2PEZA

Crystal structrue of deletion mutant of aps-kinase domain of human paps-synthetase 1 in complex with cyclic paps and dadp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
RGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Structural mechanism for substrate inhibition of the adenosine 5'-phosphosulfate kinase domain of human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 and its ramifications for enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pezA00
2H5EA 3I61A 4TT3D 5FFMA 3KB1A 1A1VA 4DBLC 3RWMB 1XPUA 2JEOA 3FMFA 4PC7A 2IWRA 5KHOC 2BBWA 4FINA 4FXPA 4OJKA 2QGZA 1E2IA 4E22A 2ORWA 2RHDA 4W9MC 4L16A 4TZ0A 4PSKA 1Q12A 4M1MA 2OEPA 3DM5A 1E2KA 1W4BA 1CJTC 3C7KA 2JLSA 1X86B 2HT6A 2MSDB 4MGZR 1AS2A 2GEVA 4BFZA 5E7JA 1S1MA 4JLDA 4G5SA 2YWGA 2UZ3A 3PITA 4IDHA 5H68A 2OLKA 2O8CB 2CHVA 1SVMA 5AJWA 3DZ8A 4F4CA 3Q5EA 5HCNA 4RZUA 2O8CA 1HUQA 1J99A 1TADA 4NCHA 1R4AA 2ZU6A 2RGDA 1G7CA 4B2LA 1W48A 1J8MF 2PH1A 3P20A 3B13B 1NRJB 4XJXA 2FNAA 3MWJA 4QGFA 1T4GA 2J7PD 2PZFA 4QHTA 3VX4A 5CLQA 2B7CA 1E1QA 1SVWA 3F8TA 4LC0A 2WM9B 2QE7A 3CWQA 1N6OA 3GD7A 3R9IA 4O3MA 2H18A 2GXAA 1YRBA 4QBIA 4HB4A 1OKKA 4MQBA 4MGIR 5SZJA 1CXZA 1U98A 4LWZA 2EU8A 2MSCB 4B71A 2DWPA 4Q5IA 3LBIA 1GITA 4NCJA 3K70D 3W8NA 1FNMA 4V02A 3NBFA 1G7RA 3W3AA 4C0BA 1KTVA 2O0HA 2P6RA 2VSOA 1WF3A 1TU4A 1UADA 2ODEA 2W0MA 1QVRA 5KSYA 3LO5A 3NC0C 3FE2A 5A0FA 3CNLA 5SZHB 1NLYA 3ZH9B 3A1UA 1Q57A 3U3MA 4BLTA 4IDOA 2D3WA 4PC1A 1Z22A 4HB0A 3VR5A 5FPKA 3I73A 1FTNA 2OUKA 3BB3A 4TYYA 4AKGA 4PC2A 1NI3A 3RNLA 2W83A 1N2CE 5TXGA 2FPMA 4NP6A 1UPTA 3RC8A 2FEMA 3NWJA 5HCIA 4JLMA 4DB2A 5HZHA 1QVAA 4D6PA 1RE0A 4RZXA 4BRWA 1PJRA 1QHIA 1ZM7A 4FIDA 3OZXA 5L3RA 4BZXA 5DSZA 3NEYA 4LV5B 4B6FA 2ZUDA 1K6MA 3H4MA 3IKJA 3QPWA 4Q4HB 1Z0DA 3P1JA 2ZIAA 4NL4H 3MG9A 2CLSA 4Q4HA 1XD8A 1CTQA 1JR3A 1FX0B 3ASZA 3K0AB 5K8IA 4TTRA 4JYBA 1CR0A 3Q3JB 2YZ2A 2XZOA 4CEJB 1FX0A 3K0AA 3N5CA 3WP1B 2Q21A 3MFYA 4CEJA 1ETUA 5IK2A 4M1WA 4RSGA 4NPHA 4NONA 1KY3A 3K70C 2IYVA 1NL3A 2X77A 2OAP1 2NQ2C 3VTKA 4FW9A 4URXR 3MSXA 3NH6A 1YZLA 1DPFA 2GETA 3VFDA 8OHMA 5FH9A 2QZ4A 2VH5R 1VIAA 2A5YB 3K9LA 4KV9A 1IHUA 4GI7A 4RD4A 2VQSA 3BB1A 2REOA 3EA0A 4IXNA 4YMUA 2EFGA 3QKRB 2XX3A 2IS6A 5CDFA 4XVUA 1AKEA 2F9MA 3GJ4A 2FPKA 3F3YA 3QKRA 4LJ9A 2DHRA 3SS8A 1EG7A 3RSLA 2ODBA 4DLXA 1Q1QA 1P6XA 1CIPA 2ZE7A 4JVMA 4MKIA 2G0NA 2QSYA 2R8RA 4M9XA 4BFWA 4DLVA 3LRPA 2V54A 1JEDA 2BMFA 3KFXA 1UKZA 3ICQB 4OQNA 4R2IA 5CK5A 3LY5A 1L8QA 1SULA 4Q7KA 2J0QA 2GVZC 1ZD1A 3K0CC 2F1HA 3L0SA 3Q72A 4LBWA 1GSIA 4UNNA 5JJIA 1E2JA 4Q01A 4V0OA 4ESVA 2VP2A 2ZTSA 4LCBA 4P4UA 5EP3A 2YOHA 1VCNA 3T1QA 1R8QA 2QQEA 5CIQA 4YDSA 4E07A 2HJVA 1ZJ6A 3KZ1E 1KOFA 3MJHA 5EE5B 3H0KA 4E09A 3AVWA 2D06A 2OXCA 3CPEA 2AWNA 4DRZA 3H2YA 3QSYA 1A82A 3OFNA 1KSJA 1XCGB 2VSXA 4XTCS 3ZIAD 4DUGA 1G5PA 1VHLA 3T12A 1H8ED 2X1VA 1G8PA 3V4RA 2JA1A 3KKNA 3UG6A 1ZBDA 2NO7A 1EXMA 4I99A 1W2GA 4FWIB 3KB2A 2FEOA 5B2ZA 1OH7A 5CIWA 4WZBE 4RD3A 3TK1A 3IPXA 1G64A 2ERXA 3EWAA 4Q7JB 5FOTA 1P5ZB 1TQ2A 4QBGB 3ZD6A 4IDPA 3WMFA 4L8GA 1ZP6A 1E0SA 1W49A 2F55A 4EFMA 4L4UA 3W90A 1E2PA 5TY0A 3UMRA 4LX0A 1J7KA 5L8VA 3GLHB 1D2MA 3AH8A 5EE9A 4Q1EA 3BBPA 1W0KA 2NZJA 3SQXA 4AURA 3HYRA 2GZAA 5JI3E 1YZUA 4GL2A 2Q3FA 2W00A 2HV8A 721PA 1D9ZA 1Z08A 1OYWA 4DDWA 3AUYA 5D3QA 3FOZA 2IS4A 1OLOA 1YJ5A 2AFHE 4I4LA 3PUZA 3U61B 4NCKA 4EQ6A 1Z28A 4RJLA 2BIFA 3Q8XB 3ZDQA 3GJXC 3L82B 2QG6A 2ZJ5A 3KQUA 3AVUA 2BVNA 5HE9A 2ORVA 2Z6VA 4CIDA 1E1QD 4JLOA 2AD5A 2ZXUA 2BHRA 2QE7D 4IVQA 3WMEA 4AC9A 4EJSB 3UPUA 4FMCF 4F4IA 1XTQA 4JLJA 4EJSA 1OKKD 2BMEA 1OE0A 2RAPA 4UJ5A 4XWAA 1U94A 4URUR 5FL7A 3EPJA 1LF5A 4PZYA 3AF0A 3LQRA 3QXXA 2ZE5A 3GJ7A 5IF9A 5JSZA 4V0ME 3SJAA 5C1BA 1MT0A 4HAZA 3GFOA 1Q0UA 1DE0A 2OV2A 4DEXA 3PUWA 4AKEA 4A36A 2ZSBA 2Q9AA 2X2FA 5J5CA 4R71A 1T3LA 3NKVA 4LY6A 5K8TA 2ZJ2A 2GRJA 4UNRA 4KBGA 1JALA 2ZI6A 4Q00A 3F5FA 1M7GA 2CHGA 2Z4RA 4HSEA 5EE3A 1BO6A 1FZQA 2WJGA 2VA8A 1N3BA 4PXAA 4U7DA 2DFNA 2QA5A 5FUXA 1N25A 1U8YA 2H7VA 2QAGC 2CLDX 4ZV4A 3CBQA 1U2RA 5CM9C 4B33A 1TAGA 3ZQJA 3AVQA 3FFAA 1SVKA 1CF4A 2QENA 1E9FA 2ZSEA 4CZ2A 3DHWC 3G82C 1E2HA 4JT2A 2GK7A 4CVNA 1EWQA 4XWKA 4HZIA 3KXKA 5JLJA 2PL3A 4AKHA 2ZANA 3MUFA 2UVQA 3O8RA 4QGHA 4DIDA 1G17A 1JR3D 4JS0A 3GLFB 1P7CA 1WE2A 3CNNA 1Q3HA 3CONA 4BLRA 5KO2A 3PQCA 3GLFA 1P2UA 5DHFA 4JLPA 5IK2D 1AS3A 2EYQA 1Z6AA 2BBSA 5G53C 4US2R 1EFTA 4LBYA 5CB6A 1X1SA 3A37A 5JCPA 3DEFA 5GVSA 5CJPA 1C1YA 3EW9A 1NSTA 1UKYA 3FDIA 3R8CA 2XOKA 1Q20A 2ZJZA 4LHWA 1AGRA 3B85A 3CR8A 5IDVA 4N3NA 1X8LA 4UXHA 1E4VA 1UAAA 3TMKA 3LW7A 2WKQA 4Q18A 3L8ZA 3RS5A 1B0UA 2IA5A 4JMPA 5EP2A 4RD2A 2O8EB 2ONKA 3KKPA 1KK2A 1W5SA 2VIIA 3PEWA 1R8SA 4GOJA 3PVSA 2O8EA 3THOA 4N0EA 5EE1A 1XBTA 1OSNA 2HXSA 2PMKA 3QKUA 5J40A 3M4YA 4PPGA 3FHTA 3IEVA 1TF5A 1E9EA 4YMVA 3BK7A 2YC2C 4QNMA 1XU4A 2E87A 2RH5A 1Z47A 4ZDWA 3O47A 5SZIA 4JIMA 5HR5A 1XPOA 2ZS7A 2IUUA 3LQQA 4DLRA 5KDOA 4KBFA 2NO6A 4TL8A 1XTJA 4RFVA 5EP1A 1ZM2A 1RYHA 4KI0A 1HH4A 2FOLA 5KTYA 1ESNA 1WP9A 3FYHA 3S1AB 3REFA 1VCOA 3K9NA 1KI6B 2KBEA 3EIHA 3G5UA 3S1AA 1KI6A 1SKYB 4IFEA 4A6XA 2YJTD 2AXNA 2WJVA 1KI2A 3DMDA 3GLGB 4A82A 4D81A 5AUPB 4BLSA 1W7AA 1MO6A 3GLGA 2OM2A 2REXB 2QBYB 4B3GA 1N6RA 1E96A 1OXXK 1OXVA 2ZAMA 3OFND 3GFPA 2GXUA 4DUGD 2QBYA 4CT4B 1H8HA 2K5UA 3OF5A 1ZU5A 3PV0A 3JZAA 3CRW1 2XGJA 3AKYA 1UBEA 4OL0A 4LYHA 2OCYC 2WWYA 3NBZC 4PSAA 2FJUA 2QTVB 5SZKB 1TEVA 1CBUA 3J81k 3AGQA 3ND8A 3K09C 2AXPA 2YWFA 3UKDA 2CXXA 1NJGA 1YR7A 2E9SA 2F9LA 4WXPA 3TSZA 3AVVA 1A5TA 1LFDB 1ZD8A 3QEJA 2IHBA 1IY0A 2P5TB 4UNQA 4DDUA 2IYWA 5M04A 2Q9BA 2FU5C 2XITA 5IHPA 4B35A 2QP3A 3TQFA 4NKRA 3O8CA 3NDBB 2CVHA 2PEZA 1YR9A 221PA 1OH8A 4Q19A 4Q9HA 2IEZA 3UANA 3OIYA 1UKVY 1ZW6A 2D62A 2QMOA 2ZITA 3T5GA 4A0FA 1G291 2H57A 2WIBA 1IJFA 1E6CA 1N6PA 3T5DA 3AV0B 1DG1G 1OFUX 2OFXA 5FBLB 2RB4A 3C4JA 2R2AA 1P4SA 4O0MA 2ZYWX 1E1RA 1L4YA 4WXRA 2O5VA 3WNBA 4ASUA 5JI2E 4BFVA 3BH7A 2ATVA 1NJFA 4B75A 1YR6A 4CEIB 5JJKA 2ODNA 3JVVA 2BV3A 1BH2A 1LS1A 1SXJE 4CEIA 2IS2A 4LC1A 1XEWY 4U00A 3HWSA 5BQ5A 2A5DA 2HF9A 3FMOB 4CF7A 5FL7D 2VP6A 2V1XA 3DOEA 4LHZA 2IS1A 2ECKA 2YC4C 1ZUNB 2ZJAA 1K5DA 4IXMA 3K1JA 4POAA 4A0HA 1CJMA 4HB2A 5JECA 4KODA 4BQSA 1WBDA 2ZJYA 3P32A 3O8BA 1TEXA 2ZR9A 3CRQA 3CX7A 4M53A 1CR4A 1T3HA 6Q21A 4MRNA 5LD2B 1KAOA 1KDOA 2ZAOA 4FI3C 5JS8A 2MSEB 4DCNA 2WWWA 2FPLA 4D80A 4C4PA 1IXSB 2NIPA 3AVPA 5DGXA 4ILEA 5J4YA 1JXOA 1P72A 1T0JB 1WXQA 4NYIR 2HJGA 2HCJB 2FA9A 1HTWA 1II0A 1ZCAA 3GJ8A 2WKRA 4D0GA 1AK2A 3EPKA 1IXZA 2D74A 2V6IA 2WZQA 4LOAA 5FOWA 1N5KA 2CCGA 4AIIA 1W1WA 5GJCA 4MDEA 4A6PA 5FUYA 2G9NA 1QDEA 4MUBA 1NKTA 5DN6A 2V6JA 1GILA 3MJRA 1KO4A 5FUVA 4GP7A 4PHHA 4OQFA 1Z2AA 1E79A 1NBME 1OPXA 5FL3A 1KGDA 1W4RA 2R6AA 5AJXA 4M21A 2AWOA 3CF6R 3CH5A 2OG2A 3T1OA 1D2NA 2JJ1A 4R9UC 3A1WA 3BORA 2L0XA 4B74A 5FTLA 5F9HA 1A7JA 4NTZA 1L4UA 1Z0AA 4ZO4A 4C0QC 1OIXA 2XOKD 5CYOA 3DZDA 1XXHE 4DLWA 2BOVA 2GXQA 3IHLA 3ZVRA 2AK3A 2HCBA 2HLDA 1G6OA 2GCNA 4KFSA 3LW8A 5FOSA 1VIYA 2BKEA 2F3RA 4W5JA 1NVVR 2YV5A 3ZS8A 1MH1A 3K9HA 1IONA 3GEHA 4F91B 3WRYC 3DDCA 4PO8A 1GL7A 4DLTA 4U02A 3W8RA 1CEEA 2ZI5A 5CB8A 2AK2A 2PCJA 2O0KA 2BM1A 4UKDA 4EKDA 3THXB 1NKSA 2C03A 1YZTA 3HR7A 4WVFA 1ZIOA 3EZ9A 3THXA 1KI3A 4KSBA 1H65A 4OI0A 3SOPA 3X1YA 3C41J 4C0JA 1CJKC 5B64A 3TVDA 2ZSDA 4HDQB 2IX3A 1S9DA 4P3YA 3V9PA 1NNEA 4C2UA 4NDZA 3UMFA 4IW3B 2J5XA 1NN0A 3DVLA 2YWHA 4G3XA 4ZDJA 2WMOB 1S1CA 1KO1A 1N5IA 1BKDR 4NZYA 1UF9A 3ZVMA 1H8HD 1YE8A 1M6NA 2PCLA 3OEHA 2A78A 2VHCA 2Z0MA 3EC1A 5IRCD 2EVWX 2G6BA 4R98A 1S96A 2V7QA 3E70C 1E2MA 3TJZA 1U99A 4NBSA 1HEIA 3IEUA 2FFBA 1NMZA 3C5CA 4EUNA 3VNVA 4X8HA 4YC7A 2W2XA 4OQMA 5J4LA 2XB2A 2WICA 4GMDA 1BOFA 3D6TB 4B43A 4LBZA 1G3RA 1VG1A 3L2OB 3ZIAA 3I92A 4TLCA 2J45A 3ZZUA 4Q48A 1A2KC 5BWMA 2A30A 4A1FA 3Q7PA 4DCUA 4PQRA 1AZTA 2RGAA 3AKEA 1RYFA 4NYJR 2PX0A 3LBHA 4PFSA 4BGDA 2XJ9A 4PAOA 1OXSC 2B92A 1M2OB 2AKYA 2AL7A 3MD0A 3A8TA 1KAGA 2OT3B 1RW4A 5AJZA 4WBSA 2I3BA 2VPPA 2PLRA 1UFQA 3G0HA 4YONB 1OYYA 1XJCA 2PT5A 3BS4A 3CRRA 4AYWA 3ETLA 1E1RD 3GJ3A 3DM9B 1RPZA 3BERA 4DC9A 4ASUD 2YHSA 1XP8A 4QBFA 4CEHB 4B3FX 5CJ2A 1O3YA 2FFAA 2YNMA 3KJIA 1DAFA 4CEHA 4TLDA 5FBVB 3QKSB 3CB4A 2DWQA 4LJAA 1E99A 3QKTA 1GWNA 3QKSA 1XNJA 2OZEA 5JEEA 1O87A 4WOPA 2XB4A 4LYFA 1N5JA 1G18A 2ZE8A 2JLUA 3MRSA 5TB5A 2WBLC 1XB2A 4NH0A 2V4ZA 3Q7QA 1CRPA 3HU2A 2DBYA 2ZQ5A 2QSZA 1OFIA 1ZC3A 3AKCA 3B9PA 4RZ2A 421PA 4OI2A 4PTLA 1XZQA 2H16A 4JBWA 4W5WA 1NG1A 3RRMA 1DAHA 4GZLA 4H1UA 4KLNA 1N6HA 1HQYE 1R0ZA 3N2EA 2QT0A 3RYTC 4D2IA 5J47A 1C4OA 2BJVA 1ZNWA 3EZ6A 4DT1B 1PUIA 4QGAA 3W5IA 2FGJA 4HLUA 4D4MA 3U44B 3GMTA 2JLXA 4DT1A 2GF9A 1MRNA 2NG1A 2QPOA 1G5RA 3QEOA 3U44A 5BXQC 2ZJBA 1Q44A 1G3MA 1AS0A 3VMFA 2I1QA 1XTKA 2CCJA 2GESA 2A5FA 2QMEA 3KFVA 3UG7A 2RGCA 3TAHA 2FFQA 4GFDA 3V4FA 1NSFA 2QEQA 3LH5A 5AUOB 5DN6D 2J3EA 1JBKA 3ZVLA 1SKQA 1DVRA 4URZR 1E79D 2ZRPA 4EPTA 5DH9A 3X1ZA 5EXTA 5EXPA 3WXMA 3SHWA 1GFIA 3IBGA 1WRBA 4NE2A 1Q21A 2GHIA 2GZHA 4WZ6A 2JATA 5B30A 4LSGA 3HPQA 1WMSA 2JJ1D 3PUYA 2CLCX 5FBQB 2C04A 4YQFA 3U7EB 3SU8A 4ZPXA 1KKMA 4TTQA 3WYAA 1W44A 2F1JA 3ECCA 1YRAA 2X2EA 3CO5A 3ADCA 3HJNA 1Z0KA 3B6EA 1ZIPA 2ZRHA 2P3SA 1DG3A 3NIBA 4EPVA 2X8AA 2IYSA 2HLDD 1WQ1R 4H1VA 1G7SA 2BBTA 2QTHA 1NIJA 5HTKA 4CYMA 3U60B 4V0MA 1E2LA 1V43A 1YHNA 4F4JA 1W47A 5LD2C 4KFRA 1WBBA 5FPSA 3FMIA 3CNOA 4KU4A 2ZRNA 2VHUA 1R7RA 1U8AA 5LB4A 4Z8XA 4Z8YA 4QKQA 5KYKA 4X8MA 1QHXA 4B47A 4O25A 2RGNC 4R2HA 1MRSA 3CPHA 3SJZA 2SHKA 1W46A 4LPSA 5FR1A 3BH0A 4ARZB 3IILA 1OH5A 4WAUA 3WBJA 1KI1A 1F48A 1ZAKA 2A9KA 2R6DA 4ARZA 3RC3A 4XTRA 4Q9IA 2YOGA 3HYTA 2XZLA 3A4MA 2F3TA 2JIZA 3NVAA 3PUVA 2A3RA 1GDDA 4OHWA 3SYLA 5LDDC 4Q1BA 4PC6A 2J46A 3QQ5A 1U90A 3QBVA 3VR1A 1W36B 3WNCA 1LY1A 1U9IA 2IXFA 3OEHD 4TN1A 2LKCA 4E03A 1MV5A 3MCAA 1L7VC 3DOFA 2GXSA 3ONWA 4RFSB 2V7QD 4JT4A 4P31A 4WIAA 4MYTA 4PC3A 1G16A 3BH6A 4DLYA 4RFSA 1E32A 1KKLA 5KPDA 4LZZA 1XMVA 3C16C 3IHWA 1R2QA 1I2DA 2C9YA 3CRMA 1OFTA 1Q3TA 4HAXA 1EGAA 1BYUA 4MRRA 821PA 3LX8A 1JEEA 2P6UA 4FMDF 4HLDA 2FH5B 2NPIA 4QOSA 1GKYA 1T3SA 3UATA 3SZRA 1E9BA 2NZ8A 1SGWA 1FPMA 2CBZA 3KKOA 2QI9C 5L3SB 2J0VA 3QXHA 3NH9A 4QGGA 1ZM9A 3W6OA 3NXSA 5L3SA 2OBMA 5CK4A 3KL4A 1UKEA 4DLSA 5JZVA 5KU1A 4NCIA 4RKEA 5LPNA 2Q3MA 3ZJYA 1PLLA 2QUZA 3BJIC 4XSHA 1KNQA 3K0FA 1Z6XA 2W58A 2ZROA 3LXXA 3H86A 3UWOA 3VKHA 4IFBA 3MWLA 1X3SA 2CEAA 1LW7A 3ZGXA 3QXSA 1TNDA 1XFAA 2C95A 4BECA 2JLRA 1UBCA 3RLFA 4MDFA 5JHHB 2HF8A 2W2TA 3IDQA 2VTKA 2WJHA 4A2WA 3MWKA 3ZZTA 4FCTA 3QVUA 1AZSC 2C9CA 3NG1A 2RHMA 4A9AA 5E3HA 4OYHA 1S2MA 4FWTA 2UKDA 3BAFA 5H8WA 3B8HA 4TSFA 1COWA 2AX4A 4CW7A 2H92A 1E2NA 1TF7A 2O8DB 4EQ6B 1WA5A 1FQKA 4M9ZA 1QG4A 2WSMA 2O8DA 3PUXA 3SEAA 5FPHA 2G77B 3LV8A 1ZC4A 3P4XA 1RKBA 4V0LA 2WIAA 5HZKA 1W5TA 3QBTA 1T6NA 1KI4A 2ZRLA 2ZRAA 2EW1A 4BEBA 3AF4A 2C5LA 2KI5A 4KAXA 4P4SB 4ZCMA 1GL6A 1CRQA 4TMKA 4P4SA 1UBFA 3OAAA 4P4TA 4YXWA 1TQ4A 2ZYUX 1JXMA 4UNPA 4L5BA 5ANRB 4AD8A 2OCBA 3BD9A 3KX2A 4KCGA 5JSZB 3BFKA 3ADBA 1AM4D 1RRGA 2ZRCA 2FN4A 2QMHA 3EG5A 4NYMR 2KWIA 2G88A 4Q03A 1DAMA 1JAIA 2FV8A 2VP9A 2J1LA 3QXJA 4JBXA 3IIKA 3SNHA 1GZSA 2HUPA 4V0NA 4A8JB 1KY2A 3HP1A 1UEIA 1QBKC 1DO0A 4HB3A 4A8JA 2G1JA 4TYPA 4BLQA 2OCAA 2GNOA 5EZ6B 1M8PA 4JJKA 3SI7A 4DEYA 1YZNA 1Z3IX 4TWZA 4U5XA 2ZJOA 5UKDA 4O2RA 3OE7A 2XJ4A 2ZE6A 2FGKA 3SHFA 3ADDA 4BFSA 4OI1A 2PBRA 1IAQA 3TUJC 2XTNA 3TAUA 1YVDA 4TYQA 3KTAB 1GP2A 3N2IA 3BWDD 4XIGS 1L2TA 3KTAA 3W9YA 3QF4B 2X19A 4G5QA 4DB4A 1SXJB 1V5WA 3TGPA 3QF4A 1UM8A 4HAYA 1FOEB 1VPLA 4D4KA 1SXJA 1DBSA 3VQTA 4LUCA 1S4QA 2WJIA 5KUTA 3QG1A 4GBMA 2FZ4A 1VG0B 4Q9KA 4LJ6A 2ZRKA 3TRFA 4TMXA 4ZCLA 5CDFE 2C9OA 4A15A 5H1YA 3SR0A 4C0AC 3SYKA 3PIRA 1P2SA 4Y0AA 2VF8A 4ZDKA 1XTSA 2CVFA 3CKLA 4Q7MB 2IXGA 1E9DA 2F1IA 3KJEA 3VR2A 3PG5A 1GRRA 2OHFA 1PZNA 2OSBA 1AA9A 2OESA 4HLUC 4M1TA 4PZZA 5J4KA 1ZM3A 3C5HA 4MKGA 1FW6A 1R0WA 5G3ZA 5KSZA 5DISB 2GEUA 5FI0B 5TARA 2CCKA 3A58B 4PZLA 1GUAA 2JJ8A 4UXIA 4QJ3A 1SVLA 2O8BB 1ZNYA 1ZRHA 3CRVA 1BMFA 2BBOA 2IBMA 1A2BA 2O8BA 3QJYA 4LBVA 1MABB 1HE8B 4HZUB 1R5BA 3PFIA 4JLAA 4M0LA 2H17A 3B1WA 1MABA 4NCNA 1SQ5A 4HZUA 4TLBA 1P60A 4YLGA 3W6NA 1GOTA 5FOXA 3CZQA 1GVNB 1OH6A 2WOOA 2GF0A 2ZRBA 4Q02A 4I1VA 1S9HA 1MOZA 2JIZD 2G83A 3OHMA 5EXXA 1MR3F 3KQHA 1KZGB 1FP7A 3X2SA 1T5LA 2GCOB 3THYB 1NBMA 4QRHA 4Q7LA 2GCOA 3THYA 2ZR0A 2ANBA 1S3SA 3I1FA 1W36D 1QHYA 3I32A 4DSUA 4KO8A 4OJQA 4QNRA 5F9FA 4C30A 1E2QA 1KDPA 3BE4A 3C15C 3UWKA 2NPFA 1F2UB 2WAXA 3T06B 2QROA 1HT2E 2PJRA 1XXHB 1F2UA 2AHOA 3RS7A 1BIFA 2O8FB 3SFVA 1XXHA 3AF3A 3BC1A 5JWRA 4AYXA 4ZCIA 2QPTA 2O8FA 4DVGA 1KZ7B 5EZ5A 5AWFC 4Q1DA 1FUKA 4DSTA 4RD6A 4FCVA 2CL6X 2XNDA 2HYIC 2JJ2A 3U3OA 2AD1A 2WVJA 3GLHE 1E0KA 3OESA 2C2HA 4RY2A 3ICEA 1D2EA 1X1RA 2QRNA 3LVRE 1JPJA 1P75A 4MKHA 4B3XA 3U7FB 1U81A 4OHZA 1KK3A 1SVOA 3B60A 4TTPA 2WJJA 1P61B 4KLZA 3C14C 2V3CC 3AEZA 1T91A 2WPDA 2GEDA 4W7SA 4F93B 2PZEA 4BE7B 1SVSA 1XD2B 4UXJA 2BDTA 2IC5A 3V00A 1XD2A 4IHQA 1F2TB 2ZYVX 1D6JA 3FFBA 1JQLB 3CR7A 1G8FA 2IYLD 1F2TA 3IGFA 3TSOA 2BM0A 3BFXA 4OK3A 4Z51A 1IOZA 2V9PA 521PA 4B3DA 1KSFX 4P32A 4IVRA 4FMBB 1COWD 1EX6A 4JKYA 4TSFD 1LNZA 3CM0A 5FTMA 1U9IC 3U7GA 2ZRDA 2P0EA 5HE8A 5TMPA 2OO7A 2FG5A 3UIEA 1M34E 4LK2A 1OIWA 5H70A 3TLXA 4C0HA 1CR1A 1P9RA 2GWHA 1ZUHA 3I8XA 3ZVNA 4FMCB 1CR2A 2W0SA 4JYCA 1TQDA 3TBKA 2CK3A 3E5HA 3ND9A 2J0SA 2JAQA 4JVLA 3OAAD 4EDHA 4YXWD 5KPJA 1OT3A 3F0TA 4JLKA 4AI6A 5C18A 3UXMA 1N6NA 1Z29A 1RRPA 1ZD9A 1PV4A 4RD1A 4OK5A 4Q1CA 3K8YA 2WAYA 4QJ5A 5JBQA 5DYGA 3EXAA 1J8YF 2FF7A 2GAOA 2BCGY 4MYHA 1IY2A 5JHGB 3U5ZB 4D0NA 4C3ZA 3Q5DA 4DIEA 4HLCA 4Q66C 4QM7A 4EFLA 1OW3B 5FBWB 4HUTA 3WHLA 2FMXA 2BMDA 3ZQ6A 4MYUA 3OE7D 1F6BA 2A2ZA 2XTMA 3C8UA 4GNKA 5FPTA 5AK0A 3TSWA 3W6PA 1XZPA 1TU3A 2ZS8A 2OE2A 3AF1A 3KUDA 1XMJA 4NYIQ 4XVRA 2IEYA 1X8JA 2ZI4A 2JLQA 1EFCA 2I4IA 1GG2A 1YU9A 1OV4A 2BCJQ 3M1IA 1XCPA 2GJKA 2NO1A 2BMJA 1P3JA 4EPWA 2B6HA 2Y8EA 3GP8A 2WTUA 3VKGA 2ZI7A 3QOFA 1SXJD 5JEDA 3RAPR 1FMJA 4L9SA 1E69A 1US8B 2DPXA 2ZU0C 3BIFA 4M8NE 3GJ0A 4QG7A 3DL0A 1US8A 621PA 2V8OA 2WWFA 4Q9LA 1NIPA 1MO4A 4KJZA 4BEJA 2B7BA 4IOKA 4EJSC 1Z06A 3FMPB 3LLUA 5AJVB 5EE0A 3LDAA 3GCGA 4EAQA 3AVOA 1I4DD 5EUMA 1VDZA 4HUQA 4WW0A 3A1SA 4Q1AA 3R8FA 5KDDA 1TTTA 4GDFA 2KJQA 1VECA 4B76A 3GQBA 4AG5A 4JKIA 3TR5A 3UK6A 4DJTA 2GJ8A 4ZDIA 1FUUA 3CZPA 5FR2A 1HY3A 5GJBA 2FSIA 2IYYA 5BYKA 1BMFD 2VLIA 1XF9A 1RJ9B 4PANA 4A8JC 5ELXA 2ZM5A 3L0OA 2GJAA 5EP4A 4M4SA 1RJ9A 1NVVQ 2QP9X 2BWJA 5E95A 1SHKA 1E0AA 2ANCA 1R0XA 1R0YA 4JL5A 5EUQB 1XEFA 1IN5A 1IY1A 1G3IA 2LCFA 1SKYE 2J0UB 2VYFA 2IUSA 2BKUA 2C8VA 2YKGA 3EC2A 1DEKA 2J0UA 2YVUA 4CGZA 3KKMA 2KBFA 5AJYA 1P62B 1EX7A 2OBLA 1UDXA 4BLOA 1KO7A 1TUIA 2ZRIA 5KSOA 2F7SA 1ZU4A 2ERYA 1NBMD 1LS6A 3P27A 4LI0A 1QG2A 2FE4A 4PSVA 5FTKA 2OCPA 3VNUA 1ZM4A 5DNYB 2DYKA 3L8YA 1ZYUA 1B23P 4PHFA 1WB9A 2F1RA 3LX5A 4NMMA 2EQBA 1G8GA 3K0EA 2C99A 4S35A 4LHYA 2REBA 4LJYA 3B82A 1Q1BA 1KIMA 3KJGA 5A4JA 5JCZA 5K8LA 1X6VA 1PVOA 1Y63A 4XH9B 4JLBA 4B2PA 1U8ZA 4XWOA 5KNDA 4K81B 4WA7A 2Z4SA 1Z6GA 3R9WA 1W4CA 1HA3A 2GJ9A 4DKXA 4M1YA 1HE1C 2P6NA 4RKFA 5P21A 3OIWA 3D31A 2XNDD 2JJ2D 3K53A 3PCRB 3PR1A 3U3RA 4BUJA 1RIFA 3RVBA 1XX6A 4GOXA 1KHTA 2IF0A 3ZD7A 4ZKDA 3T61A 1TUEA 2WSSA 4TL7A 5GJWC 1E9AA 2VF7A 3OEEA 3AB3A 2ZI3A 4ZIRB 1E2GA 1YZQA 3EPLA 1TPZA 1Z0JA 2WPDD 2GKSA 4PO1A 4ZIRA 2AKAB 4Q1FA 1T9HA 1KSGA 2EWWA 4Q4JB 4F7WA 5D3MB 1TMKA 4G5OA 4Q4JA 3PEUA 4GP6A 5D3MA 1KI8A 2DCUA 1VKJA 2JDIA 2N46A 4NYJQ 3QI2A 5LB2A 3ZZ0A 1IBRA 3PXGA 4JLNA 4M2LA 2ZREA 1NN1A 2P2LA 2A5JA 2PX3A 1Z5ZA 3TW4A 4K46A 3EZFA 1GM5A 1HQCA 1WDTA 3NBYC 4KYIB 3GFTA 2DFKB 3QE0A 5HPYB 2D4HA 5FI1B 2GA8A 3M0EA 2OXRA 2QM8A 4BPBA 1N6IA 1P2TA 1ONBA 4BRUA 4XSGA 2PEYA 3T1VA 2CK3D 5DI3B 1N0WA 4QL3A 5JJLA 1PLJA 4XOIA 2Z83A 5DI3A 1GKUB 1F5NA 5HKKA 5C4MA 1ANKA 4ESHA 3U2QA 2I1VB 3RS3A 4G5GA 4LV8B 4HI0E 1ZMXA 2WWHA 2CE7A 1RFLA 4JZKA 2XNSA 3VAAA 4ERNA 2CDNA 1R6BX 1NF3A 2ZVQX 3B1XA 4OQLA 4TMVA 3SBDA 1VYVA 5B57C 2PZGA 1K8RA 3SFZA 1KMHB 4TQUS 2PLFA 2IWHA 3TKLA 3GLIE 3WMGA 2QAGB 1JJVA 4PHGA 4B2IA 4GZMA 4ZI3A 3A1VA 3H84A 4X8LA 1KMHA 1TF2A 3SDZA 1DADA 2ZUBA 1Z63A 2D2EA 2QAGA 3VR4A 1ZVQA 1TX4B 1NLFA 2PMDA 4M22A 3EX7C 2IYTA 3AP1A 1XWIA 3QENA 1GNQA 4EPRA 2Q3HA 4C0KA 2FSHA 5KDLA 5BW8A 4JLVA 1EFRA 2A5GA 5GADl 3IQXA 1LTQA 1G3UA 1E3MA 4HYYA 1XDBA 5FPYA 2QORA 2WKPA 4DCTA 3WRXC 4TQ9A 4C7OB 3TVTA 4AY2A 1HV8A 2YWEA 1Y3AA 2VEDA 2ZSFA 3BRWD 4MKFA 2GBLA 4C7OA 2IL1A 2DFTA 5CLLA 5FTJA 5EXSA 2JGNA 4HDCA 1W4AA 3E1SA 2GAAA 4MRVA 1PUJA 4KXFB 4UJ3A 2XZPA 1XMIA 2OLJA 2RGXA 1G19A 2BJWA 3AQ4A 3LBNA 1E2DA 2VRWA 4NU0A 4P33A 1HT1E 3LXRA 2Z5FA 4Q47A 3OIUA 4Q4LA 1G6HA 1Q22A 3MWYW 1CJUC 1EWRA 1KK0A 3CPJB 3LLMA 3NC1C 4I81A 1OJLA 4LYAA 3TH5A 2J59A 2DWOA 3WYGA 4OBEA 4JJZA 4PHTA 3D3QA 4V0KA 3TUZC 2EWVA 2NMVA 3CF2A 3TUIC 2IYXA 3KUCA 2NO0A 4CT5A 1AQUA 3MMPA 1S3GA 1NMYA 2ZSAA 3X1WA 1QRAA 5KNCA 3EZ7A 3SBEA 4FD2A 4KITB 1NG9A 2DB3A 1C9KA 3Q85A 1E9RA 3FWYA 1RRCA 3LWNA 4URYR 3AP2A 4DWJA 2OAQ1 1J2JA 1NVUQ 4IEIA 4D4JA 5JRZA 4OK6A 2A7QA 3SQWA 4FN5A 4IEEA 2JLZA 1ESMA 2Z43A 3K0SA 2VHQA 3FHCB 5L3QB 5J4VA 1YQTA 4ZI2A 3TE6A 5K8UA 1M7HA 3RRYA 3U3JA 1W2HA 5L3QA 2WWIA 2WWGA 2QGNA 1RZ3A 2AN9A 4HAWA 2W6IA 2WJYA 5E7IA 1Z0FA 1G41A 3L0IB 2CJWB 3W5JA 4GMXA 2P67A 3VKWA 3B9QA 2CJWA 4HAUA 3KJHA 3R20A 3CW2A 4Q9JA 3I62A 1KO5A 5BN3A 4HEJA 2J7KA 2VBCA 2VP0A 3QUSA 3WBKA 5F3WB 3CWZA 3KKQA 1JPNA 2Q0HA 5E7MA 2V1UA 4QM6A 3R7WB 4QHYA 1I4TD 3KXIA 1G9XA 5DLQC 5G3YA 1G21E 4YMWA 3QF7A 4TMWA 3R7WA 5A5GA 4JVNA 3NHAA 4URVR 2QRZA 3K09A 1XRJA 2ZS9A 3DO6A 2JLWA 3NTUA 2N1BA 3KXLA 1KJWA 2VP4A 3IIMA 1U0JA 3NBXX 4TYWA 4LYJA 4TMZA 2WV9A 3NHBA 2VHTA 1P9WA 3IBYA 4GT1A 4TQAA 1NY6A 2WSSD 2P65A 1MO5A 1E9SA 4L15A 1P2VA 3W3ZB 1KDRA 2EFHB 3OEED 2FZLA 4EPXA 1GKIA 2RCNA 3VR6A 2CL0X 4BFYA 2E1RA 2MMGA 1I2MA 1GAJA 5JWHA 1BS1A 4HATA 4TYNA 1N6LA 4Q4AB 2EYUA 3B1YA 4PPNA 3EPHA 1KJZA 3HDTA 3BFVA 5GVRA 4MH0R 1AQYA 1SHZA 2JDID 2WOJA 2XTZA 4JSTA 4Q4AA 3T15A 4D25A 4YMSA 1IN7A 2ZRMA 3WP0A 4LPKA 4LHXA 1DO2A 2GDJA 3K0FB 2XEXA 4TMTA 1PLKA 4PX9A 2ATXA 2ZETA 1XEWX 4BFUA 5BN5A 3VHXA 2XSZA 3SC3A 4V03A 3HU3A 4G0NA 4BZQA 4C0LA 5BN4A 1GTVA 3P4YA 3BGWA 5IT5A 1GNPA 3U6KA 1OB2A 2VL7A 3M6AA 4MA4A 4B73A 1JI0A 1E2FA 4R7ZA 1MKYA 3MAAC 3B1ZA 4HDOB 1VMAA 2LWIA 2VSFA 1U0HC 4US0R 1XCMA 4NHOA 5DE3A 4C2TA 2YOFA 4FCWA 1NVWQ 1F3OA 3X1XA 2FWRA 4ABYA 3FVQA 4OHXA 1LV7A 4EPYA 3CH4B 5HKKD 3AM1A 5LBIA 4B48A 3T1TA 1GRQA 5C2JB 4JL8A 2C96A 4DDTA 3EASA 1ZNZA 3WNDA 2QU8A 1TQ6A 3R9XA 1M74A 3GEEA 5F98A 1S0UA 3VU9B 1IQPA 1OHHA 1Q1EA 5KSPA 4ACAA 1N0VC 1CU1A 1VTKA 3I3SR 3I72A 4II7A 3SJCA 3VU9A 1RC8A 3E2IA 1T8TA 4OHYA 4IJMA 3KQLA 3GLHA 4RCZA 1QHHB 4G1UC 1DS6A 2HEIA 1IXRC 2BC9A 3I5XA 1P73A 1CP2A 1Z6TA 1E94E 1QHHA 1IN4A 4OQXA 4UNSA 4Z54A 5JMTA 3LFUA 5JRJA 4HAVA 4QC2A 1LB1B 4I1SA 2R44A 1EFRD 3FKSA 1Z6YA 2P5SA 1EFUA 2B21A 2HDNB 3TR0A 1YZKA 4ON9A 3FGNA 3WY9A 4NYMQ 2QTFA 4KYUA 1Z07A 1E0JA 1ZCBA 1G8YA 1N6KA 1OIVA 3MLEA 2GCPA 3JVUA 3B2EA 4A2PA 4MUAA 3QXCA 1AJEA 1G4UR 2R65A 1AGPA 2EFEB 2YYZA 4CRWB 1JR3E 2ASEA 4PR0A 1DAKA 1IJEA 2RGBA 1W0JA 4PQYA 2TMKA 2C77A 3LNCA 4LJ4A 3VR3A 2G1KA 3CX8A 1CULC 4Y0VA 3I5YA 2QAJA 4MGYR 4N0DA 1NVXQ 4LHVA 4PPFA 5FTNA 1JR6A 5EQTA 3B1VA 3PEYA 4AG6A 1TL7C 2GVDC 4AK9A 2WMNB 3AGPA 3CIOA 2CL7X 3ZLJA 4MITA 3WHKA 2B8WA 1N0UA 3RDPA 3EZ2A 4YMTA 3A1TA 1FL9A 2R6GA 2QY9A 3HPRA 2W2VA 2CNWA 1JQJC 3FPAA 3AF2A 1II8B 3AUXA 4MRSA 3UMSA 5G41A 1JJ7A 1XJ0A 1II8A 4AYTA 2EFCB 4M9QA 1XEXB 4MYCA 3GEIA 1IM2A 1XEXA 4BASA 3GPLA 5DYIA 3A6PC 3FTQA 3PENA 2CMKA 3VX3A 5GJVC 4OI4A 1KI7A 3VHLB 2W6ID 2ZEJA 3WYFA 3BXZA 4A0RA 4DLUA 1G3QA 1XJQA 2R6CA 2R62A 2GBLC 3AKDA 4IDNA 4J0QA 4LJ7A 1LVGA 1IN6A 4E5UA 4PO9A 4PAQA 2RMKA 3CLVA 3TNFA 5F2EA 1JB1A 2G0TA 3CX6A 4BFXA 1OFHA 4JL6A 3H1TA 4M1KA 4RCYA 4BWYA 1R10A 2IYZA 4QJ4A 4EIWA 1UBGA 2KB0A 1DELA 1KJYA 4A2QA 2IXEA 4AKIA 2LKDA 2HXYA 4B3CA 1MO3A 3RRZA 1HYQA 4MGKR 5FOUA 1X8KA 1OXUA 3AVYA 4G01B 4L9WA 4QBHA 3FKQA 2F43B 4Z1MA 1DAIA 3LVQE 5DIFA 2F43A 2HYDA 3EWSA 3CF0A 3SJBA 2BEJA 5C46F 1A4RA 1E98A 2DR3A 1XMSA 4DDVA 2QN6A 2CHQA 1EK0A 3IO5A 4FMDB 4DXAA 5J4HA 1VCMA 1J70A 2N42A 4X8OA 5JWOA 2DFLA 4A92A 1DAEA 3B5JA 1GNRA 3BB4A 1DAGA 1T5IA 2QL6A 4LRWA 2D2FA 4IOMA 3QVVA 4ITRC 3U4QB 2D7CA 4S2EA 5TVKA 3ASYA 4XD7A 1N5LA 4TZ6A 3U4QA 4KVGA 4WZAE 1G5TA 2W6JA 3Q9LA 1ZNXA 2QT1A 3PJRA 1M1YE 3EIQA 4TLAA 2F6RA 4DSOA 2GK6A 2VO1A 3L0PA 3U6BA 2UZIR 4A0GA 3FHOA 2JLVA 2ZUCA 2XSZD 4ACBA 2ZRFA 3KQNA 3IPYA 3HR8A 1YR8A 5L3VA 1JNYA 1NY5A 3N70A 5G40A 2ZRGA 3K9GA 3RS4A 1VHTA 3KDSE 4GSYA 1BYIA 3EA5A 1DARA 1UEJA 1QHSA 4US1R 1VG8A 3OIVA 2ZRJA 5KNBA 4GOKA 4DCVA 1KI9A 5DI9A 2ZI9A 1DOAA 2ZR7A 2GTPA 4UQOA 2QNRA 1W36C 1AN0A 2WWXA 3DKVA 3IQWA 1D8TA 2ZVPX 3PEVA 1OHHD 1YZGA 2JLYA 1UJ2A 1FMLA 5TV2A 1KDTA 2IW3A 3CUEF 2J9RA 3EARA 1NN5A 1D5CA 1Z2CA 4IRUB 1Z0IA 4M9SA 1W0KD 4TT3A 3X1DA 3I4LA 3B7GA 5B58C 2FX3A 2YINC 4IKEA 1II9A 1Q1ZA 2RKOA 4K8OA 5AUQA 5AR1A 1CJVC 1S8FA 1XTRA 2IYQA 4TLEA 2FSGA 3LAWA 1GL9B 1SZPA 3A4NA 2H8KA 4IDQA 4KVAA 4B3BA 2O0JA 1OF1A 3B78A 3FKSD 2D7DA 1E4YA 4OKSA 3RSOA 4H9GA 4JBYA 2Q9CA 5E4FA 2RGEA 1KYIA 3NEJA 2OFWA 2NTYC 4LV6A 4N1AA 5CM8B 3DPUA 4A4DA 1NN3A 1KSHA 2ZPTX 1QF9A 4BFTA 2G3YA 4O2LA 4M1SA 3O8DA 3AP3A 1ODFA 4Q21A 2PJZA 4LJ5A 3ZYCA 3EIEA 4D4LA 2BEKA 4KFTA 5BYJA 4B6EA 1R5OA 5CYPA 3T34A 3TW8B 3GJ5A 1WCV1 3GJ6A 3QPUA 2ORIA 4C0SA 4DCSA 4PPQA 2R9VA 5AUNB 3ADKA 2JASA 1W0JD 1FTSA 5EJEA 3GLFE 2J7PA 4QFMA 1JECA 4PAMA 1QHGA 2NO9A 3A4LA 5DHAA 2VP5A 4URWR 5JFGA 2GZDA 3EAQA 1OXTA 1M7BA 3I8SA 2QP4A 1ZINA 1J90A 3K70B 5KOYA 2IUTA 5FBRB 2FFHA 1NLZA 4LGMA 4LJ8A 4B32A 2ZYTX 3W34A 3LD9A 1SVIA 4IOJA 5TDHA 4BZPA 4DLZA 2KE5A 3DKPA 4W5HA 2CNWD 1VCIA 4IVPA 3IO3A 1VG9B 2QM7A 2OILA 4HUQB 3GLIB 2JCSA 4DZZA 3A36A 3LA6A 4PQFA 3ZS9A 5FUWA 2OBNA 2RGNA 5JS7A 1KMQA 1NMXA 1T8UA 3SN6A 3GLIA 3TQCA 1FQJA 2EFDB 2WHXA 4C9BA 2FSFA 2NGRA 1CKEA 1QZXA 2KSQA 2O52A 5C4GB 1KO8A 2IF2A 2FDCA 1G20E 2IYRA 4G5RA 4I1UA 1E9CA 3TIFA 3QG5A 4KHZA 1GRNA 4RZ3A 3U7HB 1FNNA 1XD9A 2J87A 1CLUA 4OHVA 3QY0A 2IYUA 4F92B 1RVDA 4RD0A 4P0TA 3REGA 2RGGA 4D82A 1JAHA 1E2EA 1GIAA 3P26A 1AKYA 2XAUA 1KK1A 4ZKEA 1AIPA 2PT7A 3K0CA 4DSNA 1CS4C 4MRPA 2ODWA 121PA 2NOAA 3GLGE 2XXAB 4DHEA 1VYUA 1XPRA 4QXAA 2H1LA 2XXAA 2DY1A 2AFIE 2AR7A 1Z8FA 3HU1A 3QIAA 4B34A 4XVQA 2QPAA 1I4LD 1FP6A 3JZMA 3L43A 4TL6A 2ONJA 3SYNA 3NDPA 3U3KA 4CDGA 4Z1MD 1IN8A 1SXJC 2Q6TA 1EESA 4D0LB 4GPTA 1R5NA 3QNUA 3QPVA 5DO9A 2IHYA 1ZUIA 1D9XA 4TL9A 3DMNA 3D7MA 1ELOA 2V55B 3MGCA 1EFHA 2B8TA 1UDWA 3BOSA 3AVTA 2QMUA 3T35A 2C98A 4XD7D 1RRFA 4EFNA 3IUYA 2IK8A 1HURA 4RVCA 5CITA 2W6JD 2GJSA 4IOLA 4AWXA 3THWB 4JSYA 1P9NA 2CE2X 1K5GA 1DTSA 3RABA 4BLPA 4D26A 2HT1A 3THWA 4I1OA 4B44A 1U0LA 3RWOA 1T0HB 1OB5A 3RANA 1VYTA 4LDJA 1G4AE 1YKSA 1FFHA 3FB4A 3RRNA 4KSCA 2ZJ8A 4YDHB 2OFOA 1Z83A 2QQ0A 1XTIA 2VHJA 5FOVA 2C78A 4M1OA 4JVSB 4F38A 1QHNA 2MMCA 1G7TA 4HLQB 4QHSA 4KFUA 3AVXA 1G8HA 2GILA 2IT1A 3RS0A 4GRAA 1F60A 1KNXA 3RHFA 3IIJA 3SE0A 1H8EA 2R6FA 1G1MA 2J41A 1NP6A 3RS2A 3KQKA 1LF0A 3D8BA
chains in the Genus database with same CATH superfamily
2PANA 1UZLA 3ENZA 1QVWA 2HTFA 2HCRA 3KB1A 3OUTA 4GGMX 4GPBA 1ISJA 2O0MA 3RWMB 4DBLC 1XKXA 2JEOA 2XH8A 4PC7A 5DULA 1SG6A 2L17A 4FINA 2ZDGA 1FUEA 3D1LA 3E5MA 1E2IA 1OZAA 3ER6A 3VPGA 4L16A 4NZPA 3G8CA 1LPSA 3V1UA 2WVGA 3GUYA 3PX2A 3WK5A 5DP2A 2C7BA 4BJ5A 3QZUA 3FBTA 1V1RA 4P35A 1K0UA 1GFWA 3C7KA 4HWRA 2VN8A 3ZWXA 4W6ZA 2JC3A 2MSDB 2W2LA 2GEVA 3QLUC 1USUA 4AP6A 2GM4A 1IQ0A 4G5SA 2YFQA 3PITA 4IDHA 4AM8A 3ZDBA 2C9DA 2GR9A 3P9CA 2BYTA 1P1BA 3BCHA 3OG9A 4MWGA 3SSOA 3HCEA 4F4CA 4DARA 4BMXA 1QE0A 3A4TA 1R4AA 3V4OA 4E3ZA 5BQFA 2Y77A 2VLBA 4ZHQA 4Y1RB 3N2LA 1UFRA 1B6TA 3DPSA 1HFWA 1TJNA 4MQMA 2I7DA 1M66A 4QREA 5AHOA 4F12A 1E6WA 5JPCA 1XVLA 2FG7C 1ECCA 2RHRA 3GUCA 3UM9A 2J7PD 3C7TA 1S3IA 3T4EA 3VX4A 5CLQA 2IZ5A 1E1QA 3F8TA 2WM9B 1HDGO 1U0FA 3A9UA 3O75A 4ARSA 1KZHA 3N2KB 4LCJA 2JFYA 1YSCA 3PYMA 1O6GA 1XYVA 3QNWA 4AQ7A 1V5FA 1U98A 4LX8A 4R83A 3ZU4A 4TXJA 2MR6A 4JI6B 3ACCA 2DWPA 3AIIA 1YMQA 1HSOA 4UUPA 2MSKA 4NCJA 1VL1A 1FNMA 2D5AA 4JGBA 4V02A 4FYKA 3NBFA 3OOEA 3W3AA 4PS0A 1KTVA 2P6RA 4YAWA 1JPUA 1Z2EA 1AU9A 4Q16A 1B0ZA 3LL7A 3CZMA 1VHQA 1A77A 1FFBA 2W0MA 1ZD2P 4S05A 2BKVA 3LO5A 4MQEA 2CW5A 2BELA 2HQBA 3FE2A 5MGNA 3H5LA 1AMOA 2MJLA 1Y0BA 4OQDA 3SP1A 1U04A 1NX9A 2PXXA 4AS2A 3ITDA 4JUIA 4C3OB 4L74A 2V3VA 4FEYA 3KZXA 3WIUA 2C94A 1SU6A 5EHGA 1OFUA 3A2KA 2OUKA 4TYYA 1P7YA 3UAGA 2XYRA 3GU3A 4IHJA 4DWWA 1TJ3A 3EQ7A 4RK4A 1JE1A 5G4KB 2ZCJA 5TXGA 2FPMA 3WL8A 4OFXA 1UPTA 2CY0A 4IQGA 4D6PA 1XC7A 4RZXA 4BRWA 4FIDA 2X5KO 1E7WA 2BLLA 3DE4X 3OTIA 1W2WB 1M9NA 4FYVA 4IV8A 4JX8A 4X7BA 5T6BA 5TX7A 3SFTA 3ZX5A 2IBTA 3HI6A 1JFLA 3NEYA 5D87A 5DSZA 1JAYA 4FNMA 3E8SA 5CHYA 1K6MA 3TD6A 4FFLA 4IIXA 2H3HA 3P1JA 3R3SA 4Q4HB 3U4HA 5JO0A 4CG2A 2CLSA 1E7YA 2R7LA 2B1RA 2EIXA 4HQOA 1OVMA 1H66A 4INZA 1FX0B 2JD1A 4L85A 3KOMA 4P1ZA 3WNVA 4UTPA 1CR0A 2B2CA 2XZOA 3CVVA 4CEJB 2QWXA 4L9RA 3K0AA 3N5CA 1QSGA 3OCZA 4GU5A 3MFYA 5LLDA 1LK7A 2L82A 1DQNA 1NM5C 4P7JA 5IK2A 4PYNA 1NX6A 1POXA 4NENA 3RJMA 4NONA 4C03A 5DXAA 4YX9A 2XCRB 1EX9A 2NQ2C 2OAP1 1X70A 2PXAA 4GSLA 4AL4A 3IEMA 1RXSA 2W37A 2B98A 1YZLA 1DPFA 3BXGA 3VFDA 2JHGA 4EARA 1RHJA 3FDZB 3N07A 3IP9A 2WNHA 2Q29A 3STYA 1P2BA 1J25A 4KV9A 3FW1A 2NLOA 4RD4A 3ZH2A 2VQSA 3IMEA 4NU6A 1M54A 2BGWA 1SIBE 3G85A 4IXNA 1F20A 1WF6A 2EFGA 2JHAA 3C7AA 1K7XB 4ZI7B 5IT0A 2AN4A 1UWCA 5HZMA 1HDCA 2E21A 2F9MA 3OI7A 3QKRA 2FPKA 4LJ9A 4TS1A 3SS8A 2DHRA 4RA9B 3OH8A 1OOEA 1C9JA 2JLCA 1SFRA 1W30A 2HBYA 3EIWA 1TM2A 3PFBA 3L6CA 4QXRA 3RSLA 4DQLA 2J85A 1P6XA 5IT4A 2X4LA 3HJGA 2CKDA 3MCVA 4UUNA 1E5VA 4MKIA 2LNDA 2TS1A 2UYCA 2JB9A 3DZCA 4RSHA 5IAKA 5IZ4A 4AFNA 4R3UC 4ZZ0A 5I4CA 5F76A 3QTLA 5BY2A 2PH5A 5A5EA 4O02B 3O7MA 3ZHYA 4OQNA 2EZ9A 1ID1A 1YMUA 2QVLA 3LY5A 4F06A 5EMLA 1L8QA 4GGOA 3CSSA 3OKCA 5K0SA 2CHUA 1OYVA 1UBSB 3PC8A 5TLSA 3R40A 4FTWA 2XOXA 4Q01A 1QDUA 2VQDA 1UDRA 3GNLA 3LX6A 4OBWA 3D3EA 5EP3A 5B58T 3PSAA 2YOHA 1I3OA 1VCNA 3KHSA 4AF8A 4F3YA 3DXYA 4Q9NA 1Y89A 4E07A 1YB7A 2HJVA 3DE5X 4MVJD 1U3CA 2V98A 2IEBA 3L9XA 3OC6A 1X1BA 1DTWA 2BF7A 3FA2A 1U2EA 3QSYA 5B4VA 2X0RA 3V5NA 4XYGA 1XCGB 4DUGA 5GZ1A 2PKCA 1VHLA 2E4XA 3V4RA 2X1VA 3AFMA 1XAJA 3W5VA 3UMVA 3KSZO 2JA1A 1FJXA 4EJ0A 1ZBDA 4EWLA 3WWYA 1GSHA 2JKZA 1TE2A 3QU7A 1AUVA 1YTLA 2IIQA 5IUJC 1X38A 2P6PA 1Z4QA 1Y3CE 3GHYA 1W2GA 2XDAA 2FMTA 4NCBA 4KVFA 3TZCA 5K20A 1C9EA 2GN0A 3D81A 1GFSA 1BWQA 3PLNA 4W63A 3ROFA 4RC9A 1YDGA 1GTL1 4WZBE 4RD3A 1MEEA 1X7HA 1G64A 5BYBA 3UTCA 2FLKA 4TWAA 3NHJA 3OKPA 4NF2A 5FOTA 1P5ZB 4JHXA 4B3RB 2RBGA 1X7ZB 2Q41A 2WW8A 2NWQA 1QNLA 4IDPA 4L8GA 2C4TA 2Z8YA 3FBWA 3WK7A 2V5UA 4EFMA 4NQZA 1E2PA 5MN4A 4LX0A 5T4HA 4KIWA 4L5JA 1WTAA 2O8NA 4RHUA 3GEMA 1JILA 3TRDA 3UUGA 1DCKA 3JYNA 1W0KA 4AKIA 3C6ZA 3SQXA 2GZAA 3FPBA 4GL2A 2XHEA 4FB4A 4HBGA 2FW9A 2VWGA 721PA 1D9ZA 1KF0A 2MOKA 4DMCA 3GPBA 1XL1A 4KTTE 4BFLA 2GBCA 4PSDA 3B52X 2IS4A 3CCCA 1U11A 1E59A 3EVZA 2H54A 4P7BA 4Q6WA 1DBRA 2L69A 1KEWA 1ZO8A 4BPRA 4F96A 2BP7A 4NCKA 5EIEA 1Z28A 3HKBB 3HA3A 2Q9UA 2OGUA 3CTPA 3ODPA 1SXHA 3Q8XB 3FJYA 1VLJA 3AVUA 4MAAA 3OTGA 2BVNA 5HE9A 1N9KA 2I6GA 2L19A 2WSYB 2YZMA 2AD5A 2C2MA 2BHRA 3WMEA 4AC9A 4PPYA 1Y1RA 3UJDA 4A36A 2O59A 1NW8A 4JLJA 3DEJA 3G1WA 1I4OA 4XWAA 1JYFA 3MWDB 2OQRA 3I39X 1EVZA 1ORTA 1T0IA 3O8QA 3QPBA 5EZSA 2G04A 4J90A 4MRAA 1HZZA 5IULC 2JLZA 1H6DA 1MOSA 2AH5A 4D8UA 1CUEA 1J2YA 2X13A 4R4JA 2AB0A 2PBZA 5JSZA 1QYWA 1NRWA 4OGWA 4V0ME 1AQJA 3TLMA 3SJAA 1R37A 4MCAA 2QR2A 3D8TA 4JR2A 4CTJA 3L8CA 1M34A 1V37A 1ISRA 2XYHA 2LZ0A 2OV2A 2IFTA 1YVPA 3RVOA 4B40A 1T3LA 3NKVA 2D4AA 4NS1A 3UWPA 1P0PA 4GUDA 2TMGA 4KBGA 4PXSA 4EM6A 1NYTA 2ZI6A 1ZGGA 3F5FA 4QICA 1LDBA 1M7GA 2CHGA 2YZNA 3ETHA 3GPDG 4DJ5X 1BE6A 3I4CA 3I6QA 1PD1A 2PSFA 2VA8A 2XGGA 3C7CB 1O94C 5LBUA 1PT6A 4EUEA 1BX1A 1U7UA 3HTXA 4E5DA 3PKZA 3HUUA 2QA5A 2Z3VA 5FUXA 1EH5A 2J4CA 2GN6A 3G49A 1XRRA 3B36A 3EEBA 3PHIA 4Q3NA 1XDWA 1ST3A 3CBQA 1EUCA 5C81A 1U2RA 1NPDA 2ATIA 3HCNA 3VC3A 3ZQJA 4B33A 3AVQA 4EUKA 1WR8A 3OP4A 5KCMA 1E9FA 1WHTB 4CZ2A 4YMIA 3DHWC 3FYUB 3IUNA 5AHXA 2O1SA 4J0GA 4RHYA 5FWYB 1LLUA 2DH6A 2JH9A 4S1WA 1ZGBA 2OYSA 4AKHA 3KXKA 2VOJA 2PL3A 2ZANA 1A9XB 1N2ZA 3MUFA 2XXBA 3M6FA 1JQ3A 1LPNA 4QGHA 4QDZA 5EWJB 3V8EA 4KPUA 3ER8A 1JR3D 4D9GA 4PSCA 1YNSA 4FBMA 1P7CA 3CNNA 3G7UA 2YBEA 3HVRA 4BZZA 4QUGA 3CONA 3OQ1A 1UBHS 3FM9A 3PQCA 1VSVA 2G9VA 1PHPA 4ZANA 3SYMA 2PK3A 4U7JA 3UMJA 5BWMA 4R2XA 1R66A 4ISCA 1SU7A 2WTNA 4LBYA 3A37A 1CUHA 3ZKWA 1KEKA 3K6KA 1XZBA 3HBAA 4PLVA 1C1YA 1UKYA 1ZK3A 3PF9A 4ZGGA 4LHWA 4EI9A 2WFMA 3B85A 4JOQA 1QPGA 3OJXA 3CR8A 5IDVA 2M32A 4HXGA 1U0BB 4FLMA 3E48A 3Q2IA 4YP0A 3MGKA 3LW7A 5K8VA 3TGPA 1YL5A 5ALYA 5DBGA 1RC0A 2ISCA 1QJCA 4R9VA 3UGJA 1B0UA 4RD2A 5CFLA 3X0DA 3M6UA 2ONKA 2C7PA 4X7PA 1GPKA 3B6IA 3PVSA 5EHXA 3B9BA 1XBTA 1A69A 3NCTA 3QKUA 1U0EA 1SPXA 3JD0A 1A3CA 4BLVA 3IEVA 2CLMB 3PKIA 4OX9B 3IEKA 2WJWA 4YMVA 3BK7A 2YC2C 2YJZA 3M5WA 3BGVA 3K6SB 4ZDWA 3O47A 1P1RA 1G20B 3E9RA 4JIMA 4UC0A 2IUUA 4DLRA 3LQQA 5KDOA 3D7SA 3HCPA 4KBFA 4TL8A 2FOXA 3TSAA 4C0WA 5EP1A 4NSNA 2VBFA 1E0DA 5D00A 2HCFA 3KQQA 1KS2A 5K3AA 2BEVB 3FYHA 3R3XA 1L4NA 5ALRA 3S1AB 3RS8A 4E33A 1JHDA 5H80A 1KI6B 4M9CA 2FPPA 3EUWA 1I7LA 2KBEA 1T5SA 3TXYA 4C7BA 4HOYA 2PWYA 3H6GA 1V1MB 4FW8A 4G9BA 3A0RB 1AGNA 3WIOA 4QVIA 1MX9A 1P4GA 1NQXA 3EBOA 1HLFA 1DT3A 1F4VA 2J9ZB 3JSXA 1YK0A 1W25A 3CRZA 4K03A 5BSMA 3R7LA 1MO6A 4BLSA 3GLGA 2QBYB 3O1LA 1N6RA 1E96A 1PR5A 1OXXK 3HSSA 2PH7A 2Y4NA 2GXUA 3GP5A 3LQKA 5CFOA 3MJDA 3OM8A 3OF5A 2WINI 3JZAA 5JC8A 5ARCA 3EWIA 4PQGA 2OCYC 3CZRA 2WWYA 2VK2A 4PSAA 4CPDA 4M7OA 5SZKB 2RGYA 4D3DA 1R8YA 3IVMA 1MA3A 1R9JA 3MTGA 3W1EA 3J81k 4KR6A 1J1UA 1NW5A 3ND8A 3T3NA 4RL6A 1Q0ZA 2YWFA 1M2FA 3UKDA 5BQXA 2CXXA 4L4RA 2E9SA 2E37A 2W48A 1FYDA 3HNRA 4IIJB 4WXPA 2FUG1 1T9CA 3U7QB 1MAWA 4CMIB 3IB6A 1PGOA 4MVJP 4JQOA 1LV8A 1IY0A 1BVRA 4FN4A 3UAZA 2AZXA 1OWOA 3M6MD 4QFCA 5A3QA 3W9UA 4WL0A 5KSWB 3QE9Y 4ND2A 1J39A 2XITA 3O8CA 1VDMA 3G7SA 3B8EA 3TQFA 3NDBB 5TGTA 2O3SA 4XEUA 4LHEA 2CVHA 3TOSA 4B7CA 4YLYA 5KEIA 3WGGA 4JBHA 2X3FA 4HS9A 4PZEA 5DGDA 3TFQA 3A4YA 2OORA 3U31A 1C1DA 1SCUB 2E4YA 4Q9HA 2UYQA 1MB4A 1WV0A 1XZDA 1UKVY 2D62A 2WUWE 3BPSA 4L2IB 3VH2A 2AKEA 1IVYA 1TQHA 5LP1A 1IQRA 1E6CA 1N6PA 4TKUB 4EB0A 4BP1A 3AI1A 4P53A 4UM9B 2QJFA 1OR8A 4TKVB 4M99A 3RYCA 4NXMB 1MW9X 1JHAA 3EDMA 3IURA 5A3RA 4O0MA 3T5CA 2ZYWX 4P86A 4WXRA 1STOA 3SKYA 3BK1A 3WNBA 1Q7RA 1T2FA 1TVKA 1U2GA 4N9QA 5AMXA 4BFVA 5L4LA 3BMQA 1NJFA 1W8DA 3AHDA 4UOQA 4B75A 2XYQA 2ODNA 4FT4A 3G68A 2JBHA 3O38A 3PDUA 2Q3CA 4LYEA 4QSMA 4K0KB 4GKBA 4CEIA 3K94A 1KE1A 2IS2A 4Q7EA 1XEWY 4ZCSA 2JVIA 3RUPA 1QCYA 3CLRD 3DOEA 3KELA 3LYAA 4LDQA 1T9AA 2GCIA 1K8QA 1E7SA 1L3BA 1S02A 3I3OA 1FUYB 2XLBA 3HVHA 4RO0A 3STWA 5H4GA 1LSOA 1ZUNB 2XCSB 1U4OA 3DW3X 3IA2A 1K6JA 3ZJVA 2BR5A 4A0HA 1DOZA 3EXIB 3P2YA 1FBNA 3VUEA 3A6GA 4KODA 5JECA 4Y2TA 2ZJYA 3A28A 3JQEA 3TL3A 5K3CA 1PQYA 1ZD5A 4ZEWA 4G5HA 4M53A 5B4UA 1WXIA 2IH2A 3DLHA 6Q21A 3Q7EA 4MV5A 3NDRA 1ZS9A 1KP3A 1ZWKA 2ZAOA 5TE9A 5JS8A 1FNDA 4DCNA 2FR1A 5G0SA 4DIOA 1J2UA 3ZK7A 4Z0HO 1VKHA 1JIJA 1WCXA 1WVIA 2NU7B 3S2IA 1SBHA 4HDNA 4YCBA 4YUZA 5AXCA 5LZ7A 3RT7A 5LNK6 4NYIR 2BMAA 1M2NA 1ZJZA 2OMKA 3C6MA 3KYJB 4W4TA 4RSRA 1QANA 1U7XA 4KYTA 3LY8A 5BW6B 4A7PA 1PQ4A 3O8OA 3SPXA 2W6NA 3UCFA 2D74A 3AERB 2WZQA 4LOAA 5AK4A 5F2NA 4WASA 3LKVA 2CCGA 1QP8A 1V4BA 1Z5WA 3ASUA 3KYIB 4KLAA 4YJHB 5GJCA 5FUYA 3SEFA 3FUCA 2HK6A 4B3JA 5I9LA 3LUJA 1DXYA 2CDCA 4FOPA 3SX4A 5JU6A 5FUVA 1KO4A 2FW1A 3DLIA 4PHHA 4OQFA 4DR7B 2G1AA 4I9GA 1K98A 1PEDA 5U4XA 4A6EA 4FGUA 1J0AA 1LK5A 4FFPA 5CBPB 3ENVA 4EECA 1B14A 2Q8PA 2YCLA 2AWOA 2QD1A 1HDRA 3CF6R 1GZVA 2JFWA 1QB7A 5A9SB 1D2NA 1XOIA 3IKLA 4AJPA 1Q91A 3HJFA 3LRXA 3AJDA 2O7VA 3GZ4A 2PY6A 3CGGA 2F17A 1ZBQA 1QO0D 2L0XA 2I4NA 5FTLA 3KQSA 3NHKA 2M1XA 4PS1A 3RFXA 3U26A 1N7GA 2RK3A 3EEYA 2HADA 4ZO4A 1QK5A 3DAPA 1OIXA 2XOKD 1JSLA 3DZDA 2ZB4A 3O73A 4L4XA 5IAEA 3DBLB 1MU0A 1XF1A 2HQRA 2PAFA 4ND4A 5FJJA 4UU0A 3R7FA 1AXGA 2Q7OE 3AHEA 1K7FB 2XCLA 2HLDA 5F9MA 4XYLA 2E5LB 1XL0A 1ODTC 4KFSA 3VSCA 4ER7A 1KZYC 1Y5MA 2NAFA 1JEYA 1LC0A 4RDXA 4O4IA 2YV5A 3NP7A 4B81A 3PVZA 1S8NA 2WP0A 4HRAA 1J09A 2X8JB 4PO8A 5EVJA 5GMOA 5K3EA 1B3BA 3F9CA 4B7AA 5SICE 1M6VB 4QA9A 4F6LA 1CEEA 1E58A 3PL1A 3AR7A 5D3KA 4FD3A 1L4GA 2ZBDA 2CZGA 2PCJA 4LQLA 3KZOA 4S1OA 4LTNA 3PXUA 1NKSA 1YZTA 1E3WB 1FDIA 1N57A 2HDOA 3HA7A 3EZ9A 3TCKA 5DBOA 1N2CB 5THKA 5GZ3A 2BZGA 4C4ZA 3THXA 4DLLA 5BR4A 2O2JA 3SOPA 1VE6A 4C0JA 4IXDA 1CJKC 4D3SA 1WSDA 3G2NA 4HDQB 1KVQA 3FYUC 2IX3A 4MDYA 3V9PA 3K2IA 1M8JA 2NYAA 4QX6A 2WIKA 5E4TA 4UM7A 3UMFA 3LY7A 2QG9A 2YH2A 4BB6A 1GZHB 4NNJA 2IY8A 2YWRA 1K8XB 3VNSA 5HM6A 2J5XA 3AOEA 4H1HA 3DVLA 4FFNA 2AEJA 2WMOB 3S2ZA 4CM3A 4GKVA 5BSGA 1JLRA 3AUTA 1FC0A 1R4ZA 5LQDA 3K4PA 2BH9A 1BKDR 1YE8A 2PCLA 3IUJA 2A78A 4JNKA 4RIEA 1UKAA 2LCQA 5IRCD 2EVWX 2JGIA 2PT6A 2X40A 4X54A 3VPFA 2XQGA 4HNTA 3SHVA 1OUMA 4A23A 1E7RA 4M8KA 3TJZA 5I7RA 4MHOA 3VVBA 4YNBA 1HEIA 1QORA 4XPZA 2HWKA 5AIAA 5GZ6A 2VHYA 4QO7A 1LWOA 2WYHA 2X42A 3C5CA 3FMVA 4RBNA 1NP3A 4DBVO 1VHJA 3IFSA 4X8HA 2Y67A 4L8LA 5J4LA 4WKBA 4GMDA 4U7TB 3D6TB 2AG5A 3NWOA 1VG1A 1T5HX 3I92A 2QE6A 3ZZUA 4WCFA 2GHRA 3Q7PA 3D7RA 1RBZA 2GB4A 4YRJA 3OFJA 1AZTA 2RGAA 3AKEA 1NQWA 1RYFA 2YS7A 2PX0A 4TM8A 3UVEA 4NICA 1JRLA 2EJCA 3B3FA 3M3PA 1YVUA 4PFSA 3NAGA 1PGNA 2FRXA 4PAOA 1CZLA 4EHBA 2GHQA 2NU6B 1F7VA 4ROTA 2AKYA 3MD0A 3IOCA 2GD1O 4EGJA 2FWBA 1AQ6A 2XT0A 3H1AA 4EYQA 1Q7CA 2C8LA 1K4KA 4O63O 4DV2B 2OD2A 3ZWCA 5GQSA 4YONB 1OYYA 1PEYA 1XJCA 2PT5A 3GT7A 2VZ8A 3QH4A 4Z9FA 4IPTA 1E1RD 3GJ3A 3DM9B 3AHIA 3JQQA 1PUXA 2QRUA 1XP8A 3OQ6A 4ALNA 4CMEC 4KL8S 5GGXA 5I9TA 5HP4A 2QYTA 4B3FX 4TWBA 3PR2B 3A4IA 5CJ2A 2EW8A 4ZOLB 1SCDA 4AMGA 1KEVA 1O8BA 2HFKA 2AJ8A 2OVBA 2VPIA 3QKSB 5F7XA 5HPYB 5JPIA 1OLSB 2VC2B 4WLNA 5IABA 3ZVKA 1E99A 3QKTA 4NBTA 4NBWA 4D9MA 2OZEA 2PL5A 4BQPA 1B6RA 2ZJ7A 3EODA 1O87A 3V9AA 1N5JA 1R0KA 3HS3A 3L1HA 3SS7X 1JYEA 1YASA 4WD3A 4MUJA 5F64A 2X2OA 2XI4A 2WBLC 3F71A 2I9KA 5JMOA 2RONA 4JDUA 1CRPA 3HU2A 1BA3A 2OO5A 2YX1A 3IAAA 5I9SA 2PGXA 4O2AB 3AL2A 1XHLA 3ADOA 3JWIA 2XXJA 4M0EA 3WJ7A 421PA 5G0TA 3K8OE 2ZJFA 1YA6A 3TNYA 1JXQA 3H2GA 5H9WA 1NG1A 1FRVA 4AUEA 4GZLA 5JZ9A 4Y1FA 2JH3A 3DR5A 3BRCA 5F23A 3N2EA 1JA0A 2XDYA 1JBQA 3WOVA 4DWVA 5HGXA 3LQ2A 2BJVA 4RY8A 3EZ6A 3K15A 3NEAA 1U9YA 4MWBA 1ADGA 2IPAB 4I5GA 2QRVA 2Q4RA 2QW1A 4H2DA 4Y9SA 5JT1A 4DT1A 2GF9A 1WUTA 2AXQA 2HRCA 2Q4BA 3EFBA 3MWGA 1N9ZA 2DUWA 3DP9A 3QEOA 4MQEB 2YWJA 3VA7A 2VF2A 2WABA 1KZ6A 1Q44A 3VMFA 4D5GA 3EXFA 2CXQA 3ILYA 4Z49A 1PK7A 2A5FA 3BJEA 3EVGA 4L5CA 5B2FA 4K28A 4RHCA 1M8FA 3TAHA 1O95D 2CXSA 2VJYA 4RVNA 5G0VA 3UGQA 4E7PA 5I47A 1NSFA 4EJ2A 2CV1A 2C31A 2RI0A 3U3DA 1USWA 3HXKA 1BMDA 3GLSA 1SKQA 3VPXA 1DVRA 3WL7A 5C7IO 1P33A 2AUTA 2C57A 1MIOA 3RYHB 3X1ZA 3U4MA 1DIGA 3SHWA 3CZ9A 3IBGA 1WRBA 4NE2A 1Q21A 2GHIA 2YHAA 3VNBA 2C7QA 4K8RB 3QNMA 3K4QA 2PMEA 4A16A 4BE9A 3ICOA 4LSGA 5TT1A 4HSGA 4TV9B 3HN2A 1EA7A 2JJ1D 5H16A 5HNKA 2SICE 3DBVO 4CV3A 3HFRA 5FBQB 4GF5A 3U7EB 2H7YA 3R6GA 1P0FA 1U0RA 4TRMA 3LDHA 3NTQA 3WDLA 3WYAA 1ORWA 1W44A 2F1JA 3ECCA 3WADA 1YRAA 2PUWA 1EU1A 3NR2A 1H05A 3CO5A 3TLKA 1ZIPA 3G2PA 3LFTA 1DG3A 1W75A 3NIBA 5EKXA 5TPWA 2Q2VA 3BD7A 2G1UA 1M6HA 4M88A 3RQSA 2D0PB 2BBTA 1VE9A 4EMTA 3UXYA 4QLOA 3J7TA 1E2LA 1YHNA 1XLWA 1W47A 4FQ8A 4F4JA 2X0EA 3ANXA 5K0FA 2XRYA 1R1DA 2RH9B 2B2NA 2YW9A 1M8KA 4R8KA 3FMIA 3GP3A 4KU4A 1N2BA 3D1VA 1CZHA 4DSAA 4HNAA 5LB4A 1TA4A 2RHLA 5TGZA 3MRXA 5IJXA 3TLBA 4QKQA 3DBRA 5KYKA 3DO8A 1WEHA 3QQPA 3OU2A 2JGDA 1H93A 1LCIA 2VDUE 3KJQA 4X8MA 1QHXA 1ORRA 1H69A 1FP4B 3V80A 2UUBB 3AJEA 1Z8HA 4O25A 1MRSA 1QIIA 2QXTA 4Q3DA 4AY6A 5I9MA 3SJZA 1X7GA 1O95C 1JI3A 2NAPA 4ARZB 3KQYA 3G0OA 1SUCA 3K6RA 1KI1A 1BRMA 3V1LA 1E3JA 3HYNA 5A4DA 3RYIA 3N8DA 3TPFA 4Q9IA 5JZMA 1BKYA 1XQ9A 2RHCA 4H7JA 4DNXA 3A3NA 2IY7A 2A67A 1CY0A 1VMKA 5IKPA 5HOQA 3F4KA 3LVFO 3NVAA 4OB7A 2Q2OA 5KREA 2ZJ3A 3ONVA 3SM9A 3WWDA 2Q5HA 3G9ZA 4IDDA 4Q3EA 4OPMA 4B17A 3TVYA 3QQ5A 2HSEA 1U90A 3VR1A 1JLMA 3IJEB 2QPLA 1LY1A 2DJ5A 3OEHD 4TN1A 1K2VN 3MCAA 1W73A 2QVBA 2V3WA 3LLCA 3P0RA 2H4XA 1L7VC 3UCXA 4D6YA 4QGSA 4MWSA 3JS5A 2VT3A 3ONWA 3Q9UA 3HP4A 3L01A 4IG9A 2R8ZA 1PWZA 4RFSA 1E32A 1I0IA 4BN4A 4D8YA 2RG7A 1XMVA 3C16C 1I2DA 5DRTA 3JYOA 2HZBA 1OFTA 3IJ5A 4HAXA 4MRRA 1BYUA 1KMMA 4B3TB 1SXGA 2P6UA 1X77A 1TTHA 3SZLA 1PK9A 3H5OA 1T3SA 3UATA 1BVUA 3HI4A 4F84A 2WIJA 2CBZA 4M9RA 4LSMA 5BWCA 2X6TA 3BWMA 4B5LA 4ZK2A 5L3SB 3QXHA 4GR4A 2JGLA 3IEXA 3OPYI 4QGGA 3JQCA 1ZM9A 4M0FA 3W6OA 3LTNC 2XUAA 3RVMA 2OHGA 3N1UA 1WZEA 3QFTA 3RTEA 5KQSA 4ZHSA 4UVEA 1UOEA 1H23A 1Y1LA 3NANA 1QQ6A 2QUZA 2RKBA 4EHHA 3F73A 3K0FA 1Z6XA 1UKBA 4GS5A 4MICA 3NAZA 3L0BA 1OU4A 3LXXA 3H86A 2HNBA 4MV6A 1MOPA 2REQB 4IFBA 3M9WA 1L5RA 4N3GA 3TFWA 1GL3A 1X3SA 2CEAA 4I5DA 3ZGXA 1PZGA 2I71A 3HV0A 1XFAA 2JLRA 3RLFA 5CRIA 2WHPB 2JHCA 3Q5GA 2WAAA 3IDQA 3HVJA 1KQPA 5CFNA 1WTCA 3ZZTA 1PBNA 3AJRA 2WF5A 3RSZA 1EI9A 1ZRNA 4YRMA 5E3HA 1S2MA 1CUZA 1M6EX 1R00A 2UKDA 4LE0A 1E1KA 5DT2A 4YR7A 1COWA 1N1DA 3KEOA 4CW7A 1T9GS 4QUAA 1VLLA 1M1YB 1SOWA 2GLUA 4M9ZA 1GUDA 2RFLA 3MCWA 3MTDA 3N7UA 1W1UA 2XB8A 2G77B 4QODA 3SK0A 1N0IA 5A4AA 5DX8A 2RBEA 4K6MA 3AL0C 3I9JA 1O1YA 4UQPA 1RKBA 1ZK2A 2BTQB 1DT5A 2UUOA 4HGYA 4V0LA 4PAGA 4CLOB 4D96A 4JWKA 2O5EA 2ZRAA 5FIUA 4KR9A 2EW1A 2QR5A 1E92A 3OZIA 1RQXA 3NHRA 1G6Q1 5BRJA 1VJCA 3N7AA 5TF0A 4PGHA 5AVKA 4Y9TA 4P4TA 3ZCRA 2IIVA 3CKYA 3FWHA 3E3AA 1PQPA 4H59A 5IXJA 4YJ2B 3UJ9A 1SBQA 1ZFNA 3E8MA 4KKXB 4WZZA 4URFA 5JSZB 1ZOLA 2FW8A 3KJZA 1W9MA 3HG7A 1AM4D 2JI7A 1KH2A 2ZRCA 4BN0A 2QMHA 3AFIA 4MJXA 2G88A 4Q03A 1JAIA 2FV8A 2VP9A 4MWEA 4KXWA 4L27A 4PRZA 2A9RA 2JFNA 2PSSA 1OTYA 4V0NA 1TJ4A 2EW2A 1WU8A 5I9BA 4A8JB 3HP1A 3EBLA 1D4OA 3HLKA 4J2OA 4RLSA 2P9YA 2MSWA 1FU8A 1NI4B 3BCSA 5TF4A 4BXOB 3B6JA 3MJFA 3L07A 3KHUA 2WQ6A 2JARA 5EZ6B 4IZHA 2C4UA 4MI3A 4MJ3A 4YK7A 5DMHA 4TWZA 5E9JA 1SBIA 3V7WA 3IMCA 2WFAA 3IC5A 2AN1A 2FGKA 1J42A 1PR2A 2BLNA 1VI6A 5C37A 1GPMA 2BMWA 3RFVA 2NYUA 1YVDA 3D4LA 3M5PA 1GP2A 3MIIA 3IOEA 4OYRA 1V8BA 1D07A 3BWVA 3QWHA 1L2TA 4ZOEA 3W9YA 4EBFA 3HEBA 2ATEA 3W0LB 4DB4A 2B20A 4ND6A 5D5QA 1C7ZA 4PG7A 2NT4A 1FOEB 4PX3A 3L7BA 3R7BA 4YDQA 4I14A 4D4KA 4Z7OB 4QUEA 4KDCA 4P93A 2WJIA 4G5XA 3NEPX 1LTHR 1HLPA 3PXDA 4GBMA 2FZ4A 2Y71A 4JH0A 1C14A 4LJ6A 4BQEA 2ZRKA 2I91A 3KOWA 4TMXA 1OBVA 3D2LA 1O6ZA 1DXQA 1PG2A 1ZH6A 2XB6A 1HWYA 3M34A 4HYEA 5H1YA 3SR0A 1QQ5A 3H5WA 5IMSA 1XAIA 1PK8A 3DEZA 3SYKA 3PIRA 2ID9A 4LOJA 3AIKA 4YCJA 3DUFA 1SUDA 3PK0A 2VF8A 3BL5A 2DQSA 2K4MA 1Q6YA 5B1DA 5JOQA 2IXGA 3MCZA 2F1IA 1YI8A 1N3YA 5BMVF 3DTVB 1WLSA 1DO8A 2JPDA 3U4CA 4IP0A 5FBHA 3KSBC 2G4LA 3V3TA 1BXRA 3DWEX 1FW6A 3D0QA 4N49A 5G3ZA 3VOBA 1IG0A 3B6MA 4IMJB 1SOMA 4JEHA 1NXXA 4YJFB 2J4FA 4HWPA 4RF4A 4PZLA 1ZCZA 4UXIA 2EL7A 1L1EA 2IPOA 4BGUA 1ZNYA 1ZRHA 2HA3A 1J24A 1IDN1 2AEFA 1A2BA 3QJYA 2ZYIA 5EKUA 3RAEC 4K5QA 2G06A 1MEOA 3PFIA 4JLAA 2PIDA 4M0LA 1K4YA 1MABA 2WD9A 1V8OA 3DULA 4HZUA 4EI7A 2C4HA 3E15A 1QS0A 5L7YA 3NS7A 5FOXA 3W2HA 4UVHA 5DIZA 4KSYA 5C5EA 1OH6A 4QXPA 1VHWA 4DZTA 2Z2IA 3I04M 3W6ZA 3TNLA 3ZDRA 4U9UA 2HA7A 4D74A 5CGZA 1ISMA 2PR7A 2CN1A 4QOIA 1JWLA 3KQHA 1KZGB 3RIXA 2QX4A 2GCOB 5ENDA 2N75A 1P7PA 3EY9A 3L7AA 4JT8A 3A10A 1M5TA 4HXYA 4JCCA 2ANBA 4RPIA 2V7TA 1QHYA 4FUQA 1LRJA 4Q9DA 4U2DA 3PDIA 1QV9A 4OJQA 4QNRA 3VTZA 2IP1A 3N86A 4H4DA 4MKXA 3C15C 5EEHA 2NPFA 1L5KA 4FSDA 3CXRA 3AL3A 3MS2A 2PJRA 4ZVOA 3OVMA 4WJLA 1MQ9A 3PFWO 3H5AA 3M9XA 1PJZA 5DKFA 3RS7A 3W2FA 5I9IA 1KY4A 1AE1A 1E5DA 1F8UA 1XXHA 2Q5EA 4DR1B 3BC1A 2N0SA 4MW1A 2JBAA 3MLAA 1T0UA 2O8FA 4CIBA 2BFDB 5KYUB 2C7VA 4HN4B 4IZ6A 5L7TA 5AWFC 4DSTA 1ZH8A 2ATCA 4OKNA 2OV8A 4FCVA 2CL6X 2PVPA 2ZAGA 3LOPA 4U8GA 2AD1A 2JCXA 3OF3A 4DLNA 3IPAA 3O4HA 4XQEA 4HJXA 3O8LA 1QFSA 3LVRE 4S2UA 5COAA 1B7GO 1GXSA 4KXQA 4QAQA 4E0BA 4HWKA 3QTBA 4GDMA 4TTPA 2VATA 5BQPA 2I1WA 1GZUA 1JDTA 1XPJA 1T5DX 3C14C 3T41A 3TLYA 4BNHA 1O0BA 3OFVA 2VK1A 1G60A 2ZZKA 2WPDA 4JR1A 4F93B 3LGSA 4N5NA 3ZJTA 3B6KA 1GAXA 1C8BA 1GYPA 4QPDA 2QTGA 5HJ2A 1U9CA 5H9VA 2EKZA 5AKZA 1F2TB 2ZYVX 3U19A 4N5HX 2Q6VA 3CR7A 2Z8ZA 3QE4A 3E82A 3GRZA 4P58A 1J0DA 4QAJA 1Z6ZA 3IXMA 4GX2A 1IOZA 3WRXA 4Z51A 1USKA 2X6RA 3IUQA 4P32A 4TSFD 3FTCA 1EX6A 4G09A 3ST7A 3KEQA 4YBRA 4D02A 5CA0F 2QX6A 2BGMA 2QU7A 3TTSA 2ZRDA 1GZDA 2GN2A 4HXEB 3VPHA 2H2DA 3MELA 5HE8A 1WB4A 2FG5A 1RHRA 3CLSD 2Y6VA 2XD4A 3PJFA 3DT9A 2GWRA 3NORA 3JAMA 4JJAA 2VT2A 3I8XA 5JNTA 5C32A 3VISA 4HGZA 4JYCA 2IV2X 1T3GA 4E70A 5E6RB 1TT5B 3IAHA 4QULA 4X90A 3PX7A 1TGYA 3ZDDA 2HMYB 3E5HA 2J0SA 3FWZA 2ORED 4C87A 2W2KA 1SM4A 3HVIA 3CT6A 4JLKA 3HMKA 1RRVA 1N6NA 3D7KA 1LEHA 1RRPA 2DBZA 2H48A 1PV4A 1UMKA 4HV4A 3O2NA 5HWSA 2NW6A 2PA3A 4M7PA 2FQYA 3ACDA 1KYZA 4LDRA 4RANA 4HMPA 4I3FA 4QJ5A 1L4HA 3JARA 4CKBA 1B74A 4LZNA 4YMHA 4UFNA 1UPCA 4AS3A 3E9YA 1TUBA 4Z3KA 1QIFA 2AA3A 5IDXA 1KQGA 3B1FA 3U5ZB 1EVQA 4YRTA 4D3ZA 1B8VA 4MXDA 4DIEA 4E5NA 5IN4A 3L4JA 3GPIA 2MCFA