2PEZA

Crystal structrue of deletion mutant of aps-kinase domain of human paps-synthetase 1 in complex with cyclic paps and dadp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
RGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Structural mechanism for substrate inhibition of the adenosine 5'-phosphosulfate kinase domain of human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 and its ramifications for enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pezA00
2J87A 1Z0AA 5CK4A 4NCHA 1KZGB 1Q12A 4F92B 1XJQA 4DHEA 2OBMA 2RGNA 1YZTA 2QM7A 2BIFA 3MAAC 3QKUA 3KTAA 5KPJA 3U7GA 4TLDA 3W6OA 4ARZB 3RANA 1XD9A 3GEIA 4GT1A 2GZDA 2ZJ5A 3AGPA 2IWHA 5FBQB 2ZI3A 2J7KA 1CJMA 1KI6A 4JSTA 521PA 1JR6A 4C0SA 2O0HA 2GESA 4HAWA 1L4YA 2JLWA 5F9FA 1KAGA 2OT3B 2FWRA 2GAOA 3EW9A 1HQCA 2ZI9A 1J99A 2H92A 3A4LA 2J7PD 4MYTA 1YQTA 3LFUA 2FFQA 4E09A 2H18A 3BK7A 2BHRA 4BFVA 1G41A 4JL8A 2QMEA 1IN5A 3GLIA 2BWJA 3GFTA 2RMKA 3K0AA 2J1LA 4DLUA 2C9CA 1E9EA 2OCAA 4V02A 4OJKA 2B6HA 2W00A 3GFOA 4Z8YA 5LB2A 4FMBB 5FH9A 1OFHA 3BH0A 3EPHA 2GBLA 1W5TA 4GMDA 5ELXA 1OFTA 3GQBA 5EP3A 3WNBA 2VP6A 3WBJA 1MO4A 3PEWA 5FOWA 2BBTA 4A9AA 1SVOA 2OHFA 2VHUA 1DAHA 1IXZA 4YMUA 4B76A 5L3SA 2Z5FA 3SJAA 4L5BA 1QG4A 2JJ1D 4V0LA 3T34A 2RB4A 5EZ5A 1L7VC 4TYWA 4D4MA 3ZD7A 1ZD9A 5KNDA 1E1RD 4OQNA 5DO9A 5KUTA 4NBSA 3SOPA 3CH5A 4AYWA 4GL2A 2EQBA 2NG1A 3PEYA 1W5SA 4F38A 2R44A 2W6ID 4AKGA 1W0KD 4CIDA 1AS3A 3BE4A 3PR1A 2DFLA 3CNNA 4QGAA 1ESNA 1ZU5A 2HT6A 4QRHA 2QP4A 4ZIRA 2L0XA 4JJZA 2UVQA 3D6TB 4TL6A 2FSIA 2DR3A 2XTNA 3ASZA 4HDQB 4S2EA 4Q01A 4TTPA 4CW7A 4JT4A 1TU4A 3EC1A 1X86B 4EFMA 3K09A 4JS0A 2IX3A 4EQ6A 1RVDA 1KK1A 4HSEA 3GJ8A 1S4QA 3ZQJA 1NVWQ 4PX9A 4Q1DA 2OLKA 4HLUC 3GLHA 2J0QA 4DCUA 3QEJA 2OV2A 2C77A 2PCLA 4GRAA 4PC2A 3CPJB 1U9IC 1W36B 5CB6A 2F9LA 3ETLA 3LV8A 1ONBA 4LJ6A 1KYIA 3DMNA 1GOTA 2OBNA 1QBKC 1YJ5A 2GRJA 1VCMA 3AKDA 4DSNA 4YMWA 221PA 5LD2B 2FPLA 3SN6A 4NU0A 3R8CA 4PPNA 2VTKA 3BH6A 2RGDA 2HDNB 3TW4A 3GJ5A 1W4AA 2DWPA 2PMDA 3NWJA 4TWZA 1G3RA 1E99A 4FN5A 3WHKA 4F4IA 4QHYA 2XOKA 4AIIA 1Z8FA 2FDCA 2QE7D 1U2RA 4URUR 4Q00A 1FQKA 2ZRMA 4YC7A 1U81A 2Q9BA 3K53A 2CL0X 3CW2A 1M7BA 2ZVPX 3T1TA 4NONA 1JEEA 1HV8A 2QP3A 4C0QC 5KNCA 1TUEA 3B6EA 5KPDA 1AN0A 3HR7A 4HB0A 4OI4A 4PO9A 4IEEA 3KL4A 2J3EA 1ZBDA 4JIMA 3OFND 4Q4JA 4TT3D 3VMFA 4DC9A 2YWGA 2ATVA 2SHKA 1MABA 3CZQA 4PC1A 1Z29A 2FZLA 3BERA 4V03A 1XD2B 3EPLA 2OUKA 3OAAA 4FXPA 2P6UA 4BLPA 4JL6A 4V0ME 4LHWA 2WWYA 4HZUB 4LBWA 5AR1A 3KKNA 2NZJA 3WP0A 4YQFA 5JS8A 4A0FA 1KO8A 1KAOA 2LCFA 2XXAA 4A2WA 3W6PA 1KO7A 2XGJA 2ZSDA 3IUYA 3PV0A 3O8CA 4M1WA 5B57C 1YZLA 2IYUA 4P3YA 3ZVRA 2D3WA 1DG1G 3P4XA 2VSFA 3U44A 2V3CC 2JGNA 3RAPR 1NN0A 1SHZA 2AKYA 4KHZA 5FTMA 1CKEA 1UM8A 1WDTA 3PFIA 4EJSB 3TSZA 4YXWD 2WSMA 2H57A 1W2HA 2EYQA 1KI7A 2ZAOA 2Q9CA 2QAJA 3AB3A 3BGWA 3RRNA 1ZVQA 4P33A 2P5SA 2JATA 2F1RA 3L0IB 5DHFA 1DADA 4I1VA 4EFNA 4XSHA 3D8BA 2WTUA 4KFRA 2XZLA 2ODNA 4HB4A 1PZNA 4M9SA 5FL3A 5FUWA 1CU1A 3LNCA 5CM8B 3NBFA 1A82A 3ADDA 1BMFD 4AYXA 5F9HA 2QAGB 2FX3A 3FVQA 4II7A 4BECA 2RHDA 4HAXA 2ZS7A 5GADl 2ZRDA 3AF2A 1IAQA 2ZJYA 3R9IA 3C4JA 3OIUA 2JJ2D 2R62A 1FMJA 1P60A 1EESA 4L9SA 2P3SA 1XTIA 4OI0A 5FUVA 1RFLA 4NDZA 4DUGD 5L3RA 4Q7LA 1QHNA 1HE1C 3A4NA 3EA0A 2GVDC 2WOJA 3QXSA 4RD0A 4C0KA 2GJAA 1N6RA 3EX7C 3KQNA 5EJEA 1OW3B 2B7CA 1M34E 3V4FA 2JAQA 1VIYA 2YYZA 1N6HA 4XJXA 1OPXA 2DY1A 3KJEA 2REOA 2O52A 3A4MA 4Q4HB 1GAJA 1Q20A 1IJFA 3T12A 4JLDA 4AWXA 4KVAA 2OE2A 4O0MA 5B58C 1XFAA 4CEIA 2RGNC 3A1SA 3D7MA 3I4LA 3QBVA 1LS6A 4PZZA 1MOZA 2Q21A 2IS4A 1QHSA 4HB3A 4ESHA 5DHAA 4Q48A 2ZE6A 3E5HA 4P4UA 1F6BA 1E69A 4DCNA 2GXUA 1S96A 3OESA 4V0OA 3VR2A 4AD8A 3B78A 4IVQA 2OO7A 5EZ6B 3ASYA 3DDCA 4K8OA 2O8FB 4HAUA 1UKVY 2VSXA 5FOUA 4B2IA 3AKEA 2GZAA 2Z6VA 5AK0A 5FI1B 1XXHA 1N6OA 2RGXA 5TXGA 4B75A 3L82B 1CJKC 4XTCS 3QNUA 3AH8A 4MKGA 4HLDA 2ZRAA 2GBLC 1TQDA 1Z6GA 5DI9A 1ZP6A 1U98A 2FPMA 5TB5A 2BJWA 4LZZA 1Z2CA 4DSOA 5JCZA 2WZQA 3FB4A 1II9A 2W2VA 3FHCB 3CONA 4G5OA 4DSTA 2AX4A 3LW8A 4LV6A 2C99A 2XZPA 4GPTA 4JLPA 3U2QA 3KFVA 3GJXC 2DPXA 1OH6A 4A6XA 5G3YA 1N0VC 5DGXA 3AKYA 3LBHA 4NMMA 3BB3A 5AUOB 1E9AA 3DZDA 1D2MA 4MRVA 3SYNA 4AYTA 1I4TD 1TEVA 3KB1A 1MO6A 4CEHA 4GI7A 4MA4A 2J0SA 1N2CE 2IYQA 5HPYB 4TMTA 4JJKA 2WOOA 1UBCA 1VMAA 4LRWA 3KKOA 3PCRB 3RRMA 4DRZA 3Q85A 2N46A 2Z0MA 3DOEA 4Q7JB 3UWOA 3CR7A 4Q66C 2BMJA 3RHFA 2GILA 2OCYC 3H4MA 3SDZA 5FPHA 1OHHD 3ZVNA 4BFYA 1ZU4A 5F98A 1DAEA 3O8DA 2GJSA 1KNXA 1NKTA 3K09C 3LVRE 4LV5B 4PZYA 2O8DA 3EZ2A 3QKSA 2VHQA 4PO8A 1E9SA 1S9DA 1X1SA 1XTSA 3T15A 2JIZA 2RGCA 4PPGA 4IRUB 3R7WA 1S3SA 4IVRA 1YU9A 4GDFA 4KFUA 2R2AA 3MG9A 2ZRKA 3L43A 4FCTA 2HV8A 4DLWA 1Z06A 2G6BA 3QIAA 1RRCA 3P1JA 4AK9A 1LY1A 3QF4B 2JLZA 3BBPA 4XVRA 3ICEA 2BMEA 3LQQA 5AJVB 4XD7D 1LS1A 1OYYA 2ORVA 2FFBA 3T1VA 1QZXA 2QQEA 3CO5A 1GL9B 3SR0A 2A5YB 1KZ7B 1ZINA 3ADCA 2ZM5A 3C7KA 1KK2A 1OXTA 5KHOC 2K5UA 4JT2A 1W0JA 4KO8A 4Q03A 1VTKA 5FUXA 4BLQA 3ND9A 1N6NA 3LY5A 3W5IA 2J9RA 3RLFA 1KDPA 5KTYA 1IY2A 1Z6XA 2QA5A 3A1VA 2QROA 3FYHA 1NMZA 1U8YA 3LX5A 1KHTA 2XOKD 1XDBA 5EE5B 5IF9A 4R98A 2JJ1A 4X8HA 3VX4A 2ZSAA 2ZRGA 3W3AA 1NMYA 3PG5A 3VU9A 1TL7C 4KSCA 1NBMD 3AF1A 2PLFA 3A1WA 3G5UA 4PSKA 4W5WA 1D5CA 3A36A 4POAA 2ZUCA 3R9WA 1W0KA 2BCGY 3CNOA 3HU2A 3HU3A 2ZTSA 2ZITA 4LPSA 3W6NA 2YWHA 1XPUA 1X8JA 1Z08A 2CL6X 2IWRA 1G3QA 2AK3A 4HYYA 1RJ9A 1S1MA 2ZVQX 2FSHA 2HLDA 4M9XA 4OKSA 2JLYA 2QY9A 2FSFA 3QENA 4ILEA 3U7HB 4B3DA 4H1UA 3U60B 4Q4AA 1MO3A 2IC5A 1KO5A 2ZE8A 4P4SB 5D3MA 4GMXA 3U7EB 5KNBA 2O8EB 2W2TA 4M2LA 4M0LA 4ZO4A 4KU4A 1UDXA 2VHTA 3UANA 1F2TB 1H65A 4FW9A 4Q02A 1MO5A 2ZRPA 2WAYA 3RSOA 3A37A 3VFDA 1SVMA 3C8UA 3MWJA 4TL9A 1HYQA 2GETA 4QBHA 4D6PA 4DLXA 4UQOA 1QF9A 5SZIA 2IK8A 5BXQC 2IA5A 1DO0A 1V43A 3SJBA 3QJYA 4BFUA 3K0FA 2GZHA 4RD3A 4HUQB 3ONWA 2R6CA 4RZXA 3IGFA 3WYFA 3LXXA 1UEIA 2WAXA 3KQUA 2QUZA 1GNRA 3SBEA 2EFCB 1IQPA 3LRPA 3R20A 3O8RA 1GUAA 1PLKA 4MKHA 2Q3FA 4JLKA 3KTAB 4A0GA 5IRCD 3NC1C 1UBGA 3IIJA 5J47A 4JSYA 2IYRA 4B44A 1O87A 1P4SA 1KSHA 1KI6B 1N0UA 5JSZA 2N1BA 1JAIA 1WP9A 2QE7A 3L2OB 2OZEA 5GJWC 4HLQB 3H1TA 2FGKA 2EFDB 5CK5A 4H1VA 1FNMA 5JWRA 3TUZC 2ZANA 1Q21A 2QORA 1Z6AA 3GLIE 3U3MA 2OBLA 1Z0KA 4Y0VA 1NN3A 1DO2A 1E4VA 3H86A 5B2ZA 3WNCA 1Z83A 1E4YA 5CYOA 3SNHA 5JI3E 2JDID 3TUIC 3GLIB 3K0AB 2H5EA 5DNYB 2QTVB 3HU1A 3OFNA 1M7HA 4TT3A 5CJPA 1XMJA 3KKPA 3RS3A 4RFSA 2N42A 2ZRCA 1E0JA 3EZ9A 2PL3A 4AKEA 5J5CA 3LBIA 4LI0A 3RC3A 3LWNA 1IOZA 4OHXA 4JKIA 2OAQ1 1SVKA 4OYHA 1G6HA 1R8QA 1KMQA 1TNDA 4PC3A 1D6JA 3NH9A 5BQ5A 3NDPA 3WRXC 1SXJC 5L3SB 4OK5A 1G19A 1VYTA 2RH5A 3EARA 3NG1A 3PEUA 3IBGA 1WBBA 3R9XA 1ZMXA 4B33A 3T35A 4JLOA 4C30A 4ZDIA 3IEVA 1AKEA 1ZYUA 2QRZA 2PCJA 2AWNA 4DLZA 1NMXA 5C46F 2A9KA 1W4RA 4WIAA 2C98A 3W5JA 3WP1B 1R0ZA 4AI6A 2XTMA 1J8YF 1FTSA 2GF0A 2YOGA 1SXJD 4L9WA 3ZVMA 3MLEA 4WVFA 1EXMA 4US1R 3SZRA 4ZIRB 3GJ6A 1G8FA 4U7DA 1OH5A 1F2UA 2DWQA 1G21E 1M8PA 2ZRLA 4ACBA 2XSZA 2X2FA 1N6KA 4LJYA 3UKDA 2AN9A 2ZR7A 2HT1A 2HXYA 4EQ6B 1B0UA 2IS1A 4BZQA 2J0VA 2X8AA 2A78A 3F3YA 4LDJA 5L3QA 2UZ3A 2ATXA 2VP2A 2PJZA 3GLHB 5DI3A 1OIWA 2A5DA 2B21A 5CB8A 4D81A 2WHXA 1BMFA 1PUIA 4IOKA 3REGA 4V0KA 4C0HA 3VR3A 2C2HA 3PUWA 4IDNA 5HTKA 3QEOA 2E9SA 1E0SA 4PHFA 2V6JA 1CULC 1NN5A 1T3LA 3CR8A 1R5OA 4URZR 3EA5A 2PT5A 1ZIPA 2J41A 5AJYA 1TQ6A 2REXB 1GTVA 4UXJA 3T1QA 5JJKA 2R9VA 4LYFA 3X1XA 1U8ZA 2F43A 4LJAA 4DUGA 1FW6A 1JBKA 1VG0B 4PSVA 2ZETA 5FBLB 3CZPA 1H8EA 1E96A 1OH8A 3DEFA 1GL6A 3VKWA 4O2LA 2HCJB 1KO1A 2VH5R 3KKMA 1VCNA 3AVPA 3EIQA 1G5RA 1I4LD 5EP2A 2O8EA 4NKRA 3SHFA 5JEDA 3MRSA 2WWXA 4XWAA 1T0JB 1L2TA 1F2TA 2F1HA 3B82A 5EXXA 4BUJA 5DSZA 5AUQA 2Q3HA 1KMHA 1QRAA 3C5CA 4LOAA 1UADA 5AJWA 4Q4JB 2IYZA 1HY3A 5DYIA 1YZUA 3I8XA 4LWZA 2CE2X 2CLSA 1MABB 4KYUA 4ZCLA 4CEJA 1BKDR 5BW8A 1II0A 4RD4A 3V9PA 5K8TA 2B7BA 2NO6A 5JI2E 3ZVLA 1XMVA 2P6NA 1NG1A 4MRNA 4URYR 2UZIR 2JIZD 4OL0A 2O5VA 2VF7A 4KI0A 2B8WA 3CF0A 4QOSA 3HWSA 5C1BA 2ZRIA 5EE9A 4LK2A 3BS4A 3PIRA 2FU5C 2ZSEA 2XXAB 2JLVA 1VIAA 2ZU6A 3EZFA 5G41A 4B2LA 2BBOA 4M1TA 2E1RA 3G0HA 3NC0C 3U44B 1NY6A 4JLAA 1ZUIA 2AHOA 4E5UA 4A6PA 3CPHA 3T06B 5IHPA 1E1QD 2W58A 2W83A 4PZLA 2JLSA 5FPKA 1VCOA 1NJFA 1E2NA 5FOXA 4BASA 4V0NA 1XJCA 3TRFA 5A4JA 3WNDA 4M1OA 3AVVA 1W0JD 4RZUA 2DFNA 3TSOA 1C9KA 2HYIC 4PANA 4RKEA 2OLJA 3FFAA 4UNRA 3P27A 1G17A 3KDSE 1D2EA 3P4YA 4NYMR 5JFGA 4KBGA 5J4LA 5K8UA 1Z22A 2VIIA 2C04A 4WOPA 4YONB 4URXR 1IN4A 3PITA 4C3ZA 4AY2A 4QHTA 2AD1A 3OE7D 3OZXA 5TV2A 1Z63A 3WXMA 2ODBA 4J0QA 1A2BA 4UJ5A 1CEEA 1FX0A 1U94A 2J46A 1G3UA 1OHHA 1FFHA 3MMPA 1IN6A 3ICQB 1EGAA 4NYJQ 3Q8XB 1W47A 2CXXA 3K70D 4C0JA 2A3RA 2IXGA 1MR3F 4IOLA 3TUJC 3TBKA 3IPXA 4EPYA 3IDQA 2RKOA 3H84A 1GNPA 1G7CA 4KFSA 2HLDD 5AUNB 8OHMA 2ZYVX 4Q1CA 4KYIB 3LVQE 4OQFA 5KDDA 2O8CA 3TMKA 2D7DA 5FFMA 4BLOA 1R0YA 1KIMA 5H8WA 1JI0A 4GP6A 5LB4A 1PJRA 3HR8A 4CEIB 4P0TA 5K8LA 4XD7A 1XF9A 3AKCA 2R65A 3B1VA 1SXJB 1XMSA 4DDUA 5IT5A 5CLQA 3CX8A 1NVXQ 1P3JA 2VP0A 4DDWA 1UKYA 3LO5A 3LDAA 1QHYA 4DB4A 1FUUA 3GLFA 3VR6A 2H17A 3Q3JB 1EFTA 3RWMB 1J8MF 3EIHA 5F3WB 4ITRC 4YMSA 1N6IA 1DELA 2GCOA 3EIEA 4Q9KA 4YDHB 3AP1A 3CRQA 4AKHA 1XXHE 1E2EA 2MSDB 4A2QA 2F9MA 5CIQA 4DWJA 1OXSC 2FSGA 2ZJAA 5M04A 3QY0A 2HF8A 3FOZA 1P9RA 5EXPA 4F4JA 2WKRA 4TMWA 2ZPTX 1XXHB 3IQWA 4HATA 3NHAA 1G6OA 2NO0A 3LBNA 1SVWA 1FQJA 4GZLA 4RJLA 3AVWA 1XEWY 4AG6A 3CB4A 3PUYA 1DAMA 1SKQA 4W9MC 1UKEA 2PZGA 1G16A 4D0GA 1NBMA 1IXRC 1E2LA 2BEJA 4QM6A 1E32A 4JLBA 2XJ4A 4BLTA 4E03A 4DJTA 1W4CA 3CWZA 3DL0A 1IN8A 4JVLA 1YZQA 4RZ2A 4IEIA 3AV0B 1ZM3A 2G0TA 3BXZA 1CP2A 3ZS9A 5G40A 1JAHA 4ZV4A 3RRYA 4G0NA 4OBEA 3MWKA 4QGFA 4AURA 4R2IA 2YINC 1Z0DA 3DKPA 1H8HA 3ZIAD 2HYDA 3FMPB 4ZDWA 2DBYA 5DLQC 2YWEA 1RZ3A 5EP4A 4PAQA 3QXJA 2BC9A 3TE6A 3PXGA 1X8KA 2JASA 1M6NA 4TQ9A 3FE2A 4I1SA 4KLZA 1JB1A 4JL5A 4B3GA 4Q9LA 2ODWA 1HUQA 1U0HC 2G1KA 2IEZA 3K9LA 4Q9IA 3BFXA 1YE8A 3REFA 1NVVQ 2PBRA 2B8TA 4B35A 3ZQ6A 1AZTA 2XB2A 3F0TA 4FIDA 4PHTA 2O8DB 3QKSB 1NIJA 4A0HA 1L8QA 5CDFA 1KI4A 2QRNA 4RD2A 4BFTA 4AKIA 4CT4B 5SZJA 1ANKA 2PEZA 3R7WB 3UG6A 2LKDA 1EG7A 2IYWA 4B71A 5JS7A 1ZM2A 4IOMA 5EUQB 1JJVA 1ZD8A 1XEXA 2NO7A 2XSZD 2YV5A 3CRMA 3QG5A 4QJ3A 2IHBA 3IBYA 2KSQA 3Q7QA 1GG2A 5BYKA 2QP9X 3E1SA 1MV5A 3RABA 3VR1A 4A4DA 4IDHA 3ND8A 4I99A 1SQ5A 1ZNYA 2ZUBA 3BB4A 4DCTA 4DT1A 2WIAA 1FPMA 1XCGB 2ZJBA 4LHZA 1UBFA 2ZJZA 3DOFA 4TL8A 1ZM7A 3LLMA 3WBKA 4OHYA 5A0FA 4FCWA 4BRUA 3S1AA 2JDIA 2C95A 3TGPA 4LCBA 1YZNA 2D7CA 4UNSA 2IYVA 2V7QD 4JZKA 4TYNA 4MUBA 1XWIA 4MKIA 3VX3A 1N5IA 1XB2A 1B23P 2Z4SA 3TK1A 3CX7A 5HCNA 2NIPA 1K5DA 3T61A 2OXCA 4D4JA 2ZSBA 4I81A 1JECA 2QNRA 3IIMA 1H8ED 2G83A 4DDVA 2NQ2C 4Q1EA 2X2EA 1E79D 5EXTA 1EFCA 5DISB 1OH7A 3VHXA 3T1OA 3ZZ0A 4FD2A 2E87A 3VU9B 5FBVB 1DAFA 1LF5A 2YOHA 3DMDA 2VSOA 3FHTA 1R0WA 4MH0R 4G3XA 4L15A 2ZROA 3GP8A 3K1JA 3AP2A 4LJ5A 2BKUA 4CGZA 4NCNA 3RS2A 1JALA 3IPYA 2HEIA 4MRSA 1SXJA 1G7SA 1RJ9B 1KKLA 5KSOA 4DIDA 1G7RA 2X77A 2VQSA 1RIFA 4YMVA 1KY3A 1XBTA 2GJ8A 1JXMA 3U3KA 3TVDA 4Q19A 1HT2E 2GXQA 3OEHA 3PQCA 4TLAA 5DYGA 4Q4AB 4ZCMA 1OJLA 5D3MB 3AUYA 5F2EA 2G88A 2EWVA 4JYCA 1OIXA 1ZNWA 3KJGA 4P4TA 1GITA 1SVSA 3KQKA 3RC8A 5FOTA 2BCJQ 3QXXA 1GM5A 2LWIA 4M9ZA 2Z83A 1KI8A 3CBQA 2OESA 4DCSA 3HP1A 4GFDA 2WKQA 1R7RA 2XJ9A 2GK6A 3I32A 1NN1A 4B3FX 2PJRA 5E95A 5TARA 4MDFA 1T0HB 3T5GA 5FTKA 4EDHA 1TEXA 3K0FB 3KFXA 2ERXA 2IUTA 3LW7A 2Q3MA 4JMPA 2WWIA 5IK2D 4FWIB 3NEYA 4M1SA 1O3YA 3BORA 3B1YA 1M1YE 3DM9B 1P2UA 1ELOA 1FTNA 2VLIA 4MGYR 1CBUA 1TTTA 4BGDA 4LYJA 3N2IA 4HB2A 5FL7D 5JEEA 1CR2A 4HAVA 1BO6A 4UJ3A 5JSZB 4US2R 2FE4A 2FPKA 2FZ4A 1AGPA 4PQFA 2IW3A 2WWHA 2ZS8A 1MH1A 3L0SA 3PENA 4IXNA 3PVSA 1Q22A 1VPLA 4BEJA 1WF3A 1CTQA 3DHWC 3ZZUA 1UKZA 1W46A 1IY1A 3QPVA 2DCUA 2Q0HA 3P20A 5LPNA 4M9QA 4P32A 1R5BA 4BQSA 1E3MA 3CNLA 4R71A 2ZJOA 4D25A 2VP9A 4Q18A 2Q9AA 3KUCA 3FKSD 2NO9A 4RFSB 5HZHA 2PH1A 4C7OA 2ORIA 1AZSC 3FHOA 1OKKA 2ZU0C 3E2IA 2V1UA 2W6JA 4DBLC 2BOVA 4PC7A 1US8A 1KI9A 2IEYA 3TQFA 2FFHA 2BEKA 3U3OA 2QMOA 2YZ2A 4LJ4A 3T5DA 2CBZA 4ASUA 4V0MA 3NDBB 3ZGXA 3L8ZA 4OJQA 3NBXX 5KYKA 4DB2A 4JVMA 1KK0A 1DBSA 2GHIA 4FMDF 3JZAA 3I5YA 3FWYA 4A1FA 1XRJA 2C96A 5TVKA 4B47A 1CJVC 1LTQA 2VHJA 3HPQA 821PA 2X1VA 2ODEA 2P2LA 1E1QA 3WRYC 1TAGA 1F2UB 3CUEF 4M1YA 2IXFA 3CH4B 3A1TA 3IHWA 2VPPA 2RAPA 4WXPA 2QGZA 4NYIR 2PX3A 3BWDD 4NTZA 2WJVA 1T6NA 3DPUA 3BJIC 4NP6A 3AF0A 3AVOA 2OG2A 4YLGA 3CF6R 4BFXA 5L3QB 4A8JA 3B1XA 1FNNA 2VO1A 4LV8B 5DI3B 1E2FA 1U8AA 4D82A 3KJHA 1E9RA 2P65A 2QI9C 2AD5A 2C9YA 2WPDD 1A7JA 4EPTA 4YDSA 4RD1A 1GFIA 2QSYA 2ZR9A 2VRWA 5GJVC 1P73A 3OE7A 1Z2AA 5H1YA 3W90A 3EPJA 2F1IA 2QT1A 3CF2A 2ZI6A 3ZH9B 2LKCA 1QHXA 3K0CC 2CJWA 5DN6D 2GJKA 4XWKA 5HR5A 2F43B 1WMSA 4CYMA 3SJZA 2BMFA 3JVVA 3J81k 1PLLA 3CPEA 1G3IA 2EFEB 5HE8A 3RS4A 2A30A 3ZS8A 2QQ0A 1DAKA 3TKLA 4JLMA 3PUVA 3I61A 4PFSA 2I1QA 3GEHA 5BWMA 4FI3C 2IYTA 5EUMA 3N70A 4QG7A 1QDEA 1H8HD 3O8BA 2CHVA 2XEXA 1GP2A 1BYUA 1RE0A 3HYTA 4NCJA 5AJXA 2XAUA 2ZRBA 1GKYA 1D2NA 2VL7A 4UNNA 4BWYA 2QMHA 5IDVA 4C2UA 1KMHB 3K0SA 5LDDC 2ZYTX 5FPTA 2ZS9A 4UKDA 2GTPA 1KSGA 4EUNA 4UNPA 5H68A 4CEJB 1KK3A 1MT0A 1JQLB 1VG1A 4OHVA 1NIPA 4RKFA 2V1XA 4N0EA 1A4RA 2XNSA 1XU4A 3ZD6A 2D74A 4JLNA 2OEPA 1GSIA 5JJIA 2FA9A 3U6BA 4BPBA 1T8UA 1KO4A 4NZYA 4BFSA 4MYUA 1RPZA 3QXHA 1JPJA 5HZKA 4O3MA 4LUCA 1P9WA 1NNEA 4F93B 2MMGA 2WWWA 2CLDX 1OYWA 4WW0A 3UWKA 2WKPA 4NPHA 4FINA 1N0WA 3K8YA 1MRSA 2W0MA 1F3OA 3THWA 4TQUS 3RNLA 1OXUA 2OFWA 1IM2A 3PUXA 4HAYA 4ZKDA 5L3VA 1JEDA 2GK7A 2YJTD 2YOFA 3ZZTA 1P7CA 4MUAA 2DHRA 4PHHA 4XVUA 3NHBA 5C18A 1C4OA 3ADBA 1OT3A 1Q44A 4DVGA 2OAP1 2ZIAA 3P26A 2QM8A 4O2RA 2WVJA 3SYKA 1G8YA 1UPTA 1JXOA 1UFQA 2NOAA 2R6GA 1KI1A 2IT1A 4PAMA 4G5RA 4GOKA 3F5FA 1F60A 4EKDA 3UIEA 3SEAA 3MSXA 1FOEB 5GJCA 4C4PA 2O8BA 2R6FA 3UATA 3B5JA 3ZIAA 4ABYA 2P6RA 1HQYE 2F6RA 2JCSA 2QPTA 1EX6A 3KZ1E 4O25A 4A92A 3LLUA 4E22A 3AEZA 5KOYA 121PA 2CE7A 2QL6A 3MCAA 4ZI3A 2JEOA 5JJLA 2WIBA 1U0JA 4F4CA 1M7GA 2ZQ5A 5KSZA 3QE0A 1NSFA 3OIVA 3Q5DA 1C1YA 5FBRB 3AM1A 2G77B 1KI3A 3WHLA 4DLRA 2CL7X 1FX0B 2F1JA 2P0EA 1AQUA 2FEMA 3UXMA 1QHHA 5CJ2A 1VYVA 1KSJA 3RVBA 1II8A 1XNJA 5GVRA 2RGAA 1FZQA 1OLOA 1OV4A 2H8KA 2XB4A 3BH7A 4F91B 5J4VA 2D06A 1NLYA 1S3GA 1XCPA 1U0LA 3PEVA 3Q7PA 4WBSA 2WJYA 3VKHA 4QGGA 4GBMA 1KI2A 4MKFA 1E9DA 3OEHD 1FP7A 1OSNA 2O8CB 4D26A 1Z0IA 3GLHE 4Z1MA 2WMOB 1HTWA 2ZR0A 5P21A 4A0RA 2ZRJA 4Z8XA 3GJ0A 4TTQA 2KBFA 4TLEA 3ZYCA 1SGWA 1VKJA 1UEJA 2KB0A 2OM2A 4B43A 4TZ0A 1Q3HA 1ZIOA 1CR4A 3GLFE 1DTSA 3WYGA 5JHGB 2J5XA 2OFOA 4EPXA 2O0KA 1AKYA 1TX4B 4TSFD 4LX0A 4Q5IA 1OXVA 1NG9A 3AP3A 5E7MA 1A2KC 1E9CA 1GDDA 3LX8A 4IFEA 2VBCA 1W36D 3GLFB 1SZPA 3X1YA 1X8LA 4CT5A 3CWQA 2V7QA 4DXAA 4DCVA 2D62A 2GCOB 3LAWA 1FUKA 4MITA 2GKSA 3D31A 2EYUA 2AXPA 4QNMA 2A5GA 5EQTA 4G1UC 2QGNA 2IBMA 1GZSA 1NBME 2RGGA 2GWHA 4KXFB 2VYFA 2ZJ2A 1E79A 2QG6A 3QKRA 4WXRA 2A5FA 1X1RA 2CCGA 3KXLA 4PXAA 1NY5A 3W8NA 4A2PA 4ACAA 3VNUA 1NF3A 3M1IA 3UG7A 4ZCIA 1GKIA 1G7TA 4FMCF 5C2JB 1VHTA 3FMIA 4D4LA 3NIBA 5J4YA 3X1DA 1OIVA 3IO3A 2HJVA 2XNDA 1KY2A 4MGIR 2MSCB 3GJ7A 3GLGA 4B34A 3A6PC 4JBWA 1W48A 1YR9A 6Q21A 3BC1A 3FPAA 1T9HA 3GEEA 1EFRD 1R4AA 2R6AA 4QFMA 5JHHB 3FGNA 1VECA 2CHQA 2XITA 4YMTA 1GIAA 1XX6A 4PTLA 1OKKD 4C0LA 3THXA 3MUFA 2AWOA 3GPLA 2W6JD 3NKVA 4M1MA 4RVCA 1DPFA 2VA8A 1UJ2A 3UK6A 4FWTA 4JVNA 2OCPA 4WZBE 4AG5A 1MRNA 3IKJA 2C8VA 3FFBA 2V8OA 5DH9A 4ASUD 3MFYA 1TQ2A 1NJGA 1TF2A 1R6BX 5CDFE 1SVLA 2WWGA 5CYPA 4MGKR 1JR3A 3HPRA 3U4QA 5G53C 3UPUA 2GJ9A 4DLVA 2GEDA 2V54A 1UDWA 5IK2A 3OIYA 4IXMA 1P61B 4G5SA 1KNQA 1D9ZA 2V9PA 2JJ8A 3JZMA 4A8JC 4K81B 5CLLA 2D4HA 5FTNA 2FOLA 2Y8EA 4KCGA 3RWOA 4NE2A 3SHWA 2QAGC 2C78A 4DEXA 2QT0A 3ZDQA 2AL7A 5FL7A 1XEXB 2FG5A 4PPQA 3BD9A 1ZW6A 2ANBA 2V4ZA 3FMOB 2BM0A 1T5IA 1OB5A 1E2IA 2JLXA 1CJTC 2JA1A 4LHYA 4UNQA 5CIWA 4DT1B 4PAOA 2CVFA 3MWYW 5D3QA 3K70C 1G4AE 1P6XA 1IN7A 4IDQA 4P31A 1SKYE 3QPWA 3S1AB 4BE7B 1OB2A 4QKQA 5BYJA 1G8PA 2YWFA 1ZC3A 2IUSA 4G01B 2W2XA 3BFVA 3FKSA 3GFPA 3I72A 5FPYA 4G5QA 1SKYB 3EWSA 3I1FA 5FUYA 1HE8B 3B9PA 4QC2A 5FOSA 5JBQA 4KAXA 3K0EA 2QEQA 2YC2C 4U02A 1FL9A 1T8TA 3TQCA 1WXQA 5G3ZA 2GEUA 1G3MA 3C5HA 4ZDJA 1GNQA 3A8TA 3X2SA 1Z47A 1IJEA 3QXCA 4KITB 3VNVA 4HI0E 3G82C 1N6PA 4NH0A 2WSSD 4URVR 3V4RA 5LBIA 3D3QA 3TVTA 3AQ4A 1SXJE 3BOSA 1G8GA 4JYBA 4DSUA 1XTKA 4HAZA 1SULA 2QN6A 4A15A 1E2HA 2AK2A 3F8TA 2NPFA 3QVUA 3KUDA 1PV4A 2G9NA 3OHMA 1VDZA 2ZI7A 1BH2A 1JQJC 1XTQA 2FH5B 4I1OA 4LBYA 3WMEA 4FMDB 4MYCA 4KLNA 4ZDKA 1ESMA 4DLSA 3QOFA 1LNZA 4XH9B 2XZOA 1E2MA 1G18A 1ZCBA 2EW1A 1RKBA 4PHGA 2ZE7A 1PUJA 4URWR 1DOAA 2BBSA 3MJHA 3SFVA 3TLXA 3B85A 3LXRA 4N1AA 3AVUA 5FOVA 3DVLA 4FCVA 1GILA 2ZE5A 1TF7A 2D2EA 4Q1FA 2WPDA 1RC8A 1QHGA 1ZM4A 3NEJA 1GL7A 4OK6A 2KI5A 4LHVA 1Z0FA 2OSBA 4GP7A 2IF0A 1DS6A 3KQHA 1V5WA 4U5XA 5DN6A 1WCV1 3I62A 1T91A 1M74A 1G20E 1ZM9A 2BKEA 2H1LA 2OCBA 3U3JA 1XPRA 1ZCAA 2OXRA 3C14C 1D9XA 2WICA 3CM0A 3QG1A 2JLRA 3HYRA 4TN1A 5FI0B 3VQTA 3OF5A 1TQ4A 2QBYA 2QZ4A 4I4LA 3M4YA 3U5ZB 3DZ8A 1PVOA 2KBEA 1WBDA 3K0CA 1E2KA 1KKMA 4LYHA 4IJMA 1KDRA 2WM9B 1P72A 2J0UA 1TUIA 1R5NA 1CIPA 2EWWA 4CRWB 1ZAKA 4EPVA 4PPFA 3BB1A 2IXEA 3FTQA 3N2EA 3JVUA 5AWFC 4KVGA 1DEKA 4S35A 2OILA 3THYA 4CZ2A 1LV7A 1NLZA 3KB2A 5JMTA 1HH4A 2RGBA 4KV9A 5HCIA 2ZYWX 2A7QA 1JPNA 1CF4A 2CNWA 3A58B 1OE0A 4C7OB 1E0KA 1XMIA 1HURA 1XTRA 2QENA 1XZPA 4BLSA 1US8B 2NPIA 1R8SA 3V00A 2GXAA 2DYKA 2ZI5A 2QPAA 2AXNA 4ESVA 3EG5A 2PZFA 3W3ZB 4ARZA 1E9BA 3ADKA 5B64A 2GA8A 4C0AC 2PEYA 3CRW1 4Z1MD 5SZKB 4QGHA 4BZPA 2P5TB 2ZSFA 1ZC4A 1U99A 1ZD1A 2BVNA 3EZ7A 4QBIA 2IS2A 1BS1A 4ZI2A 5J40A 4KSBA 4KODA 3QKTA 4B6EA 1W1WA 2AKAB 2GCPA 1F48A 421PA 3NVAA 4DDTA 2AR7A 1DVRA 3TAUA 2VHCA 1YRBA 2YC4C 3L0PA 1AQYA 4OI2A 1GRNA 4IW3B 4LYAA 4MRRA 5CM9C 3SC3A 1T3SA 1DG3A 3VR4A 3QBTA 2ONJA 3SBDA 3WMFA 5C4GB 3X1WA 4I1UA 1N5JA 2EFHB 4N3NA 2OFXA 2RCNA 3VHLB 4NCIA 2I4IA 1K6MA 3CIOA 4QJ4A 4A8JB 1TF5A 4F7WA 3M0EA 2C5LA 2XTZA 4OK3A 3MGCA 2HF9A 4ERNA 3I5XA 1R0XA 4DEYA 2ZJ8A 2FN4A 1RRGA 4Y0AA 4HDCA 3TH5A 3IEUA 1NKSA 3KKQA 3MJRA 1KTVA 1N5KA 5B30A 4C2TA 4IHQA 3QSYA 1X6VA 1IHUA 4X8OA 1XPOA 2CJWB 2ZYUX 1M2OB 4LC0A 1P2VA 2BM1A 2XNDD 3LD9A 5DE3A 2BBWA 5JWHA 3K70B 4HUTA 1P2SA 4LJ8A 2ANCA 2IYLD 2FJUA 3LQRA 5H70A 5KDOA 3B60A 4OI1A 4M21A 2KWIA 3I8SA 1EWQA 3WYAA 3NBYC 2XX3A 1TPZA 3OEEA 3QF7A 1YZGA 4B48A 3EPKA 2RGEA 4L4UA 1WQ1R 4TMXA 1COWD 4LJ7A 1GRRA 4BFWA 5KDLA 2Z43A 2WV9A 1CRQA 1E94E 1NVUQ 2KE5A 3BFKA 3LA6A 4B3XA 1KSFX 4Q1BA 1VG8A 2VEDA 1XJ0A 2D2FA 2F3RA 2DFKB 5K8IA 2B92A 3L8YA 2GNOA 1Q57A 2FMXA 4TTRA 1X3SA 2A5JA 1AJEA 4TLBA 4BZXA 1AK2A 2GVZC 5BN5A 1NLFA 3EWAA 4JLJA 4QM7A 4TSFA 4JVSB 3MD0A 4NYMQ 4KJZA 3SI7A 4R2HA 3VAAA 2IYXA 1JR3D 3TJZA 2JLQA 4AC9A 3GJ4A 5KSPA 3FMFA 5E7IA 2EFGA 3THOA 3EXAA 4K46A 2FV8A 4QHSA 4IDPA 1Z07A 4WA7A 3IHLA 5ANRB 1W49A 4GOXA 3KQLA 4D2IA 1G9XA 4B6FA 4XVQA 5EE1A 4XTRA 4TYQA 4PSAA 4LY6A 1F5NA 621PA 1Q0UA 2YVUA 3K9GA 1LB1B 1XEWX 3EAQA 3MWLA 2GXSA 3IQXA 2CEAA 1E2JA 3SE0A 2HCBA 2CDNA 2J59A 4EPRA 2DFTA 1RRFA 4BRWA 2W0SA 3QQ5A 1IBRA 1PLJA 3QUSA 4LSGA 4BLRA 721PA 3THWB 3IILA 2MSEB 4X8LA 4C0BA 4L8GA 3RS0A 1J7KA 3HJNA 3RDPA 3B1WA 3FKQA 2NMVA 1E2PA 1HA3A 1TMKA 4FMCB 4B74A 3H0KA 2IL1A 4G5GA 1NP6A 1W44A 3PUZA 5EE0A 4D4KA 3B8HA 1EFRA 2CK3A 3GJ3A 3TSWA 3IO5A 1ZNZA 2WJIA 3BRWD 3CRVA 4MYHA 2P67A 4M53A 3M6AA 5FBWB 5JWOA 2ZAMA 3AUXA 5J4KA 1P5ZB 4L16A 2ONKA 4KBFA 3UMFA 1XD2A 2O8BB 1Z6YA 1CR0A 2JLUA 3TR5A 3IIKA 2ZI4A 1G4UR 3C15C 4HZUA 1Z6TA 1D8TA 4TMKA 5UKDA 3B9QA 3LH5A 3Q5EA 2GEVA 4XWOA 3OIWA 4TLCA 1CJUC 1Y63A 4Q7MB 1G1MA 4ON9A 2IYSA 2QTFA 3CRRA 4ZKEA 3SU8A 1AS0A 1EFUA 4HEJA 4HZIA 2ASEA 1IONA 4A36A 1N3BA 1I2MA 3BIFA 5L8VA 1QHHB 1BOFA 2CCKA 5HKKA 5TY0A 1FP6A 4TMVA 1II8B 1QVAA 5GJBA 3SJCA 4QJ5A 4LPKA 3B2EA 4CEHB 4Q47A 2ZRNA 3AVXA 2ECKA 3U61B 2ZREA 5C4MA 4RZ3A 1XEFA 2V6IA 4Q21A 2CMKA 2IYYA 5KSYA 1T4GA 2IF2A 4EJSA 2YHSA 1KOFA 3SFZA 2G0NA 2ZEJA 4RY2A 4MQBA 1BIFA 4BFZA 1YR6A 3TAHA 5JZVA 1ZJ6A 4X8MA 2HJGA 4IKEA 5KU1A 1XP8A 3N5CA 1ZNXA 4TZ6A 4JBXA 2IHYA 4Q9JA 2AFIE 5EE3A 1VYUA 1FMLA 3U3RA 3W8RA 4OQXA 2J7PA 1YR7A 1AA9A 1E2DA 1EK0A 2QAGA 3CX6A 2CHGA 5SZHB 4LJ9A 3I92A 1JJ7A 4GZMA 1OF1A 2G1JA 4Q4LA 3BAFA 1SHKA 1NSTA 2VP4A 5JCPA 3R8FA 2FFAA 1QHIA 4WZAE 4RSGA 2WJJA 2BDTA 4M1KA 2Q6TA 4MGZR 2DWOA 1ZRHA 2WWFA 1AM4D 3UMSA 3ZJYA 5AUPB 2WMNB 2R8RA 2GAAA 3QKRB 2CCJA 4RFVA 3GD7A 3U6KA 2EVWX 4C9BA 4OQLA 1CXZA 1GWNA 2X19A 1QVRA 2C9OA 4IDOA 1N5LA 4TQAA 3AVQA 2EU8A 4B3BA 5FTLA 2WSSA 3GLGE 2PZEA 2R6DA 3QVVA 5A5GA 1Q1EA 1E1RA 1EX7A 4Q4HA 2AFHE 1TU3A 4E07A 2NO1A 3NXSA 1W4BA 3GLGB 5DIFA 1ODFA 2W6IA 4DIEA 2UKDA 1NRJB 5E7JA 3O47A 2I1VB 4TYYA 3WMGA 2PLRA 1DAIA 2TMKA 2CNWD 3AF3A 2NGRA 2O0JA 2F55A 1UF9A 1RYHA 4Z54A 1VG9B 4LC1A 3THXB 5JRZA 2IS6A 2NZ8A 2REBA 1J70A 3EZ6A 3P32A 3OAAD 4TMZA 5TDHA 1LW7A 1SVIA 1VHLA 2QMUA 4RCZA 1P2TA 1G5TA 3B7GA 3VTKA 4LHXA 4W7SA 1JR3E 1G291 3TNFA 4B2PA 1K5GA 4U00A 2O8FA 4DLYA 4PQYA 2ZRFA 1UBEA 1G64A 2MMCA 4EAQA 4KFTA 4NYJR 1QG2A 3UMRA 1HEIA 4IFBA 3VR5A 2ERYA 1DE0A 1N25A 2ZRHA 3B13B 3FDIA 5FR2A 2IUUA 3NBZC 4QBFA 3U4QB 1S9HA 2QPOA 4M4SA 5E3HA 3SQXA 2GCNA 1P9NA 4W5HA 3CLVA 4QL3A 2YKGA 2QTHA 3KXKA 4CVNA 4R7ZA 5KO2A 4HLUA 1G5PA 4WAUA 3SS8A 1DAGA 1EFHA 2BV3A 1Q3TA 1WA5A 2F7SA 1U9IA 4B32A 5GVSA 1WRBA 3AVYA 1KDOA 1YHNA 4R9UC 1YZKA 4D80A 1E9FA 4ZPXA 3C41J 1J2JA 3Q72A 1L4UA 3RS7A 4NHOA 4CDGA 1CS4C 2BJVA 2WBLC 2ZUDA 4JBYA 2ZXUA 1RW4A 1GKUB 1LFDB 3C16C 1GVNB 4A82A 5BN4A 5J4HA 1T3HA 4NL4H 3NTUA 3AF4A 3SQWA 3EASA 3TR0A 2FF7A 1ZUHA 2F3TA 3DKVA 4H9GA 4EFLA 1LVGA 2V55B 3GCGA 1Y3AA 1ZUNB 4WZ6A 1RRPA 1W7AA 4D0LB 4US0R 1HT1E 1S1CA 5FTJA 2WJGA 3KXIA 4OHZA 1Z3IX 1S2MA 3HDTA 3DO6A 3RYTC 5CITA 4PO1A 1KJWA 2H7VA 4MDEA 3E70C 3CKLA 2GDJA 1KGDA 3Q9LA 4Q1AA 4QNRA 4LGMA 1DARA 4M22A 3OEED 5FPSA 3W34A 4XOIA 1W36C 4RD6A 4TL7A 1N6LA 1KJYA 1E2QA 2BMDA 4HLCA 3ECCA 1Q1QA 1JNYA 3QF4A 3QPUA 4XSGA 4D0NA 1KJZA 1NI3A 5FR1A 2CVHA 1YR8A 4UXHA 1YRAA 1R2QA 4M8NE 5EXSA 5LD2C 3U7FB 3TIFA 1KDTA 1AIPA 2NTYC 2I3BA 3L0OA 4PR0A 1VCIA 4HDOB 4DKXA 2H16A 2HXSA 2KJQA 1XTJA 2WJHA 4NCKA 2FGJA 4JKYA 4YXWA 1E2GA 1J90A 2FEOA 1E0AA 4OQMA 4TYPA 4QXAA 1G8HA 3K9NA 2CLCX 1UAAA 1CR1A 1XD8A 1P62B 4MRPA 3RSLA 4EPWA 5JECA 3DM5A 5E4FA 4B73A 3NH6A 3KJIA 4GSYA 1AS2A 2PT7A 1NVVR 4LBZA 3RRZA 4CF7A 4RCYA 3KX2A 3ZLJA 4IOJA 5JRJA 1Q1ZA 1EWRA 1CLUA 3AGQA 1WB9A 3RS5A 1S0UA 3QI2A 1A5TA 3W9YA 1XZQA 2HUPA 2VF8A 1AGRA 4IVPA 3AVTA 1GRQA 1W2GA 1Z28A 4JLVA 5TMPA 1LF0A 2JJ2A 4W5JA 2DB3A 2GF9A 3SYLA 1TADA 1OXXK 1U90A 1I2DA 3X1ZA 5EP1A 1I4DD 2RHMA 3I73A 2ORWA 4XIGS 2Z4RA 1P75A 2QU8A 5JLJA 1ETUA 4EIWA 4N0DA 2CK3D 5AJZA 3A1UA 3H2YA 2QBYB 1IXSB 1WE2A 3B1ZA 2G3YA 2J45A 4LBVA 4PQRA 1R10A 3I3SR 3VKGA 2PMKA 3WY9A 1CRPA 4PC6A 2C03A 1COWA 3GMTA 1OFIA 4P4SA 1YVDA 4GOJA 4B3CA 1A1VA 3PJRA 2YNMA 2J0UB 2VP5A 1E98A 3EC2A 1YKSA 4NYIQ 4QBGB 1T5LA 4UXIA 4Z51A 1K8RA 4BEBA 1OFUX 2QSZA 3TW8B 5BN3A 2FNAA 4GNKA 1NL3A 5HE9A 3THYB 1S8FA 4Q9HA 1RYFA 1XCMA 4EJSC 2A2ZA 2PX0A 1Q1BA 4DZZA 1E6CA 1IY0A 1Z5ZA 1MKYA 4DLTA 4Q7KA 4OHWA 5HKKD 1Z0JA 4HUQA 3K9HA 1BYIA
chains in the Genus database with same CATH superfamily
5DNCA 1W88B 4NCHA 1T10A 3KR9A 4G9GA 1CZRA 1XJQA 4H0FA 1RWOA 3CY6A 4FGKA 5C51B 5LMUB 2HFJA 1VPTA 3CLTD 5K09A 3A6EA 1XD9A 3DWEX 2W2LD 3GEIA 4IINA 3GF4A 4PGHA 5CH8A 5GIOE 2GZDA 3AGPA 5D7BA 5TMEA 4DV0B 1DB3A 1RMQA 5JSKA 2IHTA 1CJMA 2HW8A 4J43A 2GESA 4AAYA 5E3JA 4GMHA 1FIUA 3AILA 4HQNA 2WA1A 4DLKA 1KAGA 2Y1WA 1U1FA 1XLWA 4QIHA 3EW9A 4WVLA 3DVQX 5GOZA 2ZI9A 4MULA 1J99A 1JDNA 3A4LA 3AIIA 2GPJA 2QLLA 3QWBA 4K3UA 2WMDA 1N5MA 2OGSA 3M6XA 1XI2A 2ID8A 4CTMA 3OU2A 2BEVA 1L4GA 1YKFA 1XVUA 2H18A 4BFVA 2GEFA 3D2AA 3WLFA 3UA4A 4MW5A 3GLIA 2BWJA 4QU8A 1Y5NA 5AVZA 4L0CA 2C9CA 1NXXA 2YICA 4MP3A 4RQUA 5IAEA 1XDUA 2OCAA 4V02A 2WU4A 2X4DA 3H65A 3L3BA 4OJKA 5BSMA 1PK7A 3D4OA 5HTOA 5LIRA 1PNTA 2OHOA 3AESB 3BH0A 3HUEA 3MLAA 4I14A 4J4TA 3FNQA 1EK6A 1FXWF 3D3JA 4TMYA 3WNBA 4PAGA 1MO4A 3QMMA 2YWRA 1EM8B 4DUPA 4A9AA 3G2KA 2VHUA 4KMMA 1JSLA 5AVQA 1LI5A 2ZB7A 4M1EA 2WFLA 4LAFA 4R69A 3SJAA 4L5BA 3TW6A 1QG4A 1KOJA 4EECA 4N7RA 2R84A 3UHFA 2HK9A 2XQJA 2Q6LA 1ZVMA 3KBBA 1KEWA 4IG9A 3ZD7A 4QOHA 1YGPA 5ADHA 5KNDA 1X7ZA 3FBWA 3TO5A 4JYPA 3CH5A 4OKIA 2A33A 2EQBA 3F98A 4ZQCB 3PEYA 1ONNA 4F38A 3UA3A 4ABTA 1YIOA 4TKUB 3OZBA 4MI1A 3ZY5A 4MW9A 4UCWA 5FDFA 4AKGA 2A1UB 3IBTA 2GZ1A 4DBVO 4I3FA 3CNNA 4XWGA 1XTUA 2OQVA 1ESNA 1SN7A 1ZU5A 4QRHA 2QP4A 2L0XA 4XM0A 2VAMA 4EHLA 1UBMS 2LW7A 1B73A 3UJNA 4E2ZA 1BSVA 2XTNA 4S2EA 1XVVA 4HDQB 3SQDA 4JI2B 4P98A 1VQ1A 1WMDA 4TSKA 3FZGA 1DEAA 5BNFA 2XDWA 3EC1A 2W2KA 3WV4A 4EFMA 2IX3A 4BIIA 3E6AA 1RVDA 3B9RA 4ZVTA 3ZQJA 5BMVF 1FFBA 4ND1A 4D4IA 4G0WA 3DEZA 4TUYA 2J3DA 4HLUC 5DM4A 1EAYA 2MCFA 1ZRSA 3W2GA 4PFKA 4KPYA 1UP6A 1ZVJA 2NSJA 4ZOEA 2ZJ1A 1W36B 3OF3A 3Q9UA 1DC5A 1DMSA 2F9LA 3ETLA 3WYDA 1ZPDA 4XD2A 1SZCA 1BE1A 1ONBA 4MVJI 2AVNA 13PKA 1XZMA 1WZUA 1YQUA 2FX5A 2GOYA 2XRMA 4JK3A 2OYRA 3TXXA 5H4HA 4BZZA 1U63A 2R7LA 1NUSA 4IIHA 1CWUA 221PA 2FF5A 4HS4A 4JBIA 3R8CA 4PPNA 1A9OA 3O5AA 3RKRA 5T4BA 3OPMA 5HKLA 3M6VA 3TW4A 1KMNA 1ENYA 4YYEA 3ZTWA 2Q5JA 5DGHA 4C6TB 5K2OA 4IHAA 5T4HA 4FN5A 6LDHA 2RJ3A 1QIJA 2KM1A 2AZXA 4BKOA 3P2YA 4CETA 4TM8A 4UUOA 3P9NA 2ZRMA 4GPBA 2QMZA 3G8BA 2Q9BA 3T41A 1UDRA 3QTLA 5BWLA 1PZXA 3CW2A 3C5EA 3NONA 4RIFA 1W25A 1QFXA 3AEQB 3JD1A 3WGHA 2XUGA 4XUDA 3EFEA 2WNHA 4ZQEA 3R1IA 1A88A 2C4HA 1EQAA 2I2XB 1OTYA 3M81A 4CFSA 2BAGA 1Y5IA 4KN5A 5DYWA 1XP5A 1K6IA 1ULTA 2J3EA 4IIXA 2P69A 4OY3A 4CTNA 4ZVSA 3N0XA 3Q3HA 1Z82A 1S89A 4BHTA 3NU1A 1X0VA 4CF4A 3T3DA 1MABA 3WIBA 1CERA 1U8XX 1G63A 3AFMA 4TS3A 1TM5E 1YDEA 2IYPA 4KX5A 1H2WA 4V03A 5FKJA 3W8DA 1JYEA 1X8XA 3OAAA 1J00A 4EI8A 3ZZNA 1KAQA 2JBHA 4K9PA 1HRKA 2YQ4A 4V0ME 3UV7A 1H9CA 4ZQHA 1SQ6A 4B81A 3GPCA 3U60B 2CEKA 3KKNA 3FJYA 4MW6A 2BL4A 4QFDA 3WK4A 5JS8A 4I1RA 5B7NA 4A0FA 3GUYA 3CGWA 4XSVA 1FTWA 1RPTA 1KO7A 5DASA 2ZSDA 2O2DA 3B8EA 4KDCA 3DTNA 1PYDA 4L3VA 5HFNA 3WGKA 2G6TA 5B12A 2D3TA 2UUBB 5BOSA 5B57C 5B58T 3INRA 1B16A 1ID8A 1Z68A 4P0QB 5TNXA 4PLTA 4LJKA 5DGDA 1LJ8A 3HO8A 1FRQA 1SCNE 4YGYA 2JGNA 1Y4UA 5B55A 4L5CA 2XKAA 2X8JA 1P5JA 1KQNA 5FTMA 2PIDA 1UJBA 4V3BA 5AW4A 3W5BA 1ZICA 1CKEA 2P7IA 4EF5A 2Y1FA 1WDTA 3NZEA 3SYMA 4J07A 4YXWD 4YRPA 3MVEA 2EYQA 3HM9A 1KI7A 1NR1A 2F90A 4M3NA 4PLGA 2ZAOA 3ISVA 1JBEA 1NJ2A 2Q9CA 5L45A 1CJCA 3IAS6 3M70A 3RRNA 1ZVQA 1Y4ZA 4P33A 1E3LA 5DHFA 1J4AA 1GHTA 3F8SA 2XMRA 2FP4A 3L0IB 4I1VA 4XSHA 5AOBA 4GL4A 2NUPB 3H8WA 5FUWA 1B1AA 4RVOA 3SHVA 1F1JA 1A82A 4R1QA 3ADDA 2TMGA 1GNTA 3MTEA 2QAGB 3AZQA 2HHCA 2FX3A 1D4OA 3FVQA 3SJ7A 3UGTA 1UCFA 5K0ZA 1U2EA 1R6UA 2GA9A 2VJQA 5C4IA 5GADl 3BCSA 1JIKA 2ZRDA 3R4VA 2K2WA 3QUBA 2BGWA 4P7KA 1XVIA 2SKCA 2YWJA 3RIMA 3C4JA 3QPDA 3BZWA 1AXGA 5ALVA 4LYYA 1G9TA 5CR9A 4YRIA 1H4TA 4X6XA 3DQZA 1J2UA 1RFLA 4D9FA 1BDBA 2NQTA 3HXLA 5CPFA 2C2ZA 2I55A 3A4NA 1B8PA 2HI0A 3QXSA 1JDBC 4RD0A 4UBIA 2Y1DA 1ZAYA 3C8MA 1Y8RA 3KQNA 2NZUG 3LRXA 4MUYA 4CM6A 2RH4A 1Q0SA 1V41E 1QQAA 3BN3A 1YZ3A 1LI4A 3C3XA 3V4FA 2PRSA 1RVV1 3A6ZA 2WB4A 2X0NA 1MAUA 3UWDA 2HA2A 3K2EA 3ROPA 1BDJA 2O52A 2PFGA 3R7NA 1Y1SA 1FNSA 3DV0B 3BXHA 1M34B 1FYXA 3V8BA 1HFEL 1N5RA 2QR2A 4AWXA 2OE2A 1J5EB 4XZ3A 5T57A 4YNBA 2ZT5A 2PLNA 3TG8A 1XL0A 3IUEA 5DBOA 2XGOA 3I4LA 4ZAFA 3EXFB 1UXJA 1MJNA 1J8QA 5BW6B 1RKUA 2PJUA 4HB3A 3MJCA 5EEGA 1WOYA 3QVKA 1N78A 1A8PA 1CQZA 2E82A 2EW2A 1RDFA 2QPLA 2WU8A 2ZE6A 3MRTA 5M3BA 4RPIA 4PGMA 4RV4A 1EAMA 3RTAA 5BR7A 5L3VA 3HCDA 4WFQA 1S96A 3Q8KA 4XUEA 2DETA 3OCWA 2PMWB 3C6KA 3KOZA 4RO0A 1WV0A 4C7XA 5IAOA 5IG2A 5CCEA 2AMYA 1T6BY 1OXMA 3C3MA 5ES3A 3VSDA 4HTFA 3NAZA 4DQXA 3DOIA 1J09A 2VSXA 5AI9A 4FJ1A 1GNLA 3AKEA 4H0NA 2Z6VA 3UXYA 4B2IA 1XXHA 2NV2B 3VSBA 4KREA 3TJMA 3EEIA 4ZC8A 5TXGA 3SBXA 5JQGF 2Z9BA 4DNOA 2ZQYA 4CV3A 5L4NA 1E1MA 3GY0A 2PUFA 2D13A 3NHYA 3V97A 4ND2A 1XRLA 2CMHA 4ZGGA 5K01A 3MOIA 1FYWA 2CJFA 1TQDA 2SCUB 1Z6GA 1QAMA 4XB6B 1M76A 4MINA 1Y0BA 2AFVA 1STOA 3BPSA 1U98A 2Q4BA 2FPMA 3KZOA 4LDRA 2BJWA 1Z2CA 2QD1A 4GHWA 2WZQA 4KSYA 5JCZA 1PR0A 3FB4A 5CCXA 1T9CA 5TPWB 3FHCB 2JKYA 3GU3A 3PZBA 4NDAA 1XU7A 4LV6A 5FWNA 1IU9A 5CX1A 3ERCA 4KNYA 3OUUA 4GPTA 4X85A 3U2QA 4F2WA 4K0KB 3GJXC 1RM4A 3KHKA 5DFAA 3RC7A 3ZWXA 4A6XA 5G3YA 4X5OA 3VVCA 5DGXA 5IYZF 3GYGA 3D0RA 5AUOB 1RLMA 2JIPA 3DZDA 3T52A 4AYTA 2B1IA 1I4TD 1TEVA 4RLFA 4W5NA 5HZGA 1ARZA 2HEGA 4QQKA 3HVIA 5LP6A 3OD1A 3R8XA 3U7JA 1EWYA 4RC9A 3ZCUA 5HPYB 4YCCA 4TMTA 3QU2A 5JIBA 3R3WA 3FCAA 3R9KA 4CKWB 5HX7A 4NBWA 3B12A 4J2TA 4ZFNA 1K7CA 3AU9A 1L7RA 1HYEA 2RI0A 3HN7A 4W5RA 1C3JA 3U17A 4C5CA 3KKOA 4G36A 4FFDA 3LDUA 1ZI9A 3UWOA 1DAOA 4L8VA 3A2NA 5KAPA 3D1VA 4IJQA 1N9GB 5DNWA 2A84A 3KELA 4BFYA 2F1OA 1T9GR 1Z38A 3ORFA 3O8DA 4LV5B 1NKTA 3LVRE 4RDXA 2QIPA 2VDLB 2EKBA 4R0VA 1BJRE 1E9SA 1U3CA 3N7UA 1E6KA 3VMMA 1KHHA 1QZUA 3IESA 3SSNA 5EAIA 1ZVVA 1R0KA 4IRUB 1I4OA 1NX6A 1S3SA 2FX2A 4PPGA 5CW2A 1YU9A 5JS2A 1TKRA 3E7FA 3LT0A 1GGKA 5JXGA 2ZRKA 1IEQA 4RK5A 1E8NA 1SC3A 4RS4A 1Z06A 2ZJ7A 4EF6A 3DCIA 3OLZA 1VJTA 1CY6A 1R0RE 2OENG 1YZVA 5F4BA 1BA2A 1LY1A 2PKCA 5EFZA 3MGAA 4ZN6A 1P4HA 1JVBA 1KFEB 5MN5A 2BMEA 4X95A 4DXDA 1U8TA 2B25A 3JU3A 4RZSA 3JAKB 2AZDA 4XD7D 3DC2A 3FYTA 1J0CA 4Q05A 1KE1A 5GY7A 4WXHA 2NTVA 1KPIA 2FSUA 2QD3A 1QZXA 3T1VA 1PNRA 3DXFA 2FWPA 3SR0A 5T5QA 3IAM6 1LZLA 2O05A 3RF6A 1D8AA 1R27A 3ND7A 2IV7A 3NVMB 4WD3A 1KK2A 3LT2A 4YI5A 2C07A 2Z2ZA 5KHOC 4AQ7A 1MQ8B 2LVBA 4FEAA 4JT2A 4IQ8A 4Z49A 3DO5A 2HSGA 4EBFA 3EC7A 3I05A 4JY7A 5LWHA 1C50A 1WO8A 4OUDB 5CA0F 1HDYA 1YOVB 1N6NA 1R4MB 1VKNA 2O3QA 1USIA 2J9RA 3ND9A 4TMFA 3GG2A 1D2RA 4IP0A 4YHBA 4H16A 4YAEA 5SV2A 4FZ5A 4P81A 5KTYA 1IY2A 4P3PA 2A4MA 5KYNA 2F8LA 4FT4A 4RVNA 2CVZA 3Q12A 1BHJA 5F9MA 3VX4A 2JFUA 2ZSAA 3W3AA 2YUTA 1NMYA 3DZKA 5LQUA 2G71A 1FU4A 1L5RA 3B5EA 3WK8A 1OA1A 4K2AA 3ODGA 2WINI 3UAVA 2XUHA 3G5UA 2IP1A 1CFJA 1D5CA 4MWGA 4F0JA 1X7YB 3E1GA 1NATA 3SQNA 3B89A 1UBNA 1W0KA 4IUBS 4WLVA 1YCDA 3HU2A 4LXYA 2HF2A 2ZTSA 1H9BA 4I8XA 4K0RA 4M54A 5F1YA 3RUPA 1Z08A 2CL6X 2VYVA 3ZBTA 3K9BA 3UKOA 2PWAA 3BYZA 1S1MA 2ZVQX 3NIDB 5FT9A 2IEDA 2FSHA 2HLDA 4YJ2F 4AZWA 4F6RB 2JLYA 3K1YA 1TUGA 3MTJA 1DC3A 4ZVUA 4COOA 1MO3A 2IC5A 1RQ2A 2ZE8A 4X1IB 5D3MA 5PNTA 1AKRA 2O8EB 3QLUA 1H3NA 1PL7A 2JF0A 4IGKA 1FJXA 1PFKA 3PDIA 1UDXA 2X1LA 3OH8A 5EN4A 5HIMA 4DIUA 2WM3A 4JROA 1T5BA 4R0MA 1F2TB 1TKAA 3R40A 4Q02A 1LDNA 4O2AB 4QRDA 4BKPA 4F7DA 3CCFA 5HJ5A 2GX6A 2TS1A 3K9FC 1SVMA 4TL9A 1T2FA 2C4TA 1C3LA 2EKQA 2NVUA 1JN0A 4D98A 5BRAA 2GETA 1YE3A 4UTRA 1TOAA 2ODPA 3EWIA 3GEGA 1EJBA 4R3NA 3G2IA 5D5QA 4D46A 3ZEAA 4TTSA 2B2XA 4S12A 4GQAA 3JVIA 1DI0A 2R6CA 1XRPA 1OX6A 1ORRA 4KKVA 5M29A 3BUSA 5LN1A 1UEIA 1ULZA 3ZK7A 2ZTVA 3D6FA 3O8RA 3H42B 2Z5LA 3CPSA 4BATA 1OLXB 3OJXA 2X1MA 2HHAA 4JLKA 3KTAB 8ATCA 2QL5A 1UBGA 2MYNA 3L7IA 4EGQA 1RHMA 4YXFA 2PZJA 1Z2OX 4L51A 3FM9A 1HG0A 4F84A 5I9LA 2PKQP 3WKCA 4EB6A 1JPVA 2AQ8A 4DG9A 1MA3A 3MIZA 3E8MA 1NZDA 2N1BA 1LK0A 3FH0A 3ZVLA 3STYA 2R7KA 3FA2A 3VZDA 3ANSA 2QSUA 4HLQB 2RAFA 1O94D 3H1TA 3T9EA 2EFDB 1YJBA 2ZFUA 5JWRA 2A9VA 3QMPA 1DO8A 2AJ8A 2FEKA 2PN1A 5K99A 4ZI7B 2OBLA 3KSMA 4I5IA 2HRDA 1IEWA 4L8WB 4RIIA 4KVFA 2WT4A 3MWDB 4L78A 4TROA 1FDRA 4HQKA 4QUGA 1ML3A 3K5IA 3NAGA 1ZR4A 4LA4A 3OFNA 5CJPA 1XG5A 4Y7DA 3RS3A 4RFSA 1ZY2A 2PL3A 1HG1A 2RH9B 5J5CA 1ZK2A 2XXJA 3E7WA 4HBGA 3RC3A 1SB9A 5DGCA 3WSVA 2BUBA 4B6GA 1I9CA 1F8GA 4ZAGA 4WKOA 4JKIA 3JQPA 2OAQ1 2VDMB 2BHTA 3KQTA 4DOMA 4CLRB 1R8QA 1QRRA 4BGIA 5T64A 3NDPA 2JZOA 4AZTA 2I6XA 3COWA 2YFHA 2H1IA 1BVUA 3PEUA 4ML3A 5AW0A 2H3HA 2BISA 2Q3JA 4BN0A 3T35A 4JLOA 3NHPA 4N8EA 3AEXA 5KTPA 3R5JA 3NM4A 3PIDA 2B6NA 3ENVA 4ZOAA 3G8YA 1TA9A 5GIPE 2DT5A 5C46F 4K5QA 2HD4A 1TZBA 1B6RA 3FDZA 3AERA 3DS8A 4Z2AA 3O1LA 3KOUA 2WVAA 3A4YA 3QOXA 4WVFA 4ZIRB 3GJ6A 3L1VA 1P2DA 4E1AA 4DCPA 2XRFA 2HNBA 5C1OA 4U7DA 3PGA1 4KMRA 1DLJA 1M8PA 4A5OA 3OTOB 1SG6A 1JSZA 3CVUA 4OLBA 1C7IA 3W06A 4LJYA 3VSEA 1FTYA 2OBBA 3TTSA 2QW1A 1MT3A 1B0UA 2GEJA 3BJEA 3L7LA 3RYHA 4EQ6B 4EVQA 4BZQA 5JS6A 3NDJA 3GO4A 3IUQA 3F3YA 3UFXB 1U1DA 5JASA 1V8PA 2ATXA 1TA0A 5DI3A 2ASVA 1DT5A 1OIWA 5CB8A 1HTTA 2P30A 5I4IA 1DCKA 4J1TA 4YBRA 3DCJA 4ZANA 3REOA 4AJ4A 3PUWA 1X7WB 2E9SA 3FBTA 2WJ6A 3H97A 3TQTA 1LX6A 3ZKAA 3NQ41 3HTXA 4JSRA 4G0XA 1P31A 2B7LA 4ESOA 1W76A 1WMAA 1XRRA 1R5OA 2PRIA 1A9XB 2RKBA 3FD8A 3GFSA 1VGQA 2J41A 1TJ3A 3JARB 1C9JA 3OICA 5AJYA 3KKEA 1KQOA 4S0ZA 5IAKA 4BO4A 1U8ZA 1RM0A 2F43A 2IPNA 4X93A 1G0OA 3WTBA 3G5MA 1FW6A 4ZJUA 5K3BA 4N82A 2V7UA 4ISCA 5IT0A 1H8EA 2R85A 4MWBA 3P94A 4FGSA 1EEXB 2JGIA 3VKWA 3VGJA 3ZV4A 2HCJB 1TFRA 1ECFA 2LPMA 3LQYA 4BKRA 5LOVF 1VCNA 2ZBVA 4EYKA 4XKJA 3VZPA 5AI4A 4NV0A 4MA0A 1G5RA 1DXYA 1I4LD 5EP2A 1GNVA 5IJZA 1XC7A 4NKRA 3TGLA 5JEDA 2Y1GA 2BGMA 3HCPA 2C7VA 5K1ZA 4LVUA 4BMNA 4NIMA 1U1IA 4R9SA 1OGYA 3KC2A 3BTVA 5AUQA 4TX1A 2Q3HA 1KMHA 1VLHA 4BUZA 4LOAA 3QW2A 4TS1A 1ZXBA 1JHOA 2HSEA 3QWIA 5BQFA 1SHLA 2IYZA 3LECA 1IY8A 3OLWA 5DYIA 4ZOLA 5JAPA 1YZUA 2JBAB 4LWZA 5HCUA 3O84A 2CLSA 3F90A 4KYUA 4ZCLA 5IBQA 2TMYA 1UZMA 2NZ2A 2RDMA 3X2FA 1ZEJA 1II0A 2Q5HA 4RD4A 5FWXA 5G0SA 3WLLA 1UMDA 3NOVA 2B7BA 5JU6A 1YS6A 3V7WA 1U7TA 3AHFA 3R7LA 4IHJB 3TEFA 1AVTA 3KSDO 1L8LA 4B0PA 1JXAA 2UZIR 1YB2A 1EX9A 2B4YA 4KI0A 4KXUA 2B8WA 4KXYA 1HORA 4QOSA 4BNIA 1BVYF 2OBXA 4KWIA 3NHUA 1ONSA 1R4NB 3PIRA 1WDLA 4P54A 5TQ2B 5KINB 1GUFA 4O4HA 2ZU6A 5G41A 1KETA 5AM5A 3DBLA 2BBOA 4M1TA 5BSFA 2E1RA 1UBUS 3HBAA 3G0HA 1Y98A 2PGLA 4IGIA 1JIUA 4JZYA 3NTXA 4GNRA 4NY1A 1W52X 2FCRA 4NZMA 4F5WA 2E5LB 4XPIA 2RB5A 4JLSA 2PLAA 2XDYA 4JLAA 4CU5A 4CKXA 4KEAA 3ZGOA 3F71A 1BXRB 2Z6QA 4KG7A 4L02A 2ARKA 3T06B 3TL3A 4ZHSA 1ZK1A 4W5QA 2POQX 1JKIA 1QYRA 4ZYTA 4XR9A 2W83A 3H13A 3LQ2A 5E2IA 1PN3A 2IDJA 1VCOA 3LCVB 3RGWS 1KL7A 2R5WA 4YB8A 4E5NA 1L7QA 1UBTS 2CHUA 2EGGA 4M1OA 4KDEA 4PGAA 1W0JD 4JKOA 4R6WA 5EPOA 1C0PA 3IAFA 1KDYA 1V7ZA 1POWA 1Z88A 4UC0A 3KXPA 1EX1A 2OLJA 4C7MA 5F64A 1UKAA 3PX3A 5D7NA 4E3ZA 3PFNA 2H7XA 1S2OA 3KDSE 3UAOA 3TNLA 3AI3A 4NYMR 1Y7HA 3HUDA 3PXXA 4KBGA 1C1XB 4OF4A 3OQIA 2JAUA 4Y2RA 3T4XA 1TB4A 1Q0HA 3CLKA 4YYZA 1C30A 4IJ6A 5COQA 3O93A 1YB6A 1TK3A 2OHGA 4ZZIA 5GZ1A 2ODBA 1YRQA 2P79A 4PS1A 3HJCA 1A2BA 5CD1A 1U94A 4X1KA 4DDKA 2H9YA 3S28A 3WWCA 3QLUC 3BIXA 4GMFA 1KAHA 1VJRA 3ZBUA 3K70D 2X0EA 3USCS 2XMCA 5HRCA 5LKRA 2MHCA 2V7EA 2A3RA 4UHBA 3DBRA 3WC4A 1PQWA 2FXVA 1QS0A 3M8KA 3TUJC 1O5TA 5JZMA 3NXKA 3IDQA 4KFSA 3H84A 1G7CA 4Y9SA 4Q1CA 2CZQA 1HE2A 2FPGA 3DE7X 1Z7YA 4IFTA 3L6RA 3V8NA 3ZY4A 4CM8A 1Z13A 2VKQA 3TSCA 4YPVA 3GJRA 3BEOA 3M4ZA 8AT1A 5H8WA 1JI0A 3DHEA 1U3VA 2GASA 4D99A 4DE5A 3IYLW 2B1QA 3HR8A 1IAVA 4H3SA 5A0VA 4P0TA 5K8LA 3AKCA 3PWTA 3QVJA 1DJMA 3HZRA 1XMSA 2B3DA 5IT5A 1RMYA 1H6BA 1SVNA 1NVXQ 4HXGA 5HBGA 1UKYA 3HYNA 4F56A 4DB4A 1FQOA 4OATA 3GLFA 2VDRB 3VR6A 5T4FA 2H17A 2ECOA 1TTQB 2M6LA 2NU9A 2Q4EA 4GD3Q 3RWMB 3TRJA 3EIHA 3A0RB 4G5YA 3RM3A 5F3WB 4ITRC 5BR4A 2GPNA 4ENPA 3P4UA 4Q9KA 4PRLA 4ZYUA 1RWNA 1E2EA 1YJAA 4A2QA 2RIPA 5DOZA 4GUAA 3JRNA 2ZJAA 3LF2A 3FPEA 5M04A 3STVA 3L8FA 2IOHA 1USGA 1P9RA 4WGFA 5EXPA 3TZHA 3UJPA 4EW6A 2WKRA 1U1CA 2MWMA 2ZPTX 4MVYA 5U1PA 1WP4A 3MT0A 1MW8X 3VV2A 3HGMA 1FQJA 3GP3A 4XYEA 1SUEA 4GZLA 4RJLA 4U6SA 1XEWY 2X6QA 1Y1RA 3P2IA 3CB4A 3PNYA 4QWMA 3DQPA 4AG6A 5JAUA 1AMNA 1HDOA 1UKEA 5CHYA 1KRWA 1DL5A 1G16A 4NBKA 1NBMA 1E2LA 1YC5A 1TYDE 4XQGA 2O0MA 4OFZA 4HJXA 4B79A 4A23A 2IH2A 2XJ4A 4KDRA 4RIGA 5E8JA 3ZHBA 4BLTA 4BMZA 3MTDA 3QRWA 2XH8A 4E03A 3V8MA 3NUQA 1WCWA 1TW2A 2G9RA 1BW9B 1RJEA 3W5UA 1I7PA 1UAGA 3JAWB 1ZM3A 3QNWA 3BXZA 2NYUA 4KXXA 4MCAA 4PRZA 3VJLA 3N75A 5C7OO 3FSGD 1J23A 4ARIA 3H5OA 4G0NA 2RI1A 3BMQB 3HGTA 2UU9B 4QGFA 1HRDA 3GBSA 1VRWA 2VI5A 3PICA 1ADBA 1Z0DA 5LYJA 4AURA 3OP4A 4OSEA 5HIJA 4CMKA 3TB4A 3ENWA 2BGTA 3B6MA 2M1XA 2RHTA 3KRTA 1G0NA 2H7YA 3L41A 3RJZA 1RZ3A 4ID3A 3WHIA 3LKVA 3QXJA 1E6MA 3AFOA 1X8KA 2JASA 4X3OA 3BSYA 5AW9A 5CD9A 5LWQA 1W85B 3D6UA 1CQIB 3L92A 4JL5A 1M1NA 4KUHA 2O50A 2G1KA 3K9LA 3OHSX 4HQ0A 4WESB 4Q9LA 5JS7A 5K6RA 1UXGA 3REFA 5EZYA 4BEWA 5KYYB 2PBRA 2HLPA 2B8TA 3GGOA 3LUGA 2GPWA 3QELA 4KZKA 4ZO7A 4YFVA 4Z0NA 4CKCA 1XA0A 1AZTA 3L4EA 2WTBA 2XB2A 4FIDA 2O8DB 4MWSA 3UYKA 1NIJA 2R87A 1UT5A 5CDFA 4DV2B 2VEOA 3EXHB 1Y6GA 1KI4A 3GCZA 1B0AA 4GIBA 4RD2A 4N4AA 2P68A 5DX8A 3GOHA 3TECE 1ANKA 4AKIA 2JC3A 3C2QA 2PQ2A 1Z74A 2IYWA 2LKDA 2WIJA 3CNEA 4J1TC 4RIHA 5DGIA 3LP6A 2FRVA 4IOMA 1JZQA 5GM1A 1FS6A 2PA3A 1USUA 2XSZD 2NO7A 2HMYB 4P3NA 4QJ3A 2IHBA 1V1MB 2V6FA 5BYKA 3CNHA 1OASA 4FS3A 4EO7A 4IYJA 1SG9A 4J7XA 3V7YA 3A6JA 5JRDS 1MV5A 1QP4A 3VR1A 2AMFA 2Q5FA 1B4DA 3FFTA 4MUIA 2ZWOA 4XRRA 5HQ3A 4DT1A 1JI3A 4LRSB 4IIJF 1A8HA 2WIAA 3KLNA 3W04A 3LLSA 5T7BA 2XW6A 1UBFA 1RD4A 2V7WA 4JDPA 4LHZA 3TEMA 3X44A 1U4OA 4EEXA 3FGPA 4EYSA 3H9CA 3FAKA 1LA2A 3N8IA 3GJQA 3PXCX 4JYAB 4D9KA 3H3XA 3R3VA 4BRUA 3RC2A 2C94A 2GM9A 2JDIA 3ESXA 3K35A 1YD7A 4QEDA 1L8OA 4UNSA 3WLHA 5BPFA 2IBSA 4FHGA 2IYVA 5JW6A 4F8YA 4GR9A 5DK4A 3CIFA 3NHJA 3OWOA 5G1NA 1XWIA 1FP2A 3HDGA 2DT8A 5H59A 4FR5A 4MKIA 4Z2YA 1N5IA 1XB2A 2OPBA 4LC9A 4NV3A 3VX3A 4B7ZA 2Y1OA 1P1RA 2DPLA 4F21A 5A1TA 2CBGA 1BHQ1 2NIPA 3T61A 3H5NA 4D4JA 3HHPA 3QWFA 5JCOA 3EQ6A 4QLAA 4L2IB 3MSCA 1JGTA 3B7PA 5EIBD 2G28A 3RYCA 1QRUA 3U4CA 4A7PA 1NX9A 1P91A 3NHSA 4BMYA 4BWFB 2MINB 4DDHA 4F72A 3VHXA 3T1OA 1DBPA 1R0BA 4FD2A 2GM4A 3VU9B 1DAFA 3UJ3X 3DMDA 2AA3A 4Q9DA 2HWXA 2OV6A 4NVRA 1R0WA 2VAWA 2KLHA 1V1JA 2ZROA 3CX4A 1ZXLA 1P1IA 1JBQA 2BKUA 3QVGA 3OE5A 4AKSA 3FVTA 2EZ8A 1APBA 4CGZA 3HA2A 4UHKA 3E9MA 3G49A 4RETA 1SXJA 4RK7A 1G7SA 1RJ9B 3M3PA 5KSOA 4DIDA 4JXKA 5K05A 2X77A 4WUTA 1RIFA 4KH1A 4YMVA 5IT9A 3S8MA 2RK3A 3U3KA 1BNCA 3TVDA 3NHZA 4ITVA 4Q19A 4XDHA 4XEUA 3TFWA 3G9UA 3KOYA 5CFNA 2XCQA 5MF6A 3AUYA 4HQRA 3BA6A 2CUNA 3BBLA 1ZNWA 4JGBA 3KQKA 3K8OE 5AXBA 2NW6A 5HKBA 1X14A 2BCJQ 3OZ7A 3LHDA 2VTBA 4HY3A 1C4WA 3MBIA 2LWIA 3B70A 4M9ZA 2YYAA 4E5KA 1KI8A 5HA5A 4PG8A 3RAFC 3TL2A 3RAEC 1R7RA 2CXHA 2OV4A 3DFMA 2HDWA 1T35A 4TV8F 3ZDCA 3ITNA 3EGVA 5TARA 5JISA 4LF8B 1YL5A 2C2MA 5FTKA 2OQIA 1TEXA 3K0FB 1SUDA 2IUTA 4GYJA 1AMUA 4MW1A 3JPWA 4K03A 5IK2D 1ADCA 1XZLA 3NEYA 1NAIA 1J2TA 1S8AA 3DM9B 3O82A 4QU9A 2OV1A 1ELOA 5AVWA 1T26A 2JLBA 3NTVA 4BGDA 5EEHA 1EGMB 3LC7O 3G0DA 2FUG1 1UWCA 3FZYA 3RFVA 1QZ3A 1LQUA 1UBKS 1L5NA 3PC7A 1T15A 1M1YB 2GO1A 3SC2A 2G5PA 2E3JA 3H19A 5JSZB 3G0GA 2X86A 3ZN2A 1U5CA 1GG5A 3I2JA 5E2BA 4CM4B 1OI4A 5JR3A 5FQNA 1AB5A 3BWXA 2QT9A 4V38A 4AUKA 5DTIA 4PQFA 4BGVA 1HT3A 3WMWA 4TGLA 5KQMA 5CAEB 1N7JA 5BVGA 1WF3A 4GXRA 1GLVA 4BTVA 2BSAA 3LJKA 2I65A 2QN2A 3GJYA 3PXUA 3TIXB 4EITA 4LOIA 1FRVA 1M2FA 3QPVA 2V7PA 1A04A 2FUCA 2OHJA 3P20A 4FFMA 4IIVA 4M9QA 2RKWA 1R5BA 4R2XA 5EG5A 5KQRA 1UQRA 5HKAA 3OPYI 4R71A 3HJFA 3RFXA 1B6SA 3A6DA 3DE3X 4J0EA 1WD5A 4ND5A 4EYQA 3LG2A 2ZCJA 3U31A 1WB6A 5A7FA 5BSGA 2LTAA 1I0LA 3E2IA 2J5QA 3JRWA 3ZWKA 3EOBI 3AW8A 4GLJA 3ENQA 2BOVA 2HSJA 3IXQA 1US8A 3LDHA 3NETA 5B5SA 3TQFA 5KYWB 1U7UA 1XQXA 3DONA 1R66A 1DFIA 3JALA 3OU6A 4X00A 4X1YA 4BQPA 1E20A 2HN9A 2JJMA 1Y8QA 4MV4A 3WDMA 2J5RA 4JGIA 3DLIA 4O1IA 1G66A 1ABFA 2PX4A 3JQ8B 3SXJA 3T5DA 4ASUA 4V0MA 3NDBB 3R9XB 4N3AA 1OBOA 3COJA 3D3EA 3MZ0A 4OJQA 3NBXX 3IT1A 4UW9A 5CEFA 1C80A 1B3BA 4LISA 2JIQA 1EJ0A 2HO4A 3GELA 4PLPA 4QU5A 1XNRB 4FDUA 1Z2EA 1DXOA 2ORYA 3FUTA 3N6XA 2VXYA 4F97A 1EDOA 2OB1A 3KWMA 2EHDA 2HSZA 2QX8A 2W2OA 4L4ZA 4A1FA 5BVHA 5I7WA 3EGDB 1OX4B 5TVKA 1CJVC 4DUZB 3M33A 4F3RA 3HPQA 1MN6A 1OZ0A 3NVDA 2X1VA 1L3IA 3HY6A 1L5HB 1PL6A 2BMVA 2M6SA 2NXWA 2ODEA 1E1QA 4Q3DA 4BAZA 3NDIA 1TAGA 3RSFA 1FJGB 4M1YA 3EVCA 1NQAO 5BWNA 4EEKA 2DEUA 1CZHA 1GTMA 1WZNA 2CBXA 2VG8A 3MGBA 4WY5A 5AYVA 1AY0A 2PX3A 2XD4A 4Y6PA 3T7SA 2GBFA 4NTZA 5G1PA 3P9YA 4R8KA 2Y27A 4C7JA 1WW8A 3AVOA 4ZTUB 3NLLA 2XMGA 3OC6A 4IXTA 3TNJA 4KXLA 2ZB2A 2VO1A 5FV7A 1PR2A 2WPDD 1HL7A 2AD5A 2C9YA 1A7JA 5TEVA 3W5HA 2O4CA 5ECWA 4RD1A 3L1IA 4DNFA 1GFIA 4NMLA 2YFKA 4MICA 1M3SA 2VRWA 3IFSA 3OE7A 1Z2AA 2XZTA 3FJOA 5EJ5A 4MHTA 2F1IA 5FPPA 2ZI6A 5H7XA 4H3KB 4L72A 1TZMA 1U3WA 1AH2A 2CMDA 2HBYA 2VA9A 3S81A 3BGDA 2CDCA 2BZGA 2NM0A 3NAQA 1ZGGA 1NXQA 4CYMA 1PVDA 3OF2A 1DP4A 1GTJ1 2BMFA 3F9IA 5FI5A 4D45A 1EP3B 2EFEB 1Y7IA 1MORA 2NXCA 2QQ0A 2WSIA 5TS3A 3ACCA 3NGLA 2JFFA 4JHLA 2JAXA 4O6VA 1JR2A 4E14A 1GZVA 1WCIB 4JP8A 1U7ZA 2FPIA 3BDIA 2IYTA 2ZCUA 1IIRA 3HVHA 1NONA 1YMVA 2QMQA 4QG7A 5DP2A 5EUMA 3H9EO 3V4OA 2CHVA 4D1YA 3EUAA 1GP2A 1BYUA 5AJXA 2IYOA 1GKYA 4YQZA 1I3KA 3JQAA 1SNYA 1T9KA 3JYOA 4N7JA 4UNNA 4I3HA 4BWYA 4C2UA 3U9TA 5KQLA 1LRJA 2Q0XA 4UOEA 2R0QC 1M10A 1RPAA 3FTCA 4FUTA 3HFGA 4PG6A 4PHCA 1RC1A 2OO3A 3UJ7A 2UDPA 1XQVA 1GCAA 4UMEA 4UNPA 4CEJB 3QJ5A 1KK3A 1DOHA 1Y6FA 4UPVA 2P5UA 1DPGA 1LNSA 5BUSA 3GCWA 4O4LF 2OHXA 3PDCA 1YB1A 1DDGA 1Z4KA 3M4NA 1XU4A 4OAPA 1KZHA 2C57A 2ZUUA 1TEHA 3N0VA 4ALLA 2BR4A 3KYCB 4G65A 3T7CA 1GUBA 1GSIA 5H83A 1NOJA 2JHAA 4QYIA 4GWGA 4A6DA 4BPBA 2D00A 4UUBA 4DA4A 2H2GA 3V7FA 1IQUA 2JKVA 1RHJA 4MYUA 2CZGA 1IPHA 5KMGB 4O3MA 1P9WA 3D6VA 2MR6A 3F2VA 5AM4A 1NNEA 2O19A 2CLDX 4BC1A 5DBIA 1CY7A 3UWKA 1RQLA 1Q95A 1YFJA 3NIWA 3L5KA 1NW6A 1DKQA 4HH3C 4NPHA 5AM1A 1D0SA 4GKAA 2W2QA 4N3GA 3PHCA 4EA8A 1XMQB 5LZ9A