4K3VA

Structure of staphylococcus aureus mntc
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
278
structure length
253
Chain Sequence
GKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC superfamily ATP binding cassette transporter, binding pr
publication title Three-Dimensional Structure and Biophysical Characterization of Staphylococcus aureus Cell Surface Antigen-Manganese Transporter MntC.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transport protein
total genus 91
structure length 253
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4k3vA01
4WESA 1N4DA 2XDQB 4INPA 1G20B 2RG7A 3GI1A 3G9QA 4WZAA 4MX8A 2AFHB 3AEKA 2OSVA 2O1EA 2PS0A 4WN9B 1QH8B 3LI2A 3EIWA 5KOHB 4FKMA 3TEFA 4XPIA 5M3BA 3AEUB 2XDQA 1K7SN 4ND8B 2M6KA 1G20A 3PSAA 5JG7A 3EIXA 2ETVA 3ZK8A 1FP4B 1H1LB 2AFHA 2XY4A 3AESB 4BBPA 1K0FA 2R7AA 1KAHA 4NNPA 4WN9A 3ZK9A 1QH8A 3HJTA 5KOHA 3TLKA 3PSHA 4B8YA 1PQ4A 2PRSA 3AEUA 3K1AB 4N01A 4ND8A 2PHZA 2YNMD 3MFQA 5CX1B 4TKUB 5HDQA 1FP4A 1H1LA 3AESA 4IRMA 1TOAA 3AERB 4FI3F 5M29A 2AFIB 5JOQA 1G21B 4UTPA 4PM4A 4G07A 3MWFA 4OXRA 2Q8QA 4NNOA 3K1AA 4FILA 2PS9A 3NU1A 2WHYA 4PAGA 3HXPA 4TKVB 4HN9A 4OVKA 4XPIB 4TKUA 5CX1A 1L5HB 5KOJB 3MD9A 5JJ5A 4DBLE 2Q8PA 4G09A 4M7OA 3AERA 5HX7A 1M1YB 2AFIA 1G21A 4WNAB 4MO9A 3BE5A 1EFDN 4H0FA 3TNYA 5BVHB 5JPDA 3MWGA 3ZK7A 1M1NB 1QGUB 1PSZA 4UDOA 3R5SA 4TKVA 5I4KA 2WI8A 2YNMC 1N2CB 1L5HA 5KOJA 5B58T 5M2QA 1M34B 3AEQB 4UTOA 5BVGB 1K2VN 2XV1A 4HMOA 1N4AA 4OXQA 1M1YA 3PDIB 3R5TA 4WNAA 3MINB 4INOA 5KHLB 2OGWA 3U7QB 2OV1A 5BVHA 4MLZA 1XVLA 2MINB 1MIOB 3AETB 4UDNA 3ZKAA 2XQVA 1M1NA 1QGUA 2XUZA 3BE6A 2QI9F 1N2CA 5M34A 2XH8A 1QH1A 4LS3A 4K3VA 1M34A 3AEQA 2PS3A 4LJSA 4HMPA 5BVGA 1KARA 2X4LA 4MDYA 5AFSA 4WZBB 3PDIA 2M6LA 1KAEA 2R79A 4WESB 3MINA 5GGXA 3HH8A 4HMQA 3U7QA 3UJPA 4FNAA 2OV3A 2MINA 1MIOA 3AETA 4GICA 4WZAB 5FLYA 1QH1B 3LHSA 3AEKB 1ESZA 3CX3A 5CR9A 4CL2A 4H59A 1N2ZA 3ZTTA 1K75A 4WZBA 5GGYA
chains in the Genus database with same CATH superfamily
4HNAB 3QLVC 4REOA 5I8PA 4W5HA 4M60A 5CA1F 1W5AA 5CK4A 2E1RA 4GE3A 1GTL1 1JBKA 5AW3A 3CR7A 3FPAA 1F9EA 3HKBB 1P2SA 2FFHA 3UAYA 3BE8A 1QP0A 4P4LA 3DGFC 4ZDJA 2F62A 1WXIA 2OK7A 3GV0A 3OX3A 4JB2A 2A59A 1GAWA 1A2BA 5HMLA 3E9YA 2IYQA 5TF4A 1WDTA 2BI4A 1P7PA 1VP9A 1NJ8A 5I47A 2NMVA 4Y6SA 5JAPA 4JU9A 1UM9A 3PUZA 1IE3A 2FMKA 4Q4HA 3OJFA 5FV4A 1P81A 2XMCA 3ZLJA 3OPNA 1P9WA 1FFSA 3IESA 1E2GA 3HV0A 3DNMA 4FYWA 4B34A 4DLZA 3Q8KA 3D8HA 4NCAA 3A1VA 2FTKE 4HRAA 1NXTA 4WGFA 3SP1A 1EFAA 3ENZA 3GPIA 2WIDA 3TLKA 3ZDXB 1J06A 5CM2Z 3CZMA 3HGQA 3M5DA 3AEUA 5F3WB 2I2FA 3QPWA 4BKRA 1Y42X 1ZSVA 4BUZA 4C6SA 2F8TA 1YR6A 4IO1A 3TLCA 1VPWA 3DH0A 5LMUB 1JKJA 1JLHA 3B6EA 3KU1A 5BNFA 1K2WA 3NUZA 4XIIA 3NH6A 4FI3F 4RS4A 1NJ2A 3GRPA 1DTWB 4HC4A 4YPOA 2M6RA 2VSXA 4I4LA 4RIFA 3WWEA 2G83A 3TQQA 1G8MA 2F1HA 3UT5B 3EDMA 3T3HA 1VYVA 2ZYRA 4FILA 1MQSA 1X7ZA 1K4YA 1QHHA 2EJCA 2YHSA 1C4WA 4UHHA 4ENRA 1FPMA 1M2FA 5LQKA 5JJ5A 1A7JA 1J9GA 2H5EA 2P8SA 2O2HA 3OP1A 5HCUA 5BP7A 1NI4A 1E99A 4F46A 1RBYA 5CGQB 1CUUA 4U02A 5BW6B 1L7OA 3ZEAA 1SXPA 8ABPA 4YBRA 1XHFA 1Z39A 2Q9AA 4KFSA 2P9EA 3HBJA 4TTIA 3K9FC 2EGUA 1ADFA 3K0AB 1JSLA 4HZUB 1E32A 3SJCA 4URXR 5HGXA 5G0VA 5DLEA 4H3VA 3SOZA 3MS7A 3IP5A 1XEXA 1SMKA 1JHPA 1PDVA 5J5CA 2YVQA 3NM6B 3NC4A 3KR0A 4DCVA 4GDFA 5L4LA 1M1YA 2ZJ7A 1BWRA 1SU6A 2GWHA 1EM8B 1G66A 1QK3A 3O38A 4FYPA 4HXEB 4CMAA 5ALUA 1CIPA 1KMHB 1ESNA 2J85A 1KJWA 3AFHA 5KOIA 1BE0A 1ZAKA 4EI2A 3HN2A 3PD1A 3FH0A 2QI9F 5FV7A 1FUYB 3O91A 3OMXA 3PHGA 2JI4A 1EUCB 1RXEA 2X23A 3FB4A 3C8HA 2GFIA 1ST3A 1XTZA 3ANLA 3KLBA 3IQFA 4BJ1A 5BV1A 5CVUA 2VL7A 2XA1A 1RDFA 4PSCA 4PGMA 2ZRDA 2BLNA 4RTQA 5HSGA 3TFOA 3HEBA 1TF7A 1O7JA 3DDHA 4PVDA 1P75A 3QY9A 4DNFA 1P0QA 2YHIB 3EDRA 2RI0A 4A9AA 1PZGA 2RH8A 5TR9A 3DYVA 1YBMA 2VUTA 3CJRA 5REQA 5KNLA 4DFDA 1VYHA 2Z4RA 3MGBA 4WK6A 4JP8A 2UUBB 2QD4A 3GUVA 2FLWA 2V7VA 5F7ZA 5KTMA 5HZKA 4W7HA 4LHYA 1KYTA 4QXRA 2O8DB 2QMZA 3WYAA 1A2OA 3IAM6 1K6EA 4M0MA 3QXJA 2AF3C 4MYUA 4ZC8A 3GEGA 2OQVA 3AK4A 3FYUC 4JDPA 3RIHA 3A28A 1EBUA 1SCJA 3SU8A 3L7YA 3EQZA 4OGFA 4P4SB 3OHMA 2I8AA 1NQWA 1I9CA 3DGEC 1ZR2A 4NONA 3I6ZA 1SA0B 3GVPA 1PR4A 2R60A 3ILHA 2JPDA 3KXKA 1YB6A 2XMDA 3A1CA 1FP7A 3V34A 1JTVA 4Q3LA 3SHOA 5B6PA 3QEBZ 1EYZA 3QTTA 2VA8A 3RWOA 3EEFA 4ZV9A 2LWIA 1N2HA 4M1SA 4AZVA 5IFKA 2IU3A 4YMVA 3D4PA 3RV4A 3B1WA 2DPXA 2ADFA 1P1IA 4EUFA 5C8XA 1E5QA 1KOGA 1P9RA 2YINC 4WY8A 3PNSA 4II2A 2P91A 1Z34A 3B9RA 3SBOA 1ZJWA 3W5HA 1V48A 4NZMA 5KYWB 4PAQA 3DLHA 4CLDA 2VYVD 4N5HX 2IY7A 4P8RA 1WPQA 2JAWA 5AKGA 4C0WA 2NLOA 1Z6QA 4FFWA 1J90A 2MU1A 1X1DA 1R0XA 2VR1A 4RHEA 3AIKA 3ZY5A 4OBXA 2PL9A 1A4UA 2JCXA 2A0YA 3PIDA 1LKZA 2ET6A 4P4UA 4AICA 2PQMA 5FH9A 3BF8A 1N5MA 4BRUA 5LXTB 5CMLA 2A9JA 3FDFA 2OCDA 2OE2A 1WF6A 1VSUA 3RR2A 2A58A 1JBEA 3S2FA 5JQWA 3O75A 4XYGA 3R9KA 3K5IA 2VP4A 2BFWA 1Y7LA 3EDYA 3HB7A 3R3VA 7REQB 2Y67A 3GXOA 1D04A 2LDXA 3UXYA 1JIQA 2WE8A 2WZCA 3R6DA 3DR5A 3WLTA 4BP3A 1LUAA 3C14C 2VHCA 4L3VA 5BSUA 3AQIA 3KDPA 4AURA 2WWYA 1HYBA 1MA0A 1Q7BA 1CNFA 3O9VA 4PR0A 4F96A 3M6WA 4RZ2A 5CH3A 2QVZX 1XR3A 1GRRA 5E7QA 1MF7A 5LNK1 2EDCA 4BS9A 5BN4A 1XZLA 1NE7A 5TJHA 2XBUA 3VKGA 3A70A 2H63A 1NLFA 2L2QA 3U0VA 1T29A 1ICIA 3KZXA 4FONA 5T41A 5ITVA 1QZ3A 1TA9A 3PTZA 2C7OA 5HM6A 3C8UA 2D8MA 4UVIA 5DXAA 4O1HA 3O8QB 3PBKA 4WZZA 3G8BA 1PHRA 1X1SA 4RELA 2BR4A 3C7DB 1D0VA 3OQ1A 2G1AA 4EPWA 3OECA 8GPBA 3TNLA 3JAMA 2XWPA 1H4QA 3I52A 4WOPA 3KQOA 3CSUA 2BOVA 3HZOA 2A5LA 4V0MA 3MTDA 1CQPA 2X76A 5LB4A 1FFEA 4BJ5A 5KTOA 4OP1A 1L0BA 5CM8B 2QLMA 1LPOA 4NENB 4TXMA 3EMBA 1LPNA 1HZJA 2SBTA 1D6JA 1OCEA 4J6EA 4DMGA 5CFPA 4H6WA 2JLZA 1NNUA 3QELB 3M9WA 3RIMA 1EH5A 5FOXA 1U7ZA 5CFNA 2VQDA 3U4QA 1JAXA 3ISVA 5LQJA 5FO0A 2GM4A 1ZH6A 1KPGA 3QGMA 4ZOCA 2BEWB 2FCRA 2J46A 3DE1X 4BQSA 2VP3A 4R84A 3PQ6A 1JF8A 3K5HA 4MHOA 4DSTA 1CHDA 1W59A 3A26A 4IPTA 4CIWA 3E58A 4DLBA 3A1FA 3GJXC 1EQ2A 1YK1A 2CXPA 3FYDA 3C74A 1PGJA 1BXGA 3S5UA 2CLDX 3TVYA 3PHJA 1PR3A 4TXNA 3CVVA 4G0OA 2EW8A 5EJEA 4QLBA 1XD2B 3T1TA 2JS7A 5E2AA 1O6FA 2YRXA 1CNMA 4MWCA 4LQ4A 5FBVB 3LKBA 1XNQB 3GJ0A 4HHEA 4Z7QB 3VAYA 3IXLA 4K9LA 1YR2A 3MSCA 2A5FA 2B1QA 4KQ1A 2OFPA 2W0SA 1NPYA 2XBMA 5AKXA 2OHVA 1M54A 3HSYA 2F3SA 4XM1A 3RTAA 4QU0A 3V8EA 1RWPA 2RAUA 5BMOA 5K0SA 1Y6FA 3ZJUA 2O8EA 4MWTA 2CWDA 2XCOA 2YY5A 3AOEC 2CVZA 4Q7EA 4BO9A 4CIVA 3GHHA 4BV3A 1UFRA 2WICA 2Q5QA 4Q4AB 1V35A 4MQUA 5E6UA 3SZGA 1NQOA 4QHTA 2UUOA 4PX5A 1X8JA 2D54A 3I34X 4LJ9A 1UOEA 4BV9A 4X5OA 5L9AA 3AF3A 1SIUA 3U31A 1U8XX 3GVIA 4YT8A 2WJIA 4JEIA 1MXFA 4RESA 5FOSA 5H9VA 1LA2A 5JEEA 4FCCA 4ZAZA 4D5GA 2R751 1VPTA 3ASYA 3K6JA 3EMKA 1CY2A 3HB4X 4UXIA 1EXWA 3F6EX 2X13A 2JIZD 5CK5A 3FWHA 3I6YA 3L49A 5GINE 5FBLB 5EQDA 1PQYA 3JYNA 3LT4A 2A1TS 3BTSA 2GOYA 2YNMA 1KWGA 3CVWA 3DL0A 4Y2XA 1SQ0A 1K66A 2HF2A 2Q5FA 2YVLA 3DCIA 3UAVA 1NBOA 1T9GS 1EWRA 3IT1A 2IHUA 4LKRA 4RPJA 4EX6A 1R3UA 1C1YA 5DNEA 1OPXA 1U2DC 4D25A 1JA0A 4YYEA 4QDKA 2YXPX 2B2NA 1IY0A 3R77A 5FAXA 3L40A 1Q3HA 4RKWA 3B6JA 5FXMA 5IC5A 4D4HA 1SRRA 4N41A 1NU8A 3N53A 1LJ8A 1A9XB 1FXSA 2QTTA 3F8TA 1CQJB 1DRKA 3P0IA 1YB5A 3HVJA 1IVYA 1L4MA 5TJ9A 3RVRA 4GUDA 1LVGA 5CEEA 1LW7A 3G2NA 2C20A 3ND7A 4JIMA 1TO1E 1EA5A 1F6BA 1YS2X 2B4QA 3A10A 1XZJA 4EQ6A 2C4NA 1QE3A 4DMLA 1CY4A 3QW4B 1KDVA 3SQLA 3WRVA 5CDGA 5KMGA 2P30A 3PYXA 2HU5A 1RJ9A 2HT6A 3RS3A 1EJBA 3PNKA 1X94A 3QK7A 1GHTA 1G2OA 2ZRNA 1N2XA 4EBBA 4KQJA 4XRGA 3PC8A 2L18A 3HB5X 1P5HA 1XCMA 3KT6A 2ONYA 4LCEA 1ONPA 5TMDA 1I30A 3D5QA 1IG0A 1EHYA 4OJYA 1M5RA 4PNPA 2RGBA 1A96A 3OT5A 3VYTB 1X86B 5AJXA 3E82A 5E3JA 1KS2A 1IPEA 1N8TA 3HXLA 4PS1A 4ZDWA 4XWGA 3S2IA 2PQ6A 3DF7A 4KI7A 4L5CA 2GJ9A 3C1AA 4BNXA 1G9TA 1PNTA 4ZCQA 1Q6ZA 1BYUA 3FETA 2FR1A 1DC4A 1GPYA 2C9BA 1O8BA 4MKIA 5TGTA 4AQ7A 4PRLA 4PZ9A 2XYHA 3IT0A 4W1PA 1HFWA 1JUDA 2DWCA 4ZT3A 1E69A 2G1JA 2ZIZA 5E6RA 5KDLA 4C4AA 4Q9HA 4Z4GA 5K3CA 3N59A 5KWIA 3EIFA 3MAGA 1CVLA 3QFRA 4M88A 4LOKA 4TZTA 5F78A 4AZWA 5H68A 4EPTA 5KJEA 3A1TA 3I5MA 1L5VA 1JJFA 1S2OA 1F3LA 1V4NA 2LGJA 3ABSB 3KU4A 1JA1A 4D4KA 4N9QA 4XQ9A 4JVSB 2Y1DA 1X9IA 3ZDDA 1JQ3A 1GTG1 2ZB4A 2FHSA 3T3EA 1Y81A 3DYBA 2BGNA 5ECDA 3MWEA 1MO5A 3PNQA 2DXIA 4E13A 1WY5A 3OOYA 5IZCC 1AN9A 2JGEA 2OBNA 4FW9A 4HAIA 4ASUA 2CXUA 2GXQA 3FUVA 5KYVA 1Z0KA 4WXPA 4D0NA 2NU9B 3U37A 3L7AA 1LLFA 1ZMBA 1K0FA 2XEXA 1TVCA 2DWQA 1F0KA 3KB8A 4ER5A 2B34A 4OLAA 3AJDA 3K53A 5IVIA 3PJDA 4V0QA 5CIQA 2VDJA 3TWOA 5KNCA 3MRTA 3PKIA 5F2NA 3P9ZA 4PAOA 4Q19A 2HU7A 5AHWA 3W8EA 5K4AA 3WMRA 3K1AB 4WCFC 3RV3A 2AK2A 2IZ6A 5E8RA 3ELYA 1JDNA 3GNTA 1BXRA 2B8TA 4PE5B 2NZ2A 4NOMA 2J48A 1JEJA 1SOWA 4QFBA 2HHHB 4JJ4A 4HO1X 3BMXA 3G5LA 1RM3A 2J4CA 4GGMX 4UHJA 4C43A 4BFUA 5EZQA 2RJNA 1WZUA 4HLUC 2VH5R 3FKSA 2QRNA 3N2YA 3WGGA 5B36A 3C16C 4UBNA 4AJ4A 3UPDA 1GG2A 2OCKA 1YR3A 2C5EA 2Z9DA 1T2NA 1TKCA 4R8KA 5BSHA 1M8FA 1ZOLA 1SQSA 1EGHA 4FDAA 5EJFA 4ZCLA 2QDKA 2B30A 1XDBA 2GARA 4HWGA 1FXUA 1PNVA 1TUGA 3DHNA 4JLOA 4IVNA 4E14A 1FRVA 2D06A 3K2IA 1EE2A 2JJMA 1Y8CA 1XZPA 3NT4A 4KRGA 3HKCB 3ZI7A 2AW5A 3OWHA 3E23A 5B4TA 1N0IA 1ECLA 5JWRA 3LCMA 1NLYA 4E5PA 2E5LB 1USGA 1M34B 4XD2A 5BRNA 2PT7A 1HYQA 3N2ZB 1OFUX 3H8JA 4ZMBA 4XCVA 1C0KA 4RPKA 1IPHA 4EW3A 4MDFA 1UXIA 3LD9A 2WZDA 1XYYA 4C7OB 4CMGA 2FFAA 1TADA 2WSMA 1E0JA 5JH7F 4CNQA 3GEIA 5CHYA 2GZ3A 3SYNA 1VECA 3OHSX 4GH5A 4ZMSA 3E7PA 1YIOA 5FBQB 5BV7A 3QEMB 5LMNB 3HUFA 4BB6A 4XJXA 3K70D 3QV2A 4GKJB 2O2JA 3OKFA 2A35A 3T4PA 1A9ZA 4LOAA 3GXBA 2ZUTA 3T5MA 2OV3A 2A84A 5FNVB 5K8JB 1E77A 4Y6GB 1IN6A 4BNHA 3EOAI 2NV6A 3QWBA 3R7WB 2VQ6A 3KJZA 1T0PA 3DBOB 3M5WA 3V1UA 3GLGA 1WVIA 1ZVVA 4UE3S 1OZ0A 5HBRA 1T5TA 1JAYA 2OECA 2HA2A 3IBTA 4XGIA 4DSZA 2P6RA 4YCBA 3NWJA 4FTWA 4G84A 4WVFA 5TPWB 4E03A 1MENA 1U8UA 3ZD9A 3C6BA 1XK7A 3P4UA 5CBPB 1KPHA 1LRJA 2WFAA 4UJ5A 4WZ6A 3MUFA 3PUVA 3PDUA 3HNRA 1GZ3A 2O2XA 3CPJB 1VGVA 2CL0X 1ZA1A 3BAZA 2B6NA 5DIZA 4B80A 1NT4A 2Z5LA 5EP4A 4EATA 5CFRA 1UMBB 1XD9A 4C4RA 5EJ9A 2UU9B 1YS6A 3IAM1 1QE0A 1EP2B 4M0KA 1QLHA 2X5XA 1IBRA 4MR8A 1IZZA 3LBYA 2BFFB 1S8AA 1T35A 4MITA 1QF6A 1Z0FA 2OGTA 3AHHA 5FPPA 4MKZA 3OF5A 3FTDA 2QPOA 4JQCA 1X3SA 5A4MS 5HE8A 5JCPA 3WGZA 1J0EA 3JASA 3WDLA 3E27A 1I3KA 3I6IA 1OGJA 2O2SA 3BXXA 4QBHA 3R3UA 3D4BA 4N39A 2VAPA 3STWA 2XWQA 3KZVA 4B4UA 1N6KA 1PFUA 4PIMA 1X7GA 2WJGA 4RK4A 3A06A 2OXEA 3B7PA 3GYGA 3MBKA 4IGEA 3BFVA 4FIZA 3DSRA 1XIVA 3LJKA 2FW9A 3KTOA 2W6NA 2OPHA 2WSBA 4HWSA 4I6JA 5JE8A 3RBXA 3WMGA 3NHPA 2B1RA 1JHVA 2C2OA 3F8SA 1PUXA 5AKZA 2ISSD 3MFYA 3PJEA 4RIHA 2AR7A 4HY3A 2O2DA 2AXEA 1G7RA 4Q1VA 4B0OA 2HHCA 1LNQA 4QGBA 4WSOA 3TNJA 3TM5A 4F2WA 1CUYA 1EXVA 5DHFA 1YZQA 2Z6UA 1EQAA 2H1OA 2CL7X 4US1R 3E6AA 1ORIA 4ZO9A 3L7BA 3MXTA 2QT9A 1YKSA 5DGTA 4FGWA 1T4BA 2QTVB 3VR1A 1JHAA 3DBHB 1CIVA 2QL7A 5AICA 1FDSA 3FPGA 1NW6A 3WTCA 1DX4A 4DBVO 4EF5A 2NQ8A 1KR5A 2ZI9A 3GLIE 1F1BA 4LGVA 5TGZA 1TYAE 1WBDA 1VC2A 2EIHA 2JVJA 1NVTA 2AFRA 1X7XB 3ORSA 1CK4A 1M7GA 2JFUA 2WFLA 3NHBA 4U7FA 4MQFB 5IEBA 2PTGA 2QD3A 2FSVC 1RRCA 2F17A 2IE8A 5EJ7A 3FGOA 3BD8A 1Q5PA 1CIJA 1TLLA 4FBLA 4EB8A 1S4QA 2VTEA 4XFJA 5M5BA 4YJ2A 4GKAA 2YQ5A 1B0PA 1LTHR 4DM7A 4DWOA 3E35A 1PAUA 5JU6A 2PLWA 1CUJA 3OX1A 2NPOA 4LZAA 2AXQA 5JSFA 1G291 1WPRA 2X2EA 2C57A 2J9RA 2EKLA 2ZWVA 4LJSA 5FWYA 1XQVA 1DCMA 1JHMA 3LS2A 5JI2E 2XB2A 3M5CA 3ABIA 4MQEB 1OV4A 1YDWA 1YU6A 4RA9A 3F7MA 5HKKA 1SU4A 4E7PA 3FXAA 5BV2P 3HVKA 1LVUA 5HS4A 1XMPA 4FK8A 3CIFA 4RKFA 4DV1B 1RTKA 1WSDA 5CR9A 2GD1O 3PLAE 1ORVA 3CIOA 3DE4X 4KSYA 4ER0A 1QP4A 1TL7C 4GOJA 3T9CA 1XB2A 3A37A 1U2ZA 1UT6A 2QYHA 5ABPA 2HFKA 2D4AA 3DTVA 4HB0A 4PLPA 4B44A 5BOSA 1CZRA 1EK1A 3WQRA 2OORA 3HO6A 4CVNA 3WL8A 2EGGA 3WLJA 4LQLA 2FWMX 4DA8A 4MX8A 3VNSA 4LJRA 3DAHA 1F2UA 3K5WA 1CLEA 4L5YA 4OB8A 1VJ1A 4IS3A 3W4IA 1V4VA 3KAQA 4TMXA 1BOFA 1R4MB 3L18A 4H7FA 1UKBA 5E4YA 1URPA 3D6JA 3ELBA 2V7TA 4IDAA 1F9AA 2HBRA 3ASUA 3KZNA 4ICIA 5EZYF 3WGVA 4P92A 1DL5A 2REXB 1HT2E 1HDEA 3FSGA 4N5LA 3SYMA 1GTSA 5F9HA 3AVVA 1GUAA 8AT1A 3MTEA 1KO5A 2GLUA 1QG0A 1I3CA 1MIHA 5I9BA 1VLVA 3W8RA 4WBNA 2IXGA 1FNSA 4OKIA 4EJSC 5BUZA 5IVKA 2QJTA 4QNRA 5B6IA 2H2AA 2J5RA 2WNHA 4ZO4A 1RAHA 5AI4A 4RMJA 4DSUA 1T8SA 3CT4A 3GFBA 3UATA 1S0UA 4ZTUB 2QTGA 1W36D 4ZGWA 2ZRIA 1W88A 1ECPA 2HK6A 4J03A 1X7DA 4QELA 1DAGA 1R5NA 1QIFA 3O82A 3Q7TA 3D6HA 4H1VA 2WU4A 1AKWA 5TMBA 3RIXA 4X8LA 4V24A 1OYOA 2OMKA 1C29B 4AVYA 4AMZA 1FFGA 1AHIA 1IC6A 1ZFNA 6LDHA 1UXOA 3WLRA 5BMVA 3SYRA 1G8YA 2VBFA 3HXPA 1XXHE 2LE0A 5CPBA 3WX0A 4DXDA 4V0SA 5KOJB 5KYUA 1WHSA 2PFSA 3H2YA 4MJ3A 4N3NA 4QWMA 2FA9A 3CB2A 5AJWA 1MFPA 5C1PA 3ONVA 1WCV1 2AD5A 3PUXA 5IJ9B 1IEQA 3ZQUA 3ICEA 1A04A 1SEVA 1KA9H 3FIUA 3S6JA 3OURA 1QGUB 1IQRA 4MICA 2GN6A 1KI7A 3U80A 1N25A 5IF3A 1EESA 4PZEA 2PFKA 2QVGA 2WMYA 3EDOA 3FRIA 3PXAA 3ZZ0A 5KREA 5LKAA 4B9AA 4XDGA 4LNUA 4RPLA 1G6Q1 5JPIA 1A4RA 3VMFA 2VDKB 2C1EA 5EHGA 1OKKA 2FETA 2NTVA 5IDWA 1EVZA 2A9VA 1H1TA 2ZLBA 1AJEA 1MIOB 4DADA 1QB8A 3T3GA 4WLEA 3QYPA 1J7KA 1R9NA 2OFWA 1KBZA 5HNKA 1RJDA 2GS9A 1NULA 3C6XA 4M53A 2GK7A 5DYWA 3O4VA 2F1KA 5BQOA 3JR7A 2H31A 1YONA 5CT6A 3PEUA 5A9RA 4BB5A 5TB5A 1YJCA 2W2MA 3L6OO 1N8SA 1J2TA 4KH1A 4BLPA 1N5RA 2VG8A 5EXDA 4V02A 1AGXA 2PMDA 4W8GA 2VNKA 4FNAA 3CTPA 1DDIA 4MPRA 3N39C 1E0AA 1S3FA 1I4WA 3A1UA 4JWKA 1AK1A 4AROA 1JMYA 5A5GA 4EZBA 3IVCA 4O8ZA 5HILA 4RQUA 3G5TA 5AH0A 3G0IA 3U7RA 4ZICA 3OCCA 1SURA 2Z58A 1WL8A 4O3FA 1CEQA 1P62B 1EWKA 3R5XA 4K2HA 4RCYA 3TOVA 1KJQA 3DL7A 5IANA 2PQ2A 2PDAA 5T67A 4F6LA 1OFHA 5EERA 4Q7QA 3L4BA 2XUQA 4CNBA 1XPOA 4BB0A 1J8VA 1QZXA 5KNDH 1P4RA 4YMHA 2G0TA 3P4YA 3GLFB 3JPWA 4DDVA 3WMXA 2ZUCA 3N3AC 4HEHA 2IQ5A 4QL3A 7ADHA 3ED1A 4G41A 1AVTA 4EHNA 1DADA 1OPRA 1PS8A 2QW0X 4RY0A 4BGEA 1T1GA 3GGOA 3H18A 5C8ZA 1F0NA 1IB0A 3TQCA 4BWYA 1IN1A 4GLLA 4IJWA 4MUNA 4EG6A 1KAHA 3EXFA 3RI3A 1ZD3A 2C88A 3LAWA 1JJIA 4RV9A 1YZVA 2NXWA 4HTFB 1JIUA 1E2FA 5IDXA 2Q3EA 2XYPA 1OA1A 2KW5A 2ACWA 2CFRA 2WVHA 3UMMA 1DV1A 1R7RA 2XUOA 1N5OX 3C4JA 4BFTA 1SVNA 1P4GA 3L6DA 2W6JA 4OA5A 5TMEA 3BEDA 3F5DA 3LXMA 2RGGA 1BNCA 1SJ9A 3OZGA 5TF0A 4DIDA 3EXAA 1O96A 4FOPA 4QQ8A 3T7SA 1ZKMA 4PZLA 2D0DA 1DQZA 4TLLB 4LRYA 1QIGA 3M9LA 3WLLA 5ALRA 1WKVA 2P2GA 1OBCA 1JPJA 3BXFA 4Y2TA 1RI3A 2EQAA 1KS9A 4Q39A 3I5XA 1L7VC 3AB8A 2AE2A 4QUGA 5EE0A 2IWRA 2WA2A 3FPBA 2HDHA 1W0JD 5CLHA 4ZEWA 3VDQA 1KFBB 2GNAA 2X6RA 4J1QA 4I9NA 2JL1A 3LHDA 3RYIA 4CCYB 1RFLA 2INGX 5E6SA 1SXQA 3QHAA 4ZO7A 2AUTA 3EH2A 2X6QA 1MAVA 5NULA 1O08A 4YECA 4YRPA 1TF2A 1W1UA 3IB3A 1RQ7A 2F8LA 2QRVB 1KVQA 3LZ6A 4MV4A 5SICE 3ZWMA 4EI7A 5I3ZA 2D1RA 1E3WB 1CRZA 2RGEA 3VC2A 2CLHB 2I54A 1FDWA 5DO9A 3O21A 2YV2A 5DASA 5IJAA 1L7AA 1B74A 2HIHA 4JVOA 2G63A 2WM9B 1NMYA 4UNPA 3FCUB 3SZMA 1YFKA 3GFOA 2NADA 3PDIB 1VDMA 3R5TA 2BJHA 2FUEA 3VDRA 1GZSA 1F4LA 1JSCA 4U2KA 3TMYA 5EIBC 2QA5A 2Q4OA 3TECE 2BFCA 1TKRA 5AMXA 4CCAA 2JFGA 1THZA 3RSHA 1L4NA 1TXGA 2Z3VA 3ETJA 4B5KA 2EFCB 3DEIA 4JLAA 2X7XA 5BV0A 1WQ4A 5IRCD 1Z0ZA 3M3HA 1QS0B 1JJVA 3JQBA 4RGQA 3ZGXA 3IEVA 2H0AA 3EGXB 3RHTA 1KARA 4M6WB 2BM1A 3ZLUA 2IYWA 5HF9A 3NTXA 2FW0A 2YN4A 3JQFA 4FNOA 4NK4A 3ZR4B 1GG9A 5TQ0B 1L7RA 4F72A 4TMTA 4JI0B 3FTEA 1XQXA 1E18A 1OROA 1E9BA 3JVIA 5H1YA 3VVMA 2H2GA 2ZT6A 5D3MB 1IBMB 2VSFA 2Y76A 4CL8A 1TQHA 4J0HA 2AQIA 3T9DA 5E3HA 3I9V1 1MOPA 2IUFA 5F1PA 2AWOA 1SR8A 5EQJB 3KQTA 2ZRAA 3BDAA 3PR3A 3PGMA 4MYHA 4UPEA 2CXHA 1ZN8A 3VU1A 2ADMA 1OZGA 1U9CA 4PAWA 5FUMA 3CZPA 1YRQA 3JTEA 2VRWA 3WXMA 2JGNA 5L3QA 4RSHA 2VJKA 4YRBA 4MA0A 3A6GA 5JDCA 3RFVA 3PGVA 4EG0A 2HXSA 2QUJA 4I3GA 5HRAA 3PXGA 3C45A 4WA8A 2A67A 2FZLA 5CVJA 4U2FA 1J97A 4WY2A 4Y2UA 1Z63A 1Y80A 4PLZA 3CONA 1XTRA 4GMFA 1C0PA 1SC1A 2PSDA 2XY4A 3PL1A 4YRZA 1VFPA 2W2LA 3TLXA 1R0RE 2R47A 2YASA 4I2VA 5KDOA 3DKKA 1U5BA 3VPXA 2O2EA 2PGLA 3AJAA 1BKDR 3HJRA 1LLCA 1SWWA 4U2EA 4OHPA 4ZCPA 3W77A 5B64A 4F3RA 1OC4A 3GAFA 3OQBA 3VR0A 9GPBA 3BQNB 5JHHB 4LDZA 3DW3X 2HU2A 1V7CA 2BGJA 4ZOLB 4C6TB 1T8UA 3ROKA 3DZKA 3OIDA 3BULA 5EE5B 3WLPA 1R9GA 1NJ6A 3N5KA 3P26A 4JC8A 4Q9NA 2VJMB 2J9ZB 5G1OA 1RP7A 3WFJA 4DWJA 1SVSA 2HMAA 5JFTA 7GPBA 1VSBA 2CDBA 3SX2A 5HTOA 1WXGA 5F77A 1T5LA 2WF6A 1QTIA 2XVAA 3GRUA 4JLVA 5A5VA 4JP1A 2N42A 5A3QA 2QN7A 1TJNA 1R3DA 1SBIA 1V37A 4O4IB 3DV0B 3DCYA 5LP6F 1D03A 1DIOB 2V6BA 4LTMA 2CHVA 3U62A 5K0ZA 1LSUA 2XNHA 4M7OA 3RSFA 4B79A 2HPVA 1UKAA 4UDXX 5HJ5A 5TT0A 4MV8A 3LMKA 1KQ3A 4U39A 5ALTA 1T6XA 4N0EA 1TEZA 1CDDA 4YV7A 1G3UA 1UMCB 3A6HA 3UY4A 5FFFA 4MPDA 4CQMD 5FCDA 4EUNA 1JYFA 5IPFA 1Z7BA 4EHAA 3TZBA 1Z26A 2QE7D 2EAUA 1TNDA 2WSLA 1C9NA 4W7SA 4HVAA 4UATA 4FZRA 1TT7A 4OMFG 5AKEA 3FPLA 4MMZB 1GYRA 3M33A 4PC2A 1G5FA 4BYMA 3R0QA 4K9PA 2QRUA 3VZRA 3BAFA 2XF2A 4XB2A 1GNLA 3TPCA 3UEOA 2W6CX 5FLXA 4V1CA 3A9UA 1VIYA 3BXOA 3K9LA 4PG6A 4HUTA 1TEXA 1FX0B 4O1MA 1E9SA 4X3PA 2QYTA 1PK8A 4BBZA 4AK9A 2VYQA 2QL5A 3LTNC 4O4JB 2E85A 2C5GA 3ZBQA 4C07A 2PYIA 5C8YB 1BU5A 2QI9C 1CVRA 1FU8A 1Y98A 2O8VA 3DQPA 3ICCA 3KVRA 1KI2A 3F5SA 4MDHA 5B1HA 1JT9A 2C2HA 1NX9A 3EUWA 4QJ5A 5EE9A 3RVKA 2VEOA 1ABEA 3QKRB 1RMYA 3A3YA 3C15C 2B0JA 3QBTA 4NJMA 4JSRA 4EECA 1NQAO 3OU2A 3UAXA 5BXYA 4OHWA 5CDSA 1OXVA 3OHPA 3KQLA 4GYWA 3GP8A 3DOHA 4Q9DA 4B73A 2E6UX 5MHTA 4I5EA 2CHEA 3AZOA 5BN1A 2R8XA 2DTEA 5GTDA 3QMWA 4A8JB 4ZEOA 1FFXA 4KC0A 4IJUA 4RVGA 4B2LA 1QO0D 3QIAA 4JX8A 5KZMB 4G85A 3N8DA 2R7NA 2A9OA 3F9RA 3H19A 4INPA 4KPUB 1XPRA 2VYCA 4Z86A 3HI4A 2QNRA 4KIFA 1VLZA 4MWEA 3U7JA 1A9YA 1ISHA 2IVFA 1U3VA 4KUHA 2BF4A 5K5EA 2W6MA 3EZGA 1I2CA 4YP1A 4DARA 1EG2A 1TKBA 4QBFA 1QIMA 4TMKA 4GZ3A 3UA4A 2P1RA 3GU3A 4FZ5A 4L2IA 2CVFA 3ADOA 4R98A 1VZ2A 1YO6A 2PUVA 2DKFA 1NM5A 3LPCA 2E4XA 3WMFA 2BH2A 1KORA 2YIVX 1YL7A 1OT3A 3SZUA 3V7NA 1P8JA 3WQQA 2CV1A 4K6FA 3GJ7A 2VWQA 1MGOA 4QKQA 5A6VA 4UEKA 1FMCA 1SXJB 1RS0A 3PQEA 4UM9D 1NVUQ 3QVJA 1T24A 3WSTA 1YQDA 2AG0A 2DR0A 2PAAA 1U4SA 2I3ZA 1GRQA 1DAPA 5CVEA 1R15A 1GN8A 4EGJA 2ZGVA 1JHUA 3FBGA 2Z2YA 5E4JA 2PRZA 2X77A 3OZTA 4X8HA 4Z3OA 4TTSA 4MW2A 1BMFD 4EMSA 1BVHA 1QQ7A 3CBGA 1CDEA 2A7XA 1HE2A 3AESA 2H4ZA 2O8NA 4AIIA 5JQGB 1V8PA 1XZ8A 1ZM7A 3QMVA 1DRWA 3SIWA 4FHGA 4ZI7A 5AVTA 2FX2A 2RMKA 4BP8A 3RFXA 1J0XO 1F8GA 1UPTA 1EAMA 2A78A 2XMPA 3WP1B 4B7AA 2O05A 2ZBPA 5D5QA 3FIJA 2Y1KA 5DLPA 4MQ6A 4OVKA 4MGYR 5FUYA 4MB0A 3WSWA 4R3NA 2O1XA 3R3YA 3DKVA 4DZTA 1W29A 1SOUA 2Y71A 3I9OA 1RI5A 3GZNB 4RMGA 2FZCA 1CYEA 3MF4A 4PSVA 3T3IA 1B2LA 1Y89A 4AUKA 1TVKB 4CKEB 2BKVA 1B73A 4AKGA 3DLAA 3MWDB 2ZRQA 1E96A 4FFRA 2R5WA 1RZVA 3U5TA 2BFOA 1OE0A 1DFHA 5DGCA 4B4VA 4RH0A 3BZWA 5JISA 5KTYA 5FHQA 3NVKI 2H65A 1FTYA 4OI0A 3O2NA 4JLMA 2H18A 5U9CA 5IK2A 4LC0A 1JG2A 4NBTA 1H2EA 4YCNA 1TEVA 1RWKA 2OGWA 3I61A 2OXTA 4B6RA 5L45A 1LZLA 1RLUA 1U1FA 4NBSA 4Q82A 1F48A 4LJ7A 2QN2A 4GI2A 4P5DA 1DG3A 2X1VA 2HYIC 1UIMA 5AVOA 3RFFA 4HEA6 1QV7A 1P1HA 2E37A 1DINA 1H9AA 1X14A 4LJ5A 3QG1A 3FUCA 4MYCA 4NYJQ 5D8DA 1UJMA 2OBXA 1O4VA 5T7BA 3TL6A 4OM8A 4GHWA 3MTIA 4E08A 1GR0A 1TCBA 5KBYA 3JQ7B 3TBFA 1SKYE 3SQWA 1QRSA 3VH3A 2V6JA 1NTOA 4L1KA 5D51S 1G8JA 1Y7TA 3KBBA 2NT4A 1CJMA 1U80A 4G5HA 4JKOA 2FZ5A 5J5AA 1ZITA 1P2FA 3HPRA 3T9EA 1L4BA 4LY6A 1T9ZA 3KJEA 3PJFA 4DJJA 3PQ4A 2QMOA 3ZHZA 4AY4A 1P80A 1FQJA 2O9JA 3AIOA 4QO7A 3RVPA 4OIFA 2JBHA 1YB1A 3JQCA 5LBTA 2JFBA 2OHHA 1ANKA 1QRRA 2C54A 1JFRA 4OP2A 1T6YA 4RWEA 3O94A 3WHKA 1YL5A 4CIXA 2GK6A 4EVSA 1OFIA 2ZSBA 3IE0A 1NVWQ 1TJ3A 3KQWA 4AZSA 2QWXA 4HTAA 1D6MA 1H8ED 2HT1A 1CJKC 4R1MA 3BG5A 2EHDA 1JU4A 2ZQ5A 1JN0A 3NJRA 2CZQA 3UB4A 3GT4A 3RW9A 2OZVA 1XCPA 2YWDA 3IUSA 2Q28A 3QV1A 1LPBB 3ETCA 4GMHA 4I55B 2CMHA 2C5HA 5B1IA 2SKEA 2G06A 3BWXA 3OOEA 1WRBA 4WTOA 2OBMA 3UENA 2P6NA 2Y3IA 4C6RA 2FV8A 3QI2A 1U99A 4IV8A 2WWRA 1C7JA 3W9SA 3W9YA 4CTNA 5BSRA 4GBGA 1QGED 4NAHA 1GQ2A 4EY7A 1TPZA 3V3TA 1QFSA 1T9BA 3ESCA 4FSDA 1OI3A 3LWZA 2P75A 1S9HA 3QFCA 1ENPA 1I8TA 3BS4A 5C31A 4CDMA 3QXGA 3FCSB 1YC5A 5JOQA 3UCFA 3ZN2A 1F0PA 2OV2A 3QVOA 1O1YA 4ATNA 3E4DA 4LWZA 3I3OA 2VN8A 3HDYA 4J76A 3MW8A 1GGKA 4FUQA 3K6RA 4QNNA 2FP4A 1NKVA 1HETA 3O31A 2WAOA 5C53B 2QIOA 4TYYA 5A03A 3DMTA 4K6HA 3V33A 2C9MA 2IX9A 4PSAA 1OYWA 1NRWA 2WKPA 3MTQA 2XAUA 2Q5HA 4MAFA 1GTZA 4DV3B 1Q1AA 5C1IA 4PN3A 1KRXA 2CUZA 1DAMA 2JGDA 1KBOA 4TROA 5I4KA 3ODGA 3I28A 4YVFA 4TKVA 4BEVA 4ZJYA 1U0TA 3DVSX 4B6FA 3U4GA 3WGJA 3GWGA 5LFAA 4Z9BA 3SBXA 1P33A 2J3KA 4V2IA 3R9WA 3PQFA 1G4HA 5F5XA 1TK3A 4GXNA 4PG8A 4YLGA 4R40A 4LRXA 3LPMA 4KXWA 4NV1A 5CB4F 2P62A 5AJVB 3KBOA 2O0LA 3AB7A 4NEHB 2H2HA 3EAFA 2IF2A 4LF8B 3DWIA 5E3IA 1OFUA 3QKTA 4IOKA 3D7MA 1A5TA 1UBUS 4QPCA 1KO8A 4CM4B 1GM5A 1RE0A 4RBNA 4WESB 4TLEA 1Y6RA 2HO4A 1JHQA 3IR5A 2MINA 3PR2B 3HABA 4KQIA 5K8UA 4E31A 4FFPA 4H16A 1N0HA 4CMEA 5DNYB 1U3DA 1FQKA 1XEFA 2AG8A 4GMDA 1P4SA 4XUGB 4DDMA 5A06A 4OK3A 2NP7A 4L4ZA 1U6KA 3AP3A 3LP8A 2WJ4A 4E11A 4RANA 2FUG6 1DBVO 1KEPA 2KQUA 1AO0A 3LPDA 1OBHA 2BFPA 4HS4A 3NBZC 4IVRA 3AUKA 1BQ3A 4LTDA 2FX5A 3ID6C 3IRVA 3OBIA 2H9AA 2MYNA 1MAHA 1OD6A 4G2NA 5FPHA 1OX4B 3QM1A 4ZVNA 1PZNA 2PWPA 3H2HA 4MRVA 4MGKR 5D3KA 3UG7A 3LYLA 5KYXA 5KQMA 1FLVA 4KVGA 3IIEA 4Q3KA 2IHYA 5AO9A 4X94A 3QSGA 2JGKA 3NUGA 2C29D 5DCLA 3AR2A 3IR7A 4AS1A 2IK8A 2I7XA 2GFHA 2JJ1D 3MMNA 1IQPA 1HE1C 3ZQ6A 3RC8A 3SQOA 1IUNA 4AS2A 5IYZA 4K9MA 2W2KA 2V54A 1OWPA 2F8MA 3VYUB 3KOXA 3PNOA 5EKTA 3ZK9A 1D4ZA 4LMRA 4CJXA 1KY5A 2PR7A 3GLQA 1I4OA 5JPCA 1KNQA 2G36A 3A0UA 3PYMA 3DOUA 1C7EA 3DAGA 2EX0A 2YMPA 4M1OA 3H4VA 5CFOA 3AR8A 3DOOA 2DZDA 4DT1B 4F4FA 1J99A 3PDCA 3R23A 4YGXB 2NG1A 4K28A 1YT5A 4BECA 1XRSB 4CN8A 3G2OA 2XDYA 4WQMA 4LYYA 1CJBA 4HXYA 5NLLA 3BSSA 5IXYA 3R0XA 2XIQA 3VR3A 3IO3A 4WUVA 4HZIA 4Z9FA 4BO0A 2ZIAA 4AJHA 4BDSA 5C1DA 1ZLYA 4QJBA 2D6FA 1QV9A 4QOSA 1K5PA 1QNFA 2YS7A 5IAAA 1HYEA 1XP5A 1EVKA 2GWRA 2PUJA 2ILTA 2X8LA 3MUOA 5H82A 3G7UA 2HXYA 2IYYA 2HO5A 1MV8A 4FS3A 2RGCA 5CYOA 4N54A 4CLXA 1L4EA 1PJ8A 4YP7A 1GPBA 4F4HA 5I7OA 2R84A 4L8VA 1NSTA 4AD8A 2ZSDA 5EZ5A 2C2ZA 3P32A 4BFCA 3B12A 5HTKA 4D6XA 1M1YE 1PJSA 3TCKA 3E22B 2K2QB 4LX8A 2P2ZA 1GITA 3STVA 4E5UA 3F3SA 2IDMA 3EBOA 1VBMA 3F7TA 1G3QA 2XA9A 1OHHA 3RJMA 5ENZA 4IRXA 2E3JA 3Q7PA 2VP9A 1T34A 2AMLA 2H52A 2OENG 3I4CA 4Z53A 2ZRPA 4MS3A 1E7YA 1ULUA 1B00A 3SC2A 1XZCA 1Y1SA 3OM1A 2BUAA 3AY7A 3EBPA 3ZBPA 1AKYA 2JGAA 2NSYA 4MWOA 4U6QA 1OSNA 2XCQA 1D0IA 1V1RB 2QTRA 3BJMA 3FDZB 4JJZA 3IJ5A 5DHUA 1RI2A 4HBGA 1IL0A 2Z8YM 1QGOA 1G9SA 2UZ1A 3GPDG 4F5YA 2P4HX 5FPKA 1JFTA 5BO5A 4DM3A 2AYZA 3EZ7A 4L0MA 1J70A 4S1WA 4PG5A 1L7DA 3I2KA 2DVMA 5ALDA 3QKIA 1WG8A 1YZKA 2O2GA 4M1YA 5AKYA 5EYPB 3VOSA 4BV8A 4CEJA 5A6SA 4G86A 4N76A 3BB1A 4YV2A 1T5SA 1L8AA 3DBRB 1Y8AA 1T1SA 1GKKA 4CM1A 3UKDA 3DZFA 4ZAGA 3TGPA 5DYTA 1EVYA 4I46A 3ZWCA 2C9YA 4IVPA 1HLGA 4QHSA 8MHTA 5K1ZA 4N18A 4YJKA 5KQSA 1DG9A 1FDOA 3VZPA 4P4TA 1KXJA 2O7RA 2QOEA 1DKOA 2XX3A 2IIQA 5AM5A 1EDBA 2IDKA 4LYEA 1YS4A 2F3TA 5TY0A 1YF3A 2CJWA 2O06A 3OEEA 5KKAA 3A05A 3G82C 4PYMA 1G8GA 2BISA 3SC3A 2PGOA 4AF7A 1U3GA 3K15A 3OQNA 3U40A 2PUWA 4WCVA 3Q9NA 2IW3A 1XLTC 3SQMA 2B69A 3ELWA 4ZOEA 1I3NA 1WUIS 2QHXA 3CRNA 2IS1A 1XTBA 1QG6A 3TOCA 1G21E 3WL3A 4J0KA 1BW9B 1UC4B 4P4GA 3D4OA 1KZ9A 3F6YA 4QEKA 2Z1NA 1W2HA 1UIRA 3OFVA 4HQOA 4O63O 4WK2B 2Q99A 4OLHA 5HIJA 2XT0A 3K0SA 3AUXA 1AX9A 2FSSA 4AL4A 3EMVA 4EARA 3H4MA 4RWZA 3TW8B 2LPMA 3H16A 3ROFA 5K3FA 4BCBA 3H5NA 2XB6A 4KV9A 3M6UA 1UAAA 2BY4A 5B7GA 5HVNA 3KQNA 5DYNA 3L1UA 1OBFO 4C08A 3N0WA 3H1AA 1PQ4A 2M2IA 2PRSA 3RFUA 2LKDA 5HR5A 5JD6A 2E4AA 1TMGE 2IRWA 3SF0A 3UHOA 4L76A 3WDMA 1E79D 4EFNA 1VB5A 5KQRA 5JD5A 4AX4A 1F4PA 4KKVA 3OJCA 1GLVA 3NLLA 1AOXA 2ZR9A 3NP9A 1IRXA 3GGCA 1NW3A 3P7MA 3GK3A 4UTPA 4I4TF 3S44A 1L3BA 1CT9A 1QR2A 4ID9A 3DBIA 2Z9CA 3AUJB 4JBHA 4RU1A 1KEZA 2QX4A 3IA2A 4N8DA 3GAMA 5G02A 3EK2A 5C4GB 3OQHA 3OJEA 3WJ2A 3KQYA 2V97A 4O02B 4F4DA 3SR4A 4K3UA 3OEWA 4OB6A 1QOQB 2FI1A 3B52X 3VZQA 3O83A 3HNPA 1TYEB 3MCVA 4IEIA 4TV8A 7YASA 1RWOA 3AUAA 2PUDA 1SD1A 5FTNA 4IV0A 3NBMA 3GPLA 1TU3A 4M3NA 5BR4A 4QGHA 4EHDA 1NVMB 3PFWO 2NXEA 1E64A 3NHFA 5DM0A 5LLDA 1HO3A 1ZI9A 2Q4DA 2X3YA 2X0NA 3AEXA 1MO2A 3KV1A 3MJ4A 1X87A 5GONA 5JCJD 3B7GA 3D31A 4OOFA 4Q6BA 3ORRA 2G3YA 2H5LA 4EVQA 1U7XA 2ZTSA 1CF2O 3D2BA 5K0CA 4LYAA 3PI7A 4G89A 2CMKA 4TYMA 1W25A 4S2EA 5EWJB 4W8HA 5KTSA 1J8YF 3SZRA 2PO5A 3NAGA 3FOFC 1RBZA 5EOVA 2R68A 2I3AA 1Q6YA 2AZDA 2PO7A 5SY4A 1KP2A 1N2CA 3D4NA 3R76A 5EJMA 2C4VA 2WB4A 1KQOA 4G5QA 3OLYA 5ED0A 4NYIR 1AQLA 1DC7A 1NFRA 1RQPA 5HQ3B 1GP2A 3LBIA 3VKHA 2AKYA 4KAAA 4WJLA 2ZK7A 4A73A 2XDAA 2ID4A 1PKEA 1SBCA 1W4CA 3ET4A 3WVNA 1XMXA 4DIEA 1NASA 1PX2A 3D59A 1AF7A 4K0RA 2GPJA 3TR0A 3VKVA 1QQAA 2FH5B 4RK6A 1H65A 4YAEA 3CLTD 4MQ4A 3BGOS 3HR8A 4A6XA 1SUCA 2GBIA 4H59A 3W2FA 1II8A 1B8UA 1ONSA 2J9GA 2PGXA 3DXFA 1XNRB 1RYMA 3F74A 3N28A 1EX9A 1ZNZA 4KPGA 2X3FA 4PGAA 1WB4A 1N3YA 1NSFA 1Z2PX 2Y0CA 4O0LA 3Q7RA 1YZTA 2Q45A 4QEDA 4CHTA 4A0GA 1FXWF 1ZJ4A 2P90A 2XT9A 4ER3A 4RCVA 2BKUA 4S0ZA 4OK6A 1AHHA 1Z73A 3IKLA 2PS0A 3LA6A 3TLEA 1PEDA 4XUCA 1NBWB 3PVZA 4UNNA 4UCWA 5L40A 2I87A 1AUQA 3CZQA 1KAMA 4FLEA 3OOSA 2IV3A 3UFXA 1Y3AA 4XEUA 2IHJA 4JB8A 1SCUA 4NQRA 4EYEA 2O1WA 3SBEA 1L7QA 2XXAB 2GZ1A 1AIPA 4G1EB 3DB2A 3GG9A 1QKIA 1DQRA 3ESRA 4KVAA 5HKAA 1U1GA 2P78A 5JLAA 2YWEA 1OAOC 4F1WA 4IGAA 2VJAA 4ZTBA 2R7KA 5CFZA 1N6LA 4EH1A 3KPUA 1Y8QB 1ID8A 3CYFA 4EGCB 2CNBA 2XCIA 2I6TA 3GNSA 4WW0A 3ROPA 3WYFA 4B0PA 1KEEA 3ZEIA 2A2ZA 2P7HA 3PICA 1FRFS 4OMDA 4XQ0A 4NOJA 4CM3A 1N9KA 4RTOA 4C0BA 1C1XA 1FP4A 1SQGA 4A6PA 2CNDA 2RARA 4YJGB 1KY3A 4J7AA 1MJFA 2I8CA 3PEFA 3ZXIA 4RXUA 4UVDA 1DWUA 1ISPA 1X6VA 2HYDA 5EP3A 3ZPXA 5K0JA 5KIAA 2C7RA 3IALA 2B4KA 2PGNA 2WWWA 3KCQA 4HSGA 4IDPA 4IIFA 2P9GA 3UWPA 2Z5VA 3V32A 3ZG6A 3ZY3A 4DYVA 2XB4A 4J7XA 3SGLA 2PM8A 2V7XA 4WJKB 4TX1A 4I3FA 4NI5A 1C1DB 4UHKA 5DGIA 2X7JA 4FC6A 1JG3A 1J2YA 1FFWA 3H9BA 5L3SB 3R3SA 5ERXA 4B3FX 1CJSA 3QLTA 5KKNB 1ZXLA 2BI8A 3E7XA 3DKRA 4NOLA 5LYJF 4TYNA 4YRDA 4WZBE 4PLVA 3H05A 1F3OA 2X14A 1GEEA 4KN9S 4L4UA 1GTRA 5BY2A 1CKEA 3VC3A 4FGLA 2GBLC 1U8CB 2GZRA 4IZIA 5BORA 1SK8A 2CFOA 3PXEA 5HUJA 1TQ6A 2O5RA 3B6KA 1E6KA 4GI3A 4J1TC 2QJWA 3FTCA 5KNDA 2C4TA 2PX2A 3IQZA 3KALA 4LGCA 4BC0A 3PTAA 3GP3A 4GWGA 2QD5A 1PL8A 3KUKA 1WTAA 5K0FA 4G0NA 5FWXB 2PMFA 4MS4A 4FOSA 2AL7A 4E1AA 1YI0A 3CF4A 2VHYA 3IQEA 3K16A 1RJFA 4HRXA 5JS6A 2IBSA 3CMCO 1GZ5A 4KZKA 4ERXA 3G0GA 2X9NA 4J43A 5BVGA 4ACAA 1UKZA 3DW1X 5IUNC 3G7SA 3T38A 2R62A 1N2BA 5T5QA 5A3RA 2FR8C 1ZRMA 7MDHA 5MN6A 1SG0A 2WAMA 4NR0A 4AZTA 1RWQA 4ZVSA 2B92A 3LLVA 3JATB 4RD6A 5HIIA 3REQA 1FJGB 5B3AA 4HGZA 5LZ8A 1YR1A 5FOTA 4XJTA 1X38A 3VZDA 2JH9A 5H70A 3PX7A 1R4NB 4FGJA 4JAVC 1U8AA 3FMVA 1W9MA 3KKMA 3LLUA 1E2QA 5ADWA 1N4DA 1PQPA 5AKJA 3LFTA 2P2LA 4XI9A 5L7YA 5BYKA 2ZTVA 3WWCA 3O8LA 3GLHB 3T9FA 3DTNA 1E2NA 4GVPA 3MOSA 4KO4S 3V46A 4F93B 3VMMA 4P35A 3O5AA 1OVGA 3WGLA 2REBA 1LTKA 4NPAA 3WGQA 1GV1A 2Y2UA 1XQWA 2IUUA 4B40A 4GZMA 4OQLA 1ZBDA 2VAWA 3TSCA 2CVOA 4G81A 2YOHA 3S7TA 1EFTA 1O9BA 2V7BA 3OQVA 4Y30A 5I9TA 3U44A 2F64A 4DVGA 3ZJTA 1KRHA 4XWOA 3CSSA 1NHWA 1UODA 3ZJYA 1HE8B 1TZ2A 2ZM5A 3TRIA 3T7KA 2H8GA 1A9SA 1PE0A 1RYZA 2HBZA 3AU8A 3BT7A 1W85B 4YHHB 2QSUA 1MJGA 2LUOA 2L17A 3WQSB 4XAQA 1SAYA 1VL6A 3M1YA 2WC1A 5EIHA 3TZQA 2PUGA 4EHKA 2W4IA 1BCSB 4HAXA 4G5GA 2R6DA 2PSFA 2VBCA 4G9BA 8OHMA 1H6BA 1YU9A 2BCGY 2DTXA 2QUHA 2R4UA 3D2AA 4ROTA 3W3AH 1GPWB 3S29A 1U8YA 1E3EA 3U4IA 1OA0A 1AHNA 2NU7A 1I0LA 2WIAA 5F2EA 3I8OA 1HDGO 2RDMA 3WA7A 4IMRA 4RHCA 4I8IA 3KJQA 1NW5A 2RH5A 3MZ0A 3K9GA 1JQJC 4PFKA 1XXHB 1HFKA 1SOMA 1NE2A 2GR9A 4QPPA 4EY3A 4EKNB 1B1CA 1E0SA 1XFDA 3OIFA 1D4FA 4G97A 4J0IA 4JVLA 5FD8A 3ZBTA 2CVHA 1EVEA 3PCRB 4J0CA 4YWHA 4AX8A 4Q00A 1CJTC 5E1OA 4C76A 3FVWA 2ASVA 5ALOA 3PG5A 1TCUA 3U0BA 3JAWB 4LCBA 2LCIA 3DHEA 4DLXA 1V6SA 3VO1A 2XCLA 2PMWB 2ZG6A 2G1KA 3V1MA 5AJYA 3B6ZA 1MKYA 3L0BA 5LIPA 3T9AA 3EPHA 3CBQA 4FDLA 1HPLA 4M8KA 1JIVA 3IRUA 1BHJA 4WV3A 2PNJA 2JK0A 1JHOA 4CTOA 4F11A 1GZDA 4IEFB 1E4OA 2VDNB 4TUYB 4FBMA 3TRHA 3SN6A 2RI6A 3W4KA 2WYHA 4ILKA 2YXLA 3K35A 4J3NA 5CVTA 1EUQA 4BZWA 3O3MB 3ZHQA 5EKUA 1VMKA 3M82A 4NESA 4XR9A 2WV7A 5F1KA 1NYTA 2ODEA 1DXQA 2A5GA 4LBVA 2RKWA 4O5AA 4MH0R 4RQAA 1I3MA 4L22A 4Q4JA 3LWBA 4H7HA 2GH1A 5C5CA 1PL7A 3QLVA 2QLLA 2WVJA 1Z35A 1R0BA 4PTZA 1RWXA 3MELA 4HG2A 3NJ4A 1RM4A 4KE6A 1SCNE 3H2GA 3B3FA 1W4LA 1N2IA 3CCFA 4Z4CA 3PRKE 3ZOKA 5KJ1A 1M75A 3T41A 2R8OA 2PZJA 4Y98A 1RZUA 5FL7D 3VNVA 2QVXX 3U7FB 3PU6A 2AV6A 4INJA 3X2EA 3K4QA 4IIBA 1JWLA 3MEQA 4I50B 1TI7A 3OCZA 3RSGA 2EBWA 3EPLA 1ZK4A 1JIXA 2OO5C 1U0HC 2OD9A 3I6BA 4OXXA 3VR6D 5JMTA 4Z4QA 4MV7A 1W8DA 4JA2A 1R8XA 5G2OA 1ZSNA 1U4NA 3AINA 2R65A 1OLUB 4YRMA 3H87A 3PQ8A 4R16A 3HXQA 2HSEA 4JQZA 3WSVA 2C5BA 2YX1A 4UASA 5JNUA 4G4SO 2XUKA 5KYYB 3CWZA 2X0JA 3FWKA 2OSVA 4RSMA 1N2JA 4WADA 3CHYA 1IHYA 3R5FA 4QQRA 3RUHA 4D82A 1OTYA 4EUSA 1EXDA 1J00A 3WS7A 3QPBA 1C8BA 2Y66A 3ZXYA 3AYZB 1TC1A 4R1NA 3PDWA 4LDRA 4M8LA 1MOZA 4MVJP 3JQGA 5K3EA 2YS6A 3HU5A 1ORTA 5I45A 2RK6A 1R50A 3AIIA 3FNBA 2QQFA 3G17A 3VR2A 2Q6KA 3WK9A 4ZDKA 4JR0A 1RKQA 2WUWE 3E3AA 3CN9A 1RZRA 1E1LA 1ZVMA 3V55A 3W6OA 1ZU4A 3OEHD 3SHQA 2IYFA 4MS1A 1T10A 5I01A 2A4KA 4CR7A 2X0EA 2YYYA 3AFNA 4JROA 1DIBA 3BK2A 3CISA 4XASA 3JVUA 4JYBA 2VUIB 1K1EA 2QP3A 4LQCA 2DUJA 1TU4A 2ZYUX 3B1XA 4ND7A 4RSRA 4CZ2A 1O0BA 1NR5A 2LZ0A 3TI9A 1VE1A 4ABTA 4MRMA 1DC8A 3H2BA 1E66A 2QZ4A 2AN9A 3CLSD 5CEJA 1T6BY 4MW6A 1KWKA 1O77A 3OOWA 3WTBA 1NF3A 3HGTA 5JAHA 1KSGA 2R6ZA 3C70A 3K6SB 4Z4EA 1BWQA 4H1UA 1HDIA 1HFJA 1XZGA 3GIDA 1UMDB 4O25A 1D9ZA 3COVA 2Q0HA 3AVPA 1P5RA 5KJ6A 4D7AA 5F1OA 1YQXA 1S2IA 4CF5A 1VI2A 1SXHA 5F5NA 1PVOA 4BO8A 1NXPA 2QRMA 4LSGA 5I7SA 4A0QA 2ADOA 3FFTA 4AULA 1S7GA 3LTEA 1EK5A 5LP6C 3TI7A 1ISIA 5L6LB 1XDDA 2A9KA 1GSHA 2AOTB 4R7TA 5A04A 3Q98A 2Q3JA 4O0MA 3A2KA 1AO3A 1HDOA 4HXGA 3GJ5A 3EXIB 4XX0A 5DNVA 2SCUA 2VQSA 3CCCA 3ZWDA 4UDOA 5KU1A 3N2GA 3P2IA 4GS5A 1DWQA 3N7AA 4MUIA 4QU5A 2VTBB 4X71A 4PNZA 1YCGA 3H75A 4UVGA 4B85A 1E6EA 2AE1A 1GPMA 3GDGA 3E81A 4MV5A 3FLMA 3C41J 5HFAA 1SBQA 2IOHA 4P7JA 2X4DA 4P32A 5IAOA 4Q3OA 1JEAA 2PRKA 1G5TA 3KE8A 4KAJA 5IHXA 3UFBA 2XE7A 1BJKA 4GZ6A 3SC6A 3TQTA 1D2HA 2CDNA 3BFXA 2EJVA 2J41A 2XH8A 1VIAA 5EHXA 1OLXB 4KO2S 4IDGA 3GF4A 4D3DA 4LEIA 1T1EA 4PHCA 4YUXA 1MDFA 2NYAA 3S8EA 3NI2A 3FYUA 4S04A 1W6UA 2UZ0A 3LT5A 3RRNA 1TCCA 4RTJA 2XUHA 3G2IA 4FKZA 4HFRA 4R0NA 3RSCA 1ABBA 3MK31 3KT8A 9MHTA 3BIWA 3QYJA 4MVCA 2UUAB 3ABOB 3Q8XB 5B57C 3HYNA 1FP6A 1U5CA 2C04A 4MDEA 5K3OA 2EFEB 3PRJA 4A15A 4GQIA 4XJSA 1F60A 1IM2A 1USVA 1Y5LA 4NMWA 3BJZA 3ZV4A 1NATA 2C42A 3ANYB 4WNYA 1DI0A 2X8BA 4MUEA 2UZ3A 1BRMA 1D2AA 4KQMA 4YCLA 5AXBA 3EF1A 4RDIA 4I19A 1RWNA 4QYIB 1DEXA 1YZGA 1BE8A 1Z17A 2C3YA 3RRFA 3QUAA 3AEKA 3QH4A 4PX9A 3UJAA 4BBAA 5JVDA 3I9FA 2NV0A 3O9MA 4IOJA 3VTZA 2G9VA 4O4LF 4BEBA 3KNZA 3OBBA 4R2KA 5JSZB 5JAMA 1R0YA 5G3ZA 4GE0A 3OWXA 1QQTA 3T7DA 2P9FA 2Z2IA 3B48A 1YOVB 2C8VA 1J21A 3JD0A 3LGAA 5CDFE 4ZARA 3LQFA 1I0IA 3EIXA 5AXDA 3OE5A 1P77A 1Y82A 3RTBA 2R7AA 3U7EB 4CCSA 4C7VA 5TS3A 1VG0B 2VA9A 3AL3A 4EAQA 2LIVA 1M6HA 4CF7A 1RR6A 1NUUA 2Q41A 4K9QA 4E3ZA 1QPZA 4DDTA 5A5EA 4BNDA 3DJYA 1FC0A 5F2KA 1TJ5A 5A71A 3STHA 2B0CA 2BHTA 2QL6A 3ODPA 2VZ0A 3EN0A 4GUAA 1I5OA 2V7QA 4PIVA 1N5IA 4KNVA 5F7XA 2ZSJA 2HA3A 1WU8A 3G9UA 4IIEA 4N7RA 4MUGA 5T8KC 3MILA 1PJQA 2H2FA 4FR5A 4H7IA 4BIMA 4ZYUA 4B3DA 5BSEA 2Z8ZA 1FNMA 1XRRA 1UEJA 5L4NA 2EXXA 9LDTA 1OAAA 4EJ2A 5K9ZA 3OFNA 3LO5A 2QAJA 2R6FA 2VHXA 3MS2A 4XVCA 1WW8A 3WMEA 1UBNA 2YYAA 4ETWA 1M72A 1S2GA 2DCMA 3H5RA 4TTVA 5LDDC 3C3JA 1PK9A 6ADHA 3ZWWA 2XCSB 4REQB 3ZWBA 1TX4B 2OV6A 3VAZA 1U90A 3OKCA 5I7AA 2HADA 4WLVA 5IABA 3OSUA 1ZN9A 3Q72A 2VBGA 2RHJA 2VHUA 2OK8A 4HVCA 1OZAA 3CO0S 5BNTA 1FYVA 4M83A 2FZWA 2GX6A 4XWAA 1E1CB 1NMXA 5LDHA 3MUNA 1MQ9A 3IO5A 4R3WA 4OYHA 3CT6A 4CUZA 4OBWA 3ZWPA 2NVBA 2PPLA 4IDFA 5FBWB 5FYDA 2OESA 2I65A 3M6FA 3EFOA 2AOUA 1MX3A 2QTZA 1Y7IA 4HR7A 4MROA 5CH5A 1DV2A 4WA7A 5JMPA 3ZKAA 4CWAA 2CJPA 4MUJA 1IK6A 4Q66C 1TKAA 2LXNA 3LKVA 4OFWA 1JR4A 2MDTA 2SICE 4QDTA 5BSGA 5J2TA 3LDAA 2YJ3A 4HLQB 4QJ3A 1LWNA 2IS6A 3GCZA 4BVLA 3F6BX 4HX2A 1XA0A 2VATA 3BZBA 4Z2AA 1VBFA 3CX4A 3DZHA 1F8UA 2DKNA 2ECPA 3WISA 1NVVQ 2VHEA 5EL0A 5C52B 2VLIA 1ZIDA 5LB2A 3THRA 2Y4NA 2FPRA 3GOHA 4X20B 4IZ6A 1RI4A 3CLUD 3PC4A 4ZK2A 1ZISA 1QTQA 2ZJOA 3TZEA 2OM6A 3IP6A 3GC6A 4KXNA 1R00A 4UTRA 3LUJA 4H7EA 1FMLA 5G53C 1XMQB 1W93A 3AOEA 3H2KA 5KUTA 1KDZA 1YBHA 3O8RA 2AFHB 1DPGA 3T5GA 3K6KA 4EUKA 5DWQA 2YOFA 3U6BA 4A5SA 2OGUA 1Q83A 1EFUA 1Y1QA 2NTYC 4AWBA 4EKYA 4I4CA 3NDJA 4IEEA 1QIJA 3QYFA 2AFIE 2P5YA 3A2LA 2FSGA 4NCNA 2BZGA 1QQBA 2Q4RA 1JHDA 3QPDA 2M1ZA 5ALLA 1RRKA 4OJKA 2ZI3A 1OWLA 3IP7A 2OZLA 1JQKA 1OXBB 2Q4TA 5HRUA 2YXDA 1JR3A 2JLRA 3FCYA 3FCEA 5DLYA 5T57A 4B7UA 3TJRA 3DEJA 4NZ9A 4YI3A 4YCCA 4ZTZB 3KTDA 4JXZA 2J0UA 2VBIA 4NV3A 1LBHA 3QWFA 5J9FA 2DG2A 3NHWA 3IAAA 3RYCA 2R8EA 2CMGA 1PQUA 1T36A 1EFVA 3W2GA 5LJIA 1ISFA 1U2DA 1WBBA 1FNNA 2QRQA 3UIEA 1NFQA 2JLAA 1XRQA 2BFMA 2GSWA 2VTDA 3PD7A 5IKXA 4H6VA 3DBLA 1W52X 4XRRA 3W79A 1TT5B 5FI1B 4D98A 1UJ5A 1GPDG 2C2KA 5CCDA 1ZVKA 2B5VA 3EZXA 3FOBA 4CLOB 3S1LA 2JLQA 4F9FA 1JG6A 1BSVA 1B14A 1RQGA 2CXQA 4NDZA 1QHIA 1A8UA 2F3PA 2GZSA 3KSBC 3DVAB 2Y6UA 1ODTC 3VDXA 3F5MA 1L9XA 3OTQA 2IUEA 4LYDA 1YZLA 1VE6A 4YRTA 1J25A 4GRIA 2BE9A 1D1TA 1OI2A 1P2BA 2ATCA 2O4UX 2BZ1A 2WU1A 3MOIA 4TWRA 2ZROA 2E49A 3LDFA 1H5UA 2RHBA 2UYYA 5SY6A 2PYDA 3T95A 4MYRA 4ZIRB 1CZOA 5KPJA 2HQSA 1CUHA 2WTBA 4M9QA 4X00A 1WSAA 4XDZA 4DCMA 4FB5A 4YXWD 3EC1A 2B7CA 5JZMA 2H4XA 1NP6A 1ZH8A 3ZU6A 3U2QA 4NX2A 3HRKA 2Z04A 5CYPA 3TKAA 2FOLA 2OQRA 1ZGHA 1CBUA 1W0KD 2BFBA 2HA4A 4OV6B 2DY1A 5C4MA 4D4LA 3DM9B 4DOMA 4E4YA 4AMGA 3RAFC 4PXYA 3MINB 3VKUA 4BMVA 4UHCA 4MIKA 3U7QB 1GPAA 4Z1MA 3AETB 4EB0A 1WPXA 4WAUA 1KI3A 3RVJA 4M21A 1S2LA 5CB6A 1JTEA 5E9AA 3WKEA 2ZUUA 5A0FA 2PKEA 4C0JA 5C7LO 1XG5A 1HNNA 4OF4A 3L1KA 1KR2A 3O73A 4P80A 4OSPA 2C8JA 1RD4A 2BH9A 2DLNA 2IYTA 4RVDA 2FVXA 4CIBA 5DNCA 1O5OA 1YHZA 5CTJA 3INGA 3UTCA 2N3ZA 1RQ2A 3B1YA 1SPBS 2PE5A 1P0PA 3EARA 2ZREA 4FFNA 1RACA 3WLOA 2GVNA 2JIBA 2OXFA 1XO1A 3LRTA 4GYKA 4KQGA 4OJQA 4EF6A 4ER7A 4EQZA 1EP3B 3OQMA 1VHJA 2W4QA 1Z0SA 2P5SA 4K46A 3ACDA 3SS8A 2QY9A 2W6OA 4G25A 1QHGA 1ORRA 4NMMA 4RPHA 4RC9A 5FA6A 3LBHA 2AI2A 5GM1A 3A2MA 1E4EA 1XRMA 1NUQA 2PH7A 3E9MA 4IINA 3TAHA 3DQQA 1Z4LA 4AKHA 1L8LA 1XTQA 3G8YA 1DEHA 2OZKA 1XELA 2ZJAA 4WCFA 2GBFA 2FR0A 3HXTA 1J1IA 2EQBA 2R8RA 2QSJA 1GCIA 2VK2A 4I36A 4X6UA 4ZOAA 4IZHA 1VXOA 3MRSA 4H7PA 5DYYA 3VNRA 3B78A 2AIRA 2BVNA 3MTGA 4BZQA 1FFAA 1BTOA 2VAVA 3DXXA 4HLUA 1HSZA 1WUTA 3BSWA 4RQBA 3IDOA 3KYIB 4G23A 3SIPA 4DV6B 4DY4A 3I1JA 5DVZA 3HC7A 1G38A 2FE1A 1G8PA 2GK4A 5T3UA 1TZKA 2XVZA 3WKCA 4J90A 4BAZA 5TMPA 1R4AA 3B51X 4QARA 2WKQA 1Z22A 1H2AS 2DY0A 2ZT5A 3A8TA 2EF1A 4FEGA 5EHZA 1KEKA 3J81A 5LA6F 1QGAA 2WFZA 4TYPA 4GT1A 2BMEA 3U3KA 1SCQA 5GZ1A 3B2EA 3K32A 4Z9AA 4B6PA 3GL9A 2D8AA 1B23P 1DX9A 1FNDA 1T8WA 2OV4A 3IX7A 4ZIRA 2ZJ5A 3L92A 4XWWA 1RYNA 1GUDA 1S3SA 3G9TA 3HBLA 5KPDA 3UPTA 3VVBA 1NF8A 2IL1A 4A2PA 5LJLA 1QCZA 4J2TA 3STUA 4OFBA 1LSJA 4GOXA 2UXDB 5FB3A 3NDBB 4EA7A 3FAZA 3A6KA 2IEBA 3AHDA 1IHUA 3BRWA 4XVQA 3HACA 3CLRD 2VZ8A 4E07A 2BFDB 5I6DA 1XJWA 3EG9B 3HFGA 3N8GA 3UK2A 4M0LA 5C5DA 3CEPB 3DFZA 3KYDB 4Y2SA 4UEWA 4AUEA 2FK8A 2ZDGA 1WUKS 2GDZA 3W4JA 3H5VA 2GASA 4HV4A 1TIKA 3DUFB 3EQ6A 1U1EA 4HUQA 3OY7A 4MHSA 4B84A 5IBCA 2CFTA 2H1SA 4EFLA 4ZHQA 2RH9B 1HNZB 3UB3A 5B7NA 4DKJA 4HNSA 1YJBA 3QVGB 3TM4A 3GW8A 2JIRA 3SICE 5EXSA 1BWPA 3CF0A 2NSJA 3CE6A 4WNCA 2H92A 4HDKB 4L5AA 1UPCA 3S1AB 3OPQA 5EJ4A 2QTCA 3UZUA 2NGRA 3OQOA 3HKEA 2Q0QA 3SE7A 3B36A 1NA5A 3OICA 2OCYC 2SHKA 5CW1A 5AD1A 5ICGA 1ML4A 1N8NA 2ZT7A 4QYXA 4UXJA 1OXTA 2PL5A 3PGKA 1EU1A 3QVMA 4ZT4A 3WIBA 1IJFA 2ODAA 3H5WA 3UXHA 4XIGS 2OSBA 3CGWA 1TD1A 1A27A 3PFGA 4LYFA 4FSHA 3OSZA 1GZ6A 1N2ZA 6NULA 2WWFA 3W5VA 1UM9B 2AN4A 2NXJA 2IXFA 4Q4HB 4TMVA 3ZWVA 4BLTA 3OJWA 3OY2A 4EKGA 1X42A 3RC3A 3Q0TA 3FYCA 3L43A 2JKYA 3D2LA 3D3WA 4I8XA 3I1IA 3BWVA 4QYSA 3RHSA 4OL9A 3COYA 2ACKA 1SZDA 1YVUA 4JUIA 5D85A 1XFAA 2JJ2D 1QONA 5JCXA 3MBOA 2PKYX 1XU7A 4FOOA 4KL8S 3WL7A 2B83A 3BERA 1ZM3A 3AEUB 3KUUA 1DBQA 3I45A 1RAGA 4HNRA 5C51B 1ZK1A 3OA0A 1SFRA 2DWPA 2NNWB 3IEUA 4N3CA 3UW3A 4JHXA 1JKJB 1PYDA 3WY9A 4UUBA 4BX8A 4DTIA 3Q11A 1Y63A 4NNPA 1OR8A 4D8WA 4N9WA 5AJZA 3AUTA 4RHFA 1D5CA 1KSHA 1PLLA 2NO5A 3BIXA 1VE5A 4RMNA 3ZUPA 1TYDE 3UO8B 4W5NA 3NYIA 4IHJA 1W48A 3IUJA 3DZJA 2RSLA 1X7ZB 1XSEA 1QHHB 2CZGA 3EY9A 4D4MA 2ODTX 1IIRA 1PJRA 2AJCA 4WOKA 4DS3A 4EMUA 3HBAA 5BNZA 3HMKA 3RAPR 2BGTA 4OYRA 4OH7A 1ARZA 2HGZA 3E2PA 1NI4B 2JVKA 4FMDB 1M6VA 2B3TA 5FOQA 1EDZA 1UR5A 2VDLB 3ZVLA 2XKKA 1U6JA 3GO4A 1TPYA 3TR5A 1WXQA 3A27A 2C7GA 3CEMA 3LSTA 1M8JA 3BN3A 3L2OB 1DKMA 1KMQA 2QK4A 3DA8A 5SYNA 4RENA 2FSVA 2R85A 4HNGA 4WERA 5JUWA 1Z16A 3JD4A 1XEXB 4P3XA 4EI8A 3UTDA 4N3GA 5HX7A 4ETMA 1O9HA 3V4FA 1M1YB 3PQDA 2VPPA 4AYWA 2O6LA 3QEKA 3PNVA 2UV8A 1Y37A 1COWD 3KB2A 4WBSA 1STOA 1XP8A 3IMFA 4AIRA 1TIPA 3BMQA 5CHEA 2JLWA 3AYXB 1N57A 1O57A 2C07A 2CXOA 3MWGA 4JSTA 1JX6A 1VL1A 5H80A 1Y9EA 1Z4JA 1BIFA 2AQKA 2ASEA 2D5IA 2H4WA 2WDPA 1FLDA 2X8AA 3IEPA 3T4EA 4CM6A 5IM4A 3I4LA 4A27A 2R0QC 1S2DA 4B87A 1SK9A 4E0BA 2E4VA 2XV1A 4HDCA 5TLSA 1NVAA 1S8OA 2MYPA 4NK5A 3D3EA 3UOGA 2AEEA 2CLLB 721PA 1DC3A 2XUDA 2WKWA 3P20A 1GDHA 1BA3A 1EFRD 1G9XA 2VH2A 4L5JA 5REQB 3GFRA 2PKQO 4W63A 4XYMA 3CG4A 2C1ZA 4LS3A 3M83A 4O08A 4AJ9A 2B99A 3FWPA 5J3JA 3F5FA 5JANA 4GU5A 4HGPA 2WQ6A 3IDFA 4GPAA 2JFPA 2YICA 3I5AA 4IIJF 5K8CA 4IDOA 5AKIA 1KVUA 4OTZA 3K92A 3ZHYA 2EJWA 3HH8A 2E2WA 2EG9A 3LIIA 4G37A 1N1EA 3UB2A 2PX3A 1T5DX 2WMNB 3BH7A 1GVNB 1ISSA 4JOCA 1NOIA 2O1SA 2IYEA 4H7KA 3RC9A 3VU3A 4NBWA 1QVAA 3PP8A 4X1YA 2XRZA 4TVSA 2FQQA 1J42A 4OU5A 2F55A 1EUYA 2D0OB 1UZMA 4BMPB 4UAJA 3AKCA 1GA4A 3G8AA 1FOEB 2DETA 4R51A 4BTVA 3NWEA 4GOND 3CVXA 1VM6A 3EODA 4F3KA 4JFAA 2AG1A 2W43A 3SEFA 1G7CA 3T7IA 4B45A 5KX5F 2PUBA 1CE8A 3A3OA 3DFKA 5AW0A 3MJFA 4EJSA 1IXYA 1NSYA 3WNQA 1C3JA 1LF0A 4CMIA 2QEQA 5BYBA 1YIAA 5L4SA 4EFMA 5C32A 4G0XA 3FFXA 3RJZA 1INLA 4ENQA 1YA8A 5FI5A 1PDOA 3W6ZA 1LW6E 1YMVA 4LGMA 4Z8YA 5FQNA 3UJ6A 4HJXA 3RS0A 3ZWQA 2PSSA 4M0UA 5FTJA 4DWVA 5CA0F 5HK9A 2PMKA 1ZM2A 4K05A 2O3SA 1ZQ9A 4I0WB 1X1BA 2VSNA 2P9YA 3K9WA 3PXXA 1ULTA 2ZAMA 4YMUA 4RJLA 4TZ6A 4IMPA 3VYSB 3CUSA 2C95A 1DAHA 2IEZA 4O2BA 5AI8A 2G8LA 2J33A 1RCFA 2ZSEA 4R8VA 2YVKA 2VPTA 3ZHVA 1U8EA 4XFKA 3M1IA 2QR5A 3WLQA 4F4UA 3EYWA 3N8NA 3C6ZA 4KHZA 2ZE5A 4R9UC 1Y5RA 2FSHA 5LUAA 2CJFA 1L5OA 2VK4A 5E7IA 3W1WA 3IC5A 4C1NA 2QQEA 3MAJA 3JZAA 5BN4B 3QQPA 4Q9JA 4J1SA 5GVRA 1C30A 2PD6A 3EXHC 5IARA 1KERA 3ZNNA 4QG3A 3RUDA 2X5KO 4EG8A 3KEFA 5KMGB 1GT6A 5IP5A 2GZMA 1P2TA 2OLKA 2OCBA 3LX5A 1U3FA 3NFYA 4MYTA 1S8FA 4QJ4A 3W6PA 1ZNXA 1NWHA 3NKLA 3I9NA 4G09A 5AM4A 2IXTA 3EJ6A 2VSYA 1Y9JA 2CVQA 3KQQA 3F78A 3E5RA 3NBYC 4LZJA 4RK7A 5KNBD 3LZCA 2BM9A 2DF8A 2WWIA 4WDRA 4W7IA 4C14A 1BO6A 1YVDA 1XVTA 3PFBA 4KO3S 1VE3A 3OESA 4DYHA 1APBA 3O26A 3OZRA 3V2GA 4HJRA 5I9SA 2D7CA 1MQAA 1ZH2A 1BYIA 3UK7A 1AK9A 1DXHA 1SY7A 4MR7A 3CRMA 4MIEA 1W9HA 5IKPA 3WGIA 4RETA 3W04A 1QUFA 1WXDA 2IOYA 5F4ZA 2CNWA 2FUCA 1NUPA 3U4QB 1ES9A 1FE8A 1CQZA 4NOKA 1BXZA 2WMOB 3VVLA 1K6IA 4C0HA 2EGHA 3QFFA 1AUVA 4EMTA 2IHZA 2BGLA 1JLLA 4YUAA 2X6TA 2X42A 1M1NA 2IUYA 3QU7A 3JWIA 1E9VA 2NV2B 2R1UA 2QNBA 4MTLA 4YP0A 4ZYZA 4YRRA 4EA8A 4JJGA 4YJ3F 2HRBA 2G9RA 2J09A 2JIDA 5B7PA 4UUNA 3B1KA 4M0EA 3TCNA 1G19A 3OD5A 1M2OA 2XQKA 4NAVA 3C8ZA 4W8OA 1EB9A 5DT9A 5AFSA 1BXGB 3RU9A 4R8MA 4N49A 1TGYA 1YZ3A 1CUVA 1E3MA 2PZKA 3L8MA 2QVCA 3L7MA 4WCDA 1WTCA 3A3NA 3NTOA 4OHFA 4BNKA 4MQBA 1GGNA 3OETA 1E2DA 2I0FA 1UPAA 3AUSA 4P36A 1I2AA 2LNDA 3BXZA 4II7A 1MNQA 1MN6A 1OH8A 3KZ1E 4B7ZA 4JYZA 3ADDA 1NW8A 3IAFA 1VYUA 1Z5PA 4Y2RA 2HQBA 2GEFA 2OB1A 1QKJA 4UEJA 5K4GA 4BNZA 4ACBA 2F8SA 4LDQA 1XTKA 2JHAA 2XA2A 4JB0A 4AYTA 3W3AA 3RNOA 3KETA 3ENWA 4CF3A 1V9SA 3B3GA 3C6QA 4LWPA 4QXQA 4UFNA 3U3ZA 2N0SA 3UN1A 1CR1A 2R6AA 4BQEA 3DDUA 1KK3A 1RHQA 3IIMA 2RGUA 3S2GA 3S7ZA 4EAAA 3I09A 3FRHA 2QTFA 2FPLA 3QHQA 4JQSA 2GTIA 5AHRA 3RBVA 1J39A 4Z0TA 1OASA 4GKVA 5E6UB 2UYHA 3KZCA 1EFHA 1EWYA 1NP7A 3G0CA 4EB6A 3DL4A 4MVJG 3P2OA 5B2ZA 2PPVA 2WHXA 2WJYA 4EJFA 3K20A 4WH0A 1JKIA 1ZONA 1IY2A 1U9ZA 3W90A 4KVFA 1PWXA 1L4KA 4Q02A 4PPFA 1Y0BA 1FS6A 2N1BA 2J67A 4MWGA 5CLQA 1XZDA 5G0TA 3TLGA 5JI3E 3C3WA 3NUQA 4RTNA 1R0SA 5CFQA 1QH8A 4YRNA 1ORWA 5AKHA 4GP9A 1I1HA 1W5BA 2JZNA 5KVQA 4ECAA 4MEBA 4BX0A 4QC2A 3EQ7A 3HG7A 2XMQA 3EIOA 2WYOA 3F67A 5DN6D 1U28C 2OC9A 2OLJA 3C43A 3PFFA 2IYZA 5ALVA 5DOZA 2F1JA 1YS7A 1I94B 1WP9A 3PJRA 1NJFA 3FI0A 5JNVA 4LI0A 3HN6A 3DVRX 3LQ1A 1YTLA 3LXUX 1B16A 4QM6A 4OFZA 2HSGA 2BTEA 3WNCA 1NVXQ 2MSKA 2F9MA 1JLRA 3GJYA 3KCNA 5HJ7A 1D1SA 4HK4A 4A6DA 1LC0A 1WXXA 1ESEA 1F14A 1UBHS 2IPAB 4CMJA 1N77A 5CJ2A 3DEFA 5K8IA 4G3XA 4EQ6B 4XB1A 4J0JA 1J8DA 2OMEA 4J4BA 4O4HA 2VJLA 3TOZA 3LCUA 2WHPA 3LHKA 4HVTA 4BJHB 2NU6B 4E22A 2XQIA 3DTTA 3HB1A 5EE3A 1UEIA 5EJ6A 1RJ9B 1R8YA 3PT5A 2AVNA 4O2AF 1KE2A 4YDHB 3T1HB 4F8JA 5J59A 5LL6P 2C84A 2EFDB 1MP0A 3KKLA 3T34A 3ZHTA 2HRRA 2WI8A 3K9HA 1ITZA 4M0PA 3KEOA 5AK3A 2VIIA 2GD2A 2VCYA 3HCOA 1U7UA 5ESWA 1N4AA 4BDTA 1GGHA 4B46A 2OKCA 2F67A 1EGVB 3SMVA 5AW5A 2HCTA 2I7CA 5BNIA 3FPEA 3N7TA 1ENYA 1Y8RA 1J6UA 3I2HA 3ZV6A 1RRGA 4B32A 2PX6A 3HYRA 3P0EA 1XV5A 2CYAA 1JEEA 2XUJA 3IEKA 4PYQA 2ZR0A 1UM8A 3U4HA