2MSWA

Ligand-induced folding of a receiver domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPVMAKPADTSDVAKRALEMCGGDKEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator/sensor histidine kinase
publication title Ligand-induced folding of a two-component signaling receiver domain.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Transferase
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mswA00
2NT4A 4Q6BA 2X7XA 1NTRA 3HEBA 3N6VA 3O75A 3O1IC 4HNRA 2VK2A 5BRJA 1DCFA 4LDAA 4MLDA 4Z4CA 3OLWA 1EWTA 1Z2EA 3M6MD 3QELA 5TQJA 1ZGGA 1YS7A 2IPNA 4TMYA 2P9HA 4Z99A 3W9SA 1GUDA 1MAVA 4XARA 4FE7A 4RXMA 1JDPA 3JVDA 3G1WA 3IP7A 1DBWA 1XHEA 4YGXB 3UK0A 5KQLA 3SG0A 4RXUA 2JVIA 3OO0A 2IDMA 2RDMA 1F51E 2GX6A 3RVSA 4IRXA 1QP4A 4MR9B 2ZAYA 4LZLA 1E6KA 1ISSA 4MS3B 5DCLA 4RY9A 3A0UA 4ZMRA 1DJMA 3VNBA 1ZH4A 1JBEA 3FMVA 4MGEA 5PNTA 2Q5CA 5JNWA 2FN9A 3RQIA 4YV7A 1P6UA 2R47A 1ZH2A 1FSPA 1DCMA 4HNQA 1MB0A 5DLEA 4W5NA 2B1JA 4IILA 2PJUA 1USIA 1EFAA 1TMYA 3IP6A 3S99A 3O2QB 3LUKA 3O21A 4JP1A 2HJ9A 3KSMA 4MR8B 5GQSA 3HVRA 1BVHA 3F6PA 4S05A 1KRXA 4RZSA 3SQNA 3QLTA 1CEYA 1NXTA 2FW0A 4MS1A 1ZDMA 4RU1A 3QELB 2R25B 2E4VA 5IUKC 4EVSA 2LP4Y 3HS3A 2PUBA 1K66A 4E7OA 1USKA 5DGCA 1S8NA 1A2OA 1DRKA 1HEYA 3QK7A 1XWWA 2YHBA 4YP9A 2IKSA 2R48A 4MS4A 1W9HA 3LOPA 4ZPJA 4G0PA 1SRRA 3HV2A 1BDJA 3I5AA 4Z4EA 1QMPA 2E4ZA 2I6FA 3TO5A 4L4UA 2JVKA 5B3JA 3H5TA 2TMYA 1QO0D 2FQYA 9ABPA 2PUDA 2VUHB 1JLKA 1NXOA 2QV0A 3T6KA 1Z25A 2MSKA 1JYEA 4UHJA 1EHCA 3KTOA 3MMNA 5BRAA 2MYPA 1XHFA 3ILYA 3LUHA 1QQBA 3JPYA 3H1FA 3RVJA 4LE2A 1DZ3A 1Z16A 2FMIA 3H6HA 4RS3A 4ZJPA 5ABPA 2FEPA 3KCNA 3JS5A 4RK0A 5JNRA 2AYXA 2FMKA 2F8SA 4YR7A 4YWHA 5KC9A 2A9OA 4NICA 3H5LA 5TQ0A 4CBVA 3CS3A 4MS1B 3GWGA 5IEBA 3CNBA 3N8IA 5FWXA 3RVKA 1DP4A 2ZWMA 4WXMA 5HQJA 3O1JC 3LKBA 5JNSA 2WWVD 1E6MA 2FEWB 3OO1A 1GUBA 2ID7A 3OLYA 4EVQA 3M9WA 2M1ZA 5TE9A 4MS4B 2A9PA 5T7BA 3GT7A 1W25A 2QVGA 3CZCA 1RXIA 2HSGA 3CZ5A 4EGSA 3QEMA 3SNKA 5C5EA 3OQNA 1QPZA 2J48A 2VYCA 3DLBA 3EODA 4EYQA 1BDIA 4G0OA 4O1HA 3KG2A 1M5TA 4WXEA 4W5QA 1JX6A 1LBIA 2AYZA 4KQCA 4H60A 4B09A 2FQXA 2H3HA 5EWMA 2NUBA 3LTEA 3O74A 4E7PA 1KGSA 2CWDA 3CKMA 3FGZA 2L2QA 4JOQA 4RY0A 5EWJA 3C3KA 3GV0A 4EYKA 3M9XA 3UKJA 5HM6A 2M98A 4PICA 4Z9AA 2PE5A 2PUAA 2FSPA 3SAJA 1VPWA 3Q7RA 2KYRA 2FEKA 5TQ0B 1Z26A 2FXIA 1SD5A 2YHAA 1ZHHA 3DBIA 1ZN2A 5FWXB 4KREA 5B3JC 3QLVC 3HJFA 3F7NA 4KPYA 4RK6A 4Q7EA 1LJUA 1D2AA 1PUXA 2QZJA 2GI4A 4DADA 3SM9A 2GKGA 3RVRA 1A0OA 1F4VA 2P4UA 3HXMA 3EAFA 4WT7A 4OLBA 4G97A 3RH0A 1CYEA 3EJWA 4G0QA 1PEAA 2W42A 1YVUA 3IPAA 3CFYA 3H1EA 2MYUA 3Q9SA 3QEMB 3RVNA 3MA0A 1JHZA 3HZHA 3H5OA 4RK7A 7ABPA 4W5RA 3G85A 3KS9A 3ROTA 3ROFA 2E4XA 3HUUA 4EYOA 2CHFA 4RXTA 2QU7A 1QO0A 8ABPA 1VLZA 2H0AA 4TLMB 4WUTA 1RXEA 2IYNA 1R8JA 5KQPA 5EWMB 4MLCA 5FBKA 3C3MA 3T95A 1JYFA 5EWJB 2GBPA 3D8UA 3QX8A 4L85A 2QR3A 4MQFA 4ZYLA 1FFWA 1ZGZA 4DQDA 4ETMA 3MYYA 3KHTA 6CHYA 3E3MA 4N03A 2WRZA 1M2FA 1U04A 1YIOA 1OXKB 1U8TA 1VRVA 1YS6A 2WMYA 4UHKA 3TD9A 4Z4GA 2NT3A 3KLNA 3BRSA 2PL9A 3H1GA 1NXPA 3C6QA 1DC8A 1BAPA 2E4WA 3HUTA 3I09A 3IP5A 4QPJC 3LUJA 2LPMA 4PZ0A 3BREA 5FBHA 1C4WA 3GBVA 1Z15A 2IPMA 1Z17A 2O20A 1GCGA 3C97A 3IP9A 4XFKA 1WETA 3IPCA 1LK0A 3QLVA 4JB2A 4EY3A 2JCGA 1SXGA 2WY2D 3N0RA 3URMA 1NXVA 5IEJA 2HQOA 1QP7A 2BGGA 1C0EA 3KYIB 3OQOA 1D5WA 4ZMSA 1RPJA 2QW1A 3Q15C 2PUEA 1TJYA 3NNDA 4IF4A 3T8YA 1APBA 4RWEA 3LUAA 2A9QA 2FKAA 1ISRA 2MYTA 1P8AA 5CNIA 1DBQA 2XDYA 2WJWA 1EWVA 1T34A 1TLFA 4RKQA 1EAYA 4MQFB 3F73A 4JB0A 3K4HA 4JA2A 3P9YA 2FMFA 2FLWA 4QYMA 5TPWA 4N76A 4W5OA 5KI6A 1ABEA 1FFGA 4KK4A 5DTEA 1TVMA 4F3TA 1LJLA 3JY6A 3VNAA 2CHEA 3FFXA 4KMRA 1DCKA 3MQ4A 4MRMA 3HSYA 4EYGA 3MIZA 4Z0NA 2PUFA 2LUOA 2WB4A 4KV7A 5JNUA 4W5TA 4N47A 1YMVA 2E4YA 4LX8A 1M2EA 4MQEA 1FFSA 1TM2A 4KNYA 2E4UA 1B00A 1JWLA 3OQMA 1D1PA 4YO7A 4RV5A 1JL3A 3N75A 5KQMA 5KQGA 5E3JA 5IBQA 4G0XA 5CNMA 4Z4FA 2FN8A 3O1HB 3MM4A 4M88A 3LUDA 3D02A 2OENG 2R4QA 3H5VA 3K9CA 3RVQA 4NQRA 2OQRA 4JASB 2N9UA 4HNSA 3HK2A 3I45A 2IPAB 4S04A 3GRCA 1ZESA 4GNRA 5T3YA 1MVOA 3GL9A 2LBPA 3LKVA 3HCWA 4P1ZA 4LDZA 5TPWB 5KC8A 4XASA 1Z2DA 5TQ2A 4PYRA 3DGFC 4N41A 4MAAA 2L17A 3BBLA 3JVIA 1Z12A 2JBAA 4JAVC 4MR7A 1QKKA 3Q7TA 4IGAA 5JNVA 4XAQA 2MSWA 4ML3A 3B2NA 4MYRA 3CG4A 4Y9TA 3HM9A 1RZRD 2QXYA 3LFTA 3NNNA 3LUGA 1A04A 1KRWA 4LE1A 4MRMB 2PUCA 3L49A 3QEKA 2PLNA 4N0QA 2MSLA 4D6XA 5HKOA 1ZAYA 4RK4A 3EQZA 5D2CA 4KQ9A 3A10A 3FFTA 4MQEB 2JK1A 3LUFA 3NHZA 1M5UA 1PNTA 1PEYA 4NCBA 3TB6A 2FVYA 3OM1A 1CHNA 1Z18A 2PMCA 1J56A 1P2FA 1USGA 2QSJA 5F64A 4F8JA 4NCAA 3NNSA 4IMIB 1QQAA 2RGYA 3GYBA 4G0ZA 5BR1A 1YTUA 2WJAA 4WWHA 5HSGA 3T38A 2PAFA 1ABFA 3NHMA 4Q6WA 5IC5A 3R0JA 4OTZA 3EULA 5IUNC 3TMYA 5TQ2B 2MYNA 1E2BA 1KMIY 3KJXA 1RNLA 3DGEC 2HQBA 2JBAB 4MR7B 2CD7A 4G0YA 4P98A 5JNTA 2PKXA 3O2SB 4FE4A 1SXIA 4D74A 3DZDA 3IDOA 2IOYA 3RVLA 4YCSA 6ABPA 4NV3A 2NZUG 1NXSA 2VUIB 3JTEA 1UDRA 4IMJB 4F12A 4Z4IA 2L19A 3Q41A 4D6YA 3CTPA 3EQ2A 4KRFA 4ETIA 1P6QA 2IPLA 5TPZA 4ETNA 3CRNA 1NY5A 2ID9A 4YRZA 1BDHA 1GLGA 4MPTA 1JH9A 1I3CA 2B4AA 3GBPA 3RVOA 3LMKA 1U2QA 3H75A 3HDGA 1QP0A 3F6CA 3I42A 4PEVA 4YLEA 2RJNA 1DRJA 3ILHA 4O1IA 1Y1LA 5BQ3A 3BRQA 4LRQA 4O5AA 3KLOA 3HO1A 3H6GA 1JF8A 5IUJC 3EDCA 3QLUC 2A9RA 1ZITA 4QYWA 3GA5A 5EWLA 3RVMA 1JDNA 5I4CA 1K68A 3MF4A 5JS2A 3C3WA 1H9CA 1QNLA 3SY8A 3QX9A 1NATA 5DKFA 3A3KA 3HDVA 1FQWA 4WZZA 2HQRA 2JRLA 4RY8A 2V0NA 1U0SY 1YMUA 4OATA 4Z9BA 1JFTA 4OLAA 1GCAA 3O2JA 4PE5B 4RSMA 4XLTA 3EGCA 4QICA 5ED4A 1RZRA 1VKRA 1L5ZA 1D4ZA 1MIHA 1OXBB 3H5IA 1EWKA 3A0RB 5TPZD 5CNJA 1DC7A 5C5CA 3OMXA 3CLKA 5FWYA 4KFCA 4GPAA 3OMWA 1JFSA 3RVPA 3FDFA 3OM0A 3Q7SA 1URPA 1U2PA 3CHYA 3E61A 4TN5A 3JPWA 3OLXA 3N0XA 2FQWA 3OLVA 4H3HB 1ZVVA 2DRIA 5IULC 1D1QA 3H5WA 5KWSA 1DG9A 4KZKA 4OG2A 3OLZA 4EUKA 3L6UA 2L18A 3KYJB 3DLHA 1YK1A 1PNRA 4N0PA 4G0MA 4XXHA 3CU5A 4RK5A 3BILA 2RJOA 2QVCA 5EWLB 4DN6A 4G86A 4RKRA 1SXHA 1MB3A 1AB5A 4F06A 2FTKE 3LUCA 1Z13A 4MR9A 3NBMA 5IX8A 1L5YA 4HYEA 4MS3A 4RDCA 1ZY2A 2LIVA 2GWRA 1BA2A 1LBHA 4F11A 3N53A 3UUGA 4YS6A 1PHRA 2NZVG 3KKEA 3QLUA 4OBBA 3CG0A 5CNKA 4FB4A 2FLKA 4H3KB 4KK3A 2JVJA 1E6LA 2HPHA 2PL1A 4TLLB 1NXWA 1AB6A 4EVRA 3N0WA 5JS1A 5FWYB 2PUGA 1IIBA 3TX6A 4KVFA 2JB9A 1NXXA 1YK0A 2FMHA 5CHYA 2F8TA 3FFWA 5GOTA 4MR8A 4RK1A 1DBPA 4LE0A 1JFVA 4Z4HA
chains in the Genus database with same CATH superfamily
3LT0A 4Q6BA 2W2VA 2PFKA 3WWYA 2REQB 3ETDA 2HREA 4D9NA 5A6SA 5AD1A 3BWMA 3N6VA 5A4AA 4HNRA 3HGTA 2DX7A 3VR4D 3JAKA 3HC7A 1JJFA 4BJ5A 1U0TA 2BN4A 2JAPA 3DMHA 4FEGA 3C3XA 1ZGGA 1YV9A 1GRQA 1NW6A 1K2WA 1OAAA 2IYQA 3JZDA 3R20A 4G63A 1QVVA 1KQNA 1XEXB 3PPVA 2QJFA 3L7YA 2AOUA 3RIYA 1XFAA 4NDNE 2JVIA 1YMQA 1CEEA 4MZXA 1EFVB 3CX4A 4MAFA 4PHFA 1QP4A 1U0HC 2A9VA 4MUKA 2H1WA 4E4RA 1T4CB 1P18A 3E53A 4NZPA 3DBHA 1Y3FE 4RY9A 4AX8A 5L8VA 1HNNA 2V7QA 1NA5A 5IZCA 3L7KA 5KOIA 4HWPA 3QVMA 1BXRA 2C7BA 5CA1A 3M6VA 5AKHA 4AAYA 1PJLA 3EK2A 3HYLA 1VGQA 3R3UA 1W8IA 3EPJA 1EH5A 3H2GA 3JQ8A 2KBFA 3TNFA 4IILA 5CDSA 1E9FA 1R8XA 2A1TS 4BO7A 5KNLA 1WSBA 2MSEB 4Y2XA 4XSHA 1YJCA 2ZUEA 3E2MA 1NAIA 2PX5A 4ZOLB 5B37A 5C53B 2UDPA 1HT1E 2B8EA 1G60A 2PA0A 4LUCA 1QQTA 1HDXA 4WJLA 2AD1A 1RLMA 1OT5A 4QGAA 3VR3A 1V0JA 4F4CA 2B20A 3M6FA 3QQ5A 1IUPA 4HFNA 4NBTA 1UEXC 2R60A 4RA9B 3ZG6A 1TAUA 3PK0A 2AOVA 3LPNA 3H9CA 3S28A 2KSQA 3CSDA 3MJSA 4IVPA 4JP5A 3VSEA 4BS9A 4F46A 3T5GA 1E3TA 3OQPA 3DVLA 3EGEA 1NU8A 3OZEA 4JJIA 3K1ZA 4JROA 4MS1A 3NBFA 3QELB 4RU1A 3RC3A 3RV4A 2BE9A 2XB2A 2JCSA 4B3SB 3HTXA 4JU9A 4C7OB 3L1KA 4P0TA 4HLQB 3RK4A 3U31A 1TUBA 2ONCA 5LSAA 1IOWA 3K70B 1CBUA 3T7JA 4Y2JA 2PV7A 3TN7A 1U7UA 2WU4A 1C3XA 3C5VA 4LGCA 1NBMA 1P2BA 2HAEA 2VDLB 5F4ZA 1A9XB 4ARZA 5AOVA 1C7EA 2C9BA 5LWQA 1H2RS 1SBNE 2ZB7A 4OM7A 4D02A 2INGX 4KPYA 5CLQA 1GCIA 4MHTA 1Z62A 2JVKA 5HTOA 1L1EA 2B1RA 3T7SA 1NR1A 4OKSA 4NCHA 4BLUA 4CTKA 1TYZA 2PUDA 2W6PA 1MXHA 1MPTA 4Q05A 5FXMA 3MBIA 4MW6A 5K0BA 4D42A 3PPYA 3VHQA 1P7ZA 1T6XA 4CQJA 1U9YA 4K26A 3I5UA 3TM5A 3QYJA 4LQCA 5HJ2A 1Z16A 4QU5A 4NZ9A 4TSFA 4BBJA 2VDWB 3DVAA 4M4SA 5ABPA 4G8BA 1V1MA 3JS5A 3NETA 3L4EA 4P3YA 5JROA 3RUPA 4R83A 2R8ZA 1N8NA 2H52A 3HCBA 3HL0A 4PBSA 4G37A 2CK3A 1Y7PA 3A1WA 4MUIA 3CS3A 4EIWA 2NVOA 5BSFA 4ER6A 2BRUA 2QVXX 4R6XA 1J7JA 3HGMA 3L43A 4EY6A 1DDOA 2YC2C 4CXMA 1ISHA 1TDJA 3NKVA 1VG9B 5BQPA 4JLJA 1OLOA 3I3OA 1E92A 2XIQA 4PAGA 1X7GA 3I32A 2BHLA 3E1GA 4L5AA 3RJTA 2FZKA 3KOMA 3M9WA 4EVQA 3EEQA 1MRZA 5BSEA 1MJNA 3TSAA 1LLUA 2IS2A 1MO5A 2FRXA 3PEEA 3U4IA 2GCOB 4FOOA 5T67A 4DV0B 4D7AA 2DHEA 4LSZA 4KQ2A 4EYSA 4QA9A 1AF4A 1LQTA 5C5EA 2W6NA 4C2UA 2N1MA 1WZNA 4YCNA 1EIWA 3CUWA 5F77A 5L7YA 3UTCA 3JYLA 1N34B 4LZPA 1M5TA 3LCJA 4EO7A 4FCTA 4DR6B 1W5EA 2QGFA 3ZLVA 2YHUA 4H60A 2ZAOA 4RDIA 1HFWA 1OXMA 4UEQA 1F5NA 2Y0CA 3GDFA 3D6NB 4NI5A 4DV7B 4GZLA 4EHNA 3QE9Y 3O0TA 1OX4B 3E8SA 3RCBA 4EYKA 2M98A 2Q4OA 4F9FA 2B5VA 2BVNA 4NBNA 2BGKA 4NMHA 1U9CA 1UDWA 5LYJF 4B6FA 1ISGA 2Q3EA 5A2GA 1KWGA 1KEEB 4KG7A 1J2JA 1XROA 5A4IS 2QD5A 4AYWA 3L7NA 2PZMA 4G1BA 3JYHA 4R1TA 2QQEA 3KZ1E 1WPXA 4F9EA 4Q7QA 2OK8A 1LJUA 3CIFA 4GG1A 1XK7A 2VTDA 1O0SA 3ENNA 4FKMA 4WNIA 2GZ3A 1W73A 1PTJA 4XEHA 3M1YA 4ZCRA 3RYCA 1ODSA 1UFRA 3K1JA 2CJPA 3RD5A 1ZISA 3P2MA 1NBME 3FVRA 4RVGA 4KQEA 3CY6A 3OM9A 2QPAA 1GQOA 2AOTA 5EIOA 4FWTA 1VMIA 1MFPA 2P2ZA 1PV1A 5EVJA 2VF5X 1J0DA 5FDFA 1N9GB 3MCAA 5CFNA 1E8NA 2XXJA 3P9ZA 2Q5HA 5DV9A 3JX9A 2FSVA 4DTIA 5LIPA 1QIDA 2BM1A 3H65A 4O0MA 5GADl 2DR3A 2Y4NA 3Q6IA 3PF9A 5ETJA 5E9WA 3TMAA 1QZXA 1RXEA 2OVFA 1RHMA 3WQSB 3ZI4A 4Y9DA 1QX3A 3OD1A 3PXCX 4G25A 2CNNA 1EP2B 4M22A 4I66A 5DYIA 3BF7A 3ILXA 3ZK8A 2FN3A 4EPWA 1YHZA 3EGWA 1E2FA 2IOFA 4DDUA 1B3RA 4O4LA 1UDXA 4YLGA 3N8DA 2WJVA 5KYVA 4WBXC 2MWMA 4LFCB 4OK3A 5KPJA 4MVJF 4DWWA 1KO8A 1OWPA 4CR7A 3AF0A 4AJPA 3SSMA 5LU8A 2DFLA 1KMHB 3K8ZA 4RFVA 5CVUA 1SOWA 2OLKA 4ZKDA 2ZUDA 2WMYA 1BQEA 1W4CA 1ZNZA 3AJAA 4HAWA 3D6HA 5DYGA 4P36A 1NIPA 1Y4UA 1XD8A 1W5FA 2HA5A 2WIBA 2PH3A 1BAPA 5F7XA 3HUTA 3MK31 1LNSA 3FG9A 2QJTA 4GWLA 4WX2B 3WGZA 3BREA 2ACEA 1MP0A 4WZAA 3F3YA 2C2XA 2CCJA 3L6DA 5AJUA 3U7FB 1Z17A 2I4LA 5DM1A 2ATXA 2R6JA 2WP8J 2Q2OA 2YVQA 1CQIA 1S7CA 2XA1A 3VOBA 2QUHA 1M6WA 3ZXXA 4AS2A 4CIAA 3AVUA 1UZLA 5IAOA 3AUTA 5L3RA 2IX3A 3GDWA 1J97A 4HGRA 3SHTA 3ZEAA 1ZM2A 4PLZA 1RKXA 1T8YA 2XOXA 4NLLA 4X97A 4KWTA 3GA7A 4OQDA 1JXQA 3DHNA 1Z68A 2EJVA 2GVDC 2GBGA 3K1TA 5HIIA 3DF9A 1NPYA 4JR0A 1IAQA 1QCYA 3M5PA 4GVPA 1YQWA 3H2HA 3K4HA 4JA2A 1ORRA 3LQ2A 3ZWBA 2R2GA 2VF7A 1CZHA 1R9JA 1Z34A 2B94A 2HYDA 1NJ5A 3SOZA 4TZ0A 4TYWA 3P9QA 1Z7YA 3C15C 4TV8F 5TGZA 1F4PA 3WKEA 1RYHA 1CRWG 3VU3A 3MMZA 3PC7A 2C92A 3MRXA 4B3XA 3W3AD 2DFDA 2MU1A 3PPWA 1LD3A 1JUDA 4YDRA 5DE3A 3SIRA 4YBRA 3JY6A 2R87A 4N48A 1NVMB 4BNKA 2GRJA 3GJTA 2OO5C 3TD2A 3WOVA 2A1IA 2FZ5A 3M3HA 1JH8A 1XVTA 4C0LA 3S8YA 2P6PA 5C51B 2VSFA 1Z6TA 2C2HA 1D2RA 1K6XA 2CFSA 1AE1A 2AFHA 2XUHA 1YMVA 4I55B 2B83A 3CB4A 4J1NA 2F7SA 3ZD6A 3ETJA 1BSVA 4Q0MA 2O5VA 2QT9A 2ZFUA 1ETUA 4KVAA 1CF9A 1D1PA 4B5LA 1L4GA 3SMVA 4Q48A 3OZTA 4ZYTA 1ESCA 3LY8A 4I2VA 1IN8A 3AESA 4Q3BA 3TE6A 2CLKB 2FAXA 1T0UA 1NF2A 4EUSA 3F6SA 4Z4FA 5BN5A 1REQB 5H3CA 5AH0A 1WLSA 1XTPA 2JHAA 1I2CA 1MG0A 1CY6A 1KBZA 1L8OA 4CV3A 2XADA 1BU5A 4P92A 3HCDA 2F2TA 5ALKA 2ZBRA 4OI4A 4Q9LA 3VPFA 3WB1A 5K45A 1RAHA 5BWBA 4BCCA 2VHVA 4PC7A 2F90A 3KZVA 5DX8A 3THYB 2HFKA 4C4TA 4PV7A 1FVXA 4ANFA 2YJ3A 1DPFA 3B6JA 4U2CA 3CUVA 1P73A 3PD1A 1QDEA 3DE3X 2ID8A 5B7NA 4TUYB 5K8JB 5IM5A 4YGYA 1ZK4A 1GA4A 1ZRHA 2ZAMA 1XZGA 4DLSA 2IS1A 1RZRD 2IW3A 3GN2A 2K5UA 3H4IA 4CM5A 1V8OA 4UVGA 1RPTA 2AEEA 1PQPA 2EGHA 2YJ5A 3EQ6A 3NOOA 4CDMA 5KJ1A 1H4SA 4MRMB 5TF0A 2PUCA 3L49A 4QXOA 3W3ZB 2ET6A 1LA2A 2QMYA 2RHWA 1NNEA 4WZAE 1ZGBA 2GYUA 5IDVA 4PWYA 1IVSA 2OMKA 5CLFA 1JIKA 2WJJA 4HRVA 4G9BA 2HNAA 4PPQA 5GZ3A 1P7CA 4JI0B 4HUQB 1GT91 3OTOB 5IMBA 4UQOA 4F8YA 5LVAA 1SG0A 3ZDDA 3GR6A 2K2WA 4ZEMA 4Z9YA 5K6RA 3UW3A 2BEUA 1T13A 5BSHA 5DB4A 4AY4A 4JXKA 1RWKA 5HPYB 1NN3A 3OP4A 2B98A 5AP9A 4RKFA 4F8JA 3WADA 1EG2A 3E48A 1E4OA 1TA4A 2I91A 4L0CA 2RGYA 3E8MA 4GL2A 4EGAA 1QPGA 3JAWA 4PYIA 1O8BA 5MHTA 3W2IA 4DZRA 4G4IA 2X40A 1F8UA 2OLJA 4YPOA 5C7IO 1WHTA 3QY9A 2V1XA 3T41A 2R65A 3RF7A 4P98A 9ATCA 1C9EA 2R0QC 3MINB 2HMUA 3NTQA 2QB5A 3M5CA 3AY7A 2UYHA 1YASA 1B16A 1C14A 2LGJA 3L77A 1AXGA 5JJIA 4YCSA 3AG6A 6ABPA 4PC6A 3GUUA 4H7JA 3P4YA 4AY6A 4R3NA 3SJCA 3NDBB 5LYJB 3ETCA 5A1TA 1XYYA 3OIFA 5DOVA 1C9YA 1FP6A 1N5MA 4E88A 4D6YA 3CTPA 3HCEA 3TW6A 3NQ41 1P1KA 1QIGA 1XZMA 1QYWA 4RMGA 1YFJA 2YMQA 2JGRA 1TTQB 1MC8A 4MPTA 4BMYA 5K20A 1GRVA 2ECOA 2C4NA 4ZT6A 2ZJ8A 4UPVA 5F21A 4XYMA 4LDRA 1Z6AA 1AV7A 5A2QA 5IAEA 1CIJA 1T5LA 4DBZA 7YASA 2O8DA 1RHUA 4E11A 3UWKA 5K8VA 3R9WA 5H59A 3VYSB 1MB9A 2O14A 4MI3A 4MUNA 5KZMB 4MB2A 4CPDA 4GKKB 2QA5A 4R2HA 3H6GA 1M2OB 3COJA 3V3TA 2YJ6A 4OKNA 1LJ8A 2CBZA 3T9FA 4OD0A 5KTSA 1KJWA 4PYLA 4QTYA 4QG3A 3RW9A 4GEGA 2BE7A 4X44A 3OEHA 4QKQA 2ACKA 3C1AA 1IHXA 3NTUA 2OPHA 5JS2A 3ZX4A 5AIAA 4JEUA 3F49S 1A9OA 4OGWA 3VR2A 4CM3A 1NJ2A 2QRMA 5D1NA 4N6OA 5IVIA 3DOOA 3FY4A 3OAAA 1KI6A 4A26A 1G7CA 1QKIA 2ZT5A 2AF4C 3HFJA 2IV3A 1CCWA 1EVZA 4Z9BA 3S6JA 3VDXA 3ZU2A 4JS0A 2M32A 2PBLA 4HI0E 2YWGA 2H2WA 5KDDA 1PD0A 1B41A 4K2HA 3GCGA 3DLAA 1SUDA 2AKYA 5GONA 4P2BA 2LDXA 4D9MA 2NU7A 1OHHA 2A9JA 3ZKWB 4ZVVA 1ZJ6A 2IHUA 2FUG1 2EEZA 3TLKA 1ZD8A 5KVCA 5IT4A 3Q8LA 4L74A 3PHJA 5TLSA 4OOEA 5F9HA 3HSSA 1MC5A 5LP1A 3MLAA 5E1BA 3L8ZA 1YI1A 3HGQA 3ZDAA 1UXOA 3AM1A 2FNAA 1AQ6A 3H5WA 4OLHA 4B0PA 4QXRA 4EUKA 3CVWA 2GERA 1VA5A 3O4VA 4YRRA 1YK1A 4MNTA 1K3TA 2IZ6A 2PY6A 3D4IA 3KJHA 2XOKD 4KITB 4C7JA 3IUPA 7ADHA 5LIRA 3LWNA 1JGTA 2DETA 1SXHA 3R7AA 3OIDA 3FZQA 2PXAA 4BFVA 4Y8VA 5GGYA 1Y8ZA 1AC5A 5FOVA 4YQEA 3T5DA 5K6AC 4HYEA 5JSQA 3P2IA 3PNYA 4V02A 1IM8A 2VNSA 4WK2B 4ARSA 2GN8A 2WKQA 3KYBA 4RKWA 1HTTA 5GGXA 1BA2A 1RKVA 1PX0A 3LHSA 4GRAA 4O2AA 3DT9A 4ZZ2A 4M6WA 3W05A 1A97A 1Z4LA 3I8OA 4HWRA 5F7JA 3ZCTA 4CKXA 4OIMA 2EF0A 5IUNC 1Q0TA 2JCXA 3H04A 4IQ0A 3N0WA 5JS1A 3QKRB 4KVFA 2ENUA 2ORVA 3AJEA 3ZIDA 3F8TA 1XMQB 4BB9A 4ZI3A 5DBHX 1QLJA 2JLWA 1GV1A 2QGZA 1T9ZA 2VOEA 1WUIS 2JKVA 2YV2A 4HHEA 5HKKA 4D4IA 3O1IC 3O26A 4P08A 1NVUQ 2H57A 3VR4H 1SOMA 3ZIAA 3QXSA 4J0HA 4A2WA 1H2FA 3RARA 1GKYA 3ZHYA 3QTTA 1YS7A 2BV3A 1A8QA 1NR7A 4RSRA 3RS9A 1MAVA 3W9SA 4OJTA 4B7UA 4BX9A 2I62A 4XARA 1DC3A 2WIKA 3NT5A 4FE7A 5T64A 4E22A 4E6EA 4X1IA 2C94A 3TOSA 1XN1A 4JVOA 3ZGLA 2V6FA 5EGNA 3OPNA 4B47A 3IXLA 5MF6A 2HR1A 4K6MA 2JGNA 3FCUB 3G8CA 3S8EA 4QGFA 1F6WA 2ZTVA 3JD3A 4YV1A 2GCNA 3FYUB 1H2AS 1ISSA 1F8FA 3FUVA 2P35A 3IMEA 3OQJA 4X91A 4CCAA 2GD2A 4EPYA 3QEBZ 4Z51A 3NHSA 4ZV9A 1SQ0A 4A36A 4DY4A 2W6ID 4ZXPA 3VO2A 4AG3A 3PQ8A 4C6TA 5DLEA 3V8BA 2OXEA 4PZAA 1KVUA 2E2WA 2WJHA 3GJ6A 3KUXA 2B1JA 5FTJA 3TLEA 1ZW1A 4PZCA 3RT7A 1EFAA 2OCBA 4L76A 1N5IA 3HLTA 1GL3A 5JRJA 5C1IA 4K6HA 4Y9SA 2ATVA 5L6MB 3MS4A 1H2YA 4EJMA 3BD7A 4KXXA 4GZ6A 3BSSA 3K92A 1O87A 1S9HA 3V4VB 3PYXA 1TT7A 3T7CA 2ZWVA 1EUZA 4REMA 1CEYA 3DDWA 2WF7A 3KKMA 1OBVA 5KTPA 2YKGA 4IIXA 3E2PA 3VH3A 3DE4X 4X62B 2LP4Y 2A0UA 3DNFA 4WN9A 1V8FA 2FFQA 3I6BA 3SP1A 1CFJA 4P7BA 4BNDA 2R9VA 3ECAA 3A6LA 1MA3A 1UBCA 3L6RA 3I58A 5KKNB 3HNOA 4ZAVA 4ZGBA 1AMUA 2CLMB 2WR8A 1TUEA 1NNI1 2XYGA 3EB9A 4D5EA 4P5PA 2QTZA 1RACA 3IQWA 4QRIA 4WEQA 4MS4A 5FBRB 4V38A 4P4UA 1S2MA 1ZD4A 5TRTA 1T0IA 3TWOA 3RM3A 3I5AA 1Q44A 1KDYA 3PNQA 3IURA 3TO5A 2WKRA 3L8CA 2XRZA 3AU9A 2FQYA 1E58A 4OH1A 4M1MA 4ASUA 3FWNA 1JP7A 1JLKA 1XZLA 2PSJA 3P0JA 5CT5A 3CNLA 2MSKA 4MX8A 3ZE1B 4Z9XA 1PE0A 1KSFX 3B6MA 2ZPUA 4IWXA 3O8QB 1OROA 2P9BA 2NSJA 2QP4A 3DEIA 1JE0A 1T25A 3UC5A 3FCXA 3UHAA 1LQUA 1KKLA 2AQIA 2RGEA 5ESWA 4F3RA 3GJ5A 4EHBA 2ANCA 1WTAA 3GGSA 4TKUB 1LPNA 2AYXA 1RRFA 5FJIA 1MT3A 2IUSA 3RHSA 2IDJA 3KXIA 5CFPA 1I0LA 2V4ZA 2IHKA 4HYQA 1G19A 2EL9A 3GWGA 3EWIA 5HCNA 3URKA 4LQDA 1YZNA 3QF4A 3AJ9A 3IAHA 4V0SA 2NV2B 3QA9A 3K9QO 2ID7A 4PFQA 4DG8A 4BYMA 3GLFB 5DASA 2R11A 3WGMA 2PD3A 2RHDA 4AY3A 5IXJA 3UMFA 4QQNA 3T7DA 1HG1A 1LZLA 3SC2A 3PTLA 3RKSA 4LK2A 1UP7A 2BT4A 5CITA 3HV0A 4K6FA 4AZ0A 2JD0A 5BSUA 4DARA 2H2FA 1GR1A 2ARKA 3EEYA 3ORQA 3QXJA 2JDID 1MVLA 1GR0A 2GYVA 3V7UA 1M2WA 3G2LA 2Q6LA 3K9NA 4FLEA 3SVZA 3OOSA 4TL8A 3P32A 2Y0EA 3R40A 1JLRA 1V5EA 3FGZA 3WRXC 1XTKA 4PG6A 2C4TA 4WZBE 5JUWA 4CF4A 3S1LA 4EG4A 5EIEA 2PE5A 2PUAA 1T2FA 2J1LA 4RIEA 3TGWA 1Y80A 3GW8A 1IZ7A 4AMVA 3Q2OA 1M5RA 2COKA 2XKAA 1PQWA 4Q19A 4YUAA 2UUAB 1VMKA 1ODLA 3GUVA 5JWHA 5LA6A 1EWQA 2WUFA 4Y2YA 1V2HE 2PZGA 4BEBA 1LLCA 2AEMA 4RZUA 1NF3A 1ZBDA 4PNPA 3MWFA 5GIPE 2OM2A 4DDWA 2VPXA 1OFVA 4IKOA 2G7ZA 1UKVY 1CYEA 5DIFA 1OV4A 3H11B 1I6WA 2AEFA 1UINA 2P1RA 1GQQA 4ZOEA 4G0QA 5DM0A 2ZUTA 4BZZA 2CLOB 3JQGA 4BFWA 1FS6A 1G1AA 2EKZA 3Q9SA 3CX8A 4YONB 3RVNA 1UZMA 2C88A 4MV3A 2ZBPA 2DBZA 1EGMB 2XT6A 4Z8YA 5IBRA 2RSLA 4YCCA 1OB2A 1Z29A 1HC7A 1L5QA 5JISA 3KQKA 4GPZA 1QIMA 1ZLYA 5JW6A 4L02A 3U6BA 3M4ZA 1M6VA 1MAUA 4IOKA 3RNOA 4K9OA 4M0EA 4MLCA 3GEIA 3EDMA 3QKSA 4BVHA 2G25A 3HHPA 1NVWQ 5DGDA 4OHVA 4URWR 5A9TA 2Z2JA 3ECCA 4L85A 5TF4A 2NPFA 3OPXA 1W48A 3B3JA 2PGLA 2XMZA 3PUHA 4LXHA 1RQGA 1XI2A 4MP6A 1K7CA 3SM3A 3W5SA 5B6PA 2WTUA 4BXOA 1AKEA 2O2HA 2Z2ZA 3UMBA 3A1EA 1TM5E 3HO8A 1K0FA 4N03A 3T3GA 4KH1A 4C07A 2UVDA 3EHEA 5CLGA 4C6HA 2B3TA 5DSTA 1Q12A 2P68A 3PHHA 2IYOA 2QX6A 4R8KA 3KXDA 2Y0DA 1X9HA 1YZQA 5KHLB 2CY0A 2A9FA 5JH7A 2XWSA 4UKDA 3TQHA 5A0TA 2DUUA 2XMGA 2FA9A 3T4EA 3KL4A 4HB3A 2WD9A 3ST7A 4KE9A 1E5XA 3VVMA 4TKVB 4DXAA 2ZRNA 1XJCA 5HOEA 2PX2A 1E9BA 3L7MA 4JL6A 3PQ7A 3RSCA 4DQKA 1VSBA 4EKEA 2EC5A 1KZGB 3GMIA 3X3HA 2RHJA 5A4MS 1YULA 3GLRA 3LK7A 3D3KA 3QLVA 1SM4A 2OORC 3DCYA 3ESZA 4D0LB 3EVFA 4ZOCA 3R7FA 2L0XA 3GFVA 3AF3A 4U39A 5BRNA 1FX1A 3IKTA 3OQOA 4R1QA 3EOAI 3OEEA 4BLRA 4RZQA 2QRVB 5KEIA 5E7QA 5LXTA 2CYAA 1L5RA 3HR4A 1E6UA 1Y1PA 1AMOA 3QPDA 5FPQA 1LZKA 2O8CB 3T7RA 4ZVOA 1ST3A 3PR1A 4MQFB 5LP6C 1W4LA 1VE9A 3OOEA 4L08A 3G2HA 3CEJA 3LX5A 1YWGO 4JXJA 4H7EA 3HBJA 1MIOB 4LJ9A 1L3IA 4I7EA 4LOKA 3A04A 4D9FA 1X1QA 1ICEA 1U1GA 5EPOA 3AI2A 4ZARA 4F2DA 2YCBA 1VHWA 3ZJ5A 1T0JB 3S2GA 4ALNA 1SCUB 3W3AH 2Y6UA 2YYSA 3UMSA 1ZJ5A 5EIWA 1YJXA 1G8KA 4MQMA 2PCJA 2C2BA 3B1FA 2X0IA 4PGAA 4ZI5A 1AO3A 1ECCA 1ONPA 2I4MA 2K6GA 2XMBA 3ORYA 4IZIA 4QZVA 2ZE7A 1PGNA 4HNAA 1YKFA 4F04A 4P7FA 2XBMA 3TRJA 3HMKA 3D0RA 1CJBA 2OHIA 1Z88A 4JQOA 5A4DA 4CG1A 1T36A 3ZJ4A 5CYFA 2XUJA 4ZQHA 1TM2A 3P26A 1M1XB 1CLEA 2RG1A 3RB8A 3ZBUA 3ZZ1A 5LN1A 3U09A 2OCIA 5CM9C 2VL7A 3T1QA 3DAOA 2EWMA 5MN5A 1RZVA 1PR6A 2P69A 1FU8A 1GTJ1 5E3JA 3WIDA 1GIAA 2EBWA 2FWAA 2R96A 1VQ1A 3BXHA 1CEQA 1GPBA 4BNHA 2QM8A 1EFPA 5EOVA 3W9BA 4OHMA 1OUMA 3N6RA 4POAA 2G0TA 3D02A 2XF2A 1TQDA 3G6WA 3NBXX 1SD2A 4F3NA 2FEAA 3HK2A 3PE6A 3I45A 1IZ0A 3OT1A 1AH2A 1SQFA 1VPEA 5TPWB 3CURA 4Z3KA 1SURA 1KMMA 2C8KA 4C6RA 3IEKA 5DEOA 1R8QA 3B7GA 2J5KA 3IAUA 2GXUA 4A6DA 1WETA 4TS4A 3GP3A 2ADMA 2FX3A 4GLJA 4EEKA 2Q6IA 1B1CA 3TXYA 5AOBA 2ZBVA 3AR4A 5HF6A 4TRNA 2C3UA 3HCNA 4CM7A 4JYZA 1XCLA 6YASA 4WINA 5K4HA 3OZDA 2I78A 3E4CA 721PA 3KSRA 4INAA 2OFFA 4UM9B 3D4BA 1DAGA 1FRZA 3I9OA 2CYBA 4HJRA 1WEKA 4I1VA 3M6LA 1GTVA 4URYR 4XDGA 5DNUA 5ALFA 3WLMA 1E8DA 4A5SA 2YN2A 2BDTA 4LI0A 5EE5B 1WZUA 2ZSJA 5FLEX 3R5KA 4FU0A 4WE3A 5HZKA 2PZEA 3LUFA 3B5JA 1PNTA 3WICA 4I08A 4KIWA 3ESCA 5K0FA 1QG4A 1GQRA 4KEAA 4F71A 4PM4A 2B6NA 4MQLA 4E09A 1RWXA 3CPHA 5F64A 2B2XA 4RFSA 3F0TA 1H5QA 3KO8A 3RIEA 1CR4A 3W5HA 5MFZA 4KN9S 1A7JA 1PL7A 2AUTA 3ISJA 4FGJA 4OLFA 5EHNA 3RBVA 1NASA 3QSYA 4CQMD 2ZVDA 4MUBA 5IC5A 3RSOA 4U1RA 3UM9A 1ABBA 2G0AA 3AR3A 3KLBA 3OCCA 1ANKA 3OFNA 3GNQA 4ODIA 1H05A 2BIFA 2X4DA 3C3BA 4UASA 4DIMA 4ZDJA 4A8JB 4C0AC 5F98A 1AJEA 3O2SB 1X9IA 4YROA 5BN3A 1M2GA 5BOVA 4ZJYA 1WHSB 4IDQA 1B8VA 1TLTA 4MVXA 2HLDA 1GUAA 2VPPA 4OI2A 2X15A 2GRUA 2OM6A 2L19A 4P82A 2J7KA 3K0FB 4FGZA 1ML4A 2AJ8A 1C8BA 2Q50A 3RSLA 1Y6QA 3W6ZA 5KDOA 2H2AA 3CZAA 4WY5A 5T57A 1QGDA 3VZSA 1NYLA 1SC4A 1GLGA 1MKYA 5H1YA 4AJ1A 1UC9A 1EZ1A 5JD6A 3RT9A 4GECA 2BMVA 2ZI3A 3MHPA 2WFLA 2DTEA 1KDRA 4LJYA 1MZPA 3FDIA 4PO9A 1VE6A 4B87A 3H99A 5A7HA 3EY4A 4O5AA 3CV3A 3AVQA 4TGLA 3ZU3A 4OBXA 4ZI7A 1OH6A 2R7MA 1TYEB 3K3PA 5BXQC 5IUJC 1ZITA 4JWTA 2Q0XA 1Z9BA 2JLRA 4RESA 4LXGA 4D9IA 3NT4A 4K3VA 4CTOA 2HBYA 2I1WA 3D6UA 1O54A 3TTTA 4UMEA 1YDGA 2QHXA 4BNNA 3DE7X 4KIUA 3BMNA 4TROA 3AY0A 1ZRSA 3PQ2A 1ZXLA 1LK5A 1FZTA 2AG5A 2YY6A 3O8CA 1A9QA 3ZXIA 4PXYA 2VJNA 1FRVA 2W93A 3FPJA 3NGMA 5JRZA 3DOJA 1FRFS 3WIOA 5AKZA 2AZDA 5A06A 1AQUA 1O89A 2KLBA 3WAKA 1DJPA 3AM4A 5A3VA 4BDTA 3OMXA 3CVJA 1JQDA 1N6KA 1T2AA 3FDFA 1DC5A 4CYMA 2Q9CA 4IVQA 2WYVA 3D3NA 1IEWA 4MWZA 2BFDB 1RXYA 1EVJA 2RH5A 4Q15A 4EB8A 5IJWA 1U8AA 1L5HA 4B35A 4KQFA 1NG1A 2HV8A 1FFCA 3MJCA 3W04A 3PCXA 2OTCA 1NLUA 2Z3ZA 4A0SA 1H6BA 3GGPA 2B8TA 3OLZA 3L6UA 1MTZA 2QR5A 3G68A 1GM5A 3BMQB 1N57A 4PLYA 3ZLBA 2WIGA 3ID6C 3UIEA 2WSSA 1ZNYA 1B2RA 4YXWD 4M9XA 4YAKA 4OHKA 1DTWA 1RYFA 1W4AA 3IAS6 2FE1A 3TTYA 3VKGA 4KO8A 3FYSA 2FTKE 3L8MA 2DR0A 1FYVA 4LDQA 4OJYA 4QXPA 2I54A 3HXTA 4BZQA 4GOJA 4DT1A 4JXXA 1BMFA 1Q14A 3GJ4A 3MGBA 1XPJA 3PCRB 3BHMA 2NQ8A 3KOYA 2CMFA 3FKQA 3EMBA 4JDPA 3UJ9A 5FT9A 2NM0A 1ZIXA 5E4JA 4HEA6 4YRFA 1UBTS 3VZQA 1VA4A 4DR7B 3CLUD 4L9WA 3KKEA 4L2IB 4FJ2A 1RHRA 3LNTA 3K05A 1SC1A 4KK3A 1FYXA 5TJHA 5C8XA 4LOIA 5B2ZA 4EVRA 5LOVA 1OTXA 1DLJA 3W8EA 4CV0A 4E32A 3TX6A 5CHYA 4MB6A 1RCTE 2CLHB 1ZMXA 2COUA 3EC7A 5GOTA 2ZQZA 2ZOSA 2P2LA 4O2BF 1QAMA 1QZZA 2CN1A 3N05A 1OXSC 3HJHA 4WH0A 4DY6A 4J1QA 2XUKA 3R76A 1ILEA 4RQTA 4YHBA 4BJ1A 2NSLA 1DQYA 4RLSA 3ZY5A 3DZIA 5K3EA 2BKEA 1TF5A 1BNCA 1VPVA 2RAUA 3GH1A 4TYQA 5EUQB 4LI3X 4E1AA 1LDGA 1XRQA 4OXYA 2GAFA 2HK6A 2OBMA 3VO1A 1S4MA 2QN3A 1GQYA 4A15A 3OOHA 4R2KA 4IV0A 4RJJA 3U4AA 1ZIOA 2OG1A 2GJ9A 4WUVA 4PWZA 1M8KA 2IDMA 4NH0A 1DWUA 1NJSA 2SECE 4XQ9A 2ZXEA 5IM4A 4HQRA 1P3DA 1ZQ1A 4EELA 4D5GA 1ILWA 1C1DA 5EIBD 2F1IA 1FXSA 1NW9B 1J25A 1GG2A 3BWEA 3GG9A 4JENA 5J5AA 3SJ7A 2Q5CA 3I1JA 2XB4A 1ADCA 2A94A 2P78A 3NX4A 3TFQA 4F2PA 3QVKA 1SKYE 5ECDA 3WQHA 3IQGX 1HOXA 4Q1FA 2O5EA 1IDN1 2Z57A 5AI4A 1JHMA 2C29D 1TKRA 3BMCA 1UBUS 1WUTA 2GN4A 1UFKA 2J9XB 2P9QA 3Q9NA 1YJ8A 4LBYA 3UJCA 3I34X 3WSVA 5JWOA 3ADBA 3B1YA 3RJ9A 1HZZA 2CXQA 5TB5A 5TQVA 1VSTA 3KZMA 2QQFA 4WXRA 1TT5A 1KDTA 4A16A 3LDHA 3AEKA 1H0RA 1KHTA 2JAHA 2XYHA 1E0KA 3AWIA 4PAMA 2PLRA 4KREA 3EXHC 1ID1A 3SQNA 2JIRA 3KM0A 3LLSA 1NXTA 3ANLA 4IIBA 5AI0A 5DN6D 1E62A 3WMRA 4N0DA 4KPUB 3H87A 4DBLC 2Q3LA 2X2EA 2O2ZA 3WRXA 3IHTA 3S70A 2XH8A 1M76A 5C7OO 2DH6A 3PFHA 2YHBA 2N46A 3L04A 4PYJA 5CVTA 1T5TA 3BX1A 2R48A 2VI5A 1DGQA 2FSGA 2H1HA 1ECPA 2X6RA 3T3DA 2HTEA 4DLPA 1Z63A 3KTFA 2C5EA 2I6FA 2V7QD 1ZIYA 3STXA 3KT0A 4TTSA 4B0OA 4H7FA 3RUCA 1QO0D 2H48A 3A9RA 4D0SA 4ZCLA 1R0SA 4NDAA 4EITA 1G8JA 2UXDB 3I1FA 2VLIA 3AL2A 5ALLA 4WPGA 2WD7A 1JHUA 3ZDEA 4BB5A 5EMHA 4B45A 4MRRA 3STVA 1EVIA 2F3TA 4GMKA 2P4HX 5A3JA 2MT9A 1C9MA 2MYPA 2O3QA 3F47A 4NEHB 5ARCA 3STWA 3GP8A 1L4LA 2XDQB 4XDYA 3DC7A 5HNKA 3BUSA 1QHYA 4H6VA 3HB9A 4JGBA 4NMMA 4GOKA 4QOIA 5GV8A 4D4GA 2UYGA 1XZKA 1FP4B 3TLGB 1ZN9A 1Z2AA 2BPOA 3HBAA 4QPZA 1C9DB 2WAMA 1X74A 2ZJ1A 1KOJA 5AICA 3IERA 5KC9A 5KVSA 2A9OA 2H5IA 2RAPA 5HILA 1QQ5A 5DXJA 2ZJ3A 3Q8KA 2GPJA 3P9XA 3GQBA 4FEEA 4W99A 5DHTA 4DSTA 2AG6A 4HDMA 4DUZB 2H16A 2OXRA 4Y1FA 3MAGA 1M1UA 3OC6A 3OKPA 1Q16A 5P8WA 5BR7A 1WXFA 4OAPA 1DRWA 5SYMA 2X1VA 2PX3A 1N6IA 4KAJA 2D1FA 3SF8B 1F3LA 2PSDA 4UAGA 5CURA 3ZY3A 4HQ0A 5T7BA 2IXBA 1LTQA 4AJHA 1JQEA 5G2OA 4EGSA 1AQJA 3ENZA 2IEGA 2RKWA 4BIIA 4N8EA 3UAVA 5L3SB 1GDTA 4ZA2A 1P1FA 3VVCA 3UT0A 3E3NA 2GK6A 1EUDB 1XTVA 1XDZA 3QVTA 2OXTA 1MVNA 2GPTA 3EGIA 4TSFD 2FQXA 1G4AE 1J8YF 4B81A 3LTEA 4NBRA 3DUFA 5EWJA 1MGPA 2L2QA 4NZMA 1GOTA 2ZVJA 1CY4A 3KSBC 5ELXA 2ZJAA 1DO2A 5EXDA 1PAUA 4RVOA 2G6TA 1RM3A 3GZNA 2QM3A 3WX0A 1OAOC 4C4AA 3GXBA 1CHDA 1Z6ZA 4GXRA 1IOZA 4S1TA 3HJBA 3UWPA 2MINA 4R0VA 4TQ9A 4ZREA 4AKTA 4LX0A 5BWNA 4PX9A 4RHYA 1ADJA 4BU1A 1J1ZA 2P27A 2SCUB 3V8PA 2X8WA 4RLFA 2F48A 4FHZA 4P34A 4DADA 2QD3A 2VPWA 2A88A 3GJZA 2P9CA 3VI4B 2I71A 3R0QA 5LP6A 1G6HA 1WWKA 3X1KA 1X8LA 3EJWA 4MWGA 3ESDA 3IV7A 3LXXA 1XTSA 2V45A 4OGGA 5D3ZA 2JJ1A 4TVBA 4X45A 1ULTA 5K1ZA 5SICE 3VPBA 1OGJA 2H7XA 3RWBA 2PH1A 1Q1NA 2GVNA 4HO1X 4QDKA 3CA8A 3JWGA 4P38A 2GF2A 3QWIA 3T1OA 3V33A 4IJQA 4N7BA 4YACA 4UCXA 2NXCA 2AWOA 1GTL1 2QX4A 3BXZA 2QYTA 3B89A 3H3JA 4B8YA 3K0AA 2D2XA 2XECA 2DHCA 5E3IA 1WDWB 4YMHA 3I2JA 1TCVA 2B7CA 3K6SA 2NTYC 3M1IA 5J2TA 4JYAB 1D09A 4PZEA 2AMYA 4G65A 2IV7A 5LB4A 3RS2A 3Q5EA 3W5VA 4A5OA 2ECQA 4CDNA 4ABTA 1EVYA 3DAHA 1ECJA 4GRDA 4JUCA 3EC2A 2W2LA 1TFRA 1DUVG 1EXWA 4N4AA 5AJWA 3IQXA 3AHCA 4PY2A 4XD7A 3SWWA 1YVRA 1ZGZA 1RABA 4H7KA 2IYTA 5JDCA 1GNLA 1TVKB 3QVOA 4KLAA 4U7WA 1AKUA 4REQA 2PGNA 1U04A 4EHFA 5ICSA 2XVAA 2WYIA 1QZTA 4LJ8A 1OZHA 3OZRA 2LDBA 3M9LA 3WMGA 4RTKA 1RPNA 2NU9B 2FI1A 2NGRA 1EPUA 4R05A 3W7VA 1CR6A 1NUQA 2YBDA 3WAJA 2YWJA 1IQUA 2KQUA 4ZODA 5ALEA 3D7LA 1XZNA 3DEFA 5ALWA 1XPRA 4QPJC 3BA1A 5ITVA 4N5MA 4KN8A 1Z15A 2AOXA 1E2KA 4PQGA 5T4FA 4EW3A 5DK4A 5M2QA 3RG2A 4E5SA 1ODIA 5KIAA 2F64A 1KYXA 1PFQA 1MEJA 4QOSA 4PNHA 3VSCA 3TSOA 2I4NA 2JCGA 4GZ5A 3RIHA 5JANA 1ZM9A 2HEIA 1KEWA 3AY3A 1O4WA 3KL2A 4M86A 4ENPA 4DV2B 4ZU1X 4AI6A 2VP2A 4KNVA 4L72A 4QNMA 2VPYA 2KMLA 1TJ5A 4UUQA 5JD3A 3I6QA 3LUAA 4AYTA 1AV6A 4IOJA 2IITA 1OZ0A 4NEQA 4AKHA 3JWHA 4EB6B 5B57C 5LKRA 3UY4A 4Y2GA 3KKLA 3HY4A 3X44A 1GITA 1G21B 5CPBA 2AH5A 1JECA 4JL5A 4CDGA 6REQA 2IIPA 4J4HA 1T24A 4W5OA 5EMLA 1KOGA 2P6MA 3N2YA 3NRJA 3SZUA 1KP3A 2YJZA 1PWEA 4G4GA 3S2ZA 4LYDA 2HBQA 3QOFA 5JYCA 4NVRA 1ECBA 2EZUA 3S55A 4KTVE 4L9SA 5IC6A 4AF7A 2JH9A 4RD2A 4F3TA 1H1DA 1XXHA 1B6TA 1VKOA 1UODA 2VRCD 4J1TC 4IOLA 2NMVA 3TW8A 4TTTS 4YCDA 2IWRA 1N4DA 1L7AA 5SZKB 5ALQA 4EENA 4V39A 1J49A 1P33A 3OU6A 4BFLA 3A36A 1F9AA 1JLHA 1T2EA 2IBMA 1E1QA 2BFAA 2HMVA 3LOUA 3MIZA 3R2JA 1HLFA 4UC0A 4XZ3A 3RC1A 3CNQS 4G89A 2MJLA 3HCFA 1NFRA 1QORA 3N5KA 3PX2A 2BEVA 4PO1A 4PZDA 3ZVNA 1HNZB 5IAGA 4ZPXA 3SQDA 4HVLA 4HRAA 4EY5A 4OVKA 4YO7A 4ZV7A 3ZHRA 3C8UA 4V1CB 4F5DA 1DKNA 1E7RA 4FILA 5KQGA 2V5AA 1TO6A 4HD8A 4MV4A 2CBGA 2JEZA 3EXAA 3O1HB 2VUSA 3MM4A 2ZYUX 4HSGA 4G5FA 4OK6A 2CXXA 4RPKA 1T1GA 4M88A 4TQGA 1Z3CA 4BLOA 4HLCA 3IFSA 4PC2A 3Q4GA 3BE4A 3K9CA 2ZXUA 4KWCA 4ZC8A 4LF7B 1E1LA 1KSGA 2PLAA 1GP2A 1NW7A 4OHOA 3SBEA 2GETA 3GL9A 5EJ6A 4WJZA 3HCWA 4L4SA 3EG9A 2PM8A 2PRYA 4X1YB 4ZT4A 1DVRA 1BKDR 3PENA 3WGKA 1X1BA 3C4QA 1NOIA 1TLLA 1ZD5A 2JBAA 5IT5A 2FPPA 3ABQB 3DNMA 4HC4A 4E30A 5J4YA 3LWDA 5JD4A 3Q40A 3OT5A 4RVNA 2XQIA 2BDUA 3WGTA 3H8JA 3L7CA 5K3BA 5SZHB 3DM5A 3S2YA 4D3DA 5A4FS 1O97D 1GKIA 2PRIA 3I6ZA 3QWFA 4D9GA 5KTMA 1USVA 3QGMA 3Q7IA 3IV6A 1NSTA 4WZ6A 4QLBA 3ER8A 4DCJA 4OQPA 4ADSG 3EY9A 1E63A 3A10A 2ZTHA 1QS0A 2RH9B 3GGGA 4MQEB 2IQIA 4UAUA 5AW2A 4H1HA 3OTQA 3NHZA 1XKXA 3RFVA 2FR1A 1N9ZA 2QZZA 2N3ZA 3GEGA 3KQVA 4PR3A 1NBIA 2IGTA 4R1OA 1XGKA 3T52A 3VVLA 5E6RB 4FDLA 1ISPA 1JQBA 4CQLA 4UM7A 1KPGA 2OCGA 2HJWA 2DLDA 2DPMA 3MXOA 4WDRA 3U9SA 1GTG1 1QQAA 2AJLI 4WVFA 4OOFA 2VDOB 3G0DA 3GYBA 5A3RA 1Y5IA 2D4HA 3NHMA 3PT9A 3EZ7A 1U8EA 4JI8B 5CJ2A 3EIEA 3TQFA 4ZTZB 3ND6A 3KYCB 3RUAA 3VR6D 5I4IA 5BYKA 1E2BA 2A35A 1GZSA 1IQ0A 4PCUA 4CLOA 1E2NA 1KEKA 4F6RA 4CLRB 1J20A 1CY1A 2IC5A 2ZRQA 5JNTA 1NMSA 3QKIA 1U3CA 2ZIUB 1RXSA 4GP9A 3EZXA 5D87A 4U2BA 5HF9A 1KAEA 1XXHE 1QH0A 1ZC3A 1W5BA 3OBBA 4O29A 2NZUG 3RC2A 2CCKA 2ORYA 4P3OA 2ZAIA 5IDWA 1LF0A 3MWJA 3QBEA 1Z4NA 3VSAA 4IMJB 5BYAA 2XXAA 4CN9A 5JYBA 4B6JA 1JQJC 3OE4A 1O0BA 4HUJA 1QNFA 1VCIA 1Q7RA 2IPLA 4ETNA 4H9GA 1JU4A 1YQ9A 3MTIA 2ZDGA 2QRZA 2X2FA 4MW5A 3RSGA 1QXSA 1W5TA 5JVDF 2P7IA 4GE3A 3SCZA 3OX4A 4WOBA 4D97A 1U99A 4XWGA 4CMGA 1SUAA 4WFKA 2WI8A 5ENZA 2AMFA 1JVNA 1SD1A 4YLEA 5E3HA 1M1NA 2D0OB 2XUQA 4JMPA 2PS0A 1MHTA 2YINC 3M6WA 4HVTA 4Y3UA 5JHGB 1GGJA 2XUFA 2K4MA 5K6TA 4FXPA 4XUGB 5DNAA 3LY7A 2RARA 1IDOA 1CVRA 3H8WA 3L1JA 4GT1A 4R84A 3O38A 5I3CA 3SZLA 5C52B 3GPLA 3ASZA 3WNQA 3EXFA 3ZN2A 3HP7A 3ONDA 4C5CA 4NMXB 3AKDA 1GGMA 4GMHA 4I8DA 1FVOA 2GR9A 4LV8B 3X1YA 1C5KA 1FCJA 1T5SA 4J0EA 3O94A 1DQSA 4ALLA 1H69A 3MD9A 1D2GA 3FYCA 2HADA 1TE2A 1WW2A 3A32A 3QPCA 1U0SY 2Q3HA 2QLFA 4HB2A 1AKYA 5EMJA 4C3UA 4MWCA 5EQDA 1ZI9A 3O2JA 4PE5B 4PYMA 5EQTA 1MN6A 2FP4B 3B2EA 3OX1A 1KO5A 3NYWA 4PG7A 1MJFA 1VYUA 3TJMA 1ORVA 4CM9A 3HU2A 1DC7A 2VDMB 4WZBB 2VXCA 4YJKA 5T4BA 5FBVB 4RCVA 3LF1A 3PNKA 2V6GA 4ZYUA 1ZJWA 2WTNA 4TTJA 1MOZA 1TYDE 2A5LA 3C8MA 1EVQA 3KNZA 1CETA 5DCUA 5A02A 4DYVA 3CZRA 3CO0S 2YWDA 3N2GB 4TKZA 4N49A 4EK9A 5MN4A 4CUZA 1JA0A 2BP7A 2EX4A 5ES3A 4Z1MA 1AHHA 2H1RA 2X86A 3DEAA 5B1SA 2CFOA 2L18A 2VUUA 3B36A 3EAGA 4O8ZA 2R4UA 4C0JA 4C2TA 5B2EA 2Q3BA 4MPJA 5CDGA 3K2BA 3MFQA 2GAOA 3N5CA 4MKRA 2AI1A 5EWLB 3OU2A 2A67A 2Q3MA 4M0LA 1Y7TA 4AZTA 3N1UA 4QDOA 1VI5A 4DMGA 1RRMA 1IRXA 1GEGA 1XOIA 1P4SA 3D6AA 4H0FA 3WJ1A 4E1BA 1AS2A 1L5YA 4IH4A 2ZRJA 3NYQA 3E4DA 1B76A 3BXGA 2HF8A 1XNJA 4MS3A 4YQFA 3LLCA 5E6UB 3X2EA 4EKNB 3FUUA 4YIHA 2BZ1A 2R1UA 3D3WA 4GXQA 4DSZA 3P2JA 3ORSA 2AC4A 3PEFA 1RWWA 5TDHA 3IBTA 2KHZA 3QLUA 2XMRA 3TLJA 1FVFA 5JSZB 2BHSA 1IWPB 3L41A 3GFBA 3G2JA 5AR1A 3HJGA 1ZM4A 4UBMA 4FD3A 3RUDA 5EYPB 2WQ6A 3ZY4A 4LVOA 3K8OE 1CPYA 3IP8A 1SVLA 4IQ4A 4EYOA 5DTJA 3TK1A 5JYEA 1JFVA 1DELA 1J23A 1R4MB 3OJWA 4U2DA 3CCBA 1Y1QA 1XNQB 5JY1A 1KNQA 1V8PA 3LO8A 1C4KA 2VATA 4KNWA 4KR0A 2DUMA 5JECA 5KU7A 3W7BA 5JSYA 4EJ6A 2KB0A 1M8JA 4LF4B 4Z99A 1PGOA 4P4LA 3CF6R 4JEMA 1NU6A 4DV4B 1G3UA 3BWXA 5ESRA 1GO2A 4L6AA 4EHJA 1XHEA 2AUMA 2XHEA 4YUWA 4RTOA 1WCIA 3IPLA 1WCWA 3O8DA 2XY4A 3HN6A 1FC0A 1H3NA 1U2TA 3IVXA 1CZOA 1N6NA 4L50A 5AJHA 4ZAFA 2FOIA 4CKWA 4NRDA 1SCJA 4PPGA 3DHYA 4P32A 4UCWA 1TXGA 1OBFO 1L7XA 1ZK3A 1J33A 4O4HA 3K8QA 4BFTA 4EVIA 2A86A 3O6VA 3V3KA 4YV7A 4ZT3A 1JNXX 2GZ1A 4O4IF 5BMOA 1FSPA 1U9IC 3FX2A 4LISA 4UEJA 3RLIA 3JQ7A 1GPH1 3T5TA 2CW5A 5HZMA 4YI5A 1KVQA 1ITZA 1WBJB 4MVYA 5KJCA 2WUEA 4HNHA 1TMYA 3IP6A 3PX3A 3QE3A 3WBBA 1YONA 2QUZA 4B4OA 4BUJA 1KWKA 3AK4A 1NVFA 4OIFA 1Z5NA 4S1NA 3MTDA 1E3LA 3O93A 1OA1A 3U81A 1NT2A 4BC1A 1LPSA 2J6CA 2ZB3A 4RHCA 1HY3A 1W0KA 3I2HA 4JT2A 3ZIAD 4EY8A 1WDTA 3DTVA 3JRXA 1B26A 4AJ2A 3UV7A 1K8YB 4QBHA 4QC2A 4UREA 4K7JA 3HUFA 2NUTA 4EHKA 1FPMA 5IU6A 2C04A 3K53A 4RM2A 3B9RA 1G4HA 1MW8X 3RSQA 3D7KA 1EUCA 1T3ZA 1EGQA 1ZH0A 1RC1A 3LHKA 4KLRA 4YQYA 4FFBA 5T3UA 2PT9A 2R8RA 3DG9A 1NMEA 3JWIA 1R8SA 1QH1B 4ZCTA 3FWPA 1M10A 4TS1A 1BE1A 2E5FA 3RKRA 2VWHA 4Q9IA 3UK6A 1NBOA 5DLPA 2AF3C 4DMCA 2GZ2A 2PL5A 1H2XA 1XZPA 1R88A 2X41A 3B7PA 3K7EA 3R3XA 3RJMA 4F6CA 5MGNA 3GN1A 3VPAA 3ADCA 2Z1DA 3LD9A 4Z4EA 2D62A 4RH0A 4M9QA 5CYOA 3C45A 4GX1A 5IW8A 4IDNA 5BV7A 3COVA 4KE8A 4RS4A 2A14A 1TC1A 4MGYR 3JATB 4U6QA 3UUFA 5JNRA 3HRIA 3DDNA 3TJZA 4ZHQA 2R6GA 3GJXC 2RHOA 5M34A 5ALPA 2XKBA 5LKAA 1ZD9A 3I01M 1UAGA 1OLSA 4KQ1A 1DAFA 2YZGA 1W8DA 1CERA 2YIVX 1KYYA 4YNBA 3M5WA 1E32A 1G2IA 1DG1G 1RT9A 4Q01A 3IUSA 4YP1A 3IEMA 4NJEA 5TMEA 2HBRA 5LR6A 2Q5OA 5CAEB 3KCNA 3K0EA 2J5QA 1PQYA 4MV9A 4R1UA 4YR7A 3MBKA 3E27A 2JFXA 4LTMA 1J2YA 2VXBA 1OYVA 3U4HA 3G0IA 1IN4A 3L06A 4CMAA 3M81A 3OZWA 4JFAA 4TXJA 1SC9A 1P39A 1NI3A 1H9AA 3JSXA 4L0DA 4FFNA 1EB9A 2FPGA 2PWBA 4P7GA 5EMKA 3O1JC 4RE6A 3GI1A 4NNOA 1K88A 5B1DA 5B58C 4KWHA 2I1LA 3GLGA 4NBWA 4OMCA 2PUWA 4PNZA 1KJJA 1BXZA 3DBLA 3JWJA 3R1IA 3U44B 4UHBA 2J87A 3PU6A 4Y0AA 1PIWA 5TE9A 1CZNA 2GGSA 1R4ZA 2HY7A 2GAAA 2VAMA 4KSYA 4PLGA 2J4FA 1JB9A 4PX3A 4MV7A 2JF0A 3OIYA 4MK4A 3BIJA 4ZT7A 3IC5A 5DGIA 3T54A 4IW3B 1RXIA 4UE3S 3COSA 3IHLA 1OFTA 2I66A 4WHMA 1KAMA 4YPFA 4ROSA 3E0XA 1NKSA 3ZWYA 1ODFA 3AF4A 4KAXA 4ZVKA 3DPIA 4G8CA 1OBOA 4B17A 4BBAA 2ZSAA 2OE2A 1Z35A 4PLVA 4W5QA 2RI1A 2HA2A 3MTQA 3AVTA 3ZV7A 4OXXA 2Q8QA 1U90A 2FJ0A 3SQMA 1U4SA 1LLQA 1ONNA 5AI8A 2YZ2A 3R9IA 4LGMA 3UHPA 3WNCA 1NFFA 3L4BC 5KYGA 1I1NA 5LMCA 3OZBA 4HBGA 1W85A 5FL3A 4MV8A 1C8VB 4DQ0A 4CWAA 1S02A 2H7YA 4IDPA 4W1RA 1CUVA 1L4MA 1XG5A 3AETA 1CE8B 2VBCA 3OX3A 4CHTA 2FXIA 4M8IA 1E94E 4GL4A 1SD5A 3DZGA 5IF3A 3HFRA 4CTJA 1Y63A 1PFUA 1P1CA 1TM4E 4PFJA 5IBPA 3IVAA 3IB3A 4OQFA 1QHXA 3DBVO 1PUXA 4B73A 2IK8A 4AF6A 4JNCA 4MINA 2GI4A 4L4ZA 4Q03A 2VZ0A 2Z8YA 3HDYA 4NULA 5LDGA 3MJEA 4BKRA 1DIBA 1TD1A 1Y8CA 4EG5A 3NVKI 3RH0A 3MB5A 1IHPA 3FNFA 3KALA 2X8AA 3S8MA 4BN5A 1N6OA 1PEAA 4QODA 3TIVA 2VQEB 4WCFC 2ZTSA 4ZRMA 5HW0A 5B4UA 3H2IA 1RXVA 5JS6A 2YJ4A 2C8VA 4R98A 3OZXA 4B3CA 3DYVA 1NBEA 2R62A 2E4XA 3GC6A 4FI3F 3ZJYA 2PZBA 4AF8A 2XTNA 2V5VA 1SN7A 4QU8A 3C7CB 4R6WA 3AEUA 4COKA 4D9BA 2O8FB 1E98A 2PIAA 3RUEA 5J5VA 4O8CA 1QVRA 1S89A 3VO9A 4LAFA 1K63A 2H7VA 2H51A 1C30B 3KJFA 5F51A 1F1JA 2QJWA 2B37A 1T6ZA 2W00A 2BMWA 4X00A 2WDPA 2QR3A 4DRYA 2OEPA 3MUFA 1G2OA 1KJ8A 3DV9A 4AW9A 5GJWC 4OL0A 3FHLA 2XCLA 4Q1CA 4UHFA 2E1PA 2BFOA 4ETMA 2VEOA 4K6GA 4UTRA 1DE0A 3KHTA 2X14A 1R9NA 3S2FA 4IXNA 1JYSA 4K9KA 2AC7A 3EXG1 5KJEA 4HAVA 4LNAA 2Y92A 2B92A 3B1XA 4N3GA 1U8TA 1KDVA 3FROA 4NH4A 5ADUS 1RW4A 1HDRA 3ICEA 1YOVA 3GIWA 3BD9A 5FLKA 3EOZA 2NT3A 1JHVA 2OHFA 2Q6TA 3AUUA 1SKUA 4BY9E 1OFIA 5LQSA 1KERA 2PBFA 2PFGA 1QDUA 3VSBA 1TC2A 2VBIA 3DO6A 3IR7A 1R4NB 3ZDXB 1L1RA 1QV7A 2IPMA 1CX9B 4JC4A 3AHHA 3RWMB 4K81B 2NIPA 2PGDA 1H3FA 1UFOA 3BGVA 3KFXA 4U63A 4KQ6A 5DTIA 5K4AA 5BYJA 5TT1A 3RFFA 1P5FA 1R7RA 1CRLA 2AG1A 2IW1A 2PZJA 3AOEA 3I39X 1CZKA 2RFLA 2DHDA 3E18A 4O4JF 4P35A 5A04A 4KRYA 4QJ4A 1TCBA 4MVJI 2QW1A 3Q15C 3TAUA 2E6UX 1APBA 1SIWA 3G82C 1P3JA 3EEFA 4OL9A 3GHHA 1P8AA 1L9KA 4Q3NA 4K05A 5IPFA 4GWKA 3AEQB 2WJWA 1X7YB 3FCYA 3IBYA 1Z5WA 1XEAA 3Q5GA 1EAYA 3MTGA 4QLOA 4H27A 3I52A 4BFCA 4RF5A 4O4IB 4RULA 4NJOA 2CHQA 4QARA 3RIXA 4YY3B 3QEJA 1FFGA 4ZVUA 4FT4A 1NJFA 2H85A 1SB9A 1EFTA 1YA4A 2F9LA 3CZPA 2XCRB 4CEIB 1TMKA 1XRJA 2I7DA 2IYVA 5GZ6A 2G1KA 3CSUA 1Y98A 1EX1A 2X6TA 1HFJA 1EFKA 4E12A 3LSYA 4LTDA 1FTGA 5FPHA 3I83A 4RBNA 4KGZA 4QQKA 2CLIB 1CUWA 2JLAA 5IJ0B 1Q22A 3LM8A 3DUWA 1DKOA 3PXUA 4K6OA 2GNAA 2BY4A 5ERYA 2Z04A 5KTTA 3IUQA 3MUOA 2OHJA 5CB8A 2QQ5A 2WWGA 3S2IA 2PTHA 1WXXA 3X43A 3DYIA 1VM6A 1UK7A 2VH5R 3N75A 4ZU3A 1PO7A 3UICA 4HGPA 4R8MA 2H4ZA 5KTRA 3DDHA 4W5HA 3VTZA 1U02A 3MBOA 4CM4B 5GP1A 4DRXA 5B3LA 1G64A 4YDSA 2R4QA 3O95A 3UNXA 4BQEA 3MWLA 1YT5A 1T9BA 1MJGM 1K7XB 2I9PA 2HU5A 2IY7A 3BE5A 3BCRA 2BGIA 4UU8A 3Q7EA 4MIOA 4YRLA 3L9XA 2PXCA 3KVOA 2JFPA 4PYRA 4NAHA 2VRNA 1VHDA 5C5DA 1SHZA 3F5SA 3R3JA 4KDEA 1U6KA 1XDWA 5CK4A 2M6LA 3VU9B 1QKKA 3Q7TA 2G5TA 2VJAA 4KGXA 5JLJA 2II6A 2ONYA 4Y9TA 1PR2A 1XBTA 3PXEA 4PBTA 2BMFA 4MJXA 4TKMA 3F3MA 2JIMA 3H7AA 1NP7A 4PO3X 1KP2A 1QB7A 4US2R 3DB2A 4Y2QA 5HIAA 3QFRA 1KRWA 5KSOA 3L8YA 3ZGXA 1W7AA 2Q1XA 4H15A 4WXHA 1GY8A 1U5BB 3NRBA 4QL3A 2RBEA 2OC4A 5EUCA 3ADDA 1P5RA 1PQ4A 3T7IA 3P1JA 4PIVA 5CLLA 1NNLA 4J9UE 4BYGA 4EA7A 3HR7A 3V8MA 2YDXA 2GFIA 4OQNA 2VN8A 3M1LA 4G07A 3F9RA 3DL4A 5KYWA 4WL0A 2VR1A 4GLOA 2HZBA 2TECE 4ZCIA 1NVXQ 4PG5A 2F4VB 2V7WA 1CHNA 2XGSA 3G0HA 3CZMA 1KMQA 3KHSA 1SKAA 5JS8A 2IZ5A 3DXYA 4UBLA 2Z6VA 4JQZA 1SEPA 1YZHA 3RASA 3PR3A 4G0ZA 2I87A 2OZLA 3KB2A 1IY0A 3R0JA 4M38A 4XQEA 3BZUA 3OPYB 3VYTB 3WYAA 1KF0A 2BOVA 1W35A 3ES9A 1GNPA 3MMPA 4NFSA 1XVAA 1U1CA 3ZV5A 4ARUA 4CCYB 4YCLA 3DGEC 4LHSA 3RF6A 2CHUA 2XUPA 4P4SB 3NOQA 5IF9A 5ENVA 4B6OA 4RJ2A 3B12A 4I8XA 1MV8A 3DULA 1QQ7A 3KEGA 3REFA 3UJAA 4BC0A 3NEAA 2XSZD 3KKNA 5HIMA 1I1HA 2H9AA 3I30X 2NUPA 1VLLA 3RC7A 1XALA 4RABA 3UEOA 4AJ9A 1FX0A 3P52A 2VA8A 1S2OA 4LYAA 4OFWA 5IP5A 3EH1A 3SX2A 2X2OA 2ZSHA 3MCVA 2VP4A 5BT9A 1ULBA 8ADHA 1ZCJA 2A6PA 2WZQA 4WNAB 1GNVA 1W2GA 3EMDA 3EQ2A 1EFCA 4JKOA 1FTSA 2FW9A 5IKPA 2HF2A 2CYCA 3ORRA 3LC2O 4ZO6A 4LY3A 1C1YA 1M83A 3PUKA 2IH5A 2ERCA 3VBEA 3HDGA 2UZ3A 4I1OA 2O8EB 1ZK0A 1Y5MA 4NMWA 3G2KA 1Y8AA 2BTQA 1SPBS 4OV6B 2ERYA 4DLAA 1FQOA 3HABA 5IWCA 4RD1A 3AFHA 5FTWA 2CSUA 3DCIA 1NQWA 1A76A 1T91A 3ZX5A 2HU8A 4ZALA 1N0WA 4FOLA 2WYHA 2OHHA 1PGJA 2JAUA 3DO8A 4GMFA 4YJ3F 1R6DA 1UEIA 1UPAA 2R00C 3OIWA 1EGVB 1FTYA 2OK7A 3OFND 3P2OA 2YRWA 4GMGA 5K51A 4P4TA 3ZD8A 2AMVA 3ILSA 4UUNA 3ZDZB 4DHEA 4FDVA 5A5DA 1Z7WA 1SHJA 3IDZA 4AUMA 3I2IA 5A6VA 1D07A 3I5MA 1K92A 2I6QA 4RHFA 4RY8A 1IXRC 3BTVA 2QPOA 4G56A 3CCCA 1FDWA 2PD4A 3ADKA 3M4NA 2WYWA 5F1KA 3ZZTA 3ZQUA 3KQUA 2B4YA 2YWBA 2GEUA 4D6PA 3OCWA 3P4UA 1L5ZA 3R6LA 3R77A 3HFGA 2PEZA 1BH6A 4PF1A 5EIAA 2OV1A 4R7ZA 1SY7A 1NJ8A 1BC5A 2DKOA 1DBRA 3FTDA 3SS9X 4B6QA 4CCSA 2GB4A 2XB8A 2NUAB 3MFYA 1YCFA 3Q7SA 4BQPA 1QG2A 1AQNA 2C2KA 1MQ9A 2DFVA 1Z5PA 3A9WA 4I1RA 2EW2A 4H59A 4HN4B 2PUHA 3MJRA 1U9IA 4IIHA 4LTNA 1FBTA 1Q6YA 4LRWA 3KR1A 4H0CA 4I4TA 1ZVKA 4IP0A 1JDBB 2FWNA 3R3WA 1E59A 1YRQA 1FNBA 1U2DC 2XNSA 1LH0A 4N0PA 3GGCA 3THWB 1XCMA 3CZ4A 1YQXA 1C3OA 1UBFA 1Z4IA 1M34E 2JGIA 3GO4A 2YHIB 3CVYA 8ATCA 5DH9A 1UT8A 3L8HA 1VB5A 2NO5A 2PZFA 2ZRIA 4GNKA 1SELA 3HKBB 1C50A 2GHQA 3BQMB 3RYFA 1L4KA 2LV8A 2OB1A 4ZGWA 3ZY2A 2HTFA 4LF5B 1CQXA 1UANA 4FX2A 5K3SA 2DFTA 1BWSA 1ODKA 1UFQA 3TM4A 2RHBA 3IAXA 2MHCA 3JQFA 3U7EB 2HPAA 4P7JA 4QBIA 1UFVA 1YO6A 4RMIA 4AZ3B 3MGKA 4LBWA 2H9YA 1BHQ1 2C0PA 3HXPA 5KYXB 2D5CA 4QUDA 4K9NA 4XUEA 1T9GR 4KQXA 5DOZA 3MQFA 3C48A 4LOHA 1E9AA 5FOTA 4RZ3A 3QVVA 4FT2A 3PSAA 1UIRA 4RZSA 3DXZA 1I9CA 1MW9X 1QLWA 2G5PA 2GA9A 2JPDA 5TSDA 3IKMB 3PA6A 3UVEA 4DUGD 5DX1A 3IXQA 4ISBA 1RXUA 4EM6A 3QIAA 4KPEC 3ABZA 3PE4A 1CUCA 4HAXA 3SN6A 3PZRA 2ZB8A 3B6KA 5CX1A 1D9XA 1PZGA 2H54A 2IYZA 2ZREA 3JVDA 4LZJA 5DYYA 3U48A 5EIFA 3ZH9B 4YGXB 5TEWA 4OAOA 2JNWA 4HUTA 3VHXA 1OU0A 2BGNA 2QG4A 4OEHA 4ZQEA 2B4KA 3ZXSA 1JVSA 2OYSA 1IMJA 2YIMA 3RVSA 3T34A 4IDAA 3RT1A 4HR7A 3EVTA 2J0UB 4JYPA 4Q1DA 2R8BA 2GF9A 4QBFA 4OHYA 2C57A 2HSEA 3OQIB 5PNTA 1P77A 2HIHA 3UG7A 3RGGA 3WLRA 4JC5A 3WQBA 2HSWA 3OC0A 1X7HA 2JFHA 1VL2A 3LWZA 3R7LA 3WNZA 1Z8HA 4JCCA 4LZAA 3Q12A 3UCFA 1USIA 1OX5A 2FR8C 3D64A 1JE1A 3KPVA 1XFDA 4ZWNA 1BS2A 2CEKA 2WM9B 3ESYA 3G0BA 2WTMA 3EVEA 5T4EA 4KX3A 1JR3E 4M83A 1ZR2A 2PJDA 2P40A 1RIFA 3LL4A 4DEYA 3F5QA 1P4RA 4J0QA 4RZ2A 4KFUA 5D3KA 4BRSA 4FFPA 4JI2B 3HVHA 3HVKA 5AKIA 3EGXB 1MO6A 4IYJA 2DLCX 1ZDMA 2WVJA 4XGNA 1LS1A 1V3VA 4EVSA 4DJDC 2ZDHA 3CRVA 2REBA 3QFCA 4N5IX 1TU3A 4P81A 4R2XA 4KODA 3Q9LA 5DCYA 4M98A 3TBKA 4LW8A 1HEYA 4CE6A 2BKLA 2X77A 2FJUA 1B6SA 3UWDA 2RAFA 4PG8A 5KQMA 5CFRA 2HWKA 2WWIA 3BFVA 1YZKA 4A03A 5FNVA 4EKDA 1NVKA 2WF8A 3CGGA 3AU8A 1FPQA 3V4LA 3T3MB 3WK5A 5IYZF 4DDKA 1OVGA 2VJYA 4C0XA 5ADHA 2QV0A 2Q07A 2OUKA 5KB3A 3H8SA 1ZVQA 3DL0A 5GMOA 3QV1A 4DOMA 3QBJA 2HRRA 1NPDA 1IWOA 2QAGB 4J0GA 1NYQA 4KO2S 4E14A 2XHZA 4DWJA 1ZIDA 3E5HA 2BGWA 1IUNA 1R9GA 3L0YA 2B7BA 2OGSA 3EA0A 4MYDA 4UU7A 5DYNA 4B43A 4WCFA 2Y1FA 4ZJPA 3K70C 1R0BA 2BZSA 2QN8A 2VBFA 4HDSB 5AI5A 2FEPA 5GPBA 2NP6A 4DTCA 1V45E 1E4EB 2FMKA 4L5BA 1XMPA 5D51S 2P6NA 4GYYA 2VCYA 3HWSA 3B5IA 3LCCA 4IGIA 1P7YA 4E6PA 2IF2A 2C5BA 5J58A 1Y1RA 4OUKX 1V6SA 3UWSA 2QBYA 4FP9A 2H0QA 3PGMA 3BL8A 1DP4A 3EQ8A 2XV1A 3PG5A 4IINA 4DRZA 3USES 5EZSA 4BJ6A 3MOIA 4DWVA 3RADC 1JU3A 1E0AA 2WIFA 2G76A 3HN2A 3LKBA 5FFNA 1UP4A 2HZ7A 2C4MA 4GBED 2WWVD 5FH9A 2G77B 3CJRA 1TK9A 1BX1A 2W58A 3TTVA 1E77A 2JFWA 4JDUA 1WVGA 3U13A 4EJSB 4XH9B 1XQ6A 4F38A 1UZAA 3O8OA 1GXSB 1KFEB 5KYUB 4JT4A 3IOCA 2HSGA 4B3IA 2G9ZA 2XDWA 3AG5A 4URHA 1PS9A 2AFVA 3QEMA 3SNKA 3A9CA 3EIFA 4Z6KA 1II8A 1DOHA 3VM6A 4TTIA 3PEVA 1VJ5A 3DLBA 1Q57A 1X77A 3TOVA 4OXQA 1NW8A 5D7BA 3UJ7A 5KWVA 2CVQA 2JATA 2V65A 4DV1B 3ZJTA 1EVEA 4MQ5A 4TLBA 4IIFA 2I2DA 3E9NA 3INRA 5HR5A 5A3SA 1I80A 2NOAA 4YJ3B 3KU4A 2XIJA 4Q16A 5JQGA 3CUEF 5DM70 3K15A 5ICGA 1GSIA 3A3NA 3HA2A 4JEIA 4DAOA 2ZYGA 3A7EA 3ITNA 4RY0A 5AVSA 1DBSA 2W8ZA 3AR2A 5K2MA 3I5YA 3OZ7A 5AO9A 4YJFA 3MB8A 3TEFA 1CZLA 1JLLA 3RRBA 5FFMA 3NHYA 4G8JA 2GBLC 1QYIA 4N0EA 5GWXA 3ESXA 4FS3A 1YCDA 3ETEA 3U4CA 1C7IA 2HK9A 5DF1A 1RZ3A 3RHZA 5HJEA 1E9EA 4RK6A 4ENSA 1HM5A 5ADVA 1W44A 1D2AA 4A8HA 4CMIB 3U4QB 1KRHA 1Q15A 3A25A 4K9PA 3ITEA 3RVRA 1THZA 2BJVA 2JAOA 3CKYA 3IMFA 4G5YA 2XZTA 1JHYA 3KQNA 4OLBA 4IXMA 1OI2A 2WHYA 3DBRA 1GVHA 3MCUA 2VJDA 3CWCA 4BQRA 1SXJC 1RYYA 3G9QA 4Z49A 3UAWA 2Y27A 1YVUA 4UULA 3I1IA 2VP0A 4FDAA 1W0JD 3NYRA 4E51A 4HZIA 1FJGB 4NNPA 1Y9EA 3F6YA 3NWPA 2OWEA 1FSFA 3MUEA 2DOKA 4RHUA 4KYUA 4YUXA 5BR4A 4OB6A 3V4FA 3MJ4A 3SFVA 1VLZA 4WUTA 4CKEA 1Q7BA 3DHWC 1GNTA 4EUHA 4RTNA 4HX9A 4UCFA 5FBKA 3T95A 2IH4A 5I01A 1YNOA 3OPMA 4ECAA 1O5TA 2PXXA 4LRXA 3KWMA 3T3EA 2OKGA 3A8TA 3A4NA 4ZQIA 3N86A 2LWIA 4UOZA 4RWZA 2BI8A 4AQYB 4GM1A 4FXOA 1ADGA 3ZI7A 3AW8A 5FI5A 2XVZA 4R9RA 3MYYA 1FFYA 1VKZA 5I7EA 2IV2X 3IAS1 5FD8A 1YA6A 1MAAA 5LWHA 2WK1A 1KYQA 3ETHA 1C4XA 1YGPA 5JJCA 1Z0DA 1UKAA 3KSZO 1JMKC 1VIYA 4C7MA 1KQPA 2HWYA 5GTDA 3UJPA 1PZNA 1R6XA 2NU8A 4X20A 4JJFA 1VFPA 2ZRCA 3F4LA 1DC8A 2E4WA 4HN9A 4LEIA 2JJ1D 3TB4A 1KI9A 3OQ6A 1EZZA 4HEA1 3W4KA 3GAZA 1T29A 5SV2A 2ZUWA 2F9MA 5G41A 3VPSA 4KXFB 3FCSB 1MD9A 3NS7A 1VJ1A 3CLSC 2Z5VA 2IFTA 3IGFA 4X6LA 1YR7A 2YC4C 2OCXA 2AKAB 3LDGA 1BS9A 1GTMA 1TJ4A 4ME6A 4XFKA 4FJ1A 5J59A 3WI7A 4JT8A 5KMGA 5IAKA 5LNK6 3KZXA 1LDMA 3M6UA 2F55A 1U5CA 1C0EA 1CNFA 4NK5A 1YRBA 1ZH6A 1WXGA 4DLBA 2I7XA 5ALRA 1MQAA 2NO6A 3RYIB 3S5UA 1KZYC 3R7WA 1KK1A 1O94A 2A0WA 2VSNA 3ND5A 4JX9A 2IUFA 4LMPA 2WT8A 3HNPA 3KUUA 3M3PA 3PJFA 4NDZA 2BGJA 2ZYIA 5AKXA 5EN4A 2EGGA 1T9CA 3TSWA 1FY2A 1NUAA 2V9CA 1ZEJA 4WEOA 2ZRHA 4U9IS 1ZKDA 3A27A