2MSWA

Ligand-induced folding of a receiver domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPVMAKPADTSDVAKRALEMCGGDKEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Response regulator/sensor histidine kinase
publication title Ligand-induced folding of a two-component signaling receiver domain.
pubmed doi rcsb
source organism Erythrobacter litoralis
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mswA00
1GUBA 1YMUA 3RVRA 1U2PA 3LTEA 3LUCA 1Z25A 4NV3A 1ABEA 3QELB 3QK7A 4F8JA 3BILA 4KK4A 3A0RB 2VUIB 5CNKA 5JNSA 4TN5A 2PUFA 1NTRA 5E3JA 5DLEA 1HEYA 4PEVA 5IUJC 1JYEA 4RKQA 3VNAA 2E4WA 5IULC 3OLXA 4DQDA 1ZESA 3KYJB 3URMA 3DZDA 1IIBA 2WWVD 1ZH4A 3K9CA 3CU5A 2JVKA 3FFWA 4JAVC 1CEYA 5JNVA 4KFCA 2IYNA 5PNTA 3FGZA 3RH0A 2MSWA 4P1ZA 3UKJA 4ETIA 1KRWA 5HM6A 1JYFA 1VRVA 2CHEA 2HJ9A 1H9CA 3MF4A 4KZKA 1DBWA 1B00A 2FLWA 1MVOA 3NNNA 2FMKA 1NXXA 4O1IA 3KCNA 1LBIA 1A2OA 3HCWA 1E6KA 3BRQA 4KNYA 3MA0A 2A9OA 4OG2A 2L17A 3RVSA 1JBEA 1ABFA 4MR9A 5D2CA 2MYUA 2R47A 3CG0A 1ZITA 4MR8A 4RK5A 1FQWA 2ID9A 3LOPA 2FEKA 2PUDA 4WT7A 5T3YA 3IP6A 4HYEA 5F64A 4Z4EA 4LE1A 3ILHA 4RV5A 5BQ3A 3NNDA 4YLEA 4N76A 4JA2A 2R48A 4Z4CA 1TMYA 3HEBA 4FB4A 1DJMA 1MIHA 2DRIA 2JBAB 1ISRA 5GQSA 3HK2A 3G1WA 5TE9A 3E61A 4G0OA 3MM4A 4IRXA 1A0OA 1XHEA 1U8TA 1QP4A 4RY0A 3RVLA 1DCFA 4S04A 2QVGA 1SXHA 2TMYA 3L49A 2F8TA 3LUJA 3QX8A 3GWGA 1QQBA 2MYPA 2A9PA 4WXEA 3LFTA 1A04A 3FDFA 2O20A 4MRMB 1NXSA 3NHZA 5TPZD 4IMIB 4EYKA 4MQFB 4LX8A 3EULA 4JB2A 2IOYA 5DKFA 2E4VA 4D6YA 4L85A 4RK0A 3H5VA 3KHTA 1RXIA 2IPNA 3C3MA 1NATA 3H1FA 2GI4A 5DCLA 1JL3A 3SG0A 5CNMA 1MB0A 1ZDMA 2NZVG 1BDIA 4G0ZA 1Z17A 3KS9A 2LP4Y 2FMHA 4W5OA 2CWDA 5CHYA 5KQLA 4CBVA 3H75A 5I4CA 3QLTA 2JK1A 1NXWA 1USGA 1F51E 5BR1A 5FWYB 4RXMA 2B1JA 2HSGA 2PAFA 1EWKA 1S8NA 4LE2A 4D6XA 4YCSA 4MR7A 4RDCA 1DBPA 2M1ZA 3KG2A 1E6LA 2AYZA 2L2QA 1L5YA 1M5UA 5B3JA 4OLBA 4RK1A 4ZMSA 1XWWA 5EWJA 4G0XA 1EFAA 1LJLA 4RZSA 4O1HA 2WY2D 3RVMA 3SY8A 2QVCA 3C3WA 2L18A 3NHMA 3LUDA 4LDAA 2VK2A 3HM9A 1ZAYA 5BRAA 4MS1B 2RJOA 3LUAA 4MS4B 9ABPA 3OMWA 3OO1A 2QR3A 2QXYA 1DP4A 4XASA 5EWJB 3N53A 1E2BA 4EVQA 1ZHHA 1PEYA 3QLVC 4OLAA 3CRNA 1OXKB 1QKKA 3C6QA 4G0MA 2E4ZA 2FTKE 3GRCA 1LJUA 3O2QB 3I09A 5IX8A 2PE5A 4Z4FA 3JY6A 3ROTA 4Q6BA 1ZH2A 3RVNA 2WJAA 3HUUA 3DLBA 1ZN2A 4ML3A 3TMYA 3H6GA 3P9YA 2V0NA 3GV0A 3JS5A 1JFTA 2NT4A 4RKRA 4W5NA 3MMNA 5KQPA 5EWMA 3A3KA 3FFTA 4RWEA 1SD5A 2FSPA 1GCAA 3GT7A 1P2FA 2A9QA 2FN8A 1DRKA 1PHRA 3O2JA 1T34A 1XHFA 2P4UA 3RVKA 2R4QA 4LRQA 4MLDA 3IP7A 4EVRA 4W5RA 2FVYA 4Z0NA 4N47A 1BDHA 4KREA 4YRZA 3HUTA 1P6UA 2JRLA 2YHAA 1AB6A 2H0AA 2PL9A 1ISSA 3IP9A 5CNIA 4EYOA 2PLNA 5GOTA 2CD7A 4Q6WA 3F7NA 3OQNA 2HQBA 4YO7A 1Z18A 4N03A 1NXOA 4F11A 3OLWA 2NUBA 3LUFA 4PYRA 5DTEA 4NQRA 4YV7A 2MYNA 4JB0A 3A0UA 3L6UA 3IP5A 5KQGA 3W9SA 4KMRA 3RQIA 1EAYA 4L4UA 1SXGA 2PKXA 3S99A 3EQZA 3H5LA 4PE5B 4ZJPA 4XAQA 4MR9B 3CHYA 3D02A 2ID7A 3LMKA 2JCGA 4IMJB 4MPTA 4MR8B 4W5TA 4KVFA 2MSLA 2LPMA 3F6CA 1F4VA 5JNWA 3KKEA 2J48A 3EAFA 3TO5A 5HSGA 5TQ2A 3KTOA 4DADA 4JOQA 3I5AA 2P9HA 4Z4IA 1ZY2A 2CHFA 3RVQA 4EYGA 1L5ZA 4RU1A 5IC5A 3Q7TA 1M2EA 1TVMA 3JTEA 3SAJA 1YTUA 4OBBA 1QP0A 2LBPA 3Q7SA 1K66A 2R25B 3N0WA 3Q41A 1YIOA 4N0QA 4F3TA 2H3HA 4Q7EA 2MSKA 5C5CA 4NICA 1BVHA 5ABPA 5KC8A 1Z16A 6CHYA 3Q7RA 5KC9A 3HVRA 2W42A 4RK4A 4IILA 3MIZA 3FFXA 1GUDA 3QLUC 3H1EA 4NCBA 4G0YA 2MYTA 1TJYA 1DC7A 2E4XA 4TMYA 1GCGA 3GBPA 3H5IA 2NT3A 4RSMA 2FQWA 2HPHA 8ABPA 3CLKA 4XARA 5IEBA 2I6FA 4YWHA 2L19A 3HDGA 3OLYA 4WWHA 2QU7A 1APBA 1Z2DA 1UDRA 4GPAA 4RS3A 5TPWA 1MAVA 2IKSA 1FSPA 1URPA 4ETMA 1NXTA 5TPZA 1JF8A 2PUCA 4B09A 2F8SA 4RY8A 5C5EA 5KWSA 3HS3A 3Q15C 1PNTA 3RVJA 1PEAA 1JWLA 1BAPA 4RK6A 1Z12A 5FBHA 5JNUA 1CHNA 4FE4A 3I42A 1NXPA 3QLVA 3TB6A 1K68A 3CKMA 2QZJA 2FXIA 3N75A 1SRRA 4H3KB 4O5AA 1DCMA 3N6VA 3ROFA 3OMXA 1C0EA 4RY9A 2ZAYA 3IDOA 4F12A 2WMYA 1USIA 3O74A 4MR7B 5IEJA 2IPLA 3KSMA 3T8YA 1JX6A 5FWXA 1JFSA 4WUTA 1BA2A 1USKA 3EJWA 3O1HB 3G85A 3H5WA 1DG9A 1QNLA 4MQEA 4MGEA 1RZRD 3OLVA 2FW0A 3IPCA 3K4HA 3H1GA 4QPJC 1W25A 2GBPA 4PICA 4QYMA 4QICA 3O1JC 1NY5A 3CG4A 5ED4A 5TQ0A 3GA5A 3SQNA 2PUAA 1VLZA 4D74A 2QV0A 1JDPA 3QEMA 1YS6A 3RVOA 5T7BA 3QELA 3CZ5A 1JH9A 4W5QA 5IUKC 1NXVA 3IPAA 4LDZA 7ABPA 1FFSA 1QP7A 3GBVA 4DN6A 1DC8A 2RJNA 3EODA 3KLOA 3DBIA 4EGSA 4RXTA 2ZWMA 4XLTA 4N41A 3O75A 4XFKA 3LUHA 3I45A 1QQAA 2YHBA 4KRFA 1BDJA 3QEMB 2E4YA 2Q5CA 3HSYA 4KK3A 5EWMB 3O1IC 2OQRA 3SM9A 5JS1A 3CS3A 2NZUG 1M5TA 1ZGZA 3HV2A 1DCKA 3KJXA 1SXIA 2AYXA 3H5OA 4H3HB 1D2AA 4UHJA 4YGXB 3LKVA 1CYEA 2E4UA 1AB5A 4WZZA 1U04A 1Y1LA 1JDNA 2JB9A 1EWVA 1WETA 3R0JA 1Z13A 4HNQA 2JVIA 1ZGGA 3F6PA 4LE0A 1TLFA 3D8UA 3N8IA 2B4AA 4JP1A 4EUKA 3M9WA 4RXUA 2PUBA 3QEKA 4MAAA 3EGCA 3SNKA 1YK1A 2PL1A 2WB4A 4EVSA 3F73A 1PNRA 2QSJA 3MYYA 3T95A 4FE7A 3VNBA 2FEPA 4EYQA 4WXMA 1KRXA 4OATA 5HKOA 2FEWB 3NBMA 2PUEA 2PUGA 4OTZA 1R8JA 2BGGA 4MS3A 1JFVA 3N0XA 2JBAA 3OLZA 2VUHB 2KYRA 1PUXA 1YS7A 1U2QA 3H5TA 2X7XA 3A10A 4ZMRA 1JHZA 3EDCA 2FLKA 3QLUA 1Z26A 3UUGA 1EWTA 4ETNA 5IUNC 1VPWA 3TX6A 1M2FA 3GL9A 4EY3A 2FKAA 4YS6A 1D5WA 3BBLA 2A9RA 2VYCA 2IPMA 1RPJA 4MS3B 1KGSA 1OXBB 1VKRA 3OQMA 3LUKA 2QW1A 1FFGA 4MRMA 5TQ2B 3CFYA 3TD9A 4Y9TA 2RGYA 4MQFA 1U0SY 4H60A 1C4WA 4Z9BA 4Z4GA 3N0RA 1TM2A 5JNTA 4KPYA 3HO1A 4ZPJA 3CTPA 4KQCA 3OQOA 2FQYA 2N9UA 4LZLA 4KQ9A 1LBHA 1Z2EA 2WRZA 4QYWA 3Q9SA 4F06A 1ZVVA 5KQMA 3HXMA 3T38A 3B2NA 4M88A 4HNRA 4YR7A 3CNBA 1YK0A 1JLKA 1MB3A 1W9HA 1J56A 1P8AA 2RDMA 3BRSA 1DBQA 2GX6A 3E3MA 2FMIA 3JPYA 3NNSA 4G86A 4G97A 3C97A 2GWRA 4ZYLA 4E7PA 3KLNA 2HQRA 1QO0D 4GNRA 2WJWA 3C3KA 1RNLA 3EQ2A 5HQJA 5DGCA 3JPWA 1Z15A 3HDVA 5KI6A 1DZ3A 3O21A 3DGFC 3KYIB 4S05A 2GKGA 5TPWB 4UHKA 1QPZA 1GLGA 1D1QA 4MLCA 1RXEA 4PZ0A 3JVDA 1I3CA 2XDYA 4Z4HA 4Z99A 4TLLB 4TLMB 3MQ4A 3M6MD 2IPAB 4IF4A 3DGEC 1EHCA 2FN9A 5CNJA 4E7OA 4JASB 3OO0A 4G0QA 5JS2A 1YMVA 4IGAA 4MS1A 4MS4A 1FFWA 1E6MA 4KV7A 1QO0A 1YVUA 5EWLA 3HZHA 1D1PA 2HQOA 3JVIA 3BREA 2PJUA 6ABPA 5BRJA 2IDMA 3LUGA 5FWYA 3CZCA 2M98A 3OM1A 5FWXB 2FQXA 4Z9AA 4HNSA 2OENG 4RK7A 3ILYA 3OM0A 1LK0A 4NCAA 3UK0A 4XXHA 2LIVA 3T6KA 4MQEB 1P6QA 1D4ZA 2LUOA 4G0PA 3RVPA 5B3JC 4YP9A 1KMIY 3HJFA 3LKBA 2JVJA 5FBKA 3M9XA 5EWLB 3QX9A 3H6HA 5IBQA 2FMFA 2PMCA 4P98A 3DLHA 3GYBA 1QMPA 3O2SB 1DRJA 3FMVA 4MYRA 1RZRA 5TQ0B 5TQJA 4N0PA 5JNRA
chains in the Genus database with same CATH superfamily
3Q7EA 1EUDA 5F4ZA 1AKVA 1U2PA 3MUFA 2K2WA 2NAPA 2EZ9A 3A6LA 3E48A 4JUFA 5FOWA 4QDKA 5TXGA 3FNFA 4R2MA 4Z1MD 2POCA 4JJFA 1H2AS 4KK4A 3A0RB 2P3QA 2FHSA 3ZQJA 2FY8A 3W3ZB 2WYHA 3QG5A 1CS4C 3MJCA 3BHIA 2HBQA 2ZPUA 3BEOA 4ZYZA 2WWVD 2RMKA 1P18A 2Q6OA 2B61A 4MP6A 3PL5A 4AZ3A 3IV9A 1JJBA 5L95A 1OOEA 5JBQA 3GGCA 3IVMA 1WDTA 3N2EA 4Q15A 5CEFA 5KNLA 1W2WB 1N2BA 3F3KA 4PAWA 3KETA 1KRWA 1Y9AA 1MO5A 2GK6A 2NTNA 3EGWA 1AG9A 3MJVA 2O0HA 4LYAA 4TLDA 4UVHA 1Z6YA 3R3XA 5LQAA 2OV4A 2O5VA 3ETGA 5HRAA 3GCWA 2DKNA 1KVRA 1U7PA 3HCWA 3VR5D 4MA4A 1T1JA 3HA2A 5DLPA 4AXBA 2PZKA 4DANA 2Y1KA 5HPYB 5C52B 1ABFA 4RZ2A 1Z8NA 2CVFA 4E03A 4WECA 4RHFA 1FQWA 1N9KA 1WHSA 2IX9A 3DMDA 2JBHA 3KQPA 3UMGA 4EJSB 4A15A 1OH5A 2OXFA 2CLFB 3NTXA 3OT5A 4KDCA 5L3ZA 1B93A 1ST3A 5HCIA 3H4TA 4N76A 1VCOA 2WC1A 3REOA 2NZXA 3RVBA 4XGQA 2Q8NA 2IP1A 2R5WA 4E2FA 2CXNA 2W2QA 2Z08A 1RWPA 3EK2A 3H4IA 1PZFA 1IB6A 1WDLA 5GZ1A 1LQTA 4BNFA 1GR1A 4JEHA 3H84A 4BN5A 1KMCA 3CR3C 3ZJVA 5IVHA 3H7IA 4NCXA 3CRRA 1LBSA 1XHEA 1ZCBA 4XDGA 1E3TA 1MO3A 1MGOA 2BEUA 1QIEA 1VIYA 4AQYB 4IHJF 3IQXA 5LQDA 2LZ0A 4XJSA 3VTFA 4W8OA 3G0IA 4M9XA 3OPMA 1WXIA 1LZKA 1WL8A 2G80A 3QIVA 1Y7LA 4QUDA 4UKDA 1AQJA 5J2UF 4IMIB 1E5QA 5ARCA 1ZCJA 4CR7A 4F56A 2XZDA 2W48A 1NIJA 2XB9A 4G2NA 5KOYA 1NV9A 2QMUA 4TYNA 3ZHVA 3KIPA 4Q3OA 1Q0RA 1PJQA 2ST1A 4ABYA 3V8PA 4OFWA 5EIHA 4C14A 1HH4A 2HTEA 4YUAA 2IUEA 2IY8A 3BIJA 3KHTA 3M4NA 3THRA 4TVSA 4QSMA 5DCLA 1CJKC 1D2HA 4IX9A 3MT8A 4H15A 4L4RA 3RFVA 4PLZA 1XP8A 1SG0A 1KQPA 3EJ6A 4FD2A 4GGPA 2ZYTX 4LUCA 2QUBA 4A0GA 2OYCA 5EHXA 3O3MB 1OFUA 4ND8A 4TX1A 1G7CA 2J6HA 1ZN9A 4CM8A 2R84A 2Y76A 2VSYA 3H9BA 3KWLA 4L02A 3C8UA 1ZD8A 2RH8A 4ZOAA 2PT7A 1XEWX 2V8BA 4F04A 5DTQA 1KR5A 4KO2S 1G9XA 2CGEA 3AGQA 4PLTA 4BYGA 3ENZA 3X1WA 2CDAA 4U7WA 3SIXA 4N3NA 3SLGA 3E7XA 3ZY2A 3ZLUA 2OG1A 3EA5A 4XQ0A 5EWJA 5B3LA 3CIFA 3AEUB 2GAJA 1UEXC 1OX4B 1EVQA 3IV7A 2Z95A 4KXYA 2VBIA 4K26A 4TS3A 5LU9A 5BQFA 2ZR0A 4D80A 1Y8ZA 4Y6QA 3AY6A 4QXAA 4AS3A 4AUKA 2PFGA 4DSAA 2JGFA 3MAAC 2ZIEA 4H7EA 1AHPA 3AI1A 5IYZB 2FP4B 2H1LA 1IN6A 5KVVA 3X1ZA 4CMGA 3PJEA 2VDJA 4UJ3A 2VYFA 4Q9IA 3I9KA 1SIUA 3QVGB 5CXSA 2VAXA 1UKEA 1C8KA 4UCWA 3QPVA 2YWFA 1ZOLA 3C6QA 4M87A 3UMFA 2E4ZA 2WWXA 3O2QB 3HBJA 1DUVG 2XHEA 5AM0A 5F1KA 3LQQA 5KAPA 2J08A 3EG5A 2NPFA 1CR0A 3DCNA 1SU6A 1A71A 3GFQA 1T9BA 4RTJA 2XUPA 3FKSA 1QK3A 2ISQA 4MIKA 1N9ZA 1N8NA 1PFQA 2CJPA 3IYLW 3QFHA 5F76A 2HSEA 1JFTA 5B2FA 1NKSA 2COEA 2FR0A 1EHIA 4KN6A 1ZA2A 3B5EA 3TEMA 4F6LA 5A3JA 4RWEA 1GCAA 2XVXA 3NOVA 2H18A 3AM3A 1E60A 2ZBEA 3FYDA 4OI4A 3AGPA 1BU8A 5DWDA 2O57A 3KWJA 3UHFA 1D8AA 1VPVA 2XDWA 5ULLA 1NAIA 1FU7A 2WHEA 4OQDA 4DG9A 5JSZA 3NHWA 1PQUA 2DT8A 3EIXA 4K9DA 2QRLA 2KLHA 3K0KA 1U31A 2CJWB 2Z9BA 4YAJA 4YMTA 1Y3IA 2GHIA 3AFGA 3K70B 2ZSDA 5ALTA 2OXTA 3W1VA 1H8ED 3DL2A 2VJAA 5M3BA 3ZGXA 3MELA 4U6SA 3ONFA 4YO7A 1PDVA 1YZNA 4CKBB 1Z18A 2C4UA 4B33A 5JXHA 2HRDA 1OXXK 1KORA 2Q4DA 2BHRA 4OHBA 4UBNA 5ELMA 2YV3A 4ZOQI 4FFMA 4UXIA 4BNDB 1DIAA 2WVJA 3U4HA 2MINB 1PU2A 3OECA 4KFTA 1DQYA 1OXVA 5KQGA 5LZ4A 2I4RA 4ZRMA 1ITZA 3KSUA 1E18A 1XTVA 1LI4A 4JUDX 1LJ8A 4L4UA 4PVCA 4F9FA 2ZRDA 3GFTA 3RF7A 2JZCA 1J00A 4J0GA 3U3DA 5LR6A 3FI0A 3DV2A 3PC8C 1FSZA 5I7WA 3IO3A 5LYYA 4BC1A 2DQKA 3FETA 4JL5A 4A1OA 3JAMA 2O7SA 3CUEF 2Z5GA 4MI1A 2E3JA 3V1LA 4B6OA 2JCGA 1LY1A 5TMEA 3NJRA 3FOZA 1X1RA 1HQDA 4KVFA 1XMIA 1YJ5A 4P82A 5AMXA 1FS4A 2VQ3A 4JOQA 3I2GA 5CRIA 1XUOA 4LFCB 2XE8A 3I4FA 3L5OA 4LXYA 5AT1A 3RAJA 3ZXIA 4WBNB 1ZISA 5CM9C 3L9XA 1B7GO 2SICE 4FGJA 4HGRA 3WJ1A 2ZXUA 3D6MA 2I66A 1TLTA 3JWJA 4BNYA 4EMUA 2JAHA 3N0WA 4GLLA 1L8QA 1XMVA 2HIAA 2QZPA 3KB6A 2J7KA 1ZKMA 4YMVA 4NXNB 3IMKA 1QM5A 3EFEA 1VTKA 2H5JA 4XTRA 2WKSA 1EWRA 1W59A 2C2KA 4URYR 2QDXA 1NE2A 5HMLA 4A8TA 4P93A 4EITA 4ZCRA 4E14A 5JI2E 5ESWA 4Q4JA 4EARA 4DV1B 2HU2A 1T6XA 1W0KD 2I78A 4XGIA 3R0VA 3OPNA 1EINA 5DP2A 4NZMA 4QDUA 4AUEA 2WQ7A 1UIRA 4HLCA 1XAIA 4R7TA 1A4UA 4B3CA 1YE8A 2DFNA 2Q6LA 4MGKR 4GMHA 3THXA 1NNUA 4FFPA 4WOBA 4BX9A 3SU8A 1UDRA 2W8ZA 3M6UA 1WMAA 5ALNA 1R8XA 3Q9LA 1FUKA 1P4AA 1OKKA 2DPLA 3VPHA 3NRBA 4MX8A 2WMNB 1B6GA 2V7PA 1XMJA 1YHNA 1F1BA 1Z4OA 4NENA 4HSGA 4QBFA 1XTJA 4UDOA 5KTOA 2OC9A 1JWLA 2FX3A 4Z1OA 3TXAA 4EG5A 2X1LA 3AHDA 4ZO4A 4LKRA 4F4HA 2VH5R 4MYTA 3H83A 2IW3A 5DNUA 4KUGA 2VTBA 3L6DA 2D6FA 2L42A 2XCOA 3DMGA 1NC1A 1UWCA 5EFOA 1Z8HA 1N6OA 2IDJA 4MWOA 4JJIA 1OFGA 3S7ZA 3WAKA 5AESA 1HX7A 1X7YB 3C15C 4GPBA 5E1OA 3N59A 1ZMOA 1ID1A 4CUKA 1MMFB 3T5CA 1IQPA 5EI5A 3TZHA 1YKFA 3BYZA 2PH1A 4EQZA 2PEZA 4TT8A 2DM6A 3GN2A 4IIUA 1XEAA 3E81A 4XOIA 4C4ZA 1KY2A 2HOQA 3ADDA 4I5EA 1ECLA 2A5JA 2PSDA 3LP8A 5BV0A 1DRVA 1NQ5A 3A1DA 2G08A 3Q87B 4JIGA 5EKDA 1KP3A 4N49A 5GONA 1ML3A 4P80A 5NULA 3T7SA 2I4TA 2ZYUX 4B32A 3O6VA 3ILSA 1IIRA 1NLZA 1R2QA 1VLZA 2X8WA 2O0KA 4POAA 2EFGA 1M6EX 1SIOA 2OGTA 3B7GA 3N7AA 3NHAA 4GQAA 3VDQA 4D82A 1WQ3A 3KT8A 3QX8A 4HR7A 2ZEJA 5DI3B 5JAQA 4AMUA 5DHRA 4LDZA 5EZYB 5JZMA 4XUCA 2Y6UA 3DQZA 2AUMA 5I3CA 5DEIA 1KK2A 3M6XA 4M1ZA 3OTGA 4EFNA 1DSSG 1I1NA 1Y5LA 2Y68A 3LQ4A 2FPKA 2G72A 3I2JA 3N74A 4AYXA 1OAOA 2C0PA 4HVAA 3MSXA 3ZHBA 4D4LA 2J46A 1QO9A 3EYWA 1Z9BA 3JU3A 1FFDA 1Y3DE 3VYVA 1PEKE 3T99A 4Q1BA 5AKLA 4TS1A 4U7DA 3KXDA 2Z1MA 1QDUA 4HBGA 4RVNA 3WWCA 2FZWA 2OKGA 3LKVA 4ARUA 1JRLA 1UPCA 2OHVA 1Y1LA 3EZFA 5CGQB 3G89A 3R0JA 4A27A 4LRUA 4N7BA 2AXEA 4I4TF 1FYXA 1VZ2A 2PUTA 3LLSA 1V3VA 4U7PB 5IDYA 3TGPA 2J3MA 4C4SA 2AFHB 4G5FA 2ONCA 2PCJA 5CDUA 4C43A 4D4MA 1XPRA 4KQ2A 3NWPA 1NJ1A 2WB4A 3U9TA 4TMXA 4DPLA 2J5QA 4YVFA 4KUEA 1ZVQA 4X62B 4FYMA 1JG2A 2GZAA 1T8SA 1L3BA 2QQEA 1R18A 4KX3A 2G4LA 1UPXA 2PD3A 3HZZA 3P2EA 5LD2B 4QM6A 3VV2A 2C88A 1GRCA 4OATA 3VO2A 3RBVA 2DBRA 4O33A 5CIWA 4PR0A 1ZXLA 3ETHA 4CN8A 1VE9A 2KYRA 2NSDA 3E3NA 3ESDA 1BVRA 1GEGA 2C1XA 3D2CA 1RBZA 4KL8S 3DD1A 4YCMA 1DOHA 3KTDA 4GX1A 3AERB 1Z26A 3BDAA 2PUWA 1P7CA 4FZ3A 4JWTA 3S28A 5BUCA 4YAUA 1TQHA 2O7NA 5EXPA 1K6EA 1YHYA 2M32A 3U3OA 3I01M 1UPBA 2IEDA 1O0CA 1WD7A 4HN9A 1CDDA 1EI9A 3FD8A 3IJ5A 2XTJA 3BBLA 1AKRA 3IQGX 2G9NA 3LDFA 4MS3B 2RKWA 4IUCS 4BZQA 3NS7A 2RH9B 2RSLA 4ZVQA 5LZ5A 3DYBA 3EARA 3CFYA 2BR4A 4CDRA 5AW2A 1Z0ZA 5JYBA 4AWXA 2BSQA 3H87A 1TNDA 2H54A 4R40A 1U8AA 2EEPA 4DBLC 3NW9A 4K8OA 1K8XB 1ZD5A 3VPCA 1KIAA 1Z4NA 5GGYA 5AIBA 3ZJ4A 4YT4A 5BSWA 2HJVA 1QONA 2VRCD 2N9UA 3O4FA 4HLQB 4KQ9A 4NPAA 3RYIB 4IXDA 3T0GA 5KYUB 3EQ6A 3ZHYA 2FG6C 1BX0A 3QENA 1KPHA 1CQZA 5GV7A 3T38A 2B82A 1IXRC 1T4DA 3F6BX 1YJXA 5DASA 4MARA 5TRTA 1U6JA 1T1RA 1PR4A 1RSZA 3BTUA 2VXYA 3D7LA 4TSRA 4B1FA 3HU3A 4GNRA 5JFOA 4FFNA 4PYMA 4IH4A 4XA8A 3EQ2A 5T67A 3N6RA 3NUQA 4FYVA 2BKEA 1ZUIA 2ENWA 5LVAA 3JSAA 3SJUA 1FYEA 4FBGA 2HH9A 3OJXA 2ZGVA 3M81A 3KTAA 1BHO1 1CHDA 1L7BA 1YCFA 2CW5A 2QD3A 2VRBA 3DDHA 4TQ9A 4EPWA 2B2XA 1RXEA 1ZZEA 4W8GA 1RCFA 3DLAA 5AJVB 3WGMA 2CLLB 2YJNA 5JECA 4TLLB 4CFSA 2OV1A 2G9ZA 3WTCA 2WI8A 2GBFA 3DAHA 3DGEC 4ER0A 1X1BA 5DN6D 1QOQB 2IYTA 3TZBA 2DHQA 2YZMA 2WM9B 3GJYA 4DLLA 1PHPA 2WABA 3C24A 2G67A 1GGJA 1YACA 3OAAD 2XDQB 1ZFNA 2M1XA 1H69A 3R3UA 4PY2A 1UP6A 1VSTA 4OREX 1D1PA 3ZC3A 3WS7A 1SQGA 3Q0EA 1J5XA 3JVIA 3UT0A 3MVEA 4YJHB 4C0AC 4Y1RA 4AMGA 3TG8A 3M2PA 3CZCA 4JL6A 4Z9AA 4CF7A 2B92A 5IAAA 1UP4A 3EBLA 3ILYA 3GLHB 3CGGA 3U31A 2OECA 5BYBA 2JANA 3CLSC 3IQHX 1W94A 1JJIA 2ZIXA 2QD5A 1MAAA 3H2SA 1E1MA 3F49S 3FWHA 4REQB 4OUDA 4WEOA 3RR2A 3ZVRA 1DUIA 1DJQA 2LWIA 3V8NA 3C5CA 4MYRA 2QN2A 1OAAA 1UT6A 2XYGA 3C0KA 4GECA 4LWQA 2J9YB 5HEKA 3VR1A 1TQ2A 5K20A 1BGWA 1IY0A 3BMQA 1WE2A 1Q5PA 3K31A 4JLSA 3T3HA 1JHYA 4HNUA 4J4HA 4JI4B 4XYBA 1IHDA 1NE7A 4UEJA 4X95A 1I6MA 2QX4A 4RA6B 1XMSA 2YOHA 2NP7A 5F2OA 4BLPA 4Z54A 5LMCA 1F14A 1G21E 2VHJA 2ZTUA 3GLGB 4ARSA 3NYIA 2R7AA 4GF5A 3D4NA 1DJNA 1ZESA 4QATA 2FG7C 3F7OA 1IIBA 1AV7A 3DVLA 1RQGA 2OD7A 1K2VN 1O94D 5DPMA 5HKBA 4A2WA 5K0FA 5EMKA 1I32A 4ETWA 2GCNA 1DAIA 4BNWA 2KE5A 2ZE6A 3GRPA 4EY7A 1CEQA 1DINA 2WIFA 3AHFA 1XZHA 3E5RA 4BAUA 1Z06A 5JPIA 1UMBA 4OHKA 2PM8A 5HM6A 3RC2A 3ROKA 4EELA 4KQHA 4RD4A 2PUHA 5AQEA 4X61A 4C0XA 2F43A 1DBWA 1ULUA 4M0DA 4LYFA 5DTIA 4BP1A 4D46A 1VPLA 1VI6A 3CRZA 1H1DA 2YXDA 3OP4A 3ZJYA 4XIIA 1Y1KE 4KQXA 3BK7A 1CKEA 2XQKA 3HLKA 2VP4A 2VUSA 1E7RA 2X1MA 3BRQA 3GF4A 1E0DA 2QIPA 4IXWA 2RBEA 2C4TA 1WUKS 5FR2A 1GZ5A 2GN8A 2FZEA 4YDQA 1QCZA 1YB6A 4ZVRA 2RCYA 3A1TA 3WGQA 4CLOB 4MR8A 4QFBA 3TW8B 4QPPA 3LWBA 3OESA 1JTFA 3QXXA 4RJKA 5ENVA 4LE1A 3F9IA 2A4MA 1I4TD 1RM4A 2YX1A 2EP8A 3D6NB 1YIDA 1D4FA 4JD5A 4DG8A 2R48A 2DY1A 3G0CA 1Q6ZA 4CFZA 3O38A 3CZPA 4PRZA 3OD5A 3P0HA 4MRRA 3B2EA 2Q0QA 1QQTA 2W6PA 4IJQA 4XYMA 2EKLA 3VPAA 1D0IA 2F3SA 3HO8A 3P9ZA 1YI8A 2R6GA 1AGPA 3IX7A 2O3JA 3OBBA 4TN1A 3WNZA 4DWJA 5BR7A 3SWWA 4L7VA 1E92A 3SLRA 4H27A 1CF4A 1RKVA 2PKYX 2VNSA 2X14A 4KHPB 5LA6F 1UQTA 3AB7A 3SYNA 3QXSA 3WYGA 4ZGBA 2BR3A 2G1JA 4F5EA 5K0JA 4RGBA 3WLQA 1OC2A 3RVLA 2Z4RA 3E8SA 4S04A 1W5TA 1U90A 3VNVA 1SXHA 2JHFA 4ZQIA 1WD5A 3UYKA 3ORHA 3H2JA 1GP2A 3LUJA 1QQBA 1VBNA 1KAQA 1ZAKA 2MYPA 2XTMA 4FOOA 4JXXA 3LU1A 1NVXQ 3WLAA 4UOEA 2QYOA 1TM7E 5J23A 3FDFA 4GLOA 5FPHA 3VQTA 4L07A 4XUEA 3ER9A 5CX4A 2IIVA 1Z5PA 9ATCA 3WMXA 4NG5A 1IXSB 3H2KA 3AUFA 4DUGD 4OHYA 1TM5E 3BMOA 4R83A 4AROA 4FGUA 3PGA1 1J1IA 2NW6A 4Y2RA 1U7XA 3UIEA 3X1KA 5TR9A 4IVQA 3FJ1A 2ZPTX 4IIGA 4JI2B 4X92A 4M36A 3NDJA 2VF8A 3GFPA 1WPXA 1O6FA 2OZEA 4FZJA 3IELA 4PZEA 2FMHA 2PQ6A 3AR3A 4KBYA 3R7BA 5I4CA 3HDJA 2DHDA 1NQXA 3G9QA 2JI9A 2DFTA 1XLTA 1KOFA 4L73A 4JLKA 4MHOA 2IU6A 5MF6A 3DLIA 3DVAB 2PU7A 2WD7A 4I1YA 4MWEA 4Y2GA 2ODTX 1GQYA 2PZAA 1R64A 3HEMA 3CC8A 4YCSA 3DKPA 5AKJA 1ORTA 2A30A 3KG2A 2AYZA 2DUMA 3FPBA 2O2EA 2CK3D 3LVBA 1P1RA 4ZMSA 3FCCA 5EJMA 1B6TA 1C41A 3TLEA 5LU8A 3SZRA 4TZ0A 2CY0A 4GQIA 1PWYE 1CY2A 2CXTA 3PQFA 3T3DA 5BVHB 3BRWD 4MSUA 2O2ZA 4UAVA 4NAUA 2NYUA 1YCGA 1RCUA 2GSDA 4IZIA 4BFXA 1X6VA 4DOMA 3TQQA 3K0AA 4G5RA 3TF5A 1EFRD 2C2HA 4HY3A 4CM7A 4ZDKA 2PA3A 2I80A 3I2KA 4MS4B 3SQDA 1YZLA 3AT1A 4DVJA 5AO9A 4X64B 2DPGA 2F2TA 3S2UA 3W77A 5JZBA 1L3CA 10MHA 2IUTA 4RQUA 4M1MA 3DFFA 1RJ9B 4MAFA 4PINA 2X2OA 1XVUA 3BIFA 3HCNA 3M4JA 4LIPD 4QUIA 1K98A 2W2PA 2PE5A 1MOSA 4KXUA 1U3UA 5JO9A 2UYYA 1GPYA 2AR9A 3MTAA 4YI5A 3L93A 3AHCA 4XM1A 3WC4A 1LX7A 3ZR4B 3IAUA 3V4PB 5KYYB 3VKUA 2EZ4A 4ML3A 2QX9A 3G7SA 3ME5A 4EJ2A 3L40A 3U37A 1PNVA 2P9BA 2BPOA 3E9EA 1ZQ1A 2FPGA 2AJLI 1QWSA 2XMSA 4AJPA 1DRKA 3K35A 3O8DA 4FDUA 5CGZA 3X2EA 3HY3A 4ES6A 3NDBB 1TL7C 4BTEA 5KYVA 3AHJA 2FOLA 2G25A 1CZLA 1EGAA 1FJXA 1VL6A 4O0MA 3WO1A 1TTTA 3IP7A 4CM9D 1BWSA 1U2RA 4TV9A 2A5DA 4UUMA 1YQTA 5DWQA 1P1FA 4ZD6A 4PG6A 5TGDA 3VU3A 2FRDC 3AEQA 4N9WA 3IP9A 1ST2A 1AB6A 1GGHA 2O2IA 3BSSA 2YNMD 4M7RA 5FKJA 2JGRA 4L8WB 2B8EA 4MHTA 3MGKA 2PGLA 1H2BA 4G5QA 3X2SA 2OSVA 4OK5A 1PW7A 1SXJE 3DOUA 1NT2A 2VA8A 1G4HA 2ZR9A 1E6CA 1GZVA 3E1KA 4IQGA 4HB4A 3TLYA 3FMIA 4V0MA 1K27A 3HL4A 4EMTA 4JXKA 6GPBA 3OLWA 1YRBA 3K94A 3IJRA 5JJBA 2M6RA 2BF7A 1X70A 2G63A 2A9FA 2MYNA 1DAMA 1R9JA 1SU4A 2YY6A 4K6FA 1TCVA 1FMFA 4RF5A 3PHBE 3GH1A 5G4LA 1DARA 2FE1A 4M1QA 3FYHA 2OD9A 3D0OA 1M7BA 3NUZA 1NDUA 4HAZA 4PYLA 3NV7A 4XAQA 4YR9A 1G5QA 3R5TA 4MDYA 1PR5A 3VDMA 2VYQA 2WU1A 3BD7A 3A6JA 1I8TA 2QE6A 4C4YA 1GNVA 1IK4A 5AKHA 2P9JA 4OXKA 4CLDA 1PTJC 4WMLA 4DLWA 1WUIS 4EBFA 3VJMA 4JC8A 3MGBA 3ZVNA 3V4LA 1VLQA 1GNRA 1T5BA 5HSGA 1CWUA 2PZLA 2AI1A 5EP3A 5BWMA 1IQ0A 4RMIA 4G5XA 3I5UA 2JHPA 2AJDA 3MTQA 1OIXA 3T5DA 3OURA 3ZYZA 1ODFA 1LI5A 1YTUA 3PQCA 1E9AA 2A0UA 4L9RA 4N3CA 1SZPA 4R2WA 1SQFA 1Y42X 3ZVMA 2R25B 1IOVA 1XIVA 3Q41A 4C1NA 3KYDB 1HDXA 3GLQA 1HTBA 5LLSA 3OFND 2O0MA 2ID4A 1Y9JA 1NLYA 1C9NA 1N2HA 2LIPA 3BH7A 2G9RA 2E1PA 2MHCA 1QRUA 1JDUA 3T7CA 1FMLA 1W2GA 3HYNA 1I1QB 2PRKA 1YRAA 1ORHA 2FPRA 2RAUA 2XVYA 3IULA 3RO7A 5IJ9A 5G4KA 1YQDA 4W7HA 3A1VA 1B0UA 3PXCX 3QG1A 3STWA 4ZHQA 2DUUA 4V39A 4UQOA 2YFKA 3MINB 2ZT8A 5JRZA 3BD8A 3KRTA 2I6FA 2XOXA 2ZBDA 4WY5A 2O07A 4EYSA 4YRIA 1NU8A 1F06A 1W73A 1FFBA 2E55A 2ZAGA 5SZHB 3TZLA 4PX3A 4AZWA 3GRYA 4ETMA 4IUDS 4L1KA 3FCEA 5BP7A 2J67A 3CLRC 2A78A 1T3GA 4GAEA 3H9GA 3IS3A 2F8SA 3CB4A 3UHPA 1T9GR 4FU0A 1TQDA 1REQB 1CSEE 4RK6A 1XVLA 1AKQA 1ZGAA 4KGZA 2XRFA 1G6Q1 2C2GA 1OGJA 1KYIA 1NA5A 3R0ZA 1L8XA 2PKCA 2NO1A 4JUCA 4X94A 2PD6A 4LF8B 3YASA 1G1MA 3LPMA 5KTMA 2JEYA 3N6VA 3TVTA 1I4OA 1RWNA 2VYVD 1N5OX 1YJBA 3N86A 3RS8A 4IIYA 4ARZB 4ZIRB 3M33A 4L8GA 4TZTA 2WJ4A 1EK0A 1KSHA 2NO5A 3ZE9A 3CPEA 1FNBA 5L45A 1XPOA 4EG3A 4MVYA 3OTWA 2A59A 4WKOA 3HQ4O 3FJOA 3GNSA 3JZMA 1BD4A 4LJKA 5F2KA 1P2DA 1IY1A 4YCCA 1KEEA 1M1XB 1OTHA 4LZOA 4C6TA 4CCSA 1N9GA 4MO2A 3KL4A 4P4LA 1CX9B 2W2MA 3HJGA 5DT2A 4G23A 3D6JA 1S4MA 2ACVA 3IP8A 4P5PA 5E1MA 5FIUA 3PL1A 3WL8A 3FWNA 4DLPA 2YWGA 3RM3A 5BWBA 2AW5A 1ZXBA 4RD1A 3AVQA 5C5IA 1KDRA 4MV9A 1RLIA 1WCYA 2YJTD 1JU9A 1XC7A 3VDXA 1G4AE 1L9KA 5C8YA 2NQ2C 3VO9A 1OI3A 3SEAA 3U7RA 9LDTA 3KJQA 2I62A 1PRYA 1EFVB 2VDUE 1KBQA 3R3VA 3SJCA 4K9QA 5F9HA 5JH7A 4ALNA 1EDEA 1N2GA 2PYIA 1FU8A 1W0JD 1J39A 3PNMA 4MKGA 2DJIA 3BF7A 1NQUA 1HRDA 1YWGO 4U7TB 1H42A 3W5SA 4DNQA 4NU6A 3JD4A 1KMNA 3JAWA 4JLOA 4B3TB 4EHFA 3C3BA 1UOEA 4LOLA 1H2HA 1J0EA 1JV2B 5D3MB 5DOZA 3ZDFA 4F3KA 3BPSA 4LSGA 1BNCA 3FIUA 3H5OA 3V55A 1RRCA 3AMVA 4BZXA 2V6JA 3PC8A 4ZOCA 2GASA 3ROPA 1B26A 3FUXA 1HORA 4GWGA 3H8JA 4G0NA 2VHEA 2HYIC 5BQOA 3JQ7B 4C5AA 4JP1A 2JJ2A 5BWNA 2YXEA 3M1IA 1F0YA 5HS4A 1G2QA 4MCJA 2PUBA 2VIIA 3ELYA 1P2SA 2BMWA 4DHWA 1XA3A 1E6WA 4WK4B 4OBXA 4ZQGA 4EHKA 3RI3A 4LOHA 9GPBA 1PK9A 3EC1A 1NJ8A 3E1GA 4HP8A 4U6QA 2XMCA 1USUA 1L5VA 1SB8A 4TT3A 421PA 4EUHA 3O4VA 1UMDB 5FUBA 3V2IA 5H4GA 2E18A 1JWAB 1SKQA 4RTOA 4WV3A 1J0DA 3KEGA 4R81A 3M3DA 1JFVA 1NVAA 4G26A 3V42A 1YXMA 1M67A 4JC4A 4V24A 4TYMA 1S6YA 3LCVB 1W1WA 5KYXA 4P4GA 3ZHCA 1PDOA 1SULA 3AUXA 3EASA 3TTTA 3KL2A 3OZXA 5AW4A 5K5EA 1DQZA 3OOJA 5F51A 1M6NA 3AESB 4KXVA 3TIGA 5LOVA 1JAZA 3KCQA 1FRVA 2FKAA 5EIFA 3DC7A 1D7OA 2JLCA 4ILKA 2OVFA 3KX2A 3W9YA 5IS2A 1KGSA 2QMHA 3H5RA 1GFZA 2OLJA 3QKSA 4LTNA 3EXEB 3LUKA 1Y7TA 4C3OB 3ZCQA 5TQ2B 1L4HA 5F1YA 1WXQA 4S1OA 4Y9TA 4ASUD 5HTKA 1YONA 4E51A 3QFSA 1P9NA 4EHBA 3RJTA 2VVTA 4CLRA 2JKVA 5ILQA 4J2TA 4LZPA 4ENQA 1AKEA 3WYNA 1OLUB 2VZ9A 3WDKA 4CKEA 3TLCA 1X1AA 3ZNQA 4YYZA 1LD3A 1NRIA 3UOWA 4YRGA 5HQ3B 3QV2A 1U81A 3DHYA 1RI3A 5CCXA 2J6BA 4UDXX 2GAFA 4B9EA 3GIWA 4O4IA 3E23A 5T4BA 4MA5A 3K5PA 4X1IA 3X43A 2BHLA 4EB0A 4M1TA 1EUCA 2GM4A 1G8FA 2I4MA 4P0QB 1YULA 3M5PA 4DCVA 3HRKA 3RQIA 7MHTA 3GJ4A 1VG1A 3QA9A 3PTLA 4YJGA 4TXMA 3SXUB 2YHIB 1TYEB 4FOSA 1G18A 3P9PA 3H4MA 4JU8A 1YZUA 2HA4A 1I0IA 1LA2A 3RU2A 1MV5A 3N9IA 2JIRA 2EJVA 3DGFC 4QDOA 2GZHA 5DULA 2ZJAA 1Q2UA 3LY9A 4TTVA 3RUHA 2RHLA 3TRFA 4U7GA 4UM9D 2XUZA 5MGBA 3ORFA 1R9NA 1ORDA 1LU9A 1ZD2P 2DGDA 2O54A 3COPA 4ZI5A 1A72A 3R0XA 4BP8A 1EGHA 2WJGA 1A2BA 3MWKA 4K6GA 3HRIA 3QVJA 5WRFA 3K0CC 3IJPA 5BUQA 1RYDA 2FWIA 1E6MA 3ICWA 1C1XA 3IRVA 4J43A 3ZKWA 1NPYA 5E7JA 1P72A 3QE9Y 4EKYA 1Z47A 3E9YA 3GOQA 5BURA 3MUEA 1XZQA 1EG2A 3AJDA 1WR8A 1XDBA 4IGFA 4MW1A 5D7BA 5IT9A 1MORA 5I45A 4X3PA 5FWXB 4DA9A 4WAUA 4WNIA 3K30A 4CIDA 4ZYYA 4MDHA 3FR8A 2N47A 3L6OO 3Q2OA 1X39A 2D2XA 1DTSA 4RIEA 3LTNC 3RVPA 1CP3A 2FB9A 5FNVF 4UVEA 4OEHA 4GX2A 3SJAA 2Q0XA 4O4LF 1B42A 2G5TA 4CT4B 1OTXA 2PY6A 4UTOA 2YC4C 1ULSA 3UHOA 1FLVA 5TQ0B 1KWKA 4XIGS 4QYXA 3OM9A 3QJ5A 4JBHA 4CMKA 5C34B 1RYNA 2QM3A 4FNGA 1DHTA 3QELB 1KGDA 4CF5A 4KVGA 3U7QA 3JALB 1XTPA 4FYKA 5E3JA 3QEAZ 1HEYA 1UFRA 3AHEA 1JYEA 4Q3NA 1V25A 2XR1A 3ETNA 4XE5A 3GWZA 4L50A 1R4ZA 2H11A 4MNTA 3TYXA 2C7OA 1G9SA 3N8KA 4DMKA 3A6FA 3H97A 3V4FA 2A9VA 3LZ6A 1F2TB 1V3QE 3UVEA 1Z6QA 5F5XA 2FPXA 1EUDB 1MC8A 1TMOA 2EYQA 3H2ZA 4HX5A 4P81A 1TJNA 4MVJA 4C1BA 3OZRA 3HXOA 1NF9A 3CPSA 4CUZA 1GPLA 1VDMA 5ERGB 1Y1RA 2ONKA 3B1KA 3WLOA 4H17A 3DMFA 2C3YA 5EHGA 2ZRCA 3AVWA 2AOTA 1UM8A 3Q1KA 4AC9A 5AM1A 3L1VA 1HYBA 1M3SA 4DRXA 3O9VA 3IKTA 2FMTA 2JCVA 2C03A 3D3NA 3I92A 2GHTA 2I67A 1NXXA 4G5SA 4LC9A 4QTTB 4L5JA 1JB1A 3CGWA 3ZDYB 4NCNA 1VFPA 4AZ3B 3LP6A 1JBEA 4XCVA 5ES4B 1WSAA 5JARA 1LVUA 4ZYVA 3URKA 5JASA 2UVPB 1HE1C 3DEIA 2F8LA 1PZMA 1KVQA 3GZ4A 4NNJA 4X1YB 5KSOA 4Y6SA 1E3DA 5CDSA 1NQOA 4D4IA 5FUWA 3R3SA 1PJRA 5FOSA 4EJMA 2C82A 3RIHA 3EXHB 1CBUA 2PX2A 2Q6KA 4S2UA 2JAWA 4FB4A 1CCWA 4QJIA 4V38A 1E1NA 3JYOA 4A6XA 3MBKA 3G7UA 2B8WA 1IQRA 4BJ1A 4EGJA 1E62A 1ESEA 1UOOA 4V1CA 1J21A 1GAQA 1WHSB 1C1DB 3CTMA 4N5MA 5GQSA 3HYCA 4BQNA 4Z7QB 2GN2A 4G56A 4PWYA 4K9KA 4P3OA 4TMWA 4JMLA 1X7ZA 2ZVJA 3CVYA 4UHBA 2X4IA 3NHUA 3GMIA 4MW9A 4BPRA 2TECE 4UTNA 4G09A 1WY7A 2F8TA 1V7QA 3EVTA 1QWOA 4DLKA 5FHQA 1L1FA 3N8DA 2D7CA 5JCJA 2WPDA 1M54A 5EJ5A 1VE1A 2ZIFA 1FPMA 1CQJB 2P9QA 3MW8A 9LDBA 1VB3A 3DFIA 4AX8A 4B87A 3VO1A 4GZ3A 3MOIA 5B1IA 4A8HA 1E5TA 3QX3A 2BEUB 3GUVA 1BCRA 3OI7A 4MA0A 5IAKA 4X1OA 1YFZA 2YV4A 1JL3A 4OYYA 1O3YA 4BO9A 2VP2A 1VM6A 2V97A 4F8EA 4PNEA 3SBEA 4GE3A 4GI5A 5EJIA 1YVDA 1S2OA 2EBUA 3IC5A 1RQNA 4G67A 1BDIA 3E9QA 3GNQA 2NIPA 4FYWA 4B0PA 4C4OA 1NF3A 1EUZA 2AXNA 1SBHA 3QLJA 3NORA 4LZWA 3A9TA 3QLTA 4DV3B 1W0CA 1RAHA 2OAEA 3GJRA 1YFKA 4HB2A 4B83A 2VT6A 2XUKA 2MSNA 2FR8C 2PWYA 4QVGA 1IWBB 1NVVR 4RXMA 5ALHA 4DYHA 1Y5RA 2I0FA 2W4IA 2AFRA 2ZRMA 1O4VA 3EIEA 4LE2A 3VVBA 4QSHA 4F46A 1KEUA 2X77A 1QHIA 4U02A 1IN5A 1NVDA 3ER8A 5HIKA 1XWWA 1WXDA 2B1RA 4G0XA 4OM8A 2DYKA 1P2TA 4AP9A 5TVKA 3G88A 4ND8B 2HDHA 1N57A 2PL5A 2Q1SA 3IPYA 3TQCA 4KX5A 3J80A 4FUQA 3OTOB 1PFGA 2FFAA 2GUWA 2R7KA 2WF7A 2IGBA 3SI7A 2FEAA 1RE1A 3SY8A 3V4VB 3GLFA 3AC0A 2CWWA 1ZJZA 4MUAA 4TL6A 3WWYA 4TTSA 3VR3A 1UXOA 1Z38A 2FJUA 3ZZNA 2GJAA 2RJOA 5FX2A 3LUAA 2MU1A 4Y9SA 5JIBA 5EWJB 3PLNA 5AFSA 4TWRA 1T5IA 1QGUB 3D8HA 5HFAA 2P2NA 2D1TA 4QELA 4I1PA 2E21A 4R2IA 3CRNA 1ZSNA 4AO8A 4YY3B 2GZ2A 3ELUA 5HA5A 2GESA 3K8ZA 1L7PA 1IHYA 4Q4AA 5C3MA 1LJUA 5HOQA 3ISVA 3ST7A 2P1DA 4U5XA 4YONB 3V1NA 1G3UA 3W8NA 5C4GB 3U19A 2IH2A 2FI1A 4Z8XA 2QF7A 4IDHA 3LJKA 3ESXA 3GZNA 5EA2A 3VPFA 1OH8A 1RHMA 3P2KA 4OQFA 3NM5A 1E1YA 1R0RE 4DZZA 4B85A 4OAPA 2HCJB 5EIOA 3FPGA 5CYPA 2C2OA 1WCXA 1YTLA 2EL7A 2ZZMA 4DTIA 1YT5A 1RAAA 2CNNA 2NADA 3ECSA 1KDTA 4Y2TA 1GKIA 4I50A 3LCJA 3L9WA 3L04A 1A69A 4QHSA 4DIEA 4MLDA 1QV9A 3CLTD 2DBZA 1YS9A 1V26A 3G3EA 4D9FA 3TUZC 1P5HA 1RBQA 3IBTA 2A94A 1KWGA 3CO5A 3FRJA 3KDAA 2PT6A 1U3CA 1MO6A 3NC1C 4L8FA 4KO1S 3G23A 1UR5A 4N9QA 1ISGA 2BBWA 2C2YA 4M0KA 1VQ1A 2GEDA 4Q6WA 4ZAWA 3P9QA 2PJDA 3A25A 3A32A 4RZ3A 2YJZA 3VR0A 4IS3A 5KKNB 4B71A 1GPAA 2XBLA 5D51S 1JI0A 4YIKA 4F11A 4US0R 2BR5A 1I36A 1VJ1A 2HBZA 3WGZA 4B5LA 3DH0A 3B8EA 2Y0CA 4MI3A 5DCUA 3I04A 2XOKA 2XWJI 2V3VA 3R20A 1C3XA 3S1SA 4RDXA 3ZZMA 4BQIA 2GFQA 4PSDA 1N78A 3VR2D 1V5GA 3BDVA 5JRJA 1NW8A 1LSOA 2IVZA 4EA8A 1B8VA 3C8ZA 4DPKA 5IWAB 5AW5A 1P75A 3H5LA 4MJ7A 1NVEA 3FMOB 2AEEA 3MFYA 1D03A 3NBQA 2VDVE 2QJOA 1K89A 2ODWA 1X2EA 4GMGA 4LNUB 4W5TA 4TTIA 1KQOA 4RDHA 3K20A 1F4VA 4NJEA 4EEXA 3G8YA 2XXAA 1PN3A 2IWHA 1V6AA 4RVCA 2M9MA 2O8BA 1D2GA 1E9RA 2CLIB 2HEIA 4LFBB 1ESDA 4YP0A 1EBUA 1A7AA 1JAXA 4CKXA 4KE9A 4ZZIA 2IE0A 4M54A 3VSCA 4XEUA 2O0JA 4IWNA 4IQ8A 4Q3DA 3PI6A 2H3HA 3KSBC 3I2FA 3MGGA 4RACA 5CVDA 4ZT5A 5J63A 2GAIA 5B5SA 3WISA 1L2TA 3DMTC 1BVHA 1MH1A 4LDPA 4PGMA 5ABPA 1BRMA 4M6WA 5KC8A 2PFKA 2NMVA 1FXWF 3MBIA 4KITB 2YW2A 4X7MA 1GQQA 2QZSA 2W8BB 4C06A 2P1RA 3TPZA 3WK8A 3CF0A 3AF4A 1HOXA 5AW1A 2OXEA 1Z4JA 1IUKA 2DSTA 1BYUA 3GBPA 1X42A 2HAEA 2VKTA 3AWIA 4RW0A 1E2NA 3TLMA 3Q3CA 3BAFA 3N7TA 4GPTA 4LHVA 5IEBA 4E09A 1CD5A 2L19A 4B34A 1RYYA 3KNZA 2FPIB 3VAZA 2YDYA 2VYNA 4RHCA 1APBA 1NZDA 1CEEA 1Q1NA 4GPAA 1JEOA 2WE8A 1C50A 2C20A 4Q4JB 5H82A 1ATZA 4ERNA 2GD6A 3L7KA 4NFSA 2JJMA 2PYDA 5KVCA 1Y48E 2PUCA 2O3TA 1JEQB 3LPDA 4HDRB 3RVJA 3GG2A 5A0FA 3B53X 1T10A 3JQRA 1IZZA 4JBIA 2X2FA 3L1KA 2YVAA 1K68A 2DY0A 3RHTA 3N2KB 1WUHS 1GPH1 1D07A 3KUDA 4BKQA 4H3KB 3UPUA 2IYXA 1U2ZA 1IM8A 4P92A 1UXGA 1R10A 2RONA 1VL0A 1KVSA 3MBOA 3RS3A 4YMSA 1L4BA 4M0FA 3FVWA 3JQEA 3BH0A 1ZH8A 3JTMA 4JJAA 4M7WA 1A1SA 1QVZA 3WP1B 4BVEA 1GAXA 5B1EA 1QNLA 5KTKA 3B89A 4YP7A 2JARA 2IRWA 1DXHA 1TUGA 1J9EA 4A6PA 5BV8A 1A5AB 5AK5A 1AGYA 2V7TA 2XOEA 3H1GA 1GZSA 2VAVA 1UC9A 2P90A 1UJ5A 1OU4A 2ZWVA 3C3YA 2CF6A 4IFTA 5FUVA 4GL2A 3AKYA 3UGTA 4JDPA 1EFPA 1RKUA 5K3EA 4CT5A 1KO4A 3K6KA 3KT3A 3PXEA 3MD0A 1M2NA 2BGWA 3SQNA 2ZU6A 1J42A 1UK6A 1ZRHA 4D3XA 3STUA 1OFIA 2QL7A 3CZ5A 2FRDA 1QC5B 2G8NA 3GNLA 2RIPA 3EW9A 3GP5A 2NZJA 5CB4B 7ABPA 2HSZA 4QPZA 1EX1A 2J3JA 2IOFA 5K3SA 3AG6A 3FY4A 4DN6A 1TUBB 1US8B 3EODA 3KLOA 4YRPA 1ND6A 1E1KA 3IP1A 3AI2A 3EVBA 1DIOB 2Q9AA 3FA2A 3UC5A 4R01A 3R3WA 4GVPA 4I5IA 4WEQA 4LV8B 3T94A 5KOJA 3AVYA 1PJLA 3PZRA 1U6IA 1FDTA 3GEHA 4I4IA 4RLHA 1E64A 4ZI7B 4JBNA 2A7XA 2W98A 4HAOA 1JR3E 3T52A 4UMDA 3SVLA 3OSUA 5JALA 1BEUB 1OBVA 1C7RA 3KJXA 4H3HB 4KQGA 5BW6B 4B6GA 3L0CA 1S7GA 4MJLA 4WZZA 4KLRA 4G36A 1CT9A 3NEAA 1Z13A 3C5WP 3QPUA 4LE0A 2HK8A 3H8VA 4Z86A 4F5DA 5CDFE 1AZTA 1WW3A 2JGDB 5AXDA 1S3GA 1U7OA 2XVAA 3BSYA 1PJAA 4IQFA 1PTJA 3FVTA 1XTBA 3JZIA 4G5GA 2FK7A 1FDSA 1FBTA 5AI4A 5FFMA 4EVSA 2ZPAA 3LO8A 3V3KA 3SBOA 4QU5A 1XHLA 4LCBA 1Q84A 4Q4LA 1SB9A 1W46A 4LOAA 1I2AA 2ANBA 1NN1A 1FDRA 3OZWA 4HH3C 3OQVA 1JXOA 3CYFA 5C8ZA 2HQSA 4KE6A 4GKBA 1VG8A 1T5LA 5ITVA 4UULA 3ZLTA 2V98A 5EKUA 4BMNA 1QKJA 1GILA 5AJWA 3AW8A 5HKKA 2JEZA 2X5OA 1P7ZA 2QD1A 2Z0MA 5A6SA 3KWFA 2I2XB 1PJ4A 2D5LA 4B48A 4EFDA 3WSWA 2IHJA 3BAZA 3T1NA 1VPWA 2AN9A 1CB7A 4D6PA 3THYB 4PFJA 1Y8AA 1JXMA 1ECBA 1TK2A 1OZAA 1DMRA 4ITVA 5BNFA 5DI9A 2AZDA 2EV9A 3WB2A 1R0KA 1VKRA 1XKXA 1TVKB 3K0HA 3LIIA 3UJPA 4B4KA 4BFSA 5HUHA 1LNQA 2YV2A 1TTQB 3UJ7A 2FJ0A 1WOMA 3W3AA 1GSIA 3DZIA 3O8QB 1FPQA 4QRDA 2AZTA 1ZJWA 1QDEA 3GMDA 4KQCA 3G5TA 4QG3A 4DV2B 2EW1A 2Q27A 4H08A 4PIVA 1P0PA 2B69A 2UZ1A 1GL3A 4Y18A 4XVQA 1NVMB 1E58A 1LBHA 3PXUA 5MHTA 3ZIAA 1JTVA 2IH4A 3OE1A 3CJQA 1TK3A 4W1RA 3EBPA 1RAFA 3HB5X 1LDBA 3PHCA 1JHMA 2RDMA 1QDLB 3T4EA 3FLBA 4PV7A 4CKCA 1MG0A 5FWYA 4NWIA 4YXWD 3QBEA 2ZCJA 1XTKA 3HDHA 4UEQA 2PGDA 2JA2A 2YN0A 2F48A 2CB9A 5CVCA 1V8ZA 5FFNA 4DCTA 1KEVA 3JPWA 4HDAA 1NFFA 3ET4A 5DB4A 5DBEX 4UBIA 4H1UA 4BVLA 1WM1A 1JT2A 3FMGA 1JH8A 5EP4A 4E2WA 3UAXA 3WY9A 1WMBA 1SBNE 1E3EA 5D5QA 2G8LA 1TZMA 3K96A 3MB8A 4BGUA 3IUEA 4X8LA 2IPAB 1FYVA 2VHYA 3GEEA 1JUDA 5JAOA 2Q5FA 2QN7A 1QHNA 4AP5A 1TYDE 1J2RA 2Z8ZA 1ZI8A 3IOBA 3S55A 4MRSA 4B4OA 1C0PA 2X1VA 2ZIAA 3Q7PA 4FT4A 3SC2A 3TLGB 3WQRA 2PLWA 1JXQA 1DC3A 2V4ZA 3PF8A 5IPFA 1P0MA 2GJ4A 4B5KA 1DC4A 2B99A 4BV3A 4FX5A 1MA0A 2BH9A 2HRBA 2IDMA 4H7IA 3WDMA 3CSSA 5DBOA 1WJGA 2FQXA 4IZ6A 4R41A 4J1TC 3ASYA 3IEPA 4Z7NB 2RBGA 2OCAA 1CVIA 5KB3A 1EFHA 4NCAA 4OX9B 5G3YA 4IO1A 1UKAA 2OO7A 2PZJA 4KEAA 4D7AA 1GG5A 4KOEC 1SEPA 4UCFA 3UV3A 2NQTA 1LDEA 2ECKA 3F8TA 3LV8A 1XCMA 4ZVMA 5TARA 2JFBA 4K1LA 1MXHA 5AVRA 4YECA 3DLHA 5D3KA 1U4OA 1YZGA 4ZA2A 3ZGNA 4WERA 2VF4X 1R00A 2AKEA 1Z7YA 5I3ZA 4BVJA 4NH0A 3A4VA 3HN2A 4RTLA 2C2MA 4IICA 2FZKA 4XJTA 5B7NA 4NV3A 4J0IA 3PC7A 4Q3KA 5EXEA 3IXQA 3C7KA 4MV0A 1G64A 1C0KA 1P31A 2ZIXB 5G41A 2NAFA 3BJEA 1KU0A 4O4HA 3SGLA 2O8DA 5C51B 4C22A 3WGTA 1JG3A 1TCUA 2AMFA 3KDPA 4GP7A 2VF7A 4N8DA 4OQXA 4HVCA 2CLHB 5HP4A 1FFYA 1L7RA 2I2WA 3BMNA 3OLXA 1AN0A 1RQRA 5IBPA 3URMA 3DZDA 4ZAZA 3AY3A 2Q7OE 3NKLA 4AWBA 3PTAA 1VYHA 4RGVA 1X0XA 3EY9A 5IDQA 2QENA 1KIMA 4UXJA 1JEYA 4B74A 2VT3A 2V59A 4QGAA 1EFCA 5HE9A 1JQDA 1L7DA 5F7XA 3V1MA 1MBZA 3IKVA 2NXNA 3O8LA 2XB2A 1KEZA 3MF4A 3CR7A 2XNKA 3AF5A 2BF4A 2DTEA 4QRHA 3ZBQA 5KU1A 1DVRA 1G5TA 1QANA 3R3JA 1MVOA 5I4IA 3ER6A 2UU9B 5ALVA 1O87A 1GTRA 3KAPA 1PAUA 2GD2A 2L17A 1D2RA 3RVSA 4OA5A 1YA4A 4WD3A 1TT5B 2Y1CA 4BVBA 1G3MA 4JT8A 4UZFA 1C8LA 4OI0A 1KBOA 1MA3A 3W2GA 1B2LA 5CDYA 2VCEA 4HMQA 3LOPA 2IPXA 2XWSA 3VU9B 5IJ0B 4KI0A 2WEKA 3NBYC 1BMQA 4NHEA 1LI7A 4WA7A 2EKZA 3AI3A 4ZQEA 1C7FA 2HWKA 3UBMA 4PC2A 3AI7A 3MTJA 3TQHA 3VU0A 4HAWA 5H5JA 1G8GA 3DG9A 3LC2O 1BXGA 2DRIA 2VPZA 1P4GA 4QLOA 3V8BA 3R6GA 3JYHA 3G1TA 4GZMA 5ECDA 5BSGA 3PNYA 4D8YA 4KXFB 1X80A 3AP3A 4ISBA 5EQDA 1L7AA 3QX7A 1OZFA 3CWCA 4OO3A 3N5KA 7REQB 3ZE0B 1JSLA 3WMWA 1VP9A 2OP0A 2HF7A 3KFVA 2B4KA 4FFBA 4X7PA 5CK5A 5DYTA 1R9GA 1VLHA 3WYFA 3KEQA 4PWZA 2O5EA 4I3HA 2Z58A 1SUIA 2A9PA 2AVNA 4ZAYA 4JNKA 3WBFA 3F8SA 5AUQA 1A04A 1EIZA 4HC4A 4UCQA 1NXSA 1GZ3A 1N3BA 2LNDA 3QLEA 3WYAA 4F60A 2G88A 4RL6A 1RI4A 4PSCA 4HOYA 1CS0B 3GQBB 1U0OC 4BL5A 3OE7A 3KSAC 4FEEA 3PXAA 5EE3A 4BMZA 3H5VA 1ZNYA 1XCBA 1ECFA 1N5RA 2W4QA 2JJ1A 1IXYA 2RIRA 1ZDMA 2VR1A 3T0FA 2OAQ1 1DXOA 1YUMA 3K1JA 2B30A 2UXDB 4AKEA 2VPXA 3K0CA 2QPOA 3OIVA 4B80A 1QYXA 1CUYA 1NVUQ 1Z17A 3Q88A 2QN8A 4LMRA 4O2BA 4WCVA 3SK0A 4ERXA 1AHHA 1K7CA 3DEJA 1NXWA 4F1WA 2NV6A 5BR1A 4JMPA 2FPUA 4BTVA 4CU5A 2EP5A 2W0SA 5GVRA 1QHEA 2XTZA 3IUYA 3L43A 3IT1A 3T1YB 1S5PA 4RHXA 4DRYA 4DJAA 1DBPA 1QX3A 4OLBA 4MQ5A 5FB3A 3O3CA 4MQ4A 2ZAMA 4QPDA 1L6RA 1YZVA 2WLTA 1GRVA 2AXQA 2WUGA 4MVWA 3UOGA 2QV7A 4ZKDA 3CX8A 1SIWA 4AY4A 3QYAA 2MSDB 1UDXA 3JCZA 3R7WA 3B1WA 3BGVA 3FKSD 2BYTA 2ORWA 2F7SA 3DEAA 1N32B 1QU3A 1HZJA 4NTZA 1UWVA 2JI6A 1E8NA 2QVCA 5FLEX 1T4CA 2P91A 2C07A 3NHMA 4JBGA 3B3QA 1K5PA 2D1SA 5IM4F 1NPDA 3ZXUB 1EFUA 3LNCA 3QE4A 4EG4A 2G6BA 2QA5A 3U09A 1ZAYA 2W9XA 3LGAA 3DYIA 2OWDA 2QR3A 4FGWA 1XTUA 1LPSA 3N53A 3S1AA 3KQSA 2QTLA 1QX4A 1BHQ1 1Z34A 1UZNA 4ND4A 3K9HA 1N5MA 5LLTA 1I7DA 1BXRA 4LXUA 4RL4A 3ENWA 2NV2B 4JCCA 2YQ5A 1QGAA 5L3VA 4KODA 3L7OA 4YMUA 1S0UA 3GP8A 3UWOA 3FNEA 4PGGA 2BFWA 2FUG6 4F5ZA 1F6BA 3JY6A 2VH1A 2XT0A 2L0XA 2WJAA 4KDEA 2X0EA 2RGXA 3TNFA 4CCYB 1L7NA 2HDOA 4GOND 5ALDA 1KI2A 4D42A 4NMXB 3O8CA 2P2YA 1DFIA 2WZBA 3TW6A 6YASA 3MMNA 1HEIA 1TKBA 3SOZA 4FLMA 2Y92A 1GPNA 1HDIA 5E3IA 3TLZA 4WESA 2BKVA 3CVVA 4JB3A 2XD4A 2JFHA 5CA1B 4BBZA 4NVRA 2HB6A 2ZVQX 2XUHA 4RF3A 3KKQA 4O2AB 3ECAA 1TTHA 4PNPA 3HJBA 1LUAA 5DXFA 4N47A 4B3RB 3ABOB 1VRCA 3AF0A 4QODA 1GRQA 4EYOA 1XTTA 1MUUA 2P77A 4P53A 2PT9A 3TNYA 3TJRA 3T3MB 4LWPA 2HCTA 1H66A 4QUAA 1UJNA 3V9AA 4GZLA 3JARA 2XKAA 4N03A 4D99A 3CW2A 3DHWC 3DONA 4BJ5A 2J45A 1CUGA 3VGPA 3DE0X 2NZYA 1ADCA 3FCYA 4YROA 1YE3A 2B4QA 3N2LA 1P61B 4NQRA 4HUTA 4YV7A 3WL5A 3SHQA 5IKXA 3FGPA 4O5OA 5ICCA 2PRSA 2FN3A 2O2YA 3NATA 1SXGA 1U8XX 1RZ3A 2X4GA 3S99A 3FTFA 3MRXA 3I53A 4I6JA 3L7CA 4A0RA 1AH2A 2AD1A 3V32A 3BZUA 4Q3EA 3E2MA 4HO1X 3D4PA 3GBSA 3D02A 3WL7A 5FHRA 1P44A 3LMKA 4IMJB 4JNCA 3V48A 3L18A 4B43A 5LDHA 4P4NA 3OVMA 4OSEA 1PS8A 2MSLA 3JD0A 4J1NA 3B1JA 1TC2A 3MCUA 2Q28A 4R1UA 4JYAB 1MJNA 3MFQA 1CE8A 4QXPA 1NQVA 5CU7A 4DADA 4KAJA 4DIOA 4I8IA 4EATA 3ZDDA 4X6XA 2BBTA 2GM3A 2BMEA 1KAMA 1P29A 3QPBA 4I8DA 2YWEA 1N2CE 1N92A 2D2FA 5FBVB 3AOGA 3RODA 2CUTA 1I9GA 4AULA 1D2EA 1K66A 3OIYA 1NW4A 3QQ5A 2IDZA 3H13A 4IRUB 1OKKD 1OI2A 2VJKA 2J85A 3J81A 4F1KA 2MSKA 4Z0TA 3U49A 1EA7A 4IOJA 4DLXA 5KHLB 1RYEA 4L3VA 4XX1A 3S3TA 1F38A 4HWPA 4UBJA 2AV6A 5KC9A 2FR8A 2QNRA 4L4XA 3SIRA 3LWDA 5TF4A 1P60A 4Y1FA 3T9EA 2P62A 4H6VA 1J49A 2BY4A 2ZYRA 1E9CA 2Q3DA 4GWKA 3C8HA 3D7KA 4H4EA 4M1YA 3KQQA 4AP6A 5F1OA 1ACMA 2DCUA 2KWIA 3I8XA 3I9JA 1S2GA 3TR5A 4DBZA 1AXEA 3KJZA 4Z9YA 4U1RA 221PA 3KEMA 5IKMA 1E9SA 3OY2A 3PFFA 3QSGA 4TV8A 2HHCA 3VH3A 5C7YA 1EHYA 1VLLA 4MUHA 3OCJA 5KIAA 1KEKA 1X9HA 2UUOA 3R7AA 4A0HA 3FNBA 3NGXA 5IJ9B 4BVFA 5H8WA 2Z43A 1XNQB 4RY8A 4Y2YA 4Y9UA 3OE4A 4CG1A 4ZHQB 3Q15C 1JAYA 1HI9A 1X74A 4OB6A 4QASA 4UTVA 1ESCA 1UXIA 3EFHA 4OUKX 5JPDA 1DDOA 2DWCA 3ZZ1A 5KJCA 1RLTA 3NI2A 2QQ0A 1Q7RA 2HCBA 3JAKB 3CXUA 1HRKA 1BS9A 3R5KA 4NEQA 1SRRA 3WLMA 3HVJA 2WWHA 2VNHA 1GTMA 1D8TA 3CMMA 3R74A 1JQKA 4RTRA 5FBQB 1QZZA 4DR5B 4QJBA 4C21A 3C7DB 4P9NA 2EHJA 2WMYA 4P5EA 1JFSA 3B9BA 5KWEA 2FWPA 4FXPA 1GFWA 1RJFA 4RO0A 1NW6A 2YICA 3GGJA 1M76A 3GZJA 3IB3A 4R31A 4PRKA 5IZCC 1PVOA 3O8BA 3ZE8A 1ZNWA 4FW8A 3PFCA 4I4TA 1RZRD 2ZI4A 1U9JA 4IDAA 2G4CA 5A4AA 2Y0EA 3TCXB 2J9FA 1Z2OX 2G77B 5TC4A 2VDLB 1DQRA 2QBYA 1NI5A 2C2XA 3AONB 3NG1A 2TYSB 3MERA 4Y1GA 3IA2A 2DPHA 4F4JA 3G6KA 1HYGA 4INZA 5LWQA 5FTNA 4DPMA 2V45A 1U3FA 4ALKA 1NL3A 2XY4A 1RXWA 2ONZA 1N6HA 2HU8A 2ZWOA 1K3TA 1SKBA 1AM4D 2NSHA 3EWIA 3NEYA 5IUKC 4W5QA 5LZ7A 1CY7A 2V96A 3GG9A 1N9GB 3KTFA 1JFRA 3BE6A 3USCS 5CG1A 1CY6A 3HR4A 4E5UA 4HQRA 4NSNA 4PIPA 5ECYA 2BUCA 4YJFB 3V8EA 1KMHA 3F2IA 5BV7A 2YC2C 1XTSA 4MYCA 1ZVMA 2X40A 3IAAA 3OZSA 4ZVOA 3ZN2A 1JA0A 2IYYA 4GPZA 3U7JA 5FULA 3FSGA 2X15A 3S1LA 3VMFA 1XAJA 2YQ4A 2R6JA 1G59A 5FBWB 3T7TA 4GM4A 2E4YA 5C8YB 1FFHA 5KBYA 3RUAA 1YI1A 1VGQA 1X7XB 4OXXA 2PSSA 4Q0MA 2PBFA 3OJEA 2F62A 2RK3A 2WF9A 4OQEA 1EIWA 3AIKA 3N2GB 1V16A 1P4SA 2F3RA 2B20A 1KSFX 3W7BA 4CMHA 1L6IA 4RFVA 3RYFA 1TKAA 1W49A 1TAQA 4PPGA 3QJGA 4FJ2A 2Q07A 4HRAA 1CQXA 1RVV1 1W19A 3O93A 3PQ3A 5HS6A 1Z2NX 2GEFA 1ZNQO 3PIRA 3WB9A 4F84A 5CBPB 2IS6A 4UTXA 4EL0A 3JAWB 3VA7A 1Y8QB 4KHZA 4KXQA 3TGLA 1ZINA 5JJLA 2EL9A 4IDCA 2D06A 4M89A 3TQFA 3DVSX 2V3CC 2BFFA 1ZOOA 4LRXA 2XTNA 3H5AA 3HZOA 4TUYA 1H8HD 2CUZA 2CNDA 3T95A 3MXTA 4JZYA 4CZ2A 1RIFA 1DV1A 1P1BA 5KKAA 3PHLA 2IYOA 4D96A 4H6PA 3A7EA 4DUPA 1TA9A 3B6KA 4RVHA 2PMDA 1HGXA 1ZQ9A 5IARA 5HKOA 2PUGA 4XB6B 1RC8A 2BTQB 3KYCB 3PU6A 1YS7A 2CFIA 3DMTA 3MC1A 4LSWA 3H5TA 3OPYI 4ESEA 4IX1A 1M9NA 1O54A 1H0SA 2Z4TA 3S2ZA 2PRZA 2I2FA 1LLUA 2GRAA 4KUHA 4RA9A 1QFZA 5ITZB 1BWQA 2ZBQA 4JLBA 3DZ8A 3I5XA 4TXNA 1D5WA 1R0CA 3JD2A 1QJ4A 3NZEA 4FLFA 4BMCA 4QIHA 5LXTA 2BFNA 1JMKC 4URWR 3OQMA 3A1WA 1M6VB 4IFBA 2NZWA 3LYAA 2YRXA 4V0RA 2OLKA 4ZEOA 5B30A 2P6UA 4JX9A 1T0BA 2RHOA 4ON9A 5GWXA 1P81A 5AKKA 5BN5B 5DBFA 3ZE6A 2D0DA 3F5QA 3K0FB 1V2GA 4X8HA 2FMXA 2C97A 1D4OA 2CLEB 3HXQA 1L1EA 4EAQA 1ISFA 2XLBA 3S8EA 5IU6A 2FEXA 3I58A 2UYHA 1OX5A 3SMQA 1GNTA 1EP3B 3GROA 5F52A 4IHKA 1ZC4A 4QYWA 3ZW8A 1ODKA 3OX2A 4EHHA 4YCJA 4CIVA 2J3EA 2QYSA 2ZTVA 4JC0A 2VWQA 1ZA1A 1OA0A 1GA1A 2RGNC 2W6ZA 4RYLA 1Q0SA 1PVVA 1DBIA 1P8AA 3GGDA 1SCKA 1JW9B 5KI6A 4EHDA 1MT3A 4NPCA 5A9SA 1SCIA 5H83A 3Q8KA 1G21A 3OWHA 3F71A 4BO4A 2HHAA 2AL7A 3PFHA 3UV7A 3KOZA 2XF2A 1A96A 1QHHB 3DNMA 4HQFA 5B58T 4ZJUA 3JQAB 2QTHA 2I2CA 3F3MA 5HQJA 2ZJ3A 1ODJA 4GI1A 3C6BA 4Y0AA 2GXAA 4X1IB 1WS6A 1MLDA 2GJ8A 2PMFA 1EUCB 1AO0A 5DGDA 2QWXA 3ENQA 4IO0A 4RHEA 5C37A 3LC0A 4QGSA 2NO9A 4O0LA 4Z99A 3RC7A 1P2BA 3UQZA 2ZATA 3PXDA 2KSQA 5C80A 1IATA 3VPBA 3L7IA 4H9GA 4IGKA 5KMGA 2BFPA 4JASB 4CG0A 1OROA 5JS2A 1WZIA 2HW8A 1MW8X 2XNDA 1L5GB 2ZS9A 2VG8A 1NV8A 3EFOA 2EYUA 3G0HA 3L6EA 3CH4B 4HQKA 3T7RA 4J0EA 1PKEA 2HQOA 4UVDA 4DM7A 1DBRA 1IG0A 2IE8A 1U80A 4M0LA 3NAGA 3ZD8A 1XQ1A 3G7NA 3X2FA 1XD2B 5L3QB 2A3RA 1YR9A 1PV4A 4DWVA 4XPZA 1C9JA 2D62A 4YGYA 2LKDA 2IV7A 1K2WA 1NN5A 2QLMA 3M6VA 2ZBGA 4MCIA 4RS4A 4XXHA 3ZWKA 4OF4A 2WUEA 1M2KA 2JZOA 1VLJA 1I33A 2HPAA 5LDGA 5CCEA 1F0PA 4ZVTA 5BO5A 4WBSA 1C1XB 5CYGA 3GVIA 4PF1A 4RKFA 2BGUA 4RJTA 1M1UA 3ASZA 4B81A 5AJTA 1XFAA 2FW6A 3P1JA 4ROTA 4YUXA 4FYHA 5JNRA 4J9VA 4PZ9A 4ACAA 4BWGA 5H3CA 3DTVB 2J3DA 1L7QA 4IVRA 4NV1A 4U63A 1ZL2A 3RK4A 3BILA 3JQCA 4FE3A 4MCHA 5C4IA 4WASA 4DM3A 1CUWA 3R9XA 2AX3A 3LY5A 2WTEA 2MSCB 4TMKA 5DLEA 4ZEXA 5FA5A 5BSVA 4RKQA 2ACKA 4IYRA 1SY7A 1YC2A 3PPIA 4FFVA 5E2AA 1OB5A 4ECAA 4Q34A 5DSTA 4DLTA 5BV2P 2I9KA 1PBTA 1WZUA 2OCLA 2PUJA 4UOZA 3HVUA 1NVGA 2BKLA 4JJGA 1E1CA 2GXSA 4YP5A 3TQRA 3JQ9C 4DLZA 2F4NA 1YNOA 1X3SA 1C3OA 2QZ4A 1TJ4A 2CEAA 4G0UA 3KJHA 3RQSA 2H17A 2CHEA 3NO4A 3LQ1A 4U2EA 4DV7B 3B20A 5MFPA 1T2FA 1EQ2A 1YBVA 4WADA 3UV6A 3PA6A 1QYVA 2D0PB 1OIWA 1YJAA 5AVQA 4NABA 2A9OA 3ZI0A 4KRXA 2D3TA 2RGCA 4KOAA 5EZ6B 3EF3A 2X2EA 4C20A 1Y89A 5B53A 2QRVA 5IT4A 3I1JA 4M55A 4C7MA 4AJ4A 3QFFA 2VAMA 2PG3A 1VSUA 2NUPA 1N5DA 3KOUA 3PCTA 4GLJA 5ALWA 3SSAA 4M2LA 4LJ7A 2CCGA 3WHLA 2PUDA 4X6LA 2JD0A 3H9CA 3F6RA 5A7FA 3NNDA 2R62A 1Y1SA 3CE6A 2ETXA 2QT1A 3W90A 4Z4CA 2C7VA 4YNBA 2VXBA 4WGGA 2WHRA 5LD2C 5A06A 3C8MA 2XZTA 3VOBA 4DBVO 4LGCA 3E7DA 2V6IA 5IT5A 5IDXA 3GRUA 1A9ZA 1MHPA 1IULA 3INGA 4C04A 2QXUA 5JEDA 4XM2A 2TMGA 5JROA 2E9SA 5CJJA 3UFXB 3QP9A 3O8NA 1PSDA 1OFVA 3PFIA 4C07A 5EQTA 2Q3MA 3PHJA 1Y4ZA 2D54A 3OPYA 3R7FA 2XE6A 1XMPA 2TMYA 3QFRA 2HY7A 1P74A 1WW2A 2H4YA 3L7BA 4ZALA 4HNAA 1HE5A 2JFQA 4MUMA 3ZOZA 4C08A 3LDUA 3DFZA 2A8YA 4O29A 1HTWA 2AUTA 3IDQA 4YRJA 4V1CB 5LL6P 1SA0B 1KQGA 5IWCA 4JYZA 4WOCA 2GLUA 3KPVA 3KXIA 2AR0A 5G0TA 1AF7A 1X7ZB 2APJA 1PUIA 2X0NA 3IEIA 1HURA 2J8ZA 4D6YA 1QFMA 3BH6A 1H2XA 1EP9A 1BC5A 1UBGA 1J2EA 3C3MA 2IGTA 3R4CA 4B8ZA 3LYLA 3EGEA 4UMFA 1SVWA 1IE3A 4I14A 5CNMA 1SHTX 4MKFA 3PQ6A 3ZV6A 1VDZA 1UEIA 3BJIC 3L02A 3QKIA 4QU0A 4OKSA 1W1UA 3BFVA 2FE4A 4KRGA 4QWMA 2W71A 2FN4A 3H75A 2R68A 2AF4C 3P32A 5D01A 3W6UA 3BJZA 4EY6A 2P9ZA 3GQVA 5CLGA 4K0RA 4JFRA 1BCRB 1BKYA 2QX6A 4I08A 4E5SA 4J1TA 4S0XA 4G01B 3HB4X 4MR7A 3UAVA 3VUEA 1LEHA 2G1AA 3C6KA 5I51A 1O6BA 4Q5IA 5KX5B 3C3EA 3O3OB 3P94A 1M1ZA 4WNYA 3QEBZ 1GD1O 3MWGA 4FI3C 1AT1A 2I99A 2QROA 3S2FA 1BCSA 2Q5HA 4BTLA 3BWMA 3EIOA 3R9KA 1GU7A 1J2YA 2CYBA 3P9XA 3PFKA 3QU2A 5G53C 2PX0A 4J1QA 1IDN1 1M0WA 1JPUA 1Z5GA 3ZI4A 4EQ6B 1F9AA 2BH2A 1B6RA 3DQQA 4NONA 3LUDA 1Y4DE 2JK0A 1IOZA 4LPKA 4OMCA 1SKUA 2CUKA 5GJVC 1YRQA 1A9PA 2NVUA 2P65A 4HAIA 4J0HA 2XVZA 2GZRA 4J0QA 2EQBA 1JE1A 1XNRB 4CQMA 3TX2A 1ZHHA 3SEFA 3KOXA 1RXUA 2WQ6A 1OXKB 4V3BA 4ZHSA 1YBAA 3GVXA 2H1WA 3I72A 4GM0A 2JRCA 1M0TA 3GLFB 3U7HB 4BNUA 1F1JA 5I6DA 3DXZA 4JOBA 2ADFA 3AF3A 3LY7A 1Y6ZA 3EB9A 5B58C 3RTBA 1HUQA 2C5SA 1TPZA 3HJUA 1UBEA 3NGLA 3JS5A 3HKEA 1HEUA 4HUJA 1J07A 4BNNA 1IFXA 2G28A 3OJCA 4AK9A 3DBLB 4G8JA 4G4SO 2OYRA 4YQFA 4Q4AB 4RKEA 4A9AA 3LX5A 2BD0A 1VG9B 4FCVA 1XZDA 1MC4A 1XEFA 1KDOA 4OQNA 4ZCQA 4NCIA 3FOFC 4OJMX 1OBFO 4J4TA 3HRHA 5I7FA 1L5MA 3LT4A 3VH4A 3UWMA 3ZWWA 3KOWA 3V46A 1KJWA 2YJ4A 3A27A 1SD2A 2NYRA 5AP9A 4M76B 4XWGA 4ABTA 2O1XA 1QS0B 2FSSA 3GJ7A 3WMFA 1UPFA 4DB2A 2RE8A 1JKIA 3AH8A 3FHCB 4LJYA 1F7VA 5FPTA 2QTRA 2PQ2A 4ODIA 4X7BA 3OQNA 2P2ZA 3QU5A 5JOQA 4OI2A 1AIPA 1XA4A 3QMMA 4B76A 3IMEA 2H08A 1TEHA 3JWEA 4IJ6A 1XDUA 3MD9A 2J33A 2YY7A 2JGLA 3P0FA 1U1CA 1X7WA 3U7GA 1PG0A 1RAIA 3DT8A 1MZVA 2VOEA 2UAGA 3SDSA 4XSVA 5M5BA 2BJVA 5JCOA 4OGGA 4KGXA 3WJ2A 2IYUA 4X5OA 2WFLB 2CCJA 3D6AA 5D1HA 2PZMA 1RIIA 4UPVA 3E7WA 2EWVA 4ZI7F 1M2VA 2P1ZA 5GIPE 1QKIA 2IYEA 4AQ7A 2TS1A 2IL1A 2VUTA 2CXOA 2D0OB 4KBGA 1U2DC 4Q1FA 4FJ0A 2QAIA 2PDAA 4YEDA 2F17A 1XZKA 5AH0A 2IV2X 2ZUTA 4DT1B 1EXDA 2IXTA 3K05A 3GUYA 4G81A 4NKRA 1ZNXA 3WFJA 5EIBC 3WXBA 1ATIA 1GZDA 1IAQA 1WV0A 3T06B 4Q03A 5IABA 2OTCA 4UTPA 3RK1A 4Q7QA 1IZ0A 1OLSB 3N0TA 1G66A 1EJ0A 4TKUB 4MPDA 3UNXA 1MRSA 3LQ2A 3I76A 2C58A 4EFMA 5F7OA 2SKEA 1KDYA 5JS8A 2H1HA 1FX0B 2PTGA 2NO4A 3R6TA 1S2LA 4NJEB 2J0VA 3E7PA 5JFGA 1B14A 4A6DA 5C53B 2XXAB 2RBKA 4TPKA 1JNXX 2O8BB 2AWNA 4RTSA 3HVRA 1O9BA 3HCBA 1DT5A 4MEBA 2EOAA 2YS7A 3RIMA 8LDHA 2AOWA 1VSQA 3PDJA 4BO2A 4G1VA 2VSQA 3UWSA 3VAAA 3N2NA 1Q7BA 3FSJX 4DIFA 2PIDA 1J8MF 1KPIA 2B0JA 2CXXA 1GKYA 2QU7A 3E5MA 3QPAA 4M9QA 2QUJA 4B3HA 2QN6A 3A4MA 4CV2A 2VT7A 1BEZA 2HWWA 3A9VA 3LWZA 4OAQA 3KB2A 4MUNA 4TRMA 2ZBUA 5IVDA 2GTPA 1K06A 1NW7A 1P33A