2Y9PB

Pex4p-pex22p mutant ii structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
KARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2-21 KDA
publication title Pex4P-Pex22P Structure
rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/transport protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11730 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y9pB00
2Y9PB 4BWFB 2Y9MB
chains in the Genus database with same CATH superfamily
4LGMA 3U60B 1Z5GA 2BR5A 3KT3A 3I9FA 4OA5A 3COPA 1PFUA 4XUCA 1UBHS 1WX1A 2PZFA 2YWFA 5BRAA 1L1EA 4RHUA 3BXOA 2OAP1 1E5XA 5KU1A 2VWQA 4MP3A 3HUEA 3Q6MA 4KO4S 3SC3A 4F5EA 3DO6A 4LE2A 5FAKA 1RKVA 1T24A 2H0AA 3EWIA 3KTFA 3L92A 3AVVA 1DTWA 2IZ0A 4GDMA 4R5HA 1BU5A 1HV8A 1FJGB 5EMLA 3R3JA 2LPMA 4KODA 3UA3A 2DHQA 3IPAA 3WX0A 5JAZA 4HF7A 2BLNA 3SVTA 3IMFA 1V16A 1UZNA 3EUWA 2GK6A 2D7JA 4RQAA 2EYUA 4MR8B 4N6GA 1GVHA 1BJRE 1TUEA 1Z8NA 2IS6A 8ABPA 4OHYA 2VJQA 3ZHXA 1OROA 5B3JC 1F6DA 4UVEA 1FFXA 4G0UA 1W73A 2W2LA 1QRRA 4Z4QA 4DXDA 3MTGA 4HDOB 1WZNA 1P44A 2BEJA 2Q50A 2X8AA 4OBXA 4QDZA 2XTAA 1AOXA 1XAHA 1XKLA 3LO8A 1AHNA 4HRVA 4WLFA 5TDHA 2PUBA 1A9OA 2ZPAA 3ZGXA 3ZY3A 4I9HA 3ZJUA 3DMRA 2IH4A 3FJYA 2PIAA 3ESAA 1Z4KA 5KDDA 3DBRA 1GILA 1EE2A 4H6PA 1AIPA 2YHIA 3G6WA 1ZCBA 3QUTA 5JMOA 5BR4A 4DJAA 1JEYB 5EIAA 3F2IA 3OCYA 2O5CA 3ZD6A 1M2OA 3CXUA 2PKWA 4GPBA 1PN3A 1DRVA 5F3RA 1U8ZA 2WUFA 4KGZA 1U7OA 1W5EA 4BEJA 2XH8A 1FW8A 2BW0A 2GDZA 3KYIB 4ZYWA 2D4HA 4AICA 2L0XA 1F8XA 4II7A 4B9EA 1O94D 2X3FA 2QZSA 3TMKA 5JNLA 3NM5A 5B7QA 3GLIA 3D31A 5F33A 1FVHA 1T36A 3E9QA 4PR3A 3GMIA 1SPBS 2VQFB 2BP7A 2ZJ3A 2J5BA 3DP7A 1IHOA 3TNJA 2P2CA 4BZXA 3Q3VA 5FQOA 4BGDA 2QP4A 3IEMA 2JJMA 4Q3DA 3WB2A 4KDCA 5JI3E 2EDAA 2PMWB 2PMFA 2QM8A 5ALHA 1PJTA 2I7VA 2HU2A 1FCJA 3ZWXA 4R16A 2NZUG 2YV2A 4KLNA 2I8AA 1YJAA 3E4DA 1U5CA 3KTAB 2Q9UA 3AT1A 4XX0A 1XRJA 4XIFA 2V3VA 3OOJA 4TLCA 2B9VA 3F2VA 3DP9A 4BYMA 3IDAA 3VPGA 1UMKA 2J6HA 3TNLA 1S1CA 3AR9A 3EVZA 3QMVA 1CHDA 2HR1A 1XQYA 1M0WA 2K87A 5DSTA 4XM2A 3NHWA 3BSWA 1RJ9A 4CL2A 1EWKA 5LZ9A 1HE3A 1AV7A 3T4UA 1A3CA 1G5QA 4MTLA 4ROSA 3I37X 1EM8A 2AQHA 4GL4A 3RJTA 1NAIA 1BGVA 1SXQA 3E5NA 1ZBQA 2HDOA 3TBHA 2FLVA 3QK7A 4B80A 2HN9A 3GB9A 5DRTA 4EGJA 1WQ3A 5A1TA 1AG9A 3PEEA 2R3SA 2X2OA 4IBOA 3VZQA 4EI9A 4BVJA 4E33A 4EB8A 1MW9X 1NQTA 1T3GA 2Q5FA 4CFSA 3L1JA 4P33A 1PYOA 4R69A 3PC7A 3DHVA 2AG0A 2D2IA 5DOZA 4CM9D 1R4ZA 1X8XA 5FTKA 1OB2A 3G9TA 1TTTA 3CW8X 4X7BA 3WBBA 1CUSA 2X19A 1O94A 3OPNA 4PC3A 5A4DA 4FCCA 3OU7A 4L9AA 4M98A 3KEQA 1ZNXA 2HLHA 1T5TA 1WCXA 2ZSJA 3GT4A 3IQHX 3JARB 4I9FA 3N75A 4KYIB 3MTBA 3FKQA 1DAIA 3LUBA 3RBVA 5WRFA 3STUA 5C81A 3VV3A 4EHHA 1JYSA 2XTJA 3JQRA 4TTJA 7MHTA 4UASA 3NRJA 1P4GA 3CF4G 3UFXA 2QGZA 4HAOA 3R7BA 1MC5A 1YCFA 2J0SA 1DPGA 1FU4A 1Z06A 1NV8A 4G65A 4X41A 5LP1A 1L6RA 5JS7A 2J33A 3HKDB 3RRBA 4FGUA 4YI5A 1W19A 2A86A 4KXLA 1RLOA 1HKUA 2CL7X 2P11A 2VP4A 4WEOA 3TCNA 4US2R 5EN4A 3ZOZA 3DKIA 3LP8A 1N2CB 3JAWA 1L7PA 4MI6A 1A96A 3QVLA 4D96A 4BCDA 4IJKA 5KO2A 4LHVA 3NT5A 3P5SA 4Q3OA 3DBHA 5E8JA 4ESHA 1C9YA 4DPKA 3K1ZA 3GBSA 1RLJA 1ZOPA 2AOTA 2INGX 3LV8A 1JHRA 4EJFA 1DAKA 1Z6PA 3MCVA 4CM8A 2JJ2D 1X2BA 4GC9A 4ZYXA 1JZQA 3DR5A 1TAGA 1RLTA 4RV5A 4CLRA 4N48A 1U8EA 1XNHA 1WXIA 1I7LA 2F1HA 3N53A 1IWPB 2BHNA 2NSLA 4YJGB 2CB9A 1PJCA 3Q1LA 1WULS 2XNSA 4M2LA 5J59A 3U31A 4OX9B 5CEJA 1WBBA 1YR1A 2WJVA 3L7CA 4IDEA 4BKUA 1CJCA 2PRZA 4RHYA 3NTOA 1C9DB 1ISRA 4BDSA 4HTFB 1EPUA 3V4LA 1YZQA 2AN4A 2PRIA 7REQA 1EFUA 5GJVC 5IANA 2ACEA 1T4CA 4RS3A 4NWIA 1XMJA 4LGCA 5ALWA 1XNRB 1LV8A 3MLBA 3EPRA 3OKFA 3O4GA 4RIIA 3P8ZA 1MZPA 1Y4UA 1MO3A 4YI3A 1A77A 1OFGA 1SUFA 4IDQA 1QPBA 3JZMA 4DNFA 3MMNA 4WV3A 4A27A 2R0QC 5CH5A 3QE2A 2QVBA 4ZCMA 2VSNA 4YGXB 1VPTA 4BMZA 2PUTA 3QLUC 5FOSA 1Q14A 1Z47A 1FUUA 4ZTBA 4OY3A 1BXRA 3AK4A 2F3QA 4QHSA 4UD6A 1OVMA 1A7AA 2VBCA 5LQNA 1I7PA 3VVMA 2BFEB 2BMJA 1SCDA 5M2QA 5DMHA 4CFYA 2CJWB 3DE4X 5FI3A 1FL9A 2Q4EA 2AJLI 2OD2A 3L7DA 5JSFA 2JCGA 5LOVA 1LS1A 2W2OA 4KFTA 3TEFA 4EH1A 4L4UA 1YZ3A 1YCGA 1PD1A 2JJ2A 3HXLA 1FA9A 2WTAA 4X24A 3ROXA 2AQ8A 5AR1A 1TB4A 1IY2A 2DWOA 2ZJ2A 3A4YA 3P20A 1RAIA 1KO1A 1KXZA 4M1SA 5K0BA 1DFGA 3IXLA 3O75A 3URMA 3K53A 2VJAA 4XJTA 4WNAA 2YQ5A 4I08A 1TVCA 1NU6A 3SIPA 1CRZA 1CR6A 2QTHA 1OKKD 4OG2A 1V8PA 5TQJA 3QVUA 1RMTA 1E5VA 1MG5A 3CINA 4II3A 4ZOLB 1HT3A 4KIWA 3AJEA 3OCUA 1QE0A 3RIEA 2VDMB 4HO1X 1R10A 2X9VA 2J4FA 3GPIA 4N65A 2ZJZA 5BSGA 2JDID 1P1KA 4K03A 4UNRA 3FNHA 4HQOA 2BBWA 3GY0A 3UMSA 1KC3A 5LXTB 3PHJA 4S1VA 4YT4A 4U2FA 2I87A 3N2ZB 1W4RA 2G8LA 3BHJA 4N8DA 1IK6A 3RODA 4LY9A 5I7SA 1J00A 4RA9A 1Y9AA 4C7KA 4JI8B 2OBFA 4I1VA 5CFNA 4JXZA 2BI7A 1JJVA 1WNFA 3BMNB 1S8FA 4ID3A 3EZYA 1VCHA 3F3MA 2O6LA 5GONB 2QLMA 2D5CA 3BB3A 4FJ0A 4U63A 4BC1A 4OUDB 5IUKC 1O08A 2ZYUX 2A9QA 3DE5X 1PR1A 4MUFA 4N7JA 3OA2A 2EQAA 1W59A 4NK4A 1J5EB 2J0EA 1XZIA 2VLBA 3PEFA 3KYJB 5D1HA 4IRMA 4IZHA 4D9GA 4ZXPA 3UOGA 4GRDA 5ESWA 1LPSA 2FETA 4MLDA 1N2EA 4AG6A 2QUKA 1QMGA 5KX5A 1M8PA 1QC5B 1VLZA 4X9XA 5EWLB 2GD6A 2BUBA 3D5TA 2VRCD 2W48A 1F2DA 4CMAA 4UTRA 3RAJA 5JVDA 1H8ED 1BWSA 3BEDA 3IUQA 5A03A 3OZTA 4CM7A 3FGPA 3KQSA 2XVYA 1OKKA 3LRTA 1Q57A 1N3YA 3B13B 1TD9A 4MQ4A 4RA6A 4LZWA 2BRUA 4H7PA 1VGVA 2ZE6A 1E0SA 4JUCA 3OC6A 3NWPA 2WG0A 4R2LA 4ZVRA 2JDIA 2QV7A 5LN1A 3MB8A 1Q1GA 5BN3A 2C2WA 4LOJA 3ZWWA 1E3WA 4Q4DA 4DBLC 3A6HA 3Q7RA 2FSUA 3O0DA 4W9MC 2UZ1B 2ZVPX 4A8JB 1Q77A 3OT1A 4XPIA 4C3UA 1RZRA 1TRHA 3TR0A 2FG6C 2EKLA 1DQSA 2OV4A 2PH1A 3AZPA 3QKRB 1Z63A 2OM6A 5IYZB 1T8PA 1Y34E 1ILWA 3GLHA 1HT1E 2FZVA 3BRQA 3RU2A 1E3JA 2IV3A 3A4NA 5JH7A 2OG2A 4E2WA 1UBSB 4N39A 2ZBQA 1G3RA 2BT4A 2EFEB 2OWEA 3KLPX 4GZ6A 3ZDQA 1E9EA 2YWGA 3BXHA 1GCUA 2P4SA 3GRFA 1T34A 1NP6A 4GECA 2UVDA 3CGGA 2AR7A 3SM3A 3EZFA 4J0KA 1ZJWA 1SGWA 4LV6A 4LZAA 1V3VA 1MB2A 2PKQP 2PXAA 2CLSA 3HYNA 3Q0IA 4HB4A 5E2BA 4PPQA 1U0FA 1SBYA 4Q1AA 3Q8MA 1X80B 2R6ZA 1H8EA 4UM9B 1U4NA 5HCUA 5TPWA 3V7NA 4DILA 2UKDA 3HR7A 3UJPA 2V8BA 5AVTA 1XP8A 2EG9A 2ISSD 3K4PA 4HDKB 4O0LA 4OIMA 2VYFA 3DOOA 3GWGA 3LXUX 3HCAA 2B98A 2WTNA 3GLFB 2QJRA 2CVZA 3GFFA 3HJNA 3M6FA 2CC2A 3I28A 4KRGA 4F1JA 3L01A 1CJSA 3PUYA 4TXLA 4DDUA 1NBWB 1YJBA 1X92A 5F7JA 1OX6A 3IVMA 2O23A 2YQZA 1XDUA 2IOFA 3S1SA 2MDTA 1SBQA 3GAFA 3JWEA 3K92A 2GASA 3Q5EA 3QA3E 3VC2A 1BE6A 4IR7A 4L0QA 3N07A 1XTRA 1CZHA 1JSLA 3CUVA 5REQB 5LYJA 3TVYA 3W4KA 3M6UA 3S70A 1NPDA 2AYYA 2D1SA 1GG2A 4PFJA 2NO1A 1VIDA 4INJA 5C32A 2Y9MB 3FE2A 3TSYA 1RNLA 3NWOA 2CNOA 5DO9A 4AJNA 1H6AA 3RS3A 4JCOA 3NWEA 2XCTB 1TYDE 3SQNA 1YACA 1D1PA 4ZJPA 3Q8LA 3MXOA 2IQ5A 4DDVA 3WFIA 4DBZA 3C3WA 3EIFA 4D9NA 3QFRA 2AXNA 2DP4E 4KIJA 5AW7A 3RC3A 3TVTA 5DTIA 1X8LA 4M9QA 4CKZA 4Q05A 4UBKA 2ATXA 1X19A 3WRXC 1BU8A 1PJZA 5DHRA 4BJ5A 2AGVA 3KT6A 5LIPA 4ZRDA 4I5GA 3RRZA 4E4TA 1U0TA 2DERA 2BFCB 2D2FA 1PV4A 1X1RA 4F6CA 2C8VA 2CYBA 2NXEA 3OX4A 5BORA 1L5WA 1ZCFA 2VPYA 3DZCA 4BAZA 2OXTA 1NU8A 3R23A 1FUEA 1JUDA 4DGQA 4Q03A 2F8TA 4E0BA 2OA0A 1G9XA 4CKYA 1YZTA 2BGRA 1GYRA 5CLFA 4N7BA 2EAUA 3W2GA 3GEBA 4DR6B 2KX7A 2Z0MA 3QELA 1NJ2A 4GPZA 5KSOA 5IKPA 1U9IC 2BEWB 5AI4A 1HMPA 2BMAA 2G9NA 3ZXXA 5CDGA 1PQ4A 1Z34A 3VPBA 2V7VA 1JKXA 3R41A 3K6SA 2ATVA 4B4DA 5IJ9A 2GWRA 2F9LA 2VYQA 1EGVB 2NZYA 2CLHB 1MXHA 2LE0A 1CKEA 5C7LO 2DVMA 1ISPA 1PGNA 4E6PA 4G5SA 2FJ0A 1AKWA 3GFPA 3JZIA 3UJ8A 1Z5VA 4WY8A 3SNKA 3UJHA 1CR0A 4EJ0A 1ST3A 3DMTC 5D86A 2AZXA 4BEWA 3E5HA 4HFJA 5B2EA 1N6IA 1OJLA 3I52A 4AZ0A 5B7PA 4PBTA 3H17A 2GKOA 1WOYA 2QAGC 4EGCB 3M4JA 1K5PA 4WLVA 4B44A 4BMCA 2XMZA 3K72B 1ZGGA 4PYLA 2VQ6A 4ETNA 5TS2A 1GL3A 1UJMA 3I76A 1UKVY 3PFNA 3H2IA 1WTAA 3FFBA 2LKDA 2A14A 3U3OA 1I5OA 2V3CC 3S1LA 3ZHYA 3ZS9A 4BFUA 1ZRSA 2WTUA 4YR7A 5L3QB 4HGQA 1F1JA 1GU7A 3ZCXA 4HXFB 4ZOQI 3UHOA 5C7IO 1AO0A 3T1OA 2VDUE 3DOCA 3QPDA 2YCBA 5KYGA 4IIHA 3KJZA 2GZDA 2V9PA 4GRIA 1P1RA 3BF8A 2QOEA 3FKSD 4WFQA 1ZD4A 4I50B 1TMKA 2VAMA 4C9BA 1E2UA 3PITA 5F5XA 4OQEA 3HDYA 4KQFA 1T9KA 3ZC3A 4QC2A 4MIOA 1XR3A 3P4YA 1PJAA 1E3QA 3FA2A 4FGWA 4HPXB 1ZHHA 5G41A 4OVKA 3WFZA 2G0NA 4XKJA 3JQFA 3MWEB 1P0IA 4TZKA 4XA8A 1P61B 3BXPA 2HMTA 1AE1A 2QNBA 3UPUA 5FULA 2YVAA 3QY0A 4BN4A 1TJ3A 3DVRX 1B8NA 4PZAA 2GF9A 1D1TA 1YFZA 2NM0A 5HDQA 2DCUA 3TQOA 5BNWA 2CMDA 3E1SA 5DGCA 1KK1A 1M6YA 3ZDEA 1VM6A 3PNMA 1I4LD 3DMNA 4PHHA 3QE9Y 3ZE6A 4BRSA 3O1LA 2XUPA 4MJLA 5A71A 2V3WA 5CVVA 4MKZA 5DNWA 2ST1A 3CLHA 4MUAA 1BQEA 3U37A 2DZDA 1NMSA 2HHCA 3L8DA 2WM9B 2EWVA 2ETXA 2B3TA 2D74A 3ZJTA 1L3BA 5CIYA 3V4PB 1KKMA 4DA6A 1NHGA 1UCFA 4EYQA 1OLUA 5FA6A 2PSJA 5HOEA 2EU8A 2HA6A 1YOBA 3UUGA 3DLIA 2G76A 2R97A 3V8MA 1AK1A 2BL4A 5I9TA 3GLIE 4OGKA 3SQWA 3SR4A 4KFUA 2XY4A 4FMDB 4F2DA 5AM3A 1TAUA 3O90A 1QOPB 1JS1X 3FKSA 1ABEA 2FSSA 3MJVA 3M6LA 1VIMA 3O3CA 3R4VA 5TNXA 2DBVO 4MV0A 3U7QA 2OQIA 1FLDA 3ZWNA 4D3DA 4MMYB 2COEA 3H19A 1PDWA 3G0GA 1YK1A 1PHRA 2FWAA 3IBTA 4ND7A 4MIYA 2I1WA 4NFLA 2V7QD 3IVGA 2EOAA 5E9WA 3O82A 4GPIB 2ODNA 2YY5A 4S04A 1KFKB 4DR3B 3PP8A 1P2FA 5IT9A 1P39A 2FFRA 2ZSFA 4WK6A 2WFLB 5DEOA 4HNGA 5L3ZA 3CVUA 4II2A 3UM9A 4PQGA 4KPFC 1KMHB 2WQZA 2I29A 4WNIA 4ZMRA 2ZJ1A 4OMDA 4B82A 4GFDA 2V7XA 3KSBC 3M5PA 4J1TA 3DHEA 3FMGA 5JAPA 4JBHA 1U6KA 3W06A 1SZCA 1G6HA 5ALFA 4NP6A 3BORA 4QREA 5KVCA 4PR0A 1B0PA 3QM1A 4PFSA 3IHWA 1J23A 1MA3A 1SBHA 2HWYA 3NANA 2HQBA 3ESXA 4I5IA 1S01A 2WIJA 4OHUA 4UPVA 5EQDA 5TGDA 3TGWA 1Y5MA 3EODA 3TZQA 1BGXT 4PLWA 3GVPA 3SBXA 2NIPA 1BA3A 1MEOA 4EJSB 3BJIC 3GMDA 3B1ZA 3QOFA 1RAGA 4MB2A 4HFNA 4U6NA 1UJ2A 1DCTA 1IY1A 4MCAA 3DXYA 1A0OA 2XOKA 1XRPA 3L04A 3QXHA 4GR5A 3ICWA 4LJ4A 3RIMA 1FJHA 4B8YA 5E7IA 4B87A 4NQRA 1V6CA 4LVCA 5AO9A 4H7EA 2EFYA 3G89A 4WK0B 2FV8A 5AMXA 3WKEA 3U81A 2X41A 3RYFA 4DRXB 3BREA 4G0MA 3TRDA 5CFZA 2F48A 5HRAA 5LJLA 1FFCA 4FMBB 1W2HA 2V7QA 1FMTA 3GPBA 4YWHA 3H0KA 3DWFA 3IEKA 3OD5A 5AUOB 1ZN7A 3B6MA 4OKSA 2XB9A 3AUJB 3F6SA 1QJCA 2IOHA 2KYRA 1S8NA 2A30A 1SKUA 1RXYA 1W4CA 5KYUA 4A2QA 2AMJA 4RE5A 4BUJA 3HN2A 1XUOA 2R68A 10MHA 4GQBA 2H4ZA 3B7PA 3SS7X 1MOZA 3TZEA 2HM7A 1C30A 4I3HA 4BNJA 3DFZA 4DREA 4LJAA 2EQBA 4RMGA 1U2DA 4ZT4A 1CB7A 1CU1A 1M8JA 3N70A 1H94A 1MENA 2CMGA 2FSGA 1O9BA 3CEAA 1JSXA 3DONA 5HSGA 1XMVA 4A8HA 4ALKA 3DJFA 5KX5F 5LDDC 4EPVA 3QX3A 3R4CA 2GZAA 4XFJA 2OESA 5T67A 3WLAA 2FVYA 1P9OA 3W90A 3N7AA 5JVDF 1N5DA 2M6SA 5TT1A 3VX4A 2WABA 1QZTA 1EVQA 1QH8A 1L4BA 3KWLA 4AJJA 5EWJB 4XGIA 1P1JA 1QK5A 1MFPA 1CETA 1RHQA 3G2LA 5F7XA 3ZLJA 2Y0CA 2ZBEA 2IU0A 1GYPA 3K94A 3CXRA 4AUEA 2J48A 2D7CA 4FMPA 2JGMA 3DE2X 4L02A 3I23A 4XDYA 3TBKA 2QN6A 4YP1A 3GX1A 3I2JA 4OF4A 2FN4A 5AVRA 1GEEA 3UT6A 3TZHA 1J1IA 2J5XA 3E5MA 2QRKA 5K3OA 1XA3A 1G38A 2WKPA 4NYJQ 1R0XA 1S96A 3CTMA 4N4AA 2AD5A 2SKDA 4JUAA 3QX7A 1Q6YA 1K0FA 3HDTA 5L7YA 3HP1A 2ZWOA 2NV6A 4LDAA 1T15A 1JAYA 2LKCA 4MJXA 5SZHB 3AVTA 4GKKB 1CY6A 1XTJA 2RGEA 4GGPA 5FRDA 1ZIOA 5BYJA 4YHHB 1KP2A 5EXEA 2ZXFA 1CZRA 1PLLA 1JNYA 2O1XA 1YV9A 4G84A 3KOOA 4FUTA 3BD8A 2JGEA 2AK3A 2Q6TA 3UJ9A 3UMVA 5HR5A 4G3XA 4NC9A 4JMLA 3I5YA 4F5YA 2WSMA 1GQ2A 1ZMBA 3TVDA 4C5BA 1J97A 1PLJA 5I47A 4LYJA 4P5DA 1WXEA 5TPZD 2AX4A 5TLSA 4RTRA 4KP7A 5JMWA 1DG9A 1DXQA 5CLQA 3WK5A 3D3NA 2P6RA 5K3AA 2H57A 1VL1A 1IJBA 3PD1A 3NT4A 1W9MA 1G41A 1E7MA 2NXCA 1P9LA 3EXHB 1X8KA 3MRVA 3RJ9A 1QRSA 4JJ8A 2HAEA 1DJNA 3CPJB 4TWZA 4EF4A 2FPGA 1I6MA 5JDIC 1ONSA 1KDZA 4KQHA 1M8GA 3VHRA 1VE3A 3NHZA 1Y7HA 2XBUA 3E18A 1OE0A 1CQJB 1X2EA 1N3BA 5L3RA 4TXMA 4KLAA 4YGYA 1B1AA 4JU9A 3PQ5A 1T10A 1SVIA 1PKEA 2GN0A 2NU9A 1NW9B 4BP1A 1NF8A 3FRHA 3LDFA 3BERA 6REQB 3BFVA 2HX1A 5DWDA 4DA4A 3P2YA 2FLWA 3PKJA 3OEHA 1RAFA 1T2DA 3DBOB 1CZUA 1Y3FE 3GK3A 1OT3A 4D8WA 2A5JA 2H0RA 4FOPA 4QGFA 1TMYA 1F0NA 1XCLA 2GPBA 2GS9A 3QWHA 4Z7QB 3AUXA 5TR9A 4DSUA 5LYJF 2ARKA 4GSLA 3RT7A 2IS1A 1LBEA 1CP3A 1PEAA 5CP8A 4P4TA 5GTDA 3O6VA 2PIDA 1SHKA 3CF0A 2P3LA 4RF5A 2XNJA 3T5BA 1UPBA 3NMUF 1S7GA 1Y4AE 3CH4B 4RK6A 1NN5A 2OP1A 1KIMA 1IOWA 2V7EA 4MQMA 3V55A 2DAPA 3MS4A 3WV5A 4DIFA 4CFZA 3L2OB 1GPDG 3MJFA 2MMGA 1QGUB 2HV8A 2OCYC 1VJCA 1WM1A 1N9GB 1S02A 3NOVA 1EYZA 3LT5A 1QANA 4PN3A 1A9XB 4PGAA 3EVCA 3CNLA 1QCZA 5AH0A 1W1WA 2R48A 2XB2A 2JI7A 2VPZA 4KJZA 1GNQA 1OGIA 1CUGA 4WXPA 3TFQA 5FTMA 1S7CA 4JB8A 1M72A 1BCSB 1I1NA 4H1WA 3HYRA 4LN1A 2CEKA 3D54D 3M3HA 3DCNA 3K96A 2YS6A 4O5OA 5HGXA 5IEJA 1W5TA 2BE9A 4ZVUA 1X7XA 2QL6A 2PPLA 3IAM6 1MU0A 2G9ZA 3NAMA 3SZUA 3V1TC 1I4EB 4AKIA 4D02A 1ISJA 3ZI4A 4M0DA 2X6RA 4E94A 2HFKA 3WJAA 1X9IA 3DS8A 2O20A 3BWVA 4M9CA 2YFYA 4ZAWA 1L8AA 5K0NA 4DA0A 3EIWA 4O33A 3X1KA 4LDJA 2WF6A 3U3MA 5IM4F 5L51A 4I1SA 4KB5A 1WPGA 3OEYA 1N4AA 5AW3A 4CHTA 2MINA 1L3IA 3JQCA 5GZ6A 3H04A 2WHYA 4QAJA 2ZBPA 2V54A 4U0JA 1V2GA 4XVQA 3PGXA 4MGEA 5JS2A 3V2UA 3VOTA 1F20A 2IYRA 1KO8A 2AYXA 3IA7A 1TA9A 1ZRNA 4HN4B 4DXHA 4V2UA 1C0EA 3GLHE 1IN1A 3S7TA 4IGAA 1VSBA 2Q5JA 5BMOA 1LRLA 3NASA 4HQ0A 2UUBB 3FZNA 1WNTA 4XWKA 4YA6A 3SBEA 1H1LA 5FO0A 1XQWA 3VSEA 3PWTA 1RPTA 1U02A 1IQRA 3MGKA 4MVJM 4JFAA 3ROGA 1N0VC 3EUFA 3RTBA 1RSZA 2W4MA 5CJPA 3HY4A 2XUDA 2X7HA 3PKZA 1YS1X 2A0YA 3EIUA 1Z0IA 2E82A 3FZGA 1NJ6A 1NIJA 2J9FB 4ZMSA 1ESEA 4KFSA 4BVLA 3OPYA 1Z3IX 3PYMA 3V00A 4V0SA 1YNOA 1BKSB 3SEAA 2GLUA 2OV8A 1W93A 3K2EA 5JYBA 2XUGA 3NFYA 2IYYA 2C58A 2VNJA 4MQUA 1GZ7A 1UC4B 1H2ZA 2AKYA 3MAGA 4NFYA 5EXXA 5P21A 3KR1A 4K9LA 2CHFA 2WP0A 3SYLA 3Q9UA 2C8LA 3ACDA 4RIFA 1P3Y1 2ZRLA 4P31A 5CLGA 3RS2A 1YU9A 4BRZA 4BKOA 1QHIA 1PR9A 2B8WA 2K4MA 3DKVA 4QFMA 1KH1A 1QWOA 4JROA 3GL9A 4JBIA 3KSUA 2OGTA 1LY1A 1AA9A 1B74A 2JEZA 2YVKA 2AL7A 3D1VA 4D99A 4U7DA 1ZVMA 1G2OA 1H1TA 3OWXA 4FXPA 2P4QA 3EDQA 1RAHA 4I4CA 4UAUA 3IAEA 1WMAA 5ER6A 5FBRB 4DABA 1J7KA 2D0OB 2H1HA 4HWTA 1SCKA 2QYSA 4FDTA 3HUFA 4IW3B 3IYLW 2ATEA 2WW8A 3ESDA 2OORA 5J4HA 4Q7KA 5A62A 1CT9A 1JL3A 1X0XA 3FNEA 4K81B 2DWCA 4BN0A 4JJ6A 5ICGA 1VB3A 1E99A 4LXGA 2O5RA 3DF9A 3PK0A 5CFPA 5DHPA 1M8KA 3VR4H 5FPYA 2XWQA 3WFJA 5JPCA 3L1KA 1XCJA 2O57A 4L9RA 4MPTA 1ARZA 2JCVA 2PH3A 3C5EA 3LW8A 1IE3A 3O1HB 1QGZA 1YQTA 1Y8RB 3O8DA 1TT5B 4CV2A 1JFSA 1MC4A 2P4UA 3WGJA 5JIBA 3K09C 3OURA 3WKCA 2WDZA 3QVKA 2DLDA 1M54A 2IIPA 3S68A 4BWGA 4U2EA 5K6AA 3OE7D 4EB3A 1XWFA 2OOSA 5AXCA 1BNCA 3SJZA 4Q9HA 2VCYA 5A02A 1TCAA 2ZK7A 4G5RA 3PHIA 4KJXA 2Q7XA 1IJKA 1D2MA 2MSNA 3D81A 4IXMA 4BKRA 4C2TA 2BAGA 3GNSA 5DMXA 1XROA 3FYUC 4BQFA 2P8JA 1V26A 1XQ6A 2B1JA 3AM5A 2GRUA 3B1WA 3MT9A 3TUJC 1Z62A 2F55A 1RHMA 4EUFA 4JOQA 3TJRA 1HQKA 2J85A 1VSVA 3GHHA 4EPWA 4MQFA 3THYB 4M7PA 4N3NA 1OB5A 4YS6A 3CLUC 1KGDA 4H3KB 3A27A 4BV2A 2FUCA 5JHHB 2D2XA 3GW8A 2X4GA 3CJQA 2BBOA 3O4IA 3H5WA 3WE7A 3ZV4A 5ESDA 1XF9A 1XZKA 4AM8A 3SZ3A 5K8CA 2ZUEA 3C5VA 3SGLA 4AN1A 3LUFA 4JR2A 2PYDA 4YMWA 2R00A 1ECBA 4TWJA 5IM5A 5SZIA 4HFMA 3UCFA 1RR6A 4ZVLA 1ISIA 2JHGA 1IN7A 1P6QA 1R6AA 4MW6A 3LQFA 4G2TA 3PX7A 4Q1BA 5U4XA 3DOFA 4XXHA 1BE8A 1ZRMA 3MHTA 3LVFO 5JI2E 2FPKA 2Z6VA 1COZA 4MCIA 5G40A 3ZUPA 5ETJA 3RVRA 4DUZB 1KVQA 1GAEO 1GNSA 1EFPB 1II0A 3PNSA 4GWGA 5JDCA 2J45A 3L0DA 4PPFA 3S5JA 3TJMA 1XTKA 2V0NA 1MN6A 4XGRA 1AKYA 4BVEA 1DT5A 2JJ1D 5KSPA 1KRXA 4MW4A 5LMUB 3GLVA 4HAIA 3DAGA 4LBWA 3EFOA 2R47A 2DCMA 1R5NA 4MV3A 3OE7A 3H5LA 3QUQA 4JLJA 1ZM3A 1KNXA 1P7PA 2EF0A 5AK3A 4B84A 1G5TA 2CFIA 5LPNA 3CZMA 4CDRA 2MR6A 2V97A 2ZE8A 3FMIA 2RJOA 3HCEA 4QSMA 4REMA 4N6OA 1CUUA 1H6BA 2E4YA 4FMCF 1XJQA 3FI0A 4NYMR 4RWEA 2JGIA 3CX8A 3QWBA 4L6AA 1E1KA 3D7MA 1DV1A 4BP8A 1PUXA 5BN5A 2X8LA 2OXFA 1U5AA 3DOJA 5DHSA 4LE1A 4G1CA 5CNJA 3DUWA 4L8YA 1RC1A 3S81A 1BX3A 1FPMA 4KO2S 4L85A 1GLVA 2WF8A 2OBLA 4EI7A 1Y4ZA 3EVEA 1NXVA 1XDSA 2Y1GA 2ZRIA 4NBUA 4M1TA 2XWSA 3OOHA 4UUBA 5FB3A 5IBQA 5SICE 5BOSA 5BSKA 1YRQA 3N3AC 4YRGA 3PE3A 1TFUA 1HE4A 2NZXA 3VSDA 2Q5IA 3CRRA 4L28A 3T41A 2GXUA 3PI7A 4DCTA 1SNYA 2HPAA 4KQMA 221PA 1TC1A 5F7ZA 5A5GA 2JJ1A 1U0GA 1VLQA 1VYVA 2R7AA 4PEVA 1J21A 2GAOA 4QHYA 1T4MA 3R74A 4PAWA 4O25A 4QPNA 5BWNA 5BYAA 4OHCA 1EXNA 1SXJC 5EEGA 3IEUA 2DWPA 4YREA 1NXXA 3CEMA 3OZEA 5T4HA 1ISHA 1V6AA 1JG7A 2ZR8A 1KAEA 3CRQA 4BMVA 4RDHA 2X7XA 1AKNA 2ZWVA 1QYDA 2YMLA 1A95A 3H4TA 3NGXA 5GJCA 4H7DA 1LB1B 2XNDA 4XYLA 2VHZA 4AY2A 3OQIA 3VZPA 5DM2A 4NTZA 1RW4A 3ZCSA 4BP3A 1WMBA 3GCDA 4BE4A 2RCNA 3QXGA 5T5QA 3Q8WA 4IFEA 1NR7A 4FYIA 1K7SN 3UYLA 1NG1A 1Q5PA 1WTCA 2QPOA 4UHBA 5EHQA 3KO8A 5C4GB 3R9KA 3WDLA 1RWXA 2E1RA 1ZH2A 1ZITA 3MMXA 4KSBA 1VBFA 2X7JA 3OFND 2G9VA 4PZLA 3ZJ5A 1SU7A 3BE5A 1MRSA 1NZDA 1SBCA 4UHKA 5JLJA 1G63A 1II9A 1GLGA 1ISGA 4WMLA 5LA6B 1RYEA 4YAOA 3CIFA 1AUQA 3EFHA 1EP3B 3NIDB 2HNKA 1M1NB 2ZJ0A 4NQZA 4MPPA 5DCYA 3MTEA 1UJ6A 2Z6AA 3BWCA 5DVZA 3I61A 2X2FA 2QY6A 2PQMA 2AMYA 1J1ZA 4ZWNA 3DPSA 3ND6A 5BSUA 3KLOA 4CMBA 4FS3A 5GJBA 3HS3A 2VUIB 1KI8A 1YS7A 4LOHA 4PHTA 4A1FA 2HPZA 3RIYA 3OMLA 4P32A 2NU6A 2PMEA 5IDQA 2PZJA 2JKVA 2JBWA 5JCXA 1I6LA 1XQ1A 3GD5A 3M3PA 5LC1A 4OKIA 2WVJA 2C1EA 4YJFA 4UC0A 4WESA 2P6UA 5CB4B 3DBLA 5EHGA 3F6PA 4E32A 2QXTA 4DMRA 4N5MA 4OB8A 1UXIA 3C6XA 3R9XA 2EW1A 3U13A 4LGYA 2Y4NA 2JVIA 1J99A 3GVCA 1T8UA 2VPIA 1JA0A 4TMTA 2WZCA 2ZTSA 4WFIA 2ERCA 1F06A 2VOEA 2WSYB 5IARA 4BAGA 4WTOA 2R751 2HA2A 1JT9A 5P8WA 4R71A 2QE7D 3G2KA 4CIXA 1L4YA 2ID7A 3OFNA 2FW7A 4JLOA 5IVIA 3E2PA 3L6UA 2CGEA 2I62A 3BIFA 4HH4A 4PLPA 2A5FA 2C2HA 3I12A 4L5AA 3QVJA 1PZNA 2GN1A 2PGOA 2VPTA 1JR2A 1KVUA 1BDJA 2PWAA 2PLRA 2QMZA 3A37A 3FCAA 3INYA 3N0TA 3DEIA 1BVRA 4LCEA 1JQKA 1T8RA 1OLXA 4NZZA 4ZCSA 3TDKA 1E58A 5EKXA 1Q6ZA 3ZD7A 2H8GA 4I8IA 5A9SB 1UBRS 4BMDA 3RYIB 4KL8S 2PJUA 1KEZA 3OY2A 4BLSA 1P1IA 3CN7A 3WICA 3DV2A 1EFDN 3SFVA 2GJKA 4N82A 4WFJA 2GLTA 3N7UA 1KS2A 2Y1FA 3LCRA 3MN1A 1PZGA 2Z8YA 2D13A 4YDRA 1VGQA 4ZV9A 3HSKA 2B8NA 4FT4A 2F90A 5L4LA 3IP6A 3AW9A 1A88A 3OQ1A 4FB4A 2XB8A 4QU0A 4HUTA 3C70A 1NI3A 1CS0A 1UC8A 1X1CA 4OHZA 1PJRA 2D0IA 2CXTA 1IG0A 2XX3A 3SC6A 5JSZA 1UP7A 1RYNA 2XUOA 3WGOA 2WG1A 4LKOA 4KQJA 1P73A 5K0TA 4L07A 3C4VA 4Y3UA 1GGKA 4FNAA 4AS1A 3MTAA 1JNXX 5KTYA 1E2PA 2V74B 1UAAA 2XA2A 1GEGA 4K6GA 1XLWA 1JP7A 2CJFA 1TYBE 3ND9A 3DNMA 2OMEA 2AC4A 1Z45A 2QE7A 2C95A 4JVLA 5FL7D 4BNHA 3PHCA 1NG9A 1G6KA 2BFMA 4S1TA 4EB6A 2W2XA 3PVSA 1T0JB 2NYRA 3B3GA 1E1RA 2I6UA 1CEQA 2DF8A 2I2XB 2NSJA 2QQGA 2ZLBA 3IIIA 4ZU3A 4ZCRA 4X1KA 1RRVA 1RMYA 4RV9A 1TJ4A 2B4YA 3NUGA 1N6HA 4YAFA 5HE9A 1XYGA 1NGSA 4QG3A 3UAGA 1OY1A 3TDMA 3QFHA 2XF8A 3JAMA 3NJ4A 2FMFA 2M2IA 2ADMA 3GDHA 3UWOA 2WQ7A 3GJ7A 3O83A 3JRWA 1PG2A 4BVHA 2CXSA 2H7CA 5B5SA 2PLWA 4ZKDA 1NBAA 4FNGA 1BD4A 2WM2A 4E5DA 2NYUA 3PDHA 5KQPA 1ZVQA 3FX2A 2HRZA 3U40A 2E89A 3GFQA 4NLLA 1Y37A 4NPAA 1HZZC 3WXMA 1PSDA 1OILA 4DFDA 5MF6A 1FLAA 2V58A 3KSDO 5ICEA 4TUYA 2QX7A 1E89A 1FTQA 1XWIA 2QKYA 1EBUA 2WHXA 3I45A 4HNRA 4K8OA 4PZ9A 3KPYA 1GLNA 3CE6A 3WLQA 3AFGA 4EQ6A 2PMBA 1X9HA 3GPCA 5DBFA 5JASA 3N6XA 2C8KA 3DGEC 1VXOA 4MICA 1LBTA 3SYRA 1JJIA 1T3TA 1I0LA 2QBYB 2EJTA 3CBGA 2PH7A 4HVTA 1JJ7A 4IHQA 2W2VA 3LUGA 1L7NA 4K8RB 2H5JA 5SYMA 1KZGB 2YASA 2QN7A 1ZGAA 1Q91A 2GI4A 3LFUA 4OGWA 5B37A 1HE1C 4DYDA 4AUNA 1IRIA 1P3JA 1RHJA 1Y8AA 1D9ZA 2F1KA 2GCOB 2W2NA 3ACCA 5DYTA 3SJAA 4EFDA 5FL7A 5GVSA 4XYGA 1WE2A 5FBHA 3TPCA 3CZRA 3I6QA 3R0QA 3VH1A 3OKCA 4MR7B 1J2TA 1AJEA 4TT3A 4EFMA 3KJHA 2IKQA 1JYFA 3AVQA 3S1AB 4N5HX 3K8OE 4BE7B 3R8CA 3KJNA 1T0PA 5HK8A 2J3JA 3GJ5A 1J2EA 3L0CA 4DL9A 3AUYA 1XB2A 2Z8ZA 3E58A 1XZMA 2BMDA 4DVJA 1T8YA 2LCFA 3O1JC 4DWVA 1LWOA 5IAEA 5LQSA 3RFFA 4XEHA 1RI4A 2JLXA 3QWFA 4Q00A 4TS4A 4UUPA 2CLCX 3LG2A 4IOLA 3PPWA 5JR3A 2OO5A 2BDUA 4HX9A 4EA9A 4HKTA 4FD3A 4GBJA 1KPIA 4DNOA 2B2XA 4W5RA 4UBMA 2GJ9A 4Q16A 3CH6A 3PPXA 3L8HA 1Y33E 3WGUA 4E07A 1I7SB 1QFMA 2IYNA 3SDSA 2VO1A 2A7QA 5B6JA 3MIZA 3A6GA 4IY1A 4DCPA 2MJLA 1UK9A 3ISJA 3DV0A 5J63A 4C4XA 4IL5A 2QEQA 4NBSA 2ZRKA 4U7HA 1SR8A 3U44A 4Q1VA 4Q3CA 1ZKDA 2MWMA 2ZTLA 5KPJA 3KL2A 1GGFA 1JEOA 2VCHA 2ZR7A 1OQAA 3LDAA 4GOMD 4R7ZA 4UZSA 2FN8A 4J3NA 2B2CA 3SYKA 3H5IA 2MHCA 3V4ZA 4XFKA 4Z1MA 5J2TB 4ECEA 2NGRA 2GAAA 1IULA 4K9OA 5FXMA 2OPBA 1B6TA 3DMDA 3V3KA 3GG9A 4QWWA 4X0EA 1PW7A 5K3BA 2RBGA 3AL3A 4E5MA 2HBYA 4FR5A 5EE9A 5BNFA 4X7PA 1KORA 1YB6A 2GM5A 2XE7A 4HZGA 4ZCQA 2XE4A 4RAQA 1L5GB 3W8RA 5E6RA 5BR7A 1VCOA 3O1IC 1EXDA 2JI9A 5FJJA 4ZVPA 2YXBA 2I6GA 1A5SB 1N6RA 1XDBA 2ZI6A 5JSKA 2NU8B 4RGYA 3OZGA 4TVOA 2H48A 4ERXA 3JQQA 1JDJA 4TL8A 1JEDA 4Q9JA 4UVGA 4Z8XA 3G68A 4NHEA 5K3FB 4EATA 2Q1UA 4FLEA 2WZBA 1NASA 3RI3A 5LUBA 5KKNB 1RXWA 2YWDA 1MPTA 4M49A 3PJFA 5LKRA 4FEGA 4MW2A 4KQ2A 1KU6A 3ROFA 1NW6A 1H1DA 1NM5A 1TIKA 5FV4A 1QH1A 3IAUA 1E64A 3C8HA 3TKYA 3DQQA 2ZCUA 3H1PA 3LCCA 4PIPA 4B4OA 1TTPB 4EG4A 2YNMC 5EJ4A 2K7ZA 1XDGA 2H5IA 4G8DA 3EOBI 1OVGA 1J39A 1E3MA 3NYRA 2PLFA 1SHTX 2H1WA 1VG8A 4LWZA 1QIFA 4V3BA 1PX2A 1PGQA 2ZJOA 3D2AA 2ZJBA 2GHRA 3BGSA 4WZBB 5SY4A 3EGWA 3LT4A 1M0SA 1TU4A 4IV8A 1JQAA 2QX4A 3AHGA 3LFHA 4L76A 1RRKA 4HADA 4RYDA 1AGNA 3AL2A 3ESZA 3VBEA 1H4TA 4TVKA 1FMJA 3A1EA 4X71A 3PTLA 4RHCA 4B4UA 4PHFA 2JASA 4NPHA 4OQQA 2PKEA 3DXZA 3W8FA 4OXRA 4J2OA 3WKDA 1KVSA 3IULA 3NHFA 3O8NA 3VR3A 1Q19A 5KSZA 4A5SA 1LNSA 4BECA 1JLHA 2EZ8A 2VTDA 4WGFA 4A16A 3M2TA 3UAVA 4PTLA 2VWPA 2GWHA 4AS3A 1UT5A 3GARA 2OHHA 1P0QA 2SCUB 4RZIA 1XZHA 3R3VA 4D0SA 2QLBA 4UU1A 1D8TA 3SG0A 1FSGA 2XOEA 3JASA 4NFHA 4YP5A 2Q4BA 3EGDA 2DBRA 4Y9UA 4J29A 4URFA 3EGEA 2FMKA 1QHXA 1UMDB 2I4RA 5DTRA 3TZKA 3LSTA 1W8IA 4FI3C 4RQBA 2WD7A 3C41J 1GKKA 4L0CA 4ZXFA 3FJOA 3D1LA 2FUG6 4ZOEA 4AJKA 2FZEA 1P81A 3CNQS 1N0IA 3EHEA 1QCCA 1WF3A 3JD2A 1K3TA 5K9ZA 4XWGA 1QIDA 5IC6A 2HF9A 3WV4A 2JVKA 3G9ZA 1IN5A 2VTBA 4H35A 4MS1A 2Q1YA 3WYCA 3BYZA 2VZLA 4P82A 5AKIA 4CQJA 2E2WA 1AHIA 4G0OA 2FP4A 3IGFA 3E1GA 2ZU0C 3OKPA 1V8BA 5TT0A 1AF7A 3ENWA 2ZJAA 2FEPA 3F3SA 2GTIA 4O2BA 4NULA 2VF5X 1RYFA 2VPPA 4LJKA 5K09A 4TTAA 4G5HA 4GP6A 4HN9A 5DHAA 1DAFA 3VU1A 3JV7A 4Q1DA 4FSDA 3V8EA 3TF5A 4J16A 5CLHA 3D43A 4DQKA 3E05A 3L43A 3AY7A 4TXHA 3GYBA 3AP1A 3ZHTA 2RHBA 2HIMA 4ERNA 5C18A 2JH9A 4HWKA 5LWHA 3I0NA 4RDCA 4Z49A 3C7DB 4AMYA 2PS9A 1I2BA 3GCGA 2ESRA 4OYRA 1BMTA 3AUAA 3N2GA 5FPTA 2FZ5A 1X15A 2NYVA 4ZCIA 3PNBA 5E4YA 4Q3NA 4EKDA 1Y7LA 5EKSA 2R8EA 2BEUA 4JBGA 4R41A 3NV9A 3UUEA 3LBFA 3JXEA 3EJWA 4A0SA 4BLOA 5L8VA 4NCHA 3UMCA 2Q3JA 5CTJA 5F23A 2H2GA 4C0WA 3FLBA 2IX3A 4KQ6A 5FWYB 4I99A 2UXBB 1E1CA 3NIFB 1Y6FA 2G3YA 1DI0A 2GEVA 3DHYA 3F9RA 1RPJA 4QRHA 3RTAA 3EZ9A 4BL5A 3EVNA 5TIIA 4RORA 5IFKA 1NVVQ 3VR2A 2FEAA 3EMVA 1EWVA 1YS4A 1YI0A 3WTCA 1YIDA 1KI2A 1U8FO 2DHEA 3SX2A 2BVNA 1ZU4A 3RHFA 3UK7A 3IJPA 1AO3A 1PJ2A 4ZI5A 1MIHA 1CZNA 3NAQA 2JHFA 1WCIB 2A57A 1E0DA 1OGYA 3E9CA 1LSSA 2X5XA 2IV7A 2GZSA 1F12A 2JANA 1L4EA 2JFYA 2J30A 2NYAA 3HB1A 4PG7A 4ZQBA 3FPEA 4ZEMA 3VYRB 1K2WA 4FOLA 4ARBA 2ASVA 1DIAA 1EP9A 1HC7A 2N42A 5HF5A 2R4UA 2HDNB 1D4AA 1KOLA 3PQFA 2OBNA 4R9RA 3RFUA 3I64A 2UVPB 1DP4A 4GI7A 3CSDA 1R6TA 2Q6KA 5HZHA 4IRXA 4DLPA 3AUTA 4BJ3A 5CW2A 2P69A 5DFAA 1QGED 3RUPA 3KT0A 2BGTA 4RQTA 3K8YA 3I34X 3JQEA 3L82B 3QLEA 4JC8A 5U9CA 1U0BB 4BJHB 1ZHFA 1WXDA 4G9BA 5FOWA 5I8PA 3UPTA 3KLBA 3EG9A 5BT8A 5JYEA 5BQFA 1Q16A 4L6IA 2PTHA 5ADHA 3ML1A 1ZVVA 1IPFA 1PDOA 1KSHA 4FPXA 3DTVD 2V6IA 2GBLA 3BK1A 1UFKA 2WJZB 1UMCA 1IZ0A 4DCVA 1U0EA 4EA6A 7YASA 2Z6UA 2G9UA 1XU9A 5FR2A 1UKBA 4HG2A 1RM3A 2PRKA 3GMTA 4Q21A 1M2VA 4MA4A 1F6WA 2BONA 3FZEA 4RIGA 5HF9A 1W8DA 2VYVD 2BYTA 3E82A 4BZWA 5I7UA 1DGQA 1FYWA 4LHYA 3TK1A 2M6KA 1LNZA 2WBLC 4XGQA 4JI3B 2W6QA 2YIDA 1BRTA 3C6MA 4LHXA 4ND5A 4P0PB 2FPUA 3GEDA 1NQXA 2Z30A 3QHQA 5DP1A 5CXUA 3KQLA 2VUHB 1O89A 3FGZA 4IUYA 3RHTA 4CDMA 3BAZA 4H31A 4WIAA 5EGSA 4CMCA 4FKMA 3CLSC 4Q1CA 1Z39A 5F21A 3D59A 3JYHA 4F7WA 2PT9A 3V4OA 4EG7A 2P7HA 4C4YA 3KJQA 5KDLA 4DZZA 4AJOA 1JTEA 1LF0A 1B2RA 4R1LA 1X1DA 5IS2A 1PL6A 1TLFA 3MCUA 4LC0A 1T1SA 2G5GX 3STTA 4DCGA 1SIUA 2J9YB 1UOOA 1THTA 2XECA 1YU6A 1LGYA 1NQAO 2REQA 1SA0A 3UWSA 1MPXA 4CODB 4ZD6A 4TYQA 4HNAA 4FGLA 1OFVA 1NTRA 1SZJG 5TGTA 1IK4A 2ZVQX 4A3SA 2VT3A 2JARA 1GAJA 1FFXB 3L8EA 4KVFA 4LECA 4ZVOA 1BQ3A 1L4GA 1OZGA 3NBFA 3JQ8A 4E2ZA 4TUYF 4UBIA 5JQGA 2GUGA 1DIGA 3D3KA 4KCGA 4KQEA 4NDZA 5EE0A 3BHMA 5BVGA 4N9QA 5TF4A 3X3HA 3CX6A 4UFNA 1DB3A 1HFWA 1CWUA 2IPNA 2C00A 4KPUB 4MCJA 4CMKA 3KQUA 1CUIA 4GNRA 1DX9A 2YHIB 3DKKA 1Y8QA 2FPSA 3H16A 1ZYUA 4NY1A 3R3SA 4XB1A 1S6YA 2IEGA 5B12A 1PK9A 2Y6VA 2VH1A 4YRNA 1YBVA 3CCBA 3LL4A 3A1TA 4EGQA 2WP8J 1PL0A 4FW8A 2X5JO 4TKMA 3H5AA 3RVLA 1TVKB 1Y3AA 2JCYA 2AI3A 3HBLA 3MK31 3P0JA 5BUZA 3H5TA 4IGEA 1NFFA 1C9NA 2G36A 3CNBA 4FYMA 4MIKA 4C06A 4L57A 4Z4EA 1R37A 4KVAA 2YL2A 3FFAA 4N7RA 1CUFA 3TE7A 3HK2A 4QJ4A 2WJHA 3D0KA 2WJAA 4IF4A 1DKNA 2JFQA 2ZIZA 4GZMA 3M6XA 2JZCA 1MZVA 2G6TA 2VJBA 2OV2A 3P4UA 4NZ9A 1IN8A 3RD5A 1SCAA 2ZR0A 4BUCA 4NXMB 4BLQA 3GZNA 5A4MS 4B6RA 3H0CA 4EHLA 2KW5A 4XX0B 2I7TA 3EVBA 5LMZA 1C4XA 1E2MA 2R8PA 4TROA 5F64A 5DNUA 5EXSA 1ID1A 4HQ6A 4O4LA 2FKAA 3RBAA 5JRDS 5IDVA 4ALLA 3O4HA 4HAYA 1MX9A 3A6DA 4YO7A 3OC0A 2UYQA 2Z2ZA 4NV0A 1EM8B 1E1MA 5B1DA 4UFPA 4UHHA 3KFXA 3QSGA 1MH1A 2DSNA 2XB6A 3FTPA 3OAAD 2FRVA 3PFCA 4RLSA 4U2CA 3U62A 1PEYA 1T9DA 2HKIA 1WPRA 4I5FA 4UAVA 4U7GA 5TVKA 1XHEA 2NVUB 4EY7A 3D4IA 2QX9A 3A4MA 4PPGA 4REOA 4IV0A 3ENKA 2AZMA 3BXGA 1HLFA 4U39A 4E15A 2BMVA 3VYSB 3AX6A 1EHCA 1NTOA 1Z22A 2FHPA 1H3EA 3LJKA 3COSA 4NBLA 4B2IA 1NBIA 1ORIA 1XLTC 1RQNA 1Q7GA 1Z4OA 3F74A 4DG9A 1WABA 1EZ4A 2HPVA 1P80A 5AIAA 4CT0A 4C07A 3EQ2A 1QS0B 3CF4A 2RIRA 4KXVA 4R1SA 4UCXA 4Y98A 3UMFA 1MX1A 2BLLA 2P2LA 1G0NA 3G1UA 3L7IA 3AWDA 4NE7A 4X97A 4YRQA 5C5DA 5LUAA 1M73E 1B6GA 2PT7A 4IJQA 5U4QA 4G63A 3GRUA 2O7NA 2ZYIA 4RH3A 4AKHA 4XTRA 4EWLA 5AJVB 2NLOA 1CIPA 2BHLA 1S2LA 4FYYA 4IDOA 4RK5A 3MBKA 4KXNA 4MWCA 4JH0A 2CNLA 1RKXA 3QLUA 4QYIA 2VDWB 3FVQA 3E8MA 4N18A 1E61A 3CNNA 5KZMB 1E4EA 3O2QB 3ROPA 2XQKA 2EBUA 4KH0A 4EUSA 5AW6A 1DELA 1N78A 3TX2A 1E2GA 3ED1A 4RFLA 1VA5A 3EZ2A 3HLYA 1E0JA 3UH0A 3OAAA 1WR8A 1SZPA 4JQCA 4R2HA 1VKZA 1LLCA 4H1UA 2EFHB 5EYPB 4B6EA 2PV7A 2N3ZA 3RRJA 3A04A 4AZSA 2AOTB 1GZ5A 3KYCB 3O2NA 1XJCA 2O6HA 3E2IA 2WWTA 1R0SA 4L74A 3WL3A 1FDWA 4I4IA 4K5QA 3SR3A 3WOVA 5AOAA 1XEWY 1PL7A 2RHJA 2OCXA 1TM5E 2ZBVA 3WIVA 1JR3A 3WWYA 2UV8A 1N5MA 1DJPA 1U2ZA 2CJYA 2CSUA 2BHTA 1W96A 2HJVA 2NZ2A 3AY6A 1JMKC 3OQPA 4GC5A 2AMVA 3LNTA 1RFGE 4INAA 1YONA 3FHOA 4E1VA 3AEUA 3HB5X 4P58A 3L1IA 1AKEA 3MA0A 3OZRA 1VI2A 5ALNA 1V4BA 1XMSA 1U7UA 3UENA 2ZSUA 4CCYB 1T4CB 1GA4A 1XTUA 4A36A 4MVJH 1D09A 3QEOA 1MO6A 5HK9A 2BKXA 3QSYA 1EWRA 1VB5A 3JVVA 3K70C 4OJTA 2GVZC 1KAGA 2CNBA 2VH5R 3OLQA 2VRBA 2XJ4A 4J49A 4JP3A 1E2LA 4Y2QA 4YMVA 2G0AA 2P6MA 1IOVA 4I2NA 3SDZA 3WGVA 3OO1A 1K4KA 3H2YA 3SF0A 1QQBA 4DRYA 4LF7B 4FFNA 4F4IA 2H07A 1CDOA 1PZHA 2V6BA 3IVXA 4RFVA 4Y67A 4M55A 1YO6A 2BGGA 1FDIA 4R0NA 2AG8A 3MAJA 4OXYA 3F90A 5FOVA 3KQKA 3VBCA 2VXCA 1G7SA 4HEA1 2J31A 3LQYA 1OH6A 2RBKA 1RM0A 3PXXA 4GEKA 5LOVB 4MMZB 1JQLB 2RI1A 1E2EA 2W2KB 2BFDA 1USGA 4OREX 2C7PA 2CT8A 5HGJA 4BO0A 4JSRA 5CRIA 1N0WA 1XTPA 2X6TA 4RZSA 2HCJB 4QQRA 1QFJA 2A1TR 5G2OA 1M2JA 3AR8A 4KITB 4I5DA 3R2JA 5GIOE 1WDTA 1JHPA 1YL6A 3FOWA 2FW9A 3MJHA 4WVFA 2X4DA 1VPDA 5AWFC 5EC8A 3IT1A 3ZDXB 5DW3A 1F6BA 1FSPA 1N9KA 1W0CA 1G21B 2OC4A 2VUTA 1FP6A 4YIKA 4QT0A 4RS4A 4CQMD 5H3LA 5LLTA 2E5WA 3QNUA 2Q3MA 3T9DA 2ZANA 3V34A 4F86A 1ZD8A 5GOZA 3LHDA 2WUWE 4OFZA 3WKBA 5JY6A 4M0KA 2PYZA 5CW1A 4Q19A 2GEBA 3GVHA 5EPOA 4RA9B 4TV9B 4V1CA 3FNIA 4TMZA 1LA2A 3ADPA 3PX3A 4HB0A 2PH5A 2C2OA 1Z75A 4B71A 3IUYA 3H2GA 4YJHB 2C7OA 3CZQA 5E1BA 4L22A 2AR9A 3W5IA 4AX4A 4CG2A 4R1TA 2E18A 5GJWC 4X63A 4ZDJA 5DDIP 1U5BB 3ET5A 2PUDA 1G6OA 2QRPA 3C43A 3M83A 4LOIA 5DGHA 4MAFA 1OTHA 1RWVA 4WRRA 1JDUA 1G3IA 2A92A 3UXMA 3V46A 4D3YA 1W36C 3B53X 4WAUA 3GEMA 2VNAA 3ND8A 3ZN2A 3KK0A 4V0QA 4OLAA 9ABPA 3ASZA 2XMRA 5D00A 1OXMA 1V5GA 1YUMA 4ZHQA 4KIFA 5JVDB 2XTZA 4GXQA 5ICMA 1CUBA 3HCOA 4XTCS 3KVRA 4Q9IA 2Q2NA 3DMGA 1XEWX 4HYTA 4OEHA 4QYXA 4ZGWA 4JIGA 1XZBA 3ZNPA 4XR9A 4DC1A 4N6NA 1YQWA 4MB0A 3EQ8A 4W82A 1T9ZA 2WIAA 2LD4A 2RH4A 3UB3A 4L8FA 1JRLA 4CVNA 3H3JA 3QEBZ 4P1ZA 5ELMA 2XMQA 4MYSA 3VVLA 4C22A 1SRQA 1ULUA 1O9HA 4FJ1A 5BNZA 1AZTA 1PFQA 2WU3A 4HS4A 1XRSB 2LVBA 2CXNA 1QF9A 2RIPA 1TO2E 1TI7A 3BRWD 2F1JA 1ZUNA 4TTRA 5DISB 1BW9A 3H2HA 5K4AA 2N75A 2A0WA 4PC6A 3U3KA 2RHTA 4RTQA 5J3JA 5JARA 2HIAA 3IDQA 3V42A 4OQMA 3MWJA 1M5TA 1GPAA 3Q87B 1B73A 2OC9A 1A82A 3T9EA 2J6BA 1GKYA 1THMA 3DGFC 3FUUA 3FYDA 4F06A 5JH7B 2CL5A 4PICA 3CX7A 4EKNB 3E7FA 5E0OA 5FNVA 2JGKA 1XMIA 2CLMB 3CM0A 3ABRB 3E84A 3I9KA 5DI9A 3FAKA 3LSYA 1KSJA 5SYNA 3W2IA 2IP2A 5BSHA 1FMLA 4YFYA 5KYKA 2BHRA 4LSWA 2HK8A 4NYJR 4Q9LA 4TLMB 4AIRA 4NXNB 3TSAA 3TJZA 3DDSA 5BV7A 4C08A 4FHFA 2NPIA 3EN0A 3PNPA 3Q41A 4B3MB 2AB0A 2W0SA 4IVNA 4NX2A 3ZTWA 1WLYA 2B69A 3KD3A 2XJ9A 2REXB 1QE3A 3QHPA 3C5CA 3GQBA 2QMEA 1F2VA 5FPHA 4XZ3A 3FNRA 3Q9NA 3FMPB 4PLTA 5TPWB 2V5VA 2XUZA 1C9JA 1UKEA 3EEYA 1CP2A 4R9VA 1BKYA 3ZI0A 1MOQA 4XSGA 1C1DA 2OZVA 2HRBA 2PD4A 2NU7A 2FA9A 3I92A 1U9IA 3N9IA 4F12A 2BI8A 1VKRA 5KSYA 1C3OA 2H9AA 2IVZA 2FWJA 1A2BA 4Y0VA 3GEEA 5T4BA 3SXPA 1QBGA 1L1RA 5TQVA 4D0RA 1Z83A 1DRWA 2ZYGA 1SG6A 2YZNA 3G5AA 1J5XA 3MC1A 4AC9A 2AXPA 2RFLA 3HJGA 2UUOA 5IUNC 1EUZA 1ZG3A 3K4HA 4E70A 1TQ6A 5ENDA 4UNIA 1FNCA 2ZSDA 4QA9A 4RL6A 5EL0A 3TNYA 5EZYB 4EZEA 1YJCA 1SHZA 5JQGF 4A10A 2PSDA 1G4AE 2GEKA 3GVIA 2QM3A 1U80A 3R5SA 3WXBA 3NONA 2PUJA 5AP9A 1S4QA 4RNDB 1DRKA 2QAGA 5LB2A 3ISTA 4YXWD 4Z7NB 4F3NA 3VXKA 1OFHA 3AESA 2ZM6B 1IU9A 4BB6A 1MQAA 3QLJA 1NW4A 4XVRA 2PL9A 2GQ0A 2FZGA 3IQWA 4NU6A 4GX5A 2NQ2C 1CY8A 3J81k 2XI4A 4FOSA 3ABOB 3GLRA 4O2LA 2C5HA 1EEHA 9ATCA 2FPPB 2QRGA 3A3OA 5CNIA 3HEAA 3HPQA 3PXCX 3TL6A 4K6HA 4I36A 1QJ4A 3DDCA 2PKRA 2VBIA 3EXG1 4FNOA 4MQLA 1ORTA 2JLCA 3VO8A 3QOXA 5BV8A 1A4IA 2GD1O 3C2QA 4XLTA 5JS8A 3RU7A 1LK0A 1SKYE 4OU5A 5JYDA 1HYEA 4ZEOA 3LGAA 4WHMA 3ZJ4A 3BGDA 2ZS7A 4EG3A 1MTZA 2WLSA 3FCUB 5J1TB 4Z3DA 5ALVA 3EZ6A 3D4NA 5FF9A 1TYEB 4BDTA 3W3AH 4UUMA 3RWOA 2I9PA 2FE4A 2VJOA 2QJOA 4WK2B 1FFEA 1T1JA 3AHCA 3KBOA 3UT5A 1HR0B 5C5CA 3SN6A 4QJIA 4LFBB 1R9MA 3L6BA 1DNPA 2YDXA 3IIJA 4O4LF 2EJUA 4RXUA 3ZNNA 1O6GA 4E7OA 1ZC3A 3MF4A 4UOZA 3NDIA 5CBPA 2J3DA 1NOKA 2NVBA 3G1WA 1XL0A 4BPBA 4AULA 3QGMA 3D4OA 1YNSA 3ENVA 3V8PA 3BKWA 1N2OA 3IC5A 2J1LA 4RKRA 2VWGA 3BXEA 1YKGA 3KKEA 4YRTA 1M75A 4DMGA 4BB0A 5CM9C 5IJAA 5HIAA 3TI9A 2MOKA 2Q5CA 3U39A 1GU0A 3DLBA 4C4OA 4BX3A 2WR8A 2Z3VA 3EVFA 5EWMA 5FO1A 4R05A 3ZGZA 3WB0A 2OXIA 1HL7A 2VG8A 2WJIA 3NTQA 4JEMA 4M0FA 2XWBF 2DTEA 4RADA 1X74A 1Y6JA 2NT4A 1FUIA 4RX1A 2XCSB 3EXAA 3AB3A 4XASA 5I3CA 1YKSA 1TUBA 3ZLBA 1JR4A 1YHNA 5JTTA 4KNVA 3H8SA 4PG5A 1UMBA 1AC5A 1BS1A 3HN7A 4BLUA 3GRYA 1GNLA 4CTKA 1NUPA 4BNLA 4C29A 1M0EA 1OV4A 1V35A 1ZC4A 5B6IA 1TVMA 2ZROA 2UYGA 3UUWA 1Z9BA 2HSGA 4B1FA 7ABPA 3HNRA 5F12A 3JSAA 3QJGA 2G04A 1GNTA 3RG8A 3R3WA 1NX6A 1NQ5A 2WAMA 5H4HA 4R1OA 2E85A 1VJTA 1W0KA 4WN9A 4LWPA 4C1BA 1G17A 3V8BA 4J9VA 1HWYA 1QHHA 1GGJA 1SBTA 4HDAA 5FWAA 4P4GA 5SZJA 5IFLA 3VYWA 3HFGA 1WD7A 3NVKI 3S2UA 2HREA 1EJ0A 4NDNE 3VDNB 3W8EA 1ZP6A 3UJCA 3SHFA 3FDXA 2XYVA 1CUYA 3MILA 2BPOA 3OM1A 4BQRA 3GBVA 1RRPA 3U9SA 5G0UA 2TMDA 2FK7A 1ZESA 1R88A 3R7WA 2JW5A 1XQXA 1ZRHA 4YQZA 3AEQB 3R8XA 2VKTA 1OLUB 3OUZA 3ZR4B 4BTVA 4EYOA 3G0BA 1RQXA 4H3SA 4KK3A 1JKFA 5HPYB 2G1AA 5KTMA 4WLUA 3OZUA 1AUVA 1FLVA 1AN0A 4DF3A 3WYDA 5DB4A 5EI5A 3FXAA 1JE0A 4DR7B 1VJ5A 2CNKA 3ZHQA 2HBQA 3H4IA 4S2UA 1TM4E 4BU1A 3QMMA 1Y1SA 3MRSA 3W5JA 1VLVA 1BFDA 5H9WA 4UTXA 4LX8A 1UQUA 5L40A 1H9BA 1KL7A 5CLIA 5DSXA 4EO7A 4N47A 3ESQA 1UBCA 2VAWA 4IZIA 3ON5A 4JHLA 1Y80A 2Y0PA 2PXCA 1G2IA 3IAAA 1BS2A 2VP0A 4MAAA 1ZOIA 2B6HA 3PFHA 3SIXA 3SEQA 1UK8A 3LGSA 4QJ5A 4BNIA 3VV2A 2IW1A 2CNNA 3C7TA 1YHZA 2IUFA 3OM0A 4RVCA 3UJ7A 4CZ2A 2ZCJA 2WMNB 4C7MA 3SYMA 4NH0A 1Q84A 2AFRA 5AVZA 4IH1A 5HHTA 1WPXA 2R4QA 3DUFB 3SMQA 4JLSA 1G66A 3Q7PA 4C87A 2GPWA 2RHHA 2A84A 2QN3A 2GTHA 4DDWA 1E3SA 4XWTA 2JGAA 2LW7A 4NNOA 2K5UA 1GZ6A 2HCTA 1P0PA 1NVMB 3RM3A 4J6EA 1KDYA 1IVSA 2JEOA 3CMMA 1VIYA 1MJGA 1N2HA 3KNZA 4XYMA 1K7YA 1WHSB 2H85A 2FFQA 2B7LA 3WSVA 4ALJA 4ATNA 1KFEB 3GGGA 1EE9A 1UC9A 2VDPB 4X85A 5AKGA 3TRFA 5TQ0B 4YDSA 3X0DA 3UXYA 4AQDA 3G13A 4EMBA 5AKYA 1E3EA 5CIQA 1K27A 1N6KA 1YZLA 3U5ZB 2R1TA 1ADJA 3PFWO 3QPWA 2ROQA 3BS4A 3JATB 1W94A 4NCIA 4PYKA 1XL1A 1QZUA 5DE3A 2FPOA 1CQWA 1JFFB 2JBAA 2V9CA 1RWKA 2EF1A 4WFKA 3VKVA 3DFKA 2CDRA 2RHCA 1BEZA 5KNLA 2C94A 4JLUA 1FFSA 4J91A 3H8JA 3PGKA 3RRNA 3S2FA 3P94A 4CLOA 1B7GO 1C8KA 1V3TA 1TCCA 2JLRA 1DEKA 1YWGO 3IMGA 1JG6A 3V48A 3WGZA 4F3RA 5M5BA 1Z0KA 2ONJA 1FRZA 5FUBA 2W6IA 4ITRC 3TIGA 3JQAA 3KFVA 2ZI5A 2PL5A 4UDNA 2HFJA 1J8QA 2RH8A 4RPCA 1HQCA 5KYVA 3ABQB 3H5VA 1CNFA 3AF5A 3PUXA 2QVYX 4B3DA 1YVUA 1U8XX 2GM9A 1JDNA 2MYUA 4QUEA 5JDIA 1GRRA 2OV6A 3B36A 1KY4A 5DLPA 1V8OA 2OPHA 1EK2A 3GUUA 1NJFA 3NORA 3RV4A 3ABIA 4B32A 2WPDD 4HUQA 3WL5A 1ML3A 3PJRA 1Y1RA 3U48A 4ZHQF 3Q6IA 5LVAA 1Z0DA 1IAVA 1FDSA 3T94A 4NI5A 1Y9ZA 4OK5A 5MFPA 1XNGA 2F43A 2H4XA 2Q3CA 1JR3E 1SVWA 1NBOA 1TJYA 2V45A 3MWLA 4IKPA 4ZAYA 2MYPA 4BATA 3THWA 2PVPA 2WIKA 4EAQA 1XO1A 2O8EA 4WUTA 1GSOA 3G2IA 3W1EA 1NLFA 3T1HB 4EYKA 2BJWA 4I5EA 5JO9A 3NHLA 2YHUA 4Y0NA 4CKWB 1SUEA 4DV4B 4BMSA 1ONNA 1QTQA 2N9UA 2QRZA 3OZFA 3NXSA 3G5LA 2J3KA 3TOCA 3D0QA 2ZRBA 1CLUA 5IK2D 3RYCA 1G98A 3LUHA 4AKGA 4TL7A 2DPYA 3BSFA 4NMXB 2ALJA 2X5NA 3KKKA 4ER5A 4GO1A 4NG5A 3MWDB 5CFOA 1ZEMA 4LXHA 1CVIA 4RZQA 2BC9A 1GG5A 4PRLA 4WNYA 2XNHA 5FNVF 3BHNA 3SY8A 3T1QA 1Y3IA 3Q2OA 5IC5A 3ZHRA 1WUYA 4C5CA 1AQUA 2VJCA 4CL3A 3LQQA 3UFBA 5TX7A 4HNUA 1X7HA 2VK4A 1Z15A 4UZEA 5KWEA 1I36A 3F46A 2YH2A 1J33A 1D6SA 2VRNA 3WIDA 3AEKB 2FPGB 2E4UA 2IEBA 2F4VB 3RAPR 3HCCA 3L0OA 1TPYA 2QI9F 1I9CA 1PYDA 2GCEA 1UOPA 3AZOA 2JFBA 3CVOA 5BPHA 3UNXA 1HZJA 1G1AA 4WZAA 4GVPA 3GCXA 3WK9A 2NZ8A 4E1AA 1WXQA 1SOMA 1KFCB 1Z2DA 3PFBA 4MUKA 2FOIA 1VCMA 2W6MA 3D5EA 3E48A 3PUHA 4P3NA 4OQ4A 2NU9B 2FNAA 1JALA 1LRJA 3CURA 4DBLE 2AN5A 1IB6A 1CF2O 4N0EA 4DW8A 5KNDH 4EY4A 4ZRNA 5TQ2A 2D8AA 4GZLA 5D6OA 3BE6A 3GDOA 4PS0A 3TR5A 1O2DA 3L0PA 5IDYA 3MQFA 3P4XA 1K88A 1GZHB 2WG2A 4G1MB 3HGTA 1BCRA 2NTNA 4AUKA 2C2XA 1QLJA 1QYIA 3FDZA 4ZAZA 3CNOA 3RR2A 2L69A 3G2NA 4KEAA 3Q9SA 4C0QC 2DHRA 4KKVA 4TXJA 3BGWA 4MLPA 1UKAA 3VC7A 3E2MA 4RTMA 4HX5A 5B55A 3NBXX 1AXGA 2ZB7A 4LSGA 3W05A 4B8ZA 3I53A 1JLKA 4CTMA 1US8B 5ALGA 5AESA 2CJXA 2BFWA 5E8RA 5FFFA 2Z04A 4OOEA 4PXAA 2HA4A 4F60A 1XKXA 2B8JA 1CQIA 2ZYVX 5ALLA 3U19A 1KOGA 2Z1DA 2CV2A 2LGJA 2MSLA 2CLEB 2PO7A 2YJ4A 3N0RA 1LUAA 4MQEA 1E92A 5CDFA 4ZI7A 4H77A 1RS0A 2HQSA 2BE7A 3A06A 3NHRA 4IHJB 4OHXA 4LI3X 3RK1A 4D9JA 2GN8A 2W93A 3KDPA 1MAHA 2P5UA 3GFBA 4IIGA 5HJ7A 3V1MA 4BWYA 5LD2B 1PJBA 1ZK0A 5LQRA 4JK3A 3L8ZA 3UQZA 1TQDA 1QP0A 2I6QA 1QB7A 3BA6A 4MQBA 1H0SA 421PA 1DL5A 1K5HA 2WRZA 3S5UA 1F8GA 3I6MA 3MOIA 2A9PA 2H1SA 2IZOA 3SE0A 3JQDA 2AFHB 4W4TA 2NPFA 2X0RA 3HCNA 2BGWA 5FPPA 2Z5VA 3GEGA 1UIMA 1Z4MA 4Z0NA 3UJNA 4WCFA 1PT8A 4O4HF 2Q1SA 1Z8FA 4ZGGA 3SJ7A 5B64A 4Q18A 4AL4A 4ESOA 2NTVA 2NTJA 1OBHA 2QTNA 2XAUA 2ZUCA 3OM8A 5FIUA 2EFCB 4ZOCA 3WO1A 1ZQ1A 1F2UA 4DARA 1JG4A 1ISMA 1LTHR 4X60A 4HNHA 1T8SA 16PKA 3BCUA 3BULA 1RJEA 4RJIA 1GFIA 3MBOA 4DLWA 3U4QA 2Q07A 4X3PA 3IB3A 2TS1A 1VKNA 4X6XA 2XMSA 5ED4A 1H1LB 1NRJB 2BZSA 4R83A 4P92A 3THRA 1R12A 1T2UA 3BMQB 4FWBA 3RTCA 1K8RA 1VJDA 4WBNA 2QRLA 3M6AA 3UF0A 4F93B 2I4MA 4G5FA 2OKGA 4L8WB 5HTKA 3F0TA 3K35A 2QN1A 4KN6A 2OZLB 1GT91 4LDNA 1L5MA 1L7OA 5E1MA 2KSQA 3B89A 3DTNA 4B3TB 3BTOA 1JDPA 1N1MA 2ZS9A 4FGSA 1OF1A 3K9LA 1FMFA 5EAIA 4MWBA 1VHWA 1KARA 4U5QA 3LCVB 1AX9A 4F92B 2Q46A 4LQLA 3JU3A 4ZQEA 1I14A 5JNVA 2NV2B 3QG5A 3GPLA 1NAHA 2WFAA 3P9QA 3VOSA 3M70A 4KAAA 3I8XA 1W35A 3ILVA 3QEMA 4DR4B 1N5OX 4ZALA 2WTBA 2GCGA 5HG0A 4DWWA 1ADBA 4UVIA 3ZWKA 2P0AA 1PS8A 5CVJA 4IXWA 1B76A 2XMPA 5CG1A 4O5AA 4D9HA 3AVOA 4S24A 3QBJA 5HRUA 3AUSA 4ZREA 4L8LA 1FNSA 1X1TA 2A0UA 4GKAA 1TF7A 1KS9A 2DFKB 2HMAA 4QDXA 1QYRA 4IIEA 1NWCA 3O03A 1T5SA 4HQFA 4QTUB 1Y42X 3ZUGA 5FI5A 2IF0A 4BFXA 1WB4A 1OAAA 3EWSA 3PKIA 4M60A 5AK0A 4BNDA 1T2NA 1WBJB 5JAIA 1E6MA 3KXPA 4RO0A 3QUBA 1OWLA 1X9GA 1SO8A 1ZUD1 2RGBA 4RM2A 2FX2A 1S3FA 2XNKA 4C0JA 4B4KA 1FFWA 2A3RA 3BKXA 4PZYA 3W9BA 4DCMA 2X0EA 4XD2A 4V24A 1ZCZA 2C5BA 3PV0A 1AK9A 3I4FA 2HT1A 2LBPA 3JZDA 3KB1A 5LLSA 3GFGA 4IDFA 1GGEA 1NYQA 2KM1A 3DLAA 3HL4A 5JFTA 1CJTC 2CMFA 4C7OB 3TOZA 3HCPA 2QPLA 3R5TA 4MS4B 4FE3A 1NW3A 4M6WB 4WXHA 3Q3GE 2VK2A 1YT5A 3MGCA 4HQLA 3EXFB 4LOLA 1HRDA 1KJZA 1W88A 3F73A 5AICA 4DN6A 2I3DA 4HV4A 1Q0QA 1Z5NA 3FTFA 4P80A 2AOXA 5FOUA 1M1YE 1QR6A 4K9NA 1VG0B 4J90A 1P91A 1OA1A 5CD1A 4ZPJA 1XAGA 1C14A 5K8JB 3COJA 4ZU6X 2GHIA 3V7YA 1B1CA 5DTMA 1QVZA 1ES9A 4G09A 3HR8A 4QXPA 1J6UA 4Z4IA 3U9LA 1DUSA 2ZWIA 2R96A 3S28A 1YL7A 2XTMA 4GPEA 4C1NA 1FX0A 2I66A 1WB6A 1Q0PA 3E22A 2AN9A 3VPFA 2PD3A 4E4RA 4AZWA 1J9ZA 2XGOA 5ALOA 3W8NA 4CKCA 1G20B 4JR1A 1YFJA 1JI3A 1L7QA 5K2OA 3RS0A 3TLGA 1PJ8A 3SZMA 1A76A 1FSFA 4M8SA 1OCEA 2R6JA 1O58A 2EKQA 3DCYA 3BN3A 4RXTA 3BMCB 3CIOA 4P2BA 1P75A 1O1YA 1NXSA 2PU7A 1DFIA 3F71A 4X62B 3QOWA 2HQ1A 3BG5A 3JQ9C 5KHOC 3ONFA 2AZ4A 5D3MA 4N49A 3BSSA 3QQ5A 5DV9A 4B75A 4RL4A 3V4RA 5EP1A 1JDTA 2DLNA 3G2PA 2AC2A 2I2AA 2QN8A 2ZB8A 2ZJYA 3HRHA 3L0SA 5FFMA 3UW1A 5L4SA 3KR9A 2IHNA 1UT8A 5BN5B 3L4SO 3PC8A 2EJWA 3V7FA 2Q1TA 5T3UA 5PNTA 2HIHA 2ZRJA 3SOZA 3OZDA 2BGLA 1WEKA 3B6KA 2SICE 3L0BA 4QVGA 5E3IA 1GPLA 4C6HA 1C5KA 1W4AA 2IDMA 3BGIA 4RVNA 3I9MA 1KTIA 1JJAA 2EZTA 4UXHA 3OJLA 3FYUB 4JQSA 1ZBDA 2R8YA 4FX5A 3FF4A 13PKA 3GP5A 2BGMA 1HT0A 2FSVC 2VHVA 3QPUA 4DEYA 5J4VA 4A0QA 4BGVA 4KSCA 1K7FB 3PICA 3WKAA 1TUIA 3D6JA 2IELA 4A7PA 4TWBA 4WNCA 5KNCD 1YZYA 4UCWA 1SAYA 1ZN8A 2QM7A 2WJGA 3QW2A 1QQAA 3AUKA 4D0LB 3WAGA 1E2BA 5JY1A 1PSZA 3OOEA 3JW8A 1PWEA 5DWVA 2APJA 1NULA 4DV1B 2BFFA 5CJJA 4DZRA 1E2KA 2H1FA 3KR2A 3ROEA 2Z2JA 3GD7A 3FZYA 5ITZA 1ZWLA 2CKMA 3IB6A 1U99A 1SXGA 4A92A 3SQLA 1M6EX 4TLBA 5BMVB 1OX4A 2GZ3A 4G4JA 2X9NA 4P9NA 3VH3A 4AF7A 4F4UA 1DQYA 3C8ZA 4QXAA 2AVDA 5F2NA 3DZ8A 5GZ1A 1MEEA 4CLHA 1GXSA 3MXTA 3DEHA 3TWOA 1VP9A 4Y2GA 1KO4A 2VF8A 3ECCA 2R9VA 4PU0A 4XQGA 4R2WA 2PA3A 3A4LA 4FE7A 4PZUA 4DAOA 5FT9A 2YJZA 2DH5A 3UC5A 1N2GA 4GLFA 2VUUA 1U98A 2CLLB 3SU8A 1C4WA 3HY3A 4XR4A 4YPOA 3FYSA 3JVDA 3LQRA 1AQNA 1ZA2A 2JFZA 1F8FA 2QVXX 1GPNA 2YRXA 3PD0A 3H2JA 3PPIA 3R3UA 1DRJA 4QHTA 4ZV4A 5I4IA 1KDRA 3CW9A 3HQ4O 3MYRA 1GFZA 3INGA 1DTSA 1KAOA 4YJ2A 3QFFA 1W48A 4K9KA 3DA8A 3B3JA 2B1GA 3DL4A 1GV0A 3OZXA 3VTAA 2ZT6A 2CHEA 2F67A 2X9QA 4S3MA 1MVLA 3GLTA 4C6RA 4C4ZA 4GLJA 1PZXA 2WZQA 3I42A 4OHPA 5JISA 4QDTA 2DMRA 3EIQA 5DHUA 4LDQA 3U4AA 4YCSA 2JLVA 2OCDA 1ODKA 5T41A 2NNLD 2Q6OA 3EXHC 5T6BA 3LYHA 3FSJX 5FP0A 4CCSA 1VP3A 4DG5A 4BZZA 1RC8A 3QHAA 4NU0A 4LZLA 5JBNA 5G3ZA 1EUCA 3GQVA 4ZT7A 4D92A 5FBQB 1P2GA 3GA7A 4K87A 4OK6A 2VXYA 4YAWA 4IDDA 2GHTA 3RSLA 3NIBA 1A7JA 2R6GA 4BO2A 1PT6A 4MV4A 3FWZA 4YCDA 1H4VB 5B58C 1SC6A 1UK6A 1EUDA 3R9XB 5SV2A 4KZKA 1HFKA 3C7AA 4KYUA 1BXGB 1O96A 1EM6A 2FLKA 5E4JA 3QF4B 4FQ5A 4RXMA 3H05A 1DC8A 4JWKA 1G291 1MV8A 1AB6A 4IIDA 4TZ6A 2WIDA 3B1VA 1JIKA 2BCJQ 4JXKA 4YROA 2FY8A 4X8LA 4GYYA 6ADHA 4QOSA 5FTNA 3D8BA 3KSMA 1NJ8A 4XIIA 4Q48A 3TGPA 1VBNA 1TKRA 2Z08A 5HRCA 3UMYA 3PQ6A 3HCDA 1KE2A 1N9ZA 3BA1A 3ZU6A 1W5FA 5C53B 3D1JA 5KMGB 1NVVR 4TX1A 2NG1A 4YRIA 4DV3B 1YQGA 2D4AA 5IKEA 3LDUA 5KOHA 5AW2A 1OLXB 2HCFA 5JD6A 1IOLA 2NO4A 3QU7A 4KSYA 4E6EA 1C1XB 4W1QA 2P9HA 4W1RA 4DA7A 1JU9A 1RM4A 2H92A 3KU4A 4N54A 4OOFA 4P54A 5EIHA 4DMLA 3K9FC 4G97A 4HFRA 1JPVA 1NJ5A 4KUEA 2VTVA 3DVAB 5DI3B 1DMRA 4KWEA 2YX1A 4RHEA 5IKOA 1SHLA 1G60A 4HI0E 4JJZA 1WEHA 4JR0A 2R60A 2VRWA 5KOJB 1XJWA 1SWWA 4QQKA 5EJIA 4GW3A 1NJ1A 1XPJA 3AHDA 3V1LA 1JA9A 5B6PA 1XEXB 1CXZA 4BHTA 5U1PA 4YX9A 2ZB4A 1B00A 1E6KA 2E49A 4EX6A 1CS0B 3ILXA 1VI5A 2NTEA 4Q4AA 1IQPA 3BX1A 5JSZB 2N0SA 3ZCVA 1S9HA 2YR0A 5K0CA 1M8FA 3IQGX 1J07A 1E1QD 4ZOBA 3RVBA 4TZ0A 1WCV1 5DXFA 3RYHA 2C2GA 3HBJA 3W9SA 3GUZA 3U09A 5DXJA 4A15A 1RE0A 2GN6A 3GRKA 1WY5A 5CAEA 1SCUB 2HQOA 5F7OA 1NMZA 2O2SA 4HC4A 2WMDA 3IFSA 1CIJA 2GF0A 2JFXA 4IIFA 4ND3A 2OHOA 4AQYB 5H68A 2VA8A 2VYCA 2B2NA 4B6PA 3ONDA 1K7EB 4RJLA 4ISBA 3L4KA 5LKAA 1U2TA 4DJFC 2B36A 2MR5A 4DIDA 5I7WA 1JIIA 2Z9CA 4RMJA 1Z6YA 1IJEA 5GWXA 4IOMA 4OHOA 4WBNF 1CZOA 3DCIA 4Z53A 3FBGA 1XDWA 2WEKA 1DHTA 4RDIA 2XCLA 4EVIA 1Y4DE 4TMVA 1M83A 1NP3A 4K9QA 3QYFA 3FH0A 4CT5A 4BC0A 3IP7A 4IIUA 1NSTA 3FPCA 1PZFA 5H3CA 1Y8ZA 3ASUA 5C8DA 1XZNA 2R5WA 2VHWA 4JLMA 4L7VA 3C3JA 4LKRA 5D01A 5DEIA 2VSOA 3K2QA 3QU4A 4KXMA 4B8WA 3LKVA 2HSJA 2UAGA 3DT9A 3LPDA 1RT9A 2GVNA 2IYTA 3MG9A 3VYTB 1V5EA 3ET4A 3PF9A 3BAFA 1KJYA 4Y1RA 1T5OA 1KZ9A 4ZODA 4EHNA 3WGQA 1IZ7A 1UDWA 1KJQA 4I46A 4R68A 3B9RA 3KS9A 3M4YA 1E1QA 1E1DA 1NVBA 4CKXA 4UOEA 1J90A 1IIBA 2YN0A 3EDMA 2COKA 1ZIPA 4XH9B 4M54A 1SD5A 3TXAA 3A2MA 4GX1A 2H08A 2XXJA 3K30A 3LTNC 2IIVA 4OQYA 3EEOA 4Z7OB 3HO1A 2O8BA 4LV8B 1NI4A 1RI5A 5AT1A 3VR4A 1MKYA 3PCXA 1ID8A 1YB1A 2YRFA 1RM5A 3KXLA 1U1CA 4K05A 2WTMA 4RTOA 5A7GA 4CT4B 2C5SA 1LDYA 1VMKA 2H3EA 3PRJA 2XUJA 3K71B 4CMIA 2ANBA 2VHJA 4LQDA 1GZSA 4MUNA 1DEXA 1ZM7A 2QPAA 2XHEA 1N77A 1H2BA 4OB7A 1UM8A 3WHPA 2PVSA 3NPAA 3DVSX 4FTWA 5JFOA 3EUAA 3K6RA 4DIBA 4AB1A 3J80A 2I7CA 2Z4SA 4ZVKA 3NVAA 1UEIA 1Q1QA 3JY6A 5K1ZA 3V32A 5B30A 5CDFE 1XIVA 2R4TA 1H65A 2PK3A 2YYZA 1QCDA 4PSCA 1W6RA 3AYXB 1CJVC 5HQ3B 2JAHA 2CMHA 1Z0AA 3JQ7A 3UT0A 2A9OA 2HMUA 4QD3A 1E62A 3B38A 2AW5A 4Q4LA 2Q99A 5CYGA 1MXFA 1OJ7A 2ETVA 4UQPA