4MGYR

Selective activation of epac1 and epac2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
total genus 47
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgyR00
1SXJB 2WWWA 2JJ1A 4BZXA 4XWOA 3QSYA 1F60A 1W46A 3ZQJA 2GILA 1TQ4A 3A1WA 4OHVA 1YRAA 1S3SA 2DFTA 1ZNXA 3LVQE 3R20A 4LK2A 4ZI3A 2XZLA 1KO4A 3NEYA 4X8MA 4EUNA 4GOJA 2G6BA 1WB9A 2C5LA 1XEWY 1TTTA 3QVVA 1US8B 4UXHA 3ZVLA 1JB1A 5BWMA 3IO5A 2WZQA 3CRRA 1HT2E 2FPLA 1J90A 2PX0A 2P5TB 3SYNA 1E1RD 2QP4A 4M22A 3ZZTA 2C96A 1CP2A 3GLHE 3VQTA 1RC8A 4M1TA 1WA5A 4TWZA 4P32A 4N3NA 1U81A 1GRQA 4NCKA 1Z6GA 1P5ZB 2NO9A 2WWXA 1K5GA 3FMIA 4DCNA 4XWAA 5D3QA 2PZFA 4NYIQ 2QRNA 1Z22A 1A2BA 4DIEA 2ATVA 3LXRA 2E9SA 2YKGA 2BCJQ 2FE4A 4OL0A 2IXFA 5KOYA 4F38A 3U2QA 3MUFA 4JMPA 2AFHE 3GEEA 5HCNA 1Q1BA 4PX9A 4QL3A 2JLSA 2IS4A 4PQRA 5L3SB 1QG4A 2QTVB 4AI6A 1IY0A 2ZJ5A 2WV9A 2IWRA 3QF4A 3EZ6A 4CYMA 1H8HA 3VX4A 2Y8EA 3VR4A 5KPDA 4JT2A 3BWDD 3BC1A 3RNLA 5H68A 2REXB 2YYZA 1KJYA 4JYCA 1L2TA 2W2XA 2Q3FA 4LYJA 1DARA 4ZPXA 5CM8B 1RW4A 2BMJA 2QE7D 1LF5A 3KXKA 5DYIA 1OV4A 3KJGA 2R6DA 2GVZC 4FXPA 4KFSA 2CLDX 2D4HA 3CPJB 3W34A 4EPRA 3NXSA 4RD6A 3RSOA 1KK0A 5JCPA 1DADA 4M1WA 4ASUA 2Q3HA 2OXCA 3CPEA 3QE0A 2VH5R 2A7QA 4AK9A 3ZZ0A 4KODA 3AF2A 1KY3A 4QG7A 3UWKA 3HPRA 3QBVA 1N6PA 2EWVA 4QJ3A 4LJ9A 1HYQA 5CK4A 2WIAA 1Z0DA 1VYTA 4EDHA 2J9RA 2JJ2A 4V0LA 2FGKA 1RRPA 4Q00A 5ANRB 4C0JA 1JR6A 1M34E 4ACAA 3K0CA 4NTZA 5EUMA 5SZIA 1NBME 2G0NA 1WCV1 5DLQC 3BFXA 4XVRA 1IY1A 2CHQA 3PIRA 3OE7D 1DAKA 4HLUA 4JBWA 1XFAA 1SVLA 4QKQA 4B73A 4NYMQ 4X8OA 5GJCA 3B1VA 4YXWD 3F0TA 1Z6XA 4LJ7A 4D2IA 4KYIB 1YZGA 3MG9A 5DHAA 1W36D 1Q20A 4B6EA 2QT0A 3VKWA 3P26A 2JLXA 3I3SR 1W7AA 1Q1QA 3VR2A 5GJWC 5GJVC 1T3LA 4DSTA 1R8QA 4E5UA 1RYHA 3GFTA 5EP1A 2GEVA 1SKQA 1N3BA 2HEIA 1D6JA 4ZDJA 2WSSA 4GOKA 3CH5A 5CYOA 5JSZB 3R7WB 3ZLJA 1T91A 4EJSC 1XPRA 1TF2A 3QEOA 1E2MA 1QG2A 4D81A 1YQTA 1WXQA 2V1XA 2W0SA 1DG1G 1U99A 1XEXB 3UMRA 1L7VC 2GZAA 2BMDA 4IVPA 1NN0A 1XD2A 4OI0A 1R0XA 3C7KA 5FTLA 3GCGA 4C0BA 2G88A 4RD2A 3D31A 3GFOA 4JLKA 4ZKDA 1MABB 1PVOA 1X6VA 3GQBA 4Q66C 1N6RA 3I73A 3W9YA 3TSOA 1OH5A 3CNOA 4C4PA 1Q44A 1KKMA 2FMXA 2VLIA 4BWYA 4FMBB 4LYFA 3HWSA 2V7QD 3NC1C 4Q47A 1EFUA 2GCPA 5E7MA 1P6XA 2EWWA 3BE4A 4GSYA 5JEEA 1KDTA 2ZQ5A 4RJLA 3RHFA 1KZGB 4TYYA 2PJZA 3NIBA 1U90A 2ZI6A 3FFAA 2X2EA 3K8YA 3KUCA 2P5SA 3TR0A 1YVDA 4G5OA 2D62A 1G8HA 1P9RA 4Q7KA 2DY1A 2H7VA 4HAYA 1BOFA 2IL1A 1X1SA 2PZEA 5CM9C 3UXMA 1IXZA 3UMSA 2OBLA 1JEDA 4FIDA 4FCTA 1D9XA 1G41A 1QHIA 4ZCMA 2A3RA 4IVRA 2ZJZA 1BKDR 2NPIA 4E09A 2ZJYA 3Q5DA 1VG1A 1NBMD 3QKTA 1TPZA 2ODWA 3K09A 4ESVA 4UNRA 3A58B 2QQEA 1CTQA 1W47A 4DLUA 4TMWA 4A8JB 1T5IA 3U7EB 4PZLA 1E2GA 4GMDA 4V0ME 3FWYA 3QENA 4BLOA 1ZCBA 2WKPA 4B3FX 2DPXA 3SBEA 2V55B 3CX8A 1FUUA 4JLDA 3TIFA 2VSFA 4YDSA 4OK5A 4AKEA 3L0IB 4C0LA 4A36A 2EFDB 4Q02A 3MJRA 4L4UA 5JWHA 5AJXA 3GJ0A 3KJEA 3LD9A 3K70B 3FMFA 3BH6A 3NHAA 4YMVA 2DB3A 1VCIA 3SJBA 1TU4A 5E7JA 1E69A 2C9CA 2BMEA 5E3HA 4GDFA 1SXJE 2QN6A 2V54A 2XITA 4RZXA 5CIWA 4WOPA 2CCGA 1QHHA 2JJ2D 2WMOB 4QBHA 4QJ4A 3ZIAA 3DEFA 3KB1A 4ACBA 2ZRPA 5FUWA 4AG5A 3WP1B 1CEEA 2ERXA 4L16A 3OAAA 2WJYA 2FNAA 2AFIE 4JLBA 4YMWA 4JL5A 2HJGA 4ZIRA 1E6CA 3GJ4A 3I5XA 3HYTA 3THWB 4DSOA 2QI9C 1AA9A 3FKSA 2ORVA 4XVUA 3WNBA 3W6OA 2ZR0A 2EYQA 1SKYB 1XXHB 3SYKA 3VR5A 5EP2A 5EXTA 4QGHA 1XTQA 4A6XA 3U61B 4JVNA 3U44A 1N5JA 1M6NA 1VMAA 4RD0A 2JIZA 5LDDC 5CLQA 4U5XA 1GRRA 2HLDD 3C5CA 1DBSA 3L0OA 3P4XA 5EUQB 1E0KA 5DIFA 5C18A 1E9DA 5LD2B 4M9SA 1EWRA 3DZDA 4KHZA 821PA 1BIFA 4W5WA 4PSAA 3SJCA 1WF3A 5FH9A 4LV8B 3VMFA 1GSIA 4O3MA 3AUYA 1GG2A 1E9AA 3I32A 5HE8A 2FDCA 2W6ID 2FG5A 5DSZA 3TR5A 2KJQA 3AVQA 1PUIA 3AVXA 2FFQA 3HU3A 5CJ2A 5TMPA 2BCGY 5KNCA 1FTSA 2NG1A 3PENA 4WAUA 5G53C 3DHWC 1R10A 1S9DA 5P21A 6Q21A 4DB4A 2UKDA 3W5JA 1Q21A 2Z4SA 2O0HA 1OXSC 1N6HA 1IXRC 1XRJA 4LRWA 3T1OA 4CDGA 4DCSA 1OH7A 4NH0A 2F3TA 3X2SA 1Z6TA 3SQXA 3GD7A 1S8FA 2Q9CA 5FPKA 1DAFA 5DN6A 1V5WA 1ZU4A 5L3SA 4G5GA 1DVRA 2VEDA 2E1RA 3CWQA 4TN1A 3QXXA 4S35A 2YVUA 4JLAA 1WP9A 3BERA 4QRHA 2QAGB 2CXXA 4YMUA 4WXRA 4B6FA 2W83A 3EC1A 2BBWA 1S0UA 2Z4RA 2JLRA 4IKEA 2X1VA 4BLRA 3DO6A 2LKCA 1JNYA 4L8GA 1NY5A 1SGWA 5AJWA 4C30A 2FPKA 4HLDA 5EP3A 4A0HA 2OAQ1 2G83A 2J41A 2ZAOA 5BQ5A 4FMCB 4DSUA 3T1TA 1COWD 1TMKA 1GFIA 2ZXUA 4LBWA 1IN7A 1RKBA 2R6FA 4MDEA 1RPZA 5CK5A 3TSWA 3RVBA 2GXQA 3FTQA 4EFLA 1KKLA 4MH0R 1TEXA 3V00A 3NEJA 1XNJA 1FX0B 2QTHA 4P31A 5TY0A 1L4UA 2GCNA 1E1RA 4XD7A 3ZD6A 2AK3A 2ASEA 3X1WA 2WAYA 1JI0A 1OE0A 4I4LA 3EPKA 3SFVA 3GFPA 4IXMA 1JR3D 2ZRJA 2ZJAA 1LVGA 1E9RA 1FNNA 4TZ6A 1KOFA 3WHLA 1JXOA 2AL7A 2HXSA 2CL6X 2OHFA 3D6TB 3LBNA 1MRSA 2ZJ2A 4Q9KA 1QHNA 1VCMA 3A8TA 1U0JA 2CNWA 2NQ2C 3HR8A 4DLZA 4PTLA 2D74A 5JI3E 4WIAA 1T5LA 3H86A 1J8MF 4G0NA 2ZI3A 1FMJA 4A2PA 2IYSA 4JIMA 2F1RA 4MRVA 4A0GA 4A8JC 4N1AA 2CHVA 2OV2A 3I72A 4QHSA 1CR2A 4Q9HA 3G5UA 1E0SA 4DLWA 4Q7JB 3ZS8A 4PZYA 2JASA 4XH9B 3TBKA 3AGPA 4CRWB 2QAGA 1NG9A 2Q0HA 4Q4HB 4HUTA 1CJUC 2ZREA 4URVR 5KTYA 2J46A 4HZUB 2ZUBA 4LJ5A 1X8JA 2OAP1 1IY2A 4PPNA 4B2IA 2WIBA 1OFUX 4Y0VA 5G3ZA 1XD2B 3SQWA 3PG5A 4JS0A 3U3JA 2RAPA 5CLLA 5FOTA 2A2ZA 4Q1BA 2VHUA 5KSYA 4HATA 3AF4A 3TRFA 2NO0A 4OK6A 5CDFE 1KMQA 2ZS9A 4DCUA 4OQLA 2CDNA 2ZRLA 1JJ7A 2CK3D 4JBXA 2ANBA 2A30A 1YR8A 2ZRIA 3EIQA 3O8RA 621PA 3GJ5A 3OESA 2QSZA 3IILA 4Q01A 2GWHA 2AKAB 2I4IA 5FOXA 5KNBA 4DJTA 5HZHA 3SE0A 2BVNA 3M1IA 2C2HA 2F7SA 3GJ6A 4TL7A 4RFSA 1MRNA 2C8VA 4LJAA 4PC2A 1XCPA 4H1UA 2BV3A 2XAUA 1KK3A 1N5IA 4BASA 1SHZA 2KBEA 2IYWA 2EFGA 2ZS7A 4Q9IA 3GLIA 2KWIA 1EFHA 3KL4A 1UKYA 3C15C 5FOUA 4ERNA 3ONWA 2QT1A 2RCNA 2VP6A 2C9YA 3QJYA 1Z0AA 1W4CA 1G8FA 3AEZA 2XNDD 4KV9A 2Q9BA 4HUQB 2F43B 4DUGA 1VG8A 1A2KC 2ZTSA 3OAAD 1VHLA 2ZRCA 1ESMA 4MGKR 4JJKA 3DVLA 2XJ4A 2CVFA 3W6PA 3GLFB 3QG1A 1XMSA 1FMLA 1JAIA 3M6AA 4GT1A 3NHBA 5FUXA 2IYXA 2FGJA 2GRJA 3V4RA 5FL7D 2GVDC 3VHXA 4DSNA 4GI7A 3C16C 4HB0A 3VFDA 1G7CA 1TNDA 1RE0A 2YZ2A 2IA5A 3N2IA 1CLUA 3RANA 1G16A 3K09C 2WKQA 4Q1CA 3L8YA 2FX3A 4NYJQ 2IYUA 1KNQA 2IYLD 4HI0E 4M9QA 1D5CA 2YOFA 4QM7A 5KO2A 1FPMA 1KMHB 4ESHA 2Q21A 2BEJA 2HCJB 4IDOA 5FTJA 4IFEA 1G8YA 4PAMA 1N0UA 4HZUA 4B74A 4BE7B 1BH2A 2WSMA 2NPFA 4KU4A 2G1JA 3LY5A 1XB2A 2ZM5A 2BBOA 4TT3A 4Q4HA 4V03A 3KFVA 3AVPA 3E2IA 1UEJA 3LFUA 1IHUA 4QGAA 4AG6A 2VQSA 2O5VA 1KYIA 1HV8A 4R98A 2JCSA 3WBKA 4JT4A 3QF7A 1KHTA 4URZR 3WMFA 4JVLA 1UM8A 1XJ0A 3RS3A 1EFCA 3CKLA 2R2AA 2RGNA 4LHWA 2GNOA 2XNDA 1XMIA 1XD8A 4F4CA 1OT3A 2WJIA 1Q3HA 3CH4B 2IWHA 2X19A 1KSHA 3QKSB 3WYGA 4B3GA 4B34A 1OB5A 4C2TA 1E2JA 4WZAE 2B6HA 3LX8A 5LB4A 4NHOA 2IUTA 4A6PA 1TUIA 3EZ2A 1GL7A 3RAPR 1ZUNB 421PA 4UXIA 3TJZA 1QHSA 3CR8A 3G82C 1XMVA 3BGWA 4DZZA 5G41A 4M1KA 2C77A 1XBTA 2ZI4A 2GBLA 4DLXA 1T8UA 1CKEA 1R5NA 1MABA 2GCOB 3FB4A 3M4YA 3NBZC 1RFLA 4M1OA 2JGNA 4TQ9A 3GLHA 3WHKA 2ZAMA 4V0NA 3TAUA 1KMHA 3IIMA 3I8XA 4P4SA 5IK2D 4AYXA 3FGNA 2F55A 3KTAB 3KQUA 1YU9A 3W3AA 4TQAA 1XEXA 2Z5FA 5AUOB 1QHYA 1E9CA 5TV2A 2WJJA 2WWGA 1I2MA 4A0RA 1VIAA 1PZNA 1ZYUA 3EASA 2ZRAA 4Z1MA 5HKKA 2XOKA 1KDOA 4HDOB 4HLUC 4FW9A 4N0DA 3WYFA 1RJ9B 5FL3A 4US1R 5E95A 4ARZB 3GLGB 1Q3TA 2P6NA 1WMSA 3D3QA 3B6EA 5F2EA 3RRZA 4MYCA 1RRCA 1COWA 1IJEA 2X2FA 2XB4A 1R5BA 3Q3JB 1HEIA 4M21A 4ABYA 1E2FA 1FQJA 1QF9A 2GEDA 3K70D 3AP1A 1ZNYA 4F4IA 2F3RA 3NC0C 3M0EA 4QHYA 1KO5A 1R7RA 3LO5A 2IK8A 1RYFA 2J0VA 4BZQA 1M74A 2F43A 2KBFA 1FZQA 1BMFA 4TZ0A 2D3WA 4CIDA 4M0LA 1XP8A 2N46A 3DOFA 4TLEA 1Z0IA 1AQYA 3LVRE 3P20A 3R9WA 1XEWX 3LNCA 1HTWA 3IKJA 4K46A 4KCGA 1CR1A 2JLUA 1EWQA 3QKRA 3SOPA 1H8EA 1U0LA 1ZP6A 2CEAA 1C4OA 3EZFA 4Z1MD 2J59A 2YINC 4D4JA 4XIGS 5KYKA 3L0PA 4LX0A 3J81k 2PJRA 5TXGA 1A4RA 5L3QA 3E5HA 521PA 2V4ZA 2G3YA 4AWXA 1XJQA 3K0SA 3FMOB 3RWOA 4DIDA 1EESA 4DCVA 4JSTA 1KDPA 2RKOA 2QM8A 3L0SA 5J4LA 4JVSB 2DCUA 3EIEA 1IJFA 4PFSA 5B2ZA 4JYBA 4A9AA 1QDEA 2ZRDA 4R9UC 4UJ5A 2F9MA 4TSFA 3CONA 2G77B 1KI6B 2WOJA 1P3JA 3THWA 1OIWA 1A7JA 1GKUB 4IOKA 5EP4A 2ODEA 4ZIRB 2XZOA 4BFZA 3WNDA 1E2IA 4NZYA 1A1VA 4RSGA 5GVRA 4OQNA 3ADCA 5ELXA 4MKFA 1EG7A 1FW6A 2GJ9A 4OK3A 3EIHA 4PC7A 4KSBA 2A5JA 5FOSA 3EARA 3NKVA 3DPUA 4I1VA 4DRZA 3DMDA 3RLFA 2GK6A 3QOFA 4W7SA 5FPYA 5HR5A 2O0KA 2PEYA 3KKNA 3AV0B 3MSXA 4JL6A 3TE6A 3FKQA 4EAQA 5KPJA 5SZHB 1D2EA 4Q7MB 2ZRFA 1U8ZA 5EZ5A 4M1MA 4KFRA 2XB2A 3T5DA 1ZNWA 3IHWA 4KXFB 2IEZA 4H9GA 1OHHD 5DISB 3IUYA 4OHZA 3SHFA 2FN4A 4GL2A 2G1KA 4DDVA 3OIWA 4HB4A 1ZIPA 2ZU6A 1U8AA 2EVWX 4TMZA 3DMNA 1W36C 4OQXA 3WNCA 4Q48A 3VKGA 4BUJA 2QTFA 3D7MA 3HYRA 2IUSA 4BEJA 2AD1A 3OEHD 4C9BA 2OBNA 3EPHA 3RC8A 5B64A 1LTQA 2HYDA 721PA 1YJ5A 1Z8FA 2O8FB 1O3YA 1SXJC 4M1YA 4B32A 1R0YA 1T0JB 1NVXQ 3OIVA 1NN3A 4QC2A 1GAJA 2O8BA 5DH9A 4PANA 3TGPA 3A36A 3ADBA 4HLCA 2IS6A 3DZ8A 1E94E 4EIWA 2GJKA 4LC0A 4FWTA 1E79D 1SXJA 2BBTA 3CF6R 4IW3B 1NLFA 4LHVA 3B1WA 5IHPA 1IAQA 1UADA 4B3BA 5LBIA 1XX6A 5EE9A 3MMPA 3THYB 1OXXK 4Q1EA 4P33A 4DEXA 3LAWA 1P62B 3B9PA 1GKIA 1EX7A 1HQCA 3IDQA 5TVKA 5FUVA 1M8PA 2ZE6A 5J4KA 3F5FA 3EWAA 1Q0UA 3U5ZB 2AD5A 3LW8A 2D7DA 5DN6D 2QGNA 3KJHA 2IYQA 2YHSA 3CM0A 3EA0A 3UMFA 3PUYA 1N5LA 5DO9A 2IS2A 2R62A 4D80A 2GJAA 5K8TA 2PEZA 1N6IA 4C7OA 3TKLA 4MUBA 1NN1A 3U7FB 4BFUA 2F1IA 5J40A 5F9HA 1G5PA 4M9ZA 4G5RA 1M7GA 5L3RA 2O8CA 1CJTC 3DDCA 4PC3A 2BM1A 3SJZA 5JS7A 1CXZA 4BQSA 4EQ6B 1EFTA 2BBSA 2R8RA 3MAAC 3VU9B 5JZVA 1F48A 1TX4B 1NLZA 1A5TA 3TUJC 1G19A 1XF9A 3PITA 4A2QA 1KDRA 5JRZA 5F3WB 5KDOA 2CE2X 2QGZA 3N5CA 4HDCA 4LJYA 5JEDA 2YOHA 1R5OA 4OHYA 1B0UA 3TVTA 2VP5A 1VCOA 5FTNA 3OE7A 1OKKA 1G7SA 1AK2A 1Q12A 4L5BA 1P2SA 3RWMB 5FBVB 3GLFA 4L9SA 2LKDA 4J0QA 5AJZA 3PUZA 2RH5A 2FF7A 1UPTA 2VP0A 2ODBA 4NONA 1JPJA 4W5HA 3IO3A 4OHWA 2XZPA 3T1QA 1KJWA 4B76A 1PUJA 4EPTA 1KJZA 3OIUA 3REGA 1TF5A 4CZ2A 1E2PA 1JAHA 1FOEB 4O0MA 4PPGA 3UPUA 4JJZA 2QQ0A 4LHYA 2ZSFA 4KVGA 1KK1A 1XCMA 4BRUA 3GLIB 2YOGA 2YWGA 3PCRB 2GETA 1G17A 3PVSA 2Z83A 4CEIB 2XX3A 3A4MA 2QROA 3K0EA 5D3MB 3PQCA 3VNUA 4M2LA 1G6HA 3MLEA 3PEVA 1UKEA 1OH6A 3QXCA 1FP6A 2B92A 3B1ZA 4BFWA 1ZRHA 1GTVA 4EPXA 1RZ3A 1N6NA 1Z0JA 3H4MA 3TW4A 3L8ZA 3I61A 4YDHB 1W36B 2ANCA 1P61B 4C0HA 2WM9B 2GHIA 5DI9A 1FFHA 2A5DA 3IIJA 4NCJA 3SFZA 3JZAA 4PC1A 2ZSDA 3TAHA 5TB5A 4MRNA 3ZJYA 1MR3F 4F7WA 4KI0A 2GESA 3KQHA 1EX6A 1OHHA 2EFEB 4EQ6A 1S4QA 5BYJA 1CJVC 1MO6A 3AF0A 5G40A 1OB2A 1E2NA 1KI7A 2IX3A 4HDQB 3LA6A 2A78A 4OI1A 3VHLB 1JALA 1KAOA 2ZRBA 4KO8A 4AD8A 2QMHA 2XSZA 1MKYA 5IF9A 4C7OB 5FBRB 1KI1A 1R8SA 1XZQA 4B3XA 5LB2A 1YR7A 1KI2A 2J3EA 2W2VA 3LBHA 4DLYA 2XXAB 1UDWA 2Z6VA 2NGRA 5KU1A 3QKSA 4AYWA 2W58A 4Z51A 3DM5A 1E0JA 2QENA 4TLCA 5FPTA 1FL9A 5BN5A 1UFQA 5FI1B 1AGPA 2GBLC 2QY9A 1P60A 1XTIA 1II0A 5FR2A 5FUYA 3IPXA 3UG7A 1IBRA 2PCLA 3BORA 3K1JA 4GRAA 4UXJA 3TQFA 4TYQA 1B23P 4TL8A 3C8UA 2B8WA 4LI0A 1DAMA 1LB1B 4Z54A 4FN5A 1OIXA 1AS0A 1SVKA 2UZIR 3FFBA 3O8BA 4HAXA 4JVMA 2KI5A 1KI9A 1ZM7A 2FWRA 4TSFD 5JWRA 4C0AC 1Z2CA 4Q7LA 2CBZA 2GKSA 3KDSE 3L82B 5BN4A 2AX4A 1DG3A 3C41J 4I1UA 2QE7A 3TH5A 4LY6A 5IDVA 2IBMA 3K9NA 2XOKD 1YHNA 1ZD8A 3ZVMA 2O0JA 1P2UA 1DAGA 3VTKA 2VPPA 3QBTA 3FKSD 3BH7A 4LC1A 2RGBA 4YMSA 4PPFA 4JLOA 1KNXA 3NBXX 5FFMA 4TYWA 4NYMR 2D2FA 1CS4C 1ZVQA 1ZUHA 4IVQA 4JL8A 4KITB 2DWPA 2JDIA 1G21E 4US2R 5FL7A 1MT0A 1EFRD 2VP2A 5FBWB 2C03A 1Z63A 2WWIA 2IF0A 2B21A 2W00A 2ZRNA 1J7KA 1XTRA 2OCAA 3GJ3A 2H8KA 4DLRA 2GK7A 3R9IA 1OYYA 2RMKA 4BECA 4FI3C 1O87A 1R0WA 1C1YA 1OSNA 2J0SA 1KO7A 2NOAA 4CVNA 4JBYA 1SVMA 3AH8A 1TUEA 2A5FA 1ELOA 3EAQA 1TQ2A 2P2LA 3UK6A 2REBA 3AVUA 2EFCB 1YR9A 1IN5A 1BYIA 1PLJA 2QRZA 2C98A 1LY1A 1AS2A 4QBIA 3THXA 1ZD9A 2ZSAA 3C14C 2PBRA 4B71A 4C0KA 2NO6A 4DBLC 3K70C 4EPWA 1WBBA 3TUZC 3THXB 1KK2A 4LV6A 3U44B 1KI3A 3IHLA 3KB2A 3GJXC 4PHGA 4PQFA 2O8DA 4URUR 1OPXA 4BFTA 5J4YA 4OJKA 5CDFA 5AK0A 1ONBA 1U8YA 3NVAA 2XTNA 4URWR 4ZDKA 3I1FA 2ZE8A 1I4DD 2ZJBA 2DR3A 1P73A 1NN5A 1G3UA 4WA7A 1KTVA 3FPAA 4UNNA 2JJ1D 2ZVQX 5DGXA 2J0QA 3T35A 2PH1A 4D0NA 2CLSA 5GADl 3NG1A 1WQ1R 3ZH9B 3U3KA 3QQ5A 3EC2A 3OEHA 5AWFC 2AWNA 4NYIR 3VU9A 3UG6A 5C46F 3HP1A 4RD4A 5FR1A 3ZDQA 1UAAA 1E2HA 2IXGA 1TL7C 1Z83A 4GMXA 4BFYA 3B7GA 3KTAA 1CJMA 3ADKA 3WRXC 3V9PA 4LBZA 1XU4A 4LYAA 3K0FB 2BIFA 3CB4A 2NMVA 5E7IA 2IC5A 1ANKA 3IIKA 3NH6A 5JMTA 4M8NE 1OIVA 2GJ8A 4WW0A 2VP4A 3H2YA 3KJIA 4MUAA 3PUXA 4AC9A 4AKHA 2P6RA 2PMKA 1J99A 3ZVNA 5LD2C 4NCNA 3T15A 2C04A 3CRVA 4DKXA 1PLLA 4D6PA 5IT5A 4FCVA 2R9VA 1H8ED 4EFMA 2QSYA 2GDJA 1NJGA 4G5SA 4O2RA 1W0KD 1AKYA 2OT3B 4CT5A 1GKYA 2OCPA 3B78A 4HAZA 1F2TA 3P27A 3QKUA 4DB2A 4F4JA 3GJ8A 1E2KA 1MO5A 1P7CA 5DHFA 1VECA 1P9WA 4UKDA 3UKDA 2HV8A 5CB6A 5CYPA 3QNUA 3TLXA 3A1VA 2UVQA 1AZSC 3HDTA 2FV8A 4PC6A 2YJTD 1G3RA 2QMUA 4TMXA 2B7BA 5F9FA 2QAJA 3X1ZA 1SQ5A 3KKQA 4LSGA 1NY6A 2BKEA 2HUPA 2QAGC 1U98A 1XTSA 1U2RA 5FTKA 1NF3A 3CNLA 2OUKA 2O8BB 2WPDD 3LH5A 3NDPA 3GPLA 1YKSA 2JLZA 2AN9A 3B8HA 2V1UA 3A6PC 4MGYR 1G3MA 5FOVA 4MKHA 1G8GA 1OXTA 4UNSA 3CZPA 1IXSB 4GP6A 4D25A 2CCKA 1VG9B 2FH5B 4BFXA 3Q8XB 4IXNA 5JCZA 1N0VC 2R65A 1M7BA 1CU1A 1P72A 2RHMA 2VF7A 3RRYA 2ZUDA 4NP6A 4R2HA 1GWNA 1YR6A 3VR6A 2R6AA 2VSOA 1ZM3A 1GNRA 2VTKA 4DLVA 1ZAKA 2WJVA 3SBDA 2P0EA 5JRJA 5GJBA 3FHCB 3WBJA 1Q1EA 1MH1A 1F5NA 4Q1DA 4UNQA 1YZKA 3W5IA 2CVHA 3AQ4A 2ERYA 2EFHB 3KUDA 1II9A 3K9HA 1PV4A 3BXZA 1VTKA 2WJHA 3AB3A 3G0HA 3GLIE 4KFUA 2J87A 4Q9JA 4URXR 1CIPA 4HAVA 4F92B 4TLBA 1AKEA 4AKIA 4TL6A 4BRWA 1Z6YA 3CRQA 4CEJA 1OF1A 5K8UA 4B2PA 1JECA 3CLVA 4YC7A 4D4LA 3W90A 4LOAA 4OKSA 2ZETA 4ZI2A 3T1VA 4XWKA 2ZSEA 2ZRGA 3K0AA 3VAAA 3B5JA 2YV5A 4DEYA 1FNMA 2R6CA 4KFTA 4B48A 2JATA 1CR4A 2I1VB 3I8SA 5JBQA 1SHKA 2BWJA 5B57C 1NIPA 2Q6TA 1KSFX 4MDFA 4I81A 3WYAA 4XTRA 1G3QA 4G3XA 5BYKA 2QMEA 3EWSA 5EE1A 1W2GA 2QU8A 1J8YF 5SZJA 2GAAA 1W4AA 4A2WA 1W0JD 2ONKA 2NZ8A 3KXIA 2WWHA 2C99A 4II7A 5AR1A 2ORWA 1HH4A 2IW3A 3SS8A 1R2QA 4ZDIA 1DELA 2I3BA 2OCBA 2ZYUX 5B30A 1N5KA 4IDPA 1NVVR 4BLPA 2BEKA 2ECKA 2ZROA 4AYTA 3O8CA 3ASYA 2IYRA 2QG6A 5LPNA 2Z0MA 1N0WA 3LQQA 5HKKD 5DNYB 4TYNA 4TMKA 1QZXA 4Q1AA 1ZUIA 2F1HA 5DE3A 3PJRA 3MWJA 5SZKB 1NJFA 1L8QA 4IEEA 3VR1A 1W4BA 3JVVA 1VCNA 1UBFA 4JKIA 3MRSA 3ZGXA 5KDDA 4MYTA 1E1QA 4GP7A 2DWOA 2H92A 1EXMA 3O47A 4D0GA 3B1YA 3B9QA 1DAIA 4LJ8A 5G3YA 4DLTA 2O8EA 2QUZA 1JR3E 1X8LA 3CF2A 2OILA 1ZJ6A 4RFSB 2NTYC 1JQJC 4LPKA 4DWJA 3GLFE 4P4UA 1DEKA 1W0KA 3RRNA 2QA5A 2IHBA 3MD0A 2WVJA 2VRWA 4LJ6A 5JJLA 3PR1A 5HZKA 4LWZA 2YC4C 4HB3A 3RC3A 3WP0A 4EJSA 2BMFA 1KO1A 1KGDA 4Z8YA 4JLVA 3SN6A 4Q4JB 4S2EA 3C5HA 5KSZA 3MGCA 3AGQA 1YRBA 2HF9A 1M2OB 1FP7A 5FPSA 2YWHA 2KE5A 3KKOA 3CRW1 2FZ4A 2WOOA 3QXJA 3NDBB 4ITRC 2DFKB 3UIEA 2V9PA 1K5DA 3QXSA 2NO7A 2FA9A 2IF2A 1UF9A 4PHTA 1Q1ZA 3DKVA 4YQFA 3GMTA 4FMCF 5A5GA 1WBDA 3BIFA 4D26A 3RRMA 1US8A 2FZLA 3IPYA 2F9LA 1QVRA 2ZR9A 3A1SA 3B85A 3SZRA 5JS8A 3U3RA 4JLNA 1OFHA 2ZE5A 4D4KA 2O8FA 3CRMA 2PT7A 2SHKA 3E70C 2OXRA 1ZW6A 4CF7A 4K81B 4F91B 2ZEJA 2RGNC 2OG2A 2DBYA 1NVVQ 2BM0A 2AWOA 4TTRA 4I1OA 1G3IA 1GDDA 1XDBA 4L9WA 3UATA 3EG5A 1T0HB 4YLGA 2D2EA 3T12A 3JVUA 3CPHA 4TT3D 3THOA 1OKKD 3R8FA 1ZBDA 1D8TA 4WBSA 5J4HA 5J47A 5JWOA 4OQFA 3LWNA 4U00A 1KY2A 3SJAA 2HYIC 2PT5A 4Q4AB 4PAOA 1GNQA 3ZZUA 1E2LA 3JZMA 4US0R 1II8A 3SU8A 3Q7QA 1E3MA 4KBGA 4NCIA 3K0FA 1AQUA 1G7TA 4MQBA 1ESNA 4WZBE 2ZYVX 4L15A 3IBYA 5FI0B 3UANA 1T9HA 3L43A 5EE5B 1J2JA 2L0XA 1N6OA 4QOSA 3Q72A 4GNKA 1KO8A 4LPSA 1IN8A 1H8HD 2FEMA 3QI2A 1JXMA 4PQYA 2GEUA 4XVQA 3U60B 2OLJA 3D8BA 1ZIOA 2HLDA 5KSPA 3S1AB 4RY2A 3IGFA 1G9XA 1GILA 2ZI5A 2EW1A 2J7PD 2FOLA 3MWKA 3C4JA 3HJNA 4JKYA 3QPWA 1KI6A 4Q5IA 1F2UB 2CL7X 2BKUA 2FFAA 2P3SA 5H8WA 2QBYB 5EQTA 5KSOA 4RFVA 3VR3A 1OW3B 2VP9A 3I92A 4DDWA 4RD1A 4IDHA 5EE0A 4ASUD 4KJZA 3CF0A 4I99A 4EJSB 4PPQA 4RCYA 3KKPA 3MCAA 3AKYA 4ON9A 3RS4A 5EXXA 1NBMA 3A1UA 3A4NA 2AXNA 2FFBA 2CE7A 2H16A 3SHWA 2XSZD 1R4AA 4MRSA 1D9ZA 2QP9X 1CR0A 2ZYWX 1ZM2A 2JLWA 3AVVA 2ZANA 1XPUA 2OBMA 2GXAA 1TQDA 3DOEA 3K0CC 3NH9A 1RRFA 4HUQA 1ZD1A 5EXPA 1SVWA 4X8HA 4A82A 4DLSA 4TTQA 3TVDA 3PEYA 1SVSA 5CJPA 121PA 4KAXA 1UJ2A 4QNRA 3L2OB 4UQOA 4X8LA 3WMGA 3B2EA 3LDAA 4G5QA 1S2MA 4XJXA 1LW7A 2B8TA 1MV5A 3Q7PA 4QJ5A 4CW7A 4BFVA 2HDNB 3NTUA 4TLDA 1EFRA 4JZKA 5UKDA 4LHXA 1D2MA 2E87A 3K0AB 2JLYA 4P4SB 2UZ3A 5HTKA 2ZRMA 3GLHB 4MYUA 3BBPA 3WY9A 2IEYA 1G6OA 4NL4H 2NO1A 1NNEA 2V6IA 4OI4A 2YNMA 4B2LA 1HQYE 1Z0FA 2VIIA 1W44A 2WAXA 4DDTA 1NVWQ 4AY2A 4E03A 5JI2E 4I1SA 4HZIA 3BH0A 4BEBA 3U7HB 3QEJA 4KBFA 1KSJA 4C0SA 1BS1A 1E2DA 2PLRA 1HE1C 3AP3A 2J1LA 4BLSA 2GXSA 1E2EA 1OXVA 4JLJA 4RZ3A 3FHOA 1IOZA 1E9FA 1W1WA 2K5UA 5A4JA 3TK1A 2RGGA 4XSHA 2D7CA 3QF4B 3VKHA 4EFNA 4R2IA 1X8KA 2FSGA 1W49A 3DL0A 3GJ7A 2Z43A 5FBLB 4ZO4A 5HCIA 2GCOA 1E9EA 1VDZA 2VSXA 1ZMXA 4M53A 1GRNA 1ZINA 4NKRA 8OHMA 1J70A 1RVDA 1XTKA 3QY0A 1P9NA 3WMEA 3FYHA 3KFXA 5AUQA 1AGRA 1E98A 1Z5ZA 3H1TA 1M1YE 4U02A 1QBKC 2CJWA 3LLUA 3QVUA 1GZSA 4YXWA 4CEHB 1E99A 3B82A 5FPHA 1I2DA 4DCTA 1E32A 4TMTA 2P6UA 3THYA 1N6LA 2CL0X 2KB0A 1KI4A 3ECCA 3HPQA 3RABA 2QPOA 1ZM9A 3EX7C 5KUTA 4LCBA 2BOVA 3VNVA 3T5GA 2JJ8A 2X77A 3OEEA 1AM4D 2W6JA 2JEOA 1VHTA 1E96A 3K9LA 1D2NA 3K53A 5C4MA 4OJQA 4C0QC 2QL6A 1ETUA 4HLQB 2R6GA 2PCJA 3AKEA 1JQLB 1MOZA 4PZZA 3F8TA 3FE2A 3VX3A 4EKDA 1CF4A 4MA4A 1HA3A 2BC9A 4A8JA 2C78A 1TAGA 3RS7A 1CBUA 2OLKA 3KQLA 1A82A 4Q4JA 4ZV4A 4GFDA 4CEHA 1HUQA 5AUPB 1NMZA 4B47A 3GEHA 3EXAA 4UJ3A 1XWIA 5KNDA 2RHDA 2CMKA 4R71A 1M7HA 1K8RA 1G291 1F3OA 3ZQ6A 5KHOC 3ADDA 4M4SA 2PX3A 3OEED 3DKPA 4DT1B 2OCYC 5FBQB 2JDID 3Q9LA 3BB4A 4KLNA 1TADA 3EW9A 1X1RA 4DDUA 4P4TA 1DE0A 4OYHA 4QGFA 4WXPA 2WICA 3P1JA 3EA5A 1VPLA 2H5EA 3R7WA 4E07A 4MITA 2DFNA 4XD7D 2JLVA 2PLFA 2CLCX 3LX5A 4D4MA 4LHZA 2ZR7A 3FMPB 2AR7A 1R6BX 2IYVA 3IQWA 1OXUA 1GOTA 4W5JA 4B44A 4TL9A 3QXHA 3EZ7A 2GF0A 2YC2C 3ND8A 4PO9A 3QPUA 5L8VA 3CW2A 2W6IA 1G64A 2IYYA 4W9MC 3EZ9A 3K9GA 1P4SA 4E22A 1GIAA 5FTMA 2WBLC 2ZRKA 4LYHA 4YMTA 1JJVA 1DAEA 2VHCA 1AN0A 4RD3A 2J7KA 3U4QB 4RKEA 5JJKA 3O8DA 1QHXA 4GOXA 3AP2A 4MKGA 2QM7A 2MSDB 4TMVA 4A15A 2N42A 3PUWA 4EPYA 2AKYA 1ZU5A 2C9OA 4Q1FA 1NKTA 3A4LA 4V0OA 1XPOA 1RRGA 2V7QA 4LDJA 1G20E 1NIJA 1LNZA 3T06B 1NLYA 1F2UA 5CB8A 4OHXA 3U7GA 2IHYA 1Z28A 3P32A 4TQUS 3TQCA 4D0LB 3B60A 1LV7A 1AS3A 4BFSA 1UBEA 3SDZA 1G7RA 1OJLA 2DYKA 4QBGB 4NU0A 3QIAA 4IEIA 4HB2A 4BPBA 4QHTA 3IEUA 3X1YA 2X8AA 1Z47A 3QKRB 3I5YA 3CWZA 3REFA 1Z3IX 1VKJA 4M1SA 5AJYA 2EYUA 2REOA 3GEIA 2JIZD 2J45A 1E9SA 1L4YA 1XXHA 2GTPA 4Q03A 5E4FA 1GM5A 5CITA 2FEOA 3SEAA 3ZIAD 3SC3A 1II8B 2R44A 4IJMA 1WE2A 5L3VA 4NDZA 3F3YA 4D82A 4AIIA 2FSFA 3CO5A 2H1LA 3DM9B 1G18A 1DAHA 1E79A 1GITA 1SXJD 4QXAA 2MSEB 3CX6A 5EZ6B 4QFMA 4URYR 2VL7A 4XSGA 4DHEA 3T61A 2QBYA 4WVFA 4CT4B 4HSEA 1UBGA 1UDXA 2BJVA 1CJKC 2EU8A 5A0FA 4ARZA 3GLGE 1E4YA 3GLGA 3LRPA 2ZIAA 4FINA 4V0KA 4V0MA 3EPJA 3CUEF 2N1BA 1QVAA 1W0JA 4HAUA 4ZKEA 3AVYA 2A5GA 2GJSA 3NBFA 3KQNA 2KSQA 4LBVA 1Z08A 2GZDA 2XNSA 4GPTA 1T6NA 2HJVA 2VHJA 1NSTA 1Q57A 2OEPA 2OZEA 1HY3A 3AUXA 3QG5A 2ZJ8A 2C95A 2ZPTX 5HE9A 3CNNA 2Q9AA 3MFYA 4QGGA 1BYUA 3KXLA 4DVGA 2J7PA 1E4VA 4DUGD 3IBGA 2IS1A 4A0FA 2LWIA 1IM2A 2WWFA 2PL3A 1CRPA 2D06A 3BK7A 2WJGA 3V4FA 4IOJA 2ZUCA 4LGMA 3Q5EA 3U3OA 2W0MA 1LFDB 2IYZA 4KYUA 3B13B 3N2EA 4NPHA 3FHTA 1FUKA 1GP2A 3ETLA 3AKCA 3PEUA 4MRRA 4HYYA 5DI3A 3RS2A 1S1MA 1S1CA 4B35A 3U6BA 5DYGA 1AJEA 1F6BA 1FX0A 4Q18A 3TSZA 2QMOA 1G4UR 1YZUA 5IK2A 4B43A 3EPLA 1U9IC 2OM2A 1NSFA 4TYPA 3TUIC 1E2QA 2MSCB 4YONB 5H70A 3BB3A 3MWYW 2MMCA 3A37A 3BRWD 1GVNB 1X86B 2RGAA 3ND9A 1OFTA 5HPYB 2GZHA 2QPTA 2W2TA 5C4GB 5F98A 3ZVRA 2RGXA 3QUSA 4IFBA 2XGJA 1YZQA 5M04A 1PLKA 4FWIB 1KI8A 1X3SA 4GZLA 4LBYA 2ZVPX 4F93B 1DO0A 4RCZA 3LQRA 4ZCIA 1HE8B 1XJCA 3KQKA 2PMDA 3E1SA 4G01B 2AK2A 1I4LD 2ZITA 1ZC3A 3ASZA 3W8RA 1YZLA 4LJ4A 1W5SA 4TTPA 5L3QB 2PZGA 5D3MA 3BD9A 5BW8A 3AVOA 4NYJR 5JFGA 2HT6A 2RGDA 2QNRA 2ZU0C 2Q3MA 1BO6A 1T3HA 2EQBA 1HURA 2WKRA 3HU1A 4XTCS 3AM1A 3SYLA 1ZNZA 1Z06A 4O2LA 2HT1A 1Y3AA 5AUNB 3LXXA 4AKGA 1GUAA 3QPVA 2JA1A 2V8OA 2WTUA 4Y0AA 3RSLA 2HCBA 3PUVA 3NWJA 3OFNA 1S3GA 3U4QA 4RVCA 4B33A 1W4RA 2HF8A 4Q21A 4Q9LA 1NP6A 3FVQA 2CNWD 4CEIA 2WHXA 2FPMA 3NBYC 3TW8B 1P2VA 1XEFA 1UKVY 2V6JA 1NI3A 2VA8A 2W6JD 2VO1A 4Q19A 4O25A 1QHHB 2ZS8A 5C2JB 1E1QD 2BDTA 3R9XA 2OFOA 4BZPA 3ZS9A 1T3SA 4IDQA 4NMMA 3U3MA 4H1VA 1KZ7B 1CRQA 2ZI7A 2NZJA 2WMNB 1RIFA 2CHGA 4RZ2A 1NVUQ 2ATXA 1Z6AA 4DXAA 1JPNA 1G1MA 1QHGA 1EK0A 1KIMA 1WRBA 3PV0A 4DT1A 5K8LA 2RB4A 3KX2A 4PR0A 5JLJA 1LF0A 4IHQA 2OFXA 2YWFA 4PAQA 1C9KA 4B3DA 4P0TA 3ZD7A 1K6MA 2FJUA 1NRJB 3R8CA 2GXUA 1NKSA 4OI2A 4IOMA 3OFND 1OYWA 3ICQB 1Q22A 1G5RA 4CEJB 4TLAA 4M9XA 2A9KA 1XZPA 4MRPA 3AF1A 1GL6A 4BLQA 4RZUA 2HXYA 2J0UB 2WSSD 3S1AA 2FSHA 2LCFA 3OHMA 2B7CA 3BAFA 4P3YA 1LS1A 1GNPA 1SKYE 1U9IA 1XXHE 3BOSA 2QPAA 3CR7A 3ZYCA 2VBCA 1GL9B 3TMKA 3OF5A 3W3ZB 5JHGB 4BLTA 1IN4A 1Z0KA 2YWEA 2O8CB 2ZJOA 5AJVB 3KKMA 4U7DA 5EE3A 1UEIA 5J4VA 1TEVA 1IONA 3H84A 1IQPA 3SR0A 1NG1A 4FMDF 1DTSA 1JBKA 5J5CA 4Q4AA 2VHQA 1ZC4A 2QZ4A 2ORIA 2WWYA 3AVTA 1H65A 4JSYA 2ZSBA 2ODNA 3ICEA 3I62A 4HEJA 4XOIA 3BJIC 1JEEA 5DI3B 4FCWA 1F2TB 3P4YA 1QRAA 2CCJA 2XEXA 3HR7A 2AXPA 1FTNA 1TQ6A 4C3ZA 1XCGB 4B3CA 3AF3A 1VYUA 2GF9A 2WPDA 3W8NA 1XMJA 2QP3A 1OLOA 1DOAA 1G8PA 2XXAA 4HAWA 4KSCA 1E9BA 4JLMA 5JJIA 4R7ZA 3Q85A 1SVIA 5IRCD 2GAOA 3CIOA 5EXSA 1VIYA 3BFKA 1S96A 1U94A 1CULC 2RGCA 1YZNA 1Z29A 5TDHA 3LV8A 2G9NA 1R0ZA 1VG0B 5B58C 3BFVA 1XD9A 4CGZA 5BXQC 4POAA 4A92A 4PXAA 5C1BA 1XTJA 5CIQA 4FD2A 1TF7A 3FDIA 2FSIA 3IQXA 4EPVA 2IT1A 3X1DA 3GP8A 2AHOA 2NIPA 2J0UA 221PA 4QM6A 1PJRA 5KDLA 3CX7A 4RKFA 4OQMA 2BHRA 2ZI9A 2F6RA 2OFWA 3N70A 3TNFA 2JAQA 1NMXA 2I1QA 2CJWB 4MGIR 4PSKA 4C2UA 2OE2A 2P65A 4NBSA 4MKIA 1N25A 4Q4LA 3RS5A 5JHHB 3U6KA 2BJWA 2IUUA 4V02A 1HT1E 2DHRA 4QNMA 4UNPA 1ODFA 3X1XA 1G5TA 3KZ1E 4IRUB 5K8IA 4OBEA 1Z07A 3MJHA 1VYVA 1SULA 4IOLA 4Z8XA 3OZXA 3RDPA 3HU2A 1OFIA 3AVWA 1T4GA 4KVAA 3LLMA 1W5TA 1Z2AA 2O8EB 5TARA 2O8DB 1LS6A 1TU3A 2OSBA 1S9HA 4N0EA 5JSZA 3AKDA 1BMFD 5EJEA 5GVSA 3BS4A 4A1FA 1N6KA 4KLZA 5BN3A 2XTZA 3WXMA 2IYTA 1W2HA 1NMYA 3IEVA 3SI7A 1SZPA 1YE8A 3PFIA 2OO7A 4GZMA 2DFLA 4A4DA 4LV5B 1FQKA 1JR3A 4DC9A 1T8TA 2A5YB 3A1TA 2P67A 3T34A 1IN6A 1I4TD 3LBIA 2CK3A 4PHHA 4PHFA 1ZM4A 4GBMA 2RGEA 4FMDB 3OIYA 2H17A 1SVOA 2H57A 2MMGA 3B1XA 3CZQA 1G4AE 1ZCAA 1KAGA 3UWOA 2TMKA 4IDNA 5H1YA 2VYFA 3RYTC 2O52A 4ILEA 3LW7A 1V43A 2FFHA 1MO3A 1DS6A 4B75A 4PSVA 3SNHA 3BB1A 4WZ6A 2GA8A 4LZZA 2G0TA 4PO8A 1MO4A 1WDTA 4NE2A 2F1JA 3W6NA 1U0HC 2QORA 4JLPA 1EGAA 1P2TA 2QEQA 2V3CC 1NL3A 2H18A 3H0KA 2ZE7A 4ZCLA 4MGZR 2ONJA 3RS0A 3WRYC 2OESA 1DPFA 3MWLA 4NCHA 4AURA 1E0AA 1AZTA 1RJ9A 2J5XA 2VHTA 3FOZA 1KSGA 1P75A 1OH8A 2IXEA 1YZTA 5JECA 2DWQA 4MYHA 4PO1A 4QBFA 3CBQA 1UBCA 2VF8A 2ZYTX 1UKZA 2XJ9A 3I4LA 1Y63A 1N2CE 5FOWA 3PXGA 1W48A 4G1UC 4ZDWA 4LUCA 2FU5C 2ZRHA 2XTMA 4BGDA 1AIPA 1DO2A 4K8OA 3PEWA 2JLQA
chains in the Genus database with same CATH superfamily
3U7QB 1JLSA 1W4LA 2XNKA 4IDCA 2UVDA 5FHRA 5KKAA 3U17A 3QSYA 4X60A 4M1ZA 3ZQJA 4MS1A 1O57A 4KREA 2GILA 3OI7A 2X86A 3A1WA 3MBOA 4LOIA 4QQKA 5CAEB 3REQB 1YDFA 1S3SA 1JYSA 2QPLA 3R3HA 2HV9A 1LBQA 2ZDQA 1FU8A 1RKUA 4EUNA 2QRMA 3GRFA 1K8YB 4E46A 1YC5A 5AVXA 2PS1A 1SQSA 5MDHA 3OF3A 1US8B 4UXHA 2K7FA 1C8LA 2AQHA 1TEZA 2BHNA 5BWMA 4K6MA 4ZEMA 1HT2E 5JDCC 3ECAA 2J3JA 1NT2A 4C78A 1E1RD 3H1FA 3RIMA 2X7JA 2C96A 4KO3S 3ZZTA 5AW0A 1EXNA 3VR5H 3ANTA 1WZIA 2WIFA 1HDRA 4MQEA 4P32A 4LF4B 5B1EA 1LQUA 2CKDA 3OUTA 1QFSA 1BEEA 5DEOA 3UA4A 3UTCA 1NUQA 1XOIA 1Y6QA 2F1KA 3OPMA 3L8EA 4F5WA 2PZFA 1OBVA 5KYWA 4HH0A 1PR6A 2IYEA 4NYIQ 1FTWA 1Z22A 4WD3A 13PKA 4CR8A 2IOFA 4X1KA 2E9SA 2QI9F 4ZAVA 1XAGA 4AULA 3MWDA 3HCBA 4H08A 4AQYB 4B31A 3A4YA 5KOYA 3GZNA 1UC5B 4P7GA 3MUFA 4JMPA 2AFHE 1Q7EA 4PX9A 4LMAA 1P7YA 4YBRA 2YHBA 3EODA 1NBOA 3IURA 3QITA 4AI6A 3R5FA 3RIGA 2IWRA 3G13A 3JQ8A 3QF4A 3EZ6A 2QN1A 4H60A 5ESXA 4NOJA 3CRZA 4EECA 1H8HA 5ECWA 3HL0A 4I1IA 4MTCA 3BWDD 1M73E 4MYRA 1C1DB 5AHOA 5NULA 2BF7A 2NQ8A 3TQTA 1CY8A 5LQUA 2Q3FA 3L93A 4ZPXA 1QF7A 4QM6A 1JEAA 4UHKA 5B5SA 3UWDA 3GJZA 3G9UA 4LY3A 1VRWA 4RH1A 1IBKB 4R31A 2D4HA 1WF6A 3EYWA 3CPJB 2BE7A 1YK1A 1ULSA 2E4ZA 4BQNA 4YJGB 3IYLW 3E22A 4FFOA 4L8WB 2Q3HA 3QU9A 2D5IA 3ZZ0A 3O4FA 4KODA 3AF2A 1X7WB 2PD4A 2DQKA 1VE3A 1TW3A 2ZCJA 1DGQA 2VPQA 2FVYA 3BN3A 2EWVA 3PGA1 4LW8A 4MIYA 4QJ3A 1HYQA 5DBHX 4HPJB 1U5BB 3D8TA 1K2WA 1JQ3A 1WEHA 3E84A 3KO8A 2BM8A 4TXHA 1DT5A 5FJJA 5K0LA 4JI5B 1UBKS 2Z8ZA 4NBLA 2Y76A 1KR5A 3FNQA 1GGHA 3KQMA 3M2TA 1OX4A 5LOVF 4WNAA 5BVGA 3OCVA 1TQHA 2R0QC 1IY1A 2CHQA 2NAPA 1ZGCA 4JBWA 4EO4A 1XFAA 3JVIA 3CJRA 1M76A 3S40A 5EYPB 1QX3A 3VH1A 4X8OA 5E0KB 2BZ1A 4RM2A 1Y1QA 1L1FA 3CXRA 5BSGA 4LJ7A 3WS7A 4YUVA 1BW9B 1VKHA 3KPVA 4H1TA 1CUVA 1T5OA 4O8CA 4WACA 4C5BA 5DHAA 2VCYA 3UAVA 5BNTA 5MN5A 1OA1A 4RFLA 4BNIA 3O2QB 3MEQA 3SZGA 1HQKA 3GOQA 1NXTA 3OZVA 3VR2A 4DQ0A 3CUWA 4QXRA 1FVFA 3WGGA 1T3LA 2H9YA 3CCBA 4DSTA 1RYHA 1YZVA 3DOUA 4E5UA 5JDIA 1KJJA 2NADA 1SKQA 4XUCA 3NDIA 3WISA 1VE5A 2WSSA 4GOKA 5F3DA 3SHVA 5K0ZA 2Z6AA 2RJ3A 1L7AA 2X3UA 1LSJA 1NM5A 1T91A 3VV2A 1CF9A 2F3SA 4EJSC 3ZLJA 1ECGA 1WKVA 2JFNA 1SUIA 1YQTA 2BHSA 4X90A 3WB1A 3EQZA 2WTAA 3UMRA 2P78A 1M2VA 2X4LA 2GM5A 2OCLA 1JFFB 2C2KA 3HUEA 3JCZA 3V8NA 5FBHA 3PUJA 5IHXA 3C7KA 2J6BA 1FSPA 2OMEA 4QFBA 4W63A 4C0BA 1HDGO 1MG0A 1THMA 4JLKA 4PBRA 3V2IA 2IY9A 3FZNA 3CX3A 5KAMA 3SC6A 3I37X 4ENTA 3HVRA 3GQBA 3AVVA 4J4BA 3I73A 4RTOA 1XQ6A 3TSOA 3B52X 1EK1A 5GM1A 3QFCA 3L8HA 4JP3A 1M66A 3K30A 2Z5GA 3S81A 2VLIA 4BWYA 4FMBB 5IXSA 3HWSA 4G1MB 3NT5A 4Q47A 1TM3E 4MLDA 2H29A 4M54A 4YCSA 1P6XA 1V25A 1Z5NA 2DGDA 4YAUA 2HMWA 1V8PA 3ZCUA 3CZCA 4OG2A 4TYYA 3AR6A 4MK4A 1A9TA 3GV0A 4ZVQA 1XU7A 1BU8A 1RP7A 1U90A 2GD1O 1X1BA 2X2EA 2W2NA 3P9YA 3AL0C 4X1OA 2CLHB 2HRRA 3EGVA 3KUCA 4V0QA 4IZ6A 1A8QA 1H1LA 4W6ZA 3GLSA 3UGKA 2DH5A 1G8HA 4RNCA 4CLRB 1RVV1 4R01A 5GV7A 2XCUA 3LQYA 1EJ2A 4OO3A 2IL1A 5FADA 3WGNA 4WJZA 3D3WA 5B3AA 2M32A 1GPUA 2OBLA 2Q7XA 1H66A 4FIDA 4K9DA 3P9RA 5CB4B 6REQA 3SAJA 1J1IA 5B36A 3FLAA 3PJDA 3MT7A 4LY9A 2GCEA 3NAGA 1D03A 3VGJA 3PQ4A 1R6XA 2R6HA 1FFXA 4YRKA 1VG1A 1IK4A 2BONA 2Y71A 1XQWA 1GHTA 2ODWA 3G85A 1E6MA 3Q0TA 3WXBA 1VJ0A 1JH8A 1EQAA 2II6A 2UV8A 4AJ2A 3UJNA 4DLUA 4A8JB 1B43A 1T5IA 2Q6KA 3QE2A 2RH8A 1E2GA 3ABRB 4GMDA 5JD3A 1USWA 1G0NA 3CMCO 1I51A 3DF9A 3NHZA 4UNIA 5LYJA 5T41A 4NZNA 5AJHA 3VZBA 1C2YA 2CNBA 4RVNA 4BLOA 2O20A 2R97A 3GZ4A 1AO0A 2V55B 1DC5A 4IDAA 1M2VB 1FUUA 2UZ1A 2VSFA 2HO4A 4OK5A 4C0LA 1HDIA 4LOJA 2CV2A 1RYMA 3MJRA 5JWHA 1A2OA 3W2FA 4OY3A 5TVGA 3ZU2A 5M5BA 4X7MA 5BYBA 3FMFA 3NHAA 4YMVA 1G2PA 1UT6A 1W5EA 3GT0A 1FDOA 1QNFA 1SC1A 1TU4A 3PJFA 4G25A 1E69A 1K9SA 2BMEA 2C9CA 2YWJA 1SXJE 1SK8A 4JNCA 1NBAA 5E2AA 3THRA 3QU7A 1SCJA 2DLNA 4FGSA 5D7BA 5HS6A 2XYRA 3E9QA 4EGFA 4QJ4A 4E0BA 4GECA 1QB7A 5FUWA 2AMFA 1W59A 4RDIA 4H7EA 5ALLA 4F06A 5BNIA 4MB2A 1ZR4A 4L16A 4YGXB 2QRVB 4R3NA 3UF0A 2VNIA 1U31A 2BR4A 4JR0A 1WSAA 4YMWA 4CODB 2NP6A 1OQAA 2HJGA 4JL5A 2JKVA 2YV2A 4ICIA 1XK6A 1U3TA 3I5XA 3HYTA 3THWB 2OZKA 3G02A 1KPHA 5H3LA 3BXOA 3QVOA 1AA9A 4JJFA 1FS6A 1OXKB 4BN0A 1NF2A 1GU1A 4UPDA 3AB8A 2UYQA 2ZR0A 1Y8AA 2EOAA 3QELA 3RAGA 2EYQA 4TS3A 1V0JA 2X0JA 4QREA 4NG4A 4F4UA 1Z2OX 1E5XA 1XTQA 3LWBA 4A6XA 4PZDA 3U44A 4R68A 2GKGA 3M33A 1FUYB 5HHTA 4DGSA 2OENG 4KFCA 2D00A 1GY8A 2CUKA 1GRRA 2XD9A 3LT2A 3TZQA 1A9XA 5EUQB 2IYPA 5IVIA 2XE4A 1A04A 3QYAA 5AVSA 1TB4A 5IH3A 4BGIA 3DZDA 1FCJA 821PA 2DTDA 4W5WA 4PSAA 5EWMA 3ZK9A 1W88A 2KPOA 3VMFA 4BQFA 4O3MA 5DTEA 3CURA 3AUYA 1Q74A 1BJRE 1GG2A 3E61A 1DKRA 3GIWA 1RCTE 2PSSA 4PLYA 1Z68A 2FG5A 2B35A 3NWEA 4C4YA 3P2YA 3TR5A 2KJQA 4PYRA 1Z2PX 3UMVA 2IOQA 2V8BA 5BSTA 5TMPA 3Q8LA 4IGAA 1QMGA 2BCGY 4EKEA 4LDPA 3FZYA 5K5EA 3IAM1 5CJJA 5TJHA 3RCBA 1ZI6A 5A5EA 1V47A 2UKDA 3AMVA 3OZSA 2G4LA 3V42A 1IXRC 1XRJA 3VJRA 3T1OA 4CDGA 4DCSA 3O26A 4WXHA 4NMHA 4NH0A 3T95A 1I9GA 3ZHCA 2WAAA 2X4DA 4RXTA 1UJBA 1D4OA 3ILHA 4KDRA 3PDHA 1WZUA 1DVRA 5BN3B 3NWOA 3WRWA 2MSLA 4S35A 1VHWA 2YVUA 1GPBA 4JLAA 5TEWA 3ZLTA 2JFXA 1C3XA 1MIHA 5GTDA 5MN6A 2QAGB 1KQ3A 3HGQA 4YMUA 4B6FA 2W83A 3EC1A 3MFQA 2VDWA 3B6KA 2HQOA 1KVTA 2JGFA 5JD6A 5AK6A 4KO1S 1E3DA 1JNYA 4LSWA 5AJWA 3C5EA 4C30A 4F8JA 3ISTA 1FP2A 2FPKA 4HLDA 3HCDA 4A0HA 2OAQ1 5ITWA 2V7WA 1VL8A 4NECA 3W2GA 4LDNA 3D3EA 4HMPA 4AWAA 4BYGA 2W6ZA 5BO5A 4INJA 5B1YA 3PT9A 2I66A 3L7KA 1O2DA 5KTSA 1RKBA 3UMGA 1UPBA 1VJRA 2FPRA 3V1NA 2PANA 2ID9A 3W4IA 3RVBA 4DJFC 1ZY2A 1BAPA 2GXQA 1KKLA 4LQLA 2EHDA 1Y3BE 2H54A 1TEXA 1F2VA 1XVLA 2RSLA 3V00A 4FYKA 2BFPA 2O54A 3E9YA 4JP2A 4KQFA 3HADA 1WO8A 3ZD6A 5EJ2A 3ZQKA 2DVMA 4W7IA 4ABTA 1VSBA 1BMQA 3J81A 2M1XA 3KAPA 3ZV4A 1V3VA 2YZKA 4J29A 5BWOA 2MR5A 3SFVA 3T54A 3GFPA 3I6BA 3T3DA 1N2IA 3G2MA 1EVQA 5EJ7A 1ZGGA 3AOEC 5BN4B 1Z36A 5BQPA 4G4JA 1X0XA 1BXZA 2IHZA 3OQBA 1PNRA 1JL3A 1KOFA 3LWZA 1JXOA 2AL7A 4HMQA 5HQJA 5I7RA 3BWYA 2YY7A 3LT4A 2OHFA 3NJ8A 3LBNA 4NMXB 4IUDS 4KAFA 1WCIB 1JG7A 1UZMA 4ALLA 5FEMA 1U0JA 5DF1A 1K0UA 2R7NA 1QUFA 1SAYA 2H1RA 1XA3A 4CN8A 2H3HA 1U7WA 2A5LA 4PTLA 5I4IA 2KLBA 1E3EA 2BISA 3H86A 1ATIA 3W2HA 1YOVB 2AN4A 3FCXA 3BMQB 3KQSA 2IYSA 2C61A 3L6EA 4JIMA 1PJ2A 3FWPA 4TTJA 3I72A 1GD1O 4FXOA 3K16A 5CX1B 5F1PA 4MWZA 3G5UA 3UQYS 1FFCA 3QPAA 1JA1A 3LL4A 4Q7JB 1VFPA 3EGIA 4Q3EA 5DM2A 3ZS8A 2JCVA 3UWSA 4DR3B 4JI4B 1VKRA 5DZSA 3IP3A 4XH9B 5I4CA 4C7XA 4CRWB 1XF1A 2QAGA 3PFGA 1W73A 3LG2A 4Q4HB 2W43A 2PG3A 3U4IA 4HUTA 1QYIA 3C1UA 4KACA 4C6SA 2O57A 2QQFA 4URVR 5BSMA 3E8SA 5EHXA 3A3KA 2ZUBA 1U9JA 4IS3A 5C7OO 1IY2A 3D8HA 4XX1A 4O02B 4B1FA 3RYCA 3SQWA 2WIBA 5F77A 5G3ZA 1OA0A 1MZVA 1PG5A 3HH8A 2FWAA 2IU3A 4HTFB 5HBGA 4XFKA 1CQXA 4P54A 3VUEA 1BX0A 1Y6RA 3Q6MA 4PIVA 3QU4A 3TRFA 2TS1A 2JBAB 1ZGAA 3WGMA 1M9NA 5DHUA 5CDFE 1K8QA 4KDCA 3MMSA 2ZS9A 4HX2A 5HYVA 1PT5A 1A0OA 4K6GA 1BA3A 4DG9A 4EX7A 3SXUA 2UVPA 4JBGA 3PTAA 2ZRLA 1GTJ1 1OD6A 2VJBA 4LSZA 2C82A 4WUVA 3AUJB 2EARA 2NU8B 4CM6A 1KY4A 2XIQA 2Z56A 3D4LA 3OMLA 3GJ5A 1T6XA 4MUFA 621PA 5EPOA 5ALOA 3RUHA 3EVEA 1XMPA 1UBNA 1U9YA 4B9AA 5KNBA 4MIOA 1FRZA 1YFZA 1JLLB 3QLUC 2O2XA 2RHHA 4O1IA 2QYOA 4LXUA 4N18A 2QUHA 4UPVA 2F7SA 2D3TA 4JXJA 4RFSA 3HHPA 4LJAA 4A03A 4FFLA 5LP6A 4H1UA 3WAJA 2BV3A 3CLUD 4NOLA 4BVHA 3LCRA 4FR2A 4BB0A 1Q1AA 1Y6GA 1H0HA 2QU7A 4GLOA 5DYTA 5K2OA 1SO8A 1EFHA 1T4CB 4BNHA 5CEJA 2B25A 1ADCA 4ERNA 7YASA 3ESBA 1ZDMA 3HGTA 1V37A 1I0LA 1L7EA 1MJGM 2RCNA 2VRCA 2C9YA 3H9UA 3W6ZA 4KL8S 1XRPA 1Z0AA 3RJTA 1W4CA 3Q2IA 1G8FA 3N07A 3RB8A 2JGMA 3AJDA 3I05A 3OUZA 1N5MA 3ZW7A 3FNGA 3EVDA 4O4JF 4DUGA 4EG8A 3EOZA 1VG8A 1XZCA 1P45A 3QEMB 1B4DA 2RG1A 3PNVA 1IPHA 4D9HA 2CVFA 3CCCA 1LVHA 3BSWA 4PG5A 5AVTA 3B2NA 4DR6B 3QKWA 1FMLA 3DTVA 3R7AA 2O3UA 4PNEA 1MD9A 5MN4A 1MHTA 2FETA 4ZVSA 1U0NA 4TWJA 3WADA 4HYTA 2FGJA 4MQFA 4D4IA 1TJ3A 2XQJA 3MPOA 1R9MA 5IASA 4JXZA 4MVXA 3HJUA 3IA2A 3C16C 1MORA 3AHDA 4GI7A 1QP8A 3EVGA 1TNDA 3M1AA 4BKOA 1T9KA 2YZ2A 5LA6A 2IA5A 1MQ8B 1PGPA 1CLUA 2Z9DA 2PZMA 1G16A 5E1BA 1C1HA 1V4NA 2C84A 3UHJA 3NUGA 3TG2A 3NRJA 4NYJQ 1FP1D 4YN3A 2GPBA 4ZVRA 1KNQA 3Q11A 4F9FA 1EWTA 3H6KA 4LK3A 5E7JA 1YDHA 4OBWA 2IELA 2OGTA 3MJFA 1U80A 2GS9A 4UDYX 3SXPA 1MDFA 3URMA 1I7QB 3P0HA 3PZBA 4MVYA 2H00A 2Y3IA 4OMUA 2BEJA 2HCJB 4IDOA 3FN4A 3PC8A 1NASA 1G8YA 3WLHA 1N0UA 3P96A 5E6RA 1USUA 3QJ5A 3THWA 4JUAA 2ZLBA 1FYDA 2XUAA 2NPFA 4QUIA 2G1JA 1U7OA 1Z56C 4AMYA 4TT3A 2ODTX 4Q4HA 4EA9A 3GI1A 5JARA 3DR5A 4V03A 4AG6A 1VMDA 4AJPA 2J9GA 2BGRA 2Q5OA 3MRTA 3O1IC 4J8PA 4J4TA 4YP6A 2VYQA 4DR1B 3TMYA 4WN9A 1QU2A 1L5NA 3SC2B 2RI1A 3QF7A 2WKWA 3ZK7A 4URZR 4HNTA 1RQXA 2H85A 1GU0A 3TFQA 1XJ0A 4TUYF 3V6LA 1Z5UA 2H3EA 4A7PA 4B6OA 4BAGA 2W42A 4OMDA 4BMDA 4CM4A 1S3FA 4ZU6X 2D0OB 2Y1FA 2BH9A 3C7TA 3S44A 4C3UA 5I7EA 4RTSA 2FZWA 1M1XB 1XD8A 1L1RA 4F4CA 1GRVA 1Z45A 2CNNA 3DMTC 5KTNA 2X19A 2J07A 1GNSA 3C2QA 3CV3A 2P11A 4RIIA 3KPJA 2I2WA 4PS0A 4GP9A 1OILA 4QAQA 1E2JA 1R0LA 3FNFA 1CV2A 3DDWA 1IOWA 1R8JA 3JRXA 4O4HF 1KDZA 3AU8A 1TUIA 4R1LA 4UM5A 3RAEC 1GA6A 1JF8A 3E9MA 4IINA 1H2BA 1P6UA 1LWNA 3DE7X 4URHA 1D0IA 4PYJA 1QZUA 3JQEA 2IYNA 1NVGA 1XMVA 2B4YA 2O2IA 4YASA 3FYTA 1MJFA 1MH9A 3T7RA 3VYRB 4HZGA 4HRXA 4M1KA 2DULA 4QOIA 3VI3B 2AYXA 1CKEA 1Y6JA 4KXLA 1SG9A 1KPGA 2GCOB 1U7XA 2VXCA 3KVOA 4NICA 3FB4A 3M4YA 5JE8A 1RFLA 3OWOA 1JQAA 4G2TA 5G1PA 4D1YA 3KD3A 1NMSA 1PG2A 4V0NA 5LQKA 1KMHA 1LSUA 2HN9A 3IIMA 3LX4A 4AYXA 1ODKA 1PR4A 2JFVA 1M6WA 3KTAB 4ZO9A 3WG9A 1YU9A 2BT4A 2H2GA 2O50A 3W3AA 4NJEB 4NXMB 2Z5FA 5AUOB 1MAVA 2DP4E 4KG7A 2HRCA 3AHIA 4UBKA 4AY3A 1K89A 3ITEA 4UOZA 3ZGOA 4JAVC 4HDSA 3H0EA 1ZYUA 1PZNA 3EASA 2J67A 3T9DA 4HDOB 1KDOA 3BHMA 2C54A 1UK6A 3FPJA 1GKKA 4KK4A 3BGOS 2VJAA 1RJ9B 3ISJA 2JFZA 5CT4A 4US1R 2R5NA 3BL8A 1E3TA 1Q3TA 3MYRA 3VTZA 2OD7A 3B6EA 2Q4TA 2VT3A 2XUPA 2H63A 3H75A 3I58A 2GNAA 2CDAA 3E2PA 4C7BA 2P90A 2GLUA 5F33A 2I6XA 1RI1A 2Q45A 4DXDA 5EPUA 1J39A 1TMYA 2JAUA 2GEDA 4EPTA 3NO4A 3AL2A 5CD1A 1Y5MA 1YMVA 3MM4A 4K0RA 2WUFA 4F4IA 1X1TA 2BFWA 5K0FA 4OXRA 1PV2A 1W2WB 4M99A 2YXPX 4FK8A 5LUAA 1RYFA 5MGBA 3AOEA 1M74A 1O77A 1FZQA 1U8TA 4DIUA 4M0LA 3B3GA 4F85A 3JD3A 4LZJA 5IANA 3KTFA 2N46A 3DOFA 5AW4A 1H2XA 3R6GA 3H1BA 5A3RA 1ACMA 1E1LA 2DX7A 3LVRE 3Q15C 3SCZA 4E11A 1JFTA 4HWKA 3SHOA 3O0TA 2EW2A 3BILA 3ZN2A 1V8BA 4PGAA 3ZWYA 2OLEA 2ZIXA 5B3JC 2HNKA 3MRVA 3NM5A 5A0VA 4EKGA 1N0IA 4U7GA 1TUBA 2J59A 1XQXA 4TSKA 1LSSA 5KYKA 3J81k 5LMZA 3PC3A 3JQ9C 4ZI7F 5JYBA 4EZIA 4RVFA 2Z8YA 3SLGA 1WXWA 4LVUA 3UJBA 3R7LA 1XJQA 1KJ9A 1YJXA 4U2KA 2X0KA 2YRWA 4DSAA 4EWLA 1NJ8A 4DCVA 1HR0B 2RKOA 3H4TA 3L0SA 1UP4A 2HH9A 3E7PA 3I2IA 5EHIA 4LNUA 3ZDCA 4YMLA 4RKYA 3KSBC 3T38A 3ZHOA 4JYBA 2WVGA 1YRLA 1QK5A 1T24A 4RO0A 3EPPA 3UJ7A 3CY6A 1UP7A 1C50A 4IH4A 2LIVA 4X54A 1WZ2A 2X2PA 3LZ6A 2P9TA 3H9JA 2IV2X 3UHPA 2XCRB 3TDMA 4MIEA 4MUMA 4LNHA 4IOKA 5EP4A 4RC9A 5HGJA 3H1GA 5HFAA 2VJPA 5LIPA 1E2IA 1A69A 3L7BA 1A1VA 5GVRA 2RK4A 1MVNA 1R6TA 2QD5A 4XJTA 4EATA 3ADCA 3D7RA 5ELXA 1L7MA 3HCNA 1T2NA 4MKFA 3VC1A 3FYCA 1B0AA 2GJ9A 2F3UA 1U2TA 1F4VA 2GN2A 3LHIA 4OK3A 5T8KA 1ISHA 3KTDA 2G7MC 1UT8A 3MUOA 4I1VA 1IBMB 2A4KA 2D13A 3L6OO 3DMDA 2G67A 2Q5HA 3HLTA 1C1XB 3PHJA 3SYMA 3VOAA 3QOFA 4EGSA 2XZDA 4G81A 5ICGA 2FWJA 2O0KA 4V3CA 3IL2A 4EO7A 1HFJA 3RS9A 3I9V6 4JL6A 4X24A 2IXTA 3DA8A 4EAQA 4TV9F 1FRVA 1WXEA 1XZMA 1EWVA 1SKAA 4HO1X 3T6KA 1EP9A 2W2LA 1U8ZA 2ZRFA 1L7OA 4Q7MB 4B4UA 1F4PA 4PR3A 4RKRA 4G0YA 3TOZA 2XB2A 2LD4A 1RWNA 3M6MD 5FWAA 4P0QB 4GIBA 2X76A 2G1UA 5ESWA 4FFMA 1I3KA 2G1KA 3A4IA 3OIWA 1QK3A 3N76A 1M1NB 2N75A 2N9UA 2YJ3A 4G1EB 1LLFA 1YQUA 1V95A 1XJ5A 3D0RA 4RMIA 4TMZA 1YA6A 1CUEA 1HSOA 2XKJE 2IU0A 4BUJA 4DMMA 3D7MA 3EMVA 1ABEA 2J8ZA 4NR0A 2D2VA 3KRTA 3L6RA 3L7AA 1FFXB 4GDMA 2QMZA 5K3BA 3UCEA 2VK2A 4YRLA 2P5YA 1KYTA 3VH4A 1NW8A 4HDMA 3MQFA 4M1YA 2O8FB 4JJAA 4IQ0A 1NVXQ 1XCJA 2IIQA 2W4QA 3K20A 5CUQA 3ER9A 4MJ7A 2IEGA 1GAJA 2I7DA 4Z9BA 5DH9A 1WW8A 3T1TA 1NA5A 5I45A 3H5OA 1E94E 3PICA 3N7UA 2QTZA 3PHIA 4NY1A 4EIWA 1V9LA 2ZBEA 1EP1B 4BQRA 5C1PA 4H27A 3FI0A 5EUBA 1H1LB 2FW0A 2BBTA 5HK9A 1T1JA 1EVKA 1MN6A 3DT9A 1NLFA 1A2QA 4Z3DA 2GN9A 3BXHA 1FLAA 2I7XA 3EFOB 3MMPA 3ET5A 2O4UX 4MW1A 5A6VA 5GIOE 4G8CA 3THYB 3QX7A 3E5NA 3KEMA 4P33A 4UHFA 1U3DA 4DEXA 1CSEE 3P2IA 1QC5B 5BN5B 3IDQA 2HMVA 4M0FA 2FF5A 2ZBUA 2ZE6A 3WL6A 3VBCA 3BE8A 2G5CA 2GN8A 1G63A 4I4TF 3EWAA 5IM4F 1T0IA 3LW8A 4CI9A 4FZ3A 4D45A 5DN6D 1DMSA 3KJHA 5H5JA 3HLKA 3RYFA 3CM0A 3EA0A 4MR8B 1RYBA 4BVKA 2C59A 2OR3A 2ASVA 4D80A 4GICA 5I4KA 1N6IA 4ATNA 4AECA 2I76A 4I6EA 3HU5A 4NZZA 1FXWF 1H0RA 1NN1A 4XQEA 3WOHA 4BFUA 2F1IA 2JFPA 1U0OC 2IPOA 1BD4A 2DUWA 1F4LA 3ORFA 1EVYA 4FR0A 4G5RA 2PSEA 2YFYA 4MQ5A 4W6QA 2YWDA 5L3RA 5H81A 3WI7A 1CQZA 1V5IA 1SG6A 3NHMA 5FIUA 4PC3A 2O8CA 2PQMA 4NFHA 3UXYA 5F5LA 5K3SA 3SJZA 2Z8XA 4EQ6B 1EFTA 1V6AA 1F48A 1KZYC 2NWQA 3UYLA 2CVZA 4Y6RA 1A7KA 1NLZA 3BA1A 4KGVA 1EB9A 1G19A 2NXNA 3PITA 3EA4A 4Y9UA 5CDSA 5A4IS 2O7SA 5A9RA 5F3WB 4ZVKA 2QNBA 4RF3A 3A2MA 3FTDA 2QGZA 2W6QA 3BD6A 1ZGJA 3OZFA 4LJYA 2WIJA 2JCBA 1PNVA 2WINI 2VP5A 3M7IA 4KH1A 4B2YA 5I9SA 4PQEA 2QLTA 4UMFA 5AKGA 1G7SA 3ORSA 3PJGA 4EYGA 3CF4G 3GB9A 2ST1A 4ARIA 4RORA 1QS0B 3GZTB 1RI5A 2BCEA 3KPWA 2UVPB 2W2MA 5H82A 4OLFA 4DNXA 1Z0SA 5K8VA 2EGGA 1DJQA 3IO3A 3S7ZA 3P71T 3TMAA 2B83A 2HTFA 4GQIA 1PUJA 2WRZA 4B76A 3HK2A 3FCCA 2GUWA 1AZLA 1TF5A 2BF4A 2AJBA 3OJOA 2HFJA 3GP3A 4TTSA 3QU2A 4XUDA 1XDZA 1KOJA 4PPGA 4ARBA 4BQQA 1T4CA 1DKNA 3E9RA 3ME5A 3UJPA 2QQ0A 5CPFA 2ZSFA 1F0PA 1XCMA 4IIDA 2YWGA 3KJFA 3RUCA 4AX8A 5IVHA 1RXYA 2GETA 1G17A 4NPCA 1FFSA 3TZKA 1ZJYA 3EF1A 3Q8KA 1YB5A 2JGAA 4AF8A 3B38A 3PQCA 1H0SA 3BWCA 4M2LA 5IH7A 2NTNA 2G6TA 2PH3A 4RJKA 1YWGO 1NURA 2B92A 2BI4A 3B1ZA 3RFCA 1GTVA 2IHUA 1I80A 4DNFA 1N6NA 4G0VA 3MPUA 4WCDA 3FDZB 4WRRA 1U1CA 3AR7A 1P61B 4NENA 3VVBA 1MG5A 1PD0A 1AF4A 2GHIA 4BO7A 2O2JA 3IULA 4FDMA 5DI9A 3SFZA 2BFMA 3JZAA 4MRNA 4JC4A 3IE0A 3ZJYA 3NRCA 1MR3F 4EP1A 5LP6F 2WU1A 1F8XA 1SD5A 2GMWA 1SCIA 2DR0A 3E5RA 2ZPUA 4KI0A 4C1BA 1E6WA 1OHHA 6ABPA 2FWIA 1U28C 1RYNA 4Y6QA 4EQ6A 1DOHA 1CJVC 1YHZA 3AF0A 3GEGA 2O3TA 5KWIA 1MCZA 4EF6A 1PR2A 4NK4A 1G98A 3G0DA 3WQHA 1YKGA 4BAUA 2DTXA 2P4UA 3LA6A 4QYIB 2OOSA 4KO8A 1NXQA 2OZLB 2QMHA 2XSZA 4OM7A 2H4WA 4LXQA 4PCUA 1I30A 1KZ4A 2PGDA 2WAMA 4PLGA 1KI1A 3WLNA 3DCNA 1MC8A 4D8UA 4MGHA 4RLHA 1RI2A 2I8LA 2F4NA 4MR8A 3RYFB 2WP8J 3FDFA 5FCDA 3IOMA 5BQOA 5LB2A 1G6KA 1I1HA 3M4XA 4O4LF 2BYTA 4BKRA 1DBRA 5IM5A 1JKIA 4AYWA 5KTPA 2VRBA 2W58A 4KKVA 2HXGA 4TLCA 3AXSA 2P9GA 5ALFA 4A8PA 1A76A 1OC4A 3JV7A 4AL4A 2VDUE 5FI1B 5FUYA 2X0IA 2ZTLA 5FX2A 1IBRA 3BORA 3C4QA 4OMCA 2PJUA 1J0CA 3TQFA 2EDCA 3VNAA 3UJ9A 3UAYA 4CF5A 1VJTA 2B8WA 2YZMA 1DAMA 1YC2A 1I01A 4U7WA 4GXTA 1D2CA 4D8WA 4HAXA 4QPZA 3L05A 1KI9A 2QUAA 2FWRA 2PSFA 4TSFD 4C0AC 1QJ4A 2P35A 3UHFA 5J1TB 3QMMA 2X23A 4FC6A 1Y5IA 5KVAA 1DDIA 1U04A 2CBZA 3HNPA 2QUKA 5BN4A 1KDYA 3VO1A 1RWWA 4I1UA 2BN4A 4LY6A 1IY9A 1JTVA 3KYDB 3EVTA 3WV4A 1ZD8A 4FKZA 3ZDAA 4IWXA 3ETNA 5EZYB 1HRDA 3HBFA 3D6HA 4KWTA 1DAGA 1T36A 3QBTA 3A6HA 1GTRA 3OFVA 3BH7A 3ER8A 4YMSA 4PPFA 3WO1A 2IE8A 2WHYA 5ICSA 3OKAA 2R8BA 3D2AA 5E4TA 5FFMA 1H9CA 3IRUA 2PGNA 2AOWA 4KITB 2DWPA 1P74A 2JDIA 3WB9A 3PNYA 1BVRA 1Z5PA 2VP2A 5FBWB 1XVUA 3OQIB 3WLKX 2WWIA 3FWKA 2A0XA 2VZ8A 2CNOA 2H11A 1XTRA 1ADFA 2OCAA 2XMZA 2JGJA 5JANA 1WBJB 1X7ZB 5CA1B 1GPJA 1KERA 5KVCA 1S7GA 2KYRA 1SB9A 2QSJA 4RK7A 4RSMA 1OYYA 3R9IA 1MB4A 3LYHA 4FI3C 4R54A 4WH0A 2VUHB 5TC4A 3LOQA 2V0NA 1KO7A 3HDYA 1XLVA 2PLNA 3LQ1A 4FHGA 1SVMA 3AH8A 3LUCA 5GV8A 5I5EA 1U9ZA 1TQ2A 2B1JA 3VVCA 2QZPA 1LY1A 1AS2A 1EUDA 1NOJA 1RU3A 1V6CA 3LHKA 4IGEA 3VPDA 5HQ3B 3I2YX 1J6UA 1VMIA 3CUSA 4DBLC 4F1KA 2ILTA 2O5EA 1SD1A 5THKA 3THXB 1TKAA 1QG0A 3U44B 1QQAA 4EABA 5JTUA 3TCKA 2C5BA 1R18A 2JFYA 4BVGA 3KB2A 4MV5A 3ZWMA 4BNVA 2O1EA 3V7NA 5EMNA 3H42B 3N87A 3ZXIA 4PHGA 2FMKA 2V7EA 2VBIA 4PQFA 4PN3A 5K45A 2IITA 1M8GA 1PYDA 1OPXA 1E3QA 2WYUA 4HPWA 3PL1A 4G65A 2P30A 2YNMD 1L5HB 4L4XA 3KZOA 4J3NA 3WQQA 1QQBA 2UUPA 4B8ZA 1ONBA 1V8OA 4OHMA 2B9VA 4UBIA 3ZHRA 4RYDA 4N6NA 1M2WA 4TQGA 2QM0A 1CDDA 1YBFA 1O9GA 3S8MA 1KTVA 1R4ZA 3FPAA 4FYHA 4CMCA 2JJ1D 3WL3A 3ZWXA 2YFHA 5DGXA 1NC1A 4IUCS 4F1JA 3OZRA 5EERA 5LKAA 2X7HA 1HQDA 1RXSA 5FNVB 1HKHA 3SSMA 2AIRA 3N5KA 4DA8A 4EQZA 5FLXA 2WEKA 4WXEA 5GADl 2F2TA 3ZH9B 4OV6B 5DM60 3E8MA 3OZDA 4L22A 3OEHA 4F21A 4NYIR 3UG6A 5C46F 4XGIA 1T3ZA 2BP7A 2CJYA 1XTUA 1ZVJA 3ROTA 2CXTA 4BEWA 1TL7C 4EK9A 1EVIA 1WNTA 4EVSA 5IKMA 4YJDA 1CJMA 3ADKA 4LBZA 3DD1A 5FJIA 3OQIA 3WLQA 1UQRA 1N8SA 3H5VA 4WOKA 2NUAB 3X0DA 1K4YA 4AJEA 5KYUB 2NMVA 1JLHA 3PLRA 3IUNA 4OFBA 5JMTA 2HA4A 4J90A 2RHRA 1OIVA 5E38A 3H2YA 1ECBA 3PUXA 4WK2B 3RT1A 3ZJ5A 1JQEA 1PTJA 4NCNA 1Q14A 3ZBPA 3T15A 2ATIA 5IT5A 1ZD4A 4GRDA 5F2NA 2QSYA 4G5SA 4IP0A 5IX8A 2WMDA 5CXSA 2GSDA 1K0FA 2Q1YA 1OBFO 1FNBA 4MR9A 4R51A 4RKWA 4F3CA 1CB0A 2WJ3A 1Q0PA 2R8PA 1F2TA 2PLAA 2OV4A 4YRBA 4AXXA 4B6JA 1FLDA 1YOVA 2XUQA 4RYLA 3WGJA 1BX1A 1U4SA 5DHFA 2G8LA 4YUWA 2LBPA 4ZQEA 3FVWA 4YI3A 5CB6A 3TLXA 2VP3A 1AZSC 3DL7A 2FV8A 3HDTA 5L45A 2XRZA 3SDZA 1O58A 2QMUA 3JVDA 5F21A 4O2BF 3OF2A 3X1ZA 5I7FA 1VLZA 2PO5A 2E5LB 2GZ2A 4LSGA 1NY6A 4TWBA 1L4MA 2R4QA 1GQFA 2RC5A 4DDHA 3VZRA 2V7XA 1H4SA 2WG2A 3LH5A 4AU1A 5LVAA 3OVMA 2XGMA 4IIXA 2AN9A 1V8FA 2V1UA 1PHPA 4D9JA 3A6PC 4ZYUA 2X9GA 2VDJA 3MWEB 3RFXA 3P5SA 1OXTA 1TK9A 2NV6A 4RVSA 4Y1GA 3I2FA 1IXSB 3ENZA 4Y30A 2CCKA 4AZ0B 3TSYA 1X42A 5HDBB 1XROA 3Q8XB 5F7XA 1YNOA 4Q12A 4WA8A 1N0VC 4EG7A 1ZD2P 4NU8X 1M7BA 2RHMA 1P72A 2HDWA 2VF7A 3VJKA 2ZUDA 3SICE 2HF7A 2POCA 1E8DA 1GWNA 3Q9NA 1AUVA 2VWHA 3FUUA 4BO4A 1UBUS 3GR6A 3HKCB 3F6SA 3KFLA 4RZSA 3QFHA 1KQFA 2VPZA 1GNRA 1L3BA 1YCFA 1G20B 1RP1A 2X4GA 4UEOA 4YV7A 1V7PC 3I0NA 4E5DA 1GYRA 2J9YB 3FHCB 2FOIA 3TIXB 4A5OA 2P2DA 5KCZA 2FMTA 5HJ2A 3G7SA 1M34B 4C22A 3M1LA 1BVYF 5LNK6 2ZBFA 5CNKA 2O2HA 2BL4A 5ITSA 4BS9A 3K1AA 5B3LA 4TVKA 4GMGA 4UCFA 3K9HA 3FNBA 2WJAA 3Q6IA 1FA9A 2RFLA 1VTKA 4KSYA 1JZQA 1Y5LA 3ZGVA 3G0HA 2OSVA 4ETIA 1C4WA 1U0SY 1FFEA 2JIPA 1FK8A 4URXR 1B7GO