2MSWA

Ligand-induced folding of a receiver domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'GAMGMPKVLVLEDEPLIAMNLQYAFEDEGAEVVVAATCEQALKSLADNPIDVAVLDVNLGPKSHCGPVADALKQRAIPFILHTGDLDRHGELLRKIDAPVMAKPADTSDVAKRALEMCGGDKEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator/sensor histidine kinase
publication title Ligand-induced folding of a two-component signaling receiver domain.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Transferase
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mswA00
1TLFA 3O2SB 3C3KA 3ROFA 5ABPA 4PEVA 3QEMB 3LUGA 4MAAA 5DKFA 1QP7A 4MLCA 2IPNA 1EWKA 1M2EA 1HEYA 1U8TA 3H1GA 3N53A 4G0YA 4KRFA 1I3CA 3O1JC 4O5AA 5HQJA 4WT7A 1SRRA 3IPAA 4RS3A 1BDHA 1GUDA 3FDFA 9ABPA 4IRXA 4F8JA 1YMVA 4GPAA 2IDMA 2LBPA 2NZVG 1CHNA 4O1HA 4YS6A 1KGSA 3FFXA 2PUCA 4MR7A 1Z18A 5KQPA 1NATA 2B4AA 3DLHA 2PKXA 1CEYA 2JB9A 3Q7SA 5CNKA 5TPWA 4OLBA 3IP6A 2FMHA 2HQRA 3CZCA 4MYRA 4WXEA 1M2FA 2FEPA 2WY2D 1DBPA 2R4QA 3SAJA 4EYGA 4S04A 3M6MD 1ZH2A 3F6PA 4W5NA 3RVSA 4RKQA 4MLDA 4TN5A 4E7OA 4F11A 1MVOA 3SQNA 2PUFA 2ZWMA 4ZMSA 3H6HA 1MB3A 2JBAA 4Z4FA 1DCKA 1P2FA 2RDMA 4RK7A 5F64A 2FQXA 4QYMA 1DG9A 5T7BA 5DLEA 3Q41A 3MA0A 1F51E 4RU1A 4KQ9A 4WUTA 1EWTA 5PNTA 3O1HB 1BDJA 4F3TA 1D5WA 3H1FA 1A04A 1Z12A 3KKEA 2V0NA 5DCLA 3O2JA 6CHYA 4Z4CA 1SXGA 5JNUA 2F8TA 4G0MA 3LKVA 1EWVA 1QNLA 1YIOA 3H5TA 1KRXA 2I6FA 1RXIA 1C0EA 1JX6A 1IIBA 1Z2DA 3T95A 3BILA 1KMIY 4N47A 2PL1A 1P6QA 4S05A 3IP9A 4KMRA 1R8JA 4MQFB 3HJFA 3HO1A 3OQOA 4QPJC 2FW0A 1MB0A 4WXMA 5FBHA 1AB5A 4EGSA 5FWYB 3P9YA 2LIVA 4F06A 4CBVA 1E6MA 4D6XA 4YP9A 1ZHHA 4WWHA 3HK2A 4JOQA 4P1ZA 4DADA 1DBQA 3TD9A 1ZITA 1PEAA 3I09A 5CNJA 8ABPA 3C97A 4ETIA 2B1JA 3LMKA 3CU5A 4HNSA 1QMPA 2E4UA 4IF4A 4Q7EA 5EWJA 3D8UA 3O74A 1JDNA 3O75A 1U0SY 2NT4A 2R25B 1BDIA 2M98A 1QPZA 2XDYA 3FFTA 1DRKA 2LPMA 4ZJPA 4H60A 4LX8A 2A9PA 1ZY2A 2LP4Y 1M5TA 1U2QA 2MYUA 4MS1B 1F4VA 3FFWA 2FQWA 3GT7A 4ML3A 4RKRA 1QP4A 3N0WA 3KCNA 1T34A 4RZSA 5TQ2B 1CYEA 1LK0A 4G0PA 3NNDA 1FFSA 1ZESA 2MYNA 2YHAA 5EWLA 3OLXA 5BRJA 4N41A 1Z15A 4P98A 2WJAA 3QLUA 2A9QA 4RY9A 1YS7A 5JNTA 1RNLA 3KTOA 2PE5A 4KFCA 4TLLB 3CG0A 1ISSA 2HPHA 4RY0A 4PYRA 4ZMRA 1JF8A 5IUNC 1Z16A 1GUBA 2WB4A 3KLOA 3KYIB 3HUTA 4M88A 5TQ0A 4E7PA 5JNRA 2VYCA 4W5TA 3H1EA 3EQZA 3N75A 5JS1A 5GOTA 4KQCA 3OLVA 2FEKA 1K66A 4MR7B 1OXKB 1DBWA 1JFSA 3F6CA 4KREA 2E4ZA 2FSPA 4EVRA 5HM6A 3MYYA 5TPWB 4Z4IA 4N76A 3HVRA 4JB0A 4EVSA 3LFTA 1XHEA 2HSGA 1TMYA 4H3HB 3QEKA 3RVMA 2PUBA 1OXBB 3QK7A 3RVOA 3KLNA 4B09A 2WMYA 1DP4A 2FMIA 4YGXB 3E3MA 1BAPA 3T6KA 4ETMA 3I45A 4Z4EA 2QXYA 4MPTA 1USKA 4GNRA 1EFAA 3IDOA 1APBA 1Z25A 3TX6A 2PUAA 2FMFA 2R47A 4YV7A 1EAYA 1USIA 2HQOA 4MS3A 1DRJA 4Y9TA 3EJWA 2FEWB 2X7XA 5GQSA 2IYNA 2MYTA 1DC8A 1TM2A 4KVFA 4MR9A 3HM9A 6ABPA 2GKGA 4NCBA 3JS5A 3OLZA 3QELA 4UHKA 3D02A 5IUKC 2QZJA 4HYEA 2WWVD 3KYJB 4ETNA 3HDVA 4RDCA 2FTKE 1LJLA 1NY5A 2KYRA 3BRSA 4OBBA 3FGZA 3MF4A 3URMA 3A0RB 1GLGA 2R48A 2PUDA 4EVQA 2MYPA 3CZ5A 3GYBA 1DCMA 4FE7A 4G0ZA 3LUHA 3LUAA 1NXOA 3OMXA 4EYOA 1Z17A 4G86A 2W42A 4OTZA 1YK0A 4PZ0A 3IP7A 3Q7TA 1D4ZA 3IPCA 3NHMA 4Z4GA 3H5OA 3RQIA 4N0PA 1A2OA 4MRMA 2TMYA 5HKOA 3DGFC 1BA2A 1JWLA 3E61A 4JA2A 3TB6A 5FWXA 3L6UA 1GCAA 1KRWA 4FB4A 3H5LA 3JPYA 4MGEA 3SY8A 3A0UA 3QEMA 2IPLA 3EQ2A 3OO1A 1PHRA 4KK4A 3S99A 3W9SA 5C5EA 5EWJB 1RPJA 1W25A 1P8AA 4RXMA 2FN8A 2WRZA 3BREA 3OMWA 3O1IC 3RVRA 3TMYA 1YTUA 3NNNA 7ABPA 3H75A 2IOYA 1USGA 3TO5A 5BRAA 3CRNA 2GI4A 4NV3A 1YMUA 3H5IA 4HNRA 4RK1A 3I42A 3CFYA 2AYXA 1JYFA 5BQ3A 5BR1A 1H9CA 3GV0A 4LDAA 1RZRA 1Y1LA 3QX8A 3FMVA 3KS9A 4Z0NA 4FE4A 3RVPA 3LUCA 1AB6A 1W9HA 3OQMA 1JYEA 3VNAA 1QO0A 3GRCA 3HUUA 1RZRD 1WETA 5EWLB 2FN9A 4IMIB 2PAFA 5IEJA 1NXWA 3SG0A 3MMNA 1QO0D 2AYZA 4JASB 5IBQA 2FLKA 2PUEA 1DC7A 1FSPA 1UDRA 2LUOA 4YLEA 4W5OA 1Z13A 3OO0A 1SXHA 1E2BA 3GBVA 2JVJA 2WJWA 3CTPA 1JL3A 3HCWA 3UKJA 4RK6A 3M9WA 3CS3A 2PMCA 4MR8A 4YR7A 4NICA 2E4XA 2BGGA 3EODA 4Z4HA 1U2PA 3RVJA 2H3HA 4LE0A 2H0AA 1PUXA 2HQBA 1L5YA 3JY6A 1JH9A 1QQBA 1K68A 4XFKA 3G1WA 3R0JA 4WZZA 2NT3A 3F73A 4NCAA 1TVMA 3B2NA 2CWDA 2MSLA 1LJUA 2IKSA 4G0OA 1FQWA 1YK1A 1ZDMA 2CHEA 4QICA 3ILYA 1E6KA 3LUKA 2E4VA 2QW1A 4MS3B 2FMKA 3C3MA 3OLYA 5KC9A 1YS6A 3SNKA 3CG4A 3CHYA 3JVIA 1JFVA 4EYQA 4L4UA 3QELB 3QLTA 4ZYLA 5JNSA 2P9HA 3K9CA 4YWHA 1NXSA 1JDPA 2ID9A 4OLAA 4MQEA 1QKKA 1Z26A 2Q5CA 4G0XA 4IILA 1VLZA 4D6YA 4KK3A 1NXVA 3HZHA 3KJXA 5DGCA 4LDZA 3LTEA 3CLKA 4IGAA 5TE9A 1EHCA 2A9RA 4F12A 1VPWA 4Q6WA 5JNWA 2JBAB 4DQDA 1Z2EA 4RK0A 1ABEA 2IPMA 4PE5B 5JS2A 2L17A 2L19A 1YVUA 2N9UA 5ED4A 1B00A 2GX6A 4MRMB 4MS1A 2QSJA 3LOPA 3A3KA 5KC8A 3RVNA 4YRZA 5FWXB 2MSWA 2RJNA 3NHZA 2JVIA 4RK5A 4O1IA 5EWMA 2PJUA 3ROTA 2CD7A 2YHBA 5C5CA 3OM0A 1NXTA 1RXEA 3CKMA 3Q9SA 5KQGA 3HXMA 3N8IA 2NZUG 2L2QA 3ILHA 3T8YA 1VRVA 1E6LA 1XHFA 4KZKA 4RK4A 3QLVA 5IUJC 4JAVC 2FLWA 3O2QB 3UK0A 4G97A 4HNQA 1ISRA 2NUBA 3K4HA 5B3JA 4Z9BA 3KG2A 1QP0A 1URPA 2ZAYA 2QR3A 4H3KB 4MS4A 2IPAB 5DTEA 1D1PA 2JK1A 3DZDA 2A9OA 2FQYA 3L49A 4RXUA 4W5QA 2E4WA 4LRQA 3G85A 1ZGZA 2VUIB 1MIHA 5T3YA 3O21A 3Q7RA 3N0RA 3EULA 4Z99A 3VNBA 2L18A 2QVCA 1XWWA 3NNSA 2VUHB 2M1ZA 3BRQA 2PUGA 1A0OA 4N0QA 3SM9A 1NXXA 1PNTA 2JCGA 3LUDA 3Q15C 1D1QA 1MAVA 2E4YA 3QLUC 3DLBA 4ZPJA 5TPZA 1BVHA 4OATA 3HV2A 4RV5A 1DZ3A 1DJMA 4MR8B 3KSMA 4LE2A 5TPZD 3CNBA 4EYKA 3KHTA 2RJOA 1JHZA 2JVKA 3N0XA 3QX9A 4RY8A 4EUKA 3GL9A 5KQLA 1D2AA 1ZGGA 4N03A 3HSYA 3JPWA 3H5VA 5D2CA 4XARA 5IC5A 2P4UA 3A10A 4KPYA 4XAQA 2GWRA 3GWGA 1SD5A 1S8NA 3F7NA 3C6QA 3RH0A 4YCSA 1QQAA 3HEBA 3RVQA 4TLMB 1SXIA 2F8SA 1LBHA 5TQ0B 3OLWA 2GBPA 3HS3A 1ZVVA 4RSMA 1JLKA 1J56A 2OQRA 5IEBA 2RGYA 1JFTA 5HSGA 3EAFA 1U04A 3EDCA 3BBLA 4Z9AA 4D74A 4W5RA 5KQMA 2JRLA 1TJYA 2FVYA 2PL9A 5I4CA 4MQEB 3MIZA 1FFGA 3GA5A 3I5AA 5CNMA 3LKBA 3H5WA 4YO7A 2HJ9A 1C4WA 4XXHA 1PEYA 3JTEA 4EY3A 4XASA 1NXPA 3H6GA 4KV7A 5FBKA 4XLTA 2FXIA 4NQRA 4PICA 1NTRA 4LZLA 5KI6A 2VK2A 3DBIA 3DGEC 3OQNA 2CHFA 3UUGA 3QLVC 4TMYA 2QV0A 1ZN2A 4RWEA 2QU7A 4IMJB 4L85A 4UHJA 1M5UA 5CNIA 2J48A 4MQFA 3GBPA 1PNRA 5TQJA 1LBIA 5B3JC 5KWSA 1P6UA 5IX8A 4MR9B 5EWMB 5FWYA 3RVLA 2FKAA 3RVKA 3M9XA 2OENG 5CHYA 4G0QA 1ZH4A 1FFWA 3HDGA 4Q6BA 3T38A 3LUFA 4RXTA 2PLNA 1ABFA 3EGCA 3IP5A 3NBMA 5E3JA 3OM1A 1GCGA 5IULC 2QVGA 5JNVA 1L5ZA 3C3WA 4KNYA 2O20A 3MM4A 1ZAYA 3JVDA 1DCFA 4JP1A 2DRIA 1JBEA 3MQ4A 4MS4B 4OG2A 2ID7A 4QYWA 3N6VA 4LE1A 4JB2A 1VKRA 4DN6A 2MSKA 5TQ2A 3LUJA
chains in the Genus database with same CATH superfamily
5DXAA 3M4YA 4MAAA 3O7MA 4NHEA 1N25A 4L9AA 5A3QA 1LW6E 3MD9A 1CUAA 2R9VA 3EXHB 3CUTA 4LN1A 4HMOA 3RWBA 3UJDA 2JW5A 1L6RA 4UVEA 1NT2A 5EMLA 3V8VA 1S4MA 1TTHA 3LY8A 2PS1A 1K8XB 2JJMA 2LDBA 3WLOA 2QSYA 3ZJ4A 1KJJA 1ZC3A 2EFHB 2W71A 3QV2A 3PPIA 3TSAA 4M9ZA 2Z04A 5DBOA 4CQNA 3A6PC 1Z45A 1YVDA 1YS2X 2VHXA 3ST7A 3GUHA 2EOAA 3LVQE 4NBUA 1ZD5A 2ZBGA 1IVYA 4F5WA 3P9QA 1E7QA 1XAGA 4RMJA 3AFMA 4QVIA 3ZDDA 1R0WA 3UY4A 3LPDA 5BMVA 5JCXA 1XJ0A 2RI6A 4GUAA 5EIBD 5K05A 3I5YA 1M2FA 3Q3GE 1YI0A 2F43B 2ONKA 4OYYA 1YE8A 2B25A 2R4QA 2WHRA 2YNMC 2E89A 1KETA 1Q0SA 3Q3EA 4XWKA 4M0PA 3TQFA 5H9WA 1I14A 2P2LA 5JEEA 1N6NA 3W6UA 1OJ7A 1XB2A 2WNIA 4PYQA 3R9IA 3FNGA 4F60A 3TX2A 2O59A 2OD2A 3DLTA 4ZOAA 2V3WA 1MF7A 3GNQA 3L0DA 3VZSA 2FR8A 1CUSA 4G0NA 2RDMA 4X7PA 3IT2A 2G3YA 4XQCA 3UAXA 4QGHA 1Q2UA 1Q0QA 1ECCA 3M4XA 1FB5A 2QA5A 1QF6A 2OOSA 3JW8A 4JB3A 3VPCA 1ESMA 1R2QA 1EWTA 1RM4A 4K9KA 3C98A 4U9UA 4XVUA 4ZGGA 1SWVA 1SY7A 1AGPA 1QHNA 3GJ8A 2ENWA 2Z9CA 4DNXA 3W2TA 4BVKA 4ZAFA 2BM1A 3HU5A 4HTAA 3RGGA 4E1VA 4K1LA 3QXSA 2XQKA 1U7OA 2OFFA 5EL0A 1MOZA 4GW3A 5CB4B 1F6WA 3BRWA 1IPHA 1IHYA 1KSFX 1TGVA 2HPAA 3JALB 4UTXA 3AVPA 1Y63A 3RV4A 6CHYA 1PGOA 1KQGA 3NPAA 1LNZA 4XB1A 3MBOA 4MWDA 1H0KA 3IEIA 4ZVNA 4BFLA 4EW2A 3WLQA 2Y05A 4BBAA 1YGPA 1IMJA 3NTUA 4XA8A 4Q7MB 2CYCA 4ESHA 1XN4A 1Z2DA 1KF0A 4UHDA 2QRUA 3A6FA 4JYCA 4XFDA 4G85A 1GLVA 1G2PA 1GNRA 1V8DA 1RYDA 1MB0A 3U7EB 2HT1A 3B38A 1P72A 4KUHA 1GKYA 1W88B 3H9JA 3HBNA 4A8JB 4RTMA 4QEZA 4B8YA 5H81A 2QG9A 4ZMBA 1Q0PA 5JJLA 4JOQA 4TSFD 4YUVA 2CE2X 4IDNA 9LDTA 3TD9A 1S5PA 5C1DA 3TRHA 4CWAA 4HEQA 3WGNA 1CR1A 1R7RA 3HPQA 4TRNA 3VPAA 4E5DA 5LXTA 2QJFA 1YZYA 3RFFA 2XUFA 2CDAA 2AF4C 4MUNA 4RMHA 3BQMB 2H8GA 1JLLA 1XHLA 3HCBA 1OWMA 3N05A 3VISA 2W6ID 2WFAA 1JEQA 3U0BA 5FD8A 1IK6A 1JJBA 1M10A 4P4SA 4RHCA 3H8JA 4QTYA 1F4VA 1DDGA 2ADFA 4A26A 4ML3A 1KU6A 2TYSB 1X14A 3RSLA 2J5XA 1D04A 1J49A 4QBGB 4K3VA 2R8XA 5TQ2B 3VMFA 3CJRA 5I4BA 3E7XA 2QX8A 3FF4A 3EC2A 1JR3D 4P84A 1ID8A 2CZCA 5GGXA 3UENA 3G0OA 2BFEB 3BULA 1HF3A 2PR2A 2VBGA 1FXWF 1FU7A 4AY5A 4ECEA 4R31A 5IASA 1GKUB 1C0LA 4OSEA 4RY0A 3LC0A 1C9NA 5CPFA 3QP9A 1B93A 3BK1A 4EF6A 2EG9A 1EZZA 5JNRA 2ESRA 4EIWA 1A4UA 3TLGB 5T64A 5GOTA 4BO6A 1K66A 1YS9A 1TB4A 1DKPA 1RXWA 2C03A 3EZXA 1GDDA 1I0ZA 3KZKA 4X71A 5HCIA 1C7IA 2O9JA 2JI8A 2QUAA 1SM4A 2NIPA 2CXRA 4IDPA 3RHTA 4F2DA 1ZG3A 3DOJA 1Z4QA 3VU1A 1PVOA 3BRCA 1VKJA 1LY1A 2C77A 4I66A 4IVRA 4DTCA 4QZVA 3VA7A 2ZXUA 4JCOA 3T6KA 1WOYA 3E3MA 3LQKA 5EQFA 1O77A 1JQEA 1WDWB 1A5TA 4Q9DA 4UZEA 4G07A 4ERNA 3NXSA 3WHIA 4A16A 4WXHA 2YJGA 2Q3FA 4Z54A 1PW5A 2BDEA 2GT1A 4MEBA 1ZJ6A 3Q3HA 1CVRA 3I1IA 3QVOA 2D0DA 4L75A 2PL5A 3EGXB 3WXMA 4ZQFA 4NCBA 3O03A 1KDOA 4NMMA 1RXYA 4PYIA 1GAQA 3ZDYB 4BGVA 4DC0A 3SHWA 1V6AA 1Q1AA 4QBKA 5SY6A 1AK2A 1JE0A 2DBZA 1MAUA 1ZMTA 4G5OA 3M2PA 2KYRA 5K45A 2C4NA 5LOVF 1YQDA 3URMA 1XEAA 3ZKWB 1MW9X 2H7YA 2C5SA 4ESVA 4EVQA 1U9CA 1FYVA 4M36A 3L8YA 3RFXA 4TL6A 3QJGA 4FFPA 2F6RA 4FJ1A 1ISHA 1PJTA 1RQLA 1JH8A 1SUPA 3AW8A 3PWZA 4OBEA 4QNRA 3FGNA 1IXRC 1V1MB 3AO0B 4PZ0A 2C94A 2WMOB 3QLEA 3VZCA 3MVEA 5ECDA 3RQIA 4N0PA 3QU5A 4P0TA 3PFWO 3QSYA 2XWQA 1SUFA 1KSHA 4IDCA 1IOLA 1M2WA 5ADHA 5LFAA 3MFQA 4CR6A 3HTXA 3F46A 3TZQA 1U6JA 1GUYA 1SD2A 2IOFK 1K75A 3IDQA 3KPWA 5F9MA 3RO7A 3BQNB 3WHLA 3L7CA 3W9SA 1L7AA 1VLLA 1TYDE 1XEFA 3I6QA 2QY6A 4U2BA 1P18A 3NNNA 3TRFA 4L2IB 4QC2A 4L57A 1Z6YA 3SCZA 3U44A 1DBRA 4D46A 1MO5A 1WV0A 2OBYA 2Y92A 3OZRA 1ZUNA 1XZAA 4PC3A 4FGWA 3OCZA 3WK6A 5LZ4A 1YMUA 2IUYA 1I3KA 4GXTA 4F71A 2MR6A 3SHOA 1ISJA 2HLDA 2N47A 1BW9A 1T4DA 3OFND 1T36A 1EX9A 3QOXA 3DB2A 4OXKA 1H8HA 1QVAA 3LUCA 4FDLA 3A1TA 5ELXA 4Y2UA 3WC4A 3QKRA 4TUYB 4N3AA 4LVOA 4HLNA 4ABYA 1FS6A 3KDAA 3R0XA 1MGPA 1Y8ZA 1IJKA 2BKLA 2YHUA 5IM5A 5LUBA 1YB6A 1QYCA 3IELA 1E59A 4MW9A 5JUWA 4FILA 1NW6A 4ZDKA 4QGSA 4PZEA 2CJPA 3GPCA 4UZFA 2V5UA 3WB1A 4RORA 1V6CA 1V3UA 2WAMA 2BMVA 3D59A 1HDCA 3HCWA 1NIJA 1Z0DA 2N1BA 1QDEA 5FPQA 4LRSB 1MC1A 4NICA 2IP4A 2BEUA 1EGAA 2OV3A 3GJ5A 1U11A 3OU7A 3PDCA 4HGOA 4JP5A 4ZVMA 4D0GA 3OOSA 3IQXA 1CJMA 4D82A 3D3WB 2JLQA 1UP4A 5JZSA 3Q3IA 5AJYA 5KINB 3E5MA 3C3BA 2RHCA 5BXQC 4IOKA 1KI1A 1AXRA 1E4EA 3AV3A 1E8MA 3IP8A 1KYZA 1W75A 2EDAA 1OVMA 3N7AA 1LPPA 3TVDA 1CG6A 1SKBA 3PFFA 1YZTA 2E5WA 1JDZA 2DJ5A 2QSZA 3OIGA 4FCWA 2DQKA 1P8JA 1JKXA 1I9CA 4HQLA 4ITVA 4L8GA 4BTVA 1COWA 3VMMA 3GU3A 1E1YA 1DJQA 3KEGA 2JHAA 1WXDA 4NFYA 1L5NA 5JARA 4JKOA 2XUGA 4ZD6A 1UPBA 2VA8A 1Z5NA 3MPUA 3TQSA 4QX6A 4J6FA 4ISBA 4MAFA 2ONCA 5D8DA 5CA1F 3ZCVA 3CHYA 1W2GA 2Y4OA 4NG5A 4P53A 3WXBA 1KMHB 2Z2YA 3ETGA 2W6JD 1W36D 4XSHA 4EATA 1RAGA 4MVJG 5DBIA 4JFAA 1RQRA 2B37A 4BPRA 1U3DA 3WWCA 5A4IS 3VYWA 2BISA 2IHKA 5LYJF 3JX9A 1RHMA 1CUBA 5T4BA 4IILA 4CCYA 5ILGA 1U8YA 2GK4A 1ZC4A 3HP1A 4HPJB 2X4DA 1TZKA 4Y6SA 1OLSB 2C5LA 4KWCA 3CLKA 3ORSA 1KGDA 4KO2S 5B7PA 4JELA 4F12A 4DNPA 4MYCA 1JG7A 4ZEOA 2JDID 2QM7A 2ZUVA 2JAOA 2PH1A 2KW5A 4P8RA 3ZXXA 1YZKA 1W47A 1VCHA 2ZI6A 1G18A 3EPRA 4IGEA 4TV9A 1QONA 3RVNA 2QYOA 4J2OA 3EFOB 1OOEA 1N2BA 2HF9A 4H08A 4MA4A 2IYTA 4RK5A 2HDHA 5JPDA 1W8IA 5AQEA 1FFXA 1SK9A 3FCEA 4BX8A 2H4FA 2JGRA 1KP3A 3EGOA 4I46A 1E94E 5EEHA 1GNPA 1VSUA 1RXEA 4HWPA 2DTEA 3EUAA 4LJKA 4LVCA 4MUAA 3LGAA 2PBRA 4KN9S 4N01A 3VR4D 4CGYA 3RYCA 3QEBZ 4ZVPA 2NSLA 4BZXA 2YS6A 5AOCA 4YMTA 4BVEA 1ZGCA 2DPHA 3CISA 4WZBB 1R27A 2XB6A 1PIWA 3AF1A 5JLJA 4G97A 1GPAA 4X90A 3ZTTA 4EMBA 4PLYA 4ROSA 3DO5A 3GRPA 3OOJA 3WLAA 2DJIA 1CR2A 1P5JA 2RGNC 4PLHA 2NSHA 2VG8A 1TC2A 2YVKA 1EK6A 4PCAA 3AR7A 4IIHA 4MRRA 4XWAA 5E6RB 3OI7A 4BQEA 4JBIA 3QKSA 4B43A 2QL7A 5HRUA 1MRNA 1DAOA 3NNSA 1U3WA 3GLHB 1ZBQA 3QUBA 1EM6A 1AUVA 2ERCA 2EYUA 2P1RA 2EJVA 5AVKA 1KI8A 3CVYA 3EEOA 5FOQA 1MJHA 1JKJA 2GZMA 5J43A 3I1FA 1BOFA 4BMCA 2GZHA 3V1NA 1DJMA 4E14A 1IDOA 2Z6UA 1KJIA 4RENA 3KHTA 4TQ9A 2EX1A 5AW1A 1WZEA 4GU5A 3RUPA 3QX9A 1S2DA 2VSQA 1NNLA 2Q5OA 2B8WA 3GNSA 4QWWA 1RWMA 3CH4B 1PEDA 4KQMA 2WYWA 4GOLD 2BEVB 2I2FA 2Z08A 3GJSA 3PFNA 2DPLA 4FMDF 4FEEA 4I50A 1X0XA 4XR4A 4XARA 4EZIA 1IYZA 2NXEA 2WIDA 4EW1A 1RM3A 3IVAA 4EHNA 1EVJA 3Q4GA 3EVFA 1X74A 1AK1A 5IBPA 2KMLA 3GWGA 4P35A 5TGTA 1XUOA 2YV4A 1N6PA 4AN0A 4KL8S 1ND6A 2BWJA 3K96A 4J0CA 2JJ1A 3SQDA 1CW2B 2FPLA 2RHHA 3QX3A 2Y9MB 1JECA 1FUKA 3OTGA 4OY3A 4WZAA 1LDGA 4ABTA 4DMFA 2AD5A 5JDCA 1P7VA 2QTHA 3TSOA 2GWHA 2HO5A 1HY3A 2HQSA 1PUJA 3L7IA 2FN4A 3P0HA 2JGKA 4JLAA 3VR4H 3X2SA 2REQB 3GT4A 1TKCA 3AEZA 5HMMA 3NOQA 1ZS9A 4MQEB 1AGRA 1Y7TA 2KX7A 4FNMA 3PIRA 1I7LA 3QXXA 4P82A 2ZIXB 3Q8MA 3U3MA 4FLMA 2HYIC 3BMNB 4FR0A 1QLHA 1TVEA 4UU8A 3GARA 1E9VA 1SQGA 1KO1A 1VJ1A 2HCJB 1C7FA 1MC8A 2GM9A 2JGDB 2PK3A 2C97A 4LZLA 4NARA 2EJUA 1Z7WA 2E37A 4LJSA 1QZZA 2WQZA 2BI7A 1GAXA 1E5XA 2A94A 1A8UA 3P8ZA 1P17A 2HFKA 1CZUA 2Z56A 3QIAA 4RWEA 4A3SA 4E12A 1FP2A 3Q7PA 5EJ5A 1IG0A 3G2PA 4Q7LA 4BMYA 4LNAA 1KZ7B 1O3YA 4BB0A 1XC7A 3EF3A 5I7EA 5L3SA 2AMVA 5T5QA 2WIFA 3IBGA 4Y2HA 4Z8XA 3UHFA 3OJ0A 3NANA 1MNQA 1UAYA 1P2SA 5SZKB 1OZFA 1WU8A 2LKDA 4BMPB 5EFOA 2Q8PA 3PNKA 2OFPA 5DW0A 4M0UA 1GRRA 1QQ6A 3INTA 4QJ5A 1IXKA 1PJ2A 1JR2A 5LQRA 1GG2A 3MIIA 2QD3A 3PUJA 4CE6A 5A4DA 1ZGAA 4NEGA 1AK9A 5TJ9A 1YA8A 4OJNA 2RONA 2UYYA 1ADBA 2XTAA 3NKVA 1Y4ZA 4P5DA 5AR1A 1I0IA 1QK4A 2ZVJA 1QIGA 5C1PA 4NBSA 4GO1A 5BNTA 1QSGA 2OAQ1 4FQ5A 2E0IA 3TNYA 2OZEA 3D2CA 1C5KA 3VH3A 5EPUA 3W9UA 2B9VA 4N5MA 1NSYA 1OASA 1UH5A 4UTRA 3ZE6A 3IO3A 4MIYA 2GYYA 3UICA 2HUPA 4Z2YA 1C9KA 1EDDA 3DFIA 4EFNA 1ZIXA 2CXXA 2VIIA 2YXNA 3NTLA 5I7SA 1X0VA 3TRIA 4KPEC 5LQSA 2QEQA 4FZRA 3AR3A 3WK8A 4G5GA 2IDZA 4KLNA 4ZI7A 2NP6A 1CQIB 3QMPA 3ZGNA 2BSXA 1G19A 3CF6R 2V6BA 3E82A 1SPBS 1PZMA 4Q7JB 3L1VA 3CNOA 3HZRA 2XYHA 4I5FA 2G06A 5CCXA 4B75A 3AG6A 4D5EA 1GR0A 1YCFA 1FUUA 3E58A 4WPGA 5FPPA 3RF6A 3ZJUA 1XEXB 4FX5A 4I6GA 2ZETA 1JWBB 3QQPA 2ZYSA 2XSZD 4GBGA 5F5XA 4DDKA 2AF3C 3OZCA 4QU8A 3RIXA 1K4YA 4J7XA 1UJ5A 4QYTA 4QATA 1II9A 3RVSA 2JANA 2LCFA 3NTOA 3OIVA 3QTLA 4KNWA 1NYRA 2VHTA 5TVGA 4I08A 5G1OA 4ALJA 2QI9C 3DA8A 2OC9A 4B4DA 2ZIWB 3FNEA 2QWXA 2AKYA 2G6BA 3LT4A 1NFRA 1QC5B 3EMVA 5FNVB 2C0PA 1H42A 2W6NA 2X4IA 1TOAA 2FQXA 4UM7A 4KOEC 5K4GA 2CXUA 5T3UA 3ASUA 5DM4A 3SBOA 4DWWA 1GPKA 1TVCA 4GLJA 4KQXA 4PSUA 3IIJA 1DIAA 3DWGA 1RVDA 5FTJA 5AWFC 1EFLA 5THQA 1FFEA 3V6MA 1HDXA 1I7PA 5ALRA 1YZQA 3T9CA 5K0FA 4DDUA 4K9QA 1D5WA 2VP6A 3CKYA 4L4XA 1Z12A 3B1KA 3SICE 4EUFA 2V0NA 5E9AA 2WM9B 1HFJA 2G0AA 4MA5A 1MB4A 4XPIB 5EHNA 1K9SA 4NP6A 5HS4A 2GJAA 1M2KA 4LSWA 4N0EA 3UJHA 1DLIA 2OEPA 3ICWA 4FSHA 2PGXA 5KNDD 1JMKC 3UOAB 4OU5A 2JBHA 3G0HA 4I5DA 2ZUSA 3WV5A 4LSZA 4J0JA 5FWDA 2REXB 4XTCS 1QQ5A 1ZD3A 1ZLYA 3BK7A 1IVSA 3WVNA 4IGKA 5EIEA 2DGDA 4IQ8A 2PUJA 3A7EA 3OOWA 1AB5A 3TOSA 2WQ7A 4OH1A 1C4XA 3P9YA 4J8PA 4RDHA 3AIIA 5JIBA 2Y71A 2GN9A 4FD3A 1EWRA 1NLUA 4D6XA 3G0GA 3QVJA 4Z5XA 1G7CA 5K99A 3QE9Y 1TAHA 5B2EA 1O5OA 2ZWOA 5JANA 4NMWA 2ZCUA 1NONA 3TW4A 5CIYA 1MO3A 1IBRA 2X41A 2EIXA 3NHLA 3HNRA 3TCXB 3ZN2A 1U98A 2VHZA 3ETEA 3I8OA 5I4IA 5FFMA 3IR6A 4E2ZA 3DC2A 3RARA 4R2IA 2O8FB 4GZ5A 2I2BA 3RC7A 4Q05A 4J4BA 1KDRA 4Y2TA 1VL2A 3IJRA 3D5TA 3AQIA 3W0LB 1CD5A 2WSIA 3AERA 1M5TA 3TMKA 4CHTA 5K3EA 4OEHA 4Z1OA 2OBLA 4L7QA 1PCXA 2ZM5A 3KCNA 2D3WA 2IIVA 1NW5A 2ZI4A 1DBSA 1K9VF 2ZSKA 3T7KA 1E9EA 1LK0A 3VJRA 1ZMOA 2CDNA 1D8AA 1KMNA 5AOVA 1KMQA 2WUFA 2YHAA 1OE0A 5ANRB 1JB9A 2OR3A 3Q88A 4HCJA 1IZYA 4WLVA 5A04A 1SVKA 2H85A 3VC7A 4CLOB 1R0BA 2QGNA 1RNLA 1U0JA 3HJRA 3TCKA 1VCMA 1F3LA 1JAYA 4OQQA 4XD7A 5GJCA 5IVDA 4PYRA 3EQ9A 2VDRB 4MITA 3WK7A 3KYIB 5CX1B 1U1IA 1XIVA 3D8NA 4L9SA 4K5QA 5LZ2A 3N75A 3R7DA 1ULZA 1VJ5A 3I6YA 4BU0A 3MNFA 2XGOA 1NOJA 3L07A 3N5KA 2IVZA 2W7TA 3A05A 1MRZA 1P7PA 4UUOA 4GHWA 5AICA 3F2VA 4QEKA 4DUPA 5EGSA 4MIKA 3HCOA 1DFIA 2I71A 5KNDH 3MJFA 1WZIA 1RBQA 5H02A 3SC6A 4C3ZA 4GPBA 1OI4A 5D85A 5JSQA 1KEEB 2G67A 3N8HA 2X2EA 5AXCA 1DTWB 4J0GA 2IIQA 4REQB 3SJUA 1XXHB 1VSQA 2O4CA 2QKYA 4M0CA 5M3BA 5CVTA 3V00A 3MCVA 2P9QA 2BGWA 3PNVA 4HN2A 3VHXA 1OU0A 1FYXA 2QJOA 5HGXA 2FDCA 2WZDA 3QFHA 3VDNB 1Z25A 4B81A 1APBA 3ASYA 3QG1A 4ER3A 5IAEA 3AM1A 5B1EA 2VR1A 2D3TA 2NQ8A 2FPPA 3CQ9A 2NQ2C 4G89A 2G82A 4QNNA 1I2DA 5FQOA 4HTFA 2FWRA 3GLVA 5CJPA 3ADKA 2RKWA 1VBMA 1CP2A 2BOVA 2XNDA 4G5RA 2GZAA 3QFSA 1AF7A 2EXXA 4MR9A 2RGUA 5DULA 4Z9XA 4AZVA 1G60A 3W5CA 4DJEC 1EIZA 1V5GA 1JW9B 3UV6A 2IU3A 1NUQA 3DMTC 1THGA 3L18A 1REQB 3EOZA 4JQOA 2Q1YA 3SIRA 4V0RA 1U1GA 3KTAA 2VH1A 4AF8A 3NOXA 5TLSA 1PQPA 4XVRA 3BQ9A 5KYGA 4NMHA 2OM2A 1GLGA 4ZAVA 1XDUA 4RD3A 5B2FA 2HM7A 2OKCA 2IEBA 1SN7A 2MYPA 4YJGB 1BA3A 1WP4A 1O97D 1AZLA 1AKUA 3NBYC 4NEQA 5KU1A 4XYGA 2PR7A 2V54A 2WKWA 1R4NA 4HK4A 1Z73A 1MOQA 3C1TA 2HSZA 5FOVA 3VGJA 5KYUA 3U4DA 2REOA 1T0UA 1K0FA 4CEIB 3MRSA 4RGVA 3CJQA 3IIKA 4Y2RA 1G8FA 2Z3WA 5D1HA 1MT3A 3KU1A 4NS4A 4ZHQF 3F67A 1J1IA 4JK3A 3EBPA 4W8HA 1KI9A 4UFPA 4QQRA 3OUTA 3TS1A 3VZQA 2IIPA 3MW8A 4BFWA 5ITZA 1CF4A 1ZHOA 1B8NA 3PC3A 1W25A 1P8AA 3CO5A 1GTRA 4DIOA 1QYVA 2V03A 2IZ7A 1UFQA 3QVGA 4MUEA 2O23A 1WG8A 5DI3B 3ENKA 1V8BA 1PQUA 3S68A 5JYEA 2H8KA 4JI0B 3I01A 5E7IA 4FDTA 3V1UA 3WZLA 1TQ6A 2HB6A 3BMQA 1GQ2A 3L6OO 1KS2A 4GZ3A 1JKIA 5FLEX 1PO7A 2FGJA 1OV6A 3KS9A 1K5PA 4Z0NA 2VP3A 2HCRA 3OZWA 3Q3JB 3ZC3A 1KIAA 4W5JA 2BGKA 1EJ2A 2CXQA 4YJ2B 4R8KA 3DOFA 1C9DB 3ZV7A 1M6EX 4MVXA 4J7AA 3BZWA 3RSCA 4ZVKA 4Q7KA 2ET6A 2AYZA 4IJVA 5IBQA 5K3CA 3NHFA 1PVVA 4U00A 4DQVA 4QUIA 2B0JA 2G9RA 1RQNA 1ZQ1A 4TKUB 3EDQA 2CNWA 5FPYA 1CE8B 5CJ2A 5B1SA 4URVR 4G5FA 1F2VA 4DIEA 1FX0B 4PZUA 2JRCA 2BH2A 2FG6C 1T0IA 5KVSA 1WE2A 2ACEA 2E4XA 2BGGA 2FA9A 1NUUA 2ZI9A 4XH9B 4JH0A 3R6DA 4M46A 5JADA 5GONF 1C3JA 5LQKA 2R8ZA 3NKLA 2PZEA 4Z3KA 4IQ0A 5IKPA 2DY0A 1IIRA 5JCJD 4RPCA 3RG2A 3JYHA 3PFIA 2NT3A 4Q1AA 3RC9A 5K6AC 2WSSA 1JHPA 3E5NA 1XKQA 2PWAA 3JARA 4LJ4A 2NX2A 1XZGA 4JLDA 1SBNE 3VFDA 3JD4A 4B73A 1LX7A 4PONA 3MRVA 4ND7A 1U99A 5EE0A 2WLSA 3W4IA 3BXOA 4I3FA 1YZVA 5DSTA 2LE0A 2EZ9A 1ZMBA 1VE7A 1PP4A 3ZQKA 4IDGA 3DDZX 1DFHA 4RELA 4MS3B 4X94A 3WKAA 2FMKA 5KJ6A 5KVAA 1U02A 2J3IA 1SVUA 4KP7A 4M9CA 1P4AA 1SBZA 2Q5EA 2Q4EA 3CXUA 4KWTA 4MP8A 4Z51A 2W2NA 1U28A 3BD6A 4EYQA 1KIMA 2XUDA 1O9GA 1O7JA 3OURA 4Q01A 3CX4A 5ALGA 5C5IA 3I9OA 3FHTA 1LBEA 3K9CA 3OEEA 1D6NA 1YBFA 5FUMA 3CSDA 2O7NA 3DMFA 1NR7A 5ERXA 4U3JB 4HKTA 5BYJA 4OI1A 3B1JA 4M8LA 4FINA 4B3GA 5DGCA 1Z4LA 2G9VA 2IHZA 1KAOA 2R5NA 1L7PA 4PQEA 4Q19A 1SHJA 2AN4A 1LBSA 4YV2A 2WIGA 1TTQB 1GGMA 2GNOA 4QFCA 1GT91 4Z0HO 5DXFA 1YF3A 4PE5B 5J58A 3V1MA 3U7FB 1N34B 2ZCVA 4NK5A 4WCFB 1TYAE 2VSYA 4R41A 3RYTC 4DSNA 1H5QA 4LZNA 4GOND 2WHPB 4I5EA 4BWFB 1LBQA 4PXSA 2B82A 3DXZA 3SYRA 4IIJB 5H3CA 3VX4A 3IJEB 3CW9A 3R6WA 1DT5A 5E0OA 1BXGB 2PBZA 3ROTA 1NHWA 4OQEA 1QGED 4U6NA 2WU0A 1BH6A 1RTTA 2V7EA 3GGCA 3IXQA 4GF5A 1J9GA 1ODFA 2CLCX 2JFFA 2NZXA 3CRZA 1YQGA 3QPWA 4C07A 3T1TA 1UBKS 3IS3A 4FNGA 1MIOA 3T3DA 4JLMA 1QMGA 1LA2A 2P91A 3E9YA 2D2EA 2EATA 4KZKA 4U2GA 4YI3A 3M3PA 3DD1A 2FP4A 3CR8A 3H0KA 4EFLA 1TX4B 5K8JB 2PS9A 4WDQA 1E89A 2R5WA 4O5OA 1VE6A 4DEYA 5JSHA 4GR4A 4Q1CA 3KG2A 4PTYA 5F7OA 1XO1A 4US0R 1PX2A 4GPIB 4EHJA 1G1MA 1YR7A 3WNVA 1TMGE 1TQHA 1P1IA 1ULUA 3C6BA 1ZUWA 4N8EA 2KWIA 2QJRA 3P9XA 4R16A 3HFRA 5HF5A 2C00A 5JZOA 3AY6A 2AXQA 2O3TA 4KXWA 2XBLA 5SZHB 4NLLA 1HE3A 2XNSA 3KQTA 2QAGA 3AHCA 2J8ZA 1I6WA 3FUUA 5ECGC 2FK7A 2O6LA 2OD9A 3JASB 4W82A 4D25A 1KQPA 4MUKA 5GJVC 5AI9A 3C7TA 4RKWA 4YCDA 2O0KA 2RSLA 2VAVA 3INNA 4C4TA 3LS2A 1KO7A 4RF2A 1FZTA 1E2LA 1E3WB 3QG5A 2XLBA 2P8SA 2ZIVB 4HDRA 1NNEA 4AMGA 4PYJA 1MEEA 1O4VA 2V3VA 3AGPA 5DBGA 2RJOA 2J30A 1JHZA 3DLPX 3HXPA 4FHGA 4X97A 2FZWA 5IJ9A 5LQNA 2GF9A 2H2AA 2IK8A 5HIMA 3STXA 4CMIB 4B3MB 1VI5A 2WJVA 5JAPA 2NO4A 4MVJP 3TW6A 4IWYA 1PNVA 4FPXA 4F1KA 2FFAA 5KYYA 2P1ZA 3LQ4A 4E32A 3NAQA 5EGNA 2FAXA 4MWSA 4UEJA 4C4RA 2RH8A 2A5JA 4PC7A 3PKIA 4RA6B 3VPBA 3JYLA 4D6PA 4NEHB 1JPUA 2GAJA 4BKUA 3HUFA 4GWKA 1XJWA 2IYFA 3GA7A 5CG2A 3HRHA 5EJ7A 3GYGA 3VR6A 4OHXA 4RVGA 2HMAA 2F8SA 3H1BA 1DELA 4DNOA 2WSYB 1SELA 2A0XA 1E6CA 3MXOA 2FZCA 4PTLA 2KM1A 1MG0A 2NU7B 3IV7A 1ZVVA 3L7YA 2I99A 3WGHA 3LCUA 5FOSA 3EDCA 1U04A 3DTNA 5AK0A 4Z9AA 1Y3IA 1L5QA 3OCCA 1KZ1A 2G8LA 2VPXA 3TZBA 1XEWX 1FNMA 5I4CA 3GJTA 1QGDA 2VNIA 3BZBA 3KBOA 4F5ZA 3O73A 2BGJA 2BF4A 4RA9B 2W00A 4RJIA 2YNMA 4YO7A 5REQB 4DRXB 1C4WA 2C9MA 3ICCA 2CFCA 1GZ3A 5ES3A 4M49A 1B4DA 2YL2A 1CF2O 1LFAA 3ANSA 5DSXA 5CDFA 3F3MA 3ZV6A 1OW3B 5JRZA 2YINC 3G8YA 6PFKA 5AYVA 4KFUA 4C6TB 5L8VA 2ZE6A 3DGEC 1V95A 1EUDB 3HXTA 4INZA 3TFOA 3U4CA 4E2YA 3MTBA 2WU4A 3JWPA 3LPCA 4K9OA 4ZOCA 3GBPA 4GAEA 2E3JA 4XOIA 3LVFO 4L8FA 1P6UA 1GKKA 4G4GA 1PYDA 1I7SB 4B7UA 1PDOA 1X70A 1BCRB 1KI2A 3RVLA 4REOA 3QI2A 1KZYC 3HBFA 3C6YA 2XY4A 4WKCA 1S3IA 3WBBA 2OENG 1IL0A 4KGDA 4Y7DA 5BQ5A 4GWLA 1T6NA 1HBJA 2O06A 2X0KA 1WPXA 3ZCSA 4B6RA 5BR8B 2LDXA 2LR0A 3AEQA 3PFCA 4G81A 4YT4A 1O96B 3UGKA 4JENA 5IJAA 3TIIA 1GGHA 9GPBA 2OGSA 1GCGA 2HHLA 1Q0LA 4AZ0B 3IQIX 1RT9A 3USZA 3A4TA 5JG7A 4E3ZA 2FPGA 5JNVA 1JHYA 1KORA 1XZJA 3ICOA 4P86A 4HBGA 2EVWX 3IMFA 3QF4A 5DLDA 4OYHA 5EMMA 4BKRA 2SKDA 1LTHR 3EIEA 3FLBA 3ZD6A 2XEXA 5ENDA 3F96A 5F33A 3AP2A 3UQYS 1U3GA 4UM5A 3SXUA 3KJFA 4H4EA 3OD1A 1K92A 2BFCA 4JB2A 3BORA 3X1DA 4CDRA 2Q0HA 3F6EX 1TLFA 5ABPA 1ELOA 4MLZA 4WACA 2BV3A 5DKFA 4MLCA 4TYPA 3I23A 3ZCUA 2HQ1A 3TRKA 4EGAA 3UMYA 2FHPA 2PFKA 3N58A 4S2UA 2MOKA 1O08A 2GAIA 2O48X 2OFXA 4WT7A 4YRMA 5HQTA 4O59O 4PGFA 4QBHA 5KTPA 1LV7A 1WVIA 1EHYA 1YMVA 3CX7A 1AHHA 2NPFA 3TQOA 4B74A 1C8VB 2LBPA 4YT8A 5KDDA 3AY3A 2XGJA 4J16C 1GPMA 1RLTA 2J31A 3TEFA 3DV0A 3NHSA 4MGIR 1F2UA 4MR7A 4UDYX 4RTPA 4L72A 3E53A 3ESAA 3RLIA 4EABA 3C5VA 3OEHA 5CXQA 1HDEA 1TUIA 4EYSA 1RIFA 4K6KA 5FEUA 2H2WA 4N3CA 3TLXA 5JXHA 1ZXXA 2VZLA 3B9QA 5IJWA 5JMWA 5DE3A 1U94A 1HDGO 4PAWA 1XZQA 1ZLXA 4R98A 3LHFA 4WVFA 5JALA 3OCWA 3OKPA 4I5GA 1IUNA 1NA5A 2BDTA 2UAGA 1AZSC 2VHVA 5GV8A 3AL2A 5JD3A 5K8IA 1FE8A 4TZ0A 1XZHA 5F3DA 4B3JA 5AOAA 4GGPA 1NP3A 5CLQA 3RG8A 2H9YA 3UHOA 2BJHA 2CEAA 1PKEA 5DBHX 2V65A 3RV3A 4BCBA 4PQFA 3H11B 4PG6A 3O1HB 4Y1RA 1H1TA 1Y4DE 2HEGA 3QSGA 4PQYA 1RI3A 4L3VA 1N5OX 1H6CA 1V3TA 1YZGA 2PQ6A 1Y4AE 3BD9A 3PQ8A 1QM5A 2IT1A 2VJNA 3KXDA 1L7BA 3GCDA 1CZKA 5CVEA 4B8WA 2P78A 2ZYUX 2ZIZA 4E13A 5CB8A 1I1OA 4KYVA 3M4JA 2FR0A 1YIOA 3H5TA 1GAEO 1MVNA 3LYUA 4ZAYA 1L3BA 3AHGA 1ZWLA 1JVNA 1YXMA 2GPTA 2O2CA 1GEEA 2C5AA 2QLLA 1ATIA 1B26A 2JGLA 3N7TA 5AUOB 2AZMA 3A4NA 4MQFB 7AT1A 1D2GA 4XUDA 1I7QB 1OTXA 5JNLA 4J29A 1OH5A 1MHTA 5JATA 4NYIR 1T4BA 2AXPA 3U13A 1U0EA 3BDVA 1L4NA 1YRBA 2ZYAA 4R40A 2NSJA 4CBVA 4QOSA 1TADA 2H7XA 3JVVA 4P7FA 3HCFA 5K3DA 5U4XA 3O7WA 1B42A 1EUCB 2OV1A 4K0RA 1MU0A 3IBYA 3K9GA 2QQEA 2BMDA 1SC9A 1DBQA 2RHJA 2ZZKA 4GNKA 4RPKA 2LTAA 2WUEA 1WEKA 5L7YA 3Q8LA 1HKHA 2VXCA 3ZE0B 1R5JA 1NFFA 1C1DB 1RI2A 3JQFA 1G59A 1U0SY 2VJBA 1ULBA 1L4BA 1QYDA 4AWXA 4Q34A 3FNBA 5EYPA 2B7BA 1CNFA 2D8AA 2A9PA 1ODSA 2FGKA 4OYLA 5DCUA 2B30A 4F9EA 3R9XA 2P4HX 4DQ0A 1TKAA 3JAWA 3ND5A 3T5TA 5F2KA 5BORA 3MJRA 2VH2A 1AQIA 1E8DA 1RQXA 2FNAA 3GLFB 1JU3A 4WADA 2YJ4A 4BCCA 4ZKDA 3FTFA 1E3LA 3PEUA 1NSFA 4RJLA 1EDBA 1GOTA 1M2OA 4LXGA 2JLCA 5ALKA 5AW2A 2JARA 1T3HA 3FZEA 3LNTA 5C7LO 3FWKA 4I3GA 3EPHA 4O63O 3KSRA 3TZEA 1CP3A 5L7WA 1RLIA 1ZM4A 4ND8B 5EKUA 1JF8A 1K97A 5IUNC 3CN9A 1P0FA 2WJPA 3L7NA 3L9XA 4E7PA 1V41E 1Z4OA 4MKGA 4CLRB 3KU4A 4UM9D 3VC2A 4YAGA 4KQCA 2CDBA 4RTLA 2QE7D 2R6JA 2XXAA 3KZMA 2B1RA 4P0QB 8GPBA 4KREA 1IPFA 3HVUA 3PD0A 3SQMA 4UXHA 3Q9UA 2FR1A 2HBZA 3HVRA 3DMGA 3GGSA 2MSCB 2JG3A 3FZNA 1SCAA 2HT6A 3UW3A 4YJDA 1AX9A 1UMKA 2XCQA 4BVGA 4XWTA 2PU5A 1O9HA 3ZGXA 1T4CA 2C57A 3EOAI 3NGXA 4UE3S 4Y2QA 3RAJA 1G8MA 4PRZA 3QK7A 4FS3A 5I9IA 1XZFA 2WHEA 4M76B 3EUWA 4J3JA 4A2PA 4PC6A 1VDMA 1M2HA 2ZJ7A 4OSOA 4ZXPA 3LBYA 3RC1A 1EEXB 2LV8A 2QW8A 3OZGA 1A8HA 5DHUA 5EHXA 1PTJC 3KAKA 1N6OA 5LB2A 3KZCA 1M8JA 1AN0A 4G1EB 5KAPA 2WVAA 2FOXA 2FFJA 2R47A 4GRAA 3IODA 4MTCA 2D2FA 5JD5A 5JXWA 2WZCA 1EFKA 2IYNA 3JYQA 3UA4A 1OI3A 4Y6PA 5C4GB 5CR9A 4BLUA 2YFQA 1EB8A 1NF9A 4L02A 3W6ZA 3C6KA 6ABPA 5BOVA 4WBSA 2C4VA 1C7JA 3KKPA 4AAYA 1ONBA 3VNQA 4CKCB 3C48A 2FSVC 3OF5A 5G3ZA 1LJLA 2VP5A 3BRSA 2RHBA 2OHFA 2WIBA 3P2MA 4XI9A 3I5MA 4RUKA 4KYUA 1X8JA 3SSOA 3JQDA 5JCZA 3D9QX 4MP6A 4OQZA 3ZD8A 1P4HA 1IJEA 3MJSA 2QBYB 3LUHA 4BKPA 4YV1A 4CTMA 2AFRA 2VDWA 4P4NA 4KVGA 3WDKA 3SEQA 3WFIA 4D9JA 4OHOA 4YP7A 1HDIA 4KHPB 1T8YA 4W1SA 4PX5A 2AG6A 2P62A 1THZA 1J2RA 1Y0BA 2HLNA 3K72B 4Q47A 4ZA2A 1HR0B 2BL4A 1H1DA 2AGVA 2YV2A 3DGFC 4YRTA 3WBFA 4EI9A 1MX3A 1YJBA 5FWXA 1F5SA 2BMAA 4BMSA 4HF7A 4FB4A 4FGSA 4C4AA 4L1KA 4Q12A 2QRKA 2NXJA 3SY8A 2YMPA 4GX0A 3IFSA 2WPDA 4Y7CA 2JIOA 1YI1A 3B9PA 3KSAC 4G0VA 5UKDA 2RGGA 3OM8A 4RFSB 1VB3A 1K6EA 3O1IC 3DMNA 2PGIA 2C2OA 3D3JA 4QTTB 3H75A 1DARA 4ZOQI 2JLVA 1EDEA 4QE3A 5BRAA 4ER7A 2GI4A 2WUWE 2H0QA 4Z9FA 1H3NA 1PEKE 1X9GA 4I99A 1I4TD 1TYCA 1U2DA 2WYVA 4HO1X 1CY1A 2BKUA 2NVBA 10MHA 2GARA 2FOIA 4FYYA 3AKEA 2OGZA 4RZHA 2BKAA 2I6UA 2GCOA 2P3SA 3I9FA 2ONJA 2PAFA 4R3UC 2YHSA 3GZNA 3D1JA 1KI4A 4QJ4A 4IHQA 4CQMA 4FFRA 3PTLA 1LC3A 2O3JA 2OBBA 1ZEJA 1XALA 4F4UA 4L4YA 3DDSA 4UHFA 3W8RA 5JPCA 3N2KA 4X00A 5HDQA 1HZJA 1ZH8A 1QYXA 1CUUA 4FHDA 3COZA 1NLMA 3E1GA 1VLVA 1ZFNA 3G0IA 1ZNZA 4TX1A 3ZDFA 1T13A 4HZGA 3TTUA 4AQDA 2OT3B 3ABSB 1XU4A 3CS3A 1ZD8A 4LJ5A 1DJPA 2RGNA 2VEOA 3RS4A 4CXMA 2R2GA 1QBGA 1UBUS 3AI3A 1N9GB 3R09A 1NJSA 3ZG6A 4LYGA 1MJ5A 3D0RA 1UWKA 3EUFA 2ZBFA 3ITDA 1PFQA 3K5PA 4II2A 1OPRA 3H5RA 5AM4A 3R0JA 2PMWB 2WI8A 2VJOA 5JAHA 2ZYIA 3T12A 2DB3A 3TVTA 4ZDWA 3EVAA 2G08A 2P11A 2QVXX 3NHJA 3V1YA 5EJFA 4C0BA 4C6HA 4TLCA 1TU0A 4GOKA 4LBYA 5LBIA 5A02A 1H85A 2HWWA 4BNTA 3FDZA 3SVZA 1JIVA 1PN3A 4EPWA 3FX2A 3UNXA 1G9TA 4B4WA 2QRNA 2UYOA 2AXNA 2YV1A 3TZLA 1P2DA 1CKEA 2ZYTX 3GGGA 3PSHA 3EW9A 2QUJA 2IV2X 1RIIA 4IMPA 4G1MB 4ZYWA 5JEDA 1FW6A 4OX9Y 1SXJB 3ZBTA 3R9WA 1J2UA 2ID9A 4OLAA 1KYYA 1UC9A 3AF4A 1P33A 1E96A 2QYTA 1VLZA 1TYBE 3AFGA 4GMXA 4RWZA 1R0SA 2ZXFA 3H2KA 3O91A 5P8WA 3RB8A 2QLBA 3NONA 4E6PA 4U2FA 4DR4B 2ZIAA 2N3ZA 3LC7O 3I4LA 2XVMA 2ZSJA 1RW4A 1PJLA 1NVAA 4L51A 3RSZA 1W0JD 3OTHA 5FULA 1EHCA 3I37X 3OE1A 2A9RA 5HILA 1AURA 5HIIA 1M1YE 4AKEA 4AJJA 3WTBA 2J9ZB 3G9QA 1P61B 2JLRA 2AE1A 3F7OA 5CX4A 4QQFA 3ZCTA 1KERA 5DHAA 2VJYA 1JSRA 4L5BA 5CT4A 2JFQA 1WU7A 3VI4B 1NVWQ 3RRMA 4H27A 3C6ZA 2HIAA 3WFZA 3QU7A 4B80A 3A3KA 4RMGA 2ZJ4A 2BBOA 4BWVA 2JFHA 3A6HA 1JAHA 1XU7A 2H3EA 1WDMA 2F1KA 1X7WB 3KCQA 2YCLA 3AJDA 1FTYA 1IC6A 2Q3MA 4HX9A 5AKXA 2PSDA 1FRNA 1GZ5A 3VDXA 3DOIA 4CM5A 2V4UA 2VNHA 4EG8A 1A1VA 2J87A 4H6VA 4OHBA 1K7EB 1U7DA 3IAUA 2EWMA 3N7UA 1GZDA 1XHFA 2XCIA 2I7XA 3BWEA 3H9UA 4ZYUA 3WLEA 1BWQA 2PZJA 2YMLA 3K94A 3P0IA 1QNFA 3SSAA 2G4LA 2CNLA 1OI2A 3A6ZA 1N2ZA 4V3CA 3ZHVA 5SY9A 1ZP6A 4JC5A 5T57A 3NV7A 5JSKA 5JYCA 4IQFA 3O9ZA 2I9KA 5G0VA 2IPAB 4IY1A 3K0SA 2PSJA 3UCFA 4FK8A 5JSUA 4NXMB 2QTBA 5LDGA 4YRPA 1EFUA 4MDEA 4JIMA 3VAYA 3W7AA 2H7CA 2I3ZA 1U7HA 2BLLA 2OCXA 1U9IC 1MIHA 3IKLA 3CF4G 3QM1A 2F90A 4RF3A 2BFDA 1XA4A 1E2IA 1WV1A 4X44A 4DJJA 1A8IA 1TZBA 1ULSA 2M1ZA 2VUHB 2PKRA 3WDMA 1EJ0A 5JV5A 3K8OE 5AJVB 1PQWA 5ALVA 1CJTC 1DMRA 4DIKA 4BNDA 1CS4C 4E22A 1Z8DA 4JLVA 4ZPJA 4UE6A 1NKVA 2ILTA 3OQIB 1YU9A 1LEHA 2IHBA 2JCXA 2Q27A 3OZEA 4GIBA 2EBWA 4FCTA 5CYPA 3PXDA 3D1LA 3W5VA 3UUFA 3U4QB 4G67A 3M1LA 3V9AA 4D3DA 2W8BA 2Y9PB 5AKHA 3HJTA 4EYKA 1JIJA 1U3CA 4XDYA 5BYBA 1YD7A 1V43A 3PC2A 3ID6C 3VJMA 1A4IA 2J5RA 2VDNB 3ELBA 5BP7A 2O8EB 5CJJA 2N42A 1MABB 4PAGA 4C01A 4JI6B 4ZOLF 4C7XA 3DAGA 3CVWA 4M22A 1TUBA 3ZV4A 5A6VA 3FPAA 4L3OA 3VO2A 2Y1WA 3OWOA 3FWNA 3FSRA 1QK3A 3CIOA 1JG3A 2QG6A 3LJKA 3V48A 5LP6B 3AKZA 4BVLA 1WKBA 1YOVB 3A1SA 2LZ0A 3O38A 3DEAA 4HH4A 4ZZ2A 5DF1A 4DW8A 4K2AA 2XZTA 3TUZC 1LBHA 5DTIA 4F7WA 2VF4X 5F2OA 1B8UA 3BJIC 2AMLA 4TV8A 1EIWA 2CXOA 2VJLA 3AHHA 4LF7B 3GOHA 3BT7A 3PEYA 1Q1ZA 4J76A 2CZGA 2FEOA 2OPHA 3SOZA 3BE4A 4MWZA 4BGUA 5AHRA 1XRMA 3SU8A 4DG8A 4B85A 4BCDA 4OJYA 5WRFA 2Z83A 5BVGB 4JEMA 4KR7A 3I2IA 4YB8A 4YK7A 4NX2A 1Z5OA 3O31A 4LDRA 2FB9A 3KALA 2QL6A 2FF7A 4LMRA 3RKUA 3P26A 4ARVA 3JQ7B 4GLBA 1L7MA 2ZUWA 4XASA 5FBKA 2ODAA 3DHYA 1SULA 1E60A 1PYGA 2B1QA 2ID4A 4JSTA 4Q24A 4J9VA 2VK2A 2ODWA 3OX2A 4NWIA 1UM8A 1E2GA 3HKCB 5MDHA 4IHJA 1LVUA 1I3NA 4P22A 1QG0A 2QTCA 1QFJA 5B3KA 3IJPA 6REQA 2ODPA 2IU6A 4FNOA 2OB2A 3RRNA 5L45A 4CIVA 1OIWA 3QLJA 2XWPA 1I2AA 4GM1A 4BFVA 2CDRA 1PV2A 3CZ9A 1DHRA 1DMSA 3WB0A 3G5MA 3D6VA 4H15A 1H05A 1GZUA 2OZVA 5FBLB 3AP3A 1C4KA 3DP9A 3EAGA 4IIXA 4KVAA 4CEJA 4FDAA 3JQRA 1FMLA 1F2DA 1T3TA 2VDKB 4H6WA 5EXPA 5F76A 1E1RD 1V45E 1Z6XA 1XNGA 1QHFA 1VRWA 2OSBA 4J1QA 4EY6A 3A1EA 3D7RA 5IAOA 2ZBVA 1B3BA 1I5OA 4YBZA 3NCHA 4XB2A 4EZEA 4G1FA 2RHGB 3EXHC 5B1IA 2QK4A 3B51X 1ZZEA 1DPFA 4C08A 1U1EA 2OG1A 3EXEB 4OG2A 4X8HA 2JKYA 3PGJA 3NLLA 1RJ9A 2EZUA 2GUWA 1XCJA 3C8UA 3R7LA 2WLTA 2HY7A 2ZWIA 1QR6A 1SBYA 2FWMX 3DE3X 2G9NA 2PWYA 4EY5A 1EVYA 3GFVA 1DE0A 4OV6B 2XV1A 1OZHA 5FL7A 1QP7A 3RRXA 1SEPA 4W7IA 1Z36A 2WMDA 5JD4A 2GRAA 5JU6A 1Q7EA 3UV7A 3TEJA 2F3PA 5K8VA 4ZT3A 3HI4A 3ZW8A 1D6JA 5KHLB 3FD8A 4RQBA 3O4VA 3A4MA 4HATA 3CN7A 3H7IA 5AJWA 5BN5A 1X8KA 1MD9A 1VJDA 1Y1TA 2IDMA 2W6PA 3CV3A 5H1YA 4J1TC 2Q3HA 2BRUC 5EE5B 4FBGA 3FSEA 1ENOA 2ZT7A 4O1HA 4H0NA 2HRBA 1NBIA 3V2HA 1NRWA 3EFHA 1NATA 4GZLA 1G5IA 1WBBA 4OAOA 4PO9A 4OLBA 2C3PA 5EG5A 5FBZA 5I7FA 4Y2SA 1DWOA 3KSUA 3IUMA 4O2AA 4QD3A 5LMZA 3CVVA 3U4HA 4TRJA 3FTPA 4ZCSA 1ISMA 3SQWA 1EE1A 4LV6A 2OHXA 1WMEA 1AC5A 1ZH2A 2BT4A 5EQTA 3PGVA 4BVHA 4FYIA 4O2BB 4TXMA 4CCAA 2DXIA 5BMOA 2WJ4A 3ON5A 4FXPA 2AOVA 2GERA 4CUJA 4Q3NA 4MK4A 2QN1A 3HDHA 4JL6A 4CKYA 3PKJA 1ID1A 1VRCA 3A2LA 1N9ZA 2PU7A 5HA5A 4I19A 3LTNC 1ZINA 2O8NA 2QD5A 1DCKA 3SXJA 4URUR 1M8PA 2X9VA 2A30A 2Q4TA 4O3FA 4ITRC 4TVSA 2YWFA 4K0KB 4CNBA 5J9FA 2DQ4A 1SB9A 2W90A 2XD9A 2SICE 1GG5A 2B4RO 5CA0B 1E3SA 1W6UA 4GKBA 4UXIA 3ENQA 4WUTA 5DNWA 1FU8A 3OM9A 2WA2A 2X8AA 2EKQA 1VYTA 3LX5A 4A8JC 1T5HX 5FLXA 4F3TA 3O1LA 1PS9A 4TVBA 4BOYA 3I62A 1TXGA 4MJ3A 4W5WA 4CUKA 3L0BA 3W05A 2C2WA 1QUEA 2FUG6 2FWBA 2P2DA 3G2OA 4KIWA 3ICQB 3P52A 4II3A 4B3CA 2G6TA 4K3UA 1LTKA 4X63A 5K0BA 2BM9A 3GUCA 3DDOA 4CCWA 4ZKEA 1RXIA 1LVHA 5B3LA 1C0EA 3F4KA 3IV9A 3RSSA 3VYSB 1XZIA 1WM1A 2WJZB 2FEAA 2VQ3A 4L6IA 4ESOA 5B12A 3NALA 2D1QA 5FBHA 2RGEA 2ZI3A 4EGSA 3HRKA 2WG1A 2CY0A 3KB8A 3TTTA 2YWHA 1X8XA 2BBTA 1PJ8A 2YVLA 3DMTA 2YMQA 4IDBA 4AF6A 2G1UA 2RK4A 5DNVA 1FFHA 1M6HA 1W4CA 2IUSA 1ZNYA 2Q8NA 4QHYA 5BYKA 1GXSA 4KFRA 2DWUA 5AM5A 5BR4A 2G17A 1CWUA 4JJZA 4ETIA 4EUSA 3AZQA 5HIAA 5IF3A 1GCOA 3C41J 3KWJA 1VE5A 4HB2A 4LC9A 4YJ3A 1Z0IA 3UG6A 1FOEB 3O94A 2J33A 3M82A 4XRRA 1U8ZA 1Q6ZA 1W1IA 2HPVA 5LD2B 4IEIA 3G0DA 1N3BA 4ZJPA 5COBA 3ODGA 2XUIA 3ZS8A 5JVDF 1E0AA 2BFMA 1C8LA 3PFHA 2HU8A 5D5PA 4ZI2A 1QRAA 5MN6A 4MCAA 4WOJA 3KEMA 1QGOA 2MYUA 4MQ5A 2R68A 3PR2B 3HL0A 4ADSG 5HKAA 2W83A 3PLNA 4OQNA 4OHMA 1YA6A 3EPLA 1W4BA 3LLCA 4PG8A 3L4SO 1QS0B 2D1TA 2FFQA 4TXJA 1FMFA 1R0KA 5DVZA 3VYTB 5L3QA 4MUMA 3IE1A 2W8ZA 3PV0A 5ECYA 1KY3A 2MYNA 2VRBA 5I9BA 3PPVA 3ONVA 2Q6VA 4IJ6A 1N6RA 3G68A 2Z95A 2AOTA 4P98A 4WZBE 1L5HA 1P7CA 3SSNA 4TTRA 2AXEA 2QP4A 4C87A 3NTRA 3BYZA 2EF0A 3IAEA 1ZQ9A 3FUVA 2Z2IA 2G25A 1BO6A 3OF3A 4FMPA 1EWYA 1FTWA 3H97A 4KLZA 4W5TA 5ALEA 5JS1A 2NVWA 2QL9A 1ZCBA 3HCCA 5CVCA 1XFAA 1WAMA 3LKDA 2FEKA 3OCXA 2R85A 4BQIA 2X9LA 4JN6B 3QPUA 3IIEA 1G8YA 2AOUA 1PS0A 3BKWA 2WBLC 3ROQA 1T5DX 2FPIA 4FKMA 4OA5A 1UBSB 3CUKA 4Y2GA 1OWPA 4DBVO 1XHEA 4LJLA 4M7WA 4C7OA 2GOYA 1P0CA 2HSEA 5K0JA 2VPIA 2C2HA 3WMFA 5DXJA 2ZJFA 4H1TA 4PCVA 1TT5A 4YP1A 7GPBA 4UEQA 1NLYA 1YAHA 2W6MA 1GQFA 3I8XA 3EXFB 4O02B 3PQFA 1F20A 3A9WA 5AKJA 4BNJA 1JN0A 4N7MA 2HF8A 1N3YA 2UVQA 2B8EA 2WYIA 3BGIA 5B4VA 2JZCA 2O3QA 4NXNB 3DE6X 4H7DA 1X7YA 4B6QA 1CRPA 1IBSA 5A9RA 1E63A 4YWJA 1OXXK 2WU8A 2V55B 4KRYA 5EHZA 1Z4KA 2WTXA 2XGGA 3DMDA 4Y2XA 2UDPA 5K6AA 16PKA 2PZLA 5KNCD 4D80A 3LL4A 3THWA 4HYEA 3JZAA 3PNSA 3F4LA 4NCIA 3X1ZA 4D8TA 3EZFA 3MEQA 3MAAC 2NG1A 2NN3C 4EB0A 4OBBA 3AM5A 3EAQA 2NLOA 1QIJA 1YO6A 5CIQA 2A58A 4MKRA 4PW0A 4BQOA 4C21A 4DT1A 5C8YB 5D5HA 5J1TB 4GI2A 1E1CB 2A9VA 3T0FA 4G23A 4QRHA 4UUMA 4FE7A 2GXQA 1K7XB 3A4YA 3JSAA 1FBTA 3LUAA 4HDMA 4X24A 4JI1B 1SWWA 4LJYA 1C7ZA 3MJ4A 1VJ0A 3QNMA 2FZVA 1W19A 2AK3A 3RFCA 3VPFA 2EP7A 4D45A 5CXXA 1BVRA 2GAOA 3KV3O 1XLUA 2LGJA 3SI7A 2XUOA 4JLUA 3AXSA 1AQNA 3TB6A 3DL7A 3UPTA 1LWOA 4BLVA 3IQEA 2XZDA 2SKCA 4RW0A 3B9BA 4RZUA 4D9CA 5B4UA 1D4AA 3HABA 4MGZR 2JH9A 5EMJA 1EJBA 3UYLA 2IPLA 2FUNB 3FKSD 3UT5A 3MYRA 1Q5PA 3KUDA 4MKHA 3I2FA 4NCNA 4RANA 5E6UB 2JIPA 2D5AA 4FHZA 5E2AA 5HJ5A 1J7JA 4RNDB 3V7WA 1OC4A 4F4CA 4PLWA 4TM8A 2CNNA 2VT2A 2XUJA 4R6XA 4RYLA 3U3XA 3C6XA 4CM8B 1VG0B 1USGA 3FTCA 2YJ5A 1FTNA 3MXTA 4FFBA 1ODKA 4F3NA 4IXWA 2YN0A 4B4VA 2GXAA 1RKBA 4ESEA 4RIFA 1W7AA 5FP0A 1CDZA 2UZAA 3CUVA 1Y3HA 1GZ6A 1C3LA 4LDAA 4MEAA 1QCYA 1Y1LA 4TTAA 1B6SA 3QX8A 2VP2A 4QUEA 5IAJA 4JYMA 4H3SA 2W2TA 4LBVA 1YCHA 4MCIA 1HT2E 4MJ7A 3RT9A 2V59A 4L50A 5I3CA 1QO0A 1NUSA 4AVYA 3W2HA 1JVBA 4YUWA 2G72A 2BFFA 3EYAA 3W2FA 3C4VA 5IEJA 2VZEA 3GLKA 1WWKA 4H1VA 4MXDA 3FMOB 2C0CA 5GVRA 2LW7A 5KSPA 1YR2A 1Z4MA 2PZGA 4FFSA 3R7BA 2OZKA 1MXFA 2YDYA 1T24A 1XTSA 2CYAA 4MQMA 3UJCA 1RXVA 1NBMA 2FWNA 2P9EA 1BXRB 1OQAA 3HCDA 3R24A 3ESBA 4MRPA 2ZJZA 4RADA 4NBWA 3UKJA 4F85A 4YLYA 3OJFA 5KNCH 5BSWA 4HXEB 4IAOA 1ZJJA 5JYBA 4RHXA 5IRCD 4B40A 1BQ4A 4C7BA 3JQEA 3CZRA 1GL3A 3O93A 5IM4F 5BV8A 3EH2A 4P2BA 3OE5A 1PNOA 2Y1EA 5EIBC 3STWA 4JI2B 2IV3A 1VGRA 1GDHA 1YONA 1YFLA 3D8HA 2HA6A 2FOLA 4J07A 5IVHA 1FLAA 1N32B 2BE7A 4LPSA 2VNKA 4JYZA 2IXAA 3I0ZA 2D8MA 2H5JA 3GJ0A 1JHMA 5A6SB 1KJYA 2PRKA 4AUKA 2IKSA 4EYEA 4V1CI 3GIDA 3PJRA 4KE6A 5B3AA 4G0WA 1ZDMA 2QXUA 1TIBA 3FOFC 2W43A 4M9QA 1I13A 2WTUA 3TW0A 5MGBA 1DB3A 1N1MA 1YZUA 2FFHA 2V5VA 3KK0A 3AESA 3LRPA 5KYNA 3ITNA 2FW7A 2NYVA 3RASA 4AO7A 3D4LA 1Z6GA 1YS6A 4EHKA 4YT2A 4B35A 4MV5A 4P54A 4KR6A 1P9OA 1NJFA 1E3DA 1X6VA 5BSKA 1QQ7A 2YRWA 4QXQA 2HU5A 2J3HA 2PTGA 3QELB 4AZ3A 4AUEA 2H2GA 1GPDG 4LZAA 2QJWA 1QH9A 1RE0A 4HZUA 3W5JA 1Y6JA 3FH0A 3IBCA 3A58B 1WW8A 3DBRB 2N0SA 4FLFA 4ZGBA 4OMCA 2OLEA 2IA5A 1YZ3A 4U9HS 3GLIA 4XDZA 4ZN6A 3FOZA 2E5FA 1JA9A 3LTEA 2UZ4A 3KFXA 4ZICA 2GSDA 4QRIA 3IALA 1C30A 2NTNA 4PO3X 3E05A 6NULA 4E2WA 3S5JA 4EHAA 1Y37A 3V8PA 1DT3A 2GCPA 5KYWB 2HU7A 1OI7A 3LT2A 4TT3A 2ZUUA 1F7VA 2C2MA 3BL6A 2JAQA 2WD8A 3DOUA 2O1EA 4FT2A 2A0WA 5DB4A 5LPNA 4CGZA 2B2XA 4UE2A 3A32A 4E2FA 1QK5A 3GHHA 3PNYA 1AF4A 4N5LA 1QFMA 1IXZA 1XTTA 3DKPA 1KQNA 4CMBA 2B3TA 1OGJA 2FSGA 5G40A 5E3IA 3TGWA 1IONA 5JZ9A 3NYQA 3OJLA 3O8LA 4OUDA 3HKBB 5EUMA 1HZZA 5KPJA 4Q9NA 2XZPA 4TMKA 3LP5A 2ZUDA 3NXKA 2O5EA 4JAVC 4YP0A 3FOWA 3UK0A 2VHQA 1DDIA 1QRSA 3MLEA 3O9MA 4M8SA 2AK2A 3C7CB 4B9AA 3N0VA 2DT5A 4CYMA 4F96A 1KIFA 4F3CA 3BSYA 3WMGA 2PHZA 1IAQA 1X7HA 5JJCA 2BFBB 2A9OA 3FOCA 3IRVA 3T9FA 1XNJA 5LWHA 1UEXC 2P4SA 3NBAA 4UEKA 4RD6A 4HGYA 3AM4A 1ZGZA 4F9FA 5F1OA 5HUHA 3PX7A 3Q7QA 4WTOA 3V7UA 3VNBA 3BIXA 3FPKA 1BE6A 1KOFA 4KQWA 4UOQA 2JJYA 3OX1A 2M2IA 5E1OA 1K4MA 1KH3A 3LUDA 1MUUA 4IV8A 3ZDXB 4J6EA 3ZVKA 1K1EA 2CC2A 1XGKA 1XLTC 2AG0A 2WHQA 3OQ1A 4BLQA 3E35A 3F3KA 2EFCB 2YIMA 3J7AC 4ZEXA 1F2TA 4MHSA 2CHUA 2OV6A 4MR8B 4O08A 3VV2A 4D4MA 1GNVA 1H8ED 5I9SA 2JBWA 1YB4A 1DADA 4Q4AA 3GP3A 2Y1CA 2XVZA 5JH7B 3C8HA 1GV0A 2WAYA 3D43A 3HO8A 4A2QA 4I1IA 5BSMA 2ENUA 2Z9DA 5B57C 2W6QA 5JSZA 5D2CA 1Y6FA 5TXGA 5IC5A 2XQFA 2Q6TA 2ZBPA 3NTVA 3TNFA 1QTRA 1X92A 1ENZA 3K0FB 1UPTA 1UBFA 3IQGX 1H2FA 1SG9A 1L4YA 2Q6KA 1J20A 2H2FA 1QTNA 3PXBA 4DB4A 2Y0CA 2X0NA 3IUYA 1A8PA 1IQ0A 5HQ3A 3TOZA 3WGMA 1GZHB 1JIIA 4FW8A 4PGHA 4QLOA 4UDNA 3PEWA 3E9DA 1M2GA 2PLFA 3E5HA 4J16A 1N5IA 3SR0A 1L1FA 1MTZA 1RAHA 2DMRA 2BF7A 3U4AA 1ORDA 4IEFB 2VS1A 2J09A 1LV8A 4KDCA 4OOFA 3SJ7A 3KXKA 4NY1A 2TS1A 3I58A 2IQIA 3GJYA 2W5UA 3H0EA 1AM4D 2JATA 1VXRA 1EESA 1UBNA 2BTQA 3FYUB 3VQTA 4JWKA 4MKFA 1XXHE 2I8CA 1OXSC 3I5AA 5CNMA 4GYKA 5AHWA 1GYQA 4AQYB 2OBFA 4OMUA 2XTNA 3MWEB 3HU1A 2WEKA 4IQGA 2QLJA 3CLRC 3MZ0A 2AS0A 1UMBA 4J1NA 3B3FA 4CKZA 4YUXA 3F97A 3NDIA 2D59A 4A6DA 1GY8A 3DTVB 2J3QA 1J0XO 1R4MB 1MA3A 4GP7A 1HQCA 3GN2A 4L85A 3NH6A 2B35A 1AZTA 2CXTA 3E9RA 4MI1A 4WFKA 4JL5A 2VP9A 5CNIA 4Q3DA 4GPD1 2AR9A 2NPOA 1BX3A 3OY2A 2VT7A 4O4JF 1A9XB 2XJ4A 4QIHA 5B3JC 1AE1A 1DVRA 1U5CA 3EXIA 3NM6B 3OC6A 3W06A 4AMYA 1HM5A 3GEHA 1QJ4A 1WKCA 4IG9A 1SK8A 2J0EA 2YKGA 3KR2A 3HN7A 1TA4A 2OK7A 3L5OA 4I4TB 1PJ3A 3RVKA 3WNCA 1P7YA 3RUFA 2IY8A 5SICE 5HZHA 3DVRX 2RAVA 3GJ7A 3K0EA 3N2ZB 5TVKA 2XGMA 4OIMA 1GG8A 1T8SA 5CURA 1BE1A 4F6RA 2BDUA 1GFSA 1RRMA 4M6WA 1MJGA 3H6KA 1XRPA 4PSDA 4Y6LA 3WGUA 1JQAA 4TYMA 4OI4A 3L8ZA 3V80A 1T9BA 4UBLA 4BKOA 1A9PA 4JXXA 1LVGA 3L4EA 5DYGA 4NYIQ 3W3AD 5C80A 3E81A 5ICGA 4R0VA 2IOHA 4JLKA 1GCIA 3K1YA 3L8CA 1HYBA 3NHUA 4P33A 1NQWA 2GZ2A 3LBHA 1OBHA 2FRDC 4MO2A 1WCWA 1CZOA 1GGNA 4O4IB 2OCGA 4FN4A 4G9BA 4XQEA 2OSVA 3SM3A 5KYXA 4UTOA 2QVYX 2I3GA 1BMTA 3I83A 4KQKA 2XB9A 1VKRA 3IT3A 4LDJA 4NU0A 2UUPA 2VKQA 5EKDA 3THSA 3H9EO 5CW1A 3LUGA 3WA6A 4V0LA 4EARA 4J43A 3PITA 3H2GA 1ORHA 3R0QA 3IPRA 3ZJ5A 4EJMA 1Q83A 4H1UA 5K3FB 2ZSFA 1IOZA 1V16A 3Q85A 1DKQA 4CMIA 5LWQA 3EDMA 4PNZA 3S3TA 2ERYA 1H6AA 4KO4S 2RB4A 1H2BA 1YUNA 3FDFA 1ZCZA 2DPMA 3I9LA 4LY0A 4NDAA 1I01A 1E2HA 5KX5B 1ZL2A 1VXOA 4NI5A 3LVRE 1DS6A 3C3DA 1YQWA 2ZFUA 1QR2A 1FL9A 1CHNA 3BJEA 3LF2A 4KBGA 1GGKA 4P3YA 2Q1WA 1T2FA 2E6UX 2AYYA 3C14C 4UUBA 4LJ9A 1OYVA 4X1KB 1RYFA 4Q3EA 4GZ6A 3OCUA 1Z74A 3TLBA 5H8WA 2C1XA 4DHEA 3ZY2A 3ZHYA 2NUTB 4A03A 5E1BA 4COKA 3NDRA 3V4FA 4CT5A 3AFNA 5SYAA 1OWNA 1XMQB 1CLUA 1M7BA 4PZ9A 1OLXB 1SCUB 1YFJA 4LDNA 5HBGA 2V6IA 2J5QA 3SQNA 4KWEA 1N4DA 4D57A 2ZWMA 1WBJB 1SHTX 3TFWA 5JMOA 1WTAA 2A57A 2J3EA 4F04A 4F92B 1LSUA 1JU4A 5HF8A 2PGAA 5BRNA 2PWZA 4YJHB 2XE4A 1YDGA 2JAUA 1NHGA 4PX2A 1ZK4A 2M1XA 3UFXA 3EGIA 5PNTA 2XT9A 1UIRA 4A0QA 1QLJA 1TCVA 2DYKA 2GM3A 3LCMA 4D0NA 1RDFA 3ZI7A 1CJCA 1QH8A 3KM0A 4FCVA 4C4YA 3W3AH 2OO7A 1Y7LA 4NFSA 4HAUA 5ALTA 2YY5A 1N1EA 3AOEA 2BMEA 3IUSA 5T6BA 3UCEA 3QA3E 4H4CA 5A71A 1BSVA 3CZAA 2H1FA 3ONNA 1Z75A 2H1CA 2F3TA 2QT0A 1GPYA 1JQKA 1PTJA 2XMPA 5KKAA 1AS0A 1Z34A 2ZULA 3BRWD 3OKFA 1SUWA 4N49A 3U31A 3DJYA 4HRYA 3DXFA 1SA0A 3OKAA 1KMIY 3UMBA 1ZWKA 5A5EA 2C29D 1NVDA 2X7HA 2HH9A 2WUDA 2YN4A 1KEWA 3T1YB 1GAJA 3NHYA 4ZV7A 4C0KA 4HLCA 1VMAA 4DCMA 5T4FA 2VYVD 4F06A 2A0KA 4RO0A 1SXPA 4CODB 3QRWA 2P79A 2WAOA 2Q2OA 2YASA 5AW4A 2DBVO 3TG8A 2FSVA 3DUWA 4JV5B 2HJWA 3K2EA 3WP0A 3U1VA 1ZU5A 3RIHA 1KH1A 1M2VB 3B6KA 3JRWA 2J6CA 4QG3A 2HJVA 2B1JA 4FOOA 4HNSA 2YV3A 3NIGB 3L7BA 4Y9DA 1D2EA 3GGDA 1JV2B 3B5EA 4C7VA 4HN4B 1UK8A 5A1JA 5JFGA 2HBYA 1N2GA 4NF2A 2M98A 4UULA 3AB7A 3IIIA 2IUTA 1FSZA 1GWNA 1BVYF 5E4YA 1Y81A 2FSIA 3PYMA 5AMXA 1OWLA 2I6QA 3WWEA 1C9YA 2IEIA 4EB6B 2C7OA 1TAGA 1QHHA 2FQWA 1XDSA 3O47A 1KC1A 5FEMA 4IXMA 2DHCA 2GXSA 4H6XA 5IAGA 2Q45A 3X44A 4B83A 1HFEL 2Q46A 1CYEA 2PJZA 4F2WA 2ZTHA 3ESZA 3DAHA 3KQMA 3CTMA 4G0PA 5AI4A 5HKKA 2ZITA 4QFMA 2J9FB 1CIVA 2H2DA 4G4SO 1Z15A 4TZTA 2DBRA 1CYDA 1GKLA 1L7QA 1HQKA 5TDHA 1Q11A 2XLCA 3TSYA 1Z2PX 2XB4A 1SU6A 4FEAA 2UZ0A 1AVTA 3ADCA 3A2KA 1XVAA 4JLWA 2C61A 4JQYA 5TT1A 1OH8A 3RYHB 3K7EA 1Z16A 4PR3A 3L0CA 4BYMA 1UWLA 2XQIA 3HUTA 4TQUS 1JKFA 1SUDA 3SWWA 1J8VA 1L8XA 5C1BA 3P4UA 2DFNA 1ZGBA 4IUBS 3VR0A 1CT9A 5CDYA 1WUKS 4ZV4A 2O0MA 4YAEA 4RLFA 2BFOA 3JWEA 1VIAA 3KOMA 4A9AA 5J4YA 1BWSA 4L08A 2P1DA 4C4XA 3DBHA 4CLXA 1XCPA 1J8FA 1ECBA 3BL8A 3I3OA 4JBGA 3GFRA 1ZA1A 1WW3A 5ERYA 2EW8A 2A3NA 1DP4A 4D9MA 2XUHA 1EM8B 1SCNE 3LIPA 4KXVA 4HC4A 4XIFA 1A9RA 1JDBB 1Z28A 4WKGA 4E46A 1FP6A 5J5VA 2AE2A 3ZNQA 4D8UA 1ZISA 2C9BA 3OUUA 4MEJA 2YS7A 1N8KA 3UFBA 4H7JA 4C29A 3NIBA 2AI2A 1IMOA 4A5OA 3GK3A 4F6CA 1EWQA 1QYRA 2PWBA 4WNCA 1EAMA 1JSXA 3ZWOA 5JW6A 1R9MA 3FM9A 3PEVA 4UZSA 4BASA 4CT0A 3VVBA 4GC9A 1R88A 1NMXA 3M6LA 1OGYA 4EUNA 5AVZA 1ZCJA 2DFDA 2V45A 1J99A 1RAFA 1JHAA 2QV7A 2V7QA 4ECAA 2YHIB 1V5FA 4TLBA 3ZWCA 5TIIA 4W1PA 3LP6A 3QVSA 1AQLA 3NFYA 3F5QA 1DAKA 3MF4A 3TG2A 3A0RB 2WKPA 3G8AA 4C03A 3T94A 5K09A 3A9UA 2ZJ8A 3H18A 2OP0A 3E7FA 4P34A 1JI0A 4OKIA 5HM8A 1O5IA 1WMFA 2V58A 1H69A 1HE5A 1NVEA 3JD1A 3QI7A 3F1KA 4C0XA 5ALZA 1VJTA 5LMUB 3IP7A 4GP9A 3OIFA 4YAFA 1O5TA 4BIMA 2AV6A 2CZQA 2ONZA 2EKDA 4HUJA 1I9GA 1PKXA 3JR7A 2PKEA 3KYDB 4UBIA 3P4XA 1D2CA 1J5XA 1TF5A 4JA2A 4DR3B 4PYNA 4R2WA 3FDIA 3EGDA 3DM5A 3NUZA 2VHWA 2DUNA 3FRIA 1GFWA 2HA5A 3CLUD 4HNTA 1QAQA 1GGEA 3EQ2A 1U31A 2IF0A 3T61A 1Z68A 2R44A 5BW5A 1W34A 2QG4A 5EWJB 3TECE 2OD7A 4X1IB 5J2UB 3COSA 4O4HA 5B53A 3TIGA 1L4HA 3I8SA 1Y3BE 5C0OE 1JQ3A 1GRNA 1UOOA 1Y6RA 1SMKA 1WKVA 3CRNA 3GFQA 4CW7A 5M7EA 4RK1A 2AJLI 3K9NA 1SIOA 2A33A 9MHTA 4TTSA 3MILA 1H9CA 3GV0A 3LW7A 2FMTA 2BN4A 1U2TA 4RZXA 1ZIOA 3M2TA 4EPRA 3ANTA 1E3MA 4HB4A 4HX5A 5KNBA 2HLDD 3KEOA 3Q0IA 2ZE5A 1A98A 2EDCA 2R1VB