA 2XT0A 4HVTA 2QXTA 5AM3A 4FBMA 3IUMA 4J3JA 3DS8A 1SC9A 3H04A 3K9BA 5I8PA 3W2TA 3ESDA 3IUNA 2ZYHA 1CUJA 4OB6A 3DJYA 4JH0A 3ED1A 4Q1VA 3G02A 4LYDA 4GDMA 4IH4A 1CVLA 1HPLA 3C43A 5I9IA 4NS4A 3FYUA 3T4UA 4A5SA 1QO9A 1IMJA 3G7NA 5LZ9A 4GW3A 5H3HA 4ZREA 3WYNA 1LBTA 2XUIA 5AI4A 3TGLA 1R1DA 3HSSA 3B3QA 1GQRA 3WL6A 4J0GA 5HZGA 1MU0A 2CEKA 2XUAA 1BU8A 2HM7A 1N5RA 1JU4A 3WK5A 3D3NA 3QPCA 1DX4A 2WG2A 2DFPA 2WJ4A 5CT4A 2QM0A 4G8CA 2J4FA 4WDQA 2XQJA 4BVLA 2QKYA 4FFWA 5AI6A 3LIPA 4AN0A 5AOBA 3V1KA 3NWOA 1CUYA 2B4KA 3BE8A 5AIAA 2JGMA 4H18A 4GECA 5AKXA 3FCXA 1XZFA 1WM1A 2PSEA 3F97A 5ALVA 1P0PA 1W4LA 2QS9A 3EBLA 2FJPA 4EY5A 4GLBA 1UKBA 4DNPA 3QPAA 3V1MA 1BROA 1JU3A 3R3WA 3HEAA 4BC1A 5AIBA 4PSDA 3DL4A 2RIPA 4MQMA 2PKYX 1XZDA 5K3BA 3WK7A 4HS9A 1TRHA 3STWA 3D2AA 5HKAA 4H7EA 4UBKA 4U2FA 1XZJA 5T4HA 1ZI9A 1BN6A 4W63A 4E11A 2OQVA 4OSEA 2XQKA 3AILA 4J0CA 3F98A 4CI9A 3X3HA 1ZIXA 2XQFA 5CT8A 4BRSA 3KSRA 5EHNA 4N8EA 4KAAA 5CH5A 3KDAA 5AK6A 3VXKA 3BDVA 2AXEA 2QT9A 5KWJA 1S8OA 4WY8A 2XUFA 2CUTA 1AGYA 3I1IA 2V9ZA 2XMSA 5CH3A 2GYWA 4PV7A 1J07A 1WHTA 2JIDA 1Q0RA 5DNVA 1PV1A 3KOOA 3ZI7A 1W75A 2AJLI 3O0DA 1MX9A 1DX6A 2PSDA 3IUJA 3CCCA 5C81A 1AX9A 5IVKA 1AC5A 1WB4A 1IZ7A 1EINA 1GPKA 1CUZA 2JGJA 1XKLA 1K4YA 2H7XA 2FJ0A 2WG1A 3QPDA 5I7UA 3BIXA 2JGKA 5E2IA 1W52X 2EEPA 1MJ5A 1R9MA 1XQWA 4AO7A 4Q34A 4X92A 1U65A 1N1MA 5CW2A 2VF2A 2ZSIA 5JZ9A 1XQYA 5DTIA 1LNSA 3KXPA 4KRYA 3LIIA 3WYDA 4QDXA 2QTBA 1EK1A 1E8NA 2ACEA 1BRTA 1G66A 2ONCA 3PICA 3G8YA 3WA6A 4UBOA 3VJMA 1DU4A 1GZ7A 4XIIA 3MVEA 4BAZA 3I2FA 5AM4A 4Y2QA 4K5QA 1T4MA 4J0DA 4YPVA 4FLFA 4BZZA 2Z3ZA 3I6YA 1CV2A 4BDTA 4YK7A 3G9XA 2WQZA 2O7VA 4M0MA 3AIOA 1ORVA 3C45A 5AM2A 4B6GA 3S8YA 1CUEA 4UBMA 5LKAA 1XROA 3I6MA 1R9NA 4DMKA 4G8DA 2YYSA 4AZ3A 3WI7A 2VT7A 4WFKA 4BYMA 5EGNA 4O08A 4PSUA 1QE3A 4PSCA 5CT6A 3A6ZA 1MAHA 1HL7A 1P0MA 2ZYIA 4DIUA 3L1JA 5JD6A 1G5FA 5E4YA 5AK3A 2WHPB 1CUAA 4B82A 4CCYB 1L7RA 4LYEA 1FFDA 5ALTA 4Y2YA 3D0KA 2D0DA 1DT5A 4AMZA 4BVJA 2VTVA 3GZJA 2RI6A 1IUPA 3GUUA 4MEBA 2X76A 2XUJA 1FFCA 3HRHA 4FLEA 4DLNA 1UK6A 1IUNA 1JJBA 5ALWA 2D5LA 2HFJA 3WWOA 4BB0A 1R88A 3SWWA 3YASA 2WHPA 1JJFA 4GI1A 2Y2UA 3PFCA 4CCYA 4ITVA 1FJ2A 1GKKA 3AFIA 4WCVA 4ZV7A 1AUOA 2BFNA 3W04A 5ALEA 5CXUA 1DTEA 2WFMA 2O7RA 3OURA 3ZV7A 3P2MA 5A7FA 4DGQA 5FRDA 3OM8A 4EHBA 3T52A 2GBIA 5AI0A 3BIWA 4DNFA 2PSJA 2VT6A 4HXFB 4KE8A 4JEIA 4OB7A 4DTCA 5JANA 3TEJA 2WUEA 1WHSA 3STVA 2B61A 3KD2A 5E4TA 4G9EA 2HRRA 3O95A 3IDAA 2DHDA 5AK4A 3RK4A 4Z49A 2PBLA 3H18A 4W1PA 4OU5A 2JEZA 2G4LA 2X8BA 3WLAA 1YB7A 4HZGA 2WFLB 3UMJA 3OG9A 3A2LA 1QLWA 5ALIA 4MWSA 5DYYA 5HF5A 4CG2A 4B9EA 5EHZA 2HA5A 3O4HA 1UT6A 4FWBA 5K3FB 3IB3A 1XQVA 4UHBA 2X5XA 2JGLA 5DWDA 1IUOA 4UFNA 4BVKA 3LP5A 2QXUA 2W6CX 5KREA 1THTA 1BEZA 1DQZA 1X2BA 2O2GA 3STUA 1ETHA 4M0FA 1CUUA 3C6XA 4UFOA 3R41A 4Y2JA 2FUKA 5ALFA 5FDFA 2AJDA 4W9RA 4Y2XA 4ZXFA 2WFLA 3C5VA 1R3DA 1TKRA 4WDRA 1DWOA 5A7HA 2IIVA 1EDDA 1Q83A 5IVDA 3G9TA 3D5EA 5K3FA 1MT3A 4LKOA 5ISMA 2HU7A 5HFNA 3W9BA 5JZBA 1AURA 3G0CA 5LYYA 4N8SA 1YS2X 2G5TA 3QBJA 5AKHA 2WJ6A 2XUDA 4QNNA 4MYSA 4L72A 1ACLA 4XJVA 2CZQA 2P8SA 3EIOA 2XDWA 2VAVA 2DHCA 5FPPA 3IBTA 4RGYA 1ZICA 1QIHA 1VXOA 2H7CA 4LXHA 5HCUA 4FLMA 3O4GA 4B0PA 3U1TA 4KAJA 4UBLA 3ICVA 1B41A 4Q82A 1EA5A 3AINA 3E1GA 1NX9A 2XE4A 1ZD2P 2O2HA 3M3DA 3R3ZA 1LPBB 4UHCA 3K2IA 3QMWA 5JYCA 5EI5A 3PF8A 1JFRA 1A8UA 4C6HA 2BGNA 4Y2RA 5AK5A 1ZD4A 2WSLA 4Y2UA 3FYTA 2E3JA 5IVIA 3VJKA 4BATA 3DOIA 2JEYA 4UBIA 1VA5A 2DQYA 5ALGA 3HACA 3SK0A 2EDCA 2BCEA 4N5HX 3VJLA 2C5FA 1M33A 2R8BA 5ALKA 1QIKA 3FYUC 1Q84A 2OCGA 4H7IA 3N0TA 1XLVA 1MO2A 1X2EA 1MX1A 5FPQA 5D3KA 2QOEA 4IHAA 1EDBA 4KEAA 5AHXA 5DYTA 1VE6A 4KAFA 3WMRA 3HJUA 1HDEA 3C8DA 3GBSA 2BUAA 4OD0A 2H7YA 4Y9SA 1J2EA 4AX4A 3G0DA 2XLBA 4Q05A 4E14A 5AKGA 2H9YA 1ZGCA 2XMDA 3SC2A 4X90A 1OXMA 3DKRA 1U4NA 3PF9A 1VXRA 3O9VA 4M0EA 5DNWA 5ALYA 1VA4A 4X97A 2V98A 3F9CA 3H2GA 5ALRA 5HK9A 5EHQA 1Y7HA 3I2GA 4BBZA 1TIBA 4UFPA 4K6HA 3L1HA 1VZ3A 4BAUA 3B12A 1MX5A 3VISA 1EH5A 1ZD5A 1J06A 2WILA 3O9MA 1T2NA 2IITA 3U0VA 1EVQA 4IH1A 4P9NA 1QFMA 5A62A 2FX5A 2WFZA 2XQIA 1OILA 3EQ9A 5LKRA 1IVYA 1UKAA 1XRQA 5AKLA 3HZOA 5ALDA 5CT9A 5LZ2A 5T4BA 1WB6A 3WWDA 3FWHA 2GBCA 4XWGA 2QZPA 5EIAA 1MN6A 1RYYA 4BC0A 2XMCA 1GPLA 5JIBA 3K6KA 1LPAB 1YS1X 2ZJ6A 1XZCA 4HRXA 4C4YA 2NW6A 4FFVA 1H2WA 4H7JA 1XRMA 1XZBA 4PQEA 1SCIA 3PFBA 3TRDA 3BJMA 1QIMA 1U2EA 3ZWQA 1NU6A 5BWBA 1H2YA 3WIBA 2WLSA 2PPLA 5DLPA 5ALXA 3LS2A 1O6GA 3EQ7A 3F8SA 4RNCA 2JBWA 1YB6A 3WWEA 4KR0A 2WHQA 3ESAA 5HK8A 1BE0A 2DQZA 1CUWA 5ALMA 3BF7A 2I3ZA 4G1FA 2VEOA 4ETWA 4MXDA 1VKHA 2C58A 4DSZA 2HU8A 1OCEA 1MNAA 2Z8XA 4GXNA 1EDEA 5JATA 1E3QA 2ZSHA 2WM2A 2CB9A 4DM7A 4MJ3A 5HKBA 4FMPA 4UHFA 4OYLA 1ODSA 5CRIA 3WWCA 2HHAA 5K3EA 4EA6A 2WIGA 4UPDA 3DNMA 4AO8A 4S0XA 2RHTA 1LPOA 3H0CA 3H2HA 1QOZA 3L1IA 4I4CA 5A2GA 2DR0A 4Y2SA 3WK8A 2V96A 7YASA 2WIJA 1GKLA 1QTIA 2C0QA 2HDWA 1YAJA 4KACA 3E3AA 2OGZA 1CUSA 3BWXA 4GBGA 1DINA 3E0XA 3H2IA 4H7HA 1QIJA 4K6GA 3V48A 3AUKA 4ARAA 5CMLA 2HIHA 5K3CA 3EQ8A 1WOMA 2OXEA 5AI8A 1PFQA 2C0PA 5JAHA 3FLBA 1G42A 1GXSA 4NZZA 4EZIA 1XRLA 4ZRDA 5HFAA 5ALPA 1U8EA 3CCBA 4K2AA 5ALZA 2V97A 1DQYA 2WTMA 1X70A 2AJ8A 3IULA 1AQLA 2RHWA 1TCBA 2Z3WA 2Y1KA 5HF8A 2XQGA 1AKNA 3WK6A 1JI3A 4QDTA 5BOVA 1XKTA 2JGEA 5AJHA 3FSGA 3R3YA 3DL7A 5AI5A 2VAXA 2GYVA 1ISPA 1QIEA 4EBBA 1CUXA 1UOOA 4J0HA 3R3UA 1CQWA 3WWPA 2HA6A 1DWPA 3Q8WA 1F0NA 2UZ0A 2WUDA 4A23A 3BDIA 4FTWA 2I03A 1XRPA 4PO3X 1QIGA 5C8ZA 3FLEA 4TGLA 1MPXA 1XZIA 2GYUA 2WIKA 1WCYA 3IIIA 1N8SA 3DOHA 4WFIA 1LBSA 2DHEA 5LIPA 5KWIA 1RP1A 5IVHA 4B0OA 1FSSA 5ALQA 1CPYA 3C6BA 3H2KA 1BCRA 5ALOA 4Y2VA 3W05A 4I3FA 3B5EA 3WA7A 4QDUA 4Y2PA 4D9JA 4OB8A 4F0JA 4DNOA 2B9VA 1YA8A 2Y6UA 5F4ZA 3PUIA 4G4IA 1AZWA 4PF1A 2HADA 4V2IA 4WJLA 3HI4A 5LZ8A 2OCLA 5JARA 1MAAA 4CG3A 3PI6A 1BS9A 1YASA 1ZGBA 4LHEA 1TQHA 1XZKA 4Y7DA 4BCBA 2PVSA 2J4CA 2OGTA 2Z8ZA 3C6ZA 3JYHA 5FKJA 3KWFA 1TAHA 3VDXA 4Q3KA 5D6OA 4FHZA 3I28A 4KYVA 4BRZA 3FOBA 2WKWA 4AQDA 3I2HA 1H2ZA 1E8MA 4GWLA 1E66A 2ZYRA 3MUOA 5JADA 4FNMA 3TJMA 4QA9A 4U2CA 3STYA 4FBLA 3I1YA 1GGVA 3IURA 4Q3OA 1PJAA 4X3CA 3C8HA 3FBWA 1LPMA 1RWQA 5T4FA 4UBJA 1HQDA 1R50A 5E4JA 4EUSA 5IH7A 1SCQA 2HA7A 2CMFA 1UK7A 4BCDA 2PUHA 3BL8A 3ZPXA 1JMKC 3GELA 1UOQA 4OCZA 4BDSA 2QRUA 4QDZA 5JZSA 1R4ZA 5CBKA 3G9UA 5AM1A 3PDCA 1UXOA 1JMYA 1XQXA 4P92A 1H23A 1O6FA 5AP9A 1LPSA 4JYMA 1YR2A 3QVMA 5K5EA 3HLKA
chains in the Genus database with same CATH superfamily
4J0EA 4EKEA 1E79A 4N49A 3WO1A 3MBIA 2VA9A 4MI6A 5HWSA 2GAAA 3FMPB 1PG2A 5F2KA 1R0LA 3IIJA 3T3DA 4CBVA 1QHGA 2I4RA 4D3SA 4D3XA 1FP7A 2GZRA 1EVZA 1NQXA 2OFWA 3OKAA 4UUQA 5AO9A 1GG8A 4I6EA 2AG0A 3QE2A 3N2LA 4H0CA 4D97A 1PWEA 1CUFA 1P2FA 3DVRX 3GFFA 3N2GA 3ENNA 4NICA 3BGOS 3MTAA 5HQTA 1QDLB 4MQBA 5D3MB 2Q3EA 1NXWA 2C7BA 3PIRA 5D84A 2W6QA 4FJ2A 1H1LB 3FR7A 3OPMA 4TYMA 1MJFA 3H9JA 4G8BA 5SICE 4E15A 2H3EA 2JVKA 3DUFA 1BKDR 3DR5A 4YXWA 2HNKA 3ZDDA 2DULA 2ZULA 3CINA 4HR7A 4O2BF 1EYZA 1JPNA 1MO5A 2VP5A 4FYKA 1K68A 4ZQHA 3TI9A 5WRFA 3HDQA 3WLFA 5F98A 3TN7A 3JWIA 1ZK0A 1D2RA 2R68A 5AJWA 4NC9A 5DO9A 1E4VA 2Q7OE 1LQUA 1XEXA 2EU8A 3OUZA 3L7MA 2J0UA 4XPIB 1ISJA 1C1DB 4OMFG 4L2IA 3REQB 2HBYA 1WG8A 1UJ5A 4CR6A 2XKKA 4X45A 1X13A 2QL7A 5BV7A 4ANFA 4CYMA 4PYIA 5FL7D 2FEWB 5DN6A 4JMPA 3G0GA 4NMWA 1I3CA 3OCXA 1O94C 4TV8F 4UPEA 9MHTA 1QKJA 2VDUE 3IE2A 1KZ7B 1LSJA 2HDHA 5LMCA 1PQPA 2OLJA 5BSUA 5IT5A 3O8NA 1WMEA 5HE9A 4EVSA 1LBHA 4YMHA 4NAHA 2DLCX 4F5ZA 2CBGA 3SHVA 4D96A 3LV8A 2E2WA 4U2DA 1U9JA 3SQLA 3BWCA 1EJ0A 3T38A 3TD2A 5IS2A 1NQOA 2ZBEA 3A4TA 3WB1A 3A2MA 1YJCA 2VUHB 3MYYA 2HX1A 4EGJA 3OHPA 4F38A 3AEQB 5DEIA 2EDAA 2RGWA 3K1AA 3IODA 2PSFA 2NSDA 1S2IA 1P17A 2G72A 1ZYUA 2OGSA 5A71A 3OCWA 5TQ0B 2RHMA 3UB2A 4D42A 1XZLA 1GZVA 1N0WA 3LX8A 4AI6A 4BFVA 3R7WA 3MJDA 2BGWA 1BX0A 4M9UA 1DHRA 1OHHA 3MK31 1TDJA 4EYEA 4K9DA 5EMMA 4PX2A 5ELXA 1B6TA 1LZLA 1W5BA 4YP7A 5F78A 1YS9A 4MR8A 1V0JA 1YCDA 4P34A 4E07A 4UJ3A 1ORDA 1YR8A 3ASZA 3OIGA 4MRPA 1BMFA 2QM3A 3B9BA 1TJNA 2BKLA 3F9IA 1ND6A 5IDVA 1HT2E 4F9FA 1KJ8A 4Z99A 4HAWA 5LWHA 3KSAC 1OY1A 3ICPA 2BIFA 1Y3BE 1V1MA 4H7DA 1VLVA 3LY7A 1RQGA 2ZRNA 3PUJA 3ZQJA 5FUXA 1FNCA 5AUOB 1T0HB 5J5AA 1J22A 3A36A 3T0FA 3DF7A 5KDDA 3LQ2A 3RSOA 2JKZA 3UWPA 2FN8A 3GEHA 4GZ5A 1RRPA 4B3CA 1FFXB 4C7XA 2VZ0A 4IRUB 4L3VA 3NBQA 1OLXA 2A0XA 5LZ7A 3RFXA 1DKMA 1F0YA 3A28A 3ZDQA 3QG1A 4DSNA 3G2KA 4QJ4A 1U2SA 1NXSA 2P7IA 4LXGA 4EX7A 2J9FB 4ZEWA 2V8BA 1TMKA 1U3FA 1RWMA 3E8SA 3O7MA 1GCGA 4GZ3A 5CLFA 1NWHA 1RQ2A 1BD3A 4HVAA 4CEIB 2VXBA 1VP9A 3WJ2A 2RGRA 2QN7A 1CY2A 1HX7A 1IXRC 3BGSA 1Y5NA 1V8PA 1FVFA 2R2GA 3BCUA 3DFFA 2APJA 4KIJA 4ZPXA 4ZIRB 1VBNA 4C08A 2RGNA 2VUIB 4WLVA 1GGEA 2AYXA 1ZGHA 2F17A 2ZR7A 4Y6OA 5D1NA 1I7QB 2A57A 3A9CA 3VOAA 4BNDB 2YHIB 4Q7LA 2HJGA 5TSDA 2K7FA 4KO8A 3V46A 1HBJA 1QONA 3CX8A 2Q62A 4J1SA 3WVNA 3WDSA 5IVPA 3NHJA 1AHNA 1JHRA 1Z0IA 3O82A 4LJKA 2YFHA 5JCOC 3KJEA 4WINA 2Q4EA 3L0DA 5ILGA 3QMVA 4PYRA 5B1HA 4W9NC 3ZBUA 4C2UA 2ZKLA 2IDZA 3LUAA 1BCSA 2GAIA 1FXSA 1XKXA 3IFSA 2ZJ1A 2P69A 3F49S 1E5DA 3LC2O 3S2YA 2ZIUB 5B3JC 2H4HA 1P5FA 3MGGA 3D3EA 3O3CA 4XQGA 2OP0A 2R7AA 1JJVA 3VYSB 3CRNA 2REXB 3ZHSA 5LP6F 3IIKA 3R5JA 4I46A 3NOXA 4X94A 1TA9A 1W36B 2DHRA 1ZLXA 1F8GA 2EZ9A 2Z2IA 3HDHA 5LDDC 2G5PA 4IJ6A 4R7TA 2OHIA 1JFFA 1KJYA 4WQMA 1T10A 4Y3UA 2V74B 5HRAA 1I3OA 2G06A 5I7RA 1BMDA 1QBKC 3FKQA 3TG8A 1GZSA 4UVDA 1JEQB 1Z68A 3EFOA 3KUXA 1OC2A 5SZKB 2P2YA 2VP4A 2HCTA 1GUYA 4LRXA 3ZE1B 2HZBA 3UOGA 1Z2OX 4X95A 5K4AA 3RVMA 2AN3A 3ZCQA 4X8OA 1E5TA 1P5JA 3Q3EA 1GPYA 4EBFA 5FPKA 3I0MA 2R25B 3N2EA 3R09A 1JDBC 2JZOA 2WOJA 3EXIA 3GIDA 4ENWA 5KYGA 5EJ6A 2KBFA 4AN4A 3C6QA 5CIQA 1DPFA 4AY3A 3R4CA 1PGPA 4RXUA 5ALLA 3ZXUB 4PWZA 1ISGA 5G41A 1KVTA 2WU4A 5I4IA 2WP0A 1T8TA 3VH4A 1SXGA 2BELA 3HCRA 2R97A 3EH2A 1SVSA 1J6UA 2XHZA 2XYGA 1TFRA 2WJAA 1AN0A 1KI1A 4YB8A 1EXVA 1XDGA 4C4TA 1FLAA 4NVRA 3N05A 2OYSA 4R1LA 3H9BA 1YU9A 1TT7A 3CY6A 6ABPA 4W5RA 2V1XA 2C61A 1E7QA 1R8QA 5KPJA 3CXUA 3FZNA 3IGFA 3NKLA 3U7RA 3URMA 4ER3A 4YMVA 4HLQB 1I51A 1H22A 2P2CA 3AP1A 3KM0A 4BIIA 4D9CA 3VZSA 3A9TA 3PT9A 1LNQA 3DP9A 3F1KA 3I1FA 4II7A 4RY8A 5F3DA 4AU1A 1A1SA 1MO4A 5D86A 3NX4A 5FUMA 3WKCA 4D9FA 1HZZC 1K63A 5AI9A 1D0IA 2QLJA 5K0JA 4LJ7A 4DEYA 3J80A 2GPAA 1JHXA 2OBYA 4RF3A 1S1MA 4PE5B 2AXNA 3A4IA 4GPD1 3WKAA 4RHCA 2G09A 4B3BA 2C00A 4K3VA 4YJ2A 3K4PA 4O4LA 1SCKA 3KVNA 1UK8A 3DBVO 4HDKA 1DWUA 3NEAA 3A7EA 1BE6A 5FXMA 3SR3A 2D13A 1ZH0A 1DO0A 3DKKA 2Q41A 2O2DA 5AKEA 1DCTA 1OYWA 4EKDA 1W36C 4AD8A 4QDOA 3C70A 3EQZA 1Q5PA 4M87A 4ZK6A 1U28C 4V24A 5FB3A 2GT1A 2ZSKA 1ZD3A 4RSHA 1W1IA 1Z6YA 2FPUA 4PPNA 1H69A 2VA8A 3W5CA 3R3XA 2DVMA 5DEOA 3VQTA 3I53A 4ARUA 1HRKA 2PQ0A 1TEVA 4YCDA 4HEJA 3HVJA 1XDUA 5EJIA 4IQ8A 3SYMA 4LA4A 3VMFA 3QSYA 4UCFA 3TRJA 1TU3A 1ODTC 2BFBB 4ITUA 4U5QA 3WRXA 1VI2A 4L8YA 5HP4A 1PZHA 2PRKA 3CKKA 4X00A 2R65A 4R51A 2AI1A 2IPMA 3GGSA 4ZQGA 1Z5WA 1W88A 4OAPA 4G5FA 4JCOA 3RRBA 1UUFA 3WIDA 4CZ2A 1PR5A 5CD9A 3TTSA 3PNVA 1KAHA 4YCMA 2OHJA 2QGNA 4IJQA 3GRZA 4QPNA 1STOA 1T9HA 1I2AA 2YICA 1PWXA 1ZQ1A 3IB6A 1QHFA 3OFNA 2EF0A 3HTXA 4TZ6A 4MUXA 2BFFA 4MV3A 4QXAA 4DMFA 3MWDB 2H07A 1QO0A 1VLQA 5PGMA 3DG9A 3NFRA 3M6FA 6YASA 4ZC8A 4CG1A 2A94A 2EZ4A 1LRJA 2GN9A 3BD6A 4DBZA 1YWGO 5LD2B 2A67A 3N2KB 3RASA 4MS4A 1Z5UA 4TLEA 1JL3A 1Y63A 4JBNA 4ADSG 3G7SA 1XLUA 1OOEA 3H1AA 4UE3S 3JQGA 4BRUA 4BIMA 5D2CA 1E9RA 1VLJA 1W34A 5CXXA 1KZ1A 3SU8A 1NVWQ 2YKGA 1BH2A 2JHCA 2V9PA 1LJUA 2QMUA 3W9YA 3LDUA 1RXCA 1VRWA 3F74A 3QFHA 4MS3B 3X2FA 4QPCA 4YRGA 3PGKA 4HXGA 4K86A 2K2QB 4ZI5A 3CM0A 1CZLA 4MMZB 4XVHA 4F3CA 3DCIA 4EHJA 3T7AA 3C8ZA 1ILWA 2A0UA 3OBBA 1QU3A 2P5SA 3O93A 3GJ8A 3DHYA 3EF0A 4C76A 5JASA 1GPNA 3ANLA 3VSAA 3SXPA 1ENOA 3UJNA 3JS5A 2GCOB 3VU9B 4PHCA 3QFRA 1G5IA 4K87A 4MP8A 4C6SA 3E9DA 4I36A 3PJRA 4QDKA 1SVMA 2BSQA 1NT4A 2QVXX 1M7BA 3NANA 4IQ0A 3I9MA 1Y5RA 3KE8A 4BQFA 1GQQA 5CFOA 2G88A 4B74A 5JECA 1RAAA 5BN1A 4NFYA 1DXQA 1Y1KE 1ZJ5A 2I29A 4BMDA 1AA9A 2IC5A 3FLAA 2V54A 2PAAA 4FN5A 3RYHA 3GQVA 4Y6GB 2ZRKA 5B53A 3DO6A 2J3EA 1SUWA 5KNBA 1T8YA 2QX8A 2PMCA 2IYLD 2ZM5A 3RSHA 4EO7A 1GYRA 2Z9BA 2JD2A 3ZXXA 3THWA 1XZEA 4MLCA 4OOFA 4W7IA 1WB9A 3K4HA 1EIWA 1G0NA 3KB1A 1K8QA 5EWJB 3RTGA 5BYKA 5MFPA 1B0ZA 1TRKA 2AYZA 3D8RA 3GEBA 3IT0A 4RC9A 3T5BA 3PJGA 3VHXB 4BE9A 1J09A 1SHZA 2HA3A 4L27A 5CDTA 1G17A 1N57A 1K06A 1PKXA 1S02A 4C87A 4K05A 4ISBA 4ZYZA 1P80A 2HA2A 2P6NA 2ANCA 4RDHA 1G3QA 3ANMA 4OP1A 3LX6A 5LQUA 1D4ZA 4FDVA 5CCBA 4W5OA 3GZNA 4TV9A 4DR5B 1X8KA 3HRKA 2XE7A 2BZ1A 5M3BA 2LTAA 3NOOA 3WZMA 1F60A 4WXYB 3R9XB 1WDTA 3KOZA 2EWMA 2J7PD 4UBNA 3FZQA 3Q72A 5GJCA 1XHFA 1SVOA 1MOPA 3BJRA 3BJEA 3ER6A 4B79A 4C0LA 3PSHA 3EXHA 5A04A 3CN7A 1KGDA 1LK5A 3ITEA 3KAQA 4TXHA 3VH3A 3L6CA 4QRIA 4Q9HA 3REFA 2NQTA 1E1RD 4RCVA 2HDOA 3QM1A 1GGKA 2P3OA 2FN3A 2GNOA 2CMKA 1GN8A 1D1SA 1TZBA 1AMNA 2ZI4A 4CF7A 4DPKA 4JVLA 3EVAA 3GXOA 2YW2A 3IJPA 1JPUA 4ZGBA 5JVDF 3CJQA 3EIHA 4QWMA 2CXRA 2EX4A 4R81A 3WL8A 5CTAA 4RJTA 4YLYA 4I2VA 5COAA 1CU1A 2PMDA 3VGPA 3MTQA 3QYFA 2C7QA 4AICA 1ZPDA 3FZEA 2HC9A 2IHZA 4MA4A 5JJBA 2C2KA 1CYEA 3CN9A 1A5AB 4HL6A 2A5LA 4QZVA 1U6KA 1VIDA 5ES3A 5HKOA 4BX3A 2DWUA 5BQOA 3UFBA 2DQ4A 4GI5A 4RQTA 3GFSA 1EXMA 1MGOA 2GEJA 5LL6P 2BFOA 4HGZA 5LQCA 2QVLA 4U0JA 1PS9A 4EECA 4WNCA 2AZDA 4LNAA 3O4JA 3MB8A 2I7DA 2TS1A 1KJWA 2HK8A 1USVA 1RMYA 4G01B 3QYAA 4DQVA 4KJXA 2CZCA 2Y3IA 3ENQA 3ZW8A 5HRUA 3F6SA 1R64A 4UXJA 3GG2A 1CUHA 3C7KA 4P5PA 1KMMA 3V1YA 4TZKA 1HK7A 1MPTA 4AKSA 4LBWA 3ZHQA 1G20A 4C06A 1AS3A 4RVOA 4EW1A 1ORWA 1PTKA 4WH0A 2E5WA 3CLVA 2Y1CA 1PFVA 3SM9A 2ZRGA 1M6HA 2NAPA 4JNCA 3K7EA 4RF5A 4EEXA 2HUNA 5EIEA 5AVXA 3TRHA 3BEOA 4KDFA 1HL3A 4ZI7B 3ND6A 3RLIA 3FWNA 2UXCB 4N3CA 5LLSA 5F9MA 3QUTA 4OKSA 4DXHA 1TTTA 1Y7IA 2C2HA 3BHJA 2AOXA 3OOSA 2J3DA 3R6TA 3RO7A 3R23A 4CT4B 3HVKA 2CLEB 4R2KA 3OCZA 1VFNA 2NVUA 1BGXT 1UJCA 4B9AA 4K0KB 1T9CA 5FWXA 3AU9A 5EZYF 2YVAA 4FR5A 2B0JA 3RC1A 1ABEA 1C7QA 3L79A 4OHZA 1O5OA 4H7FA 2A4KA 3RAGA 2J87A 3RE1A 3V4FA 4KR3A 4BXOA 4R2LA 2V55B 4GPBA 5D85A 2TMKA 3NEYA 4HCJA 4TPKA 4D8XA 3H8WA 1EX9A 1MO3A 5KX5B 2VHUA 4H35A 2I33A 1KRXA 4FNGA 4ZZIA 4PC3A 2YUTA 2YMPA 2O06A 5JW6A 3S1AA 4JODA 3JR7A 4L9AA 1E2JA 5AM0A 1GT6A 3ENKA 3ZHZA 1NV8A 4YIKA 4XZ3A 4JUBA 1X1TA 1RXUA 3K3PA 3W5HA 5F23A 3LXMA 2QD2A 4EFNA 1L7DA 3ZE2B 3D8BA 3NTLA 1V35A 4NNJA 4BNHA 3A27A 2YRFA 2JANA 3MTIA 5ECGC 2GILA 3T9EA 5IM4A 2E18A 3FDZB 1XMJA 1RI5A 1TZ2A 1D1TA 1QGUA 4QTYA 1K6IA 3EARA 3RARA 1CRLA 3OE1A 2ZJ0A 4EENA 2WIFA 2HHJA 3WZ2A 3U6BA 3OE5A 5HYVA 3QZUA 4X8MA 2IX9A 5AQEA 5CITA 5TLSA 3PC8A 3BS4A 5E7QA 5A7GA 3U9LA 3OP4A 1IPFA 5JDCA 4QE3A 5D5PA 3JRXA 3PR1A 2DE0X 1U0GA 3UW1A 2GPBA 5GIPE 1U8CB 1BC5A 5FBLB 4NMMA 4WL0A 3CLSD 1RYBA 1NPTO 2PKXA 3A3YA 3EIXA 4NU8X 4P4SA 4YTEA 5TQ2A 3UOWA 2YX1A 4TXLA 4R2XA 4EJSA 1NVEA 1CY7A 1YDHA 1XPUA 3L46A 2DSNA 1D07A 1ID1A 2FR8A 3NHUA 1Q3TA 4KQIA 3WDMA 2ATCA 1A77A 4MRAA 3AYZB 1M7GA 3UWSA 2I80A 4URWR 4ZZ2A 2Q2OA 4OREX 2ZAMA 3FE2A 1Z2EA 2A0WA 4BO6A 3VC2A 5BXYA 3Q7SA 3RFVA 5I7FA 3GIWA 4M1YA 4NOMA 3SMVA 3AIMA 1KR2A 2H2IA 3UCEA 4XGKA 3OFSA 4JIMA 4QWWA 1C8BA 3GJ5A 3TNJA 5IDXA 5DZSA 3A25A 3K15A 1U3WA 2LCIA 3B52X 3VI3B 2HF9A 2GF0A 2ZB8A 2CJYA 4N5IX 2AW5A 2PTHA 3UMCA 3D81A 4DMGA 3KYDA 5SYMA 3EDQA 1SXQA 4TYYA 3R74A 1Y7PA 5KTNA 4WKOA 4MKRA 3SVLA 3L6OO 4D3ZA 3AM4A 4TLMB 5G1OA 3T1NA 2X41A 2Y2VA 1OU0A 1XAHA 2EW2A 2A7XA 2H9AA 1NHGA 2JLVA 5JS6A 3QI2A 1YCFA 1S8AA 4QYTA 2WKSA 3ZWMA 1RLJA 3QPVA 4FMCB 3MJSA 4IOMA 5L4LA 1CUGA 1C3JA 1X8LA 1DQRA 3MJHA 5DGIA 2ZCVA 3BZBA 4QPDA 4RMIA 1QRTA 3PD1A 1TYZA 4EHDA 4UHHA 5FA5A 1T9AA 2O48X 1FNMA 1WRBA 5G1PA 5BQPA 1EAMA 2MSLA 3QY9A 5SV2A 3VUEA 1CWUA 2C9BA 3PEWA 2EBHX 5EP1A 5JAPA 1B0AA 1KR5A 5JZVA 5KAPA 1AF7A 2ZR0A 1XTJA 3PXAA 3ZX5A 2FXVA 2EVWX 1BFDA 2G5CA 4B3RB 2X0NA 1EK5A 2ZBQA 2ZRLA 4LZLA 2NG1A 2GKGA 1S01A 3HCBA 1WUKS 5DMXA 4LWQA 4EVIA 1T1EA 1S3SA 2QUIA 3QKUA 4GLLA 3OX3A 3ZU6A 5ADWA 2YZGA 1GHTA 4DSAA 4OLBA 1WW8A 1D9ZA 1X7XB 1WV0A 4PONA 2CGEA 5H82A 1AHHA 4Z8XA 3GEIA 3D5QA 3L6UA 4ZYLA 3ANYB 5H83A 4ESHA 3ADCA 2IZOA 1E96A 1W4CA 1OBVA 3FCSB 2P9YA 3VNAA 2OSBA 3ZE6A 4Q7QA 1FPQA 5EIHA 3BQ9A 2XWJI 5B1YA 1HEYA 1JAYA 4H6WA 4M7WA 4D0RA 5CB4B 2B1QA 3AEUB 3KLMX 3V8RA 2V03A 3HDGA 4NDZA 2Y27A 2AN9A 4EO4A 2DPGA 2Y0BA 3KJGA 4B85A 4TLBA 2VUUA 3B2EA 1WY7A 2PU5A 1QUEA 2X8AA 3H5LA 1Y8RB 1ZUIA 2H3HA 5ANRB 3CUWA 3V3KA 1JG4A 5IPFA 2ZR9A 1H4TA 1PEKE 3EHEA 1RHQA 1AS0A 2DLDA 4Q00A 4X7BA 4P5DA 5I9NA 1MQ8B 1I7DA 4MGZR 3WK9A 2CHFA 4KGVA 2M98A 3ZV3A 3E22B 5JHHB 3U3MA 1UZAA 5HBGA 5AUQA 4BN5A 2R11A 2IIBA 5AESA 2ACVA 3KT3A 1T5LA 2RK6A 4RCZA 3NU1A 5F3RA 3UMVA 1C7EA 2H7VA 1XTBA 4GNKA 3WLOA 4CQLB 2R4TA 1NYRA 4XJXA 4ZOCA 2PMFA 5CFMA 3OMWA 2OHOA 1DRJA 4J7AA 3RFUA 3ZE9A 1MR3F 3F67A 2Q2NA 3MD0A 4QDJA 3RNLA 1IYZA 2CLMB 3TR6A 4U2EA 3JQDA 4UATA 4UUAA 2AFHB 1GPDG 3A8TA 1PL0A 3FLMA 4LWOA 4W9MC 3AIIA 1U0RA 1JBQA 2VXCA 1FNDA 4BMPB 2NQ2C 4OJYA 2Q4BA 4L0CA 3H1PA 2FEMA 2XUPA 2Z9CA 4RE6A 3T15A 2UU9B 1JR6A 4V0RA 1KMCA 5JXHA 4I1PA 4MUYA 2PUCA 4U7TB 5AJXA 4O4HB 4EMBA 4MWGA 4DYDA 3TCKA 2CNNA 4ZOBA 1IEXA 2K5UA 4RIHA 5I9TA 1QSGA 3PU6A 8MHTA 1XWIA 2NZVG 1MAUA 4E5MA 2VTDA 3ACDA 1QOPB 1THMA 1Z25A 5EZ5A 4ACAA 2O8BA 10MHA 4HNAA 4OL0A 1ACJA 1RMQA 1UDAA 2QX4A 2O2JA 2PSHA 4M1TA 4Y1EA 3BEDA 2A3NA 4DZRA 5C7YA 2R86A 4WLOA 4BP3A 1RYMA 4HY3A 4QLOA 1CQZA 1R0RE 3BC1A 3F96A 1L7PA 4GBMA 1EGQA 2NACA 1DJPA 1E3IA 4EZBA 5FH9A 2XMGA 4JT9A 1PHRA 2C3UA 1H2HA 2JJ2D 2P9ZA 4DA4A 1UFKA 3AG5A 4M1ZA 2ZSFA 1E63A 1M2FA 1M7HA 2Z4RA 3H11A 3EJWA 1ZVJA 3HWRA 3OM9A 4DY6A 1P4SA 1NE7A 5J4YA 4D9NA 4KFCA 1O95A 4Z1MA 2C1XA 1IN6A 3O4IA 1JVBA 2R3SA 1TA0A 5SY4A 4N47A 3IUSA 3UMMA 1OSNA 1L4MA 1WUYA 2HU5A 4HPXB 4MP3A 4KZKA 4G4SO 2ROQA 4Z1OA 2D1RA 2P27A 5CLQA 3ZJUA 2ZRIA 2PCJA 2QL6A 3ANSA 4RHXA 1ORTA 1QF6A 1AB6A 1XJQA 4GU5A 4BZXA 4F3KA 3KVRA 2TMDA 4BJ3A 3F6EX 4EFLA 4P0PB 3EUAA 2VP6A 2AQHA 2P9GA 4LZJA 3ENZA 1Z56C 2XMZA 3N3AC 5I3CA 4CIWA 1HFKA 3OUUA 1E4OA 3ILYA 4FCWA 1I1NA 4F2WA 4GOND 1K4KA 2PZAA 3FD8A 3LAWA 2D2EA 2HA0A 4D9IA 1HQYE 1N2SA 3J81k 1FQWA 2BBTA 4E5NA 4U39A 3F3YA 3I34X 3I72A 4DWJA 3K8ZA 1RWPA 4JI6B 4GSKA 3QTTA 5G0TA 3FXAA 4HVTA 1N7HA 5TGDA 5JAZA 3HKEB 3DF9A 2IPXA 1U0JA 3TLJA 5CIWA 2OXRA 5C5IA 4JLVA 4DIMA 3N76A 5IYZB 1E9FA 1E18A 4DLAA 1U2GC 3HGTA 1X1AA 1W0JD 1WSWA 2Q3HA 3DS8A 1TF7A 2B1IA 3GAZA 2QJFA 3H04A 1KBQA 4KPUB 1BFUA 2ONZA 3AF2A 3T4XA 5CJ2A 2JLRA 4N7BA 3E8MA 4YJFA 1CY0A 2A5FA 3T3IA 4PG7A 2XQVA 3TLKA 4AROA 1NVGA 3AVUA 2OHHA 3IUNA 2AK3A 5REQB 4PBTA 1HO3A 1MBZA 2F59A 2FUNB 5F5NA 3NYWA 3ED1A 3PE3A 4ALKA 4H6VA 4LPKA 3DVSX 4XJSA 4MPPA 3G02A 3ZEIA 2E0IA 1YCGA 5AMXA 3CZ4A 4ITRC 4PPYA 2FZ4A 4LYGA 5JSUA 5BO5A 3BMQA 3EGDB 1A2BA 4IH4A 3G1TA 3TCXB 1LDMA 1X7YB 4IVPA 4JASB 4KMOA 1LXCA 5ES4B 2DG2A 2OB2A 3D31A 2NO0A 1PZNA 2W2OA 3EDOA 3TLMA 2WA1A 1WZEA 4LJ6A 2CLHB 3H9CA 1NTRA 2I7XA 3I52A 3MJCA 1LLUA 3RKRA 2Q2WA 4OBEA 4DFDA 1GDTA 2UVDA 3IRVA 3EZ9A 3V4LA 3AY6A 6CHYA 4DLTA 4B5LA 3QX7A 4YDQA 4A5SA 1QO9A 2VP2A 2WWFA 4OHKA 3G7NA 3DMHA 2VDVE 2FMXA 3FI9A 3TLGA 5LZ9A 5H9VA 3I5MA 4JJFA 1AKUA 2EG9A 2BTOA 4GW3A 4IMJB 4JCCA 4OXQA 1I1HA 4XEHA 4ZREA 2C04A 2R1VA 4ZAYA 4NENA 3V4RA 5HMMA 1JHOA 3MRSA 3UTCA 4E3WA 1N77A 1IVSA 1KSJA 3ND8A 4D46A 3LP8A 1ZK2A 3X1WA 2JFGA 3HSSA 1A8HA 2OHXA 1SKYB 2NSLA 3MCWA 1I8TA 3B6MA 4OUDB 2X1MA 4XWTA 3SFVA 4OQNA 3WL6A 2QYSA 4CKWB 5HZGA 3PUYA 4IDFA 2W8BA 3CNNA 3FGNA 3OZWA 1YZQA 1CDDA 2CEKA 2DH6A 3MHPA 4FSXA 1T29A 2GD6A 2XUAA 4X1YB 4UMEA 2HM7A 1KH3A 3RS8A 4RXMA 2XADA 1L4KA 1UIRA 2JFOA 1A2QA 1ZG3A 3EDMA 3P1JA 3QU7A 3T5TA 3N2YA 2ZQZA 4KKXB 4BP1A 3MINB 4O25A 1FS6A 3KCQA 4NDAA 1LW6E 5CDHA 2OM6A 1NFQA 4X61A 3QLEA 3L04A 1DX4A 1QCZA 2WG2A 3WFIA 5JC8A 2R1TA 4LOKA 4L08A 4CM8A 2WJ4A 5BSRA 1Q3HA 1A3CA 5C7LO 1WMBA 2VHZA 3N8DA 4DXDA 5J2TA 1T0PA 3DE5X 4B3HA 1W5AA 3UPTA 1FIUA 2IEZA 1ZM4A 3BAZA 3QU2A 1O4WA 1G4UR 4FNAA 4M9ZA 1Q0HA 2FZGA 4BVLA 1E6EA 1Q11A 4ZI3A 1Z5PA 3TKYA 2QI9C 5AI6A 4M1OA 4KQKA 3H05A 3LIPA 3BXGA 2BC9A 3B53X 2WINI 1LEHA 4IW3B 5DOZA 5FBKA 5FO0A 1RAGA 4J6EA 4CIYA 1OX5A 2Q6VA 3GJ3A 3FYSA 1CT9A 3NWOA 2DFNA 5AOBA 1N7GA 3OM1A 4KN5A 4ZT3A 4ZEXA 4EFMA 2VAMA 2H06A 4BKPA 3ZBPA 4DCJA 2ZTSA 3W2IA 1K6JA 1V2HE 3AI3A 4S24A 2G25A 3MNFA 1YS7A 3KKEA 4X3PA 5AIAA 2DFKB 3ROPA 3KKQA 1H66A 4R1OA 1Q7BA 5AKXA 1AUVA 2W0SA 3F6PA 4Q1CA 2RGDA 3FMFA 2PSEA 3L0IB 3ZH2A 4LYAA 4WGGA 4ON9A 5GADl 2JIMA 2ZUWA 2QN3A 2ZTVA 3O47A 4I4TA 3UQZA 4FYIA 5ALVA 4KQEA 5BN3A 3SC4A 1JX6A 1K8XB 1GGJA 5ETJA 4FFBB 1J8YF 3AB7A 3FNHA 2V7TA 3EBLA 4Z9XA 1J1UA 9ATCA 1OXXK 5FBHA 2QAGB 5AVOA 4L5CA 4RNDB 3QPAA 4YWHA 1NFFA 2RHBA 1BHJA 1UBCA 2VPIA 4RACA 3R3WA 3FGPA 4PZCA 4BNNA 3IQIX 3KR9A 1RHRA 3I09A 2Y1GA 2ODWA 2W2QA 4MQMA 1L4NA 3HUTA 4EMTA 3I42A 5K3BA 5TMEA 1TJ3A 4HS9A 4HEHA 1JDZA 3STWA 4O4IB 5U9CA 1WXXA 2I1WA 3Q3IA 3MMSA 4AF6A 1NVUQ 3H75A 5LMZA 4MNTA 3U2QA 5JJLA 1MKYA 4U2FA 5JNSA 1Y33E 3B2NA 1RI2A 3BPSA 3CZRA 2ZJ5A 4QQNA 4KHPB 1WU7A 2W6ZA 1ZI9A 3FUUA 1BN6A 3CGGA 4W63A 1L4LA 1QH8A 2OESA 5E3JA 2ZYDA 4CLOB 4DCGA 4EELA 3DAYA 3E58A 2R6AA 1M34B 4WLEA 4RH1A 1P91A 3RHTA 4EFKA 2FPSA 1VSUA 2E5FA 3IT3A 3UWMA 2GM4A 4KFUA 1J7KA 1SM4A 2XA2A 1PGJA 3F2IA 4Y1GA 5TB5A 5CHYA 3L2OB 3KETA 1LV7A 1CRZA 2DCUA 1M2VB 1ZGZA 3P8ZA 3RC2A 4N8EA 4RZUA 4PXSA 1B6SA 2UZAA 3KDAA 5DSXA 5B12A 4AYXA 4ZZ3A 2XY4A 2VH1A 3UT5B 3GLSA 5EINA 4R40A 4DZTA 1FXUA 5GMOA 2Y66A 4XUDA 4AWAA 2OFOA 5KWJA 3M6LA 3U26A 4D99A 2Q6KA 1WLSA 3Q7EA 4WY8A 1ZIDA 1FXWF 3IKMB 5JXGA 1ZR2A 2CUTA 3W7AA 4TQGA 1AGYA 3BYZA 3I1IA 3SS8A 3WGYA 3HSKA 1WXIA 2Z43A 1FS5A 1Q1EA 2ZT5A 3KQOA 3PNYA 3UF0A 2PKWA 4I6GA 1DAGA 5B7NA 4YRLA 4JI4B 4OQMA 3LPMA 2FSVA 2VHVA 4MW5A 1KZ9A 2NWQA 1VPTA 3BE6A 3HUFA 4FDLA 5ERXA 3KQUA 3SE7A 3GMDA 3KYCB 4GF5A 1VHLA 1Q0RA 3JQCA 3MAAC 3P9IA 2OE2A 4JJAA 4UNIA 5AJZA 1PV1A 5THXA 1IRIA 3L82B 2AJLI 1YA6A 2FG7C 4Q7KA 5EKSA 5EIFA 4XYLA 2QAGC 2MSNA 5KVAA 2CXSA 1MX9A 3IEUA 1I7SB 2WMYA 5ABPA 1COWD 1NMEA 2V6IA 1I36A 1TVMA 3CCCA 4NWIA 1AX9A 3K5IA 4BWYA 5IVKA 2YWEA 1SHTX 3JD3A 4AZSA 1V8BA 1WB4A 4HYQA 3WNBA 1T9DA 1NOKA 2JK1A 4AZWA 1OPRA 5EIBD 2B21A 2H7XA 1P7WA 2Y0PA 1X1RA 4BKRA 4D2IA 1LNZA 4M22A 4LJ8A 5KWEA 3BIXA 4IBOA 4BVFA 5FWYA 4US1R 1UP6A 3NHRA 2VK2A 2BFAA 3T1QA 3UV3A 3UAVA 4EF6A 5B57C 3HXMA 2ZJ3A 1JUDA 1IZZA 4GRDA 4DV6B 1GV1A 3OJLA 1XQWA 1JHUA 2PX0A 2VJPA 1IDN1 3OPYI 4Q34A 4I1IA 4HDMA 4YAFA 5KWSA 3HDTA 1MB2A 5CW2A 3O7WA 5CLLA 3ZZNA 2VF2A 3D3WB 4AVYA 4R4JA 1N6NA 3KS9A 1QQTA 3CBGA 2ZSIA 2NZXA 3OFJA 5JZ9A 5M04A 5IZCA 5A9SA 2YRXA 1BXRB 1LNSA 2DTDA 2C3YA 3HR4A 1DDIA 4ENUA 3TQRA 1DBIA 5K8JB 2N1BA 1EQ2A 3KHTA 3WDKA 5J2UA 3WL4A 4QDXA 3ABOB 3VR5D 1Z63A 2HPZA 5DHUA 3WX0A 1IH8A 1EK1A 3MAGA 4I5GA 1E8NA 2FSIA 3D1LA 3K8OE 1PTJA 3KQTA 3Q15C 3ZDRA 2AZMA 2O50A 2R6ZA 4TS9A 4DARA 5KKNB 1G66A 2WAMA 3K30A 3NI2A 1O54A 3ILHA 4HQRA 3K0BA 4CU2A 5IK2D 3BH7A 4BLQA 5JBQA 7MHTA 3CVJA 4M86A 2JJ1D 4MVJA 4MYRA 4NEGA 1E92A 4YRIA 1T36B 3A1CA 3PC2A 1A4XA 2YBEA 3VJMA 1DU4A 1GZ7A 1ZUD1 5LQNA 5CFQA 4XIIA 1SU6A 1H8ED 1Z15A 2QZ9A 4UHJA 3QQ5A 3QWIA 1VP3A 5DNYB 3HKCA 3NAGA 1ZUNB 3C3DA 1OLUB 3D6HA 3IAEA 5FX2A 4I8DA 4OLHA 1E2PA 1VLLA 2H4ZA 3EW7A 4PR0A 3TE6A 3ZE8A 1QHYA 3P20A 1Z4PX 3I8OA 3M4JA 2AI2A 1HI9A 5FFNA 1DAHA 4XWYA 5JTTA 4XQEA 2FI1A 4O2BB 5CXSA 4YRRA 3KJNA 2RGXA 1U8YA 2Q3DA 2PGJA 5B58C 2G9ZA 1GUBA 1XF1A 4R5MA 4Q5IA 3I6YA 1CV2A 3GJ4A 5FBVB 4Q4AB 1QV6A 5EZ6B 1CTQA 1Z35A 4EGFA 4IHKA 2QLBA 2WQZA 4JEMA 5FPSA 5EJ5A 3IAS1 4NBWA 1D4OA 1YFKA 1JR3A 2XGJA 2ZETA 2ZW9A 4G84A 1VHWA 1Z5GA 2F2TA 3SY8A 3JARB 2PUBA 4XGNA 1Z0SA 2J9YB 3NP9A 1QG2A 2ODPA 4O2AA 1GTVA 3VR6D 3BXZA 2K6GA 2PKRA 3GRUA 4HDNA 3RYTC 2UVPA 2E82A 2WMDA 2VRCD 5LKAA 1LW7A 1DFHA 4QUBA 4EARA 4YN3A 1QDUA 1R9NA 3IBGA 1Z12A 3G2QA 4IV5A 3MUEA 1H3FA 2YYSA 5CVVA 2FLKA 1HH4A 2W2PA 1RTKA 3TQCA 3Q40A 3JYOA 4WFKA 3F5SA 4ZMSA 4B3JA 3TXXA 2PWBA 3MGKA 4O08A 5GZ6A 5K0BA 4RA6A 5AXDA 2QMZA 1EP9A 1QE3A 1SXJB 5DGCA 2BKVA 3A6ZA 1YNOA 3WMFA 1L7XA 4LBYA 2B1RA 1JS1X 1HL7A 2W11A 4N6NA 1P0MA 3I9JA 2Z5FA 4HWSA 2LWIA 3LKZA 1E4EB 1SXIA 3L7DA 4YJDA 2QLFA 1YGYA 4HG2A 1R4MB 2QTFA 2JGAA 4U5XA 5IU6A 3LM8A 1GY8A 2GJAA 4LZPA 2HBZA 2GN4A 3DV2A 1YL7A 5E4YA 5AK3A 3S7ZA 1WVIA 4BFZA 1DB3A 2ZCUA 4EI8A 4JYZA 4DDUA 1CUAA 5JQWA 4S04A 4J1TC 3GPDG 4A9AA 1NYQA 4N5DA 3UJDA 5GQSA 4C29A 2VNKA 1Y4SA 4GEKA 3TTTA 2NIPA 5A4DA 5KIAA 2ZYAA 1SQ6A 3H1TA 3IEVA 3CLUC 1OBHA 2C4MA 2FW9A 2O9JA 3R8FA 4WKPA 4O1IA 1ZCZA 2P90A 4NZ9A 5BWOA 5DIFA 4KLRA 3I83A 2O1WA 4Y2YA 3ER8A 1KVUA 1NOIA 2DRIA 2WYWA 1GR0A 3DVAB 4I66A 1MOQA 2DR3A 2RKWA 1S8FA 4FKZA 4AMZA 4EAAA 2O6HA 2Z4TA 4J7UA 3ZOKA 4X7PA 3SLRA 3T7IA 1RQPA 4UQPA 4YECA 3ROQA 4BFXA 1MW9X 4RTKA 3ZJVA 3LOUA 4YJ3F 5MDHA 1KQPA 1C2TA 4MVJM 2BEUA 1IRXA 1FS4A 1Q77A 1RJGA 2C77A 5DIZA 2CL5A 3DTNA 1T2AA 2IXFA 2W5UA 3SZOA 3OMLA 3F6CA 2DECA 3I3OA 2X76A 3GLIA 1NBMD 4EY3A 4CW7A 4MS1B 1FFCA 5EQFA 2PUFA 4D1YA 2FQYA 2XR1A 2PO5A 3RC3A 1F2TA 3KZMA 3ZGNA 1JJBA 5JMOA 3OJFA 3GN2A 4D98A 3ZY2A 5ARCA 4IFBA 1R88A 4CTMA 4FFRA 1UMBB 1A2OA 2AYYA 1H2RS 4CIDA 1YRWA 3YASA 1N5KA 4KW7A 5GOTA 4CQJA 1HE3A 3JQ7B 2BBSA 1SXJC 1QRDA 1B6RA 1KDZA 4JD5A 2EX0A 1FJ2A 2ZAIA 3GAMA 1SMKA 2EW1A 3FN4A 1SKAA 1YQDA 4H59A 2F1OA 4RK1A 5JFTA 3TUJC 4M76B 4ZRMA 1IZYA 2Q5QA 1BRMA 1E4YA 4JC5A 2O7RA 2QW1A 5LP6B 2QTTA 3OURA 1RXYA 5C8DA 3HN7A 1GLGA 4XX0B 4X9XA 3AVTA 1YR9A 5A7FA 3AJ9A 3ZCTA 1JQEA 1OFUA 5FRDA 1WULS 3HCFA 3O2QB 2PNFA 2OD2A 1NSFA 1JR3E 1UPXA 2NTEA 3RVJA 5AJVB 4NYIQ 4UC0A 1ZH8A 1BDMA 4EEKA 1YZTA 4NTZA 3TD6A 5H02A 3LGAA 1CIPA 4KOEC 1IDOA 1ZMOA 2AQIA 2W90A 5TF4A 4AL4A 1NUHA 1K1EA 3NW9A 4JEIA 4LDQA 5KINB 2FPPA 1L5QA 2PRSA 1IL0A 1U2DA 3R2JA 1YC2A 5K45A 3C3PA 2O8EB 1UWKA 1JIJA 1EVIA 4WZAA 4BLWA 3STVA 1PLLA 4BN0A 4PN3A 5AFSA 4JUDX 1AH2A 1NBEA 2W58A 1M6YA 4FC7A 4RORA 3FCOA 1NBME 4C0AC 5E4TA 4IIGA 5F2NA 4G9EA 1ESCA 4PPQA 3QLUC 1G7RA 3H9UA 4WN9A 1OH7A 2NPIA 4PTLA 5LWQA 4B3GA 1EEXB 1BKYA 1IBKB 2ST1A 2ZRQA 4B4WA 1Z5VA 4EKIA 4Y6PA 1UXJA 5DXFA 1P9LA 1Z62A 1J0EA 1Q95A 1REQB 1N2IA 2YQ5A 1YFLA 5BSTA 1BMTA 1JAHA 3UY4A 4XUCA 3KUUA 5LSAA 1KO8A 1S0UA 3UHAA 1L2TA 4WSOA 3IDQA 3ZD9A 1SUIA 4WVLA 1XOIA 3DHNA 5BMVA 2CF6A 4QVKA 1G8SA 2Q6LA 4V0SA 2CBZA 2G36A 4Z51A 2F6RA 1PFWA 3KR0A 1ZK4A 4HZGA 3QVGA 2ID9A 1UM9B 3RVPA 4PY2A 2WFLB 1SD2A 5IAEA 3UMJA 2C78A 1NVFA 3WYAA 4Z54A 1L3CA 3QF4A 1ADGA 2Q45A 2DFTA 2H2HA 3GJSA 5CDYA 2P35A 2D6FA 3FMVA 5LP6C 1S96A 4BQEA 4DC9A 2IYFA 3AV3A 4W5NA 1BO6A 1ZCBA 2XE6A 3E18A 3JD4A 3L6RA 1G21B 3ORSA 4IIFA 3FCUB 3U9SA 5A6SB 4B9EA 2SHKA 5EHZA 1T0UA 2GJSA 1M2WA 1BKSB 1J49A 4ZHQA 2FP4B 1JWAB 4H6PA 2W4MA 5ER9A 3MWKA 1TE2A 1Z4IA 1JKXA 3LW8A 4MRSA 5BMOA 2FEKA 2X5XA 4GYWA 1E69A 4LRUA 3IAM1 1SKMA 5DWDA 2G6TA 3FBTA 5KJEA 4JLSA 3DQPA 3T7CA 4LBVA 2DUWA 1DV2A 4TTIA 3V6MA 2ZIXB 5CVEA 4AYWA 2YNMA 1A0OA 3SHOA 2QF7A 3V42A 1X2BA 1RWXA 2O2GA 2Q3FA 4H7PA 2I22A 4ND4A 4UTOA 4PYJA 2D06A 2E48A 3K6SA 4R2HA 3U44B 3P0FA 3W6ZA 5FT9A 1K0FA 4LNHA 4GYYA 3A05A 4JBIA 3R6DA 4QECA 5CCEA 3B1WA 3GP3A 1DBVO 3M70A 2AUMA 4W9RA 4AAYA 4C78A 5JNUA 4Y2XA 3NRJA 4HJXA 4WGFA 4XQCA 3SQOA 3UEOA 4WOKA 1JYFA 4DAOA 2O5CA 1WS6A 2IFTA 4GKVA 3COZA 5BSWA 4ZXFA 1IAQA 3E7WA 3FBGA 4S0ZA 1PSDA 2R85A 1O97D 1E79D 3PX2A 3VFDA 3R24A 3KE9A 5FHQA 1H3EA 3TF5A 3IXLA 4W99A 2UZ4A 1O57A 2PZ8A 2OWDA 4V3BA 1NONA 4N41A 3QX9A 2V6GA 3BRWD 3G9TA 4PZUA 2D7CA 1FY2A 1QAMA 1I33A 1ISFA 2GEBA 2ZUEA 1XZ8A 4G9BA 4BV3A 2Q9CA 3OIWA 4JBYA 2JAHA 5HFNA 3VNRA 1BEUB 1KORA 3U7EB 4PQGA 4U7FA 1Z0ZA 4R84A 1AURA 2CXUA 5LYYA 4RJ2A 5HM6A 3N8NA 1YZKA 3RYIB 5U4QA 2DYKA 1HYBA 4UU0A 5EJ9A 3L6EA 4YQYA 5BPHA 1FX0A 1YQ9A 2VPPA 4MYSA 4IXTA 3G0HA 1DAMA 1JEEA 2XB4A 1DFGA 1I10A 4N0MA 1E7WA 4ZVNA 3RIEA 1JDNA 2FRVA 1DAFA 3BZWA 1E6KA 2W7TA 3UK7A 2XDWA 1J5XA 4NYIR 3IBTA 1R0CA 3M6XA 1RRCA 3I64A 3K70D 5DRYA 2Z2YA 1PVVA 4JKYA 5IAGA 3T9CA 2IIQA 1GDHA 2J3LA 1XQ6A 2H7CA 2C94A 1UODA 4WASA 3SQMA 4E2XA 2ZDGA 1NOJA 5HCUA 5A1JA 2D2IA 1VMAA 4KFTA 5DF1A 2A4MA 1A7JA 1G8PA 1LVUA 1ZBQA 2XB9A 2BTQA 3KSZO 4V0KA 1G7SA 2ESRA 1A7AA 2GN6A 2NVOA 1KPGA 4IICA 3U1TA 3VGJA 2V3CC 4RDXA 4HMQA 3QBDA 1F9AA 1QG4A 3CPJB 2Z1NA 3QU4A 5IT9A 5ADHA 4LG1A 4RTRA 4PIPA 2FWJA 4IZOA 5LOVA 5TC4A 1FRZA 2Y9PB 1FUKA 4ILEA 1IC6A 4EAQA 5IWAB 1NM5C 3ESXA 2B78A 3M3DA 3BXOA 1LPBB 3NKVA 2VNSA 3MC1A 4B3SB 1K97A 2VO1A 1K5GA 2IK8A 5EI5A 2GZ1A 4E21A 3JSAA 4F96A 1UBHS 5LQMA 3C1OA 2RHJA 1A8UA 4GGMX 4FX2A 3FR8A 1ESZA 1CJKC 3LLSA 4QODA 2PMEA 2CCJA 2DUUA 1ENYA 1KI6B 2EZUA 3UJ9A 4R0MA 1QLHA 4N7RA 5G4KB 5HW0A 2BGNA 5CA1B 4FCVA 2H85A 4FHDA 4Y2RA 2H5EA 1KWGA 4KVZA 1Y80A 2Y4NA 3H97A 5TRTA 3WXMA 1H93A 1QYXA 1H94A 2DBZA 3O8BA 1J2JA 4IY1A 1HMYA 3FYTA 2VLBA 2AMJA 1HTWA 1P1KA 2C57A 3BH6A 2JLCA 5C5DA 2FQXA 2BOVA 1DL5A 2JFYA 3I3SR 2M9MA 4I55B 3DPIA 4TS4A 1SD5A 3I8SA 7ADHA 5L3SB 4O8CA 2JEYA 3LLVA 1JKJB 3X1XA 3HFRA 3IAFA 2VTEA 5T3UA 3TXAA 3WGGA 1M8PA 3ZHCA 1X3SA 1HFEL 2YZNA 1KPHA 4EO9A 4C4RA 3HWSA 1X38A 5F2OA 1QHXA 5FLXA 2BLNA 4J2TA 3RRMA 1PK8A 1GRNA 4KVGA 4MPRA 3U60B 3GVIA 3N7TA 1EG2A 3K32A 4BNFA 3DT6A 3JQ9A 3EA0A 3BMOB 4MV8A 2XWSA 1JH9A 1SCJA 3QBEA 4XIGS 3HNRA 3IP1A 2C5FA 1I4OA 1ZD1A 2O7SA 1GGNA 3RYFB 2PK3A 2MJLA 3LECA 4DHWA 3SIRA 5TT1A 1DAEA 2FQWA 2HF8A 1OGYA 2OCGA 2D1SA 3PPIA 4EKNB 3L41A 3DYBA 2OLKA 1Q50A 4G1EB 3CKLA 1DXHA 1MX1A 3KP1A 5FPQA 4HDCA 5G0WA 3KNZA 1F14A 4ODIA 1KRHA 2GK4A 3T61A 3LFTA 1Z8NA 2I34A 1KO4A 3OE7D 2WKRA 5IABA 4ZKEA 4LF5B 1DFIA 1PJLA 4KEAA 3NDRA 2VKTA 5AHXA 3IBYA 2WHXA 4IIJA 4KAFA 1ZOSA 4CLEA 1HDEA 4L76A 4LF6B 4YVFA 3IOEA 2BUAA 1MV8A 1MFZA 2O57A 3AUTA 2IOQA 3JZDA 3O75A 1Q7TA 2Q50A 1J2EA 3JQEA 4A6DA 1OAAA 2PS0A 4ER6A 3QUAA 4L6CA 4QGBA 1F9EA 4XGIA 4Q05A 4E14A 5AKGA 1DADA 2NVBA 1L5YA 2YXNA 3LUFA 1I4TD 4DR4B 3OM0A 4OA8A 3ZNOA 2H4XA 4U3JB 5C5EA 1NG9A 3O8OA 3E70C 2X14A 1TK9A 1EP2B 1TF5A 5T8KA 1VXRA 4H6XA 4TT3D 3U39A 5A3RA 4KPYA 3OEHD 3QVKA 1W581 2OBNA 3FSRA 4IUCS 2HLPA 1UBFA 4EL5A 1DOZA 1UBGA 1OGJA 1RC8A 1MEOA 2QPAA 1PZGA 4IAOA 1R4NB 1U0TA 1E1QD 4NE9A 3OKCA 3MUFA 4FYHA 3JWHA 2FPMA 3CQ9A 1J56A 1ZA2A 2BSXA 3DMDA 3IAXA 3OZ7A 1M5RA 3SHTA 2YYAA 3G2HA 1KMHA 2QTVA 1MAWA 3TUIC 3HY6A 3I2GA 4FFLA 5SZIA 5A4IS 2CT8A 1M1XB 4BBZA 2Z57A 3CUUA 4J75A 4MB2A 2P2LA 1UZNA 2EX1A 1NUSA 3WMGA 4UFPA 4YJGB 5E1BA 4K6HA 1G2QA 3JQAD 2OA0A 3TRKA 1BU5A 3PUXA 2QRVB 3A6HA 3HCDA 2YS7A 2C2GA 5BQFA 2DM6A 2QMYA 4EPVA 2D5AA 2PZEA 5LFAA 2OO5A 5JROA 3WYFA 4D56A 2VJOA 3NHFA 2UUAB 3CG4A 5FTNA 3GARA 3IERA 1NZDA 3ENWA 2I0FA 3OLCX 5DX0A 2BFMA 1T2NA 3KTAA 4PRLA 3U62A 4EGQA 3W5BA 4OH7A 3GVPA 2RH9B 3BD9A 4UNRA 5DKFA 1WX1A 2O8FB 4JJEA 2PR7A 2C98A 2HV8A 4LVUA 2BCGY 1OVMA 1NZJA 2XQIA 2NYUA 1EBUA 1U9IC 2R8XA 4MGYR 3A37A 3I30X 4AZTA 3DDHA 4O1HA 5ALDA 2BHTA 4MLPA 5CYOA 5LZ2A 5T4BA 1G16A 3RVOA 1WB6A 2Q3MA 1C80A 3R6WA 1B2RA 3FWHA 5CPBA 1TQDA 3P45A 3TLCA 1FDIA 1FJXA 5EIAA 4XWAA 2FN4A 5CLIA 3TZLA 1XDSA 5BUCA 2ONYA 1RYYA 3HU3A 2XCUA 1NW3A 3VDNB 3OJWA 3QEBZ 3X1DA 5JIBA 1PT5A 1X0VA 1YRHA 1HT1E 3D6VA 2QENA 3TZKA 2HGZA 3N8KA 3ZW7A 4JA0A 4ZC1A 4HRXA 5JS2A 2HQ1A 2IWHA 4HH3C 3W79A 1XJ5A 4ZEMA 4KX3A 3IL2A 1KI2A 1PG0A 2F1HA 4H7JA 4OV6B 5EGSA 4KB5A 3BJIC 4EHAA 1XRMA 1U3VA 2VHQA 3UBTA 1DKPA 3QVVA 1SCIA 3KB2A 4MZXA 1BWRA 4P82A 2ZJ2A 5FPHA 3RG2A 1JAZA 1SA0A 3HN2A 4KQGA 3DMFA 2GZMA 1U2ZA 2PH7A 5ELLA 2WTUA 4OLAA 3EUFA 5BSHA 1E6WA 3JV7A 5HS6A 1L8XA 4FFSA 5IKMA 5C7IO 3WHIA 3QSGA 5DLPA 3OESA 1ST2A 2IH2A 3GU3A 4G0MA 3S2EA 3IP3A 4L4XA 3UWOA 1O6GA 4JXKA 1QS0A 3EQ7A 4IDQA 3F8SA 4PC1A 5C37A 2QRMA 3MQ2A 4RNCA 3CR8A 3QXSA 2VKQA 1F2UB 1L8OA 1YB6A 3LBIA 4Y30A 2VPTA 4KR0A 3VVCA 2WKPA 3ANNA 3Q2IA 4WLUA 3MRXA 2IKQA 2P5TB 2PUGA 5BRAA 3RCBA 1R0KA 3B78A 3HG7A 5AHWA 3TLYA 2VEOA 2BV3A 2C58A 3KPWA 2MSWA 2FQQA 4DSZA 2AF3C 2HU8A 5K8VA 1MNAA 5BYAA 1GU1A 4WOBA 2JARA 3AYXB 3ABRB 4JBGA 4KBFA 4OAOA 4UNPA 1FU4A 4F3YA 1Y1PA 3E1KA 4DC1A 4NBSA 2ETXA 2H4WA 1RSZA 2J48A 2R1ZA 4WCFA 1L5LA 1XHEA 1Z9BA 3S2GA 5TMPA 4RTSA 2TYSB 2J59A 3DMNA 4NFLA 3VBEA 2PZFA 3ZJYA 3K9CA 1OTHA 13PKA 3C6MA 3AVXA 1K5DA 1E3QA 1QWSA 2R9VA 1TYAE 2IV2X 4ENSA 5AXAA 5EEGA 4YP9A 4KFRA 2WM2A 4DM7A 5ADVA 5IT0A 4RA9B 3R0JA 2PGIA 4TKVB 1X8XA 1WCIA 2XJ9A 1MTOA 1GPWB 1O3YA 2OK8A 2Y1DA 1UDRA 2P4HX 2HHAA 4G26A 4BO0A 3AHDA 1WV1A 3DSRA 3IAS6 3ZC3A 1GPAA 3GEPA 4RIFA 1SVIA 2HN9A 4J1NA 4ZICA 3IKVA 3QU9A 2C5AA 1X7ZB 4UPDA 4D3YA 1YZFA 2QROA 4GZ6A 4A1OA 5DK6A 2J5RA 4BJ5A 2YHBA 1P33A 2EHJA 3JRWA 4PLFA 3OOHA 4B4UA 4P7GA 1XEWX 3HZZA 2AMFA 2DOKA 4NK5A 5KHLB 4CUJA 2VCYA 3G82C 4Y2SA 3WK8A 5FYQA 5EWMA 5CXQA 5K4HA 2WIJA 1Z47A 4WW0A 5TY0A 1GUFA 2COKA 3DLIA 1WR8A 3FWZA 2C0CA 1S4QA 1YAJA 3FRIA 3F5FA 4H1WA 2I3BA 5JFGA 3P97A 2H59A 4F86A 1CUSA 3IPXA 1FYDA 1R00A 3DZBA 3H2IA 3UOAB 2X3YA 3D7MA 5LYJF 3OT1B 5GJWC 3D5TA 3IPYA 3IQXA 3ONEA 4ZYVA 4RPHA 2A7QA 4E4YA 3BRQA 2XZTA 4KIFA 4OQYA 4PFJA 3LHIA 4J16A 1UP7A 4CN8A 4HSEA 4F4IA 1Y6RA 3GGPA 4CN9A 4JXJA 2OXEA 5E2BA 1PO7A 1X1QA 3BL5A 2XD4A 2CY0A 1YB4A 1EAYA 1M8JA 2VYCA 2WF8A 4S1TA 4G25A 1GAJA 1WSDA 4PFSA 1GXSA 5DNCA 3K0AB 2RKOA 1SU4A 4QO7A 1I7NA 2WNIA 3R5SA 1E60A 4YJ2F 4A8JA 4QT4A 1Z7GA 4YRMA 1E6MA 4O4LF 2O2YA 5DU2A 5HFAA 2PN1A 1GTMA 1XMIA 2VQEB 4M8IA 4N5NA 3NP7A 4URFA 5ALZA 1RZRA 3SCZA 3COJA 1R8SA 3IESA 3L9WA 3EC2A 2WTMA 3GFVA 3NBMA 4MVJP 4WHMA 2FZWA 4X20A 4B44A 3PKZA 1RBQA 3OU2A 1C4KA 2WICA 1TJPB 2JI9A 3ZBTA 2XITA 4IVNA 3VM6A 5I6DA 3LUHA 1OPXA 2PZGA 2H8KA 2QSUA 2RHWA 3N2IA 2I6UA 2Z3WA 1GL3A 3R7LA 2Y1KA 1E64A 4D4KA 3QELA 3JD1A 4N0QA 1Y9EA 2CK3A 3RAEC 3KJFA 3QXHA 4C7KA 3A3OA 5AVQA 2JFFA 1VJ0A 2BP7B 2G9VA 3EGOA 5CR9A 3DT9A 3WK6A 5JCXA 1BCRB 4JKIA 4Y6RA 1NW5A 5KNCH 5ICMA 4TS1A 4KREA 2O4CA 2BMEA 1PK7A 4Y8VA 4QGGA 2O14A 5KYWB 1DG1G 1G6KA 3NVMB 1PEDA 1IOLA 1AUXA 3PFKA 4QJ3A 4NOLA 2Z98A 1MO6A 2GZ2A 4KGZA 2GYVA 5AVTA 3IHTA 3V8PA 3BCHA 1UC9A 4EBBA 1UDBA 3TZHA 5DWVA 3ZU5A 3B9QA 5DLDA 3TO5A 2CNOA 3CUYA 4BMVA 1ZXXA 1BYIA 1DEXA 4NHOA 1JALA 4E6EA 1W9MA 3VBCA 1OIXA 4LOAA 3T9AA 3WWPA 2CMGA 1DWPA 4D4HA 3UT0A 1RNLA 2UZ0A 2V58A 4A23A 2ISQA 2LKCA 1Q0LA 2I03A 3TQOA 3U16A 2JRLA 5I9IA 4BGIA 2I54A 4RSMA 1FPMA 3WIVA 5BQ5A 5LPNA 3GT0A 1XZIA 5D8DA 1QP0A 4KODA 5EHIA 1FFYA 3AT1A 2G76A 3DHEA 1V16B 1IBCA 3CLSC 3VPBA 3T1HB 3D6TB 3WJ7A 1A9OA 2BEKA 1KVSA 1AGRA 1JQBA 4F7DA 2FDRA 3VYRB 5K99A 5KWIA 1IOWA 1DIAA 1R0ZA 2ILVA 4LQ4A 1KDVA 2IEDA 3QG5A 3RHFA 3QPWA 4B0OA 4L8LA 4JLDA 3DFKA 3SYRA 3T7SA 1RACA 1JLLB 1WXEA 2PZJA 3FPGA 3LK7A 4OO3A 5EKUA 5HG0A 3THXB 5AJTA 4O3MA 1R5NA 2Q0HA 3W05A 2FW7A 3B5EA 3EGIA 2PJRA 4XE5A 2A1UB 3CZQA 3HRIA 3WA7A 1O96A 4XRRA 5SY9A 3ORRA 1YRYE 2DX7A 2XZPA 5JCJA 1P75A 4S1OA 1DEKA 1NW8A 4F0JA 4PG6A 1BE8A 4GKBA 1SHJA 4H1VA 3R8CA 2IHNA 3PEEA 4G0PA 1QWOA 4GM0A 2EIHA 1LA2A 1NE2A 1B3RA 4EF5A 2CZGA 3ZD7A 5EKXA 1J9ZA 4CM7A 3ET4A 4DG9A 2NV2B 2W8ZA 2HQSA 5K20A 2HADA 4V2IA 4DN6A 1D6NA 4DR7B 5KJ6A 2LD4A 1DP4A 5BVHB 3G9QA 4IGEA 1RPNA 3R7SA 4MO9A 3HNOA 1RKBA 1KYWA 4RD2A 1B42A 4XYEA 4ETNA 4M1WA 4DLVA 2Y8EA 1ZGBA 2NU7B 2XBLA 4LHEA 3H5VA 1XZKA 2C8KA 2H63A 4XLTA 1V39A 2C07A 3E9EA 1X19A 4KAXA 2YV2A 4EB6A 5BSEA 5KSZA 4BX8A 4Y7DA 1W2HA 4BRWA 2INGX 4DDVA 4WN3A 1VIAA 1T3SA 4LRTB 2DKFA 1D7OA 1N2ZA 1ZCFA 3D3JA 5HKKA 3A3KA 4RYDA 3TAXA 1NKSA 2B83A 2ZBPA 5L51A 6LDHA 3DE1X 2JGDA 3RABA 3RUFA 2OXFA 2D2VA 2KLHA 2NU6B 5K51A 1G59A 1VHQA 4A8TA 3S40A 4CF3A 3LBAA 1W5EA 3DO8A 4C0SA 3TKAA 5HZHA 1YZUA 2FHPA 1WZIA 2Q29A 4AS1A 6GPBA 1NMYA 1N3YA 2QLMA 2WT8A 4MJXA 4QPZA 3BSFA 4ZAWA 4AQDA 1NBOA 3PENA 3W5VA 2MTBA 2MMCA 1H2ZA 1N9ZA 3HZRA 4K1XA 1JXQA 2UZ1A 3RUPA 3ANXA 4GWLA 1QG6A 4PEVA 3A9UA 3KQSA 3HSYA 1N6OA 1TF2A 1JGTA 1NPYA 2X4GA 1DC5A 1G3IA 1ONNA 3TJMA 3ZDXB 4BLUA 1W7AA 2QJTA 4NESA 3STYA 2XDAA 1SXPA 5TF0A 5FTLA 2NZYA 1RKXA 1S2OA 1OBFO 4KSBA 4RW0A 2E6KA 1QF7A 4H2DA 1I7PA 4X3CA 4LJ5A 5E6UB 4CL2A 4CEJB 1DUSA 4RL6A 4IWXA 3SIPA 2QIPA 1SZPA 3L8ZA 3L05A 4HQOA 4MQ4A 4BNKA 1RWQA 2YDYA 4C1NA 3V5NA 3SKVA 2UYCA 1Q1AA 3USCS 5KO2A 4UASA 1ADCA 4NBRA 5EE1A 4E7OA 4D43A 1NJ2A 2JLBA 5IH7A 1P0FA 2HRDA 2O52A 4IDNA 4B6SA 4X1OA 2VCHA 1SCQA 3ZWDA 5F76A 3OZVA 1A4RA 5EEHA 3P7MA 4D8YA 4F06A 1KO5A 2CMFA 3NHYA 1UBKS 2VHJA 2ID8A 1ZIOA 3BL8A 4IIBA 3RK1A 3ABZA 1CVRA 4UDNA 4OQXA 1UMCB 1XTSA 5CX1A 3PXGA 1PZFA 1T3TA 3OLWA 4RMHA 5M2QA 4GDFA 1N33B 3KPJA 1UOQA 3PXDA 4PQYA 2QRUA 4QDZA 5C5CA 1WXHA 3OQPA 5B3AA 3VU0A 2NUAA 2ZUUA 3PFIA 3ZKWA 2WWRA 2XEXA 4DY4A 3PNOA 5CNIA 3ZZ0A 2YL2A 4X6LA 3HB0A 1XQXA 1XQ1A 3CX6A 3U3JA 2VDRB 3ZQKA 2WAAA 4P92A 2GWRA 5AVJA 1TKCA 1H23A 3LOQA 3OPYB 4XDZA 4RMNA 5TX7A 4BEJA 3ITNA 4JYMA 1GAXA 2BFWA 4XKJA 2MMGA 3R5XA 1IHXA 2J31A 4NBKA