2Y9PB

Pex4p-pex22p mutant ii structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
KARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transport protein
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2-21 KDA
publication title Pex4P-Pex22P Structure
rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11730 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y9pB00
4BWFB 2Y9MB 2Y9PB
chains in the Genus database with same CATH superfamily
1FUIA 3GG9A 3NIBA 3U7HB 4QBKA 5D5PA 2QX9A 3HCNA 4O2BB 5G0VA 1CEYA 3L4SO 1GAXA 3E81A 2PPLA 1SHTX 1SCKA 3HJRA 2XMPA 1V4VA 2XBLA 3MN1A 2ZQZA 4DLTA 4F3KA 2FLKA 3FWPA 4QNMA 2NU9A 1F4LA 2VBIA 2ZVJA 2Y1KA 3L6EA 5GVRA 3RO7A 4II3A 2BH2A 3STTA 2Y66A 4NBSA 5A5GA 1AK2A 1UJ5A 1QVAA 1BMFD 4C0LA 2JRLA 1T25A 4XZ3A 2XMBA 2XDYA 3DBOB 2CNWA 3CZMA 4QPZA 3M5DA 3FLEA 1X2BA 2FG6C 3ROPA 3W3AD 1U8EA 2AC7A 4HO1X 4IIVA 1IC6A 2NTVA 1KMCA 1XMVA 4M1WA 4Q1AA 4D4GA 5DF1A 4LF8B 4LF7B 4N48A 1DQZA 3AKYA 1PSZA 2V7GA 1JFFB 5DIZA 2R1TB 2I2FA 4V1CI 4MAFA 1A4XA 4LNHA 3W7VA 1NUSA 2ONCA 4J90A 1JIKA 2PNJA 2O1EA 3V6MA 1GPYA 5GWXA 4LZJA 3NAGA 1XCMA 1MTZA 1CJTC 3EDCA 2CHGA 1BFKA 2ZT8A 4J1NA 1CB7A 1DX6A 1WM1A 2Q3LA 4C6SA 4CEJB 4FOSA 4B44A 3TAXA 4C01A 2QLMA 3E8MA 1VIYA 4C03A 4AUNA 5L4NA 4RTQA 1YZLA 2RHHA 1W1WA 2AXEA 1M34E 2ZGVA 3OKPA 5E1OA 5B12A 1FZTA 3FM9A 4MKZA 3F78A 5F2EA 1XCBA 3CLSD 4YT4A 2PMKA 2EHDA 1II0A 2WIJA 1GZHB 2FPLA 1PS0A 4I9NA 1KDOA 5GAJA 5JXJA 3UKJA 1CPYA 1L8XA 2Q0XA 2OO5C 5ALQA 3BJZA 4ERNA 4ENPA 1HH4A 1Y4AE 3UC5A 2J5QA 3GW8A 3KOOA 4JD5A 3SX2A 1ZH2A 1QNFA 3FWYA 3PRHA 1L1FA 2NWQA 3MWEA 4OLJA 2WDZA 1W36C 4FFMA 1K8QA 3QI7A 3F9IA 4M0PA 4Q1DA 3RC9A 2EV9A 2QTVB 2ZT7A 3MA0A 2RHJA 2IUYA 2IS4A 3W5BA 1BS1A 4WFIA 5FPYA 5BV7A 1GLNA 1NQXA 1FF9A 3DZGA 5B2FA 1N6RA 4L9AA 1K98A 2GYVA 5J4LA 1DCFA 1EVLA 3OU6A 3G0HA 4B6PA 3O1JC 4MO2A 1YZNA 2WIKA 1CCWA 2EEZA 3HNPA 2EEPA 3NHLA 4RFSA 4FYHA 3ZWQA 2VAMA 4DLWA 1ZQ1A 5CFQA 2ODBA 3EVFA 3I5XA 2QN8A 4PR3A 2Q28A 4U00A 2DH6A 1OASA 2HBQA 2EWMA 4FZ3A 1KMNA 3ZWXA 2P65A 2F64A 2HPZA 4B9EA 4YV7A 3FTQA 1F1JA 4UQOA 3UNXA 4C7VA 2J0QA 3MTEA 4QG7A 4FHZA 3QWHA 2HMAA 4BNNA 4BNTA 5BSVA 1QVWA 1EDOA 3A4VA 4LVNA 2FUG1 1YS9A 3H2JA 1R3DA 5FYDA 3RSQA 4CKZA 3KAKA 4MIKA 1AUPA 1LZKA 2F2TA 1Z4LA 3FZNA 4JOCA 4MRVA 5AQEA 5BYAA 4D2IA 3HXQA 4XUDA 1GN9A 1X3SA 1ZRNA 2GUWA 2Y9MB 2G36A 3U4IA 1LDNA 4URHA 4GL4A 1FYDA 4II2A 3OJLA 3IOEA 3L43A 1EJ0A 3WMFA 1BYIA 4C7XA 4WDRA 1OAAA 1P8JA 5GM2A 5JBNA 2O5EA 3S2YA 5C4MA 4L4SA 3OIGA 4IZIA 4NE7A 5CIYA 1O0CA 5AW5A 4JA2A 2PMEA 4NBUA 1F48A 1NLYA 1SXJD 1GG8A 1P7VA 1VBMA 3VOAA 2H51A 3VUFA 4RTKA 1CF4A 1UUFA 3OUTA 1OYOA 2WJ6A 1U7DA 4EG4A 3II6X 5I9LA 4JXXA 1NQ5A 3RVLA 5IVIA 4CEHB 2QLTA 3GNQA 4Z0HO 2H9AA 4CMJA 3PT9A 3QW4B 3M4JA 5ALYA 1WJGA 2BZGA 3AM4A 5H0IA 2IYNA 1W30A 1AHIA 1F14A 1SKYE 3OCJA 5FNVA 2JFYA 2Y0CA 3IC5A 3K2QA 3SQDA 3QUSA 3EGCA 2Q99A 1S5PA 4PYRA 4BO4A 3KVRA 2Y05A 5TV2A 4XYLA 4QTYA 5ECGC 1G3IA 4OHVA 2JGJA 3WTBA 1VTKA 3HYSA 3OHPA 1PZGA 2NYVA 4OQEA 1H2HA 5FAXA 3ORYA 3UHJA 5JANA 2B83A 4OQPA 3WXBA 3UJ9A 1W4CA 1Z39A 3AP1A 3MZ0A 3PP8A 4O4JF 3RHZA 1U81A 2VDQB 4X1KB 3ZLBA 4WZAA 1C4OA 5DDIP 4L2IB 2VDNB 5LA6B 4MW7A 4U7JA 3CEHA 4YO7A 1UIMA 4BDSA 4EHAA 2DWPA 1K3FA 2YV1A 3QYAA 1DMRA 5DLDA 5TQ0A 1BA3A 2ZWVA 5KKCA 3IURA 3AI7A 3ZQKA 3I04M 1L5GB 1KJJA 4H7IA 1ZX1A 3KQSA 4MHSA 3AEQB 4JP5A 2FN3A 4L15A 1M7HA 1U0EA 1ZICA 2A1IA 1UBUS 2I4TA 3KX2A 3QF7A 1Y7IA 1P91A 3HPQA 1R8JA 3GLGA 2DSNA 3WFZA 4LMAA 4ZANA 3QBVA 1L4YA 4F3CA 4HDOB 1HDZA 3ZWAA 4LVUA 1TW2A 2BPOA 1ENOA 1GT6A 1R6UA 3H6HA 3KVOA 4MW2A 4QRDA 1JILA 3ROEA 3WB2A 4PAQA 3TPCA 1EX1A 2H1IA 1OE0A 5ULLA 2XB2A 2OHFA 1KY5A 4N7MA 2ZTHA 3ZHQA 1KC3A 4EL0A 2A7QA 3E7WA 2I2AA 1E63A 1GPKA 2X0DA 1I3NA 5J43A 2GBPA 3B82A 5ICMA 4YLEA 1SUWA 2EKDA 2V6JA 3IPXA 4J7XA 1ODCA 2J9XB 2HY7A 2R6FA 2WJHA 2Q3HA 3OOJA 1DIBA 5FYQA 4YRDA 4E7PA 4EUKA 3V8PA 1NLZA 2JGIA 3SHFA 4DUGA 5HKKA 2H2AA 4LJ7A 3RYIA 3PNLA 1S2OA 1KPHA 3J7TA 4H4CA 4QQFA 3CLKA 5TS2A 4B3GA 5TARA 2GZ2A 1F1BA 4EJMA 2JD0A 1B8NA 4MCIA 5F73A 1QHGA 3RHTA 5F23A 1TZBA 2ZE5A 2FWPA 5IJ0B 5HJEA 3TZQA 3IAM1 1A2BA 2NVUB 3HJCA 3KQOA 4TLCA 1IXZA 3LOQA 2VDWA 3BQMB 4Z6KA 3NMUF 1UZUA 1VMEA 2QN7A 3DFKA 2A9FA 4Q82A 4MUIA 2PJDA 3C87A 3PUZA 3TZKA 4UCQA 2AJDA 2Q3MA 1XT6A 3H1AA 3MMNA 4WPGA 5JRDS 3WV5A 1XQWA 4N6NA 3RYCB 1YTUA 3EW9A 5F1PA 1SIWA 4NCXA 4AN4A 4UNRA 2GTHA 3FZGA 2VJYA 1P0QA 2PGIA 2UZ1A 2CC2A 3EY4A 3KR2A 5IARA 1PL7A 5C53B 1EG2A 3ENNA 1L7EA 1V4NA 2XZPA 4K6MA 3FHTA 5H83A 4L08A 4YR7A 1I2AA 4RLFA 4AX8A 2AD1A 4TKZA 3SS9X 4BEVA 5I3ZA 3WWEA 2PLNA 4WLUA 5IJ9A 3H17A 4X20A 1VHQA 1FXWA 4YCLA 1BH6A 2RHBA 2ZPUA 3KL2A 2WQ7A 2P4SA 2P4HX 1W29A 2C2XA 1H5UA 1KDRA 2JBWA 2P9TA 4Y2PA 3QELA 4WK6A 1XRSB 3AW9A 3TD2A 2DM6A 3PD0A 2LCQA 3UG7A 4YAIA 3IDSA 3AZQA 4Y0AA 1C3EA 1E3MA 3HYCA 4Y6SA 1AG9A 1V9CA 1J39A 3WK9A 1NA5A 1THMA 1YZHA 2VQFB 1U9IC 3NV7A 1AN9A 3M2TA 2O1WA 4P4SA 2XE6A 2C29D 2CHUA 2PMCA 4MUEA 4LN1A 1CULC 4H31A 3E58A 4TLMB 2XIQA 3QLUC 1E0AA 5IWCA 4RYDA 5DTIA 2I7VA 3H1BA 1J0BA 5GJWC 3IEVA 1AA9A 2QXTA 2X6RA 3ORSA 3BRSA 5EIOA 2VWGA 5LNK6 3GARA 4KAAA 2I6GA 4N82A 1YBMA 4Q0MA 2ZRFA 5AJYA 4RDXA 2VJCA 3CKKA 3ESDA 2ZAMA 3B53X 4EHLA 3H9BA 1G6OA 1FPQA 3IRVA 3JZMA 1M8JA 4WFKA 2HT1A 4R8VA 3D1JA 4CWAA 4F9FA 1EWKA 3L7OA 4PZUA 5I9BA 3UMSA 1DUSA 4IV8A 2BGTA 4DJDC 2V7VA 3AFNA 1ZUHA 3IT2A 3KC2A 4W1PA 5HBRA 2IVZA 3C3YA 4D1YA 1X1BA 2HLNA 2VT2A 3IV6A 4U5XA 4YRCA 1ZNWA 3SBEA 1ZK4A 2BEJA 3FCEA 4DWWA 4ZO9A 4ZZ2A 4NFHA 4B4UA 3PU6A 1IBCA 2AD5A 4C4ZA 5JD3A 3OQMA 4ZEMA 3D8HA 4FFSA 4HDSA 4NMXB 4DR3B 4Q15A 3RQIA 1ZM9A 1CUSA 5K0TA 3WQQA 4RD6A 3GROA 2C78A 1FNMA 2I7XA 1Z16A 5DM4A 1NLUA 4WV3A 3X1KA 1XJQA 1RHQA 4X24A 2DYKA 2EJCA 3QKIA 3UUFA 3MINA 2W6ID 2J67A 4MI9A 2OVFA 4G1BA 1G20A 4DC9A 3HV2A 4UAUA 1XJCA 4N5LA 4MLDA 3JASB 5AW2A 5KTYA 3VH2A 2Z1MA 4C0WA 4E14A 3OCCA 2FW0A 3AY7A 4WESB 1PWZA 2YH2A 4ETMA 2EKZA 3GT4A 1A7JA 1O8BA 1AKEA 1VJ0A 1JFLA 3A04A 1TKRA 4FHCA 2FPXA 5EEGA 3V33A 5CEJA 3SVTA 2HDWA 3VDRA 3P5SA 4WW0A 3O6VA 5KEIA 2VJDA 2NXNA 2EHJA 4GGPA 3A0UA 5TF0A 4BLQA 3MCWA 4J0KA 1IB6A 1ZOLA 2I6XA 3L1VA 4WMLA 1H6DA 1MEOA 5IH3A 3TQHA 2QYSA 4RFSB 4JC0A 3KR9A 5EA2A 4BQSA 1J2RA 3QKRA 1YH3A 4PZPA 4TLDA 5E6RB 2PMFA 2WFLB 3C1OA 1CQWA 4RPJA 3PKZA 3ZW7A 4AKHA 3G7UA 4NLLA 4P4NA 4Y1EA 2UYCA 2W37A 1GQQA 1RHMA 1C9NA 4FS3A 3T1TA 2FZKA 1M34B 4IQ0A 5HJ2A 1EPUA 2ID8A 3K6RA 1M2EA 3PCRB 4HDKB 2QV0A 3S3TA 1JLKA 5EERA 2CLCX 4PC2A 2PZAA 3ZJUA 1SXQA 3FJ1A 5AVSA 2Y1CA 1X7YB 1AC5A 4Q1EA 4ZVNA 1W87A 1G9TA 4DNXA 3LDHA 3S81A 2D1YA 2CLFB 4DMGA 2JGKA 2ZI4A 3H2YA 3JS5A 5IC6A 3B8EA 3ECSA 521PA 4B71A 3WFJA 3Q98A 3WGIA 1QP4A 5A06A 1TPZA 5LJIA 4JSYA 4BJ5A 1NKSA 3WGMA 2IEBA 1X8XA 3L7YA 1Z8DA 4EY4A 1IEXA 3EBOA 4PTZA 3ZHYA 3ZVRA 1NXWA 2ET6A 1U8XX 3B78A 2JD1A 4QHSA 5K0JA 1HM5A 2C77A 3RUAA 2JFBA 4HUTA 3WHKA 1T9GR 1GTG1 4H77A 1A2KC 1CY8A 4I4IA 1F2TB 4MP3A 5H02A 2XUJA 3RBZA 3T7KA 4GGOA 3E03A 3ICPA 4DBZA 4YEDA 1GEEA 2FN9A 2GN2A 2DFTA 3MTBA 1PYDA 2HK8A 4YCNA 5J23A 1GQSA 1Z4JA 5L7YA 1JTVA 3QPBA 5J40A 2DX7A 4CUKA 1DC8A 3L79A 2FUCA 3D81A 3HGTA 4Y8VA 5U9CA 3ZHTA 4LFCB 4B6RA 4Z0TA 3PR3A 4X00A 3HP7A 3VR3A 4OPMA 1FX0A 4OUDA 1LPOA 4TWIA 1MEEA 3NHJA 2VP6A 1EUZA 1U0GA 4D9FA 1SOMA 4MUGA 3EGEA 1FYVA 3HR8A 4NU0A 4KR9A 5HNKA 3AF6A 2HK9A 3U9LA 3K73O 3LOUA 1H22A 2X76A 5TQ0B 2WRZA 4H1WA 5KOHB 3ABOB 1NQWA 3K5PA 3R0IA 1PBTA 4HYQA 4V0SA 4I99A 1BOOA 2FK7A 1ZK3A 5J5AA 1FRQA 1S3IA 5TLSA 5BR8B 1C8LA 1Z88A 2V65A 1CZKA 5JVDA 1PW7A 4JJKA 2W2NA 5H3LA 3ZU5A 4KAXA 5EWLA 3KWMA 4K9NA 3B85A 4BGIA 1E1YA 4LTNA 2X2PA 3FPJA 4E70A 1ZGHA 3R7DA 4BAGA 3QKTA 3LVQE 3EVEA 3THYA 1ONBA 2D1RA 1MO3A 3QNWA 1V7CA 2GFIA 2W6PA 4ETIA 2RHWA 4Q47A 4HB3A 4GPD1 2I55A 4IQ4A 3FFWA 4CTMA 1TIKA 3ZWWA 2PE5A 1T9KA 1FXUA 2D59A 1NIPA 5DBFA 1LB1B 2NZ2A 5CA1F 4EL5A 1GQYA 3U19A 3GJ8A 2CT8A 2Z4TA 5TGTA 4Q9LA 5ADHA 2FVXA 1R00A 4YUAA 1E1LA 1JSLA 1UPAA 3JYNA 5FUVA 1QQTA 1G59A 4QULA 2XW6A 5DHRA 2JLBA 1E0SA 3ANMA 3OFVA 3PXXA 4DIOA 3OJCA 3R5FA 1QV6A 4OXNA 3K0KA 3OEED 5EP3A 2YIMA 2N42A 3QVSA 3PFGA 3M1AA 1P5ZB 1T4CA 1K4KA 3UY4A 1ECFA 2GEKA 1P19A 1T1SA 4DMLA 2O23A 4X1YA 3TNDA 1B8UA 1KIAA 5DBIA 5EIAA 2P3QA 1JAYA 3HU2A 3VC7A 1LX6A 4GRIA 4UQPA 3P8ZA 3G0OA 4TTAA 3RAPR 5AHWA 2W6MA 3I23A 3FCXA 2NU6A 3HN7A 2CF5A 4AZTA 1CEQA 4A4DA 1KGDA 3O73A 1FNNA 4EPYA 2R1VA 1XNRB 4JVMA 5ALUA 4LDJA 5HGJA 3KZNA 2P2DA 4WCFC 1OV4A 2JLAA 1QR2A 2N46A 4PR0A 1OLXA 2PRKA 4X97A 2XOKA 1U3UA 2IP2A 2MSCB 4TMYA 2TS1A 1N1EA 3T1HB 3BL5A 3QELB 3LQ1A 4MGIR 3TW0A 4YJGA 2VPZA 2YVLA 1C3OA 1QCCA 1IOLA 4OL9A 3JWEA 5JSHA 1BE6A 1JPUA 5IKXA 1PZNA 1PW5A 2PZEA 5EXSA 2FXVA 1C8BA 3PJDA 2MIIA 3RM3A 4DLPA 1D7AA 5DCUA 3G2LA 1RVV1 2YJ3A 3T34A 1GNSA 5AXAA 1IVNA 4Q1VA 2V9PA 4MVJA 1GTZA 1QX3A 2FEWB 2OMKA 4ND8B 1DBVO 3FE2A 2SHKA 3CA8A 3DZKA 5ISMA 1K9SA 3K35A 1KDVA 1C7EA 2I2WA 3IUEA 1MA3A 4JLUA 3KCQA 5A5DA 4E46A 1I7LA 4U5QA 3DTTA 2X5XA 3C98A 3A3YA 5CIQA 3U3XA 1FK8A 2RGEA 4A2WA 1MJNA 3OZXA 3IIEA 1ZGCA 3KPWA 3OEYA 1QO7A 3CLTC 5EKXA 2A5DA 2Y1FA 3U4GA 1JFSA 1RKVA 3RRYA 4PRLA 4MRNA 3FG9A 5A7FA 1U7PA 4X8OA 1QNLA 1CY6A 2JNWA 2NV0A 4IUCS 4K6FA 2EZ9A 4JI1B 2XLBA 4KJZA 4MDHA 2VRCA 4H0CA 2JFVA 2OCLA 3ZDZB 1O0BA 1A1VA 4S1TA 2O20A 2BFBA 2WG1A 3NRJA 4RVNA 4OQXA 1R6TA 1VGRA 2VNHA 3R1IA 1JXMA 3U4AA 2PG3A 2HLPA 4A6EA 3CRMA 3LDGA 3FCAA 5CJ2A 3EG5A 5ALTA 2CL5A 2JJ1A 1FUYB 2Y76A 1NF9A 1FLVA 4JBGA 3V2GA 4EG8A 5FOWA 1GAEO 5JQGA 1BE8A 1HYGA 5AHXA 4YY3B 2RGDA 4FFBB 3KJQA 3R5SA 1IPEA 2PKEA 1Y4UA 2PU5A 3WLHA 3FYDA 4LYAA 4UPEA 1XTBA 3MJ4A 1HQKA 1IXYA 1A82A 3EGIA 4ZHSA 1MGOA 2DWUA 1K8XB 2UZ3A 2EGUA 3KEOA 4TL6A 3OY7A 3VFDA 1E1QA 3LHFA 4Q01A 1WA5A 4O2RA 1JSCA 1QVZA 2SCUB 1BXRB 1IN5A 2I2BA 3PYMA 1G7RA 1R9GA 2HBZA 2C84A 1UR5A 4W99A 2ECKA 1D04A 3P4YA 3A6HA 1ZP6A 5HK9A 3GFFA 2BRUC 1CLEA 4X66B 3K2IA 3CTPA 1CB0A 1W94A 4QODA 3HVRA 2XTAA 4L0DA 5KSWB 3JQAB 4JLJA 2WV7A 2ZCVA 3CPJB 4FPXA 1RZRA 2A1TS 3H8WA 3HZHA 3COYA 2X3YA 3TM4A 3AJDA 4DGQA 4DCJA 1KI1A 2IHJA 2VA8A 2AUTA 4EKIA 5K8TA 1OSNA 5BSUA 4NX2A 4TXMA 1C0KA 4JDUA 3UANA 4BE9A 2QNIA 3FR7A 4OHWA 3ADBA 1RXVA 2C5HA 1CS4C 3TZHA 4A2PA 3NTOA 3D2AA 1HE5A 5AW6A 1OZ0A 2GBCA 3EWNA 5HR5A 2BGIA 3BMOA 2CFRA 2ADOA 1CETA 2PO7A 3I76A 1QK4A 1NW6A 1OOEA 2IQIA 2W2KA 3DZHA 4MH0R 5EMJA 3OKAA 3U7JA 4D25A 2GLXA 2QN6A 3ESZA 1NW3A 2CSXA 2XWSA 4XYEA 2VSYA 5KYVA 4K1LA 2BKXA 2VF5X 3MCUA 4I1VA 4Q9HA 3GRPA 2R7LA 3I4FA 4EUSA 4YHHB 2PL3A 3OETA 1L5YA 4NG4A 5BOSA 3CEPB 2E48A 1YZKA 2IJGX 4RGQA 4U9HS 5H59A 4HAYA 1Y8QA 2UYGA 1N2IA 1HDXA 5KJEA 1GA4A 2XMGA 4MLPA 4AWAA 2QJTA 1OD6A 3NZEA 4M76B 5E1BA 2ZWAA 3EQZA 4DHWA 2GB4A 2F9LA 3M8KA 3MBIA 1T9CA 3OTGA 4AAYA 1X87A 2E4AA 3X1DA 5TMBA 1QYDA 1H1LA 4HHEA 2XBMA 2FN7A 1LXCA 1SHJA 2DR2A 2QGZA 1UXJA 2HYDA 3FUWA 2FRXA 2H1HA 1QHEA 1I7PA 3MBOA 2ZYWX 4QD3A 4E13A 4ALKA 3PE4A 1KDPA 2OEPA 3AF5A 3EDMA 1A9ZA 4ZP1A 4TS3A 3I62A 3U44B 5DHTA 3Q7PA 3AW8A 3DF9A 4KMRA 1KI3A 4ZAZA 1DE0A 5G0TA 3HJHA 3P94A 3QSGA 2BHRA 5SYMA 4GRAA 3WMXA 5C81A 3AL0C 3GAMA 2JIMA 2DFDA 2YNMD 1R18A 1XC7A 2ZWIA 3LHKA 4UHEA 2P35A 1JKIA 5H3HA 3ZVNA 1YRQA 4XSHA 1OBHA 4G65A 2ZRPA 3ZCVA 3HBLA 4Q34A 4GQAA 2Q7OE 4LHYA 3SFVA 4LZPA 3LBFA 1ZIDA 4GZLA 5EXEA 4MQ6A 4FDUA 4PNEA 2C7RA 2WTEA 1S7GA 2YY6A 2IUFA 2IPOA 4EM6A 2FPIB 3BWYA 4TYPA 1O1YA 2RFLA 4RQTA 1LSOA 5D6NA 1CR0A 3D0OA 1BXGA 2PGAA 3LUFA 1AH2A 4RH3A 4DIDA 1WF6A 4QO8A 3ER8A 3JAWA 2YVUA 4GBJA 4OGLA 3DL4A 4ZVKA 3ZQJA 2XF8A 1P1BA 2PS9A 3DHYA 3HZZA 3LQFA 2BUAA 4K9SA 4BCDA 4RF5A 4LECA 1JFRA 2XRFA 3FMVA 2Q3FA 3LL4A 3Q3IA 3CSSA 3I2GA 1XGKA 3HNOA 3KCNA 3TLKA 4DCVA 1ZQ9A 3GJSA 3I9MA 4URVR 3AB3A 5JC1A 1QV7A 2PD4A 1GJRA 2RONA 2AZXA 4PNHA 3PDJA 3LKBA 3JPWA 4XYBA 3A58B 3H4TA 2Z5VA 2JJMA 2JRCA 3A31A 2QMUA 2O7NA 1AZWA 2HBYA 3MRTA 4O8CA 4TKLA 1BVUA 5IC5A 1N0IA 1YJ5A 3TLGA 3VAAA 4BO3A 3X3HA 5IHPA 3AF4A 3OOWA 1E2HA 4LXUA 5LIRA 1JHAA 5I7VA 5IAOA 2JG3A 5AUQA 1KEWA 4RHFA 2IYEA 1Z0UA 3EBPA 3UZUA 1E2GA 2Q3DA 3KSBC 5FV7A 3UV7A 2L17A 3TYXA 2VFAA 2AEEA 1JJFA 2VLIA 5FULA 5FOXA 3ZE2B 5AIAA 3CPHA 2IE8A 5EKTA 3H4IA 1ZPDA 1BWQA 4CKEB 4FE7A 4XVRA 4AN1A 3RS5A 1EFTA 2JHAA 1WZUA 4MUHA 3JQAD 3TOCA 3LYAA 1LF5A 3P2EA 2OXFA 4C0AC 5MGBA 3K8QA 4H6VA 2VXBA 1LLFA 4P4UA 1H94A 3KXKA 3LY8A 4L07A 2XVXA 3C1TA 5F2OA 1QGUB 3BCRA 1S0UA 2DJ5A 5DSXA 1X1EA 1XEXA 3MSCA 3PPYA 4RK1A 4S0ZA 4E22A 1IBLB 1Y9DA 4E5NA 2RH8A 4ZV4A 5FOUA 3V5NA 1Q7TA 2QENA 2OFXA 1X8JA 4I2NA 4YRJA 1V8ZA 6NULA 5JEDA 3TRHA 1EK0A 4MQ5A 3RDPA 1DG3A 1LK5A 2YZNA 1KEEA 4NCAA 1KZYC 2XQVA 1V1JA 4K28A 3RF7A 1PR6A 3VVCA 2FW7A 2VPIA 4OJTA 1NQVA 4J0DA 3AR2A 4JXKA 5BW8A 1I24A 1AK9A 1DAHA 1K8YB 3O84A 2AN4A 3CN9A 1K0FA 4KX5A 4AJJA 4E5YA 5JZ9A 4JHLA 1O8CA 1LKZA 2R1VB 2ZJ0A 2EERA 2F1IA 3IDQA 3L7NA 2J48A 3ZD6A 4LDPA 1EGAA 1XTPA 3W5HA 4S35A 5DSZA 4K40A 1SPBS 3JD4A 3V8EA 1H2WA 3DJYA 4XM1A 3SKYA 1LGYA 3DMYA 3C16C 4MUXA 3MUEA 1SQGA 2HA5A 3GCWA 3H0EA 2JIOA 4P3NA 5BWMA 4ENQA 1C4XA 2P9CA 4K87A 3GUUA 4YJGB 2HMUA 1UXOA 1ZCFA 4DLLA 5J2UF 3ZV7A 1V7PC 2KYRA 4J4TA 4BO6A 5H7XA 5HFNA 3IPCA 3W79A 4URWR 2AG5A 2FPUA 1J25A 2VJLA 5ALNA 3WTCA 3LO8A 4UNNA 3G5AA 3FFAA 3P45A 2ZIUB 1DWPA 5EAIA 1CQPA 5EEHA 3R5JA 2GKSA 2R7MA 5CDFE 5F51A 5IT0A 3WIDA 2GD0A 2IXFA 2WJPA 4BV8A 5A4FS 5JIBA 3HA3A 1HG1A 1AKMA 3F67A 2YRWA 4RV9A 1IVSA 4HFRA 2GNAA 3C43A 2D7CA 4Y9DA 1Y7HA 1TJ5A 1G9SA 1NKVA 4L0QA 1PX0A 3RASA 3ANXA 1XTIA 4XLTA 2JHFA 4FZ5A 3KDAA 1U8ZA 3LBIA 3KB2A 4KQWA 4TTQA 3Q3JB 3BGWA 2A9PA 2W90A 1N5KA 2VOJA 3PQCA 3IFSA 4HNVA 3F6RA 4BO9A 3DOIA 3T7DA 2WF8A 3G7SA 4O33A 3KV1A 4MCAA 1HXHA 4QLAA 4TZ0A 1GPBA 1U2SA 2QWXA 2ZB7A 2PKQP 1IQUA 3ACBA 2HH9A 5H5JA 3NHRA 1C1XA 4KZKA 1XRQA 3FFXA 3MMPA 1Q0TA 3ZDQA 1ZONA 1C81A 2YYYA 1HTBA 3NCTA 4K6GA 1H9AA 3U4QA 1YFKA 5KTKA 5ELLA 1OFIA 4C5CA 1FTWA 4JIMA 1BEZA 3KKMA 4RCYA 1T4GA 1P77A 2ANCA 3IE0A 3PD7A 1QBKC 4IFTA 1JBEA 2Q50A 3OZUA 1IPFA 3A4TA 1G38A 2Q6OA 4GOLD 1YA4A 4W7HA 1QAMA 4TZKA 5JISA 4F4IA 2E37A 2A5JA 3STWA 4S24A 2ABWA 5BSMA 1Q16A 4NRDA 3CXRA 4MGZR 1G6HA 1LFDB 1NURA 2BEKA 5CEFA 5F9HA 4PLZA 5B37A 1XX6A 4POOA 4BQFA 2D2XA 1XDBA 4N7RA 5BWLA 1E59A 3HVHA 4QJIA 2XVYA 3OPXA 3C85A 1CRLA 5F4BA 6LDHA 1MPXA 1Z2EA 4ZVTA 3S1AA 4DJAA 2A1UA 3SMVA 3ZZ1A 4HSEA 1GGHA 1NUPA 3AWDA 3LWDA 3TIIA 2BTEA 4I8DA 2QU8A 2FW1A 4P8RA 1NN1A 2JJ2A 4W8OA 3HUDA 4JR0A 2Q5LA 4UAVA 1QB7A 1YKSA 5ALKA 4RL6A 3QU2A 1PR0A 4M38A 3AOGA 4L57A 2NO0A 3VU8A 3W6NA 4FQ7A 5LLTA 1T0HB 2RMKA 3RSCA 3RRNA 3RSFA 3WLSA 4EB6B 1QHIA 4I0WB 5BSGA 1MT0A 2WA1A 3R5TA 2CMDA 1SZCA 3EVTA 1I1NA 3UJ3X 1V3UA 1QM5A 2JJ8A 2NVWA 3WYNA 1M7BA 2RHCA 2YMLA 1N0VC 2C00A 3R0JA 4GKVA 2W2KB 4MIEA 3SAJA 2REBA 1DAEA 4N7JA 5JARA 5HQJA 5C31A 3T0GA 3KELA 4ITVA 4YALA 1UBLS 1JX6A 1UBCA 4YJ3F 4L7QA 3JQCA 3R0QA 3ZTTA 2QY9A 2F6RA 2OO5A 3HP1A 4FBGA 5FH9A 3CZ9A 5F2KA 1POWA 2PUDA 3VHXA 5HRCA 4L72A 4Y2GA 4HVCA 3V4PB 1ETUA 5IZ4A 1TK3A 3EISA 2XDQA 2C7OA 5HIMA 3EC2A 3FVRA 3CNLA 3IULA 2K5UA 2WM3A 3Q3CA 1GL3A 4I1OA 3A2NA 4XW2A 2WFZA 1UDAA 5KYUB 2I6FA 1M76A 1N6LA 2PKYX 1E3SA 4NJMB 3ES9A 3S2ZA 4V0KA 1B23P 1ZK1A 1PJQA 2XB8A 2CXQA 3AERB 4QBHA 1DNPA 4WKCA 2J9YB 1K8RA 1XNGA 3ETCA 4BZWA 3HB5X 4XYMA 1TA4A 3G79A 5E8JA 1THGA 4BWGA 5KPJA 2TSYB 2ZAYA 4WFJA 3EUFA 2O59A 4H3SA 3JZFA 1ODJA 2Q9UA 3M0EA 4RENA 1RJ9A 1OB5A 1GP2A 1UP7A 1DQRA 2WU3A 3NWJA 1DI0A 1EUDA 3LC1O 2OY0A 5EPUA 2AKEA 3K8ZA 4DYDA 2BSQA 3N6XA 1GZSA 2ATXA 3GQBA 1C0IA 1R0KA 1V37A 2ZRHA 3LNCA 1WNTA 2FUG6 3SPXA 3H4VA 1NXPA 2PX6A 2WWWA 3GHHA 2VZ9A 1I0IA 4EATA 5B36A 5FTKA 5J2TB 5K3AA 1N2SA 1W46A 3H84A 3DKVA 3JYOA 4U2BA 3KYDA 4P0TA 5GMOA 4JODA 5KX5B 1BXGB 1EFVA 2A9VA 4EI9A 3OOYA 3H9CA 4BWVA 1GADO 3WFIA 2PKCA 2VJMA 3OQJA 4WLVA 4A1FA 1M73E 2GASA 1DZ3A 3G2HA 5HDQA 4JV5B 2AQHA 1TIBA 2WLTA 1IJKA 3RYHA 3ZY6A 4EH1A 5BRJA 2C8KA 3JWIA 5DLQC 5JJBA 4ZOLB 5AKYA 3JALA 3DMNA 3UATA 3MGKA 1TA0A 2C9OA 5CD1A 4BDTA 2Y3IA 3IP3A 1D2RA 4ZQIA 1KE2A 1Q6ZA 5EOVA 1TMOA 2ZSJA 3GRZA 3L8CA 3WVNA 1QGOA 3N3BC 3NTXA 1ZH0A 2PSFA 2G40A 1PJZA 1OR8A 4G5XA 4OQYA 5FADA 1H4VB 2OYRA 2YVKA 2Y2UA 1QH8A 1CUUA 1SEPA 1M1YE 1JR3E 1MGPA 3WJ2A 4E08A 1IAVA 4JC4A 5KSZA 4JLPA 4YUWA 3PWTA 5E3JA 2IPNA 1Y6GA 1T5BA 3TNFA 1H6AA 5PNTA 1Y8ZA 3QLVC 2PXCA 1R6AA 1R4MA 1CUGA 3C3PA 2LUOA 4MWDA 1RAGA 4FCWA 1JG2A 3OFSA 4LHVA 2EJUA 2XIJA 3D7NA 1JUDA 1VKNA 5TX7A 2QMEA 4RIGA 3LS2A 1U4OA 2HK6A 2ILVA 3CUEF 1CIPA 4B73A 4EUHA 1PG2A 3G5LA 1YQDA 2PVCA 5K09A 3UMFA 1V6SA 3ONEA 1I7DA 1Y4ZA 2KM1A 3BMXA 3KQLA 1MB0A 1U1DA 4MWZA 1SUDA 3ZUGA 4L8FA 2DVMA 4MQEB 1ZSNA 4D4MA 1ZUIA 3MJTA 4IIFA 4EYKA 1S89A 1D1SA 1V41E 4BC1A 3V4FA 3C5WP 3SD7A 3CM0A 1GGMA 3P4UA 4FYIA 2X4DA 1S96A 1KEEB 2DR3A 2GPWA 3T3IA 1YQ9A 2EFCB 5IYZB 1X6VA 4CCSA 3BXHA 3ZHVA 3L0BA 3LMKA 4B7UA 5AP9A 2H9YA 3SXUB 1XPOA 2IOFK 4S12A 1UBFA 1T2NA 1ADGA 1PFKA 1ZA2A 1E96A 3SJCA 3Q8LA 3OEHD 2V8BA 2CFCA 2OCXA 3I73A 4KO8A 5EYPA 4AKEA 2I4OA 1SVSA 3JYPA 4OY3A 4QT0A 1GCGA 1U3DA 5K0CA 3DB2A 5ENDA 1KNXA 2R7KA 1H4QA 3M1YA 3RS7A 3GFGA 2FB9A 4FZRA 1D3AA 1KS9A 3IYLW 4FQ8A 4K86A 3I6YA 1IQPA 4PU0A 1UC4B 3VJKA 2RAFA 5AK6A 1A9TA 2QD2A 4KQHA 3IAM6 3VRHA 3PFBA 2W0MA 1C7JA 2GPAA 4LHEA 4Y3UA 2PEYA 3MGGA 3RWBA 2H31A 2XUGA 2X8LA 2DPMA 4JSRA 3UPTA 2ENWA 3CF4A 1W5FA 4MEAA 4FYPA 4CUZA 2VO1A 3WWCA 5ICCA 1N0WA 3EW7A 2Q2VA 1BA2A 1FFBA 5DLYA 4FM9A 4Q12A 1QG6A 3FNFA 2VNIA 3JARB 3PC8C 4XJXA 3VDQA 5C3MA 2Y0PA 2QUZA 4RD2A 2C9MA 5DYTA 3EE6A 3FFBA 1KERA 1NI4B 1SD5A 4FOTA 4G07A 4HYYA 3S5UA 3SYKA 3G8BA 2JDID 5GINE 2GEVA 4UM9D 1T9ZA 4D74A 3P0RA 1F8FA 2YIDA 3DAPA 4CI0B 1TVEA 4D26A 3JQ8A 3W4JA 4JSTA 4DCSA 2RBKA 2F9MA 3L04A 4JJEA 1MOZA 1OXXK 4KXUA 4YAJA 2ZWPA 5E1DA 5JY1A 3S2SA 1Y5LA 4KYUA 1WIWA 4JENA 4KBGA 4OJMX 4B9AA 4D8YA 3IQDB 1GL6A 3PE3A 4QATA 4QHTA 1AB6A 1XCJA 1NVKA 3LDUA 1B7GO 2BLLA 2ATIA 1SUEA 3BGVA 2GN6A 3F2IA 1CR4A 1YB5A 4R71A 5JROA 4ZDIA 5CDGA 3M5WA 3UCXA 2C1XA 1O95C 3QOYA 1R5OA 3AI2A 2G9UA 3QUQA 1VYHA 2QW1A 3IODA 1NAIA 4OGGA 1U9IA 1QUEA 2QM3A 3LO5A 5HSGA 1UAGA 3BH6A 4TSFA 4ZDWA 5GM1A 3DE4X 3GH3A 4UHDA 1SUSA 1TO2E 4KGZA 4WCVA 1UC9A 3SYLA 3HEMA 4PANA 5SY9A 2EKLA 1G2OA 2VP3A 4I55B 4HWRA 2ZXFA 4IUYA 3DMDA 3VVMA 2VYCA 1MIOB 5AVTA 3AI3A 4BLWA 1JHVA 1G8MA 4TTJA 2VPQA 4EB3A 2N1BA 5AKHA 4RETA 1TMGE 1D2GA 1G66A 5I7OA 1MC8A 2CMGA 2NUAA 2WAAA 5F77A 3QA9A 1L1RA 4R9NA 2YVAA 4NCIA 4ARUA 1I6LA 2H92A 3DPUA 3ONNA 4RESA 5EPOA 3WKDA 4KNYA 4JUAA 5IT4A 2O3RA 4UHBA 4JCCA 3CRZA 3S1AB 1Q1EA 3KDSE 1S02A 1NQTA 1OYVA 1WEKA 4D92A 1US8A 2H4XA 2NT4A 3UXYA 2EL7A 1M5TA 2ZUVA 3KAJA 3V46A 4PLWA 3WLTA 1OB2A 3D4PA 1EDZA 3L7IA 2LCIA 4HT3B 5KWIA 3IJEB 1PWXA 2H7XA 2P9BA 3PNBA 4PLGA 3PNSA 2YS6A 4HOYA 5SICE 3VDMA 2VZ8A 4Z4EA 2VTKA 4DQUA 5FWDA 3E2MA 4TVSA 2PR7A 3D4IA 1C7IA 3FUCA 4TV9F 5KJ6A 3GLFA 1M2JA 1BD3A 2DPYA 3HUFA 1XD9A 5IJZA 4P2BA 3RAEC 2FK8A 3Q5DA 3KL4A 3RVQA 4OKSA 1GNRA 1MR3F 3VPHA 1QG2A 2B7LA 3I3SR 3QXXA 2QJOA 2OGSA 5K51A 3G1UA 2WJJA 4IEIA 2L42A 1OTYA 2XR1A 4KKVA 5DWVA 3K70B 2BMDA 2NTEA 1S3FA 1IEQA 2P69A 1ARZA 2FE1A 4DQVA 4AI6A 4H7PA 4Q4DA 2Q8NA 2X0NA 5DLEA 1ZC3A 3HCOA 3JQFC 1AUVA 4EW2A 1L1QA 1EBBA 2PSDA 3V8BA 2X77A 4UTZA 4ZJYA 4Y2HA 2JGEA 5F1YA 3GZNA 2X1HA 3KHKA 4MVJH 3DA8A 4JVSB 4NCJA 4UEJA 2CFTA 4CL3A 3DUWA 2IHNA 2P0AA 1SC1A 1XQ9A 4K6OA 3ZOZA 2XADA 1TRHA 1EWQA 3OSUA 7AT1A 5JADA 3CJTA 4R7TA 4LQLA 5GZ6A 1P5FA 5CVVA 3CVVA 2HT6A 1NUUA 1KZ6A 1WMAA 1XVTA 3AB8A 1SNYA 1JT2A 1FMTA 2FN8A 2VHYA 1V1MB 2R8ZA 4MKHA 4X6LA 2RI6A 1RYZA 4Y30A 2EF1A 5DM1A 5JSQA 4YAGA 1XTKA 3ZGOA 1RJ9B 4AZ0A 1KF0A 4NZYA 3ZGNA 2RAVA 4A8PA 5CLFA 1GU0A 2ZRLA 4QM6A 4BX3A 5A4KA 3U7GA 4RD0A 3CX3A 4W8GA 2VVTA 3ZCPA 1E0DA 3LF1A 1L9KA 3WRYC 4CYMA 1GZDA 4X91A 3JPYA 2C54A 2ZETA 1TKBA 3HYNA 2WP8J 4CG3A 3GY0A 3L77A 1SJ9A 3BREA 1SBTA 3UCFA 2OK7A 1O54A 3KWFA 3I9OA 3MOSA 3HE3A 1E3TA 4MW4A 5LQCA 2VKTA 3SIRA 1Y98A 3LDFA 1QO0A 3CZ5A 4GR4A 2A0FA 5IJWA 2FFBA 2ADFA 2LPMA 1GNTA 4B4KA 3TAHA 3WWDA 1G8FA 3DTYA 2ZULA 4J4BA 2Z2IA 1EFVB 3PEUA 2F43B 3FTPA 4N47A 2O8FB 1EE1A 2PV7A 5AHKA 4ECAA 4UBIA 3OX4A 2FFAA 4NBKA 4EGSA 1JRLA 4KVFA 4UDOA 3SF8A 3KSDO 3W6ZA 2IP4A 1U9ZA 2VHCA 4DJJA 3TQRA 4RFLA 4KFTA 2ZRCA 3V7WA 2FV8A 1C0LA 2E4WA 1OU0A 2WEKA 2HWKA 2BR3A 3JALB 3N87A 2R97A 4HNQA 1FP6A 4NC9A 2N3ZA 4U7DA 4FFOA 1UK7A 4KDRA 3D6NB 4JBWA 4Y6OA 3PQ7A 1PLJA 2BUBA 3ET4A 4EYOA 1PUJA 1DJOA 1GCUA 5CX1B 3QEKA 1TAGA 1ETHA 3WRVA 1CR1A 5CLHA 1WSAA 1R66A 3VPGA 2AFIA 4PZYA 5MN4A 8ADHA 1FJ2A 3ZW9A 4ZV7A 3OZBA 1ZUNB 3CT4A 2NUTA 4DLZA 2X8WA 2SKDA 2I4IA 1T5HX 3BL6A 2WD7A 3OQ1A 4M0KA 5TJHA 4DA6A 4G4GA 4IF4A 4DCMA 4KXFB 4K0KB 4W9NC 1JIVA 1A8PA 1YXMA 1BN7A 3BD8A 3G0BA 4F96A 1QP0A 2VQDA 4TWAA 3BB1A 2NYUA 2FPGA 2J32A 1T1IA 2YN2A 3ROMA 4RJIA 5KCMA 4AWXA 4DB4A 1K6XA 3G89A 1UDRA 2AFHA 1BE0A 3Q2KA 2GJ9A 1EP9A 3RSOA 3FDIA 3GEGA 1JEQA 1IZ7A 1PNQA 2P8SA 4KKXB 3ZDEA 2RB5A 3BILA 1SA0B 5DM2A 4BJ1A 3H3JA 4CF3A 1U94A 5CCXA 2H3EA 3B3GA 3FDFA 1I4WA 4FHFA 5LMNB 1J5EB 1RZUA 1U28C 3V55A 2IS6A 3CSDA 1N3IA 2VDUE 1PT6A 1RAEA 2VJKA 3C4JA 5CK4A 4I1SA 5JZOA 2QQEA 3AB7A 2PVPA 2ZTLA 2UUBB 3GAZA 4OOFA 1H8ED 2FI1A 2QDXA 2OGZA 4CL0A 3NXKA 5AW3A 4JLKA 5CEEA 2M32A 2DF8A 3MHPA 3O83A 4FBMA 1JH9A 3K70D 3OZTA 2XGSA 3GWGA 5FTMA 3ONWA 3KZVA 1M1YB 1VRCA 2VT6A 1MN6A 2QQGA 1CUCA 1YS2X 3ITDA 4DV6B 1K2VN 2VDRB 5FPQA 3O4VA 5EYPB 2X22A 1M83A 2JIZA 3T4XA 4ZMBA 4CT0A 3VR2A 3CT6A 2FFQA 3I2YX 5AVOA 3WLKX 1WW8A 5EKUA 7REQA 3IA7A 2LDXA 4MDFA 2ZAOA 1HEUA 1N78A 3DGEC 4UE6A 1LVUA 5AKLA 5IAAA 5K4HA 2GJ8A 2NU7A 2OZVA 5LR6A 3TEJA 4HY3A 5DGIA 1OW3B 2DQSA 1ABBA 4LBZA 3UEOA 4WXRA 4HWPA 5DGXA 2MU1A 3QVMA 3L1IA 4TT3A 4DC1A 4ZHQF 1IY2A 4ZDJA 4BCCA 1YBHA 1YK1A 3EXEA 2C98A 2QYTA 1E5XA 1SXGA 4GYJA 3VH3A 3DE2X 2D1SA 4G85A 4NYJQ 2WWVD 4P5EA 5BN3B 4RMNA 3OE5A 4GMKA 3H75A 4YP0A 1AXRA 3ZK9A 2CMFA 3QQ5A 4QU9A 3WDLA 5BWOA 4QYXA 1VBKA 4NVRA 3I2HA 3ROXA 3I8SA 1E6LA 1UM9A 2BN4A 3IUPA 2D7JA 4KQJA 3R9IA 3SYMA 4E11A 1YS7A 1H0SA 2WMNB 2A84A 4YQFA 1OFGA 2C4WA 2I62A 3NORA 1HSOA 1RKUA 2CKMA 3VNQA 1C0PA 1U3CA 3QVOA 1HNZB 3MMSA 4M1EA 3HGQA 1Y37A 2NZ8A 4LOHA 1GYPA 1E66A 1OWLA 1MVNA 2BM8A 3ELYA 3EPPA 3H2HA 4X1IB 3ILVA 1E99A 1HWYA 4MWEA 3GDHA 5J5CA 5KC9A 3COJA 4G09A 3EASA 4J1TA 4CF7A 1P61B 1Z0SA 2KWIA 2O2EA 2FCAA 4MQMA 3A4IA 4S1WA 4TWZA 1UZLA 4GXNA 3C3MA 4TYMA 2OV8A 4O1HA 5IC4A 3U5TA 2CBGA 3B5IA 1TYEB 3C3DA 1H0HA 3EDYA 3BRWD 4HVLA 5KWJA 3K4QA 5T67A 1AQIA 3WL4A 2O8DA 3EEYA 2AMJA 3OFND 2DZDA 2YN0A 2FQ1A 2KBEA 2ZPAA 4AKTA 3MXTA 3UJNA 1JMKC 1XTRA 2XE7A 3WGVA 1YDMA 3LSYA 5K2MA 3MQ2A 2AJLI 1HDCA 3UOAB 1KH3A 1CRZA 3T5MA 3GNLA 4RGVA 5CDSA 1ZNZA 3PHCA 1JVNA 1NVWQ 2NSDA 2VNAA 1U1IA 4RGBA 4Y9TA 5DYYA 5JFTA 4GICA 4YLYA 3C8UA 2OD2A 3C24A 3WGTA 4CLHA 1D6MA 5KPDA 2IGTA 5JZSA 1CDEA 2JAUA 1UFOA 1G8KA 3O26A 2J5RA 3Q3VA 4B35A 4WY8A 4YS6A 5F7ZA 5A04A 4DCGA 1QFSA 2YQZA 1CUEA 3OF2A 1AQ6A 4TUYF 5H1YA 3UBMA 1N77A 3ZE6A 2ZXEA 4F04A 5K3DA 4URYR 4UQLA 2IIPA 3KWLA 4OL0A 2C88A 3WK8A 2CE2X 1JE0A 3L4BC 3C6BA 5AI8A 4CKYA 1VI2A 3QPUA 4HDRB 4YONB 5JWRA 3HB7A 4UD6A 2X0KA 3CUYA 1Y5RA 4WNAA 4Y2VA 4CV0A 3KYIB 4F4UA 4TYQA 1CEEA 1ZGGA 1NBEA 2GYYA 3RFCA 3X44A 4EPWA 3PS9A 1G8YA 3K3PA 5DCYA 2BFEA 1I5OA 1BKYA 3AK4A 3EEIA 1F7UA 2QLBA 2ZFUA 1F2DA 1JIIA 4HMOA 4U7WA 4GL2A 5L6MB 2L18A 2DGDA 1RCFA 3N05A 4GWKA 5ES4B 3ZUPA 2O1SA 5DH9A 3CE6A 1Z7EA 1KA9H 1ICEA 1S2DA 1SU7A 3AZPA 1ID1A 3X0DA 5A4MS 3INTA 1E2IA 2C58A 4PS1A 1M1UA 1Z4IA 2ZRDA 4O1IA 1CS0B 4JJFA 5G0WA 1R7RA 2XB4A 1CQXA 2H8KA 2PY6A 3CZ4A 1OAOC 5T4BA 3QBJA 2BRUA 4BCBA 2F67A 5KU7A 3ZS8A 1I1OA 1G1AA 1AHHA 3DOCA 5LOVF 1JR3D 4K0RA 1LZLA 2RHDA 3TBHA 5LLDA 2C2WA 3NP9A 3RU9A 2I1QA 5AJHA 1AE1A 3RC2A 5CFNA 3C4QA 1DMSA 1XDWA 3H5RA 2MYTA 4P81A 4C14A 1ULSA 1IZ0A 2QTLA 3NTLA 2VPXA 4HQNA 4LI3X 3LUKA 4FJ1A 3UWDA 2OBNA 4EJSB 1HT3A 1M3SA 1ZS9A 1T1RA 1V4BA 1T3SA 1Z37A 4MCJA 1TAHA 2GCNA 1XDUA 3AJ9A 1FU7A 2HRQA 2ZB2A 3ASUA 4JASB 3G8CA 2V7UA 4MR9A 4O4JB 1HE3A 1KMIY 2G9QA 2FSHA 2G1UA 2QGFA 3QVGA 4JLDA 4LVOA 1UMCB 2H4ZA 3QOFA 1KU6A 3LY7A 3AR5A 1PR2A 1T2DA 1CDDA 3GJYA 3QGMA 2VNJA 4AZ0B 3F9RA 1JIQA 2X58A 1UXHA 2WY2D 2V1UA 1HORA 4PAWA 3K7EA 3BMQB 4V2IA 4QVKA 1VLQA 3WA6A 5DN6D 4BQIA 2EP5A 4HB2A 2WJYA 5AI0A 2CEAA 4A91A 3PDCA 821PA 3RSGA 3DDNA 2OG1A 2BFPA 3KZOA 1Q0RA 2EBHX 3ZJVA 3HKEB 1P4HA 1Q20A 1TVMA 1V8PA 2XF2A 2ZUSA 2HNAA 3DT9A 4R05A 2DECA 3S0JA 2HIHA 4DANA 4DT1B 5L4SA 5FLYA 2V5UA 1J2TA 4QPNA 3DKKA 1JAXA 2GYWA 1KAOA 5COBA 3FWZA 4LKRA 5H8WA 4HNGA 5TE9A 1F8GA 2UVDA 1YGYA 3CB4A 2JI7A 4JYMA 4EA6A 3E05A 4LAFA 3WGQA 1J1IA 2HADA 4PX2A 5E38A 3GJ3A 3KSRA 1Y80A 3ETNA 3GRFA 3EXG1 3VJMA 3VDNB 2QG4A 4RF3A 3RH0A 4E5PA 4EKYA 4G4SO 3ZX4A 5JTUA 3TUIC 4H7HA 4C0XA 4F86A 1Z5OA 2WSYB 1G55A 3TF5A 4LZAA 1OV6A 4KQIA 4M9XA 1QE5A 1U6JA 5EI5A 2X13A 4Y6GB 1NULA 1SO8A 4HLCA 4UC0A 2OHGA 1TD1A 4EEKA 4YRRA 1BRMA 3L93A 1G5HA 4KIWA 1X7DA 4MNTA 1MV8A 2AFIB 4Y1RB 4CCYB 1CQIA 3FYUA 5B1YA 3K1YA 1OHHA 1IN4A 3OHSX 1AZLA 3VYVA 2PQ0A 1J2JA 4PSCA 4UM8B 1U0TA 3I72A 2Y1EA 2EJVA 3ZYCA 3D6TB 5BUZA 4RLSA 4D8WA 2ST1A 4CTJA 2YKGA 1JEYA 1OZFA 2AJTA 2I80A 4MOWA 2C2KA 1R1DA 5IFLA 2J3QA 1F7VA 3GBPA 5JNVA 2J7KA 4F38A 1AQYA 5LMZA 4GIBA 4EW1A 1KGSA 3HS3A 3IERA 4WVLA 2EFEB 4OHYA 1NVUQ 2VPTA 4AO6A 5BV8A 3BZWA 2CNLA 5DNCA 4UDXX 1J8YF 2C9DA 2FZWA 5ESXA 4UTPA 2EZ8A 1NQOA 2Y0DA 4YRAA 4QYIB 3ISTA 3DBRA 4WFQA 1NM5A 3AL2A 2DE0X 4XLZA 1QIFA 2J31A 1XP8A 2WMDA 3UJ7A 1G21A 3W5SA 1F4PA 1V11B 4IEEA 4GZ5A 1LBTA 3D02A 3JATB 3F8WA 4JLMA 4KXWA 4W9RA 1QXSA 3KKPA 4PX9A 4Q9JA 3SQWA 1Q44A 2O50A 2Y92A 3PEFA 4CIBA 3UWSA 1AO3A 1AKTA 2RGYA 1Y8AA 1J8MF 2BHNA 4KITB 4CKWA 3TXXA 5FBVB 4MS4A 3R3VA 1QKIA 4IL5A 4JP8A 1J42A 1XVIA 2PL1A 4DM7A 1BQEA 4EKDA 1JQ5A 3NTVA 5C8YA 4BEWA 3GD5A 4EP1A 3QU9A 4NOMA 4J0GA 3LUHA 2BEWA 3VQTA 3KEMA 1YONA 3TGPA 3TXYA 3Q8WA 2Q6KA 2VK1A 1KI8A 2WKSA 4EKNB 2J4CA 3NDRA 5DEOA 1OXKB 4JOSA 3ZHCA 2P9JA 1DV1A 2F17A 4MKIA 4QRIA 3T61A 3OX2A 5A02A 2WWYA 3K30A 1P1JA 2E6KA 4PGGA 3USCS 1UC8A 3LWBA 4MW5A 5GGYA 1ZN9A 3D3JA 4BASA 2JGFA 4K9PA 1HBJA 2E82A 4EY3A 1E9AA 5DWQA 3RC3A 1H4SA 5LSAA 2VTBB 3FVVA 2P0YA 3G9TA 1T6XA 2JIPA 1RE1A 2IOHA 2HAEA 1E6UA 5IWAB 2WIDA 1UPBA 2DOKA 3H1GA 3ZIAA 4WTOA 5BT9A 1VJ5A 4X45A 1L3CA 1T9HA 1AKRA 2GD1O 4CLOA 4JKYA 4AJKA 3KZMA 2J4DA 4WIAA 3BEOA 3HBNA 3PNYA 4PSUA 5KNLA 3PLAE 1IUNA 3IIMA 3OZSA 5CIWA 2DRIA 4D9NA 4QICA 1JJVA 3HVJA 1KR5A 4OXRA 1JSRA 5EWJA 5C51B 2M9MA 3AF2A 2FHPA 4G4IA 1UBKS 3FKSA 1WX1A 1NY6A 1P4AA 2FQYA 4K6CA 1FFAA 1FOEB 4B85A 2IU3A 3DV2A 4JBHA 1H65A 1QYRA 2O3JA 1TQ6A 2TRSB 2YV4A 4E15A 3KLPX 3AL3A 1DINA 2XMZA 2ESRA 3KJNA 2OOSA 3M4XA 3OI7A 4MUAA 4Q1FA 4BJ3A 1PJTA 4RIHA 1P45A 1T8SA 3HUTA 1R74A 1IY0A 2H5EA 2QVBA 4IM7A 5DTJA 2C9ZA 3ZWMA 3ADCA 1V8BA 4LC9A 4LE1A 3UCEA 3DV0A 3ANSA 3OCZA 1M2WA 1WCV1 1CK4A 4CKBB 4PPGA 4MQFB 1Z06A 3OIUA 1PS8A 5HM6A 1ADJA 3ESRA 3NGLA 3SZ3A 4RVDA 5FTLA 1QQAA 2QMZA 2MSKA 3NAMA 3ZU4A 3R0ZA 1KBZA 3CF0A 1RT9A 1KIMA 4G0XA 4XFJA 3MTIA 1O0SA 4RM2A 5KDLA 2J08A 3I2IA 9GPBA 1LDMA 3TR5A 1Z2OX 2A78A 4TLAA 4HH3C 1C9JA 5L7TA 6Q21A 2P5UA 1KMQA 4RE5A 1DKNA 1CRPA 3QKUA 2W11A 3OC0A 4PSKA 4ZV9A 3IBSA 1AGRA 1ZD5A 3EGWA 4RA6A 2H1RA 2LCFA 5BXQC 1KQ3A 4M0DA 4UPDA 2XUPA 3DHEA 1L5SA 1ZZGA 4IJKA 4WXPA 2Y67A 2XYPA 4D96A 4OI0A 3DCJA 2GM3A 4N3GA 2Q27A 2YRXA 4NPHA 4PY2A 4TSRA 3DOUA 3PXBA 3TW6A 4MPPA 2QSYA 3AHEA 3E18A 4XVUA 1R3UA 3VGPA 4WK0B 2I87A 1AGYA 1NW4A 1XCGB 1NN0A 1Z7WA 1ZXXA 2CL0X 2ROQA 3HV0A 3IR5A 4KXMA 5EN4A 4DNOA 4GX2A 2NV6A 4QVIA 3PJFA 1TYZA 2VRWA 4GSYA 2ARKA 1VCOA 1Z0DA 4FGLA 2O7QA 1ENZA 5A6VA 2QVCA 4L5YA 3FR8A 3FX2A 3GA5A 1KXJA 3QX3A 1U3TA 2ZUDA 3H5NA 3GUYA 2B6HA 5EUCA 4C87A 4TYNA 3EVBA 4D8VA 5L45A 1X1DA 3P2MA 1RADA 2W5UA 3K1AB 1BCSA 5KINB 1E7YA 5H80A 1JJAA 1G7CA 3BJRA 3K2BA 4PAOA 1TYDE 1TVKB 1XR3A 5EVJA 1ZMBA 2ZIXB 1CVRA 2CLEB 3M6AA 3H42B 1DC7A 4L8WB 5FFFA 3TLYA 4DHEA 2CK3D 2FPWA 4B48A 3QF4B 1TIPA 1ZI8A 1SOAA 4KLCA 1WMSA 4CT5A 3QWAA 3C1AA 4F3RA 4I81A 4O63O 5KOJA 1KRXA 2Z95A 4Q3AA 1WP9A 4N3CA 5HS6A 5HA5A 5BN1A 1VGQA 4DCUA 4W1QA 3C7CB 5CVEA 3KKQA 4UTNA 3AG5A 3I0MA 2UUOA 2QAIA 3O4GA 4MMZB 4DVGA 4ZMSA 5FFNA 2NU8A 2JB9A 2HMTA 3K9HA 2VZ0A 2BKLA 1TECE 2OPBA 4HKTA 4X92A 3BK2A 5BYJA 4P34A 2AOTA 2HX1A 1X19A 4WI1A 2AV6A 4MCHA 4D82A 4DMCA 4WOJA 3IOCA 4DABA 5K4GA 3TJZA 3ZGZA 2BTQB 4NYIQ 1U31A 4MB0A 5KSOA 2ZSIA 2BT4A 4IIEA 1NC3A 3DO5A 4OXXA 1E8NA 5ED0A 3K31A 1S8FA 3B1WA 1M5RA 2ZRNA 5DB4A 2AHOA 4FONA 3KPJA 2XDAA 1JIUA 1X38A 2CFOA 4YMHA 3Q88A 5AVWA 1SCJA 4DIEA 2ZANA 3UC9A 5AVQA 4E12A 5LQAA 1EA5A 1COZA 4Z1OA 3W2EA 1I6MA 5JCJA 2GPBA 3I9KA 4DV1B 1M8KA 3CLUC 2IZ7A 2GEFA 2B4TO 4JQSA 3D3WB 1NMZA 2I76A 2MR5A 1YE3A 4R9VA 4Q4CA 5FX2A 1SOWA 2GDJA 1R6DA 3LWNA 2Y4NA 1EIZA 4ISCA 5K0NA 4OAQA 3UUEA 3FOWA 4AMVA 1NDUA 2LW7A 3DHVA 3SKVA 2RE8A 1SVNA 2X1LA 3S7TA 4R41A 1TQDA 3T94A 1NUTA 3PXUA 4MUKA 2VYNA 2C82A 1W19A 3FWNA 4UBJA 2JCVA 1J0DA 4R5MA 4DNPA 121PA 3NKFA 4KG7A 3OWXA 3ZR4B 1DVRA 2XUQA 3GT7A 1QH1B 2QAGB 4Y7DA 5AYVA 2ETVA 3AR8A 5CA1B 3WZ2A 1YRLA 1V2HE 4OQNA 1KFCB 1V47A 2MMCA 3AHHA 3QE3A 1IU9A 2QS9A 3G0CA 4LKOA 1GTMA 3SS7X 1WNFA 5LP6F 1F0KA 1JFTA 1OFTA 1ECLA 4HNAA 4ZRDA 4JT2A 4PQYA 2A9QA 2JCYA 2B20A 2K7ZA 2XLCA 4JL6A 3FYUB 1T1EA 4OLFA 2W93A 4TMXA 4DJTA 4GOJA 4IHAA 4FT2A 3DOFA 2FE4A 2Y99A 3M81A 4AY2A 1VHLA 4KPYA 1Y81A 1VMDA 4UCWA 1WV0A 4W5NA 4IJQA 1T8TA 4F8JA 2VTVA 1AXGA 2UV8A 3C2QA 3TNYA 3VR1A 4N0EA 9LDTA 5JLAA 3PEWA 3AUJB 3S70A 3OM8A 2PZFA 5HKBA 2VWPA 3F3SA 4IQFA 5JSYA 4YUZA 4BE4A 3TZ6A 1QTQA 3DBRB 1DEOA 1NW5A 1S8NA 2P9EA 3BGDA 2ACEA 3KKEA 3PRYA 4LI0A 4QOIA 4TXHA 4ARVA 2WVHA 2B82A 2WYVA 4IW3B 1L5OA 2ZBRA 2ZJZA 3T3DA 1PK8A 4HXEB 4BFLA 4IFIA 1B1AA 4OFWA 4E2FA 4QOHA 2Z8YA 5ALHA 2BGGA 4I6JA 5J2UA 1P8AA 1UBOS 1VI5A 2W83A 4M87A 4MS4B 4EJ2A 2CL6X 1FMCA 1YBFA 2CNBA 2VG8A 1JIJA 4HS4A 4DMHA 1V5IA 4RQUA 1KYQA 1Q84A 4M21A 1NU6A 4M7PA 4K03A 5DYWA 3UGTA 4F56A 1CD5A 4E31A 4RC9A 1QV9A 10MHA 4B3BA 3R7AA 2CNNA 3TVTA 4AJIA 1JEJA 4UU0A 3PD1A 3ESYA 3Q9LA 3T3GA 1NTOA 1P1HA 4F0JA 4U6SA 3UA3A 3CY6A 1UMDB 4TTTS 3B20A 4ZALA 3ZKWB 4LY9A 1XA4A 1HYQA 4HQ6A 3GGJA 4QU5A 1WOYA 5AI4A 2UZ0A 4FS8A 2P3OA 5ERXA 1DWOA 3RROA 4JIGA 1BX0A 1GXSB 2IH5A 3A6JA 4YUVA 3UW1A 5IMBA 4ASUD 3O91A 1F38A 3EXHA 3MWGA 2QVGA 4DCNA 1GUDA 2ZEJA 1VCMA 5I9TA 4ZTZB 1DC5A 3PFCA 4KR2A 1DP4A 2YZKA 3PUWA 3GT3A 4AKGA 3FSRA 3KAPA 2A9OA 2IYVA 4UMFA 5E4FA 1E2KA 1R50A 3NCHA 2VI5A 5CNKA 2JJYA 3M1IA 4FINA 4IJMA 5F5NA 1E3WB 5ECYA 3A27A 2P4QA 4I5IA 3SOPA 4DS3A 2WIAA 2OXEA 1O4VA 3LTNC 4BQEA 1R9MA 3ZV4A 3EIQA 1RRCA 3NPMA 4C07A 3GNSA 5AM1A 3ENWA 2C9YA 3FPBA 4KR7A 1HFKA 3LYLA 2FUKA 4ZAVA 4E5VA 2BDUA 2X4GA 4Z7OB 1T5SA 3JX9A 4DOMA 2Y8EA 5HF9A 421PA 3BT7A 4PZEA 1YZVA 1M6YA 3T54A 1CR6A 1JWLA 1K9VF 1TTHA 3IAUA 3QMMA 5JPCA 2PL9A 2X9NA 1YU6A 3CHYA 4NMHA 1AKWA 4DXDA 1DT3A 2B0JA 2CZGA 2OFWA 2AUNA 2W2PA 3OT1A 4R2MA 5AJZA 2VH1A 1DL5A 5FR2A 3GZJA 3HU5A 3QE2A 1P5JA 4LQDA 1AJEA 1R4AA 3J81k 3PC3A 1I6WA 1VI6A 1E7MA 4NCNA 3QSYA 2X86A 1Z0AA 4FLMA 1I4OA 3NH9A 1WG8A 2OBXA 1OY1A 1DKUA 4M8NE 5C80A 2OESA 4NCBA 2R5WA 4O2BF 3ZY2A 5HOEA 2BFNA 2NNLD 1L4KA 2V6FA 4GLBA 5H68A 3E3AA 4E5MA 1SVIA 3WGLA 1OWNA 2XCIA 3NHSA 3W5CA 2D62A 1NVTA 1YRAA 2NUPA 3GGOA 4GFDA 4JJ7A 4RKRA 2WPDA 3HXPA 3ZWYA 1XMQB 2Z3WA 3GMDA 3MJHA 2G8LA 4BMSA 3WSWA 4M98A 1OI2A 4BMCA 3EYAA 1CEXA 3VYSB 4ZJUA 4TLEA 3TOZA 1KZ7B 3IVRA 1QGED 2EFJA 4R8SA 5ALMA 2SICE 1I36A 1P2UA 2FWRA 2O07A 3KOUA 4YJ3A 1DV2A 4AXXA 5JNUA 4ZCIA 2ADMA 2FZLA 2ACVA 4BZZA 1VPDA 1NKTA 4CKXA 1CNMA 4NZOA 3ZCRA 1NSYA 2FSVC 1RLUA 2VWQA 2IIVA 3HBMA 5CDHA 5JXIA 1N25A 2FF7A 2Q4BA 2H1FA 3N70A 3P0HA 2B5OA 3ROZA 3RUHA 3CVOA 2G77B 2C4TA 4NECA 2F3QA 4WWHA 1Q0ZA 3O4HA 1NTRA 1RQGA 3QV2A 1I1HA 1LLDA 4MIYA 2OLEA 4NEHB 4PNPA 3GUHA 3QVVA 2PVSA 3TOSA 4D3SA 4QFMA 2ZQ5A 5JT1A 3O8QB 2W6JA 2NGRA 5HQTA 2W58A 2JFOA 1CUYA 1GUZA 3NTUA 5M04A 2QUHA 3AEUA 4HFMA 4JI3B 3ZI7A 5BP7A 4XEUA 4D8UA 2HF7A 3D8UA 3OQPA 4PVDA 1J23A 2BV3A 2JJQA 3N0VA 3MS7A 3W5JA 2O14A 1OH5A 4S05A 1RSZA 3FOBA 2CHQA 2MR6A 2O48X 3GOQA 4BU0A 2O2IA 4L5BA 1C8VB 1NXSA 3O2SB 5LP6C 1M2GA 4YXWA 4MA5A 4QUEA 5CJJA 2C0CA 1HZJA 1SBHA 4US2R 1MHTA 1UK8A 5KNDA 3UTCA 1VKOA 3GX1A 3N6RA 5JCZA 3QX7A 5JMPA 2D1TA 4H7EA 3V32A 1KBOA 5KIAA 3WA7A 3IHWA 5BQFA 1EVIA 3LC7O 4S1PA 4XFKA 4A8JC 4G9GA 4C1BA 4DA4A 1M1XB 3CV3A 1NJ8A 4MRAA 1LY1A 1N6IA 3I5MA 4MXDA 4UBKA 4R4JA 4QREA 5ALEA 1KK2A 5K03A 2QKYA 4XVCA 3EB9A 1XQVA 1WQ1R 2HRCA 5LQUA 5CK5A 2GESA 4KLAA 4GKJB 2ORVA 3GJ4A 1VJDA 3M6UA 4M55A 4CM1A 2AQKA 1RKBA 1EH5A 4Z3OA 3D7LA 4O29A 2QZJA 2AB0A 3ZV3A 5BSHA 5A9SB 3JQFA 3RUFA 3PRJA 1O2DA 5E4YA 1UF9A 3SJBA 5HIKA 3VKHA 3A3KA 1IFXA 1XTJA 1RI5A 3AZOA 3P9CA 3QTBA 4NZPA 1FRFS 1N9GA 1ZVMA 4B40A 1N8TA 4CGZA 3NM6B 1AX9A 4NBVA 4HATA 4OBBA 4N18A 5FKJA 3TLMA 3ZVLA 3UT6A 3FSGD 1FDIA 2LV8A 4J29A 3AY3A 2W2XA 2P9YA 1IG0A 5FT9A 3RVOA 4LJ4A 1L3IA 1QHSA 1EUYA 2N0SA 2D2IA 3R3SA 5IKOA 5IF3A 1GG9A 3WK4A 2ATCA 1QFZA 5EXPA 2VDMB 5FWXA 2I78A 2OM6A 1Y1LA 4HEJA 2WICA 4BQNA 1LV8A 3BKWA 4GMFA 3RK4A 2GCIA 2AXNA 2HCRA 3DMPA 2I3ZA 3RQSA 1MFPA 2ZYIA 2BI7A 4DW8A 3OD5A 1Z25A 2MYNA 1TAQA 1NRWA 4YDSA 1RAAA 1EP2B 3HKCA 3SS8A 2E6UX 2WWHA 3L07A 4U2GA 3NVDA 4OHPA 1A0OA 5DT2A 1D2MA 4WBSA 1P5HA 3ABZA 4E5UA 4GP7A 4PG8A 1WAMA 3PPXA 2YWRA 3WRYA 5I01A 3QHPA 1C8KA 1N7IA 1DUVG 2XYGA 4FFDA 4LSMA 3B1FA 2ZYDA 3WNBA 1DG9A 2GEBA 3H99A 1JQBA 3RK0A 1NVVQ 3LWZA 4UNIA 2HWWA 3I8OA 5TB5A 5FWYB 3NOVA 4EX7A 1CV2A 3WDSA 1OI7A 2PR2A 4HAIA 1EK6A 3QUAA 4WGFA 3WQRA 3E0QA 4H7FA 4QOGA 3WLEA 1KQPA 3CKYA 3HNRA 4YRLA 4XOUA 3AEZA 3S7ZA 3IOBA 3NBQA 3PYXA 3VZDA 3RI3A 1AHPA 1CIVA 5FI3A 3S27A 1YE5A 1J2UA 3U1BA 3VR5D 1TZMA 2B21A 1TVCA 4JYZA 2COEA 4QHYA 1N7HA 1AQLA 4PNZA 1E9EA 4CKCB 5JNLA 5LA6F 3DZDA 1TM5E 2PKRA 1VA4A 1CE8B 1ADCA 3A9CA 4P7BA 3FI0A 3FUVA 3IJPA 5KO2A 3GIDA 5FTNA 3C7AA 1ZJWA 4N49A 2FZCA 1YL5A 4AC9A 5I7UA 3TAUA 1LW6E 1KOGA 2XWPA 4ZVOA 4NDZA 4WN3A 1J1ZA 2V6BA 1KVTA 1TM4E 3LVBA 4WA7A 4I5DA 5TPZD 2A0KA 4UBNA 3ZJTA 5JNTA 4DMMA 2O6LA 1QOQB 4KOEC 3EQ6A 1Q0SA 1W4RA 4XQ0A 2PX4A 3HC7A 4H6PA 5GGXA 4G0PA 3A6KA 3TLZA 2QRPA 1QMPA 2B8EA 1SXJC 2EP8A 1C1HA 3EIXA 3DEYX 3V6LA 3WYAA 1VKHA 4WCDA 4UCXA 1X8KA 1JZSA 1N2EA 2OV2A 2VJQA 3WL3A 1DWQA 1SHLA 1T1GA 4N8SA 1PHRA 5JZBA 3U6BA 1M6NA 1BYUA 3KE9A 2IX9A 3HFSA 2P1ZA 1E79D 3ETLA 1SWVA 3IE1A 2JHPA 4HNTA 1KAQA 1NVXQ 2VAWA 2CLMB 4ZVLA 2WF7A 3F7OA 2PWYA 4WERA 1CY1A 4PSVA 1E20A 2FEXA 2IEYA 2VN8A 1QUFA 3ILSA 1RFLA 2OKGA 3JD0A 4WINA 1D2CA 2C9CA 4HGQA 5F3DA 2JBAA 4RPGA 2Y1WA 3TBFA 1M6HA 1FSSA 2B4KA 2I03A 4BXOB 1CF9A 4F3YA 5EFOA 1Q1GA 2ONJA 3ROTA 4AJ9A 3EXHB 4DQLA 4ENUA 3MWDA 1IVYA 5J3JA 5U1PA 2OR3A 3ZPXA 5FUYA 2B69A 1EFRA 3A7EA 3DZ8A 4HWOA 4P83A 1KVRA 4BMNA 4FDVA 2PUTA 1XZGA 1ZGZA 2QRVA 4NBWA 3TNJA 4CN9A 1YVUA 3O94A 4F85A 2XCUA 1DAKA 4BVBA 1DPFA 1VP9A 3X1XA 4EFNA 3RVJA 1PEKE 2IZ6A 4X54A 3U4MA 2G9ZA 3DVSX 1KJWA 4RABA 1NSFA 1K7SN 1Z5NA 1KKUA 2QRHA 3PWSA 2DLCX 2X19A 4YJFB 5CXQA 2QOEA 2EF0A 2ZSDA 2QTMA 4NHOA 3VSCA 2HFJA 3MOGA 1OGJA 4N0PA 3TIFA 2ZI6A 2PUEA 1Q3KA 1DT5A 3G2QA 4F1JA 1O6FA 2VEDA 2XYQA 3GLUA 4QJ3A 2PWAA 1CZLA 4ZCPA 3HJFA 2DHCA 3WZLA 3OT1B 3TSAA 1IE3A 5IK2A 5IJ0A 5CB4B 1N33B 3JD3A 4NMWA 5ITZA 1WXEA 1QQ6A 4YECA 2IWRA 2QMYA 1CJKC 3AWIA 3TDNA 1JYSA 2YBEA 3SNKA 2RAPA 3ET5A 2Q4DA 4KAFA 2J3MA 4X1OA 3B70A 3DEJA 3SEZA 4BRSA 1ECPA 4CMHA 3UAGA 2OD7A 4D79A 1X9GA 3PIDA 1NP6A 3L4KA 3PKJA 1JLRA 4R83A 4X9XA 5J59A 5JXGA 3LNTA 3ZLTA 2FHSA 5EJ4A 5D84A 4A0GA 4YRNA 1WDKA 2JGLA 3CLRD 4TV9A 4BFWA 4Y9RA 4UHCA 3UV3A 2Z58A 2GCPA 4TL7A 3KIPA 1JXOA 2H4WA 5B4TA 1YHYA 3W1VA 2X41A 1MC1A 5TPWB 3PHBE 4I3GA 2JFGA 4YJ2F 2FJPA 2C7QA 4FGJA 3LKDA 3BX1A 1RJGA 4ZGWA 5B1HA 2ZBDA 3OPMA 3Q3EA 5A4JA 4KBFA 2CXSA 2GZHA 4WUTA 4YJ3B 1XZPA 4UVIA 2I4RA 2WVAA 3LE8A 3U9SA 3FBTA 3ZHUA 5IKEA 4YROA 4YFYA 3GZ4A 4KIUA 5FUBA 2BFWA 2YDXA 4L7VA 3N0WA 1D4ZA 4QOFA 3LBHA 3WDKA 4M8LA 5IYZF 4XR9A 4TRRA 3ONVA 4JI5B 5DNUA 3NUZA 1HDGO 2XNJA 1MKYA 4LPSA 1EAYA 4QX6A 4WXEA 3CEJA 1VE7A 3AONB 4BNVA 4C0QC 1FJHA 4OKIA 5AJUA 1Z4OA 3BTOA 5JALA 4JI4B 4ZWNA 4C6HA 1VP3A 4X8HA 4EW6A 1OIWA 1K27A 3KUUA 4JGGA 3AEUB 4HQ0A 2ZOSA 5FB3A 4EQ6A 5KVVA 2QTAA 1HETA 2SKEA 3PQ2A 4FI3F 4ZU3A 5AVXA 3E53A 4OATA 4ND2A 3LC2O 4L9SA 5CT6A 3HRIA 3B1YA 1LH0A 1I4DD 3WLPA 1GLGA 4TM7A 4DNQA 1BFDA 1D9XA 2PJRA 1OT5A 2XE4A 4QFDA 4H7KA 2RGGA 4NTZA 1JKJB 4LGVA 4NJOA 3C6MA 1UPFA 4OA5A 1OGIA 1QG0A 1PGPA 2Y1DA 3M6VA 5ECDA 3T4PA 3GCXA 4L4RA 3VR6D 1UZAA 3RF6A 1PNRA 5AVJA 3RJTA 2HLHA 2NSJA 2P2CA 3OZRA 2AE1A 3ESBA 4Q3DA 4NXMB 1G3RA 2ISCA 4A36A 4UEWA 2E18A 1WE2A 2CF6A 2H07A 2ZJYA 4FZVA 4NBNA 1RRGA 1TCBA 3RVSA 1BHO1 4MUFA 3FYCA 5EMMA 2XUFA 4H4DA 5TSDA 4IHKA 5IT9A 5FHRA 4CM9D 1PWEA 3VI4B 1SUFA 3HK2A 3B1KA 4JJZA 1CUXA 5CYGA 2NAFA 1SVLA 3GPIA 3KXIA 4ZVVA 5A3JA 1SVKA 3V7YA 4EBFA 1QVRA 1ZW6A 4B31A 3D6AA 2II6A 2JGDA 3I83A 3K2EA 3EG9A 2Q6VA 3NONA 3GLRA 1VFNA 4C3ZA 1GRCA 3LPDA 1RS0A 5L53A 3EWSA 1OAOA 1RYFA 2MT9A 3O8BA 5D3MB 1R8SA 4XDGA 1PWHA 4AS1A 2VNKA 4YNBA 5DK4A 1KOFA 3W05A 2DETA 3AESA 1N9GB 4OXYA 4I7EA 4E1BA 2O9JA 4KI7A 2H7VA 4KRGA 1QOPB 3TRDA 4HX2A 4M8IA 2YC2C 3MRXA 3H5IA 4JUIA 4YH1A 1MLDA 2GZDA 4IDHA 5TR9A 3AUXA 3R7WB 4F7WA 4YPFA 3VTFA 2H48A 3IEUA 1G4HA 2FEAA 1JPJA 2Z98A 1Z08A 4IIGA 3CBQA 4RPLA 2R6CA 3LXRA 4ED9A 5FEUA 2WSLA 1ADYA 3RW9A 3RFUA 4DA8A 3K92A 2CCJA 1KAMA 1NNUA 1R4NA 3IEIA 1UPXA 2C7BA 2IZ5A 2LIVA 2RGCA 2ZS8A 1D4AA 3IKLA 4KNWA 2H16A 4LWZA 1T35A 5EGSA 3UK2A 4I46A 2VRNA 1QMGA 1JXQA 3GB9A 2YCBA 5EXXA 4HSGA 3FXAA 1UIRA 3HKBA 3LF2A 4RH0A 4DQDA 4R1QA 3EDQA 3EFBA 4NNOA 3LZDA 3N8IA 5K45A 1Z3IX 2FF5A 3RT7A 2GD2A 2IEGA 1IMJA 1QYIA 1N7JA 4E2YA 2W0SA 1D5CA 1JLHA 3INRA 3PQ4A 3VPCA 1KI6A 2B7CA 3DLTA 2QB5A 1ZL0A 4GR9A 4O3MA 1P44A 5JI2E 1N7GA 2ZYGA 2ZATA 1F2UA 4OH1A 1U9CA 2YXPX 5E2BA 1SCQA 2BKUA 5DTRA 4PQEA 3MLAA 1NXQA 3FD8A 4GUDA 4MV6A 2RI1A 4NENA 3CTMA 2OP0A 4H3KB 4HZUA 1EUCB 2ZJ8A 3CX6A 4PE5B 4UW9A 2XT9A 4CF6A 4ZI7F 3VU9A 3O4IA 1W85B 1XTUA 2UVPA 4PBRA 5EINA 4RZ2A 1R16A 2C8JA 2R4TA 3IV7A 5D7BA 3U3RA 3BA1A 3BXPA 2QTFA 1V5FA 3WLIA 1XL1A 5FF9A 3TSZA 3G9UA 1IOWA 3AR9A 1ZH4A 4C7BA 4D9EA 3SHWA 4I9UA 5F5LA 3R7FA 2DXIA 5C5EA 3D0QA 4FMBB 2XSZD 4BNMA 1G5FA 2WKQA 3CB2A 4KACA 2MWMA 3MK31 1N3BA 2WHPB 2CLOB 4LSWA 1UJMA 3NOQA 3NYQA 1WUTA 2ZU0C 1IQ0A 4JT4A 2HDOA 1R6BX 3KU4A 1BCRA 1F5SA 3QVLA 5BUCA 1S1MA 2JFPA 2O3SA 1XLTA 2QG9A 4J76A 4C21A 3NB0A 3SWWA 2XKKA 2H4HA 2E49A 4TRJA 3KXPA 2BFDA 3IXQA 1RQNA 2AL7A 3PHLA 4G2NA 2IRWA 4E4YA 4LC0A 1IZZA 2Z83A 2OCIA 1JHZA 3DDCA 3KQQA 2WLSA 4MR7A 3B3QA 4CMGA 4ZHQA 1K92A 1IXRC 2AW5A 2AOVA 3S8EA 1XG5A 2YBDA 1CY7A 3EAQA 4V3CA 5L6LB 2MSNA 4GU5A 4J1QA 4DPMA 3LXMA 1NGSA 3T5CA 3KT0A 3RVBA 1Y8RA 3DAFA 3FWHA 4PBSA 5DNEA 1NLFA 1JVSA 3TN7A 5CLQA 1MZVA 2I6UA 4JZKA 1BN6A 1USUA 3U0BA 4IOLA 2GLUA 5IBRA 2EKBA 1EP1B 4CTOA 1GTJ1 4Z49A 2F7SA 3NVKI 1IN6A 2CVOA 4UJ3A 2XQFA 3PA8A 4MKGA 5E7JA 1UJ2A 5DKFA 5BO5A 4H59A 4BLUA 2WZBA 4BZXA 4CFZA 1AMNA 4ILEA 4QGAA 5MHTA 1NUQA 1QE0A 4X3CA 4XARA 2P75A 4DDUA 2RHOA 1XROA 3PGMA 4LXYA 4YRTA 1LDEA 3FNEA 4YJHA 4ALJA 2XEXA 1DJMA 4KPGA 4QU8A 1KIFA 3HCAA 3MAAC 3P9YA 2I7TA 5JS8A 4I3HA 4D81A 4DFDA 4D43A 1FVOA 3RPEA 2PH5A 3UAZA 4B2YA 3JZAA 3KJZA 2OC4A 4TQGA 1U1CA 4MB6A 4QU0A 1MRZA 2HFKA 4CE6A 1IL0A 1CJUC 4ZQBA 2WW8A 3FVQA 3K71B 3P7MA 2JD2A 2WIBA 4TMFA 5FXMA 4A23A 1RIFA 3RFVA 2F1KA 3KLMX 3K15A 5LUBA 3GLHE 1KDYA 2V7EA 1Y3IA 4DIUA 2HHJA 4OOEA 2Z6AA 1JG1A 1HA3A 4RUKA 1RWMA 3BFVA 3L41A 3RE1A 3ZY5A 3RODA 1G19A 2QJFA 2XQJA 3WL8A 4ZGBA 5HFJA 2FSGA 1O96A 2OBYA 3CJQA 3IAS1 3W9SA 3VR4A 3T35A 4F6RB 2M6SA 2AGVA 5FUXA 4D9HA 1BMTA 1JV2B 1JI0A 3RS2A 3T15A 2H2IA 2Q4OA 3H97A 3PNOA 3R4VA 2GBLC 3PR1A 2VHUA 3K09A 4M46A 3H3FA 3KETA 4AXBA 5ITZB 2OXTA 2OG2A 3R9KA 4HS9A 1AD2A 3D8RA 2J6BA 3Q1KA 1IZ8A 4TUYA 3Q9NA 4FEYA 4IVNA 3UHOA 4E2ZA 5F7XA 4DLYA 1KJZA 1XTZA 3CPEA 3B9RA 3QIVA 3LY9A 1JS1X 4H18A 5EKDA 4RJTA 5F64A 5K20A 2BFCA 1W36B 2PGXA 3WGHA 3TGWA 1C0EA 4EOGA 5DGDA 1M0TA 3GT0A 1WULS 3FHLA 3FPLA 2H2FA 3LPLA 4RCVA 1XZEA 3N2GB 1JQJC 1P1CA 2NYRA 1LU9A 5AXBA 3RTAA 5B64A 3FPCA 1LC3A 2H5LA 4KH0A 2D3WA 1JAHA 4HH4A 2VAVA 3QMPA 3B6MA 1T36B 2D5LA 5BSTA 5BV1A 4TKUA 1Y4DE 4UBMA 3ZBPA 2L19A 3SXJA 2B1GA 3L84A 2KSQA 4BVAA 2EXXA 2H2HA 1USKA 1NU8A 4FEGA 4Y0VA 3LK7A 4ZYUA 1T6BY 2F1RA 3LKZA 4OVKA 4CIYA 1F5NA 3SC2B 4XX1A 4C3VA 4F1WA 4M99A 1Q1ZA 1HTWA 3IKMB 1XZFA 5DN9A 3SVLA 2J09A 2P78A 4AN0A 5P21A 1P4SA 3BRCA 2CXPA 3OF3A 3L8ZA 3T5GA 1YNSA 3RU3A 4J0HA 1XVVA 2X14A 1DRKA 1YS6A 3K16A 2RGNA 3L46A 3PPIA 4Y2QA 4LQCA 4N01A 3GFRA 4NU5A 4YUXA 4YAUA 5JJLA 1E58A 4LG1A 2XHZA 5LZ2A 1CJVC 2ZREA 3VO9A 4D0SA 4OSPA 5T64A 5KYXA 2RGUA 2QR3A 3J80A 3P0EA 3ZG6A 2VL7A 3H87A 3DKRA 3LAWA 5H16A 4PC6A 4M36A 1KYIA 4XXHA 2AFHE 4Z1MA 4CLRA 2A4MA 3GRRA 4I4LA 1GOTA 3DM9B 2HYIC 5GY7A 4DILA 8GPBA 5JFOA 1FTSA 3GGDA 3ST7A 1DRVA 3A1TA 2ODAA 3TLAA 4AW9A 3L7AA 4IO1A 2YICA 3IB6A 4DSTA 4DZTA 2DTDA 3RRZA 1G3MA 3EFOB 1U02A 4GKAA 1UKBA 1E1MA 1FFWA 1NVDA 1SUPA 2HSDA 3NJ4A 1QKJA 4H60A 4TRNA 4UBLA 4AMYA 2B1IA 2RB4A 1MAUA 3LZ6A 4OHKA 3MW8A 3FOEC 3Q6NA 4A2CA 1ST3A 1ULTA 1NBME 5HF6A 1CZRA 1YJAA 1G0OA 1S1CA 1FUEA 3R40A 4KGDA 2ID4A 4L73A 5E7MA 4D42A 1N2CB 4YRKA 2PV0A 5CA0F 1T8PA 5KTNA 1S2NA 4Q9NA 1M1NA 3BGOS 3G59A 2AK3A 2Z5FA 4BGUA 4HLQB 4F6CA 3QHAA 4X8MA 4DPKA 3FOFC 3EXFA 3F5QA 2OTCA 1G63A 3IBFA 4LIPD 5D6OA 5CNIA 5A6SA 2P6NA 1K6EA 4RTSA 3PLNA 2FMKA 4QUJA 5JFGA 1JQL<