4K3VA

Structure of staphylococcus aureus mntc
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
278
structure length
253
Chain Sequence
GKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure and Biophysical Characterization of Staphylococcus aureus Cell Surface Antigen-Manganese Transporter MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein
molecule keywords ABC superfamily ATP binding cassette transporter, binding pr
total genus 91
structure length 253
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA01
5KOJB 4TKVB 4UTOA 1K2VN 2XDQB 4LS3A 3TEFA 2OV1A 2M6LA 2AFIB 2AFHA 3U7QA 4ND8B 3AEUB 2PRSA 3LI2A 2XUZA 2X4LA 4CL2A 1EFDN 4WZAA 1QGUB 1N4AA 5GGYA 3AEKB 3LHSA 4NNOA 1G20B 4XPIB 2R79A 5CX1B 1G21A 3AESA 1M1NA 4HMOA 1KAHA 5BVGA 4G09A 4B8YA 3U7QB 2AFIA 5M3BA 2OV3A 4WNAB 2OGWA 3MWFA 4WZAB 3K1AB 1XVLA 1G20A 4UTPA 3MINB 1M34A 3EIXA 3HXPA 2QI9F 4FNAA 3AERA 4WZBA 4H59A 5KOHA 4IRMA 1K7SN 2R7AA 4HMQA 5HDQA 1TOAA 3K1AA 4UDOA 4TKVA 4OXRA 3MWGA 3PDIB 4TKUA 3TLKA 1M34B 2Q8PA 3CX3A 4MX8A 1H1LA 3AEUA 5B58T 4GICA 4FILA 5HX7A 4WESA 3PSHA 3AEKA 4HN9A 5JJ5A 4XPIA 1K75A 3AESB 2PHZA 2XH8A 1MIOA 3UJPA 4LJSA 5JOQA 4N01A 1QH1B 1N2CB 3AEQB 3GI1A 2WHYA 4H0FA 2PS3A 4UDNA 3BE6A 1KAEA 3HJTA 2XQVA 5BVHB 5JPDA 3ZTTA 4NNPA 5I4KA 4INOA 2Q8QA 1PQ4A 2MINB 3ZK8A 4DBLE 5CR9A 4WESB 4INPA 4HMPA 3ZKAA 3ZK9A 3ZK7A 2XV1A 3AETA 2PS9A 4PM4A 4WN9A 1MIOB 5KOJA 3R5TA 3HH8A 4WZBB 2XDQA 2RG7A 4M7OA 2M6KA 5BVHA 4FKMA 3MD9A 1QH8B 3NU1A 3R5SA 4ND8A 2XY4A 4OXQA 5KOHB 1M1YA 3EIWA 2MINA 2OSVA 4MLZA 1K0FA 5JG7A 5M34A 4MDYA 3PDIA 4TKUB 5CX1A 1G21B 4BBPA 2ETVA 1KARA 3AETB 4WN9B 1H1LB 4FI3F 3TNYA 5BVGB 1N2ZA 5AFSA 1L5HB 3G9QA 1QH8A 3MFQA 4WNAA 1M1YB 2YNMC 1PSZA 4G07A 3PSAA 1FP4B 2WI8A 4PAGA 1ESZA 1QH1A 1N2CA 3AEQA 3MINA 2O1EA 5FLYA 5GGXA 2AFHB 2YNMD 3AERB 3BE5A 4K3VA 1L5HA 1QGUA 5M29A 2PS0A 4MO9A 1N4DA 5KHLB 4OVKA 1M1NB 5M2QA 1FP4A
chains in the Genus database with same CATH superfamily
1ZH6A 1BVUA 2XEXA 2YQ5A 1WS6A 1UIRA 1U3TA 2XDQB 1TNDA 4ZOLA 5TXGA 2E6UX 2AEJA 2QRLA 5JAOA 1D4OA 3EGDB 4LI0A 2EV9A 2EL9A 2PPLA 4F2WA 5KO2A 1WXIA 1TYZA 2P2LA 5F51A 4KXUA 1DJLA 2ECFA 2YBEA 3I9JA 3J7TA 2W70A 4EB6A 4PNZA 4F5YA 4B3BA 1SXJD 3C6BA 3MB5A 5IFKA 5FPHA 3UXYA 5TPZA 4GI2A 3MTEA 3GRPA 3UV7A 1JEAA 2B94A 3OLWA 1X1SA 4DL9A 4QXMA 2V5VA 4LXYA 4YREA 2R6GA 4P2BA 3U62A 3VHXA 4PQGA 2QAJA 2XWBF 5JXWA 2IYXA 2A9RA 3EY4A 3B1KA 4B0PA 3W2IA 3ICPA 1U2DC 2X4IA 1E20A 4RLQA 3TQOA 1BYUA 4TTSA 4I8DA 1KQOA 4HUQB 4PBRA 2O50A 2QX4A 5K1ZA 4YJGA 3SZGA 4MYRA 4YQYA 4EB0A 4FNGA 5IC6A 2QA5A 4DPKA 3GUCA 1YMVA 5JADA 4Y3UA 3L6CA 3E5RA 4HJRA 5CFNA 4ZGBA 3F97A 4B4OA 1LDGA 1TM1E 1GU0A 2R00A 2C8JA 1FJGB 2V0GA 4YN3A 4K86A 1YB1A 4J2OA 1YV9A 4BE4A 3TVDA 3EG9A 2J0UB 3NLLA 5G0UA 2JIMA 1Z0KA 1KE1A 5J47A 2R5NA 5FO0A 3G85A 1GTG1 1SKQA 4ZODA 3OQIB 3PSHA 1IOLA 4XI9A 1UZMA 4OAOA 2HAEA 4ZCSA 5M7EA 3ROZA 4AU1A 3D3KA 3SR4A 5C8ZA 5JCZA 1IQ0A 4JBXA 4KDRA 5CVUA 4KIJA 3SIWA 4Y2JA 1HNWB 2PIDA 2BMWA 4YALA 1D0IA 1JEJA 2VDVE 4LBWA 3FYHA 2NUAB 3ULKA 1QBGA 1C4OA 1EXNA 1ZG3A 1FUYB 1VG0B 2JJMA 1Z2AA 3NJ4A 3D4LA 3PRHA 1SBQA 2NUPA 3BQNB 1I7NA 4E3WA 3ZD8A 4CIWA 1LWOA 1CNMA 3AJEA 1UAYA 2ZJ8A 3NHKA 3O90A 1G8HA 3G1WA 4WFQA 3PC2A 2ZWPA 3OQNA 1VMAA 3ZCQA 3QKUA 1HI9A 3FNBA 4G2TA 1Y8RA 4MQEB 1V8DA 2FE4A 3SC2B 1F7VA 3HB0A 2A88A 3IT2A 3TL3A 2GKOA 3CW8X 1LVGA 2A30A 5E4JA 1NYLA 4UTVA 4NE7A 1T34A 2JFHA 1IEQA 4FCTA 3WL3A 2CSUA 3GJXC 4BBPA 3DAGA 1KARA 3DWIA 4QUJA 4II7A 2C0QA 2FN8A 1RP1A 2YV3A 4FI3F 4J75A 4WKNA 3IDFA 4JBYA 2UYQA 4PINA 5A7GA 3IKLA 1P7WA 3GPLA 5BSUA 1I2MA 2BGTA 2B5VA 3K0FB 4OHFA 1U8ZA 4IQ8A 5JMOA 3FYUC 4Q9IA 2WI8A 4WBNA 1D4AA 4Q6WA 3BEDA 4WGGA 1CY0A 3GT0A 1G3MA 2IPOA 1Z26A 4YRLA 3TOXA 1C1DA 1BNCA 4JJIA 5ALGA 3DTYA 4H7HA 1H69A 3LLUA 5JSHA 3QVUA 1CLEA 1E2QA 1RAEA 4IGKA 1LW7A 2A0YA 1MW9X 5BWMA 4BX9A 1V45E 2DPHA 2FVYA 4D98A 1G1AA 1V37A 1WDKA 4CMEA 4RY8A 4EG5A 3PUHA 3N2KA 5C8YA 3KQNA 2IDMA 4Q4AB 4PG4A 4YPFA 2LUOA 1NWHA 2GEJA 2FZEA 3V8QA 5K3SA 1T3GA 3G6KA 1C7RA 3I8SA 1QPZA 1UANA 1UT6A 1S1CA 1J49A 3K0HA 3MPOA 4IIJF 4JLJA 2OQIA 3QY0A 4DR2B 1FTWA 4YJ2A 2YS6A 2G4VA 1EFDN 3EXHB 3KJXA 1QGUB 1W8DA 1HE3A 2ZJ1A 4FGSA 2CFOA 1LBHA 2GF0A 4NNOA 1G3UA 4KJZA 2Q5CA 2NYAA 1K6EA 1W4ZA 2HWUA 4M46A 5LP6F 1SOUA 3C39A 2VAMA 1FDUA 1KKMA 2F59A 2QZSA 2G0AA 3ETGA 2CNWD 3V6MA 5HZGA 3VR3A 2XHEA 2GKSA 1TAQA 3HVJA 1NATA 3QF4B 3F2VA 5EZYB 5M3BA 4A1OA 1O5OA 1AQNA 1OLSB 1QAMA 4I46A 3JXEA 1WMBA 4N9QA 4DR4B 1KF0A 1V1RA 1F6DA 3C3AA 3WHPA 3FGOA 3ND7A 3WMGA 2IGBA 4UBJA 1Z7WA 1N6RA 5BW8A 3T34A 2YCLA 1J06A 4L7QA 1NHWA 2VOJA 2RGYA 1P18A 1Z4OA 4PCAA 3PFNA 4H7DA 2G5GX 4I3GA 1O03A 4MWTA 3IUPA 5B3AA 1WCV1 2G76A 4YPOA 3DGEC 3K9HA 4IZ6A 4JU9A 1E4VA 4HH0A 3V2IA 4HRAA 1ZHOA 3PGLA 3R3ZA 3TL6A 3HPQA 1C1HA 1T0PA 4UQPA 5SYNA 3RAFC 3QHQA 1NW4A 2C3MA 1L3IA 2HADA 3O1LA 3A25A 1CKEA 3PWTA 2O7RA 2Z08A 2Y0BA 2AKEA 4PSDA 3MHPA 1H0KA 3JVUA 3VH1A 1V8PA 3I30X 1HTTA 2Q4TA 2W6ZA 4YCSA 4M0MA 1S0UA 1XZEA 3T5BA 3WZLA 3UAOA 5KPJA 1F6BA 3CRQA 4H08A 4HDQB 1W0JA 1KRXA 3EPKA 1CTQA 1K5PA 3E23A 1VKHA 2FXVA 1RWQA 3OFND 3AVYA 5C31A 1MA3A 1FDVA 1HV8A 1UKAA 4C0HA 1HGXA 1PR0A 2GCEA 4CEJB 1K3FA 2CVPA 1L9KA 5AXBA 4DRZA 2YS7A 2OGZA 1HLPA 4XVRA 2JEZA 1Z2CA 4K26A 3SJAA 3WL7A 3WRYA 3ZDRA 4D9HA 2QRZA 5A5VA 5CB6A 4X91A 5HFAA 1GDHA 4DEVA 1OE0A 3W04A 5IABA 2BONA 5KOHB 3LFTA 2IH5A 1R18A 2MINA 3GLHE 1Z4JA 1QANA 3DMRA 5TLSA 2RIRA 2CLKB 4UC0A 2XLBA 1YMUA 2BFEB 3DL0A 3DDSA 5JVDA 3D1VA 3HCFA 1T8RA 3NBYC 3TBKA 5C4MA 1EDEA 1QCCA 3PHHA 5IJAA 4NESA 3SHTA 2C3UA 5DH9A 3V4OA 3PQ4A 4PX9A 2FRDC 3CEMA 5CDHA 1AKEA 4P0TA 2XE8A 1VCOA 1W0CA 4OIMA 4GUAA 2P3QA 4V0KA 4WLOA 5KI6A 3ZVRA 1NMSA 4M88A 1TM2A 2NT4A 2WJPA 2RHMA 3KSMA 1JNYA 3U09A 1TZ2A 3Q3JB 4QLBA 2DLCX 4UBLA 2XRYA 4DZTA 1L5HA 1EZ1A 4NX2A 2FCAA 4ALJA 1Y6FA 2CXUA 5CA0B 5TB5A 1TGYA 1FXSA 2VDPB 2YASA 1RPZA 4KNYA 4MYSA 3ZZTA 4JXXA 2BGGA 4MB6A 4V0OA 4EYGA 2OFXA 3ZTYA 1MGOA 3VO2A 2YUTA 4C6SA 3F3KA 3WAGA 1S8NA 2UVQA 3EWAA 5T6BA 2PRSA 3VBCA 2CJWB 3ICOA 4RXTA 3S2FA 4BCCA 1MEJA 3L02A 4ISBA 3DL2A 4KLRA 4PVDA 4WA7A 5BXYA 3KYIB 1A9TA 4UATA 4FHZA 4ZVQA 4B3IA 1OQAA 2P6OA 1HF3A 4D9CA 5I4IA 4I3FA 4C6RA 5C7IO 4X93A 3T3MB 3W6NA 3DMTA 3W8NA 2VHUA 2K87A 1GM5A 1O8CA 4YAGA 3PPXA 4CYMA 5P21A 1UC4B 2B78A 2IXTA 4LJ6A 2J5QA 4ZQFA 2HA7A 3VXKA 5C53B 2CB0A 2KI5A 3IGFA 2VSNA 2YWDA 4UNNA 3B7WA 3EXIA 4PIMA 4WCFB 4YS6A 3BREA 4B46A 4CR8A 5KJFA 1ML3A 2RC6A 3LBNA 2H5EA 1LRKA 5F7JA 4PBSA 1T8TA 2RH9B 2PSHA 1RE0A 2D5IA 3B9PA 4H1TA 1SQ6A 1P74A 4IJQA 5C46F 4GPIB 3CMCO 3GG2A 4GD3Q 4R1LA 2Z56A 3WMXA 3HP4A 1BU5A 1XO1A 3A3PA 5L3RA 1GNQA 3R0JA 1U28C 2NZVG 5CVJA 4YJ3B 4XR9A 2Y66A 3Q88A 3QMVA 1G6OA 2ZYSA 3TSOA 5JQGB 2X1LA 3D4IA 4NBKA 1TCVA 2C5GA 3KO8A 4CV0A 2XBUA 2EBWA 5EHNA 1QH0A 3A3YA 3M1IA 1IL0A 1EXMA 1EWYA 1NXTA 2Q2VA 1I10A 3EWNA 4JEMA 4LOKA 1WY7A 2O7QA 3GJ4A 1ZX1A 3FPSA 1RW4A 2TMGA 4FMDF 4XIYA 5DCYA 4BLQA 2XZOA 1B26A 1G6Q1 2DQZA 2R8OA 4OHXA 4OPMA 1YDMA 2O48X 1BCRB 1NUHA 1ZYUA 2HNAA 3N2LA 1N5RA 3FVWA 2OHXA 3K8YA 4WT7A 5BSTA 4X9XA 2HA3A 5GQSA 4DAOA 4MMZB 2V7TA 4M1WA 3WJ2A 3A9WA 1CZNA 1T9DA 5LQSA 5K9ZA 3HGTA 2CHGA 3AETA 3FMOB 3ESQA 3LQYA 3QJ5A 1PV2A 4KPEC 1SUEA 4KPGA 1QHHA 4GQBA 2P6RA 3V55A 3CUEF 2BH9A 4JUAA 2JGDB 3LCRA 5KNDA 2PX2A 3UHPA 2JCYA 1QGYA 4AYWA 3TX6A 1RXYA 2CD7A 2QRVB 3G2OA 2QX7A 1A98A 1PSWA 1A5BB 2GEFA 2Q99A 3OEHD 4IQGA 1MKYA 1Z4PX 3GPCA 3TZBA 3W5HA 4ZV4A 2P11A 2FX2A 1ZC3A 1EX7A 4O4HF 1C1DB 4B6JA 1CJTC 1EUCB 4ARVA 4FFMA 3F5FA 1GZ5A 4QJ3A 1AO3A 3C1OA 3KYCB 3OBIA 2G0NA 3NHBA 5HF5A 4CEIB 4Z6KA 1QH8A 3V9AA 1OAAA 1UWCA 4HB3A 4U6QA 2OO5C 3EK2A 3WLKX 1E1CA 2ORVA 2QGNA 4ZXFA 1YONA 4B3HA 3E3MA 1QHIA 3K32A 3CZQA 2D2VA 2H7XA 2V59A 3DCNA 3IODA 3MNFA 3R3WA 1GPWB 1O95C 1TU0A 3RAEC 3BB4A 2AF4C 4GXNA 1NXXA 2P9GA 4EELA 1OH6A 1QGUA 1TZKA 3D2CA 4LRXA 1NT2A 4EHKA 3F4BA 4AURA 4UUPA 5EQTA 2C03A 3G9ZA 1JBQA 4BLOA 5HDBB 1OX6A 3RDPA 1RQRA 4GC9A 4MVJA 4FYPA 4TYQA 1YR7A 4EB8A 3SJUA 1IPFA 1D0VA 1RQPA 4OXKA 2J6HA 3QFTA 2HTFA 2RBGA 4BWGA 4DNPA 2VFAA 4KK3A 2BCJQ 1EFAA 3KBOA 2Q3DA 3LT1A 3T4EA 3NHRA 3AEKB 1NIJA 2FEKA 3P9NA 2ZYIA 1XP8A 4A0GA 1FIUA 4ZK2A 3A1NA 1R0CA 4B3RB 1P0FA 4AG6A 4UQLA 2FEMA 3VPFA 5AKXA 2PS1A 3KEQA 3U7QB 3M7IA 4NBWA 4M8IA 3WLAA 2PJUA 2V55B 3RKUA 4ZHQF 1LPPA 3K1AB 1RQXA 1SXGA 1MR3F 1MA0A 1TF5A 2GLTA 3DKRA 2XWPA 3M3PA 3NGLA 3PB3A 4ZQCB 4BMVA 2IX3A 3FOCA 5CNJA 2P9ZA 5AJZA 3WRXA 1Q0HA 5A03A 1JUDA 1TJNA 4G0OA 1NJ2A 1Z39A 4OA5A 2TYSB 1I9CA 4BO1A 1L8XA 3CVXA 1MX3A 2V65A 3JQAD 1Y98A 3O0TA 4JI1B 1AJEA 4C03A 1VGQA 4MYUA 5GY7A 3FWNA 5AW4A 1PX2A 2ACWA 3TAHA 4RTSA 2GF9A 3OZVA 3TQIA 2HR1A 3T35A 1SKYE 4AG3A 1OW3B 2ONCA 2Q8PA 2WE8A 5BV1A 2NP6A 3CR3C 1QCZA 3WAJA 3Q0TA 4A0SA 3DHNA 3E2IA 1QFJA 1VIDA 2EC5A 4PGAA 5BQPA 4G41A 5K3AA 1N36B 3LT2A 2D7JA 1QTNA 1NVVR 4R9SA 1PR6A 2JD0A 5DXFA 3VUEA 1KORA 1NLYA 1XAIA 2A3NA 3D3WA 5K3DA 3GJ5A 1A77A 3OE7D 5EEGA 2HMYB 3V7UA 2GN2A 3C6QA 3S3TA 1E1RA 3VMFA 1YRLA 5DGTA 5DTIA 5L4SA 1XZCA 3QNUA 1IY2A 1P2UA 1W9HA 5EMLA 5T4HA 3UK1A 5KUTA 5CH3A 3EF0A 2BFEA 1UOEA 1D07A 1AX9A 2ZUFA 2QUJA 2DHDA 4IQFA 2TSYB 4K1XA 1IWOA 2UVPA 1TUEA 1UCFA 2RGCA 3BWMA 1LDYA 1JEOA 1ADJA 1RD4A 4OGFA 4MSUA 3RJMA 1A3CA 5LLDA 1BAPA 4GPD1 4BVLA 1IBLB 1T6ZA 3PXAA 5JD4A 1LX7A 4MR8B 3DZIA 2MJLA 2RGRA 5TJHA 4C01A 4V0RA 5B4VA 5CBPB 5ALQA 5FLXA 3KYDA 4NXNB 2DU8A 4Y6GB 4LQDA 4B4WA 1W581 2HBRA 4MLPA 2RHRA 3GR6A 4TRJA 3VDXA 3RKSA 3L4BA 1A8PA 4TLDA 3PJGA 4R1PA 3R8XA 4BLUA 4WRRA 2FWBA 1N9GB 5F5NA 2Z5GA 4AO6A 2CUTA 2IYQA 3MFQA 2XX3A 3ODPA 4C0XA 1RLIA 2WV7A 3AWIA 2ZZMA 4Q5IA 1C1YA 4P31A 2K7FA 5E1BA 3FCOA 1KRHA 1L5RA 1LEHA 2B6NA 5JRDS 4CKCA 4TX1A 4WN3A 1LUAA 4M7WA 3HKCA 2BMEA 5DNVA 5G0TA 6PFKA 4Q0MA 1ZIDA 1U1DA 4DUGA 1VDMA 1RAGA 1CW2B 2BFCB 4OQYA 2J09A 1UPCA 3MC1A 4FLEA 4OBEA 2XTNA 2Y4NA 3KZCA 4O4IA 5CITA 1MB3A 1JECA 2JIPA 1IB0A 1OX4A 2H9AA 3L6DA 2FUCA 3DZBA 2B4TO 3RC3A 5ILOA 4LHXA 2VL7A 3PWSA 1Z18A 2BGNA 4LDPA 2WWRA 1UJ4A 5HK9A 3DWFA 4GWGA 3S1AB 4CNBA 3JYLA 4CT5A 3LYUA 2QTHA 3W34A 1V41E 2R3SA 1VXRA 1POWA 5JXGA 4BC0A 7AT1A 3C3YA 5EVJA 3X0DA 2GWHA 3WYNA 4TN5A 4LGCA 3E7PA 3HB7A 3PYLA 3EPHA 3FGNA 1ZQ9A 1FFBA 5DM70 3KL2A 1GAEO 1MBZA 2ZTHA 4BKUA 4C3OB 1CVLA 2JHAA 4JEUA 2BF7A 1CQWA 3HN6A 3UB2A 3SQMA 1FSPA 1AHNA 4CNQA 3B1JA 3BH7A 2F62A 3MELA 1ZJJA 1JN0A 3NNDA 3MJRA 4C3ZA 1GYQA 4JJKA 4NBUA 3UUGA 3W3AH 2DUJA 4FYIA 3RTGA 4L5YA 1SCUB 1SZJG 1JAXA 3QBVA 4PCVA 3MS2A 3COZA 4GYYA 4HNVA 1P1HA 5KYXA 1QVWA 1LSUA 3LA8A 4B76A 2DUMA 4LJRA 2HV9A 4Y0NA 4NCKA 2M2IA 4OHZA 1XD2A 4KXWA 2HCTA 1MQ9A 1UFOA 5I5EA 1J8FA 3QUSA 3RS3A 4Z9YA 3A4VA 4XIFA 2BMVA 1EHCA 1QQBA 2GBCA 1XEXB 2XYGA 2ZYVX 4Q3EA 5AKYA 4DQXA 1U9IA 1FFWA 4P36A 2O2YA 2LNDA 3GRCA 3R24A 4KQKA 2EIHA 2FMHA 4A8JC 3TG8A 4KQIA 2XVYA 1Z2OX 3ZE7A 3K0FA 5B7GA 4H1WA 4B6OA 3T0IA 2I33A 3W5VA 4WBNB 1UZAA 2KHZA 4HWRA 2OR3A 1Y5RA 3QZUA 1CIVA 3EFOA 5G53C 1KP3A 3HR8A 2FPPA 4M8SA 5F9MA 1JVBA 1XDGA 1ZN2A 4FGJA 4TV8A 4GYWA 4MP6A 2ID7A 3CISA 2PAFA 1DC5A 1NDHA 2J8ZA 1NMZA 3LCMA 2ST1A 3IIEA 4FNMA 5AK0A 2H5IA 2Q1SA 3E8XA 4DG5A 3CWQA 4HTFB 4LIPD 3DLHA 4KZKA 2XCIA 4DXHA 1N1EA 1PJTA 2IHTA 1NTOA 1YDWA 2NYVA 1XDBA 3B3JA 3GEDA 3QXGA 1DUIA 5CRIA 4BUZA 1XPOA 1U2DA 1KEVA 3RR2A 3HJAA 2ZI7A 3HKBA 1DIGA 4ZQBA 3ANSA 1ZW6A 1QIFA 2GN8A 3GHHA 2PSJA 4TROA 4CMKA 1XQ6A 3FPGA 3LMKA 2NSDA 5HBGA 2XB2A 3GGCA 2PRIA 4AZ3B 1YC5A 1X80B 4QTZA 2E87A 3IQFA 4FZ5A 5EERA 1QIEA 1DTSA 1WEKA 4HG2A 2P91A 4B7ZA 5BN5B 4CU2A 3OFKA 4IXNA 3RK1A 2R8ZA 3ZDFA 1VFNA 1QH1A 2G9NA 3C4JA 3R40A 3UPDA 3KZOA 4DR1B 3EGDA 4PXAA 4BLPA 4JIGA 5KWEA 5EIHA 2CVZA 3L2OB 4MI3A 3TRKA 1THGA 4NYIQ 4B74A 2OQ2A 4O25A 1T26A 1LLDA 2PWBA 1TW2A 2FETA 2EG5A 3USZA 2ZBEA 4LK3A 3SLRA 3K0CA 4ALIA 3IESA 1P4HA 4HFJA 3ZGLA 4F85A 7REQB 4QPCA 4RKRA 3D7SA 4RVDA 3THOA 5TSDA 1W30A 1RLOA 1AK9A 1V71A 3E9YA 2VN8A 4GWLA 1TVEA 4UTRA 1FFDA 2X1VA 1IBRA 1Y7IA 2F1IA 3GFVA 5F3WB 5AO9A 4I8IA 3DAPA 5D1HA 4DIMA 4CXMA 1E9EA 1A88A 4G65A 5D87A 2GTHA 1WUTA 2GK3A 2WNSA 3U4GA 3HBJA 3NAQA 3AT1A 3M5CA 4UU0A 3BL6A 1V16B 2XNDD 3VUFA 4TSKA 4BGDA 2NU9A 5AVKA 2FSFA 3DMTC 1HT3A 1K68A 3DVLA 4BHTA 2QTAA 1URPA 3KR2A 3P71T 3MTQA 3CRW1 4WUTA 1Z08A 1BE8A 2P2SA 4IAOA 2CT8A 1Q22A 4R05A 5BNWA 1HQKA 1IHXA 4IS2A 1KI3A 4GZ6A 2JLVA 4K46A 4LA4A 3EDOA 5CG1A 1RRCA 2Q3BA 1MRNA 1G63A 3D0QA 3LSTA 3VOAA 2OM2A 4DWVA 3ZLTA 5EHXA 4TZ6A 1ZSNA 3WL5A 4BJ5A 3VX3A 1Q17A 2QTTA 3JZMA 2VJMA 3HYRA 1YNSA 4H4DA 5F9FA 1SR8A 2O0MA 3EXHA 3DMGA 4OLBA 2R6CA 4KVAA 5KYKA 1W76A 4F9GA 3BXPA 1UT8A 1NUAA 2AQ8A 4N0EA 1EVIA 4S24A 2VUUA 1QAOA 2FWAA 4J0KA 4BPBA 3AXTA 5KNBH 3GI1A 2RAPA 3L8HA 2C4TA 3E1SA 4JUFA 4RA9B 4HSEA 1A4XA 4BMCA 3MWKA 4CT0A 4A0HA 5T7BA 5AICA 1U1IA 2ZRCA 1P3DA 3AVOA 3DDZX 4ZO8A 4DTIA 4JI6B 5IYZA 2WYHA 3P0HA 2E5LB 1WMEA 4I55A 1IEXA 4D9KA 1JVNA 4IJ6A 2FSVA 1YJ5A 4Y6OA 1ADYA 2EQBA 1ZEJA 2FEWB 2QRHA 4NP6A 1UAAA 1KFCB 4B09A 2BTQB 2JIOA 4FT4A 4RIGA 1GLVA 5IN4A 1U65A 4MIKA 2DWCA 3RHSA 1JEYB 3BZUA 1JFFA 1ISSA 2HQ1A 1QVZA 2UUOA 2GBLC 5DK6A 5FWAA 4MLZA 1T4BA 3ZLUA 1GFSA 3TF5A 1WMSA 3UWMA 1H9BA 2X8WA 1C3OB 5CX1A 1FCJA 1N9ZA 3ILYA 5FB3A 1EP1B 2XXAA 1JSLA 1RLTA 1X9GA 2IWHA 2YRFA 3WLIA 1DINA 1P4JA 2ROQA 3FGZA 5H3CA 3ZGOA 2VHEA 4E5DA 3QKSB 4GPEA 2G63A 2H5JA 2YJ6A 2WICA 4QUIA 5CDFA 4FIZA 3U4AA 2QQ0A 3BBLA 2NXWA 4MJ3A 4CLRA 1BQEA 1QHXA 1JHOA 5EQDA 4DXAA 1ETUA 4G67A 2EFGA 4GMGA 1XAJA 2R4TA 4R1NA 1J5XA 3AP3A 3DBRA 4TMYA 3HXOA 1GAWA 1L8AA 2IV7A 1UDAA 5ALMA 2CHUA 3IMKA 3EEOA 3UJCA 2D62A 1T1IA 4C7OA 5IDYA 3KD2A 3O7WA 3GVCA 1T3ZA 3NEJA 3ROKA 3LXMA 4MI9A 1YK0A 3GFFA 3NHJA 1Z0SA 5F21A 2F3PA 2CNDA 2W6ID 2R8XA 2JCXA 1CLUA 1U4NA 1XLWA 4ACAA 3R9WA 3WWZA 2E4ZA 4V24A 5LOVA 1Q14A 1SVMA 1AA9A 1AKVA 3JAKB 2ZRNA 4UHJA 3GXBA 4WVFA 4AJ1A 1IHDA 2QF7A 2GCPA 2PL3A 3QW2A 3I73A 4GYJA 3BFJA 3EARA 3KJQA 3AF6A 2QP3A 1N5MA 1UJ6A 1DIAA 1SQGA 1WKCA 1FTGA 1SM4A 2Q4DA 3DFZA 4I55F 3G1TA 4LYHA 4MVWA 4QUAA 5T57A 5BSGA 5JR3A 4CEHA 4C2AA 4GR4A 2GQ0A 1XKXA 2JIQA 3KZKA 1QRRA 5T8KA 5TPZD 1F06A 5ADHA 1UC9A 4F6RA 1LQ2A 1NVMB 4DGSA 1EUZA 3H8SA 3QKRA 3EIXA 3OP4A 4GMFA 2ID8A 2X13A 5FXMA 4ZYWA 4KXNA 1WMFA 5AUQA 1FUUA 5ICGA 1H22A 2NYRA 4R7GA 2C2WA 3M1LA 2O3UA 4MI1A 2VHZA 4IO1A 5E8RA 5EHQA 4X62B 3FD8A 4CM5A 2CUZA 4KJXA 1AKMA 3DC2A 2IQ5A 4JC4A 4LWPA 3D3JA 4OJNA 4ZRDA 4KXVA 1SUWA 5SY9A 2VEDA 3MVEA 4UMEA 3A6HA 2V96A 3IAEA 2VYNA 4PIVA 1SNYA 1UAGA 3AEUA 3E81A 3IRUA 1KO5A 4FILA 4AJ2A 3QVSA 5JI2E 1ZD9A 1ZW1A 4S2UA 4ATNA 1SUPA 2HHCA 2F1OA 5LWQA 4UEWA 3DZCA 2O7SA 1IM5A 2BEVA 1NJSA 1JHXA 4LC0A 5IHXA 1M2EA 2GPYA 5K03A 5CHYA 2WAXA 2JAOA 4C4XA 3AEYA 4L9WA 5H3HA 1CEXA 3FMVA 3DBRB 4PC1A 4EKEA 2QRMA 2KM1A 3E6AA 4JT9A 4A8TA 4J94A 5ITZA 4B3MB 4IIXA 3D7RA 2XBLA 3VC3A 4D8XA 1BFDA 1SUFA 5K2OA 3MJVA 1K98A 3TPCA 5AJWA 5BNIA 4YMUA 1MIOB 2PQ6A 4UHEA 3KFXA 4WZBB 5IC5A 3CPJB 2HFKA 4RENA 1QV9A 2I1VB 3KB6A 1JEDA 1H23A 2ZR7A 3AUUA 1W88B 3FLMA 4RK6A 3NDJA 4F5ZA 4JI8B 3RLFA 2CLIB 1PGJA 2BFDA 4PO8A 3PNVA 2YWEA 3JALA 2RAFA 5JG7A 4DVJA 4LF6B 3C74A 4JBIA 1YA8A 3OPVA 2QUBA 2ZU6A 3L1VA 1W46A 3M5WA 4ZQIA 1H1LB 4ML3A 4OBXA 5A71A 2KSQA 4F6LA 1QYXA 5L8VA 4DB2A 1ZEMA 2VF5X 1XTIA 1L5HB 2A5YB 3EOZA 1WZ2A 4HX5A 1P31A 1HE8B 3BMNB 3VZDA 5DBIA 2WIBA 3CO0S 4WOPA 4TV9F 1SU4A 4BQFA 1UMCB 2B37A 3AEQA 1M8JA 1UMDA 2ZI6A 1GZDA 4LF4B 4UULA 3TE6A 1ZIXA 2P62A 1OV4A 1B2LA 2KJQA 1L5FA 3P2OA 3INYA 4YT8A 1PS8A 1PHPA 1B1CA 4EMBA 1I1NA 5CFPA 2CNBA 4DLAA 3L7AA 4YP6A 1QVRA 2J45A 3FCEA 4FM9A 3GEPA 1ZGBA 3EVGA 3LK7A 4UTOA 2CHFA 2HJWA 3Q9LA 1NZFA 1WSBA 4LRQA 1GKKA 2OV1A 4RKWA 2AFHA 2DPGA 3T9CA 3AEUB 3H1EA 1Z8HA 2R68A 3L93A 1UJ2A 1GL6A 2ABWA 3GFQA 3MD0A 2CV0A 1N3IA 1LY1A 4R0VA 2XAAA 4KV7A 5EVCA 3ZU3A 3GLFE 4JL8A 1JE1A 3WP0A 2CUNA 1D5CA 3GGSA 3NWBA 4PBTA 3DBIA 3AF0A 3K0AA 1GSOA 1N3BA 5DEOA 4B8YA 3FZYA 2OWDA 3W8FA 2C84A 2GJ8A 3VGPA 4TUYA 1OBVA 4OGLA 5I7VA 1TD1A 3FUXA 1M34A 4Q3LA 3RASA 2ZSKA 3DZJA 4W63A 3LWNA 5LP6C 1QHHB 4IWNA 1S2GA 3ELWA 3D8BA 2WIGA 1WD7A 3GJ7A 5DRYA 3SNKA 3AKZA 4QU0A 4K9QA 1GUZA 3I5XA 3ZHQA 4S1NA 1LF0A 1RACA 2WF5A 1V95A 2XTAA 4EI8A 3BWVA 2WZBA 1G5RA 4YLGA 2CD9A 1L5GB 1KO4A 3UC9A 4C0QC 1XAHA 4RYDA 1KMMA 4AJ9A 1RI5A 13PKA 2WJYA 3NANA 4CMJA 4D4JA 1U7TA 2ORYA 3O9ZA 1OJLA 4A7PA 3BWYA 4GOND 4QJ4A 2IPNA 3OURA 4NS4A 4QICA 1L7BA 4AX8A 3ZDDA 1FYWA 2PSSA 3IIKA 4MYCA 3AOGA 1XVAA 3TAXA 3H7IA 4CIBA 2J46A 3PKJA 3M4XA 2RAVA 1C2YA 1YZVA 4FC6A 1VFPA 1ZJYA 3IDAA 3BKWA 3GRVA 4RZSA 1IJFA 4FEGA 3FYUA 3EH1A 1QRSA 3BEOA 3A9UA 5G4KA 5C52B 3VI4B 5A6VA 2YW9A 3JYOA 5EI5A 2FWRA 4QDJA 2FFAA 4X6YA 1WXQA 3TQFA 4D82A 4P1ZA 3FZGA 5IH7A 5JH7A 4DIKA 1GAQA 3K5HA 5BV7A 1E1YA 1DMRA 1OX4B 3IP8A 3ND9A 2ZEJA 3AHHA 5BWNA 5AHWA 2I7VA 3I04A 4WGFA 3TLEA 4JVNA 3KQLA 1OIVA 1HOTA 2YW2A 3HR7A 1MRZA 5K0ZA 2ZRLA 3SAJA 1V7PC 1NYTA 1JNXX 3H5LA 2VWHA 4AN0A 5HUHA 1WULS 3CX8A 2VZEA 3M5PA 5ADWA 1AGRA 4DDUA 3KSZO 3R7BA 4JXJA 1A69A 4LZZA 2F67A 5DDIP 4W8GA 1LJ8A 2FSSA 3JSXA 1SPBS 3TN7A 3PGJA 5BY2A 3GJSA 2WOOA 2M6SA 2N9UA 4Q1AA 5LLTA 4X71A 4YCAA 2IUEA 1EP9A 3VPSA 3ZNPA 3OFNA 5BSVA 4Y2QA 5BN4A 2O7VA 1DV1A 1CB7A 3BSFA 4A2PA 2OBFA 3KUXA 2I66A 4PAWA 2R8RA 2EF0A 2MSKA 2IYOA 3LBAA 4CQNA 4Q9LA 3K1YA 3QEJA 3CLSC 3KWJA 3L1IA 4U5XA 5H80A 4E1BA 7MDHA 1WB4A 1EM8B 1H2RS 3KTAB 5IUNC 3FI0A 4R31A 2AR7A 3DUFB 2P6UA 4UAVA 3NZEA 2JI9A 4JLUA 1NF3A 3CX4A 3NB0A 3OWOA 3DMFA 1MJ5A 4P5PA 4EO7A 5K3FB 1F8FA 1BXKA 2NLOA 2R1TA 2YZMA 4IZOA 5E6SA 3V00A 4ND8B 2GM3A 3ZKWB 2R00C 1E5VA 3QU9A 4WZAA 1UKCA 1WAMA 2GXQA 2GZ2A 3HUEA 4GOMD 2L0XA 1I2CA 4NDNE 4FDMA 1LRLA 2L18A 3GJ3A 3TRJA 4TMKA 4CLXA 1CU1A 4HAXA 2C2BA 5CD1A 2FN3A 2IW1A 3L0SA 3RS2A 1VGRA 1GFIA 1U9YA 2D1RA 2IYNA 2FR8C 2Q2QA 3SY8A 3G17A 3GT7A 1U8YA 4MS4B 4TTVA 1O97D 1RPNA 4BO2A 3IP5A 1RJEA 2FLWA 2R85A 2ZAOA 3OJCA 4V38A 5FOXA 4DADA 4F2GA 3LKZA 1E60A 1XWFA 1A9YA 3L7KA 4FQ7A 3HNPA 2GM9A 1YRHA 1OA0A 4UASA 2ZUEA 5BQXA 4IYRA 2J5KA 2WD7B 2PUGA 3WTCA 1V6AA 2F43B 1IXYA 2W93A 3HCWA 3PFFA 3ZJVA 2QDXA 1Y5MA 3AJAA 3ELUA 1E1RD 3E3LA 3OF3A 4RKEA 1LC3A 5IT9A 1GCUA 4YJHB 1N8TA 4FUTA 3ESRA 4LY9A 1JR4A 3SDBA 3VKVA 1UWVA 5BWCA 1RCFA 1YTUA 4UVGA 1IWBB 1GGEA 2BP7A 2CLMB 4MUFA 5JZSA 3NBZC 5IRCD 1VYTA 2HK8A 3I4CA 3GJ0A 1HYEA 2F9FA 4RZ3A 4BVJA 2OBYA 2DT5A 2JJQA 2WTNA 3IAUA 5DX1A 3IUSA 3PI7A 4XTCS 3O2JA 4E2ZA 3FCSB 1QS0B 4ROSA 5D5PA 2R8BA 4JC0A 1HR0B 3PTAA 4Q3KA 3RUHA 2D0DA 1Y3HA 3HJBA 4L0QA 4PLZA 4KHZA 4RIHA 2OKCA 3AQIA 1Q0ZA 4JB8A 4CFZA 1QZTA 4Q9NA 2HUNA 4LXIA 1RM0A 1Y1TA 3N86A 5TV2A 4RK1A 3U4CA 4GR5A 5DYYA 1RYYA 4BO8A 1UL1X 2RI6A 2V6MA 2X7HA 3SQWA 3FWZA 2GD0A 3DYIA 4I1VA 4UBKA 1F48A 3ABQB 4XJXA 4C05A 3IIJA 1GA4A 2PY6A 1E6KA 3EQZA 2NO1A 3GGDA 1TT5B 4LRUA 4ZQEA 1I30A 3MPUA 4X3OA 4YV1A 2V7XA 3SFVA 4Y0AA 2JD1A 4N4AA 4BWFB 3QTTA 1JQJC 3H2ZA 4R2JA 3ZWDA 1A9RA 4QYTA 3DO8A 4KQJA 5AVVA 3PLRA 2NN3C 3HA7A 1TJ5A 1LZLA 5CLJA 3I01A 4KYVA 3A7DA 2FPOA 2P2NA 4YXWD 5MFZA 2IPXA 4I5EA 2R87A 5ANRB 5B1SA 4RM3A 4K9NA 1FYDA 2WQZA 2O2JA 1Q7TA 4QQFA 1H3NA 3VNVA 3C97A 5DCWA 1XCJA 1DG1G 1YFKA 4Q3BA 1PL8A 5I4BA 2QM7A 3ZLVA 2HIGA 4FWTA 1KP9A 3ETJA 4CODB 3DFFA 3LP5A 1AXRA 3IXQA 4MO2A 2WD7A 3NHUA 1IWPB 3QTBA 4TL6A 5A4KA 3ZGZA 3O84A 4ZDIA 1EP2B 1TA9A 2AKYA 4ERNA 4O2AF 1E6WA 2VK2A 1JDJA 4OKIA 4YJHA 2QUKA 3P32A 2WUGA 5EWMB 4UBMA 3NT4A 4OGGA 1PR3A 3FHTA 3VR6D 7ADHA 1AKYA 1LI7A 5LQCA 1LB1B 2HUPA 2NTVA 2WYUA 1PT5A 1U7WA 3GROA 3H5VA 1IG0A 3UIEA 4OYLA 1GGHA 3E5MA 5A2GA 4RGVA 4HQ0A 1DBWA 5FWXA 4LCEA 4KLZA 1JHQA 3JQ8A 5CA0A 3PQ8A 4LGYA 4RZHA 1H8EA 4O4JF 1A8QA 4MUGA 2CKDA 2HBYA 3QBEA 2EJVA 1RKUA 5KYXB 4OY3A 4IIJB 5SV2A 1DAPA 4RVGA 3ERCA 1DOAA 4O2AA 5BWLA 5FH9A 2XNCA 4DW8A 1JR3E 1PW7A 1JA1A 2ZIFA 4YRPA 4RD1A 1J8YF 2PU5A 1HETA 2IU4A 1P0QA 4MR7B 2VSXA 3N70A 3AF2A 4Y6LA 4I1SA 3ZD6A 1ZKDA 4MQBA 4BEVA 4EEKA 4BQSA 1DTWB 5HPYB 1UZLA 3TX2A 1D2NA 3UW1A 3RAJA 3ZBTA 1NYQA 1J9GA 3CVUA 4Z51A 4QPJC 2LXNA 3KZVA 2QN6A 5LYYA 5G41A 4LBYA 3EVCA 3V4SA 3WBJA 2GM4A 3H0KA 3HZZA 3MGGA 3FNQA 4F97A 3PWKA 2J85A 4BQIA 1G2QA 1B8PA 1H94A 4Y9RA 5BRAA 3BWEA 3LUDA 4ZEMA 5KTOA 4WNYA 3L7CA 3VNSA 1POXA 3PK0A 2OECA 3GH1A 1GAXA 3JYQA 2ZQYA 1AQIA 2IBMA 1MEOA 4IOKA 4R41A 2G1PA 4Q3NA 4KX5A 3UICA 3QPBA 4HPXB 3ZLBA 1HDGO 4MV8A 1F2UB 3NYQA 4AYTA 4AXBA 3NHPA 3A11A 3T7AA 3B8HA 1LNQA 1NQVA 1JJAA 4QYXA 4ZU1X 5PGMA 1GUAA 1YVUA 2SHKA 3OTHA 3QRWA 4F5EA 1KMHB 4OH1A 1XKQA 4Q3OA 1WMAA 4RESA 1FFSA 3T1HB 1W36C 3DE5X 1L9XA 1UP6A 4M1QA 3AV3A 4C4ZA 2AI3A 6NULA 2Y27A 1CJKC 2AJLI 1BC5A 2YZGA 4GVXA 5K6AA 3T1OA 1VMEA 1BDIA 1SA0B 4M7OA 1ZRNA 1RABA 3IBCA 2DH5A 4CM3A 3X1JA 1CUDA 3CWCA 4HRYA 1JS1X 3HB1A 2ARKA 4PY2A 3B1WA 2OHVA 2UZ4A 5JO9A 2FEXA 1EI9A 1Z75A 3HN7A 4PLTA 2BR5A 4C7BA 2E4WA 4FFRA 3Q1LA 4E0BA 2G09A 4ZYYA 1C3VA 1V4VA 3L18A 3QFRA 4EI2A 1T9KA 2YYSA 1OYVA 3GH3A 4OQ4A 4LDJA 3K94A 4QTUB 3HKDA 4BV8A 2EF1A 1PYGA 2DRIA 3IPCA 3OHSX 5GV8A 4WDQA 4ZCLA 1KOLA 4RIFA 2SKDA 2E82A 2P2GA 4EGJA 5K99A 4N03A 1DFHA 5JY1A 2R6JA 5FFFA 2YXNA 3G2NA 3RJ5A 4PR3A 4I1RA 3DDOA 3EVDA 5BN1A 1ZU4A 4IM7A 5JJIA 5C80A 3B82A 1XR3A 1C3XA 1RRGA 1SCIA 3WK8A 2REBA 1SHTX 2PUFA 1QO9A 5EXEA 5KOJB 2AQHA 4K8RB 2IPAB 1HE1C 4QYMA 1JU3A 2HIMA 3HDQA 3K72B 1KEEA 1XJ5A 2CY0A 5ED0A 4ZI5A 3ZV4A 3KOWA 4EI7A 3B1YA 3SVTA 2VCEA 3HLYA 1DBIA 2P4HX 1U7UA 4JLWA 5LQRA 5TQ0A 3FIJA 2GVDC 2ONYA 4YCDA 4YAJA 3MUFA 5CCDA 5I7SA 2YNMA 1JJ7A 4BZXA 3DE6X 4H6XA 5JCOC 2PE5A 3JVIA 1MFPA 2P9FA 1MOPA 1ZN8A 3M8KA 4V1CA 4P98A 4ADSG 5DT2A 4F96A 1JIUA 4GP7A 3BQMB 3QE4A 3Q12A 1K8ZB 1II0A 2GEBA 3DLIA 4UPDA 2F3RA 2MT9A 2ANBA 1SXHA 3OTWA 1ZM3A 4H7EA 5JAPA 5FNVB 1WBJB 2R6DA 2ZVJA 3G5MA 4B34A 5CEEA 3S5JA 4DYVA 1XZKA 1WV0A 1OY1A 2GYYA 2G25A 3P2MA 1E9RA 3A06A 1XN1A 2Z3VA 4FCWA 1P60A 4CG2A 3V9PA 3EXG1 1Z0AA 2YHUA 1M2HA 4L76A 4RACA 4XIJA 2XF8A 3WGNA 4CG1A 3PEYA 3AKCA 1C9KA 2G88A 3EXAA 3LDFA 1NVEA 2C9MA 3JALB 4PF1A 2HRQA 4QOGA 5HTOA 4KZPA 1KH3A 1GNLA 3Q3CA 4FMCF 3WLRA 3GA0A 3ZWQA 1ZVVA 2N46A 2X2PA 1D3AA 3NUZA 3LE8A 4QA9A 3AO0B 3GFRA 2Z2ZA 3EYAA 2Q9AA 4LRSB 2QHXA 1I13A 1FQJA 1ODJA 1U4SA 2Y8EA 3FMGA 4RETA 1OB2A 1K3TA 2EP5A 4CN8A 2AFVA 4Z0HO 2ZS8A 4Q05A 4JLBA 5CCEA 1KHHA 4ZTBA 1UM9A 4BX3A 3HJTA 4PYRA 1E2KA 4XDZA 2BSXA 2HJRA 4QEZA 1YQUA 4Y1FA 2Z2IA 3TRHA 5JNWA 1Z47A 3ZX5A 4MPTA 1WW2A 1CQZA 2H1FA 3ADPA 5DWDA 2D8AA 3D8HA 2H63A 4M8KA 3NXKA 4Z49A 4S04A 4EUFA 3W2GA 2DPLA 4IJMA 4AZWA 5TE9A 2PLAA 3TQCA 1US8B 1AIPA 3CX7A 3LDHA 3MCUA 4MWOA 2VRCA 4QFDA 5AVTA 4JBLA 5IZ4A 1E9DA 4MRMB 2V0CA 4B85A 3EBLA 1WKVA 2XTZA 4UUAA 2NUPB 2AQKA 2ZRHA 2WYOA 4D43A 4DIOA 2WJVA 4RF2A 4LK2A 1V5WA 4AZ0A 1DIRA 1IC6A 3PEFA 4BRSA 4A15A 1J42A 4X97A 4ECEA 1KJ8A 1YBFA 2QN1A 4L5BA 1E3TA 4V1CB 1G291 3MB8A 4CEIA 5GZ6A 5B37A 4XEHA 3NT2A 3FAZA 3SC2A 3NNNA 1ZUHA 1W5AA 1TU4A 2IW3A 8ADHA 3H65A 2QTLA 3UH1A 3SK0A 3BAFA 5FUQA 4F6RB 1ATIA 1M5TA 1UPBA 2A9KA 3FVVA 4GKBA 5CT6A 4JI7B 2QPLA 4NDAA 4PNEA 1JQAA 2AOUA 4KQ9A 1Y3DE 3G9XA 1HYHA 1H66A 2DFTA 4ESVA 4PSVA 2CC2A 4IIBA 1AK1A 3M49A 5B1HA 4HCJA 2UVPB 4L9AA 3G2MA 4ZAZA 1ISMA 1PI3A 2DEUA 3U6KA 2RGWA 3QENA 1I1HA 5E4TA 5C3MA 4RA6A 3I4LA 2PZJA 4M0FA 2C4KA 4M0PA 1YVRA 3LI2A 2ZU0C 5JLAA 3AHDA 3I58A 5J4VA 5K0CA 5KSZA 3CN9A 3HCAA 3EGXA 4IDCA 1FF9A 5CURA 4E31A 3UUWA 4F4IA 2DMRA 4LHSA 3G02A 3SU8A 1I2BA 2FMXA 1LBQA 4WTOA 2MMCA 4XUEA 4AMYA 5KQPA 1R6TA 3QEAZ 4Y67A 5EESA 4UUQA 1YRBA 4L8YA 3BHNA 1EK1A 3EEYA 1SKAA 3WSTA 1OTHA 3I2GA 3OY2A 3LP8A 3HKCB 5DCUA 1WE2A 3SKVA 5KNCD 4TKMA 2OZLA 2VOEA 1F4VA 3G0IA 3OETA 1DTEA 2NNLD 2GOYA 3HA2A 3KZNA 4OHWA 1T3TA 3RW9A 3I1IA 6ADHA 3HEAA 3A1VA 1L7NA 4UCWA 4WCFC 4F45A 1KMIY 5JY6A 1XXHA 2O3RA 2A1UA 4K2AA 4UE6A 2H0RA 2VZ0A 1VKRA 4TKVA 4AZ0B 4Y2YA 4ZI3A 5E7JA 9LDBA 5J3JA 5IBCA 4FFOA 3G88A 4N6GA 5EC8A 3H75A 2RGAA 3MUOA 1NHGA 3NTLA 3BRWD 4JR1A 4WESA 4C0KA 4ETWA 3OMXA 5C7LO 4EL0A 1RKBA 1E4YA 3QE2A 4BKOA 1FDSA 3W3AD 1A71A 1DADA 1MJHA 5EZQA 4DMKA 4DDKA 3GAMA 5J4LA 1E89A 3MAGA 3NIGB 5TEWA 2ZJYA 4D56A 1YS4A 4KGDA 4BB0A 1MZVA 4KLAA 4ZOCA 5KTSA 4NNPA 1G5PA 3VR2A 1FX0A 4QGFA 2HCRA 3FKJA 3AFGA 1LTQA 5DHRA 3IEIA 1IJBA 2C1ZA 4I6GA 1MIHA 2ISQA 5JYCA 3HTXA 1QE3A 1ZRMA 3LLMA 4BE7B 1XBTA 2NP7A 1KDPA 2Y9PB 4C0SA 4F06A 4ZP1A 4I6EA 4JBWA 5DBHX 2QJOA 3W9UA 4DLKA 3HCOA 1BWSA 2JNWA 1EK0A 3AI7A 4WXHA 5GIOE 4ND8A 3L8ZA 4P4LA 1BVYF 4KFRA 2VQ3A 1XNJA 3BN3A 5KNCH 1MC8A 4UKDA 4AT1A 5JEDA 3KSBC 3AB8A 3RD5A 3UKJA 1OBCA 4JLSA 1QLJA 2Z3WA 3LFHA 5KOIA 1ZU5A 2QLNA 5FFNA 4XVCA 2CXPA 2VYCA 1FJ2A 3WMWA 2DKOA 1KFKB 3WQBA 2IHUA 4N48A 2GARA 2GYUA 1ZXBA 3CEJA 1D9XA 4WLEA 4HI0E 5KHOC 1ZL0A 4C0BA 4QLOA 4M1KA 3OJOA 4HAZA 4RJTA 5HUQA 5K8UA 1MAUA 2CZCA 2H0AA 3MGBA 3R5KA 1GDTA 1KS9A 3TR5A 5YASA 2O6HA 3F78A 4HADA 1SHKA 4DPLA 2R1UA 1CUEA 2BGLA 1ZOSA 3PA8A 4I1OA 1DMSA 4OHKA 4IH4A 1GPJA 1H2XA 5FTLA 3H1FA 5IG2A 3QUAA 3I9V1 3JTMA 3GNLA 3HY6A 4CLOB 4PE5B 4QHTA 2A67A 1YIOA 4L4SA 4OQDA 3KKEA 3RIEA 2PUHA 3VSBA 4B84A 3KPVA 5ER9A 3W9YA 4ZZ0A 1SXJB 5IT5A 4JI2B 2IH4A 2QSUA 2BT4A 2PX4A 4QREA 1D2AA 1OB5A 2WAAA 2WDPA 3EXFA 2HF8A 4OK5A 4FE4A 1U8EA 2FR0A 1UBNA 1AKUA 1D4FA 5FL7A 1QE5A 4NJMA 5AOAA 8OHMA 4UMFA 3TKYA 3WGHA 3ICQB 1P72A 3M9WA 1EVQA 1JFLA 1FX0B 3SYKA 2P4UA 4F56A 2PU7A 3TIGA 5AVQA 4XSGA 2IZ1A 1GIAA 4CKYA 5EUQB 3ZBQA 3CNOA 2ERXA 1T29A 3IAM6 5KJ6A 3OQMA 2VYND 4FYJA 4CLEA 3IT0A 1JLHA 3MTGA 3GPIA 3ETNA 1HZZC 3PF9A 4J3NA 4MTLA 1K3UB 1SELA 3ZQUA 4AECA 4HPWA 2O5EA 2VSOA 2DULA 2CFRA 4Q3DA 4PSUA 4BQQA 3HKBB 3LUJA 4KP7A 3RS8A 1P1BA 1XTKA 1ZSVA 2GZ3A 3LC7O 4BY9E 2I78A 1PJCA 2AWOA 4O4IF 2F9LA 1A82A 2NSJA 2O6LA 4P5DA 3ZGVA 5HW0A 4YGXB 4GLFA 3G2QA 2D7DA 1BFUA 1FXWF 1DO0A 3IL2A 4URXR 1E2FA 2C92A 1K8QA 3MS4A 1FYEA 4YBZA 4ENVA 5KTNA 2Y1GA 2ZSUA 3RSFA 3L84A 4E5SA 5IJZA 1FNCA 1Y81A 3CWZA 3FLBA 5MN5A 1NBWB 2DCMA 5JQGA 5LZ2A 4CKEB 5I7RA 1JRLA 2RHHA 3O3OB 1ES9A 3D6NB 5DSXA 5EIAA 3DB1A 2BV3A 3PUIA 3K2BA 2C9CA 1G9SA 4TT8A 2RE8A 1HT0A 2C59A 3IV9A 4QUHA 1NNUA 1JMKC 3LT4A 3HFSA 2PL9A 2VHWA 1Q1GA 1B15A 1GHTA 1IM8A 2XDQA 3HBAA 3D4PA 3NTUA 3OX4A 4JASB 4P58A 5CAEB 1GGJA 1UMBA 2JKVA 4JKYA 1G60A 2ZIUB 4EYEA 4BP9A 3NETA 4CM7A 1Z88A 1PJ4A 2CFCA 5AWFC 4TMVA 2PX0A 2UDPA 3UV3A 1W2WB 4MXDA 2BYTA 1KI2A 1YZTA 2GCNA 4RPGA 5ICCA 3OQ6A 4HNQA 4D9EA 1D7OA 2W2VA 1T2AA 4OI2A 1AURA 2WJIA 1BX0A 4QIHA 3OCCA 4O4JB 4BKRA 4JYAB 2VYQA 1NG9A 2XR1A 4YDHB 5CA1A 4ZPXA 2HGSA 3A2MA 3AHIA 3DTVA 4XB6B 3ZC3A 1Z06A 1L5NA 3M1YA 3EF1A 2XKKA 2R1TB 2XYQA 2XODA 2EKLA 1F0KA 2GK7A 2H1WA 1AGPA 1JWBB 2JZOA 1WXDA 2V3WA 3RT1A 2EJWA 2G70A 4PXYA 4I55B 3KJFA 3ORHA 3JYNA 1H2FA 1GWNA 2CNLA 5EP3A 4E5KA 4HEA1 1NU8A 4HNGA 4RS3A 2YZ7A 1N6HA 4GSLA 4QODA 4DLPA 1B6GA 2NAFA 1E62A 4JEHA 3CRRA 4P84A 2QJRA 1VZ2A 2OC9A 5BOSB 1R4MA 3FX2A 3CJTA 3PX2A 1GGVA 5JAMA 1FW8A 1YR6A 3GD7A 1TF2A 2Q2WA 4Z8YA 3K0KA 1G20B 3KSRA 1DIHA 2X58A 3TH5A 4N7JA 3DOJA 3IMGA 4IWYA 1KDOA 1T5BA 5E9WA 1F9EA 1MHPA 2I7TA 1Y4AE 1DAHA 3F67A 4RK5A 5BN3A 4ZV7A 2WIDA 4YUXA 1TEXA 5EIWA 3AR6A 3EAGA 2AJBA 3JQQA 3KDAA 3PU6A 4CKEA 2WKWA 1X0VA 4X6UA 4QUDA 2WF9A 3JPYA 4UD2A 4C7KA 5FEMA 5SZHB 1KBZA 4H0CA 2GSDA 2Q1XA 3V8MA 3SEQA 1E6LA 4NOKA 1FBNA 1DFGA 4LTDA 3ADBA 1FA9A 3GFPA 3H9QA 3IAM1 4AMGA 3PPYA 1NIPA 3PVCA 4HVCA 3WHKA 5HJ7A 1TLLA 4HUTA 5ITWA 3IERA 3TUJC 3GU3A 3AUSA 3UM9A 4ILEA 3KU4A 1WPQA 3B1ZA 3G9UA 4Y2VA 3CZAA 2HRBA 3CXRA 3K6KA 1MPTA 1O2DA 5G2OA 4CIVA 1RADA 3TLKA 3TZKA 1JSCA 1J70A 1P77A 3R4VA 4OHUA 5EWMA 5JD6A 4F1KA 1K8RA 1Q19A 3PZBA 1AE1A 2VF2A 5AUPB 1V0JA 3QBTA 3QFHA 3RF6A 2EJUA 1WWKA 1LZKA 2D4HA 2HMVA 2BFMA 2H11A 1ZUNA 3HKDB 1QP0A 3FETA 1KH1A 2Z43A 4S05A 3VDMA 2QQEA 1E3EA 3OZSA 4IDPA 4QVIA 2QL9A 1KQFA 2UZ1A 2C29D 3KWMA 4NU6A 4PZCA 4UDYX 3AVPA 5U1PA 5LJLA 5KJCA 3DONA 1L5ZA 4P8RA 3ZWXA 4RGBA 5MDHA 1EWVA 3S29A 1D6JA 3ETCA 1HQDA 1NLMA 1PQ4A 3ORFA 4V39A 3TJZA 4J16A 4F38A 1J9EA 3UMMA 3P9KA 2CCGA 1SOAA 4M0UA 5AJTA 4JJFA 4BGUA 4M86A 5ALZA 3THWA 1M0TA 1HZZA 1OVMA 3T5MA 3KHTA 1RHQA 1CZHA 2PS9A 4QBFA 5IUJC 4Q4AA 3WFZA 2ANCA 1T5TA 2Y1KA 3OLYA 1NXOA 1OLXB 3F3SA 4B87A 4F3RA 5EIBC 4ZEXA 1KNQA 2XDYA 2H08A 5JISA 5DM1A 1H2BA 2AXEA 1VGVA 2C9YA 3MLBA 4GLOA 1KQGA 2IYTA 1IY1A 3PXGA 2HO5A 4PZYA 4AJPA 4UFNA 3EWIA 1N8SA 4C14A 4MLCA 1F2TA 3EDMA 4ZVKA 1U0JA 5PNTA 2JHPA 4Q24A 1TYEB 1WW8A 1ZNZA 1RXVA 2CDAA 3Q7TA 5A9SA 5ICFA 3QU5A 1XZ8A 2ZRIA 5CM2Z 3BIJA 1XNRB 3NYIA 4GU5A 1W2HA 4ZRNA 4NV1A 2W4QA 1V9CA 3S55A 4DMRA 2PFSA 3NHZA 5AMXA 4Q1FA 4F72A 3K1TA 2UZAA 1GKLA 1MJFA 1ODIA 1MAHA 3ROFA 3QKRB 3EGOA 4X3CA 4C76A 3HU2A 1TDJA 1GV1A 5B7NA 3BT7A 2GBFA 4KWCA 1LS6A 1I7SB 1Z4IA 3GYBA 2I3AA 5LN1A 1RYBA 2H52A 2FFJA 2V7WA 4AUNA 3IUEA 1IVNA 1FFGA 1KJYA 2P2DA 3LL4A 4V2IA 3KKNA 1JQ5A 4YQZA 1YJBA 3AUTA 3CIFA 5MFPA 5LFAA 2PRZA 3I3OA 2NU8A 1O95A 3PITA 1K8YB 2PH3A 3LHDA 4ARBA 4QM7A 2WWHA 3RK0A 4L73A 4S3MA 5C32A 3WWDA 4Q7EA 3EXEA 4HAYA 1SCBA 4LYEA 3QVXA 3O5AA 4P4SB 2VAVA 2C2XA 4RZIA 2I8LA 5DK4A 1RJ9B 3LUHA 4A5OA 4O1HA 5K7SA 2QW8A 4Z4EA 4G8CA 1KAHA 3NC4A 4JLOA 4NH0A 3UG7A 4IOMA 3G13A 5IKXA 3ODGA 3O0DA 4RVNA 5IT0A 2NUBA 1FS5A 1N2EA 1A9SA 2REQA 1XXHE 2WWGA 4OYHA 3RYHB 3U44B 1SUBA 3T0FA 4CHGA 1N2HA 3TSWA 4L5CA 4L8LA 1MXHA 1ABFA 1FYFA 3JVDA 2QI9F 1BCSA 2J9ZB 4MS3A 1QONA 2ZIVB 4MGKR 4AIRA 5IC4A 1US8A 4G56A 5F5LA 3AVUA 1WZUA 1PT7A 3IR5A 5TARA 1OHHA 1YJAA 1ZCJA 5A9TA 3G23A 1T1EA 1PGQA 1MQAA 5K4HA 2ODWA 2DOKA 4XB1A 3KPYA 2UZ0A 2B92A 4TRMA 5BR4A 4TLEA 2GN9A 3BIOA 4HYTA 4C4TA 3B3AA 4PO9A 1EIWA 1OI7A 3LH5A 3WI7A 2ZKLA 3PHCA 3OMWA 1G1MA 3O2SB 5FQOA 1BH6A 1GP2A 4R8VA 2IXFA 5EP2A 5C1PA 4JB3A 3U56A 2AI2A 2C2GA 1VP3A 4XFJA 4N3BA 3BHMA 4YRZA 3MCTA 4WZAE 3EFEA 2Z6VA 3Q87B 2HOQA 4Z8XA 1QO0D 4ZCQA 1DXYA 2BSQA 4L4UA 2QX6A 3QU7A 4QM6A 3S8YA 2HXYA 4K9PA 3CF0A 1XEXA 2WZDA 3ZZ0A 1IDN1 1VL0A 1XX6A 1RYDA 4TV8F 1XROA 4DYDA 4JFAA 3CNNA 2V6JA 3ZK7A 3FDZB 3WA6A 2Y3IA 4EPRA 4IKEA 1DDOA 5FD8A 4WXPA 3EZYA 1USUA 1G8MA 3KM0A 2EJTA 2JIRA 4G86A 5HKLA 2IBTA 4Q47A 3G68A 1Z5VA 4JLNA 4O0MA 1OH8A 2B6HA 5KYYB 3KR0A 4OU4A 5JHGB 5IZCC 1SMKA 2AJDA 3GNQA 2ZS7A 2C4VA 4Y7DA 4GX5A 2PZFA 4XE5A 1K5GA 1WEHA 8AT1A 4GWKA 4AW9A 1QU2A 4LTNA 2XGMA 1COWA 2GZ1A 1DHRA 3RNOA 2CV2A 1Q83A 2DTDA 1NE7A 2OO7A 1LGYA 2II6A 2IFTA 3BTOA 3TD9A 1JR3D 4U2EA 3TQRA 4BNGA 3O94A 3OQOA 2YMQA 3QXHA 1YB7A 3DE0X 3DKKA 2RHDA 2XEDA 3R6DA 4OMUA 1CRQA 2F3QA 4TRNA 1N7HA 2PSFA 5CLGA 2JK0A 2VQSA 4EYOA 4C4YA 3DTTA 2ONJA 4GT1A 3I52A 1VA4A 4AZ3A 2QL7A 3TR0A 2PZKA 3B6KA 2CYAA 2Y05A 5TMDA 1HT2E 1A7UA 1A9XB 3HFRA 1PFWA 2Z8YM 3GEGA 3MWDA 4FFWA 2GCOB 1FU8A 1V11B 2F3TA 1N2JA 4KU4A 5C8DA 1T36B 1KU0A 1R9GA 3SBOA 5JDIC 1S5PA 3VR6H 1G8AA 4TLBA 1IMOA 4MR9A 1ZIYA 3N7TA 3U31A 5KKNB 3H17A 3C1AA 4AY5A 4GOXA 4XRRA 4F3NA 2BY4A 2QRNA 3NM4A 5IANA 2H1IA 3IDSA 3MHTA 3FR8A 1DG9A 4LJ8A 3H2SA 4XLLA 1NV9A 4KNWA 3EY9A 5HJ5A 2AG0A 2JLCA 3BGDA 3I6ZA 1FLNA 3NBKA 3UEOA 4HQKA 1XLTA 4F46A 5JV5A 3LHFA 3QWBA 4FN4A 3F6PA 3M34A 1O5IA 4C08A 5DX0A 3ZHRA 1DEKA 1SUAA 1VSTA 1P7PA 3CQ9A 3U80A 2JFPA 4TXNA 4US0R 1XVLA 2BR3A 3G0CA 3IEXA 4MKGA 5FUWA 1OWLA 2PKEA 2OBBA 2XE7A 4I4TA 4XGIA 4ZDKA 4HNTA 5JC1A 2V45A 2B8EA 3DEAA 4JMLA 3WLJA 3GLUA 4IJ5A 3GLIB 3EZXA 5I9TA 2D7CA 5IEJA 1N32B 1Z83A 4FR0A 3WMFA 3ABSB 1UM8A 4E70A 4HXGA 3R6GA 1PJZA 2BHLA 5K3FA 3OFVA 7YASA 3QSYA 1GQQA 1L4BA 3PNYA 3MLEA 4AS1A 4TMTA 4BX8A 2IEYA 1EFVA 1KZHA 3LC2O 4IIEA 4KQMA 5ALFA 1SU6A 2H18A 5ICSA 2OGTA 3GN2A 1QP7A 4J49A 2NU7B 1WRBA 2ZJBA 3KSDO 4N0MA 3O1HB 2CVFA 4NTZA 3P4UA 5CG2A 5JJCA 3CZ4A 2B8NA 4FGLA 4M0CA 3T6KA 6REQA 4CEJA 5H81A 4OM7A 4OD0A 4KX3A 3PGA1 3M4JA 4XQ9A 4Q9JA 4ED9A 4F2PA 1TD9A 2CW5A 1JH8A 2LKDA 3BMOA 3IS3A 1Z8DA 4C4OA 5ESDA 2MINB 2NV0A 4GI5A 3OHPA 4IY1A 4JI4B 4P6VF 5DRTA 2IXEA 3BA6A 3GUYA 1M7BA 1O9HA 4O33A 2XV1A 4RK4A 4ZYUA 2A58A 2XGOA 3OCUA 4NMHA 4RW0A 1FDOA 4MVJD 3AFHA 5AK5A 3LZCA 1ZR4A 1Q1AA 2NXEA 4IDOA 1W36B 3AVXA 4G5OA 2E4XA 1TLFA 1XDZA 2QOEA 3LQFA 4MUNA 1ORDA 4DM7A 1UEXC 3A1CA 1Z2NX 2WTBA 3U3OA 1U0RA 3IVMA 3T1VA 1C9YA 2O57A 3PDIA 3Q3HA 4XH9B 1H5UA 4UUOA 1UXOA 4XQEA 5DB4A 2GJSA 3ESZA 5F33A 1RVV1 3TNYA 3F5MA 3DT9A 4IH1A 4Q15A 2O2IA 2GTIA 3D2AA 1NMXA 1KVTA 3MWYW 5B1DA 1JTFA 3SEAA 2IZ5A 3KJEA 1XJQA 4I4IA 3H5OA 3HDYA 3JWPA 4LRWA 1H1TA 5D86A 4C04A 4F4HA 5CYGA 3LG2A 3CRNA 2MSWA 4G1EB 1FP4B 2VLIA 4RELA 4ZKDA 3ANTA 2DUUA 1NLZA 1WU7A 2G8NA 3BXOA 1U7DA 4R2MA 3OY7A 4JYPA 5G0WA 1DHTA 2GYVA 3HUUA 1ULHA 2AE2A 2H00A 1Z29A 3H4IA 3I8OA 3JWIA 4OHVA 3D6MA 2YYZA 1ACMA 4HN2A 4OGKA 1JMYA 3VTAA 4MGIR 5HOEA 1YS2X 2PGLA 2HJ9A 1PWEA 1NXSA 3A6FA 3FROA 5FL3A 5IJ0B 4WK0B 4D2IA 3B85A 1NVFA 3O8QB 4YCJA 1S96A 4NPAA 1VL1A 1EGQA 4IVQA 5CVCA 5JECA 2I2AA 3JQGA 3N0TA 5AJHA 3RS0A 1A9OA 2G4CA 2OM6A 2V7UA 2XVAA 4BVEA 4BX0A 2GBPA 1FUKA 4L8VA 3CUKA 1CHNA 1PUXA 3GOQA 3W2EA 2O1SA 1EE2A 1TUGA 2R4QA 5TT1A 4GLLA 1KO8A 1DLJA 3Q2OA 1E2HA 1AN9A 4G36A 5MGNA 1W4CA 3C0KA 4H4CA 1MD9A 5JYDA 2J6BA 3QPWA 4BNLA 3PHJA 4GKVA 5KQGA 4BFUA 3G9TA 1CF9A 1OA1A 1KDVA 4ENWA 3ZWNA 5GZ3A 2D0PB 1ZN9A 4NU0A 2PZEA 4HLCA 3P20A 4FGWA 5HCNA 3RSCA 1HY3A 5KBYA 4L72A 3BDVA 1W48A 1DC8A 2YXEA 3HXPA 1PNVA 4CF5A 5ALPA 5LPNA 1IRXA 3T9EA 3SJZA 3TGPA 2WU3A 2EKQA 1PL7A 2SBTA 2FG5A 3ZE9A 5EZYA 3ZVKA 4RJJA 1CJVC 3RUCA 3UAWA 1WL8A 3RT7A 3EH2A 3R5FA 4EUHA 3E9NA 1BRTA 5EMMA 3GQVA 1IXRC 4TSRA 4ARUA 2I67A 4FSXA 3U26A 2GMWA 3HZRA 5H68A 3GGGA 5LUAA 4OUDB 2VJOA 4QQRA 1GPYA 3AY7A 4TLLB 5JE8A 1EE1A 3F4LA 4LVUA 2W4IA 3DE1X 4W6ZA 2HSWA 1KZYC 2PT5A 2CVQA 3HVIA 3QIAA 2PTGA 3H18A 4MZDA 4QX6A 4DMMA 1M10A 3PJDA 2FPXA 1NBHA 2FUG6 4I1UA 1NVVQ 5KAPA 3ST7A 5HQTA 4K40A 2PV7A 1VMKA 1MQ8B 3RCBA 4BYGA 1X7HA 2HSGA 2W58A 2ZIGA 1C4WA 3AI2A 4CKWB 1VSBA 4OHRA 1E32A 2E1PA 2A0XA 3WOVA 4NFHA 2I2DA 4MR8A 5E4YA 1ODKA 1Y89A 4UM7A 1JQEA 3O1JC 4OI0A 1UK8A 1XZQA 1K06A 2B4KA 4LXQA 2CBGA 5TMEA 4LJ7A 3WHLA 3JQAA 1S3GA 2AW3A 3U3KA 3ZR4B 1E1LA 2HEGA 4P4UA 4QXOA 3V4VB 3RTBA 4E09A 3NUGA 1BOFA 3OM1A 4FCVA 2OFOA 1KIFA 3I01M 4GS5A 1PWXA 1YDEA 1P3Y1 4UDXX 4MQUA 4C06A 4ZI7A 1ILWA 1KMHA 1G6HA 5EMKA 4B44A 3L6EA 3T3OA 2RMKA 2IPMA 3FCYA 3K5WA 1KKUA 2GZDA 3PGMA 2J07A 5FOVA 5IEBA 3R7NA 2M98A 3RS9A 3SZ3A 1WHTA 3TUZC 2XA9A 4PHHA 2VUHB 1FNNA 3E4DA 2ZYRA 3EGVA 4I14A 3RIYA 2QYSA 3VDNB 1PG5A 1TM4E 1FC0A 2YN2A 4UMVA 1G8KA 3GFTA 3GMSA 5EHZA 1LD3A 4IVPA 4C1BA 5BMOA 3DTNA 3NBFA 3ZE6A 4CUJA 2WP0A 5CLIA 4ASUD 4O2AB 2V98A 2EBUA 4LZPA 2IYAA 3RB8A 4XTRA 1XPRA 2CLDX 4CFSA 3LIPA 3RVPA 1XCPA 4EY5A 2BHRA 2J3QA 1WSAA 3O3NB 5BQOA 4PFQA 5DPMA 5KJEA 3D54D 3N5CA 3K0CC 3AKDA 4R40A 2GHIA 3DNFA 5E9QA 1U3VA 1QRAA 4Y2HA 1I6LA 3A37A 3DOIA 4MO9A 1U7ZA 1N8NA 1T2CA 1UPFA 3QMMA 5BV2P 1MO4A 1NN5A 3KCNA 3PNQA 2D74A 3J81k 4R6WA 4MQ4A 5EZSA 1GFWA 1MV8A 4QG3A 1HPLA 2G3YA 1E58A 2QEQA 3DMDA 4G0XA 5ALVA 6GPBA 1J20A 1Z7BA 2H5LA 4QGGA 1JGTA 5A7FA 1BQ3A 2JVIA 4R3NA 4HQLA 2RJ3A 4IV8A 1NLFA 4HQRA 4F60A 1E63A 5T3YA 5A5EA 2NV6A 4Q9KA 3DAOA 4M53A 1TK9A 1KIMA 2I62A 4LXHA 2F4VB 4LNUA 5BNFA 2DPMA 3FDJA 4Y2RA 5JI3E 3QG5A 5FCDA 1LPSA 2C07A 1NY6A 3REQB 3FNIA 1RSZA 2PQMA 2D1YA 2FPRA 1UJNA 2PMBA 3FCAA 4MKIA 4U1RA 2AD5A 2EAUA 2OB1A 4F7WA 5JH7B 2BGWA 3B53X 1NUTA 3VKHA 4R3WA 1ECPA 3GCGA 1K7EB 4LE2A 1N6NA 1K6IA 1VC2A 2D2IA 2VSQA 3DAHA 1N7GA 1DRKA 1M2VB 2WJGA 1JFRA 3K05A 2QYOA 3ESCA 3B20A 3AR7A 2GASA 4DQUA 1QFYA 5L40A 2C54A 5HIMA 3DKVA 3N2NA 1LPBB 4J4BA 4MVJM 3UMJA 4A8PA 1WPRA 1LBEA 1OASA 2LR0A 3ITNA 2Z3ZA 4BNDA 3K15A 5FNVA 4IX1A 3VKWA 3NH6A 2QVXX 3H5WA 2I03A 4WKGA 3SR0A 3O95A 3ZVLA 3S2UA 1V2HE 5I7WA 1J2EA 1EA7A 3E84A 2Y0CA 5A9SB 3CKKA 1ODLA 1ZM7A 3WFJA 3DBOB 3L79A 1RZVA 3DJFA 4HN9A 3PHLA 1JLRA 3VTKA 2QVGA 2G06A 3V7WA 5DASA 5AP9A 1QTQA 2B0CA 1GGMA 3THXB 4WLFA 3VR3D 3ZHVA 1XRLA 2FI1A 4HNSA 4N6NA 1O6GA 4MJLA 3A26A 4Q1CA 4TWJA 3HFJA 2C9ZA 1G8YA 2BKUA 5KYUA 3RJZA 3RREA 1OT5A 2GT1A 2HCFA 1MQSA 3FTCA 4E5MA 2JRLA 2NV2B 1YFJA 3KX2A 3MXOA 1Z5UA 2A94A 4IMJB 1XDSA 4QPDA 4RPLA 5HEKA 1T1RA 3LD9A 2ZW9A 3WKDA 5B6JA 2DERA 2JI6A 2Q1WA 3H2JA 1FJHA 2GA9A 2YOFA 3DHEA 3FOWA 2IELA 3IOCA 2QL6A 3AYXB 2KPOA 3CTPA 3DJYA 2IF0A 3P9ZA 4ABYA 5LQKA 1I14A 3O38A 2GBLA 1MHTA 3ADOA 1BFKA 1MENA 4JR2A 3ZZNA 1RM3A 5FI3A 2LE0A 4W7HA 2FEAA 5HIIA 2H57A 4MAFA 1KI9A 4Y9UA 3QK7A 5EE9A 1NWCA 3BA1A 1XRRA 4FGZA 4H77A 3FMFA 4BCBA 1GUYA 3LPAA 2VPYA 3AFIA 4O2LA 1YZQA 2J87A 2O2ZA 4IBOA 1HFWA 2JAHA 3WGOA 2O8FA 1PTKA 1ICEA 4GPAA 3OUTA 4KO8A 3RI3A 1R9JA 5IDWA 3V4PB 3S2EA 2OILA 4I4LA 4LDRA 3S8MA 3RBZA 1PDOA 2VA9A 2F1RA 3AF3A 3CO5A 4O3MA 2X8BA 4XWWA 3L6UA 5GGXA 5LMCA 3JRWA 4DKJA 1WZNA 3FUCA 3IVCA 1JHZA 1SN7A 2X0FA 1YO6A 2HPHA 3DT6A 3HBNA 1Z6XA 2IP4A 1XTQA 3ANNA 1L5QA 4N7RA 3CKMA 1F3LA 4ND3A 3TS1A 4CMCA 4JX9A 4DZRA 2CDCA 2YYYA 4UHKA 2QMQA 3RUAA 3C8UA 1WUJS 2HRDA 1J0DA 4QEKA 2QZZA 5U4QA 3NATA 5ITSA 5KU7A 5HRAA 2X0IA 2I80A 4V0SA 3G2KA 1QK3A 1L4YA 3K70B 4TWAA 2NU6B 3DOHA 4HAUA 1GZSA 1NLUA 2V7BA 4E1AA 1U2ZA 3IPLA 4IDDA 4J76A 4PLGA 5LA6B 3PFWO 1FTYA 5T41A 4D4GA 1ZD3A 3TNFA 1EFPB 3AHJA 2BZGA 2MU1A 3T7TA 2DHCA 3OEYA 2YJ5A 3EMBA 5J2TF 4KB5A 2CVOA 2V03A 1DLIA 3UY4A 1RLUA 3MILA 4QYWA 1GZVA 3OQ1A 4K0KB 2H06A 1IK4A 4WBXC 5HHTA 3T3PB 1N6KA 4YH1A 2DQKA 1EDZA 2JEYA 2Z04A 5TGTA 3I4FA 3ORSA 3F2IA 5LR6A 2ZIAA 1PF7E 5AXAA 1J4AA 1QTRA 2NSLA 4LOHA 3STVA 4R8RA 5WRFA 2AG8A 4MGHA 5SYAA 3SS9X 1NFQA 1WW3A 4LGMA 4AMVA 2NW6A 2IP2A 2Q9UA 1MNQA 3GLTA 2P41A 4QAJA 1P8JA 2GBGA 3LYLA 4HUQA 4CUKA 5FOUA 4BP3A 2B8JA 4J0JA 1W0KD 1W93A 4CMEC 4E6EA 1T8YA 2A5JA 3ZU2A 4HGZA 1R0KA 2VTVA 4WVLA 1XKTA 3K5IA 5SY6A 3CUTA 3T4PA 3A31A 4JT4A 4OXYA 4TRRA 4C7JA 4KVZA 4HGNA 1JDSA 2K6GA 4MIYA 1NI3A 4M1TA 4UZEA 1NVTA 1P61B 1SG9A 1YB2A 1XMVA 4JFRA 2BH2A 4G8DA 1SVLA 2AL7A 2Q5EA 1XMJA 2Y1WA 4H6VA 2CJPA 1VI6A 3WV4A 1VJGA 3WGGA 5HKBA 3HI4A 2B25A 2PWPA 2I6TA 2FF7A 2I1QA 3HBMA 3RJTA 4A27A 2QLLA 4JJAA 4FC7A 2ZITA 4R6XA 2VYFA 3KQHA 2LBPA 2QLJA 1C9MA 4KN9S 1UEJA 4MQ6A 4PHCA 3LVFO 3KXKA 3EA5A 3EQ8A 4KR0A 5DGIA 3TLGB 3VR4A 3ZWPA 2QRJA 2R6R1 3ONDA 3UATA 4AFNA 2VNKA 4CM9A 5ALHA 2QBYB 1WSDA 4DWWA 5A5FA 2ET6A 4ENUA 3S4YA 1NBEA 3DZFA 3G2HA 4W5JA 3LWDA 2IWRA 2P3SA 3D02A 1NT4A 1GL9B 3FG9A 3NWJA 4HBZA 4IVRA 5F1OA 5LB4A 4NS1A 1Q0SA 3D8UA 4KR9A 1E0KA 2C57A 5F4BA 1SXPA 4GPTA 1W25A 1Y7LA 4BQEA 1ST3A 5KREA 1ZLYA 3PNBA 1J1UA 5JZVA 1M0SA 1ENZA 2FKAA 2VWGA 4QD3A 4ENSA 3FFAA 3AM1A 5L3SA 5KYNA 4PGHA 4KBFA 4KH0A 5B64A 1LLFA 2CFIA 2DHEA 1GPH1 5A3SA 2XNKA 3PRKE 4KKXB 3RWOA 2HB6A 2R86A 3KKLA 3OQHA 3QEKA 1IZ9A 1R88A 2ZT6A 5K05A 1S8FA 4BJ3A 1E3MA 5A04A 3RRJA 3G7NA 1GKYA 1OUMA 4MW5A 4EW1A 1JPNA 4GX0A 2OMEA 2RDMA 2I2XB 1TVKB 4GZ5A 4CUZA 2V9CA 1QV7A 3RG8A 1H6CA 1FFXB 2VJNA 5LXTB 2NTEA 4W5TA 1P19A 3WMEA 4CMIA 4AVYA 4UBIA 4BZWA 3MTJA 3NIDB 2P9JA 4JOCA 1R6UA 2ZTSA 4JKIA 2A5GA 3WIVA 5C9ZA 5JBNA 3ZD7A 1XPJA 3WBBA 1M74A 4FQ5A 5TVKA 4N3NA 3WNDA 1XA0A 3UYKA 5I48A 1B0PA 2ATIA 4DYHA 2WSSA 3RE1A 4BU0A 4KO4S 4HDRB 1HH4A 3VH4A 4BEJA 4O4HA 4RTRA 3JPWA 1GRCA 1MJGM 3GCWA 5C81A 4R16A 2QGZA 1T3HA 3GA7A 3ZLJA 2Q7OE 1UBOS 3JQ8B 2IYLD 5LB2A 1D2EA 1OGIA 3HDJA 4F3TA 3SYLA 4J8PA 4YAIA 2QLTA 3M89A 2YYAA 4IIJA 3C6KA 2CF5A 1WF3A 3QUQA 4IINA 4ND5A 3STUA 3KEFA 4AZTA 3KT6A 1WBBA 3IPAA 1DKOA 1RWWA 3H13A 3IKTA 5SZJA 1T36A 1ZK4A 2RGUA 1KMNA 2O0HA 2HLDA 3TSCA 3FYSA 3B38A 2MMGA 1TX4B 2EDCA 1XSEA 2FW9A 1RPTA 2FP4A 3IMFA 3TW8A 5HFNA 4D42A 5KINB 3KBBA 2P3OA 1N33B 5ITZB 2R9VA 4PFSA 1ZZGA 4TYPA 3LL7A 4OI4A 2GN6A 5JXHA 4I50F 3JR3A 4G6ZA 2X8LA 1MIOA 3OIWA 5JOQA 4PW0A 4KSYA 1O4VA 1KBOA 4JSRA 1F9AA 1L5OA 4P35A 3B36A 3MRSA 5DBEX 3CF6R 4A26A 1QIJA 2AUTA 1EWQA 1OSNA 2X6TA 5K8LA 3IJ5A 3R0VA 1SQFA 3NRBA 2RH5A 1RFGE 2XT0A 2WFMA 2B98A 2PSEA 4H7KA 4PQRA 1JJIA 3PXDA 4RX1A 4A6DA 1OFGA 4GL4A 5HRCA 2G5CA 1EUCA 2ZI4A 4DABA 2G17A 4J0CA 1DQRA 3GDOA 1UPUA 3PFCA 3T52A 3LECA 2C1EA 3PS9A 5CB4A 1KGSA 2Q6KA 5JPIA 3LNCA 3S1AA 1M73E 5LD2B 1T9GS 3P5SA 4G5QA 3J81A 3WLFA 2J08A 2R6HA 4Y18A 1JB1A 3ME5A 4E2WA 4HNUA 4JLVA 1ZVQA 2XQGA 1T2FA 4X1YB 1QIHA 1TVMA 3C15C 1V35A 5JWRA 5GJWC 2Q8NA 4NPHA 4B7XA 3DKPA 2GN0A 3VPHA 5GADl 4QYIB 4B6QA 2BJHA 5HIKA 1EFHA 1F4PA 4MLDA 4MOWA 4S1OA 5DNWA 2CV1A 2O8CA 2VDRB 2WB4A 1DIBA 1XJCA 2P6PA 5FWYA 3ADDA 4WWHA 1KZ1A 3O31A 1HA3A 4CL0A 3NBAA 4EIWA 1ACLA 3OPYB 2C5HA 2E21A 2I2CA 4ARZA 5JSQA 3NT5A 5HRUA 1OROA 2ZWOA 4BNFA 1ECLA 4OQFA 1OYOA 3Q2IA 3U9LA 5FBZA 3P7MA 3IFSA 4R0NA 3HO1A 3LCCA 4BFCA 5KC8A 1ZJ5A 1UBLS 5FT9A 2NNWB 5JLJA 3HI6A 2ZBRA 1KEZA 3W6ZA 5BW4A 2RHBA 3C7TA 4HZGA 2ZI3A 2FPKA 4EKNB 4L4XA 3ZOKA 1ZXLA 3CSSA 2X3FA 1SVKA 4MKXA 3URMA 1CP2A 2AT1A 5LQMA 2YWXA 1N2XA 3AB7A 4D3ZA 5DE3A 2BKLA 2W43A 1TYBE 3DDUA 3BRWA 3OJEA 3PC6A 3N28A 2CL0X 3L0CA 4MCAA 4RLHA 3NOVA 2NO4A 4A3SA 5B57C 5C8YB 2J6IA 1ZCBA 2OAP1 3JVVA 2SCUB 2MR6A 1VJ5A 3EC2A 3K9CA 2A9FA 3C6XA 3DE2X 1J90A 1SD2A 2REXB 4KBGA 5FTMA 4L8FA 2SNIE 4Q00A 4DMFA 1J2TA 1IE3A 1TPZA 3ZU6A 4B79A 3SE0A 2BI8A 1KYYA 1UDXA 3AKYA 3DBLB 3SS8A 4U2CA 5JBQA 4FDLA 3PQCA 3U19A 2ZK7A 1K5HA 4G85A 1YT5A 1ZVKA 3MINB 3S5UA 1QHEA 2IU3A 2IHYA 4L78A 1WTAA 4JJZA 4OJKA 4P53A 1EX9A 3CINA 1DDIA 1SBIA 4G1VA 5FV4A 1O0SA 3GJRA 2XMGA 5IK2A 2BFBB 4URUR 3VR4D 3DVQX 1P0CA 4RTQA 4DLTA 5J1TB 3C3PA 3E8MA 1QYWA 3LOQA 3IH5A 1FSFA 2FMIA 3WGQA 2AB0A 4GX1A 1GPAA 2XIJA 4RMJA 4QEDA 1B23P 2Q21A 1F6WA 2JGMA 1ESNA 4H7IA 4NAVA 3O74A 1IHPA 1OF1A 4NJOA 3RYCB 1ELOA 3NNSA 2FJPA 1PJQA 1WP4A 1DWPA 2J9RA 2PSDA 2WAYA 5HJ2A 5LUBA 5BRJA 3E53A 5IDXA 3VNUA 2DFKB 2V97A 3A05A 1DDGA 3SF0A 1W49A 1NDUA 3SZMA 2IEGA 1NMYA 1TZMA 3IUMA 2F8LA 3A2LA 5B7QA 5EJ5A 4MRMA 5HCIA 2CE2X 1E3DA 5HS4A 3DQZA 1EM8A 1JAIA 3MW8A 2ZYUX 4ETMA 4HZUA 4WY8A 5J2TB 1V3TA 1Z56C 3PE3A