4K3VA

Structure of staphylococcus aureus mntc
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
278
structure length
253
Chain Sequence
GKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure and Biophysical Characterization of Staphylococcus aureus Cell Surface Antigen-Manganese Transporter MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein
molecule keywords ABC superfamily ATP binding cassette transporter, binding pr
total genus 91
structure length 253
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA01
2X4LA 3AEKA 3AESA 2O1EA 5FLYA 2PS0A 4WZBA 5KOJB 2Q8QA 4CL2A 2OGWA 2XDQB 1ESZA 4HN9A 2OV3A 2XY4A 3AEUA 2R79A 4FILA 4H0FA 1QH8B 3AEKB 1M1NA 5JOQA 4WZBB 5KOJA 3R5TA 4WZAB 3TLKA 5BVHA 4UTPA 4MX8A 2Q8PA 5M2QA 3AEUB 1KAHA 4TKVA 3ZTTA 5BVGA 5KOHA 1QH8A 4INOA 2R7AA 5GGXA 2M6KA 1K2VN 3ZKAA 4ND8A 4G07A 1FP4B 2MINB 1L5HA 1M34B 4UDOA 5KOHB 4HMQA 1PQ4A 2QI9F 3MFQA 4HMOA 1G21B 2PRSA 2MINA 2WHYA 1QGUB 1QH1A 3G9QA 4XPIB 3AESB 2PHZA 1MIOA 4NNOA 4OXRA 3PSAA 4NNPA 4INPA 2XV1A 3MINB 4BBPA 3AETA 4M7OA 4UDNA 4XPIA 1H1LA 1KAEA 4FNAA 1M1NB 2RG7A 3U7QB 1PSZA 4FI3F 3EIXA 3R5SA 4FKMA 3UJPA 5JPDA 2OV1A 5M3BA 4WNAA 3EIWA 3AETB 3MWFA 4WESA 4G09A 1H1LB 4UTOA 2M6LA 3HH8A 4TKUA 3PDIA 3U7QA 4ND8B 1TOAA 1G20B 2XH8A 1FP4A 2ETVA 1L5HB 3BE5A 3HJTA 4WNAB 1K7SN 1N2ZA 4PM4A 1N2CB 2AFIA 4B8YA 3PDIB 4MLZA 5KHLB 5GGYA 3AEQA 2XQVA 3MD9A 5M29A 1M1YB 1QGUA 1QH1B 2AFHB 3HXPA 1MIOB 2PS9A 3NU1A 5JJ5A 5JG7A 3MINA 3LI2A 5HX7A 2WI8A 3CX3A 3AERB 4MO9A 3BE6A 4OVKA 2XUZA 1K75A 4WN9B 4GICA 2XDQA 3ZK9A 4H59A 3GI1A 4PAGA 4WESB 5CR9A 3AERA 3MWGA 4TKUB 5I4KA 5M34A 1G20A 4K3VA 4WN9A 4WZAA 5BVHB 4MDYA 1XVLA 1N4AA 4IRMA 1N2CA 5B58T 4TKVB 5BVGB 2AFIB 3PSHA 1KARA 1EFDN 3AEQB 4N01A 3LHSA 3K1AB 5CX1B 2OSVA 1M1YA 4OXQA 2PS3A 2YNMD 3ZK8A 2YNMC 4DBLE 1M34A 5AFSA 2AFHA 4HMPA 3ZK7A 5HDQA 4LS3A 3TNYA 4LJSA 3K1AA 5CX1A 1G21A 3TEFA 1N4DA 1K0FA
chains in the Genus database with same CATH superfamily
2O9JA 3JCZA 3AESA 4LOIA 4NMMA 2PS0A 3QUSA 4YAUA 4REQA 1ZBQA 5WRFA 5CH5A 4XRGA 5HRUA 2IVZA 5EQJB 4MQBA 4QAQA 4B75A 5JD4A 1PFUA 2BCEA 1OWPA 4JZYA 2GBIA 3W05A 2WWYA 4EA6A 3BREA 3LO5A 3CPHA 2C5BA 2ZYVX 3MF4A 4P7GA 1PQPA 1QLJA 3OZIA 3AJAA 4MS4B 3T5MA 4LZAA 3UMVA 2X8WA 2HHLA 3IR5A 3PQCA 2VPXA 4POAA 4UAGA 5IKPA 3KJQA 1Z9BA 1XMJA 4OA8A 1F4PA 1ETHA 2ZUDA 3TW4A 5G3ZA 4G0NA 3HKBA 5G3YA 4URZR 1RQXA 1NQAO 3CRZA 5E9WA 1MF7A 3UVEA 3VXKA 2C7RA 2ZOSA 3M9WA 1RWNA 4JEHA 3AT1A 3KU1A 2GZAA 1LBSA 3SN6A 4BNLA 2W8BA 3UAXA 2QENA 1Z29A 2XCOA 4LPKA 1THMA 3HL4A 2C59A 2QRPA 3AIMA 3RI3A 4F1WA 2EX4A 4RM2A 3S2GA 3G82C 3JXEA 5JLAA 4AY5A 1OFUX 2VSXA 5LYJF 5CVDA 3IIEA 4BBZA 1VB5A 2E2WA 4E5MA 5KJFA 4O8CA 3BGDA 4DCVA 5HP4A 1QV9A 4J03A 3KCNA 3Q11A 3QVOA 1BXGA 1I6LA 1PWEA 4I6JA 4WSOA 4Y1RB 2CZCA 4Y9DA 2WE7A 4H7JA 2KE5A 3Q12A 4RETA 1C14A 3K8ZA 3OTQA 2B82A 3SJ7A 1QG2A 3Q3EA 3HM2A 4FR5A 4JSYA 5G1OA 4DM4A 4CFSA 4DYHA 1JL3A 2WK1A 3V1LA 2C8LA 2QRQA 2GQ0A 1ZXBA 5DTIA 2J3QA 3OQIA 2AWOA 1WDWB 2AG6A 3V2HA 1OREA 2Q3CA 4MB0A 4UUBA 3VVMA 3TG8A 1IN1A 1SH7A 3OG9A 1P5FA 4OH1A 3PLRA 5TQ2A 2OBYA 1BVRA 1A5ZA 2I71A 3QBEA 5D5PA 2VJPA 4P1ZA 4E22A 1C9YA 1LLFA 1VIMA 3AR4A 4J07A 3UJ9A 3K6SA 2ZJ7A 3DZFA 1UIRA 5H81A 4RVNA 4C1NA 5LKAA 3TFOA 4DLAA 2J30A 1E3EA 2VH2A 3EOZA 4YTEA 3SXJA 1FJXA 3P94A 3U3DA 2RHDA 3K5IA 3RC9A 4UTRA 2I6SA 1TIPA 3LUGA 5FF9A 5B3JA 1FA9A 1XELA 4GYJA 2R6DA 4ASUD 1CEYA 2DJIA 5JZOA 5JXWA 2GCOA 5A4JA 1L5OA 1XX6A 3HDVA 2CVHA 5EWJB 1Y34E 3PNYA 3VSCA 1Z4LA 4I1RA 3MYRA 3PUVA 3ZQKA 2WYVA 3L6DA 1XNHA 4IDFA 4LC0A 4Y30A 2OFFA 2ZRDA 1F51E 4NENA 4NABA 1JNXX 1Q22A 1TGYA 2BE7A 1WUIS 2G1AA 2XQIA 3KWLA 1RKUA 4UAJA 1NBME 3WJ1A 3C5HA 5TVKA 3PSHA 2OV4A 1GG2A 1ZGBA 3RPEA 5EWMB 2Z8ZA 1WBJB 3RBVA 1KU6A 5ELLA 1P2DA 2CY0A 4OXQA 2VBCA 3EF3A 3M6IA 1GKLA 4IJKA 1IN6A 4FYKA 1RM4A 3H8VA 2Z43A 2IXFA 3N76A 4IXDA 5LKRA 1Y33E 3V46A 1JHYA 2GRUA 3AR7A 1XP8A 4YY3B 1IZ7A 3MCAA 3N0WA 3ORYA 4MYHA 5DCWA 1F48A 1YOVB 1GSIA 3G1TA 4AUNA 2ZATA 1OFIA 3WA7A 4LHSA 2ZJ2A 1RXYA 2O0HA 3O4VA 3HNRA 3L8YA 2AQHA 2R6ZA 3BTVA 4ZANA 4D99A 2X86A 4B82A 2ZJFA 1Y4AE 2FSUA 4ALMA 3BZWA 2WM3A 5DP1A 2AJBA 4L0DA 4YBRA 1MVOA 4DIKA 5JCPA 4H27A 2YHBA 1RP7A 2I9PA 1FBTA 2PUTA 4BXOB 4JXJA 4R3UC 1CUZA 3SOZA 4TYMA 3W9UA 1ZR4A 1BH2A 4GQAA 1R0SA 4Z4GA 3NBYC 1OV6A 3FTEA 2DFPA 2I87A 2L82A 2QLMA 4Q3OA 4ALNA 1GNRA 4D8VA 3GEHA 2ZR9A 5FPTA 4CTMA 1IWBB 3VISA 1NQ5A 1Q1GA 3QE3A 3A0UA 1ZAKA 4ZCPA 4NRDA 2UYYA 1DTWA 4EB3A 3IMCA 5LQKA 2VK2A 3Q7IA 2O3QA 3NBAA 3DDSA 5CM2Z 5GJVC 5JAQA 2WTAA 3G9QA 2O2DA 5D3ZA 5H9VA 2D74A 4PX9A 2EX1A 4HNHA 1HDXA 3V55A 2WWRA 4L76A 1VL6A 4BZZA 1QU2A 4WN3A 1TW2A 1W5BA 3LPNA 4MV9A 2XNDA 2D0OB 4JP2A 3G6WA 1WP4A 4H7HA 5LZ2A 2VSNA 2O5CA 4KN5A 2QY9A 3IDSA 4MCAA 2COUA 2NVUA 3BXPA 3O7MA 2UYGA 2EC5A 5KNBA 2RAPA 3O82A 2R2GA 3S1AA 5HHTA 3NTVA 4Z5XA 5DIZA 5COBA 3EEYA 3BL5A 4XDZA 4YJ3F 4LZWA 4EPVA 5KREA 4PYJA 1V35A 3ILVA 1R5BA 3H2IA 4CM5A 2I1QA 3B2QA 1FS5A 2ZBVA 2F43B 3TOZA 5JU6A 1X42A 1MN6A 2BGJA 2BP7A 3FE2A 5EIBD 1G8SA 2R62A 1FE8A 1J99A 1RYMA 2ZRCA 2Q6KA 4NLLA 4F97A 2D1FA 1YR6A 5IM4F 4LVOA 3AEQA 4QU8A 4YCDA 1DWQA 2OA0A 1G3MA 3T99A 3VSBA 3ZGYA 4AMZA 3ZCRA 4KUGA 3ANYB 5L6LB 1DT3A 2JA1A 3K0HA 1DJPA 1Y9DA 4PPNA 4YEDA 4EHIA 3ZIAD 1SOAA 2HRRA 2XLBA 1F2UB 1L5VA 1E7MA 3F8TA 4Q3DA 4M1ZA 1NWCA 1OXKB 3Q7QA 2B5WA 4ZOEA 4EQZA 3L7JA 4UFNA 1YU6A 1Z6YA 4NZPA 1CS4C 1E3WB 2ZFUA 3RJ5A 3GRRA 1H8HD 1O8BA 2A0UA 3G2OA 1DJMA 4ENSA 1DU4A 1VSUA 1SOWA 2FNAA 3AY7A 1QRRA 2VP6A 1TVMA 3D3JA 4ENWA 1I5OA 3NAGA 2A0FA 4KQ2A 4XB6B 1L4GA 3GFSA 5FADA 5HRAA 1X1SA 1AN0A 5C9ZA 4KPUA 2ZB7A 5LD2B 1JHPA 1NJ1A 1NF8A 3VGPA 2ZDGA 1L5GB 3BS4A 1SB9A 1T0PA 5ESXA 3BK2A 4U63A 1NRXA 4J6EA 4PZZA 4KXLA 1UBNA 3SZ3A 1F8FA 1GU0A 2X0NA 1NR5A 1TKCA 5HZGA 2TRSB 1D4FA 1S6YA 3MT9A 5L6MB 5HMMA 3M3DA 2WAAA 4G1BA 2A9JA 1YDEA 5SYAA 5I51A 2LGJA 1RYDA 1ZK0A 1XQVA 3RG2A 3VBEA 1RFLA 3EVCA 1JLLB 3TAXA 3ZQUA 1KORA 2GYUA 2XHEA 2C94A 4BNGA 4GW3A 3BXXA 3C7CB 1GAQA 4D8WA 1V45E 1BDHA 5DWVA 4UCXA 3M2TA 5EWJA 4LE1A 3UK7A 4BWYA 3GRKA 1MFPA 4PTLA 3CW8X 3O75A 2HA4A 2R6JA 1VHWA 1DQZA 2NUBA 4H0FA 4OF4A 1XTIA 2FUG6 4YRPA 3SMQA 5FJIA 3WICA 1QRTA 1JEDA 4YUWA 5DB4A 2VXOA 1OGJA 1C29B 3RLIA 3HWSA 2QG6A 2XCLA 3IUPA 4GOOD 5J1TB 1FX0B 4K9QA 2PMEA 5BVGA 2VR1A 5EKXA 4EHDA 3Q0IA 4HC4A 1A9XB 4UEWA 5F64A 1QB7A 5KYNA 1DKOA 6ABPA 2IPMA 1EG2A 1IDN1 2WD9A 4R0VA 5HDBB 3V2IA 5BUCA 1E3LA 2BFDA 3W06A 1BS9A 2OAQ1 4RGQA 3E84A 2F3QA 2YW9A 4HUJA 3CG0A 3GCGA 3GFTA 4D4KA 3LBYA 2PJRA 2B9EA 4KN6A 1BFKA 3ESBA 2WWVD 5HJEA 2M32A 2IW1A 1QH1A 5F9MA 2Z1DA 2A5DA 2NT4A 1MG0A 2QEQA 3OZGA 2P2LA 3E7PA 3DTTA 4EVQA 1QCCA 3B20A 3LKZA 4UVDA 4K9KA 4EW1A 4KEAA 4R41A 3GT4A 3KQSA 2V0CA 4RF2A 3K9CA 3RVLA 3BMQB 4JLNA 4B83A 1NW8A 1SUSA 4UUMA 3ZNPA 5CK4A 2RAUA 1AE1A 4NL4H 4AIIA 1TZJA 1ZA1A 2KSQA 2OV1A 2XIJA 5G0SA 4D7AA 4IHAA 3KR9A 1WV0A 1CULC 1IBCA 1RADA 5AHKA 1NONA 3SKYA 1LC3A 1VMKA 3AG6A 4IVPA 4KK4A 3WMWA 4J1TA 1KY3A 4XW2A 4V1CA 1U8CB 3RSLA 4PLWA 3DFIA 4DCCA 3NTLA 3GP8A 4DV7B 1I3LA 4GMGA 4AICA 1SZJG 4G5GA 2Y0DA 4UJ5A 1ODIA 2X9VA 3IMGA 1XZDA 2C7VA 2JHAA 1NI3A 4LF9B 3QXXA 3ETGA 5FHQA 1SG0A 3KZKA 1B8OA 4EFKA 1XEWX 4DLWA 1U11A 2PWAA 2VDUE 5HSGA 4UDYX 5DOVA 2WHQA 2VSOA 3LP8A 2B21A 1WSDA 3W2TA 1VZ2A 4H7PA 4LWQA 4C4PA 4R5HA 5IJ0A 5D3QA 3N7TA 4AY3A 1W29A 4EGSA 1CUIA 2UZ1A 2OKGA 2HJSA 1PJBA 4HB2A 4MCJA 4CDGA 2Q4TA 1GLGA 1HNWB 1IOLA 1W6UA 3QU2A 4H59A 1UFVA 1D1QA 2V6JA 4ZRMA 3WGMA 1IFXA 3H0KA 4F4FA 1QNFA 1V4BA 2RB4A 1TTQB 4OLBA 1JHMA 1N6IA 2PQ6A 3FIUA 5BW6B 4C4XA 2IKQA 1VL1A 4I36A 1ESMA 2ZQ5A 3NCHA 4CM4A 1ZJ5A 5DNWA 4RADA 4CETA 4DM3A 1SG6A 4X24A 4F21A 5JIBA 1D7AA 4BV3A 4FN4A 2IUSA 4FMDB 3IPYA 2XRFA 1RXWA 1B15A 3ZV3A 3D6FA 4I9FA 4WNYA 2IWRA 1XZNA 1YCFA 4WUVA 5GIOE 2OBLA 1ADBA 4KIGA 4BNZA 2BBWA 4AIRA 3V9AA 3F1LA 2ACWA 1VG9B 1BW9B 1RLOA 4M53A 2X9NA 1ENOA 2WM8A 3PNVA 4PEVA 4B48A 5AKJA 3UQZA 4B6OA 4NY1A 2BIFA 4RHXA 1IRIA 1W9HA 2X7HA 3GGJA 3ZWPA 4WBXC 2O8CA 4ZMRA 3W5BA 2V7QA 4IBOA 4ESHA 2J41A 3PG5A 4HDCA 2PWYA 7MDHA 5JAOA 3CVJA 4X61A 2Y1GA 2O7VA 2OV3A 2RHRA 1ZHOA 3IQHX 2WJ6A 1J7JA 3D1LA 1SUIA 1P0IA 5KS2A 1BAPA 3WIUA 3RVNA 1TLTA 3BCUA 3WLTA 5CBKA 4FDAA 1BU5A 3IOYA 5FLXA 3EIEA 5BSRA 3V4ZA 2VUHB 4RTMA 3AF3A 3SE7A 2Z2IA 5EE0A 3GEDA 1P29A 4HADA 4I5EA 4Y6LA 5FPYA 1JHRA 4BX2A 1C5KA 4QOJA 4RFSA 4BATA 1ABFA 1YS9A 4EGCB 4HNAA 4B71A 2Z08A 3OOWA 3SBXA 4GHWA 3UHPA 4E14A 1ZXXA 2IH2A 4D2IA 1G6Q1 3HO6A 2DH5A 3NWEA 3WWCA 2BCGY 4DRXA 2QTMA 5TIIA 3OJXA 4RAQA 1D4ZA 3I37X 3R74A 4ZV4A 3KCQA 1U1EA 2ODAA 1JLLA 2G4VA 2OFOA 5HFJA 5LQJA 5D51S 4UOEA 2JIRA 3QUTA 1UOEA 2RCNA 4IGAA 5EC8A 1W5AA 2V9CA 4YRLA 3AX6A 1PRYA 3H3XA 1EXDA 5FUMA 2OO5C 4D6PA 4K6OA 1DAKA 4U2FA 1WMEA 5KDDA 2CJFA 2GEFA 1LI4A 1PR5A 3LWBA 4YWHA 1D7OA 3RUHA 5HIAA 1NKTA 1O6FA 4RUKA 5F4ZA 1ZW6A 4GFDA 1DBRA 3CLUD 4HWGA 4Q03A 1PNTA 2H31A 3PGMA 3VRHA 4WCVA 1E5VA 3OKPA 4O5AA 1J00A 4CG1A 1C3XA 1JFVA 4PX5A 3GUCA 2ZI5A 4QPJC 4YQZA 4U02A 3SR4A 4B3FX 4EB8A 1DINA 4E33A 3D3EA 4EMBA 3A6FA 5AOCA 3NM6B 2RBGA 1RAFA 4TYYA 1WUJS 1G5IA 4IDGA 3T1YB 3X1XA 4HXFB 2QW1A 5E1BA 1ULSA 2I6TA 4FBMA 3DL2A 2EW8A 1C3JA 1IZ8A 3M4YA 1ZH8A 4QU0A 4YJDA 1H2FA 3UGQA 1W35A 4BKQA 3ND9A 3GLGA 2HM7A 2QJWA 3HUFA 3KYDB 1U8FO 2V54A 3WMFA 2IBTA 4FGSA 3E9CA 2REQA 4IH4A 4RK7A 5K51A 3SSMA 1XEFA 3VU9B 2LE0A 1KI3A 2W2PA 3LX8A 1ATIA 1CFZA 3RFFA 5KTRA 3B1XA 3N6VA 4KRYA 1T1EA 1SUFA 4DW8A 1I7SB 3PTAA 2AD1A 3FNIA 3HU1A 3E3LA 1Z68A 4XM0A 4FK8A 3EDMA 1Y9AA 5EWLA 2XCRB 2J9GA 3MM4A 4YJFB 5TNXA 2PFKA 3AUYA 4ZZ1A 1UBLS 3LXMA 3G0HA 4IWXA 1I24A 3SJAA 4KGDA 4FT4A 4EY5A 4HOYA 5C35A 4CEJB 2X5NA 1SNYA 1VE7A 1DQRA 4W8GA 1GIAA 1LGYA 2DGDA 4I5GA 2ZWOA 4LXIA 5F12A 4BQOA 3PGVA 3TQHA 5JAHA 5G1NA 4HWRA 3GLIA 5IZCA 4AW9A 2RI1A 2PEZA 4QUAA 5TT0A 3BSFA 1R12A 2V6MA 1CZRA 1G6KA 1YHZA 2MMGA 3EVTA 1I4TD 4MRVA 2PJUA 3NHFA 1UP4A 4FGZA 5LYJB 4RYDA 1QPZA 3DBLB 3GELA 4H6PA 4G0OA 3QFFA 4QG3A 4KOEC 2I55A 1JMYA 2HRCA 2FZGA 1EVYA 3NKVA 3NQ41 3NANA 3QY0A 3TUJC 4B6EA 4UD6A 1OILA 4Q37A 1E9DA 2QRMA 2OB2A 2BL4A 2ICAA 4DY4A 2Y27A 4JK3A 1T35A 1M8GA 5LOVF 4WN9A 4LVCA 5AW6A 4ZO7A 1B93A 4PU0A 4U7JA 5T7BA 4ZGGA 3MWDA 1CIPA 3WHIA 2LTAA 4X92A 3ETCA 4Q3LA 2R79A 1CDZA 4AZTA 3MGCA 4M9RA 4OOFA 4EW2A 1QIFA 4PLTA 3PCTA 1ODSA 4NPHA 5KOJA 3IRUA 2VRBA 3QEOA 1MZVA 1UZLA 2GF9A 2GEJA 2VRNA 5LQSA 5JQGF 3DAGA 2HC9A 3NR2A 4PZ9A 4UUAA 3ZU2A 1QH8A 3GFRA 2JEOA 2KLBA 4IIBA 4TTJA 3WC4A 1KYIA 5C1PA 1Q7TA 4XX0B 1KMCA 5AW5A 1A0OA 2FEKA 2VDKB 3TE7A 1YS7A 1YJXA 2I5PO 4FB4A 3W5DA 1XZCA 1NT2A 2H1SA 3P0FA 3V8RA 1W0KD 2BMJA 4P9NA 5I3CA 1EJBA 4O2RA 4OQXA 1E2HA 2Q0XA 3EFOA 2ZI4A 3MERA 5I4BA 1GM5A 2QUHA 3CTMA 3E61A 4QA9A 1KXJA 4QATA 2CNNA 1G2QA 3QA3E 3CCBA 1TXGA 1VOTA 1U7XA 3JWGA 1V47A 3DZDA 3T7TA 1H2WA 3CIFA 3FCXA 3WQBA 1JDPA 5C7IO 4DSZA 2B3DA 2B34A 4R98A 2BFOA 1SKYE 3F5FA 2WV9A 3D9QX 1Q92A 1NPDA 4LCEA 1XCGB 2BSXA 3WDSA 2CV1A 3SC4A 2VH5R 1I3NA 1ZMTA 1U2RA 1HDYA 3S7ZA 1KJIA 1QCZA 3ZJUA 4ETNA 1FRZA 1T3GA 4MI3A 3Q8MA 1T36B 3P0EA 3PUJA 3ZOKA 3BFXA 3BRWA 2XCTB 2JJ1D 1IK4A 2AOTA 4DIEA 4Q19A 2G25A 4S1OA 5BOSB 2X77A 2WOJA 4M54A 2GPSA 5KWEA 4AG3A 3LPAA 2IQ5A 5AVWA 1IAVA 1NRWA 3H16A 3KR0A 1YB2A 1YNSA 2AMJA 3QW4B 4GZ5A 2AZDA 4XTCS 1N1DA 5DOZA 1AF7A 2F1KA 3ACBA 1I7LA 1VHLA 4F84A 1FXSA 5DH9A 3KQQA 4P54A 5CT4A 3K0AA 4B3MB 2CWWA 1QKIA 1YH3A 4BV8A 1OH7A 2IOFK 1AKYA 3ZCQA 5DLPA 5ARDA 3H17A 4JB8A 1TYZA 3FYUC 4YS6A 1P2GA 3EDOA 2VZ8A 4PHHA 3K9LA 1QPGA 1J39A 4ZO4A 3R7FA 1VL0A 1XHFA 1C2TA 3KFXA 3KYJB 1W0KA 4JA2A 2CLKB 2RGUA 1QS0A 4IIJF 4KQKA 4PO8A 2H08A 4Y3UA 3WR5A 4BNFA 4DMFA 4P4SB 5B1DA 1HSZA 1GYQA 1OLSB 4G0MA 3V1KA 4TGLA 3CLRC 5EMHA 1JU3A 2ACEA 4K3VA 1JIJA 4ZI3A 4ZZ0A 3L8ZA 3DT8A 3WSTA 1G0OA 2YJ5A 4KYUA 4NF2A 3ZHTA 4H3HB 3UJNA 1CQJA 1SBCA 2QU8A 2PKXA 4IAOA 3ZE2B 1JDUA 3L6RA 4N01A 4BL5A 5LNK6 1QIHA 3CBQA 4RY2A 4RELA 3WRYA 2W2NA 4FKBA 5LP6A 3V8BA 5CFLA 1QDLB 4W8OA 1RZ3A 3KQOA 4GRAA 5JECA 1U8XX 3VAAA 2H4FA 3A11A 1ULTA 2JJ1A 2FPRA 4W9NC 4IQFA 1DQYA 4MX8A 1YUMA 4Y9TA 1VPDA 2B2CA 4AB1A 2Z6VA 2WFAA 3OD5A 4PS0A 3MMNA 4HQOA 2TMDA 3O1HB 4R54A 5K05A 3WL6A 3F7MA 4XWTA 5AI8A 2NPFA 1E63A 3K0BA 3V3TA 4KREA 4C0BA 1SUBA 3HDQA 3P97A 2NNWB 3KWMA 2DHQA 1RC0A 3ZV5A 3KZ1E 3OPXA 1T13A 4ZAGA 3UXEA 3GR6A 4LBYA 5IWCA 5BSFA 1YBMA 5JMOA 3D81A 3D0QA 2PCLA 1KNXA 2OP1A 3PKIA 2XE6A 5AUQA 1ZR2A 1GJRA 5AT1A 3L1VA 4WKCA 4IYJA 3UHJA 1RKVA 4XH9B 4TYNA 5K2OA 1NHGA 2E7ZA 3SJUA 4ZDKA 1DJNA 2F67A 4HNRA 3LTEA 4C4YA 2FG5A 3OM0A 1CNFA 2O7NA 3B5EA 3ESYA 3G0BA 4U2KA 2PYIA 3NYRA 4JLUA 3UWPA 4AAYA 3OA2A 4OV6B 1O96B 1MC8A 1BCSB 1R64A 4FVTA 3GMSA 3IEPA 4N0QA 4MUHA 2Z4SA 3MJDA 3PYMA 1AKRA 3IV6A 2ZE7A 1U0EA 1XVUA 4EO4A 2G6TA 1M7BA 3RYHA 1ZRNA 2Y92A 4IDCA 3UMBA 5CFOA 4KLNA 3OA0A 3CINA 2EZ4A 2LPMA 1E8NA 2DQSA 1H4TA 3OH8A 4RPHA 2GBCA 2QJFA 3A3YA 4MOWA 2AEFA 1ZJJA 4CKBA 3CRMA 3FAKA 2MSNA 2NG1A 1ZGHA 4LBVA 5HR5A 1Z7YA 1J97A 3PC8A 4MS1B 3OKAA 1AQIA 1YVUA 1YTLA 2E55A 4JJ8A 3PC7A 2B92A 1KI2A 1PYOA 1H8EA 3K09C 3IV9A 4P5DA 1JYEA 1Y6QA 1ORVA 3DEYX 3GEPA 2W11A 4MA0A 1P4AA 2DFNA 1Z2DA 4CNBA 1RKBA 1JQBA 5KJ6A 2XT6A 3E03A 3NXSA 5IJ9B 1VSBA 3ACDA 3K6KA 2ABWA 4RCVA 1JBKA 1RFGE 1KE1A 4IIGA 1G3IA 3BSYA 5JG7A 2BF4A 4O2AA 4UUPA 1H5UA 3PEUA 4PZYA 2Q0QA 3GOQA 3OZFA 1HZZC 5KPDA 4WT7A 3K92A 2P2YA 4Z0TA 2X0FA 4IZ6A 2W6ZA 5F76A 4X1OA 4BLWA 1DSSG 4BLQA 4JLSA 4BCDA 2B2XA 1BS2A 2P8JA 2OE2A 2RHGB 3GRAA 4MNTA 5ER6A 4KWCA 4DQVA 1KO1A 2XE8A 2CLSA 4NQZA 5IC6A 3TCNA 1JVBA 3ZVLA 5BVHB 1LCIA 4D97A 4ZQBA 4YAFA 4C7KA 1D2EA 1PGJA 1UMDA 2YMPA 4RQUA 1GKUB 4Y2RA 4AF8A 3DONA 1E1KA 1T4GA 1EBFA 3GLHB 1P19A 3C1TA 1LDBA 3AB8A 3MB8A 1XDDA 1G55A 1YOVA 5JCZA 3VPAA 5JHHB 4GM1A 5LWHA 3K31A 2FPMA 4MWDA 4BWGA 1B8PA 3LK7A 4OHRA 3OHPA 3DMHA 5A4AA 1WY7A 5CFRA 4PE5B 4NBWA 4OQZA 4DIMA 2QQFA 4CBVA 1E6LA 1YZFA 4MEAA 1GEGA 1XUOA 2WF9A 4LY0A 4OKNA 4TL8A 3RASA 1I3CA 1NYQA 2Q5QA 4A03A 4R5MA 1E2QA 2QAGC 4DNPA 1JKJA 5ADHA 2VQDA 5AUNB 4DHEA 4KHPB 4W5RA 4ROTA 3P9XA 1UBTS 1WHTB 2B4QA 4HF7A 4O4HF 5EKTA 3GJRA 2XF8A 4OM7A 6ADHA 4F12A 2GARA 1GTVA 1GA4A 3TQCA 4CF3A 3RSHA 3PC6A 3IQEA 3S70A 1Z34A 1MTZA 5DLYA 1GFWA 3D7MA 1ZSVA 4KYVA 3FOCA 3SYRA 1K6EA 4PYIA 1HKUA 4DDWA 3C0KA 3H4TA 2VAXA 1FXWF 3RVBA 4HMQA 3L40A 3MUOA 1I0LA 4LZNA 3CNLA 1QE5A 4QUGA 5ES4B 1E6KA 3AMVA 3DCYA 4PWZA 5KAMA 5JRJA 1BQEA 3RBZA 2AOVA 3CJRA 4H31A 3OWOA 4A27A 4XYLA 5JEDA 1GGKA 2IU4A 5J3JA 1U9YA 1U0HC 5BMVA 1EUDB 1JAXA 2PH1A 1S4MA 2YJ4A 5LA6B 3C4VA 2ZXFA 3EGCA 5AM0A 3CRNA 4KAAA 4RCZA 1SCQA 2RBEA 4EABA 2FWIA 3X44A 1TMOA 4YCLA 2BFMA 2NTYC 1II8A 4ER3A 3F73A 2CL5A 1M76A 2X1LA 1EJ0A 3TGPA 3GV0A 2EKZA 1K5HA 2WIJA 2WTXA 4PO3X 4UEQA 2GN9A 3R5SA 1OVGA 2X2OA 3TXXA 2NPOA 5DBOA 5JPDA 1QSGA 3C6BA 4PC7A 5FRDA 4OI1A 3I39X 1SU4A 4EB6A 3CLVA 1Y8RA 4DCMA 3B2NA 4EG3A 3TUZC 1KZGB 1VL5A 1BD4A 3PT5A 1L4NA 3DHNA 4WI1A 1W36C 4AUKA 4P4NA 3M49A 3VKUA 1Q0TA 1BXRA 3GJ0A 1Q1AA 4NKRA 2PRIA 1R9MA 6PFKA 4DRYA 4RH1A 4RS3A 3EDRA 4V1CI 3JYQA 2IF2A 3Q2IA 3Q87B 2FLKA 3J80A 4U8HA 5FBQB 4HQFA 2P69A 3EEOA 3PQ4A 2MSEB 2A5FA 1PVDA 3SSNA 3ZQ4A 1PFGA 4CLEA 4DSOA 5BORA 2IHKA 3FTQA 4D8XA 1C7EA 3FUTA 4BCCA 4DDMA 5IKXA 1QYXA 2WHPA 3DLIA 2GPYA 3DBVO 5ALOA 4MAFA 4MO9A 5DM60 3LUBA 4KSBA 3FRHA 1U8AA 1OZGA 4GOLD 2ZS7A 1UH5A 1AV6A 3HR7A 1MO5A 4N65A 2FVYA 3G89A 3L04A 5F1PA 2D6FA 4CG0A 4ARIA 2AE1A 4DTCA 2I2XB 1O58A 1GTG1 2V4ZA 1XTKA 2ZSFA 1IYZA 1YA8A 3IR6A 4OL9A 2YV3A 4ZK2A 1MRNA 1YBHA 1WMBA 4ITUA 4P4GA 5JXJA 2ZYHA 5K0LA 3EVNA 1BD3A 2PLAA 3IQWA 5KBYA 1ILWA 3O4RA 4A0FA 1EUCB 3K72B 1RHMA 3KHSA 3L06A 2Z5LA 3KOUA 3LC2O 4I3GA 4XFDA 4YMSA 5DO9A 3TW8B 2IYSA 4RE5A 3EXIB 5CBPB 3HTXA 1EU1A 5JS1A 5L3VA 4B44A 1O6GA 1TCCA 3LOUA 3NYWA 3A1FA 3WQSB 1ESEA 4QGAA 3LSYA 4MTCA 4NZMA 3KQVA 3RABA 1DUVG 4HRAA 3ZXIA 4CU5A 3TZ6A 4RABA 2NNLD 3ELWA 1L5FA 2E5FA 5CT9A 1QO9A 3WX0A 4NE7A 5BR8B 2ONKA 1UJCA 1ZZGA 4HLNA 1SIOA 2ZWMA 1PZXA 2O3UA 3BDVA 4FEGA 4KAFA 4TLCA 3W8DA 5KWIA 2QLBA 1S4QA 1HFKA 2CCGA 4II7A 1Q0UA 2DH6A 1X94A 2DWUA 3B51X 4W6ZA 4DR7B 5TJ9A 2XBUA 2R6FA 2V0NA 2HK8A 2DG2A 3P26A 1LVGA 1LTHR 2NUPB 3NBXX 1Z4MA 4PGHA 4RPJA 5REQA 3TQSA 4EELA 3E9NA 1BMTA 4V02A 4C0SA 4BRWA 2RHHA 3BZBA 1ONSA 4PLYA 4B2YA 3MCWA 3HO8A 3NAMA 5DKFA 2CHFA 3DZKA 3V1MA 5JV5A 1KIAA 1Q7CA 1QYWA 3HPRA 5JTTA 3G3EA 4EG6A 1PQWA 1M1YE 4IF4A 2IEDA 3A4TA 4RFVA 3TN7A 1U7ZA 1CVLA 3QHQA 5K20A 1SCAA 2YN0A 2G77B 1Y81A 1B2LA 1UJ6A 1WB6A 2M6SA 3E3NA 3IBFA 4JXKA 4EF5A 1JFSA 4LWZA 4ISBA 4LZOA 4NFYA 2YZ2A 2WNIA 5JSZB 5E7JA 2QA5A 3CF6R 1Z6ZA 3OWHA 3QK7A 4RVGA 1TIKA 4B6QA 1M2GA 4US2R 3IR7A 1HDCA 3BTUA 3NHKA 2AS0A 4X20B 2YFKA 4XPZA 4B9EA 2YXEA 3Q9LA 2RHCA 3PJGA 3QWBA 1I6WA 1S2DA 1Y1PA 3PQ6A 3QJYA 3EAFA 1LDEA 2RCYA 1F1JA 2Y1EA 3TD2A 1U98A 3Q5GA 4MR7B 1UWVA 3W6PA 1NE7A 4J1TC 2J07A 4P0TA 3RYIB 3STVA 2H07A 4JFRA 3GJ3A 1NMEA 5I5EA 5K0FA 1E59A 1PTJA 4ZO8A 1ZUNA 1OC2A 1GNTA 3D0OA 3M3PA 1JAHA 5I5GA 2HSGA 3OZAA 1XMOB 3NBKA 4LTNA 4ILKA 1E66A 1NQTA 4Z4IA 2P77A 1IXZA 2ZBDA 1WXXA 1SPXA 2WV7A 2GVDC 3AI1A 3I30X 2GVZC 4PFQA 2PTHA 4H6XA 3PQDA 4HGOA 1NLYA 3JALA 4BDSA 4DCUA 2NXCA 5I7EA 1GR1A 5I4CA 5KMGB 4L85A 4FX5A 5TV2A 1KETA 3COZA 2YVAA 1NMXA 3DFKA 3WRWA 3HB5X 3SC6A 5A4KA 1N8NA 4N3GA 4ZPXA 3TG2A 2QT9A 3AI2A 1ECCA 4O4LB 3MTBA 4BQNA 4CG3A 1G1AA 1NY5A 3NOXA 5DFAA 5K8VA 1GPBA 2CMHA 4A0SA 4PSDA 4HAIA 4DABA 2EV9A 4HAZA 1ZK3A 1GTL1 1NBEA 3RD5A 3VTAA 3JQRA 1I7QB 4JODA 5CCEA 4LDRA 4BNMA 1DEKA 2O5EA 1YRBA 4MV6A 4IV8A 4QTTB 4YLEA 3RC7A 4V0QA 4UCWA 1SA0A 3LV8A 3RRJA 3WBBA 4D4LA 1F2VA 3GJTA 1O6BA 3K2EA 3GD5A 1TCBA 2SNIE 2C3OA 2X0IA 4MV1A 2P5SA 2DMRA 1FFSA 1SG9A 1SBIA 4REQB 1YZNA 2Q4BA 4OQDA 3KYCB 4IGFA 5BNTA 2ERCA 3O6VA 5JEEA 1D0IA 4YI3A 5K3FA 4CF4A 4X00A 5C1BA 2H9AA 1XF9A 3HLKA 4JC4A 4N54A 4UMVA 1DG3A 1X8JA 2Y1WA 3EZ7A 1HM5A 1Q3TA 3GPDG 1OB2A 4X94A 3AEZA 3UV3A 3PZBA 4YBZA 5ICCA 2F6RA 3A6LA 3LLMA 3BH7A 3PFBA 1I80A 3PHLA 1Q1NA 4GBED 4IIEA 4MB6A 4BPRA 3ZDDA 1RLMA 2QSUA 2B94A 2XB9A 3HKDA 4CCYB 4CFYA 2I8AA 5G2OA 1H0HA 1XDBA 1GZ7A 5BWNA 4NU0A 1J5EB 2GESA 2QTFA 4YR7A 4Z9FA 2VDNB 2FMXA 4L9SA 4BNIA 1WXGA 3MHTA 3O3OB 4LGCA 4PN7A 1JHAA 2DCMA 1S89A 3TTUA 2J3DA 2UXCB 4HDQB 4GQIA 1AUQA 4BVHA 1TA0A 2XI4A 2EW1A 3A2LA 3IVXA 2QJOA 2NVWA 1S01A 2LWIA 3PQ7A 3RKRA 1PQ4A 3B13B 1FUKA 3V4PB 1N2EA 3MBIA 4DN6A 4BFTA 4B3CA 1EFPA 2ISCA 5AJZA 3EX7C 3U5ZB 2DEUA 3JATB 1Q1ZA 3WB1A 1Z2OX 1YASA 2GVNA 1WWKA 5BN1A 4BLTA 2P78A 2REBA 3DV9A 3EIFA 1Z5OA 4L0QA 3AF1A 4PZCA 1CJUC 2QP4A 2XQFA 1MCZA 2CNBA 1JMKC 1U94A 4TXLA 2OD2A 4CM8B 3DP9A 3EWNA 5C53B 3QVSA 3BERA 4H4EA 3P9IA 3BFKA 2NUPA 1YWGO 4I50A 1X70A 3C6XA 4TWBA 5JAIA 3OLWA 4ND3A 5CIQA 5BRJA 2PZEA 3TQRA 3WIDA 3EMKA 1WCWA 4UVGA 3JQPA 4XX0A 5TS3A 4KVFA 1DRVA 4YRDA 1R0WA 1OQAA 2FP4A 1XZKA 2X4GA 1TW3A 2D5BA 1CB0A 3QF4B 4D8YA 4D56A 5JXGA 1DVRA 1JG2A 1EHIA 2A4KA 1DC3A 3GRYA 3L43A 1P1KA 2QVGA 3DEAA 1HT1E 3OPQA 1DO0A 1XD8A 2W00A 1FBNA 2PK3A 3L8MA 2OCGA 3CLTC 3OCVA 3IQGX 4MJLA 3EN0A 5IAKA 2BGTA 5T4EA 3DLTA 3CH6A 3W7BA 5C7OO 5FAKA 1WLSA 3FPBA 2HQBA 1E9FA 1K3TA 4JH0A 3VVLA 1J6UA 1KA9H 3ODPA 4TVSA 3LCUA 4NMWA 3IBYA 3O4FA 4KQIA 1IPHA 3B8EA 2X0EA 3ZWXA 3QLTA 4HZIA 2G83A 4MLPA 5DXJA 3K53A 4ME6A 2JJYA 4TT3D 4N5MA 4IKOA 1JJAA 1W76A 2HLHA 3Q72A 2YQ5A 1AD2A 3OBBA 2YWBA 4PO1A 1GGFA 1V26A 1Q0HA 1J1UA 2INGX 3ICEA 1F8UA 1N5LA 2HREA 3TRDA 4EBBA 4HUQA 7YASA 4PQEA 3OLCX 2XWJI 1Z3IX 3WSVA 5FOWA 1QVVA 1XTJA 3WOHA 4EB0A 4GXQA 2FWNA 4DA4A 1TPZA 4G2NA 3FYUA 3SEAA 3IUBA 4TMXA 1UT5A 5HUJA 3E8MA 4P35A 4R01A 3JVVA 5FPQA 4MTLA 2BFAA 2XCIA 2IYUA 2WE8A 5DHUA 3FVVA 3VJLA 4LJYA 2VP4A 5ECYA 4ZEXA 2Q41A 3G9TA 2HA7A 1DXHA 1COZA 4B7XA 1KY5A 1RYHA 1Z0SA 2H29A 5H0IA 1NNLA 4DMLA 2XRZA 1J33A 4W5WA 3QY9A 2XXAA 1J06A 2Z56A 4OJYA 4XCVA 1HDEA 4JBXA 4DNQA 4XSVA 2QP9X 2WWIA 1GV1A 2JFQA 1KQOA 2WKSA 1EP1B 1XWFA 2G08A 2XD4A 3LVRE 1A9OA 2RK3A 1BXGB 3EOAI 5K3SA 3SBEA 1U0JA 2BR4A 2VJDA 1WPXA 4YCJA 3MK31 2ZSJA 3AEUB 3SIXA 3KX2A 5HQTA 3TD9A 1N6OA 4TRRA 1Q6YA 1KFCB 2RAVA 1NOIA 1V37A 5H1YA 3WHKA 4BP9A 5BW5A 1WXFA 3ROGA 4FJ2A 2EWWA 3LUHA 4TMTA 4NDNE 3ZU6A 4HEJA 4CLOB 2XUPA 4E2WA 4Q6WA 3RFUA 4LNAA 4NEQA 3W78A 5B3JC 1HNZB 5B55A 3LRXA 3BJMA 3D8NA 1UANA 3JRWA 1T6YA 1MAWA 3H2GA 5KO2A 2O20A 3EZ9A 2ZS8A 4R81A 4UJ3A 4CKYA 1FLNA 4MGKR 1GL9B 1O95C 1P74A 1X19A 2C1XA 3WLLA 3T3NA 1V5IA 3GT3A 3PDJA 1T5HX 4F46A 2QVXX 1FSFA 2ZKLA 5FOXA 4Z9YA 5K0ZA 2HMTA 3D8UA 3R5FA 4MMYB 5ALTA 4DCTA 1CUEA 3S1SA 1WU8A 2CSUA 2QE6A 4G84A 4K2AA 4MWTA 1NVFA 2IT1A 2JI9A 3FGZA 2VZLA 4FLEA 4L0CA 4QJIA 5AIAA 3NATA 3BRQA 2X8AA 2C2HA 2C07A 4IRXA 1T0JB 2YN2A 2ZI7A 1DQSA 5ECWA 3TLJA 2LR0A 3F74A 3HHEA 3JVEA 3GLFA 1IATA 3DV2A 4HDKB 1XBTA 3S1AB 1PK7A 4FT2A 3L7IA 4E46A 2H57A 4E94A 5DGIA 1JDBB 2MDTA 2YV2A 2PQMA 5IDYA 1ZD3A 3C3JA 4M0EA 3C24A 3IP3A 2PZAA 2IZ6A 3TL6A 1WZNA 4D81A 3UW3A 3KSDO 4PRZA 2PT5A 1F20A 1P8AA 2QNIA 2ZRJA 5AM4A 3R6TA 1BFUA 2IYEA 4MRSA 1QIJA 2ZJ8A 3BK1A 3G0DA 2YW2A 2VJQA 1QRDA 4XARA 3IE1A 4NSNA 5FBLB 1XPUA 1UR5A 3R0QA 5BQ5A 2C7QA 3Q2OA 3ZE1B 4KR0A 4CODB 2VTBA 3ZJVA 4MVXA 1OZ0A 2YWGA 4L4XA 4X6XA 5DYYA 3GA5A 4HB3A 2IHJA 5EL0A 2JGMA 1NVWQ 4I50B 1JU4A 4PHGA 1R00A 3WIBA 4LF6B 1DGQA 1XPOA 2Z9DA 2NU7A 3F3MA 2XYQA 4H3SA 4I5FA 2F3TA 4NNJA 1H93A 4UU1A 1NSYA 2WW8A 16PKA 1P73A 2R1VB 3OICA 4YA6A 3MJHA 4DM7A 3HKCB 2J33A 3W5UA 3QENA 2RMKA 3RBXA 821PA 2CL7X 2CDAA 1SKQA 5CXXA 2ZAMA 3W34A 2J9FA 3U39A 3I2JA 5DYWA 1CLUA 2B4KA 3FCOA 4XUCA 5AVSA 3PBKA 4TUYA 1M8FA 2GERA 4QE3A 1YJCA 2HWWA 4LDZA 1NQXA 1SXJA 2OAP1 2YQZA 3B1ZA 1YBVA 2CNWA 4XIGS 1TF7A 3WL5A 9ATCA 4FCWA 1EUYA 3BXOA 3UK2A 1DOHA 5FI3A 2XE7A 2I2BA 5ENVA 1FTGA 5KINB 3PXBA 2WVGA 4FFLA 2XE4A 2JLBA 1WJGA 3H65A 2A30A 3CC8A 4DUYB 5ICGA 3HC7A 1JJBA 3MJVA 2Z5GA 1I2AA 4G5RA 3ERCA 2BEKA 1K7EB 3DBRA 4J0KA 1KYYA 4UAUA 3RS7A 2X0RA 3RRYA 1HTWA 4CMBA 3D8BA 2WTMA 4DS3A 2FSFA 1RJDA 3OOJA 1A4UA 2HCRA 3OSZA 1AKQA 1U3WA 2R66A 4F1KA 4EG0A 3NRJA 3ZDRA 1WZEA 3WGUA 1SXJC 4AU1A 1P80A 2VQ3A 5K99A 4J0GA 1FSPA 3LOPA 2G1UA 3WLAA 1F6WA 1HK7A 4DA0A 1ZD1A 1PN3A 4QEKA 1QTQA 2WPNA 3LF2A 5BT9A 4UPVA 1IBRA 1YZTA 4LRWA 4YI5A 3DF9A 4JGGA 4AZVA 5FPPA 1UDCA 3OEWA 1HUQA 1V96A 2QRJA 2JBAA 2HKIA 3NXKA 3DDOA 4HDMB 2AN4A 1G6OA 1LRLA 1P4HA 4ZKDA 3FZNA 5CW2A 4PGFA 1P7VA 4XOIA 1CYDA 3ZBTA 2C58A 1DT5A 2PZGA 2ZRIA 3KQYA 1G38A 4M7OA 2M9MA 4A7PA 2RH9B 3RB8A 3A1UA 4ZZIA 1CXZA 1OC4A 3LL7A 5E95A 7ADHA 1F06A 1GPH1 2ZW9A 3C3XA 1DC6A 5CIWA 2PMBA 1LF5A 2P6PA 1XPJA 2XAUA 1OV4A 3ESCA 3K4PA 3QX3A 4LOHA 1SCDA 3LXRA 5CPFA 5THKA 3PEVA 4JYMA 1WMSA 3C6ZA 2A59A 4PM4A 3PLNA 5LDHA 3R9XB 1OU0A 3KJIA 3A10A 4CKXA 1VYHA 1JDTA 3M70A 1DJLA 3QH4A 4MS3B 5EP2A 2AKAB 5DMHA 1UJMA 2WF7A 5F1YA 4FLMA 1F2TB 5B1SA 1KC3A 1E4EA 1YK1A 5FI1B 2RHBA 4B3BA 2HNAA 3OO0A 4UXHA 3PD7A 1GPLA 2LIPA 4K0RA 4MUGA 3X3HA 4CW7A 1TYCA 5DN6D 2XB2A 1RBMA 3HJNA 1E2IA 4B35A 3WDLA 5HZKA 2DHDA 3Q8WA 3A2NA 4G63A 3EZNA 3E23A 2WIAA 4OK5A 5JI2E 1M0EA 4UTZA 2XDWA 2EW2A 4ZXFA 3UJ7A 1IWOA 1YVRA 2BGGA 4IHJF 4LOKA 3OF3A 1LLUA 1E3SA 1HOXA 3AR6A 5DHPA 2B8TA 3ZHVA 5A6SA 4Z4QA 2Y2VA 1JS1X 3KDAA 2UXBB 1XJCA 4OQNA 1MABB 5BN5B 3FWHA 1P62B 4JELA 1XF1A 1AS2A 1QB8A 4PHCA 5CDFA 2VDLB 3UHAA 3GRVA 2WJYA 4HQ0A 2WUEA 1XTQA 3CWCA 2ODNA 4D0RA 2JD2A 2IDKA 1NI4B 1E32A 4KK3A 3KWJA 1A8QA 4R1LA 3R24A 2UU9B 1OB5A 4MI9A 1NC3A 3GZTB 1DNPA 4JUBA 2WFZA 1NDQA 1RI3A 3DFZA 3PWKA 2VNAA 2GM3A 2ID4A 4QQNA 1RE0A 5F3DA 3PLAE 2HV8A 2HRQA 2JD0A 1B23P 3ENZA 3OZWA 3G7UA 5AI5A 2FG7C 1YCDA 1KEVA 3MRXA 4KXYA 4ZVMA 3TMYA 2JK1A 1REQB 3RS5A 1KY2A 5F7OA 4KQCA 3T5GA 3CNHA 4E2FA 2R86A 3OSUA 4FCVA 3EIHA 1V43A 3HGMA 1GAJA 3G23A 2A86A 2A3NA 5DN6A 4DKXA 2HIGA 4A8TA 1JZQA 1X7XA 2ZBFA 3JPWA 1L5MA 1T1IA 2ARKA 4WBNB 5J4LA 4CGZA 3DAOA 3RWBA 3AVXA 4B73A 1RM3A 5EUCA 2WP0A 3PPWA 3C6QA 1E6WA 2OAGA 2D4HA 5LYJA 1DIGA 4UNRA 5DHTA 1WZ2A 2F1IA 2ZDQA 4PW0A 3TZQA 4KNYA 1BGWA 1ND5A 2PANA 2QUBA 2D3WA 5A04A 5KEIA 2LD4A 3LQKA 3Q5EA 1JIKA 1YI1A 2UV8A 5ALYA 2FMHA 3ZHOA 4INZA 2GLTA 1HT2E 3GNSA 3QJGA 3NPAA 421PA 2EKDA 3PXEA 1V9SA 4BQFA 3WAJA 4F6LA 1AZSC 2C4VA 4XQ0A 3EGWA 4IICA 1YI8A 3QMPA 2IYOA 3WGQA 1W52X 4A16A 3FOFC 2RG1A 3S2SA 3A3PA 5JY6A 4QFBA 5CM8B 3TOXA 2FR8A 4IEEA 1Z74A 1RCUA 1P2BA 1T5BA 1UBUS 5HE8A 3K7EA 3H9BA 4UE3S 1N5DA 4CIYA 1PX2A 2QD1A 1PZHA 4XQ9A 4XSGA 2IW3A 2O8VA 2ENWA 1WVMA 2H4ZA 2FWAA 4B6FA 2PSEA 3GH3A 4IWNA 3STUA 3ZD6A 1DG1G 4KNWA 4UBNA 4AZ0A 4CMIB 5BUQA 1PJSA 5BWMA 5K09A 3RTBA 2HT6A 1XA3A 3FUXA 1A7UA 5H80A 3K96A 5CAEA 3SFVA 3FPGA 1ZYUA 2XB6A 3EFOB 4R1SA 5I9LA 2BKXA 1PJLA 4JEUA 4O2BB 2WPDA 1DDIA 4FYVA 1WUKS 2VVTA 3AHHA 2I67A 3BMCA 3AKZA 4OX9Y 1EVJA 2J6CA 3LE8A 3NT5A 3IXMA 3WL8A 4NICA 4IZOA 2HN9A 4F6RB 1A7JA 5LDDC 1QOZA 2A1IA 1XTSA 3VPSA 4IKEA 1GPDG 1A8HA 1TYAE 1X1TA 1KMHA 4OSEA 1PD0A 4B09A 1ZUWA 3QE9Y 3A8TA 2C2YA 3Q7PA 3CWZA 1KYZA 3ISTA 4GDMA 4TWIA 1XL0A 2BEVA 4MGEA 2HGSA 1V6CA 2P7HA 3WI7A 1GL6A 3ZWWA 2EHDA 5F9FA 3WQHA 5H8WA 3NC4A 2IV2X 1WXDA 4HQKA 3QELB 3ESRA 3TB4A 4RIIA 4INJA 1GCUA 2FH5B 4KSYA 1N3LA 1NKVA 5TEWA 4CV3A 4YQFA 1EB9A 1BMFD 3E5RA 1OU4A 1JLRA 3IUJA 3SVZA 1Q11A 2Y76A 1EA5A 2XYRA 3AL2A 4LWPA 4O63O 4C0QC 1O5OA 4QGBA 4EBFA 4KPEC 1QNLA 2NXEA 3H5WA 2FEAA 1HMYA 3H3JA 1J8MF 1Y8AA 2W8ZA 1IHYA 1HOTA 2ZUUA 4N1AA 1GGVA 1ORIA 1DEHA 4NYJR 4E5DA 2CF6A 3A58B 3B12A 3FNQA 4C3VA 2JLZA 3VNSA 2WUFA 4HDMA 5IVHA 4HLUA 1HDRA 4MCHA 2EKQA 4KWTA 1LBTA 5FWAA 4YREA 3UGTA 3B6IA 3A1CA 2WT9A 3I01A 3TZBA 4Z53A 1TQHA 4JBLA 1U0OC 1C3OA 3LFTA 2V7TA 2HRZA 2ZB4A 5DGHA 3TTTA 1DI0A 3C7AA 4Y1FA 1Z7BA 3G85A 1Z8FA 1VLMA 4YACA 5JHGB 1ZCJA 3QX8A 4OHBA 1P7CA 1ULHA 4I5IA 3ZNOA 4HXYA 3BMOA 1PEKE 2VSYA 3HRIA 3OZRA 2HDWA 1PZNA 4JDUA 1X9GA 4ZAXA 5CNMA 5AKEA 3QPVA 1QIKA 3RV3A 1MC5A 5DX0A 2FW6A 2GPBA 1IPEA 1Z08A 3LECA 3ZN2A 5CEFA 1CHNA 1XCPA 3UK6A 3ZHBA 1M83A 1NUTA 2FUCA 2OECA 2AR0A 5B64A 4OQLA 4Y2UA 2I6XA 1E7WA 2NSDA 3ENKA 1LRKA 1A7AA 3NVAA 4W6QA 5EJ2A 3S5UA 5DI3A 4BVFA 1CCWA 1ZITA 4M88A 5KKAA 4YRJA 1AUXA 1VPLA 2FAXA 3RKSA 1EK5A 2RFLA 1DDOA 2WICA 4S0XA 4UZSA 4B3XA 2OY0A 4BGIA 4G86A 4CYMA 1U3DA 4FD2A 4D45A 4GYKA 1DAHA 4UASA 5EJ6A 3DMTA 3DNPA 2HA6A 1G4UR 1R5OA 4ZQEA 4EDHA 2IHBA 2I4IA 4A6DA 3VU0A 1NG1A 2C1ZA 3OFKA 4U39A 4PYOA 1ODCA 1TTPB 1S9DA 2G04A 4HAOA 2AFIE 4TKUA 4U2GA 3BB1A 5EYPA 3R6GA 2J46A 4YUZA 4JX9A 1QZTA 1LLQA 3ABQB 2XWSA 4CF5A 3O47A 2YY5A 3S2FA 4PICA 3ZE0B 3PIRA 3NHAA 2PRYA 3VTZA 4CIBA 1X38A 4S35A 5HNKA 4L2IA 4LMRA 5FKJA 5AM2A 2MYTA 3ETHA 3CNEA 3B1WA 3O4GA 4J2HA 1VBFA 4J8PA 2G17A 4UCQA 4Y2VA 5AI6A 1UADA 1JKIA 4D80A 1ZH2A 1EFKA 1PF7E 2WBLC 3VYTB 3ZZMA 4AYWA 1CY2A 2XAAA 3VO8A 2NO0A 4AJJA 5BY2A 4ZYUA 3I83A 5CDYA 1Y3AA 2GYYA 2E4VA 2VHTA 3AJDA 3L49A 2P3OA 2POQX 1ZIOA 1OZFA 2XDYA 2VHJA 3ITEA 2ZI3A 2EBHX 2YS7A 5ALZA 4ERNA 3IMEA 3GLIE 5FP0A 1Y5LA 2XITA 3NNNA 3ITDA 1PDVA 4N3CA 1MC1A 5EHIA 1UBJS 5KQLA 1Y7IA 5G4KB 1W0JD 4J0JA 1U28A 4I3HA 4RF4A 3WGKA 2BDEA 2D2FA 2RGXA 5F52A 1V5GA 3SU8A 3L8EA 4G24A 4C76A 2GXUA 3BHNA 5K3OA 1UZAA 2IIQA 1ECLA 1RLUA 1ZFNA 2K2QB 2PKCA 3I1YA 4GM0A 1P1BA 5GV7A 4DLVA 3KQHA 5T6BA 5FTLA 4BQPA 1RYFA 1SWVA 2LCIA 3HCDA 1PLJA 4E07A 1OH8A 4XCXA 1XLVA 4JUDX 3YASA 3PWSA 5AQ1A 2BH2A 1E6MA 4MWCA 4EGQA 4KH0A 3MGAA 2PLNA 4HS9A 4WCFB 2OYRA 1FF9A 6YASA 4U00A 1JAYA 2DY1A 2J1LA 2PKWA 1DO8A 3HO1A 5IT9A 4MYUA 2ZUFA 1BEUB 2IUFA 4L5AA 9GPBA 1A4IA 1J07A 2XBMA 4WASA 2QRKA 3IJ5A 3RRBA 1KH3A 4NJEB 2FUEA 4RAOA 1Y3FE 5EZYF 3G7SA 2JHGA 3BCHA 3LGAA 3ESZA 5DNDA 2JLCA 4D3FA 1K06A 1WMFA 3RBAA 3ZV6A 3BWMA 4N6OA 3VNRA 1AOXA 2CXHA 2RH4A 4QICA 3KL4A 1TIBA 2QE7A 3TX2A 1WPQA 5GMOA 4JLVA 4BLUA 3LPCA 4X8MA 1WSBA 2Q5JA 3DFFA 3N2LA 3AVWA 4S05A 1TCUA 2QX9A 3K30A 1QVAA 4DCSA 4QFCA 4PX3A 1GKYA 3FVRA 1TKAA 3OZUA 1RQPA 4M1OA 4B32A 3COJA 1R4ZA 5E2BA 2W0MA 4GSYA 3UB3A 2HD4A 3K9NA 4X0EA 2FF5A 3M34A 5DNAA 5AW7A 4EZEA 1SN7A 1E58A 1WDMA 5BSTA 3EEFA 1BWSA 2MR6A 1JU9A 4I4NA 1RS0A 3TJMA 1CY8A 5FYQA 3T54A 5KDOA 2ZSKA 3SD7A 2RD2A 2RGNC 2Z4RA 2OQIA 4K6KA 1JDZA 4XJVA 4L8YA 5AJUA 3U17A 2FLWA 1XN4A 4NH4A 1T0IA 4YP6A 1UPAA 5LLDA 2ZVQX 1K92A 4ZOBA 1OY1A 5CD1A 1I94B 5FO1A 1EVLA 1QAOA 3IAEA 4LRYA 3OX2A 4AO8A 4F71A 2PLWA 2VF4X 4V0MA 3RRFA 3JZIA 1E79D 4UTOA 4RLQA 1YB7A 5EERA 5FH9A 4QD3A 3SQLA 5KTMA 3B9QA 4AROA 5L3SB 3A05A 2XOKA 5EP1A 3V8EA 5ICFA 4E32A 2X58A 2W6JD 1TT5A 3MOGA 3NI2A 4IINA 4UCFA 4BO8A 3S2IA 2JFUA 2VBIA 3F97A 4HEHA 1OI4A 4II2A 4KQMA 4BVBA 4C0JA 3KQUA 1G8YA 2A5JA 3JQDA 1T6NA 2JLXA 2P0EA 1M1YB 2AOUA 4J16A 3QIVA 5B5SA 1YB1A 1WSAA 2BDTA 3OWXA 3RARA 4AKTA 4DCJA 2FN3A 2AFHB 1TEHA 2CJWA 3B53X 1KQGA 1ZRHA 2G6BA 1HE1C 2QE7D 1D2RA 4DLUA 2R0QC 3MINA 3U40A 4IS3A 2B1QA 3W3AD 1UPUA 3F90A 3GHYA 4OVKA 5CNKA 3W9YA 4R2IA 5IVPA 2I1VB 2HEGA 3C3CA 1SEPA 2Y2UA 2C9DA 2XRMA 4I1SA 2VDWB 1OAOC 3ZPXA 1ENZA 1T5DX 3E5MA 2VF8A 3AZPA 1NJFA 2P6OA 2QR5A 1E62A 3H2JA 3HEMA 3FNBA 3GCWA 4IZHA 5LUBA 1QC5A 3K35A 2A9FA 2QYOA 3WNQA 3QPCA 4F6CA 1U3TA 2QGZA 3F7NA 1MRSA 1P2TA 1Q74A 2YBEA 1YE5A 1ATZA 4YJ2F 3S40A 1IUPA 1WW2A 5G0WA 4KPFC 3U31A 3VAZA 1AMUA 4ZT7A 1IXSB 3V8PA 2RH5A 2D2IA 3ZU5A 3M8KA 1Z0DA 4IO1A 2GAJA 2G07A 1CE8A 3G0CA 4WIAA 3L4BA 3WLHA 3LP6A 1DWOA 3KJFA 2PLRA 3E9EA 4M7WA 4AYTA 1JG4A 4URYR 1CDOA 1U2GA 5FUBA 3DMNA 1RXCA 5TQ0B 1VCHA 3KUDA 5IDQA 5JSFA 4XLTA 2YVLA 4LECA 5DM1A 1E6EA 3C3YA 1DHRA 4W1QA 1L8QA 3DE7X 4I1VA 1ACLA 4C14A 1KQFA 1CVIA 1JG1A 1FEZA 5TX7A 2I29A 3IIJA 3U16A 3HCOA 3WYFA 2FK7A 3K8QA 1GNQA 2JCBA 1CC1S 1R9GA 1S3SA 3DJYA 3ENQA 3K5PA 3NG1A 2F8SA 1T0BA 3ZDCA 4I9HA 5IDVA 3ROPA 4J76A 1NWHA 2D0PB 5CTAA 4KKXB 4GR5A 1RQNA 4TTSA 4W1RA 3OTWA 3EJWA 3I0MA 4HLUC 2PL5A 2HMUA 4GL4A 1UMCB 4KRGA 3O94A 4ND4A 2C9YA 1Z8DA 1FU8A 1KAMA 3CIOA 4NU5A 3C8HA 3U1VA 5LJLA 1QU3A 1IBKB 3OJFA 1HH4A 2V6GA 3SHVA 1OBVA 1DAPA 1NV8A 5HKBA 1F8GA 1RZRA 4LZLA 1E89A 4FW8A 3QVVA 2BFEA 2FOLA 2WHEA 1KSFX 1PFWA 2EFCB 4XZ3A 4PX2A 3HWRA 4EGJA 2H54A 4TRMA 4C2UA 2V7WA 2I3ZA 3AR2A 5HIJA 3W7AA 4UTXA 2FWRA 3EGVA 1V1RA 3UMRA 3O8DA 5IYZB 4NARA 4DE5A 4ZT5A 4PLGA 2P3QA 5FBKA 1RAGA 1UWLA 2J4DA 4DMUB 1GFIA 1P9WA 2BRUA 1TM3E 2B6HA 3QKSA 1MNAA 3Q1KA 4J3FA 4C43A 3QOFA 3CVWA 1T8UA 2DPLA 1X74A 4Z99A 3E18A 4FKZA 1KHHA 2BKLA 1QGOA 1ZOOA 3P45A 4TZKA 5LA6A 4C4AA 1PUIA 1KYXA 1UZNA 3EWAA 3OQMA 3FGOA 4XFJA 4W99A 4NDZA 2YOGA 4NH0A 2GBPA 5JSKA 2VKTA 3DZJA 4EJSC 3E8XA 2FTKE 3PDIA 3C3KA 3S2UA 1F7UA 1YS1X 1W25A 2PQ0A 3BKWA 3A32A 1JXOA 4JHLA 2G06A 1LW7A 1NVBA 2XCQA 2AFIA 3I23A 3MSCA 2V6FA 2WYWA 3LA6A 2F90A 2IY7A 4QDXA 1OIVA 2HRBA 3OIFA 1DAEA 2OHJA 3OQIB 4HO1X 4Q3KA 4P5PA 4I6GA 4K7JA 2IXTA 2VT6A 3HA5A 4EP1A 1LJ8A 4XFKA 5GJCA 4ENRA 1OLUB 4H1WA 5L51A 3T7KA 4RHUA 3EVGA 1A69A 1P4JA 1TECE 1UODA 3RKUA 4CEJA 1LNZA 5AJVB 2OPHA 1VPVA 4D6YA 1Y6RA 3N2GA 3BD6A 3WYCA 3IBCA 5MF6A 1NI5A 2FSVC 2I4MA 4UUOA 4JBHA 2H9YA 2BFFA 2JC3A 3MT8A 4RSHA 3RT1A 1FMJA 5IXSA 2GJKA 2QAJA 4EHFA 4QO8A 2J9FB 1D6SA 2ETXA 4FHGA 3EB9A 5LMNB 3A4VA 3S3TA 1H2EA 3HBMA 3VH3A 4OEHA 1N2CA 1J1IA 1ZVKA 2XJ9A 1Q7GA 3FPAA 4MW2A 1PG0A 1U6KA 4TLDA 2ECOA 4TKVB 4RENA 4EHJA 5IZ4A 4Q0MA 4XWWA 3O0TA 4MYDA 4DQKA 4IDDA 3K1AB 2OV8A 2MCFA 5BYBA 2AV6A 1UPTA 4OHPA 4RIHA 1N1GA 1QIDA 2A7QA 3MTDA 4OI2A 3ZY6A 4DMRA 1T8SA 3VKGA 4BN0A 1WXEA 2WTNA 5EWMA 2J9YB 1QP4A 2DPHA 4RA9B 3ROMA 5BRNA 4PGGA 3HABA 3LK6A 5TMEA 1NLUA 3TLBA 3AJ9A 1CR4A 3EIQA 3L0CA 3DBLA 3MW8A 2C83A 4RE6A 4QUKA 5CVVA 5FL7D 1FS4A 3WQRA 2FWBA 3C1AA 2CK3A 2B8WA 1K1EA 1ECPA 1GL3A 3AFGA 3HE3A 3T15A 3ADDA 4Q01A 4HLDA 3HFSA 1ESZA 2MIIA 3BSWA 4WY2A 5REQB 4AY4A 4KDRA 2C31A 5CVUA 1MABA 2CNWD 5BN5A 1V3QE 3FVQA 5B4UA 6CHYA 4CUJA 1T6XA 4I46A 1OYVA 1PR4A 1W8IA 2ZJAA 1KMIY 4BQSA 2GJ4A 2NYUA 2K2WA 1OTXA 5FOQA 3AU9A 1E2EA 4F92B 2V7UA 4LVUA 5LMCA 3L5KA 2BHSA 5H82A 3U9LA 5CXUA 1SHTX 5AXDA 5JNVA 2GFHA 1Z33A 2ZBRA 1ILEA 3O84A 2F8MA 3LC0A 2OUIA 4OIFA 2LP4Y 3NNSA 3FDIA 3AUFA 1ZJYA 2VHXA 5FUXA 4LW8A 1II9A 5IUJC 5C8YA 1A9ZA 4IHKA 2H2AA 1A1VA 1EINA 2X9QA 4EFDA 4YAKA 4NYMR 3U0BA 1W34A 4K86A 1ZAYA 4Q6BA 3AY6A 3SJCA 3N6XA 3BD9A 3SJBA 2A3RA 3Q3HA 3THSA 3VU3A 3ZUPA 4YV0A 1DHTA 2JBAB 3L5OA 2Z1NA 4IXNA 4XPIA 3RV4A 3TSYA 5A4MS 2DFDA 2AHOA 1G8KA 3AQ4A 4NAHA 3LX4A 3R41A 3ZWDA 1FDOA 4PN3A 1ZXLA 4Q7KA 5F78A 3C6MA 3EWSA 3KWFA 4DCNA 3JARA 1T9AA 1V2HE 5FL7A 5FNVB 4RIGA 4FGLA 3VBCA 3VR5H 1DKNA 2D2XA 4IUDS 4Y6PA 3CM0A 5KB3A 1NPTO 4MLZA 2QMZA 5HKLA 4HEQA 4WWHA 3ZBPA 3PC8C 1A8SA 3RTEA 1MT3A 1UWCA 4WEQA 3H5VA 4LC9A 3LSTA 1Y3HA 3ECCA 3TOSA 3H86A 3QJ5A 3W2GA 4KGVA 2X9LA 1W96A 3HP1A 1UKBA 3OE1A 3WYGA 5JANA 2QBYB 3TTYA 3QKSB 3ZI7A 5AVYA 1E4EB 3EGIA 3T95A 4ECEA 4RO0A 2DR3A 3R1IA 2GUWA 5BYKA 3DV0A 2FU5C 3M2PA 4K9NA 4RFLA 4IPTA 2Q7DA 1PT9A 2F3UA 2NADA 4JUIA 4M1YA 2ZZNA 2I2AA 3UHFA 1ZUIA 3ZY5A 4AJPA 4B9AA 1WBBA 5LP6F 4EQ6B 4CJXA 4J0FA 1TU4A 3HBNA 1M33A 1K5GA 3IAS6 3JQAB 4PYNA 4UEOA 5FTWA 5BN4A 2QM8A 2JPDA 2OFPA 5CFPA 3M81A 2AQKA 5CFQA 2DU8A 1N78A 1JI0A 2HMAA 3WYBA 1M75A 3A1WA 4LHYA 2DUNA 3UCFA 2ECQA 4LNHA 2ODWA 2GZMA 4OLAA 3V80A 5TY0A 1J42A 5KUTA 1LUAA 4W4TA 1KI6A 1XJ0A 1DZ3A 5BSUA 3O38A 1OTHA 1SOVA 1ZPDA 3EXEA 4IS2A 1T8WA 4JASB 4LDPA 4UOQA 5COQA 5GY7A 2O59A 4YP0A 3K73O 4H08A 4OHYA 4O3FA 1Q3HA 4O2BF 3BBLA 3PE3A 1NW7A 4CUZA 2FW8A 1WXWA 2PKQP 4ANFA 1WABA 2AJ8A 3FNHA 4HD8A 1EFVA 3CV3A 2J9ZB 3TCXB 2C5EA 3KFVA 5KQSA 5EPEA 3ICOA 2QWXA 2VF5X 1VPEA 1PWHA 2A9VA 1FDWA 4EG5A 2BBSA 1RLIA 2VP0A 1C4XA 3DKKA 2FOXA 4MPDA 2R60A 2HHJA 1SIUA 2FVXA 3N8NA 5EIFA 4Z3DA 2OV2A 3ZHYA 3S8EA 3MGGA 2G76A 4FBGA 1DPGA 1JN0A 3EWIA 2GSDA 4EUEA 1ZVQA 2WSIA 2H2FA 1FFHA 2JLQA 1MQ9A 1ZSNA 3AF6A 2QT1A 3KTFA 1OJLA 1GXSB 3RVJA 3DVAA 3GFFA 2GZSA 1EFPB 5JSYA 1JFFB 1NDHA 3WO0A 1ZI8A 4IOLA 1KP3A 1Y4SA 1X3LA 3BXFA 3PR3A 4INPA 4XRRA 2XNHA 1E77A 4I4TB 1W94A 4X7BA 3OCZA 1EK6A 2NU9B 1Z8NA 3RE1A 1KS9A 4N0EA 4L6IA 2HPHA 1GSOA 4X3PA 1IONA 1E2KA 3UAWA 1CUCA 1RHKA 3FZGA 4JKOA 3THWA 2XGJA 2CHQA 1Q57A 1UAGA 3LBFA 4R69A 5EFZA 4RTPA 2IDZA 3JVDA 4NV3A 4GM4A 5HQ3B 5FO0A 4S1TA 2KWIA 2WJGA 5E3IA 3M82A 1NXQA 2OL4A 4UW9A 1K9VF 4TLBA 1H9BA 1MV8A 5JFTA 4FI3C 1T1RA 4URFA 2ODBA 3BN3A 3WKCA 3H97A 1SA0B 3C4QA 3D7RA 1W48A 4QQRA 2XQVA 1YL6A 3KKOA 2GTHA 3NEPX 4X1KB 2M1ZA 4X9XA 1H85A 1QH1B 1QO0A 3GUVA 3KKEA 1XVVA 1AXEA 4YHBA 1NMYA 5LU8A 4TLLB 5CGZA 5EIHA 5DYIA 4TV9A 1A5BB 3KTAB 3WK5A 1JLMA 4MLCA 4MWSA 1VHJA 1DAFA 1U2EA 1PBTA 3ETLA 3O7WA 5KNDH 1G5QA 2ZIWB 2PX2A 3KVOA 5K3FB 1ZC3A 4Q4AB 5EZYA 1YQ9A 3H2HA 1R7RA 3L7DA 1OXUA 3FA2A 4YQEA 2IS2A 2BOVA 3L1HA 1EDDA 2VAMA 2X5XA 2AMFA 2X76A 3LM8A 2VYFA 3JV7A 3G8BA 1QQBA 2ZJ0A 3SHOA 3MTIA 3VH2A 1AGPA 4RVCA 1FYDA 4ZTBA 4LC1A 4HDKA 3ZGNA 4BFLA 4NOJA 4EUSA 4G23A 4IQGA 1QHFA 1PGOA 4BMZA 3FF4A 2AIRA 3LMKA 1N4AA 4DJJA 1PNVA 1U5AA 2CXOA 4EY4A 4R7ZA 1E0DA 4PIPA 1E9SA 3I32A 1LBHA 1Z6XA 4C7MA 3LPLA 2XNDD 1PW5A 1WD5A 1FJ2A 2Q3LA 4MINA 1QE0A 1C1DA 4U0JA 3UAYA 4ALIA 4C6TA 4BNNA 2ZIVB 5CD9A 4G37A 2NQ8A 2BTOA 3REGA 2PT6A 2BUBA 2FV8A 4JR1A 1J2TA 3W5CA 1LDYA 2WINI 1U0GA 1XZGA 4KH1A 1UXOA 4LHWA 1GZUA 3AF2A 1A7KA 2G7ZA 5HGJA 4E12A 3JQQA 1BG6A 4J49A 3E9RA 3GMDA 3VVCA 4YT8A 4NE2A 4IR7A 4P4UA 3OQNA 2DETA 1CRPA 2IEZA 2YMLA 4CM8A 2ZB2A 5C32A 2ZCJA 1TF2A 4XLZA 1OD6A 2YWFA 4L8GA 1U65A 4XLLA 3R7NA 2PO7A 3G2HA 4V3BA 4E11A 1C30A 2Q49A 3FSEA 4J0EA 4LX0A 2JRCA 5JBNA 2C4MA 5LNK1 2FSIA 1Z4IA 4Q05A 4UNSA 8MHTA 3GJZA 3E4DA 2FUNB 5EQFA 5CT8A 4EHHA 1N57A 3TSAA 1E0SA 1E5TA 4RD1A 4C5AA 4WQMA 3OU2A 3EY9A 4DVJA 3VR4D 4GP7A 4GVLA 2WUGA 2VDJA 3FFAA 2J0EA 3TTSA 3IC5A 4AUMA 5EXPA 1Y3BE 5LLTA 3VC2A 4OKIA 3SLKA 4D5EA 3OZ7A 3HMQA 1T2AA 5H16A 2IZ1A 1NN5A 2DXIA 2ZIEA 3QP9A 1ZHFA 4HNAB 1IY0A 4LISA 1G16A 4ZT3A 1ZA2A 4OI4A 4ZVKA 1L3IA 4ZHQA 1A2QA 5AI9A 2AA3A 3GBVA 3OQ1A 5KSWB 3LO8A 2IGBA 1TMYA 1U5BA 2RHTA 3GVIA 4QEDA 1M73E 2G9RA 4TKMA 4DBZA 1VBMA 3DOUA 4KZKA 3EF1A 1UM8A 2V5VA 2YJNA 3PXXA 1GUAA 2JGEA 4KRXA 2UUOA 3AL3A 2J4FA 4B40A 2ZTVA 5KCZA 4C1BA 3ADKA 5C80A 3JRNA 1QGYA 4FMCF 1SC1A 1WY5A 4C3ZA 3R0IA 2C4KA 3DT6A 3RUAA 3CZPA 1LF0A 1FZQA 3C45A 5A02A 5CA0A 1DAIA 4UHKA 1OWMA 5JY1A 1W59A 3HRHA 4MPPA 2PVSA 4ZTUB 2O57A 3DLPX 5IMSA 1E98A 1T6BY 1DFHA 5K3AA 2AKYA 2EERA 4AG6A 2BELA 2V55B 2CWDA 4HUQB 5LZ8A 3KBBA 2JFYA 4J91A 4FFSA 1DB3A 4LEIA 3NVKI 1D8TA 2XUIA 3DT9A 5SV2A 5AOVA 4Q39A 5K8JB 1AIPA 2LVBA 4DV1B 3JWHA 1YIAA 1N9KA 1NN1A 1GUBA 5KJEA 2RE8A 1JFFA 1G21E 4CEHA 4RJKA 3PVSA 4AQ7A 3SR0A 3UWSA 1DCMA 5J63A 4KMOA 5HX7A 2UVPB 4HN2A 1XT6A 2ASEA 1U1FA 5JPCA 1ZVVA 1T25A 2VPTA 5CXQA 5J2TB 4MDEA 3EY4A 3EBLA 1Z2NX 3IOBA 3U4MA 2IZOA 1NW9B 2H1IA 1RM0A 5IMBA 4B4OA 1YQEA 2KBEA 2IQIA 3T61A 5HK9A 1J0DA 3COSA 5CBPA 4MKXA 2V7PA 2CB0A 3W3AA 1GL7A 4MGIR 4TMWA 1EQ2A 4LF8B 4FR0A 1DV2A 4GUDA 1XRNA 3PWZA 4FMPA 4KQ9A 4II3A 5JFGA 3T5AA 1YRAA 2XMZA 4PPGA 1TZMA 2EWVA 3RJZA 1T0HB 4EMTA 1P2FA 4HTFB 3P2JA 2HWYA 2VNIA 3EYAA 4YRSA 1HYBA 3F7TA 4F06A 6NULA 2Q5EA 3A4MA 3QUBA 4C06A 4E4RA 4RD4A 2YNMC 2A88A 1C7ZA 1UXGA 2QPAA 3NWPA 3QOXA 4X7PA 5K0NA 1NSTA 5DYNA 4QUIA 3LQYA 2QMYA 4BNUA 5IAGA 5D87A 1KOJA 1H9AA 2CLLB 4PVCA 3X1WA 2O8EA 2ZVPX 5KAPA 3N2KA 1D2AA 4K5QA 5EIWA 1MW8X 3SKXA 4XEHA 4PLFA 5A6SB 3LPMA 3K9FC 3GLRA 4CG2A 3OIWA 1MOQA 1Z4NA 3R0VA 4G4SP 1M0TA 3DMYA 5F5NA 1NA5A 4AMBA 5JR3A 1N7IA 2NU9A 1FVOA 4IIDA 1VKJA 5CEJA 5JNTA 3DH0A 2HO5A 3PGA1 1P0MA 2W0SA 1O95D 3RFTA 5FWNA 4MUEA 3UIEA 2QW8A 2XUHA 4F93B 2NACA 1XLWA 1I13A 3G7NA 1NR7A 2EG5A 3R3XA 3ZWAA 1VJTA 2L17A 4DIOA 3I9LA 3NTOA 1C1DB 1RYNA 4KMRA 1AQYA 5EMJA 4C6TB 3M4JA 5ARCA 4BJ6A 3LDUA 4YLGA 4F3RA 3U1TA 3U26A 2AXPA 5JZVA 1BXRB 1EWTA 1DUIA 4KLZA 2ZWPA 4BIIA 2YS6A 4J7AA 1GPKA 3JRXA 3BC1A 3H0EA 5ELMA 1IJBA 2ZSBA 1GQQA 3THOA 4E21A 4QZVA 4OX9B 3MAGA 3QYJA 5L40A 3CRW1 2HO4A 4ZYZA 1U3VA 3AHCA 2RDMA 1LBIA 3R3VA 1A2BA 1RPAA 5K6RA 1RZRD 3KG2A 3MS7A 3IP8A 3MMSA 1H5QA 4ZVQA 1KDYA 1FMCA 1UOPA 3CO5A 2J48A 3JYLA 2P6UA 2Q46A 2R6R1 3H9JA 3KXPA 3L41A 1NT4A 3LDFA 3O4IA 4WHMA 3PVCA 3STXA 1VKRA 5JDCA 2R25B 3FVWA 1IZ0A 2IUTA 3NKLA 1VHQA 2OHGA 3A4LA 3T1NA 2JIOA 2XVZA 1Z15A 4OGLA 2RI6A 3FZYA 3D0KA 3H2BA 2O5RA 3CUEF 1WQ1R 4AJLA 4AJKA 1HR0B 1NXWA 3ZZUA 3L84A 4DLTA 3EW9A 3KB6A 3ZDAA 5JO9A 2Y1OA 4BTEA 5B36A 3CZAA 2CZQA 2NT3A 1BXZA 4R6XA 2XMSA 4B45A 5GONB 5CVTA 5JFOA 4GKJB 3TW8A 3RQSA 4LZJA 3H5TA 3RTGA 1VBNA 1YUNA 1L1EA 1LX7A 3VYWA 4ALJA 2VJLA 1FB5A 5GONF 4QPNA 4UXIA 4CT5A 1LI5A 1J0BA 2IU0A 1F0NA 2Q3DA 4JJEA 4NOMA 3UMMA 1Z16A 1E18A 3E58A 2C9OA 4PQGA 3I9OA 2ZPUA 4OGWA 5C31A 4DAEA 1U4NA 3DG9A 2QLTA 4IMPA 3H87A 4L08A 1QRSA 2WHRA 3RSQA 5CRIA 5DRTA 1SQSA 2CUTA 4S0ZA 3B6ZA 3KFLA 1WX1A 4Z51A 1P9NA 3WGYA 5E1MA 3MQ2A 1U0RA 3FIJA 4V0ME 4PBRA 3K71B 4WINA 1JLSA 3SIRA 3VO9A 4OUDA 5SY4A 4L22A 3MS4A 3DGEC 4GYYA 1CHDA 1MA3A 3N0TA 2HWKA 5GVRA 3BGVA 3RIHA 3NIWA 1ZVJA 1W85A 3UQYS 2QMQA 3A1NA 3G0GA 2BCJQ 3ZU3A 4FWBA 4HJRA 2AFIB 2Z5FA 1HNXB 1T29A 1SBHA 3DEHA 1QC5B 1N2IA 1SCUA 2AI1A 3DQQA 3S8MA 3PV0A 2GA8A 2BGNA 3H11A 2OZLB 4C88A 1KYVA 1R1DA 4CM9D 4RK4A 3OHSX 3QLEA 1W47A 2YZ7A 4M87A 4ZA2A 4DV6B 1NVVR 1SEVA 2H1RA 5LYYA 2ONJA 3C74A 4E5SA 3KLPX 1LTQA 2KS6A 4KIJA 2HU2A 3OMXA 5MN4A 2A67A 2YYZA 3DAYA 2FEWB 2IP4A 1SQ0A 1G9SA 4YRAA 1E3JA 2OQ2A 4F2GA 8ABPA 1VCNA 1OF1A 4AJIA 2OCBA 4X63A 4AY6A 3RC8A 4NJMA 2H0AA 4OUKX 4ICIA 4F4CA 3T1VA 4PG7A 5THQA 4WKGA 3SBDA 4CL2A 1IIRA 1SCIA 3DHYA 1PKXA 5T4BA 5HZHA 3M9LA 5KX5B 3AP2A 1QZZA 1M6YA 3QU7A 2I1LA 1M1NA 1CF4A 2FFRA 1C50A 1FRVA 5DM70 2IP1A 5E4FA 2DTEA 2N47A 1ZLYA 2IYZA 4ZK6A 3R5KA 3LHIA 3F49S 3D6VA 1XCLA 3PC3A 1QP8A 4F3KA 2D1SA 2R1ZA 2X2PA 2R96A 1F5SA 2QVLA 2RBKA 2ZI6A 2ZJ1A 1R6VA 3KJEA 3PXAA 2P1RA 4HB4A 3ZWBA 2WP8J 4R2XA 3ZBQA 2FSGA 4R9RA 5KYXB 5AMXA 3B3AA 3CVXA 2I6UA 4XGNA 2AC2A 2CE2X 4ONEA 4HLQB 2IL1A 4JI1B 3QLUC 3EOBI 1ID8A 3CZQA 1LPNA 2QN2A 2WTEA 3FPHA 4EK9A 5IU6A 1UP7A 1HTTA 1Q95A 1W73A 2W6IA 5AK5A 4YCMA 1VGQA 4KP7A 5GQSA 1ECGA 1SVOA 5LLSA 4Q47A 4N0PA 3R5XA 3RVSA 4D8TA 2E9SA 3ABSB 1NY6A 1PAUA 1X7ZB 1RAIA 2EG9A 3JQ6A 3KT6A 4GR4A 1BQ4A 4NK4A 3WWEA 1E6CA 2WYHA 4G1UC 3NEYA 4FU0A 1FOEB 3P9QA 2EBWA 4TQUS 3RGGA 5J2TF 4YXWD 4XWYA 2ZRMA 3PPXA 1ZVMA 5CEEA 3Q3IA 1I3OA 1L7BA 1D1PA 2DC1A 4LKRA 4AWXA 3TLAA 2YIJA 2X3FA 5EUQB 3HBLA 1W36B 2HMSA 3VHQA 3VR5D 3QI2A 1V71A 2I3DA 3WLFA 2H1HA 3H8WA 2JW5A 3HU3A 1OAKA 3E9QA 3KOXA 5JMPA 3L7KA 4K6HA 5TDHA 5ILOA 3DAPA 3EIOA 4Q7JB 3WL4A 3QMWA 3KZXA 2Q7OE 1VSQA 3AXTA 4K05A 5EQDA 1SOUA 1UQUA 2RHOA 3JQ7A 5CTJA 5A03A 1EGHA 3AZOA 5JH7F 5FQNA 4RTSA 3IP6A 3VOTA 1WULS 1HL3A 2WUWE 2ZDHA 4OPMA 1Q2XA 5HIMA 2FRDC 2HYIC 1I1QB 4O2BA 4MVJM 2JGJA 4IEFB 4JQSA 4PCVA 5CX4A 2P4EA 4DWJA 4IDEA 5BSGA 2TSYB 3IELA 4GZ3A 3LBIA 4TT3A 3ZHSA 3I5YA 5A5VA 4KXWA 4B2PA 2X3YA 1N5MA 1YJQA 4ZQGA 4B1FA 2A58A 1D2HA 5JCOA 2HL6A 1BHSA 3E7XA 4LJ9A 1XMIA 3UKDA 3IT1A 2XF2A 3M6AA 4LUCA 5A62A 1MEOA 1RCFA 3U9SA 2PSSA 5IXJA 3MBKA 3X1JA 3HI6A 1O5TA 1QK3A 3CPEA 3KYIB 4BJ1A 1XU7A 1NIJA 3WV4A 4AJHA 1IY2A 2Z3WA 1WTCA 1V1JA 2RGNA 4KW7A 1XEWY 3E6AA 4LXQA 4TT8A 4WJZA 5CXSA 3W6UA 5HUQA 4D6XA 4C20A 1Y89A 2I34A 2HK6A 2HWUA 1EWVA 4PCLA 2QN6A 1PQYA 4X6YA 4R3WA 3T7CA 1L4YA 4G1MB 4QXOA 1VG1A 2Z5VA 2H4XA 3K94A 4ADSG 1KF0A 1KJQA 2VO1A 4N48A 3BRWD 3T3DA 3AR5A 3A1SA 1ZW1A 3EE6A 3EUAA 2AFHE 1VFPA 3UXMA 3MJ4A 3PKZA 2DX7A 2PQ2A 4IMIB 5J47A 4JUFA 2ATEA 5TMBA 2WU3A 2FR0A 2XDAA 3NHUA 1XZAA 2CD7A 3URKA 3ZWVA 1JR2A 4DC1A 3LUAA 4OJTA 5FUQA 4UBIA 3ZWMA 2VJYA 4KE6A 4WXPA 3IDQA 4EL5A 2D54A 4KKVA 2CK3D 2QK4A 2Q8PA 1E92A 1T8TA 3B3GA 5DHSA 1N2CE 3UT0A 1H4SA 3VOBA 2CJPA 4QYIB 1KJYA 2OSBA 3PNMA 3QFRA 2IXDA 3HB0A 2VN8A 4O33A 3B78A 3SOPA 1PP4A 3IKJA 3UUEA 1ZMXA 4FOLA 1R8JA