2PEZA

Crystal structrue of deletion mutant of aps-kinase domain of human paps-synthetase 1 in complex with cyclic paps and dadp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
RGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism for substrate inhibition of the adenosine 5'-phosphosulfate kinase domain of human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 and its ramifications for enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
total genus 69
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pezA00
4ACBA 1KYIA 4PZYA 4Q1DA 4JLKA 2BM1A 2YVUA 1ZNWA 3CO5A 3HJNA 1T0JB 2B21A 3AGQA 2LKDA 3OFNA 1N5JA 1R2QA 4KV9A 3CM0A 1SZPA 3GEIA 5AJYA 2XOKA 1CR4A 1X1SA 1I4DD 4PAMA 2BVNA 2YOHA 3EXAA 4GZMA 1NSTA 1BMFD 3QVUA 4O2LA 1MO4A 1E2KA 4UQOA 1E0JA 4LJYA 5BYKA 3CF6R 2GWHA 2IX3A 3U6BA 4IJMA 3RLFA 3GQBA 5B58C 5J4YA 2D2FA 1GL9B 4Y0AA 5FBRB 5FBLB 1S1MA 4CEIB 1IXZA 2C9YA 5LDDC 1LF0A 4ZCLA 4ZDJA 2YC2C 4EIWA 3TRFA 1Z07A 2V3CC 1QHHA 4ARZB 5AUOB 2FGJA 3M6AA 3R20A 3RSLA 4US2R 2FX3A 2QRZA 3X1WA 4UNQA 3ZVNA 3VR3A 5P21A 5TB5A 4Z54A 4PHFA 2PZFA 3SHFA 1PJRA 1E0KA 4BECA 1KAGA 4BGDA 1GKUB 4IEIA 4KFRA 1KSFX 4OI1A 5FPKA 3B60A 4PQYA 6Q21A 3QBVA 2ZEJA 1UBFA 2IW3A 3LNCA 3S1AB 5CDFA 2QM7A 1MO5A 1VYUA 5DH9A 1LVGA 4YDHB 5AJWA 1ZM9A 1GVNB 4IHQA 3V4FA 3B1YA 3RANA 2C96A 2A3RA 1AGPA 3ND9A 1E2HA 2XZLA 1N5IA 2GBLA 2OHFA 2QSZA 1SXJE 3B13B 3KJIA 4V03A 1NMYA 2ZI6A 4TT3A 1ZYUA 2PJZA 1N6KA 1U0JA 3NVAA 4NMMA 1G3RA 5CK5A 3RRMA 3SI7A 3K09C 4Q9IA 1C4OA 2FG5A 4M53A 1SKQA 4V0MA 1II9A 4WOPA 3AVVA 3OEHA 1BMFA 5H68A 2P65A 2Q3MA 5JSZA 1VIYA 1VTKA 2KBEA 4YMSA 2QEQA 2JLRA 3OEHD 5SZIA 3NHBA 1ZUNB 3MWJA 4M9ZA 1YU9A 3AP2A 1E9FA 1G7RA 1ZIPA 4AY2A 2PCLA 2NG1A 1E96A 4C2TA 1ZNYA 3EZ6A 2JLQA 4NYJQ 3ONWA 4A2PA 3TLXA 4RZ3A 1GNQA 5TV2A 4OHYA 1UF9A 3EZ7A 3PIRA 2FA9A 4TL7A 5AJXA 1W0JD 4UNRA 1SKYB 2YKGA 4BASA 2ZRIA 4R98A 2AD1A 2QORA 2OG2A 2W6IA 4ON9A 2EU8A 3KTAA 3WRYC 4Q4AB 4MYUA 5B2ZA 5JCPA 4U7DA 1TF5A 2ORWA 2OV2A 4B43A 3FMFA 2OFWA 3QG1A 3T12A 1CKEA 2JJ2A 4K8OA 5JFGA 2IHBA 4WVFA 4KU4A 2ZR9A 3AF2A 4LV6A 2G0NA 4A1FA 1XTIA 4C0QC 1U0LA 3LWNA 1M2OB 5KDOA 2A5GA 2RGBA 2WPDD 1Z63A 1AM4D 1YR6A 4KBGA 2Z0MA 421PA 4MUAA 2ZS8A 4GRAA 4TN1A 1G6HA 4A6XA 1XRJA 1KNXA 2NOAA 2ZREA 4F92B 2IYVA 1RRGA 2RHMA 2FEOA 1AIPA 3PUZA 1FOEB 1FQKA 5FUXA 3FHTA 1ZP6A 1RJ9B 2QY9A 3DZDA 4IRUB 2J0VA 4NDZA 3OHMA 2EWVA 1G17A 2VP9A 4HLUA 1KO4A 3WMGA 3OEEA 4KVAA 1PLJA 3SJBA 4YXWA 5DI9A 1G8GA 1XCGB 2ZUCA 1R8QA 4DCVA 5JJKA 5E7JA 1TX4B 3K70C 3KXKA 3LD9A 3I5XA 4JLVA 3LFUA 4M2LA 4XTCS 5KSOA 5BW8A 3FKSA 3PUVA 1XBTA 3QXSA 1VIAA 1Q0UA 3QPUA 821PA 1KAOA 1MRSA 1AQUA 1RIFA 2XTNA 3MFYA 4Q9KA 1UM8A 1CRQA 4JLMA 1VPLA 2RGEA 3T1TA 4EPRA 4KYIB 3I5YA 4TYNA 1T3HA 4B6FA 4ZIRA 3GJ0A 3AM1A 3MAAC 4GT1A 4HZUB 1L2TA 5EE1A 3SU8A 5L3SA 4PPGA 1AQYA 2O8BB 1KI9A 4Q48A 3X1DA 1RYHA 1KO8A 4WAUA 3KDSE 2AWNA 3FB4A 2NO6A 1EFUA 2QGZA 4JZKA 5HKKD 4NBSA 5L3VA 3TR5A 4P3YA 1QRAA 2IXGA 1GRRA 3WBKA 4KO8A 4ZDKA 2XZOA 1AS2A 2IT1A 1COWD 2PZEA 2WSSD 2IEZA 4FMDF 3RRYA 4TMXA 5J40A 2GRJA 3SNHA 3WBJA 4BLOA 2G3YA 2GJSA 4D0GA 4DLVA 1MRNA 4TZ0A 4OK6A 5CJPA 2AXPA 2WHXA 1E94E 3JZAA 3LQQA 4BLQA 1CTQA 2J0QA 3CONA 4AD8A 3A36A 2WKQA 5KOYA 5F2EA 5C2JB 3L2OB 1Q1QA 5EE9A 1UKZA 2C99A 4DDUA 2IA5A 3W8NA 2ASEA 2H1LA 3VR1A 2X19A 3DOEA 2ZU6A 3CRQA 3VX4A 1G21E 4AWXA 4EPWA 1NG9A 1GKYA 1SXJA 3P4YA 4Q1EA 3ZGXA 3SQXA 1P9RA 1KZGB 3UKDA 3W3ZB 2P6UA 1MH1A 1XWIA 2WMNB 3I73A 4V0OA 4XWKA 2J9RA 1Z28A 4PQRA 5CJ2A 5JHGB 2PLRA 4U5XA 3WHLA 3WP1B 1X8LA 2GXSA 1RW4A 3ZVRA 4V0LA 4E03A 3SHWA 3Q8XB 1OB5A 1G7CA 1ELOA 3BXZA 1NLZA 4OQNA 4A2QA 2Q6TA 4HSEA 4KAXA 2D4HA 2ZR7A 2EFHB 2V4ZA 5AUQA 1JPNA 3BJIC 2NZJA 1LW7A 4D80A 4TMWA 3GJ4A 2BBWA 2VA8A 2ERYA 1DADA 4W5HA 2WICA 5GVRA 2ZRPA 2NO0A 3PVSA 4I99A 4I1UA 1NRJB 3R9WA 4YDSA 1E1QD 1JQJC 1KY3A 2ZPTX 2OILA 4GMXA 1Z6YA 3K0AA 2ZUBA 3OE7A 1SVMA 3PEYA 1ZUHA 2FOLA 2ZUDA 4KI0A 3EASA 2GXUA 2IBMA 2BEKA 4URZR 2ZE7A 1J7KA 5KPDA 2WWYA 4DSUA 4L9WA 2HV8A 1ZD9A 4HUQA 4R2IA 4B2LA 2VP5A 3ETLA 1W36B 1VMAA 1WDTA 4WA7A 1DBSA 3T1QA 5G3YA 2PT5A 1SVOA 1UFQA 2QT1A 2NIPA 1MR3F 2D2EA 3JVVA 2QA5A 2AXNA 3P4XA 1LNZA 3IDQA 4FMDB 4W7SA 2IXFA 3ZYCA 4DT1A 3QF4A 4PPFA 4GMDA 2VP4A 3AKDA 1E1QA 4QG7A 4LHXA 3C4JA 2PZGA 1P72A 3MG9A 1OH7A 1WBBA 3EW9A 4A15A 1I2MA 2X1VA 2JLWA 4YC7A 1O87A 2OO7A 3R8FA 3O8BA 1GUAA 3BBPA 1EWRA 4QXAA 2IYLD 1P9NA 3K9HA 4JT4A 2H7VA 3U3MA 4B47A 4BWYA 1XCPA 1RKBA 2CCJA 3AKYA 4YLGA 3K0FB 4JJZA 4DVGA 1M7GA 3AP1A 4Q01A 2C2HA 4C0HA 4HB2A 4TLEA 4LV5B 2AK3A 3LX8A 1FNMA 1E2FA 4NCIA 3ZVMA 2Q9BA 2HYIC 4Q9JA 2GXQA 4CRWB 4ERNA 4MGYR 2EFDB 1N0VC 2QBYB 4G0NA 3TUZC 2Y8EA 2ZRGA 4PC6A 4NYIQ 1M1YE 1YZQA 2RGNA 4ZKDA 2OXCA 2QPOA 5HKKA 1UKEA 3PEVA 3TW4A 1CJMA 5BN3A 4EFNA 4HLDA 1VCOA 2XX3A 1UKVY 3E70C 4C7OA 1ANKA 2EFCB 5FPHA 2ZRKA 1G3IA 4JLDA 2JEOA 3AVUA 1N6IA 4IDNA 3TQCA 2P0EA 1G7TA 1CIPA 2BWJA 3BIFA 1KDPA 4LYAA 1VHLA 1YR7A 2Z5FA 1KSGA 3W34A 1IJEA 3K09A 2DYKA 2GCPA 4LYHA 4OHXA 4B2PA 1KK1A 2HXSA 2KBFA 1SHZA 4BLRA 4NYJR 3IO5A 5JHHB 3QKRA 5CLQA 1QF9A 3AVOA 1W2HA 3AEZA 2QAGA 1Z3IX 4CIDA 3KQUA 1G16A 2H57A 1DG1G 3Q85A 1Z5ZA 2GDJA 4C0SA 4IXNA 4B35A 5HZHA 2H17A 5DYGA 3U7EB 4A0HA 2ZYWX 4URVR 5AK0A 2O8EB 2REBA 1Z83A 2CNWD 2R65A 4ASUA 2E9SA 2B92A 1OYYA 1RJ9A 2VO1A 1SVWA 5E7MA 3W6OA 1LS1A 3VNUA 4UXJA 4B48A 5JI3E 4GFDA 2EYQA 2YINC 3U61B 2RGGA 5E95A 3IIMA 2F43A 2OAP1 2CEAA 1VG9B 4UXIA 1SQ5A 3QKSB 3OAAD 4G01B 1XTSA 4A8JA 4JT2A 4D26A 1T8TA 2WOOA 4HAVA 4I81A 4KCGA 1NBME 3A6PC 1LV7A 3I8SA 4LX0A 2UKDA 1BYIA 2EW1A 3FMOB 1NJFA 4RD2A 4RZ2A 4TL9A 5CM8B 2IYTA 2O8EA 2GJAA 4A8JB 3EPHA 4MKFA 1ZNXA 3GD7A 2W2TA 5DNYB 4C4PA 3SS8A 1NLFA 3SE0A 1XP8A 2OZEA 3H84A 2EFGA 3GFPA 2O0KA 1TQ6A 5FI1B 1YRBA 4JSYA 4OYHA 3FHCB 4EAQA 2QU8A 5LB4A 4TMVA 3QKUA 2VBCA 4B44A 4JVSB 2ZAOA 4U00A 1N6OA 1RYFA 2RKOA 2PH1A 1SXJB 1MO6A 2WWXA 4YMVA 2WSMA 3HR7A 4IFBA 5FL7D 1XZPA 3CWZA 3GJ7A 3U3OA 2RGAA 2XEXA 2VPPA 4C0LA 2JIZD 3KZ1E 2XNSA 3ZDQA 4EUNA 4GP6A 3AF0A 2ZI5A 1RC8A 2GKSA 1KJYA 4PSAA 5LD2B 2CL6X 3CF0A 2GILA 1OXXK 1KI6B 1CLUA 3I61A 1XF9A 1M34E 3W5IA 1ZM3A 2BHRA 1A4RA 2IS1A 3NC1C 4XIGS 1AA9A 2ZE8A 3NDBB 2BMEA 5HCIA 2D74A 1OHHD 1AS0A 5FL7A 3B1XA 3QSYA 3A1WA 2BDTA 5G41A 4XD7A 4TZ6A 4L15A 2SHKA 1KDOA 4J0QA 3V00A 5GJCA 1JR6A 1I2DA 4QNRA 1P2UA 1OYWA 5D3MA 4E09A 3KKOA 3PCRB 1VG0B 4D0NA 2F1RA 2GESA 3QPWA 2R44A 4R9UC 4IOJA 5KO2A 2QE7D 5G53C 2O8DB 3K0FA 1EX6A 1ZJ6A 5F9HA 2QMHA 1S96A 3TSOA 4JLNA 4G5GA 4OI2A 4CYMA 4L5BA 3THXB 3AVXA 4DEXA 2A2ZA 2N42A 2X77A 3F8TA 2QP3A 1OXSC 2R6GA 3FFBA 2MMCA 3GJ5A 4RVCA 1KDTA 3UPUA 4Q7MB 4HDQB 1DO0A 3KFVA 5G3ZA 5JBQA 1RRFA 1M6NA 4KYUA 3SYKA 3U5ZB 4Q9HA 1Z6AA 3CH5A 4BFTA 2EQBA 1IJFA 1II0A 1X3SA 1YZUA 3BH0A 2ZIAA 4M9QA 2GAOA 2P5SA 5J4HA 1P6XA 3B1VA 4TQUS 4B3FX 2WJVA 2VRWA 4C30A 3NIBA 3SC3A 3L43A 1E2IA 4RSGA 4JBWA 1N2CE 4JIMA 2UVQA 1J8YF 1CULC 4AK9A 2AKYA 3GLGE 2R62A 4I1SA 3QXXA 4A8JC 2VTKA 4X8HA 3NG1A 1WB9A 1GRQA 3NH9A 2BMFA 4GOKA 3IIJA 4IDPA 4A0GA 1E2EA 4BZXA 2QE7A 2BBOA 1JAIA 1IXSB 1NN0A 5DHFA 4DB4A 3RDPA 3WHKA 1D2MA 5TMPA 1W4BA 2XZPA 5C4GB 3EG5A 4CVNA 2IWRA 2XNDD 5LB2A 2WJIA 3EPKA 4I1OA 3DVLA 4O3MA 2DWQA 3WXMA 3J81k 1K8RA 5JLJA 3SJCA 4W5JA 4QRHA 2F9LA 2P6RA 2R6FA 5FOTA 1P75A 2VLIA 1VCNA 4OK3A 3T35A 1KI2A 2WKPA 3F3YA 1NBMD 4A6PA 4UXHA 1NY5A 3KXIA 3FDIA 4HAZA 5EP3A 3KQHA 4ZDWA 3P32A 2CL0X 3U7FB 3QXCA 4B6EA 1GKIA 4MUBA 3BRWD 4HEJA 4LJ7A 5BXQC 1G5RA 3THWB 2G1JA 3GMTA 1HA3A 2ODEA 2MSDB 3TSWA 4EPXA 2FSIA 5AJZA 2WJYA 3QKRB 3DZ8A 1Q22A 1CJVC 2ORVA 1EX7A 2JIZA 4RCZA 2Q3HA 3U60B 3MJRA 4M9SA 3T1VA 1PVOA 3GJ6A 1S3SA 3ND8A 4PTLA 2EWWA 5E3HA 4NCHA 4RZUA 1UDXA 1A7JA 2DWOA 1FNNA 2KJQA 1XPUA 1C9KA 2P3SA 4QBIA 2HT6A 4DLUA 4P0TA 4RFSA 1XMVA 3LVQE 3DL0A 5EZ5A 1S9HA 2VEDA 4IEEA 1E9EA 4US0R 3OZXA 1IBRA 2O8FB 3DMDA 1IOZA 5DE3A 1G20E 1W46A 5EXXA 1GNRA 3GLFB 1CBUA 1ZU5A 2OXRA 5K8IA 4LBVA 2VYFA 5LD2C 4M1WA 1SVSA 2FE4A 1TADA 4URUR 5KUTA 2OM2A 2O8BA 1G8HA 2GEUA 3BB1A 1II8A 3QI2A 4G1UC 3X1ZA 1IY0A 1E2JA 3SQWA 1E6CA 2WWFA 4DSNA 4CEHB 1KK3A 4CEIA 2BV3A 5FL3A 3THYB 3OEED 4Q1CA 4NL4H 2IXEA 2C5LA 1JR3D 4TT3D 3NBFA 2W0SA 2ZRDA 2ZRFA 2G6BA 2ZJYA 2I1QA 2BOVA 4HZIA 2J1LA 2BBSA 4QC2A 5EUMA 3NC0C 1U9IA 4D0LB 3A37A 3LA6A 3BK7A 4PR0A 4TTPA 3I72A 4EJSB 5EXPA 1E98A 3OIYA 4K46A 1PZNA 1CJUC 1DS6A 4PHHA 4N0EA 1VG8A 5BYJA 1DG3A 2WPDA 3THWA 1NIJA 2I3BA 2C9OA 3O8RA 4Q4JB 1KNQA 1G7SA 1KO5A 2W58A 1G19A 2W2XA 2VP0A 1BIFA 4QJ3A 4DDVA 3D31A 3KJGA 3L82B 1Q20A 3NEJA 4LBYA 4LJ8A 4JBXA 5JWOA 1JXMA 1EFRD 4F4IA 2WV9A 5EQTA 5IRCD 4FCVA 1E69A 3I32A 2D7DA 1I4LD 5C1BA 1NMZA 4Q7LA 2P2LA 4Q7KA 1F48A 1XDBA 1Z6TA 1HV8A 1XD2B 4V02A 4LPSA 3CF2A 3OESA 2ZROA 1JECA 5CIQA 3NDPA 2F43B 1XEXA 2IWHA 2D3WA 1FFHA 2KSQA 4DZZA 2OBMA 4B3DA 1QHNA 4LCBA 4MGIR 1XD8A 2XTZA 2B7CA 3OAAA 1KI3A 4BFZA 4Z51A 1LB1B 5KNBA 1R6BX 3SFZA 1XMJA 5DIFA 3P1JA 2ZE6A 1GFIA 3MWYW 4TL6A 5JS8A 2E87A 3LBIA 2QT0A 4NZYA 3LVRE 2KE5A 3BORA 121PA 2AR7A 1ZVQA 3CUEF 4QL3A 3THOA 4D4JA 1AK2A 2GVDC 3EC1A 5IDVA 2JDIA 2OCBA 3RYTC 1ODFA 5C46F 1W36C 5E4FA 3CR8A 1R0YA 1SULA 3B9PA 2IUSA 2UZ3A 3ECCA 4PO1A 5DHAA 3GLHA 1JXOA 1N0WA 1Y3AA 4ZI2A 1HUQA 3CIOA 4QBHA 1IY1A 2F9MA 4U02A 4XH9B 3K9NA 4MDEA 1XTJA 1KKMA 4JL8A 3HU3A 4QHSA 2Q9CA 4PHTA 2J59A 4M21A 4JL6A 1AKYA 2RHDA 2YZ2A 4Q5IA 2WM9B 4KLNA 1M7HA 4IDHA 2PL3A 5TXGA 1DO2A 1TQ2A 1EK0A 2REOA 4KXFB 4BEJA 1PLLA 5KDLA 4DB2A 5DI3A 4B73A 4QFMA 3U44A 1XTQA 4NCKA 1W0KD 1GSIA 1NVXQ 2FFQA 1MV5A 3GEHA 3HU2A 3NKVA 3D6TB 3FVQA 3P27A 4FWIB 1FPMA 4B75A 5KPJA 1KI1A 1N5KA 2HJGA 2J7PD 5SZHB 3LLMA 1N6NA 2OFXA 4B3XA 1XB2A 4AG6A 2OBNA 4E22A 1U8AA 2GCNA 2V1UA 4P32A 2ZITA 3DEFA 3H0KA 4BUJA 4LSGA 4YQFA 4NTZA 1JJVA 2C03A 3LH5A 4KJZA 5AUNB 1R10A 2GAAA 4I1VA 1OKKA 4WZBE 4RKFA 1TL7C 5HZKA 2VHQA 2ZSFA 2IS6A 4BE7B 3KQNA 3QXHA 3K53A 4BZPA 4ZV4A 3IHWA 5D3MB 4CEHA 1IN6A 3C5CA 4V0NA 4NKRA 2ZSDA 1PUJA 1RZ3A 5SZKB 3IBYA 3R7WB 3PUWA 3ASYA 3CRMA 1E9SA 2OFOA 4S2EA 1P3JA 2X2FA 3PV0A 1FMLA 2FN4A 3IBGA 4A4DA 2B8TA 1Z06A 4HAWA 3ZVLA 3ZZ0A 5L3QB 3HR8A 1QHHB 4ARZA 3P26A 5FPYA 4AYWA 1P5ZB 2CCKA 1CS4C 1X1RA 1W44A 2XGJA 1FX0B 1K5DA 2DBYA 5F98A 4MYTA 2EVWX 2HJVA 3W90A 1N6RA 3KUCA 1FUUA 3AVTA 1R0WA 1M8PA 3CR7A 1R0XA 1YKSA 2J0SA 1E32A 2CLDX 5DISB 2DFNA 1QHYA 3B1WA 3BWDD 3VU9B 1P4SA 4ZI3A 4ZO4A 2OT3B 1AKEA 1V43A 2H8KA 2Z4SA 3KQLA 1G8PA 2ZANA 1KHTA 1V5WA 5DN6D 2ZRBA 1B23P 1KMQA 2VP6A 5EP2A 2V9PA 4AKIA 2GBLC 3OF5A 2A5DA 1G8YA 1E1RD 2QTVB 3IGFA 2FFHA 1E2PA 2JLSA 3WY9A 2IS4A 4IDQA 2ZYVX 4M0LA 2PEYA 4XD7D 5ANRB 2GJKA 5K8LA 1T6NA 4IW3B 1NJGA 1KK2A 3ZH9B 3K9LA 5BN5A 2WAYA 4OJKA 3B7GA 1T91A 4PSKA 4HDOB 2JLYA 3CPJB 4US1R 1JPJA 3EC2A 4TTRA 4TYQA 2V7QA 5K8TA 4KITB 4W9MC 3MUFA 2GF0A 4RJLA 4YMTA 1UEJA 1Z29A 3N2IA 2CHQA 3QJYA 2O8CB 1XXHA 1FTNA 1Z6XA 4PHGA 5K8UA 2HUPA 2MSCB 1CP2A 5AWFC 1NMXA 3JVUA 1OE0A 4NCJA 4PPQA 2CLCX 3QEOA 1XTKA 2PBRA 3AUXA 3WMFA 2Q9AA 4AYTA 1AS3A 3C14C 4FINA 1N6LA 2H92A 3B8HA 3MWLA 4UNNA 5FFMA 5JWHA 2H16A 4Q4AA 5KDDA 3BOSA 2GTPA 1GITA 1RE0A 3HP1A 3DKVA 3L0SA 3X1YA 2UZIR 5DSZA 5TDHA 1XJ0A 3DPUA 4LRWA 1ZAKA 4BFYA 5CB8A 4AKGA 2CE7A 4V0ME 3DMNA 5B57C 1LF5A 1SVKA 1T5LA 3BGWA 2IEYA 5D3QA 4KVGA 1F60A 3B78A 2YC4C 3LXXA 2OSBA 1XNJA 3CX6A 3FMIA 3T5DA 5IF9A 1IN5A 2G1KA 2HYDA 2QQEA 3Q9LA 1GILA 2GCOA 4DLYA 1RRPA 3CH4B 1IAQA 3LV8A 1G3QA 3ZLJA 3IQWA 5FTNA 4G5SA 3GLGA 5J4VA 2IYQA 3WNDA 2A5YB 2BKEA 2KWIA 5DLQC 2XSZD 4JMPA 3CNLA 1Q12A 1Q1BA 1NLYA 2JLZA 3THYA 2ZJ2A 4JLBA 4LBZA 3AP3A 1IM2A 1NSFA 4X8LA 1S2MA 1X8JA 1UJ2A 3K1JA 621PA 3TH5A 1ZC4A 2ZI9A 3K8YA 1K5GA 1XXHB 4DT1B 2GCOB 1XJCA 1QHSA 5J47A 1OB2A 2ODNA 4HZUA 4WBSA 4MRVA 2KB0A 2XXAA 2OCAA 2IL1A 2GJ9A 1QG4A 5DYIA 2P67A 3PXGA 1FZQA 1WA5A 2KI5A 3A1SA 4LOAA 4TLBA 3C8UA 2W2VA 3CWQA 3O8CA 4I4LA 2HF9A 1N5LA 2W6JD 2ZI7A 4IOMA 4TMTA 4X8OA 3LX5A 1HQYE 3X2SA 2J3EA 4LHZA 3VFDA 2WBLC 4KSBA 1SVIA 4ESHA 4YXWD 4F91B 2YHSA 3TJZA 2ZJZA 3KKNA 1KY2A 2ZETA 2WAXA 3M4YA 5KU1A 3RNLA 1ETUA 1GDDA 1GAJA 3QOFA 2PMDA 2ZS7A 5CK4A 2FU5C 3DKPA 3ICEA 1NN3A 2AHOA 4HLCA 4OHZA 4A92A 1W0KA 5HPYB 4UNSA 2ZVPX 3UK6A 3SDZA 4YMUA 4PANA 2FPMA 5KSYA 3OE7D 2F1IA 5JWRA 2PMKA 4OKSA 1XD2A 5FR1A 1VECA 3DO6A 4IKEA 2B8WA 4KHZA 3D3QA 1TQDA 1G3MA 1WQ1R 1CRPA 5EJEA 3N2EA 2XITA 2QSYA 4R7ZA 3W5JA 1F2UA 2ZXUA 2GEVA 1TU4A 4EDHA 1HTWA 2ZRAA 4BZQA 2CL7X 1GWNA 1XMIA 1W48A 1ZMXA 3A4MA 4N1AA 1R4AA 3B9QA 3U7HB 1TTTA 1F2TA 1W0JA 4DJTA 3AB3A 1OLOA 1S3GA 4NE2A 1DEKA 4Q4HB 2NGRA 5C4MA 3TIFA 1VDZA 2FZ4A 1Z0AA 2IYYA 4GBMA 2WWHA 4M1YA 1EXMA 1EG7A 3VKWA 3BFXA 4BLTA 3Q5DA 3ADBA 2FEMA 1E79A 2AL7A 4JL5A 2VQSA 3LW8A 4OJQA 3UMFA 3FMPB 4DKXA 1E2DA 1E3MA 1A5TA 4XVRA 3QUSA 1WE2A 3KKPA 5FI0B 2P6NA 2QTFA 1E9RA 2YOGA 2YWHA 2CK3D 2PX3A 1DAHA 1XCMA 2IYZA 1J99A 2JJ1D 1CJTC 2AKAB 2OAQ1 2ZJOA 3AV0B 2V1XA 4DDWA 5BN4A 3IPYA 1IN8A 3TAUA 5EE5B 2RGCA 4EJSA 4JLJA 4DCUA 4DBLC 3B6EA 3CBQA 4TQAA 1TF2A 2ZRJA 3TGPA 5EE3A 3L8YA 3FGNA 4IVQA 1ZBDA 2RB4A 5ELXA 2ZJ8A 3E2IA 1MOZA 1NVVR 2BMDA 5L3QA 4LYJA 3DDCA 4PSVA 2QBYA 4II7A 2L0XA 2XAUA 4MRRA 3GLFA 2IS2A 2LKCA 1JQLB 4PZLA 4OQLA 2IC5A 1Q57A 4L4UA 2QM8A 5IK2A 2DHRA 3H86A 4PC1A 3VKGA 3VR5A 1XD9A 2DFLA 2GZAA 3EX7C 1G4AE 3DHWC 1W2GA 3RRNA 5C18A 1NVUQ 1PV4A 4YMWA 4LC0A 1KSJA 3WYFA 5A5GA 1VCMA 3UANA 2C04A 2ZR0A 4Z1MD 1YZTA 2QP9X 4NONA 4EQ6B 4A36A 4P4SA 2DCUA 1Z0KA 1KJWA 1NF3A 4LPKA 1N6HA 4QBFA 4QGAA 3REFA 3GP8A 3K70D 3OIUA 4Z8YA 4JVMA 4HI0E 1SGWA 1BH2A 3W9YA 3FHOA 3QF4B 4QJ4A 1CJKC 3TVDA 2DR3A 1GZSA 2WJGA 1OFUX 4QOSA 5JEDA 1G291 4EKDA 5KYKA 4YONB 1J70A 4FMBB 3ZS9A 1TQ4A 4N0DA 3LRPA 1F2UB 3VQTA 3ASZA 4F4CA 2FSHA 3UATA 1G41A 2ERXA 3L0OA 1KI7A 4RD0A 4RD4A 1KZ7B 2R6AA 1A2KC 2AFHE 3FPAA 4H9GA 4DSOA 3AVYA 1S1CA 1G18A 3LBHA 2G83A 4B74A 1KDRA 2IF0A 1OJLA 4M1OA 3EZFA 3R8CA 3PITA 2F1JA 5HE8A 3U3KA 1OFTA 1P2SA 3EIEA 1U2RA 2IUTA 4TYPA 1AZTA 2K5UA 1H8HA 1Q1EA 5B30A 4TTQA 2VIIA 5FOVA 1U8ZA 3KXLA 2VSXA 2HXYA 1Z2CA 1P7CA 1WCV1 1T4GA 2J5XA 4BFWA 3VNVA 3ZZUA 2HCJB 1E99A 3AKEA 4DDTA 4F93B 1VYTA 1EWQA 1ZCBA 4ABYA 2GETA 1DELA 3AUYA 4GI7A 1KOFA 1PLKA 4W5WA 1OPXA 2VSOA 3IQXA 3L0PA 3V4RA 3MGCA 4LHWA 3PENA 3QNUA 4G5RA 1XFAA 4MDFA 4XSGA 5DN6A 2ZE5A 1CEEA 1Z8FA 1J90A 2I4IA 4Q18A 2PLFA 2Q21A 4MA4A 4D4MA 3C5HA 221PA 1CF4A 2NPFA 1OFIA 1S4QA 3RS3A 4EFMA 5KNCA 2R9VA 1CR2A 1GP2A 3IEVA 5J5CA 2QL6A 4B3GA 1XMSA 2DWPA 2CK3A 2PCJA 4NPHA 3MRSA 1XJQA 1FL9A 3AF1A 4M1TA 3CKLA 1P60A 1KI4A 2FGKA 1SKYE 4POAA 1G4UR 4TSFA 5FUYA 3GLIA 2W83A 3ZS8A 1NP6A 2Z6VA 2ZTSA 3IEUA 3UMSA 3VTKA 1GRNA 2JLVA 1U8YA 3S1AA 1D9XA 3GPLA 1L8QA 4BQSA 3QQ5A 4HLQB 2OLJA 1Z08A 3PUXA 3EPJA 5JMTA 5EZ6B 1EGAA 1TU3A 4LJ9A 4ZKEA 4AI6A 1JBKA 2HCBA 2W00A 4TLDA 2O8FA 4LBWA 4TL8A 5JRJA 2GK7A 2ZJ5A 5FUVA 1GL7A 3U6KA 1P62B 4JVLA 1COWA 2WSSA 2EFEB 3A4LA 3KB1A 5AR1A 1OT3A 4CT5A 2QAJA 5LBIA 3TMKA 3NEYA 3NHAA 3WP0A 2QP4A 2AWOA 3NWJA 4M1SA 3F0TA 1EFCA 5AUPB 3SJZA 3K0CC 5A4JA 1TEXA 2HEIA 3WNBA 4R71A 1KK0A 2Z43A 2QNRA 2EYUA 4OI4A 8OHMA 5IHPA 3K0SA 4QM7A 3HYRA 2CMKA 4QJ5A 4ZCIA 3BB3A 3QVVA 4LY6A 1F5NA 3I8XA 5HE9A 1FTSA 3CRW1 3C7KA 2ODBA 1JI0A 2V54A 2FSGA 2G77B 3UWOA 3R9IA 3D8BA 2TMKA 3B82A 1ZC3A 3VR4A 2J46A 2QMEA 2WWIA 4GOJA 2R6CA 2JCSA 4QKQA 2BEJA 1TPZA 4G5QA 4CZ2A 3EIHA 2PJRA 1NNEA 2WMOB 4MRSA 5EUQB 4D4KA 2RCNA 2W6JA 3LDAA 1UPTA 2GXAA 3UXMA 1UKYA 2A9KA 2ZS9A 1GL6A 1Z0IA 2NZ8A 3TAHA 4EPTA 2O5VA 4DCNA 1IN4A 2Q0HA 1JNYA 4IXMA 2IF2A 2OEPA 3T34A 1YHNA 3L0IB 3R9XA 2R6DA 4MRPA 4RFSB 1X86B 4Y0VA 4ZDIA 4GP7A 1TNDA 2V6JA 2GVZC 4XVQA 3K0AB 3PEUA 2A78A 3O47A 4S35A 1ZNZA 5JRZA 3U4QA 1B0UA 1G5TA 4Q4HA 3T06B 4DUGD 1H65A 3BE4A 3QEJA 4EPYA 1N6PA 1OF1A 1YR9A 3K0EA 2E1RA 5HTKA 4TYYA 3RS2A 2REXB 2QROA 1NG1A 2A5JA 2YOFA 3T61A 4ACAA 4LJ6A 4OQFA 4NCNA 5CLLA 4MKHA 3E1SA 4UNPA 4LYFA 1AZSC 2QENA 4A9AA 1U0HC 4QM6A 3IKJA 4PPNA 4MYCA 3SBEA 1JAHA 3PQCA 4QGHA 5FTJA 5G40A 2J87A 3QKTA 1S0UA 4Q21A 3VX3A 4C0AC 1NN5A 1HT1E 1EFTA 2C98A 4TWZA 4NHOA 3VR6A 3N70A 3CPEA 1HT2E 4OK5A 1L4UA 3RVBA 5JJLA 4BPBA 4D2IA 3ADCA 2WIBA 2A30A 3HWSA 3W3AA 4KBFA 4P4SB 1U98A 1ZM2A 4B76A 1XEWX 2BJWA 3FKSD 2QMOA 2C95A 3LAWA 3VU9A 3QBTA 1AJEA 1HE8B 3T5GA 2CE2X 2GF9A 1IXRC 3FE2A 4B2IA 4GSYA 4CEJB 2WWGA 2RGXA 4WW0A 1XU4A 2OUKA 4Z1MA 3RSOA 1H8EA 1XEFA 2AX4A 4B3CA 4N3NA 1KGDA 3QF7A 3BH6A 4TMKA 2ORIA 4LHVA 3I3SR 2VHUA 3ZIAD 1BO6A 2LCFA 4FXPA 3TSZA 4UJ3A 4AURA 3GLFE 1ZM4A 3QIAA 2PEZA 5UKDA 1DPFA 1F6BA 1GTVA 1D2NA 1J8MF 1YZLA 2ZRNA 4KFUA 2F3TA 4WIAA 1IY2A 3GLIE 1UADA 4Q1FA 4BRWA 1OH6A 2RAPA 4NH0A 4M8NE 2FWRA 2V8OA 1C1YA 1UEIA 3IHLA 1Z6GA 2BMJA 3B1ZA 3PG5A 4LK2A 2OBLA 3B2EA 3SFVA 1R8SA 2BBTA 1ZD1A 2XSZA 5F9FA 5JJIA 2QG6A 3TKLA 3SOPA 1G5PA 2FPLA 4M22A 2IHYA 2R8RA 2HLDA 3GLGB 3EZ9A 1RVDA 1E0AA 1VYVA 3TBKA 1UAAA 1KJZA 2C8VA 2J45A 1IONA 1ESNA 2QPTA 2A5FA 1CR1A 2FDCA 5FUWA 3D7MA 4JLAA 1QVRA 2AD5A 5FR2A 2G9NA 1YE8A 2AK2A 3UG7A 4A82A 2XB2A 2J7KA 2OESA 2ZJBA 3Q7PA 3CNOA 4P33A 4DLZA 4K81B 2ZRLA 2YWGA 3UG6A 4D81A 1YR8A 1GM5A 4KSCA 1Z22A 4RKEA 3CX8A 4DRZA 4DLSA 4E07A 4OHVA 2WWWA 4RD1A 1X8KA 1W5SA 3X1XA 2JATA 4JJKA 1QHIA 3RC8A 4CGZA 5CDFE 2CDNA 1ZCAA 4CDGA 4O2RA 1BKDR 4NU0A 4C0BA 1II8B 3H1TA 4M1KA 2QPAA 1Z0FA 2FJUA 4LJAA 4PC7A 3KJHA 5J4LA 3A1TA 3EAQA 3M0EA 4LI0A 3O8DA 5EXSA 3KL4A 3U7GA 3E5HA 2W6ID 3CNNA 3A58B 4IDOA 5B64A 2JDID 3GFOA 4Q7JB 5JI2E 4HUQB 1OV4A 4GL2A 1NKSA 4FD2A 1TUIA 3B5JA 1AN0A 1OFHA 1Z2AA 2CNWA 2ONJA 3KJEA 3BFVA 4JKYA 3ADDA 4JLOA 4P4UA 1T8UA 2VP2A 4QHTA 4XWAA 4D25A 1SVLA 4PAQA 1OIWA 2XJ9A 3GFTA 4D4LA 3GLIB 4NP6A 1VKJA 3MJHA 1BS1A 1KKLA 4RY2A 4TQ9A 5EP4A 1OKKD 4IOKA 4NYIR 4KFSA 1Q3TA 4AYXA 3KKMA 3TW8B 1H8ED 4A0RA 2BKUA 3OIVA 5KSZA 2ZYTX 2DY1A 1DTSA 4F4JA 1JR3E 1BYUA 4D82A 1T0HB 3UMRA 4DHEA 3AF3A 3I1FA 2QI9C 2JAQA 4RCYA 1NKTA 4BFSA 1QBKC 3SZRA 3G0HA 2BIFA 3GJ8A 1HQCA 3ADKA 1ONBA 1LY1A 2NO7A 2NTYC 2OLKA 2W0MA 1HY3A 3HPRA 4M4SA 4R2HA 2D62A 3REGA 5KHOC 4XJXA 3RAPR 4P31A 4TLCA 1IHUA 1DE0A 4EPVA 3H2YA 1E2LA 1CR0A 2CJWA 1JEEA 5LPNA 2CXXA 2WVJA 4UJ5A 3PJRA 3TK1A 2IYWA 2RH5A 4CT4B 1A82A 1Z0JA 5HR5A 1T3LA 1EFHA 1P2TA 1R0ZA 4IVRA 4UKDA 1A2BA 2CBZA 4C7OB 4DLXA 4HUTA 1MKYA 1D9ZA 2YNMA 5FTMA 3P20A 5IT5A 2H18A 4AC9A 3IILA 3LXRA 2YWFA 1R5NA 3GEEA 3BAFA 3EARA 1DAEA 5JS7A 2JLUA 2FH5B 1G8FA 3OIWA 3TNFA 2B6HA 4QNMA 2G0TA 1HEIA 1UBEA 2ZI3A 2HT1A 1F3OA 2YJTD 3Q7QA 1P9WA 2ZSBA 2WKRA 3FOZA 2PT7A 4XVUA 1UBCA 1DARA 3A1VA 3C15C 4LDJA 5TARA 4DLTA 4DLWA 2RMKA 4A0FA 4KFTA 5CIWA 1RRCA 3PR1A 4BEBA 4TSFD 4E5UA 3C16C 1Z0DA 3CZQA 1ZW6A 2ATVA 5KNDA 3QENA 721PA 2QUZA 1GIAA 3VHXA 5EXTA 3AKCA 2ZJAA 3QXJA 1OHHA 3TE6A 3K70B 5GJBA 1E79D 4PXAA 2J7PA 3W8RA 2WTUA 1CU1A 3IPXA 4DEYA 2CHVA 2X2EA 4GOXA 4HB3A 4MQBA 5E7IA 3R7WA 1LTQA 2ONKA 4EQ6A 3U44B 5DI3B 4BLPA 3NH6A 4XSHA 2ZM5A 1DOAA 5FOSA 4C0KA 2X8AA 4ILEA 3LBNA 5H70A 4HB4A 2NPIA 4F7WA 5A0FA 2JASA 1EFRA 3NBZC 3ZQJA 1W4CA 3CB4A 1X6VA 2QZ4A 5EE0A 4LV8B 3HU1A 2HLDD 5FTLA 1JALA 1QZXA 2ZRMA 4LZZA 2DPXA 3KQKA 2JJ8A 1WMSA 4RD6A 3GLHB 2MMGA 3CW2A 1XTRA 1HYQA 4LUCA 1OXUA 4IOLA 3A1UA 3KB2A 3Q3JB 2JGNA 1E9DA 4JYBA 1O3YA 1E2MA 2CHGA 2ANBA 2VF7A 3MLEA 1ZD8A 5FTKA 4IVPA 4O0MA 4WXPA 1TMKA 4L16A 3F5FA 1T3SA 4F38A 1OSNA 4D6PA 4DIEA 2ANCA 1FMJA 1KO7A 2D06A 3IIKA 4Q4LA 4B34A 3ZD7A 2O0JA 2JLXA 2F7SA 2XTMA 3PEWA 2QTHA 4PQFA 4Q19A 4Q1BA 1DAFA 3I62A 2VL7A 1U94A 4RD3A 4V0KA 3QKSA 5CYPA 4DSTA 1EESA 2FNAA 4JS0A 1RPZA 3NBYC 1MABA 1K6MA 1KMHA 3A4NA 1XEXB 1DAKA 2WIAA 2XOKD 4JKIA 4URYR 5JEEA 1NL3A 2HDNB 3EWAA 1VHTA 1G1MA 3K0CA 1G6OA 1US8A 3AVPA 1LS6A 1Q3HA 1D5CA 5KSPA 1L4YA 1MABB 4DCTA 4P4TA 4ESVA 4MRNA 3SYLA 2IYUA 5CB6A 1YZGA 1ZU4A 1UDWA 3CPHA 3KTAB 3ICQB 2F1HA 2Z4RA 4Q9LA 4H1VA 2FFBA 1GNPA 3FYHA 3EA0A 4FW9A 1WF3A 2OCPA 2XXAB 1D6JA 2WJJA 4URWR 4GDFA 1DVRA 1ZINA 4JLPA 2PX0A 4MYHA 4Z8XA 3ZIAA 5JSZB 3VMFA 1E4VA 3GJXC 5IK2D 2D7CA 3AQ4A 3Q72A 1WP9A 2BC9A 4OI0A 2ZRHA 1BOFA 1DAIA 2G88A 2ZAMA 4JYCA 1KSHA 1IN7A 1M74A 2WZQA 1XX6A 4HAUA 5FOUA 1Z47A 3B85A 4PC2A 3TQFA 3ZJYA 1E2QA 2J41A 1W5TA 3CX7A 1Y63A 2FPKA 1KI8A 4KLZA 3LO5A 3LQRA 2QQ0A 4AKHA 3BS4A 4M1MA 2DB3A 4FCWA 4MITA 4EFLA 4BFUA 2F55A 3BD9A 1OH8A 1NBMA 2RGNC 1YRAA 3VHLB 3U2QA 5M04A 1QVAA 4PO9A 3T15A 4BFXA 3IUYA 5DO9A 4B3BA 4RZXA 1J2JA 1XZQA 2Z83A 3K9GA 5F3WB 2VSFA 5GJVC 4DC9A 2QN6A 1ESMA 4WZAE 2XB4A 1DAGA 4Q4JA 3RS7A 1JJ7A 4WXRA 3TVTA 1PUIA 1XXHE 1N3BA 2C78A 5H1YA 1XPRA 3BC1A 4ZCMA 1QHGA 1NVVQ 1Q44A 2V55B 2QGNA 2NO1A 1N25A 3WRXC 1YZKA 4TLAA 3AF4A 1XPOA 1A1VA 3EZ2A 2JA1A 5GJWC 5L3SB 2ZYUX 4PZZA 4BRUA 1E4YA 4C3ZA 3TR0A 4DWJA 1U99A 3RWOA 2DFKB 3WYAA 4DUGA 2WJHA 1ZUIA 2QAGC 1SHKA 5FOXA 4KODA 1L7VC 4HYYA 2O0HA 5TVKA 4M9XA 4L9SA 4LJ4A 5L3RA 3VAAA 3VR2A 1W49A 4QHYA 1QHXA 1E0SA 5JCZA 4ZIRB 5FBQB 4CEJA 1E2NA 1U90A 4OQMA 1QDEA 1ZRHA 3V9PA 2AFIE 3BERA 4GNKA 3RRZA 2ECKA 1WRBA 2GEDA 2F3RA 2IYSA 2OE2A 3KKQA 3TUIC 4PO8A 2VH5R 3EPLA 4FMCF 4IFEA 3CZPA 1HE1C 2CVHA 2N1BA 3Q5EA 5HCNA 3SBDA 5JECA 4FMCB 2VHCA 1E9BA 2IUUA 2F6RA 3HPQA 4B32A 4FN5A 4DLRA 4A2WA 4JBYA 1HURA 1U9IC 4AKEA 1CXZA 2O8CA 1OIVA 4NYMQ 3EWSA 1E2GA 1JR3A 1KTVA 1TF7A 1YVDA 4ZPXA 3WNCA 4TYWA 4CF7A 1W47A 1R5BA 1QG2A 4TMZA 2JJ1A 2J0UA 2ZU0C 1G9XA 4C9BA 1W1WA 3FKQA 3W6NA 3WYGA 4QGFA 2CVFA 1SXJD 2IYXA 3MMPA 5DGXA 2FF7A 1D2EA 2I1VB 3OFND 2P5TB 4MKIA 1NN1A 3KFXA 5FH9A 2QAGB 2RGDA 1I4TD 3SN6A 3DM9B 1NIPA 1KMHB 2GJ8A 3EIQA 4Q1AA 4PX9A 4QGGA 4RFVA 1JB1A 3SYNA 4B33A 2FSFA 5H8WA 2ZRCA 3FWYA 3RC3A 1JEDA 4Q02A 3LY5A 2V6IA 4FIDA 3MSXA 5L8VA 2ODWA 3BH7A 5CYOA 1FX0A 2ZSAA 2HF8A 3SR0A 1LFDB 1T5IA 2YV5A 1SXJC 4HATA 2NQ2C 2XJ4A 5GVSA 3LLUA 4Q00A 1G64A 3LW7A 3DM5A 4Q03A 5BWMA 3SJAA 4XWOA 2BCJQ 1P61B 4FI3C 1W4AA 5EP1A 3UWKA 4B71A 4BLSA 3U3JA 3QY0A 4OQXA 2NMVA 2MSEB 2ZVQX 3U3RA 5GADl 2GA8A 2BM0A 3UIEA 3CLVA 2AN9A 2QMUA 3QE0A 4LGMA 4XOIA 3THXA 1P73A 3W6PA 2ZQ5A 1N0UA 3HYTA 2GHIA 5FBWB 4FWTA 3AVWA 1FW6A 3CRRA 4HLUC 4DIDA 2IK8A 5FOWA 4JVNA 3NBXX 1NY6A 2FMXA 4MKGA 3RWMB 4GPTA 5J4KA 4MGKR 3RHFA 5FBVB 4GZLA 3AH8A 3WMEA 2BJVA 3A8TA 3IO3A 1DAMA 4H1UA 5KTYA 5BQ5A 2GK6A 3GJ3A 1YZNA 3MCAA 4HDCA 4MH0R 1MT0A 3C41J 4OBEA 2XNDA 2GNOA 4ITRC 2GZHA 1S9DA 1Q1ZA 1P2VA 4EJSC 4FCTA 4C2UA 4JSTA 4HB0A 4WZ6A 5FPTA 1GOTA 1ZIOA 3AVQA 2H5EA 2Q3FA 3I92A 1KI6A 5TY0A 3TUJC 3MD0A 4L8GA 3G5UA 3JZMA 3GLHE 2C9CA 1H8HD 3EA5A 4OL0A 4C0JA 1E9AA 3AGPA 1R5OA 3KUDA 2O8DA 2FFAA 4DXAA 1Q21A 3ZZTA 3GCGA 3PUYA 5CITA 4Q47A 4LWZA 2NO9A 3FFAA 4ASUD 2ATXA 2OCYC 4LC1A 4OHWA 1KO1A 1G3UA 1TEVA 1TUEA 1VCIA 2DFTA 2V7QD 4QBGB 4BFVA 5JZVA 3N5CA 3FTQA 1WXQA 1OXVA 2BCGY 1RFLA 1HH4A 2CCGA 2IYRA 2JJ2D 2LWIA 2VHTA 3MWKA 3NXSA 3QPVA 4PAOA 3RABA 3G82C 1ZM7A 1OH5A 1NVWQ 1OIXA 1YJ5A 3QG5A 4O25A 4URXR 1US8B 4AG5A 1E1RA 3RS5A 2YWEA 4LJ5A 2YYZA 3DOFA 3M1IA 2B7BA 3RS4A 1WBDA 3L8ZA 2VF8A 4G3XA 2ZI4A 521PA 1FUKA 1M7BA 1YQTA 2GZDA 3NTUA 3PFIA 4Q66C 4X8MA 4PFSA 5CM9C 2ZSEA 2C77A 2CJWB 1S8FA 5SZJA 2CLSA 3RS0A 1FQJA 1VG1A 4CW7A 2QRNA 4AIIA 3CRVA 1GG2A 1T9HA 1MO3A 4HAXA 2VHJA 2O52A 4LHYA 4MGZR 1IQPA 3BFKA 3BB4A 3T1OA 1NI3A 1U81A 1XEWY 3HDTA 1W4RA 1E9CA 3ZD6A 5FPSA 3U4QB 1F2TB 1FP6A 2N46A 1D8TA 1AGRA 1OXTA 4PC3A 1OW3B 2FZLA 4XTRA 1TAGA 3I4LA 5AJVB 3ZQ6A 1W7AA 1KIMA 3KX2A 3SEAA 4DCSA 1UBGA 3VKHA 4G5OA 2WOJA 1W36D 4HAYA 1FP7A 3H4MA 2J0UB 4NYMR 2R2AA 1R7RA 2FV8A 2A7QA
chains in the Genus database with same CATH superfamily
4ACBA 1KYIA 1H0RA 2E1PA 2V7EA 4PZYA 5IAGA 2BM1A 1WVIA 4O4IF 6PFKA 1YACA 1ZNWA 3EMKA 1T0JB 1APBA 4L9AA 3KSDO 1ICEA 3AGQA 4FFBB 2LKDA 2FMIA 2BGGA 2Q5IA 5GGYA 1WPGA 3T7RA 1SHUX 3N2GB 4K26A 4N40A 4EB0A 1N0HA 5EWLB 3DTNA 1MX5A 2Q45A 3PWTA 4K7JA 2BVNA 4UU7A 4ZV9A 5ALWA 3RBVA 4X24A 5KNBH 3B5EA 1MO4A 1E2KA 1PFQA 4ICIA 3KQTA 4FVTA 3TL2A 4OATA 1I1HA 1JB9A 3RV4A 3ZE2B 5BYKA 2GWHA 1EWYA 3U6BA 3E84A 3A0UA 3RLFA 2R6R1 1N3LA 5I48A 3HBNA 3IAS1 1RPZA 4LGVA 2P9FA 4OX9B 2QUHA 1S1MA 3EYAA 3K94A 3L4SO 4HYQA 4CEIB 2C9YA 5DLDA 2PH5A 5K05A 1GD1O 3QP9A 1QU2A 3ABOB 3KLMX 3UF0A 4HYTA 2XRMA 1PBTA 2RGUA 2BAGA 3QFFA 4A27A 2B4AA 3L0DA 1DQSA 3EGCA 4US2R 3OJXA 2VPIA 2QRZA 1LV8A 1C7EA 2D59A 3Q0EA 3A3PA 4I36A 4J16C 5HUQA 1MZPA 4XLTA 3GA0A 5TB5A 4Z54A 1SUSA 2BYTA 4PHFA 2PZFA 2PX6A 2PDAA 3BXGA 5CNMA 1ADYA 4BECA 2G6TA 4B7CA 2XT0A 1Z17A 4IEIA 4EG5A 3AEQB 4FJ1A 5FPKA 1RPTA 1R9NA 4PQYA 2X41A 1EFPA 2ZEJA 3D6FA 4FJ0A 2IW3A 2VQ3A 1N57A 1VHQA 3LNCA 1MG0A 3BD8A 3G89A 3BSSA 4A3SA 2G36A 1IB0A 2J09A 5DH9A 1ILWA 2LZ0A 2A1TR 1ZM9A 1SIWA 2FZ5A 3RANA 4N6NA 1SY7A 4JJ8A 2P3OA 5I51A 2XZLA 1Q1GA 2DUNA 2GBLA 2AJTA 2C7GA 5BWOA 2QSZA 4GUAA 2K6GA 3B13B 3F7NA 4BQEA 1YR1A 5IYZF 5KYWA 2ZIZA 3ESRA 4V03A 2VZ8A 3CYFA 2JA2A 4TT3A 1V5IA 5EZYF 4FOOA 5HOQA 1IZZA 4YYEA 1Z35A 4CM8B 1MC8A 5JD4A 5JC8A 1U0JA 5AVXA 1EGHA 1OC2A 2LD4A 1RCFA 2ETVA 1UPXA 2MYTA 4Q9IA 4E5PA 1Z16A 4WOPA 1ETHA 1FY2A 4PXSA 4KN5A 2NSDA 2VNHA 3OEHA 4PAGA 4XIYA 4RDHA 5AXBA 5H68A 2LDXA 1AN9A 2AN3A 3H9QA 5DNWA 2QVYX 5D2CA 2FN9A 5KMGB 1NNUA 2ZIVB 3CX4A 3CO0S 4JGGA 3NHBA 4X7RA 1DIRA 3KT0A 1WEKA 1QH9A 2O1EA 2VH1A 3OX2A 4MRAA 4C21A 2JVJA 3AP2A 4OHOA 1ZIPA 5L3ZA 3JYNA 2IEAA 3EQ6A 3U13A 1ADBA 3KS9A 3LRTA 1V4BA 3EZ6A 2JLQA 2FXVA 1L7AA 2BFBB 3ONWA 1QG0A 3TLXA 3BYZA 1PJSA 4YP7A 1P0CA 4IF4A 4A2PA 1RT9A 3ESXA 2ODAA 1Y34E 2FA9A 3G8BA 3MOIA 3PTLA 1W0JD 4TL7A 5AJXA 1SKYB 1SMKA 3Q98A 1RBZA 3Q0TA 4DAEA 4F8JA 4HWPA 1XFDA 3HY6A 1VPWA 1XJWA 3ID6C 3JQAA 2OG2A 4ON9A 4BP3A 4ARUA 3CJQA 1GTJ1 1M6WA 4NQRA 4MYUA 1WUTA 5B2ZA 1TF5A 2ORWA 2OV2A 4H7FA 1OLUB 4GYYA 3T12A 4E5SA 5T3UA 2ALJA 2ZR9A 1SM4A 4IDAA 1UL1X 4LOLA 4A1FA 1U0LA 4P6VF 4EG8A 3CE9A 4LHEA 1C5KA 3BZBA 2YXDA 4D0RA 5JDIA 2BKAA 4QSHA 1K97A 3N8KA 3ZTYA 4O1IA 2ERCA 2GD6A 4GRAA 3SYTA 421PA 4EVSA 3W7AA 2XD4A 3FOFC 4JV5B 1QANA 2NZWA 4WSOA 2HHCA 1KNXA 3BIJA 4LKOA 5AHWA 3G2JA 4Q4CA 3L4JA 4KGVA 4KQFA 1RAGA 3HJFA 3ETDA 4AN0A 2DPMA 1RRGA 2RHMA 2X2OA 1AIPA 3QXGA 3KYDB 5FUXA 3FHTA 4XJVA 3OZUA 3V8QA 5LA6B 3FPLA 3REQA 3DZDA 4H08A 4HNAB 2OO5A 2O06A 3OHMA 5DBGA 1JJIA 1LSOA 3D81A 1KO4A 4A5SA 4J0CA 4KVAA 1YNOA 2APJA 4B6SA 5B5SA 2GGSA 1M2VA 1ZGGA 3B52X 4MMXB 2LUOA 4YV0A 1G8GA 1Q1NA 1PL7A 2PLAA 1XCGB 4XFDA 3X2EA 4IHAA 4MR9B 1TMGE 4OYLA 4S04A 2C3PA 1C4KA 1TX4B 5FNVA 3PVCA 3LD9A 3LX6A 3T7DA 1QRUA 3HNRA 1XDWA 1K7CA 1ZOLA 3TEJA 3RYFA 1PJ2A 4P81A 1EBBA 1ISHA 1TD9A 3PUVA 1SUPA 821PA 1NC1A 1VIAA 2A4MA 1K89A 1QGOA 2Z95A 1JFLA 1MRSA 4PLFA 1KZHA 3UGTA 4INAA 1RIFA 2XVMA 2HJSA 3I0MA 2XTNA 3CSSA 3MFYA 2DH5A 4HWRA 4Q9KA 2M6SA 2QX8A 1LQ2A 2NQ8A 4JYAB 4B6QA 1J00A 5KYYB 3T1TA 1M1YA 4TYNA 1T3HA 2E5LB 4B6FA 2H0AA 3GH3A 3RW9A 5E9AA 3I4FA 3QE9Y 1L2TA 4HNRA 1SWWA 1EP1B 5TX7A 5LQRA 4B3MB 3WK7A 4GM1A 5ALGA 4HDRB 1XAIA 1AQYA 3G8CA 4M55A 4Q48A 1GZVA 1SBYA 1R9JA 1HKHA 4PHCA 5I6DA 1YUMA 1P31A 2OP0A 1YK0A 3FPBA 4OO3A 1EFUA 2QGZA 4IHKA 4LMRA 5HKKD 4NBSA 1W96A 1K3FA 3GO4A 2IXGA 1H2BA 1X42A 3K1YA 3WBKA 4J76A 3TIGA 3VJLA 2ID4A 2WSSD 3SNHA 4Y9SA 2IEZA 3RRYA 2MJLA 1ULTA 2PRZA 5J40A 3WS7A 2BTEA 2G3YA 1MC4A 2GJSA 3G68A 4TZ0A 1AH2A 1IZ7A 2PM8A 2PBLA 3SZLA 5BRAA 4EOGA 3LQQA 3JATA 5C81A 1MIHA 4AD8A 1X9HA 2GM5A 5BSFA 5L40A 2DVMA 3PKIA 2XVZA 5C2JB 3L2OB 3DE5X 1SZJG 4X6LA 3QFSA 1ZRSA 3I58A 1UKZA 2C99A 1Q0ZA 7ABPA 4D8XA 3D2BA 4YALA 1UIMA 2WTMA 3W8NA 2YWBA 4PGHA 3VR1A 2VXYA 2ZU6A 3VX4A 4N3GA 1PGQA 1Z7WA 1G21E 4DA0A 2J4DA 4C6SA 4EPWA 1SXJA 1XIVA 3KPUA 4M0DA 4Q1EA 4DSZA 3HK2A 1P9RA 4PCLA 3SQXA 1SEVA 1EBFA 4PS0A 1KY4A 3DMTC 2QN3A 4YRMA 1D4AA 5IN5A 3NAMA 1WUYA 5K1ZA 5E4YA 5JHGB 1Q0RA 1KE1A 3WHLA 1X8LA 2GXSA 2R1TB 4XR9A 2Q41A 2BZSA 1QX3A 2NNLD 5HF5A 3STWA 3Q8XB 4REMA 5HQTA 1UBSB 1W59A 3JTEA 3LYLA 4L6AA 1X74A 2JCYA 5EJ9A 1VQ1A 2MHCA 3R75A 5AI8A 2Q6TA 4HSEA 3L9XA 4EYOA 1VRCA 2PUJA 4FBMA 2ZR7A 4QDZA 1L5KA 1JPNA 4S0XA 5GONB 5KZMB 2AX3A 3QWFA 3NJ4A 4DGSA 4I6EA 5CW2A 1M2OA 2BBWA 2VA8A 2ZT5A 4W5HA 5KVQA 3SHQA 4FDAA 3TZ6A 3FPSA 4NOKA 3L7YA 4FTWA 1IVYA 3JWEA 1BN7A 3AEKA 3PVSA 2H4FA 4I99A 4XDYA 8LDHA 4YDSA 1P5FA 1ZMOA 1JQJC 2ZPTX 2OILA 4MHOA 1JG3A 3EXHA 3QX7A 5DHSA 1AT1A 3NASA 1SVMA 2XIQA 1O95C 3DBLA 4H0FA 2M9MA 3PEYA 4ALIA 5FHRA 4KI0A 1XXLA 2PGDA 2IBMA 1A88A 4D97A 4B79A 2ZE7A 2WWYA 3C7DB 4HDNA 3ZWNA 1Y8AA 4NBRA 1R0BA 2DF8A 1T2EA 1VA5A 1ZD9A 3UGKA 1WSBA 1WDTA 4LOKA 4EHIA 4GE3A 5DP2A 3DGEC 3T1QA 1EPUA 1SVOA 2FDXA 2PT5A 1HO3A 5HS6A 4HNTA 2NIPA 2D2EA 5DNCA 3FZEA 2AW3A 3E35A 3DSRA 2IXFA 1H2EA 2FRXA 3IX7A 4ZQHA 1JIUA 2Z2IA 3RRBA 5DV9A 1O94D 1B0PA 4GMDA 3SPXA 2H4WA 4NCAA 5DM60 1I3CA 4C4SA 3EY9A 1ZPDA 3NGMA 5LQCA 4EJ6A 1P19A 1WBBA 2WE8A 4F5ZA 3FRHA 3C39A 3RH0A 4CI9A 4YC7A 1ISJA 1O87A 3BHIA 2OO7A 3R8FA 3AONB 2YJGA 4QXAA 4Q0MA 1WXHA 3ES9A 1P9NA 3K9HA 4MV8A 2WKSA 1XAHA 1JSLA 2F3SA 4JFAA 1CV2A 1Y7PA 3FMGA 1QVWA 2EWMA 2Y2VA 3DD1A 1M7GA 1R4MA 4C0HA 2D1FA 2NTNA 3I12A 3B53X 4R2KA 5EFOA 1E2FA 3MJCA 4NCIA 2Q9BA 5KKAA 2HYIC 4RAQA 2OXFA 3COVA 4MGYR 3DUFA 3DWIA 1H2FA 4UBKA 4WESB 1FFDA 4YHHB 3IEPA 1FSFA 4M0KA 4AULA 2NQTA 2Y8EA 4PC6A 4ZALA 1GRCA 5EAIA 4NYIQ 1YZQA 4BQQA 2OXCA 3PEVA 1FDSA 4R68A 2VJOA 3MTJA 1URPA 3FYTA 4HLDA 1QGDA 1VCOA 4PYNA 1UKVY 4YJ2A 1ANKA 3C2QA 5FPHA 5BNFA 2ZRKA 3EZXA 1U31A 2UVPB 1G3IA 2JIPA 1EDZA 2A94A 2Y1DA 4N47A 1N6IA 1M2FA 3U62A 1E3LA 4INJA 4X1KB 2A84A 2POCA 4IAOA 1QFZA 3VC1A 5LQUA 4UTXA 2N0SA 1VGVA 3NO4A 5F5NA 1Y7IA 1MMFB 4MEJA 4QPJC 3W34A 4YUZA 1PI3A 3AI3A 1SIBE 1T29A 4B6OA 1NYRA 2QTBA 3RYCA 4HTFB 4OHXA 1KK1A 1RWPA 1SHZA 4BDTA 4NYJR 4MTCA 3HA3A 1DIAA 4F06A 1QF9A 3AJEA 1THGA 5F5LA 4H7JA 5F12A 1DV2A 4R2LA 3WLEA 4DMRA 2YZMA 1Z3IX 1T9BA 5FAKA 1QHEA 4JN6B 2AC2A 3HL0A 4QD3A 3HBMA 3SC4A 3BFPA 4IXNA 1DRVA 4HN9A 1PQ4A 3BL6A 3PHGA 4HH0A 2DHEA 3CX3A 5EC8A 1KH1A 3U7EB 2YXNA 1KBOA 4NBLA 2P7IA 1R66A 4ASUA 2E9SA 1REQB 2O5RA 1L4NA 1RJ9A 1W5BA 2VO1A 3GEBA 5E7MA 1OXBB 1LS1A 1NP3A 5ES3A 5JI3E 4KOAA 1JFTA 4H6VA 2PWYA 1UPAA 2HI0A 2YS6A 4PIVA 3GGSA 3DA8A 3O2QB 3G9UA 3KXPA 2WU3A 2CUKA 3IIMA 3I9OA 4Q34A 2X1MA 5BP7A 5LMZA 1ECBA 4IP0A 4QXOA 2IHUA 1HE5A 2WF7A 1TDJA 4H3VA 4N5NA 3FPGA 4S1VA 3OVMA 3UV7A 4B4UA 1SQ5A 1U7WA 2ZBVA 3QKSB 2NZUG 3V2UA 4G01B 1KQNA 3AR2A 5A9SA 1XTSA 3W06A 3IESA 3P2EA 4JT2A 3RJ5A 4QODA 2AI2A 4BKQA 3ADOA 2VXOA 4C0WA 4YUXA 1M33A 2AVNA 3Q4GA 3S8EA 3OA0A 1RHKA 3WAKA 1LV7A 2ZCVA 1T3ZA 1BYIA 2EW1A 4RKYA 4RZ2A 4G41A 5CM8B 4BLWA 4OFWA 3VH1A 2IYTA 2O8EA 3TW8A 3KQQA 4FSDA 3HM9A 3EPHA 4MKFA 3UQYS 5KREA 2Y0DA 3GD7A 3UK1A 5DNYB 4NBWA 3SE0A 3V7YA 4MAFA 2OZEA 1CZKA 1BDMA 3H84A 3PQ4A 1T26A 1OD6A 2RHOA 3DDUA 2O0KA 4NY1A 3QVJA 4MW4A 4WVLA 3SMQA 3T9FA 2A9JA 4MPRA 4D9KA 7REQA 1ZL2A 4UTOA 1LLCA 4IWXA 4IFIA 3THRA 1I2CA 3W9UA 3FLBA 1TYEB 2H1OA 4KQKA 3R2JA 1A1SA 1HMPA 1IN1A 1MRZA 4JVSB 2XT9A 3MINB 5JAPA 3WWZA 3NUGA 4U00A 4PZAA 4RMJA 4U2FA 3SM3A 1UK7A 2E18A 2PH1A 3WQQA 1WZEA 5A3JA 2QW0X 4NNJA 1RM3A 1YB6A 1SB9A 1AG9A 2XQGA 5IJWA 2Q9UA 5IP5A 4QTYA 4MW0A 3B2NA 1MQAA 2JKVA 4EG4A 4K5QA 2XEXA 2VPPA 3MS2A 2PR7A 1DJQA 3X1JA 2HJWA 3TTVA 1I2AA 3N74A 4FFSA 3ZDQA 1OASA 4EUNA 5I9SA 3TSCA 1DU4A 1R6UA 5A9RA 4E11A 1KJYA 1P45A 2NTJA 3R5FA 5LD2B 4WZZA 2CL6X 4FIZA 4RQTA 1K7YA 3T4EA 2C2GA 2G70A 3ZG6A 1V9CA 1V11B 2A35A 5DHUA 4HX5A 4DV0B 2DWCA 1CLUA 5BR4A 3HZRA 4QU8A 3IE2A 4NPAA 4GUDA 4HEA6 3LI2A 2COEA 2Q2VA 2G25A 3OCXA 2YWRA 3AEUB 2BMEA 4HD8A 3DE1X 1CEQA 3SX2A 4W9NA 1AS0A 5FL7A 4FHZA 1Y37A 2JJMA 3MTEA 1O94A 3REOA 1E3DA 1U28C 1V39A 5G41A 3L18A 2JHGA 1OA0A 3GI1A 5KC9A 4E6EA 3GLVA 5ALEA 3WLHA 3V00A 4F4DA 4BX2A 4Y9DA 4UBIA 1QFMA 1G21B 1P2UA 1OYWA 4XZ3A 4FDLA 2V6FA 5D3MA 3L07A 5REQA 4DM4A 2NV2B 1XRRA 4BX0A 1J23A 1XCJA 3IH5A 4AL4A 1VG0B 4ECAA 2B94A 1OLXB 2F1RA 3QPWA 4G07A 4J0IA 5T64A 2VS1A 1TCVA 2QE7D 1TKAA 1XGKA 2QIOA 3KV3O 1J0CA 3NGLA 4XFJA 1LJ8A 4BCBA 1FVOA 4CYMA 4TSKA 3I6ZA 4A8HA 3THXB 3L79A 2A2ZA 3DAFA 4AZ0A 4I0WB 4UVDA 3TEFA 2P2ZA 2R6GA 1SUIA 1HL3A 1KDTA 3OA2A 1A9XA 3F5QA 1L5HB 3I2GA 4Q7MB 2UUPA 1DO0A 1U9ZA 3Q0IA 4GI1A 4WTOA 3SYKA 4KYUA 2XYQA 2HWXA 2WF5A 2CUZA 4C7BA 2EQBA 1M2HA 2PRJA 4MLDA 3WQSB 2ZIAA 4M9QA 2GAOA 3GEGA 1P6XA 4TQUS 2O3RA 4B3FX 3GRYA 3ICCA 2GNAA 3PGJA 4C30A 3NIBA 2CVZA 3SC3A 2CDRA 2DERA 3Q2OA 4J90A 4RCVA 2I3GA 4GDMA 2AN1A 3K4QA 4U2CA 1Y81A 4AK9A 1CULC 4AY6A 1ZJYA 2R62A 3NRJA 1BMQA 4UUPA 3QXXA 1R4ZA 1CY4A 4U7PB 3HCRA 4RAOA 1C0PA 2QD2A 1GLNA 3LA8A 2ROQA 3IIJA 4IDBA 1E2EA 3GJYA 2QE7A 2IP4A 3G7SA 1QGAA 3JS5A 2FW0A 5AJTA 4EABA 1EQUA 1GGNA 5CBPA 3VDRA 2B2NA 4LWOA 5AW7A 4RJKA 4IH1A 3KEGA 5BUSA 1ZY2A 4X85A 5AKHA 4CVNA 1EUDB 4GYWA 2HTEA 3CISA 1T8SA 1VGQA 2OZLA 4I4TB 1PT7A 1YXMA 1O95A 3WXMA 2HIMA 4ZD6A 1E66A 3R5KA 3KWMA 5JCJD 2O5EA 2VDRB 4QRHA 3DOIA 3GG2A 3IVRA 3O26A 4ZOLA 4NBUA 5HQ3B 3A70A 2VLIA 3K1ZA 4QXRA 3UHJA 4IWYA 1SA0B 3T35A 3J7TA 3F3YA 1NBMD 1NY5A 3ESYA 3KXIA 4HAZA 3ZLUA 1SKBA 1KFEB 2PWPA 1SC3A 2CF6A 4XGRA 3KQHA 2FUCA 1HYHA 2CL0X 3UCEA 3QXCA 2P9TA 3SHTA 1FDRA 1NQAO 4LJ7A 4LOHA 3U4DA 3THWB 3N6VA 3USZA 2NU9A 2XV1A 1HA3A 3FYCA 3DXFA 2MSDB 2V7TA 3TSWA 5DWQA 3QELB 5AJZA 5LQAA 3DZ8A 2CF5A 1RXVA 2IZ6A 3TLGA 1H3EA 3FHLA 4RTRA 3F1LA 1CJVC 3ZI4A 1EX7A 1UMDB 2WSLA 5ALTA 1TZJA 1SOMA 3COWA 3IELA 1NKVA 4QOIA 4XGIA 4C06A 1JDUA 3RAEC 4M99A 5CDYA 3ND8A 3PQFA 4MPPA 4GM4A 1UDXA 1RLOA 3ANNA 1T9ZA 1DJNA 3DC2A 2UZ1B 1CE8B 4NBKA 4D9EA 1XPUA 1V25A 4DLUA 4P0TA 4QXMA 1YFZA 3H7IA 5AKEA 2I78A 1XMVA 1GLVA 2AG1A 1QGED 1HLDA 1NFQA 4Z9BA 4YR7A 2EF0A 1IJKA 1RCTE 2E6UX 4LGYA 1C3LA 1DEAA 3BRWA 3OZXA 3AIKA 3T7KA 2PGAA 5JO0A 4JUAA 1L1FA 3GRFA 3LX4A 1IOZA 1DO8A 3EPPA 4KNWA 4D3YA 2C83A 1Z39A 4PZ9A 5A2GA 4DE5A 2A59A 1B42A 3OLXA 1NWCA 4KDRA 1CDZA 5IZ4A 2EEPA 2WJ4A 1Y80A 5LD2C 1R50A 2ICAA 5KUTA 2HK9A 3CY6A 2OM2A 4C5BA 1ADFA 1P17A 2A0YA 2GEUA 4E5MA 3QI2A 1IY0A 4BE9A 2Q5OA 4F6LA 5JJCA 1E6CA 1JZQA 4WCVA 4KN6A 3I1IA 1U2PA 1SXGA 1KK3A 1M8GA 3LUFA 3V97A 1SVUA 4CEHB 3CLSC 3H9UA 4C3UA 5LA6F 3K05A 3QA3E 1T10A 3NHLA 4N0MA 5F4BA 2QTZA 2HWWA 4CMHA 2IXEA 4MR7B 5K0GA 1CZOA 4IHJA 3EW7A 5IG2A 2F3PA 4AUMA 2ZRDA 1P7ZA 3DEKA 3ORYA 2C4NA 2I1QA 2GFHA 4MW7A 3IAHA 3C6MA 5EJ2A 2HHLA 1TVMA 4HFMA 4TXJA 3DHEA 4GZ5A 4XDZA 5C0OE 3D9QX 3SEFA 1T2NA 1U9IA 3LA6A 3BK7A 5U4XA 4EJSB 3I72A 3T7SA 5EHZA 4XOUA 3FR7A 3G1TA 2IHZA 2X1LA 1CJUC 3NHWA 2EL9A 2H2FA 4N0EA 2BR4A 1DRJA 1NIJA 3H5WA 2OUIA 1E3EA 4G63A 2C9OA 3P0RA 3O8RA 2PUGA 1E1NA 1G7SA 1ACJA 2Z09A 3C1AA 2W58A 5FEUA 4CKEA 5C8VA 1ZK0A 4QJ3A 3MGAA 2E49A 2C7QA 3TB4A 5BN4B 1SBHA 3WRVA 3KJGA 3L82B 2HQRA 4BGVA 4EB3A 4CIBA 1X7DA 4LJ8A 3LC7O 3DP7A 2AV6A 2GCIA 3L7KA 1IUOA 5EQTA 5F73A 3R9KA 3I32A 4IQ0A 1LPAB 1J8FA 1JG6A 1JFSA 4B6JA 1UXKA 4Q7LA 5IM5A 3LUPA 4HH3C 3FUCA 5F7OA 5ICGA 3A2NA 4Z6KA 1PR4A 3T3IA 4L8VA 4Q7KA 4RHYA 3B6MA 4NICA 1XDBA 1Z6TA 1KH3A 4PZCA 1T36A 2ZAGA 3OO1A 5C31A 3LKVA 1JECA 1P1BA 1T6YA 4W8GA 1GCIA 2IY7A 4AX8A 1YOVA 2KSQA 1WDWB 3CINA 3C74A 4GVXA 3DFUA 4OL9A 4IF6A 3WIBA 4B3DA 4DMGA 4F9EA 5C8ZA 2I6UA 3JQ7B 2NYUA 5CVTA 1WU7A 3OAAA 3D8UA 3RB8A 2V7UA 4YV2A 1YTUA 1GQ2A 2R0QC 4Z51A 1LB1B 2P90A 3A1CA 3BMOA 2ZYHA 3SCZA 4OLHA 1DCKA 2RH9B 2IDJA 4GRDA 4ZRDA 1GQOA 4EF6A 3MWYW 2ZDQA 1K1EA 3RJZA 2O2CA 2GTIA 4AJ4A 5FPQA 4LW8A 2VSNA 3CE6A 5E8RA 3LBIA 2WF6A 4O4JA 1B4DA 4JUIA 3IOBA 3BORA 1GZHB 4NFHA 2ECOA 2AFHA 2OCBA 3RYTC 4K05A 1JKFA 2VVTA 3ZI0A 1Z88A 4JJFA 4DCCA 4D44A 3KHTA 2WVHA 4HRVA 3B9PA 2IUSA 5DHAA 3GVHA 3K32A 3UW1A 1N2JA 1TJYA 4X1YA 3MT9A 1JEQA 1HUQA 4QBHA 1JF8A 3UOGA 3IERA 1KL7A 4BXOA 4BVHA 5D7NA 2QU7A 4OBWA 3KSRA 1BCRB 1KKMA 2W6CX 4QHSA 3T7EA 5EY5B 2J3DA 4Q5IA 1JMYA 2RHDA 1WV0A 4ND2A 3ZBQA 1ORRA 3E9DA 2ZSHA 4RANA 1EK5A 1K9VF 2P4HX 3QYJA 1NBWB 3VR5D 1KRHA 2FWBA 1DO2A 3KVYA 3K5HA 1FU4A 3RVJA 2AI1A 4E6PA 4G36A 2B5VA 2REOA 4BEJA 3S99A 1PLLA 1HBJA 3FKJA 4KB5A 1Q91A 4NCKA 4QFMA 4XX0A 3JU3A 3V7NA 1KQFA 2PGXA 2GZ2A 1DRWA 1N8KA 2C8JA 3GEHA 3OLCX 4MJ7A 1JDTA 2X1HA 3FPFA 1FPMA 4A73A 4E70A 5J59A 2J7PD 4UBNA 3FBTA 4Q37A 2JGMA 5AK3A 3OOEA 4L4ZA 5DT2A 5SZHB 1NF8A 5BMVA 1KERA 4HBZA 4BNMA 4AG6A 1FLNA 1U8AA 1USWA 2V1UA 1QU3A 1K5PA 4FYIA 4KXWA 1SOVA 3R7SA 3WKAA 1UFOA 3GZJA 4L9RA 1E6UA 2K2WA 4LQDA 2PNJA 2FRDA 3ORRA 4J2OA 4KJZA 4U4AA 1R10A 4ZO6A 1JEYB 5FRDA 3AKZA 1TL7C 5HZKA 2VHQA 1Q16A 2FPWA 3P45A 4NECA 2ZSFA 3WMXA 1PV1A 3N6RA 4GX0A 2IS6A 4TSRA 2ZDGA 1E59A 1DPGA 1SUAA 1V7PC 1RHQA 3CLTD 5K3SA 4V0NA 4A6EA 3NOQA 1J6UA 5K0SA 2Q50A 1EEHA 1QWOA 1ZWLA 2NAFA 4TYMA 2WU8A 4MWDA 3CRMA 3RTCA 4QATA 4HY3A 1YBFA 1EM6A 4K6HA 1K8QA 4C4XA 2VKQA 4IYRA 4L76A 4CCYB 5KQLA 1KHHA 5ALPA 5I9IA 1MJ5A 3H16A 2AN4A 2CWWA 3FCYA 4YRKA 4YXFA 2NSJA 1V47A 1E7QA 5FAXA 1B6SA 1P5ZB 2FY8A 2OG1A 1F12A 1X1RA 1Z8DA 2DM6A 2CLHB 1FX0B 1K5DA 2DBYA 3OY2A 1N4AA 2OBXA 3V1MA 5F98A 4Y9RA 4AY5A 2W6PA 4IIJF 1EB9A 4IMIB 2FDRA 2GTHA 2MYPA 1HGXA 4KWHA 5CB4F 4BBJA 1YKSA 3B89A 3HRIA 3ZV3A 5DISB 2B99A 1QHYA 1QE0A 2RD2A 3ET4A 3BWDD 5TNXA 2H2DA 4OBXA 2XEDA 4EB6B 5C8YF 1KAHA 4NG5A 5IJ9B 1AKEA 4RMIA 4QVGA 3ZBTA 5JTUA 2PUEA 2I7XA 1LSSA 3DV2A 2BEVB 2HTFA 4RK0A 4EUHA 5ED0A 3S2IA 3KQLA 1KHTA 4IUBS 1V5WA 4RSMA 5FI3A 3WTBA 2ZRBA 4X92A 5E6UB 3M5CA 3V4ZA 2BSAA 5GOZA 1TLLA 2A5DA 1IBLB 1OZHA 5A4IS 3AQIA 1G8YA 2QTVB 4RVUA 1QYCA 2NU6A 3EA4A 4UZSA 3WY9A 1RKVA 1ESEA 4Z9AA 5IJAA 3OEWA 2E7ZA 2IS4A 2AMVA 2ZYVX 2XDQB 1IK6A 4WNAB 4XD7D 2JARA 1PG0A 2V7WA 1P4RA 3O4IA 1I36A 1L0BA 3VOBA 3WMRA 1KK2A 2QMYA 2YW2A 2HA6A 4EFDA 5BN5A 3U1BA 3C6QA 1JIQA 3KQYA 3B7GA 2O7NA 1T91A 4BN5A 4HDOB 2R86A 2A1UB 4ZVSA 3A9SA 4JQOA 1JPJA 4W9MC 4DRXA 3MUFA 2GF0A 4HG2A 3Q7RA 3PYLA 1XZNA 3K73O 2HRDA 1UEJA 1YDWA 4RLFA 3L4EA 4JXKA 2VOEA 3O5AA 2B5WA 4BN4A 1FTNA 1U8CB 4XXHA 3KKEA 2HUPA 2MSCB 2RAVA 1CP2A 4C4AA 1ORWA 1PFWA 2VT2A 1NMXA 1LH0A 3I3OA 4MW1A 1U04A 3CMCO 5KNDH 5KVSA 4NCJA 2F48A 3ND6A 2Q6LA 1XTKA 1UXIA 3LQ4A 1PSDA 3WMFA 4EHLA 5AOCA 3B8HA 1J42A 4UNNA 1AKVA 3LDHA 1EA5A 5KDDA 1DKMA 1NJ5A 4YRFA 5IBRA 1K0FA 1RE0A 2GAJA 5EKUA 1PS9A 3X1YA 3E4CA 5BV0A 5KTSA 4KPUB 5K45A 4LRWA 4BFYA 4AKGA 3PS9A 3N75A 5JO9A 2AFIA 4EW6A 1T5LA 1V2HE 4LF7B 2QLNA 3ZWWA 2ZJFA 2QE6A 1F60A 2X9GA 3IFSA 3LXXA 4R8VA 4RPJA 2IUYA 4OU5A 3T5DA 5IF9A 1Z5VA 1IN5A 3KLNA 2QQEA 4IPTA 1MPXA 3O90A 3Q9LA 4HBGA 5H16A 2PNFA 2BZGA 2PYZA 3QLUC 2I3ZA 4FU0A 1Z4KA 5DM2A 4E32A 4OKNA 1IAQA 2HC9A 1ZN9A 4U3JA 3LGXA 3ZLJA 5FTNA 4ZVLA 3ZE9A 2Z8YM 4XYGA 3GLGA 3SG0A 4PCVA 3RT7A 1JE0A 2VRCA 1GYQA 1W8DA 4LZLA 2HY7A 4DMKA 2A5YB 1XI2A 2V0NA 1ZRNA 1U7DA 2NYAA 1ZUWA 1Y6FA 1IULA 1Q12A 5CGQB 3U5TA 1A2OA 5TGDA 1UM9B 4Q16A 1U0SY 1I4WA 4NEQA 4OMCA 4EKIA 4JLBA 1MAHA 3F4LA 4C1NA 4F3CA 5TF0A 1FSGA 2H7CA 2AT1A 1IM2A 1ZI9A 4UUMA 5ALZA 2WWVD 1IWPB 1X8JA 1ZESA 1U8XX 2EJVA 3CVJA 4JHLA 4UUQA 3H0EA 1KEKA 4P93A 4UAGA 2F4NA 3EVAA 2GCOB 1N8TA 2CFTA 1QHSA 1NRXA 3RLIA 3RG2A 1VE5A 3RUDA 1OILA 3M7IA 3UFBA 1RMQA 1S8AA 4QWWA 5DYIA 4EEZA 2DPYA 3OY7A 4E2ZA 1OY1A 1R6TA 1WQ4A 4TLBA 2KI5A 2B82A 3O8CA 3EXIB 4I4LA 3IAM6 1N5LA 1QZUA 2TYSB 2W6JD 4TMTA 4X8OA 4COOA 4KMMA 1Y82A 1SUBA 3DEYX 2M6KA 1NASA 2WQZA 3Q1KA 1HDIA 2NUAA 4XGKA 3DDHA 1YNSA 2WBLC 1SVIA 2JFWA 4KSBA 5CLHA 4YFYA 5FORA 4YPOA 4YXWD 3DE0X 4F91B 3TJZA 1H1LA 1QO7A 1KY2A 4BEVA 2WAXA 1DX6A 1NDUA 4FOSA 4I3GA 1ETUA 2QRVB 1GDDA 1IXKA 1GAJA 1O8BA 2J85A 5CK4A 4EVIA 2FZGA 3OZCA 4EL5A 2FU5C 5A7FA 1BS2A 1ISPA 1GPLA 2Y1WA 3D3WB 3INTA 3BWYA 4L5CA 4BUCA 2P1ZA 3ZCXA 1SKMA 3ICEA 1WAMA 4XYLA 4UNSA 5HRUA 5EIBC 1B26A 2ZVPX 4HLNA 4UUNA 5JR3A 4E3ZA 4YP9A 3DPIA 4UQPA 2HU2A 4BJ3A 3D6AA 2RK6A 3OE7D 2F1IA 3R5JA 2I6FA 1L5WA 5ICCA 2G4CA 3B36A 3N8DA 3QVGB 2JH3A 4OKSA 3ZGOA 1SUEA 5BUZA 3GGOA 1ZL0A 2OB2A 3K1AA 4HTAA 3UNXA 2Q5JA 1DDOA 3EK2A 4DCGA 5CBKA 3UXHA 4YJGB 1DSSG 1G3MA 1GADO 4FB4A 1WQ1R 3NANA 4QT0A 5EJEA 3DMPA 3W5JA 2VI5A 1RWWA 1S5PA 4MV7A 1SCBA 3ZQ4A 1PWZA 2Q5LA 4KKXB 4UU8A 3S70A 4BZQA 1GTRA 4EHDA 1GWNA 3A14A 4QGSA 3JQAD 1NMEA 3E3OA 1R4AA 3EFHA 3V5NA 3HHEA 3AV3A 3ZY6A 5K4GA 3UMYA 1FQWA 2P4UA 3BSWA 1SUDA 3FPHA 2QMZA 3AB3A 1WCIB 2I8AA 2WWRA 3KRTA 2X0IA 4ZHQA 4ZI7B 5A5FA 3D59A 2GEJA 3CLKA 2X76A 3N05A 4KDFA 2NGRA 1NURA 4Q4HB 4RS4A 1LLQA 1UKBA 3GMDA 1M6EX 2FZ4A 2X3FA 4RK5A 2QW1A 1NP7A 3F47A 3BXOA 2IJGX 1A9XB 2WIFA 3MK31 2VJMB 2G1PA 4XQEA 3WWPA 2KPOA 3DE6X 4IGFA 2FEMA 1WB4A 4R8LA 3CVXA 3KYCB 2FE1A 3LW8A 3R24A 4DKXA 4E0BA 2DC1A 1D4FA 2PS0A 2NTEA 1ZK3A 2BFFB 2JCXA 4PG5A 4E1BA 4TMYA 2PXXA 3RNOA 1CYEA 3T0FA 2CK3D 3PPXA 4TM7A 3SAJA 5M5BA 1XCMA 3BVPA 4D98A 1CJTC 1P91A 2AKAB 2XF2A 3ZWCA 3TAUA 1WVMA 1KYZA 2HK7A 2V7BA 4GOMD 2BZ1A 3IUMA 3G02A 2EGGA 3VTFA 4DCUA 1TYDE 4ECEA 2J0EA 4DBLC 3B6EA 2O05A 1TF2A 2ZRJA 2HUNA 2QYSA 4G97A 3DE3X 2RGWA 1M6VA 1RZVA 2XE4A 2CHFA 3FGNA 4IVQA 4X3OA 3ZYZA 3I6QA 5A4MS 5ELXA 3EH1A 4JT9A 1QF6A 4XX0B 1NVVR 4K2HA 5AVTA 1MEJA 4BMNA 5L3QA 2DWUA 4DIMA 4QQRA 2IS2A 1MVLA 1F8FA 2LKCA 3R0IA 3DEIA 4BVJA 2OHVA 1Q57A 3HBAA 4KN9S 3NJRA 4F12A 2IUEA 4G4GA 4I14A 1O97C 1WDKA 3GBSA 5NLLA 4XGNA 3DTVB 4LCEA 2Z30A 5LJLA 2IHKA 4LDZA 4BV8A 2UYQA 3EX7C 4H16A 6AT1A 2WUFA 2ID8A 4F9TA 4RTPA 3LT4A 5EQFA 2QTWB 4QULA 4R3UC 3S28A 5SYMA 3D5TA 4YRIA 1W73A 2I76A 2ZR0A 3GL9A 4P3PA 4RW0A 3UANA 1B7GO 3E8SA 3X44A 4A36A 4HX9A 4P4SA 3SICE 4LPKA 1N6HA 3K0KA 3GP8A 1BHO1 1TK3A 2FX2A 3Q5GA 1NQVA 3ZE0B 3OIUA 1UDBA 3IMKA 2D5CA 1ZD4A 3GZNA 1BH2A 3W9YA 3DE4X 2VEOA 5ES4B 1DGQA 1CJKC 4OB6A 1CETA 4OJMX 1GZSA 2WJGA 1OFUX 3NETA 4NJEB 4ILKA 5CP8A 3TMAA 4EO9A 1FYEA 5AK4A 5EWMA 2LXNA 3DKKA 4ZCRA 5JEDA 2LBPA 1GQFA 4JI7B 3ZS9A 3LF2A 1TQ4A 4N0DA 2AE2A 4CQNA 3LDFA 1F2UB 1ZMTA 3ASZA 3N87A 3M3HA 4I46A 4F2PA 4F4CA 3OM1A 4KDCA 3UATA 2ZZMA 1RBYA 1G41A 3TJRA 2HMTA 1KZ7B 5IKEA 1UWCA 2XCUA 2BD0A 2GK4A 3RVKA 2XUKA 3AVYA 4GLFA 1EK2A 2AW5A 1R5JA 1S1CA 5AHRA 3LBHA 5LQNA