4MGYR

Selective activation of epac1 and epac2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
total genus 47
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgyR00
3CZPA 3GCGA 3LDAA 5EZ5A 4US1R 1RYHA 4URXR 1U8YA 3NBYC 3T5GA 1HY3A 3K9NA 5JS8A 3T5DA 1N6IA 4QHYA 1SVOA 1E0JA 2XSZA 3S1AB 3PEVA 4B71A 2RGBA 3HPQA 3KFVA 4K81B 2XOKD 3PUZA 3OE7D 1FFHA 2GXSA 2ZVQX 3M4YA 5H68A 3U3RA 4DLRA 2JLXA 1WE2A 4TYWA 1E9SA 4NE2A 1KI6A 2HLDD 2Z0MA 2MMGA 3QOFA 4HZIA 1CEEA 1CF4A 3CRRA 4C0HA 4GOJA 1TQ4A 4YQFA 4KBGA 5CYPA 4QGFA 4QGAA 4I99A 4JL5A 1TX4B 3BGWA 4HLCA 5CLLA 1YR9A 2HXYA 4JL6A 2CLSA 3U4QA 1N3BA 4EPTA 2ZJYA 3W6PA 4ARZB 3L8YA 4B75A 1Z6YA 2EWWA 4XD7A 3KUCA 4AY2A 2JJ1A 2CJWA 3QENA 4KYIB 1OFIA 2QGNA 3X1XA 1I4TD 5TY0A 1OW3B 2ZJ8A 3QPUA 2ECKA 4IW3B 4MRRA 1A82A 2A5GA 4LYAA 1FP6A 2JAQA 3A36A 4D4LA 3C14C 1W44A 3GJ0A 3LX5A 1XMJA 2UKDA 3X1YA 2PT5A 2GBLC 1BOFA 2QL6A 3RVBA 3SHFA 3LFUA 3NDPA 4NYIQ 2J0VA 4EDHA 3GLGB 2A5FA 4QBIA 2IC5A 4LC0A 5EQTA 2J9RA 2DFTA 5JWRA 2AXNA 3LV8A 2EFEB 5F9HA 1T8TA 4LRWA 5F3WB 1OXSC 2GEUA 3AGPA 1O87A 1VKJA 3CRW1 1JAHA 3F0TA 4S2EA 3TGPA 5HZKA 1NVVQ 3BXZA 4CEIA 1HQCA 3AV0B 5IRCD 4JLOA 2CNWD 2JIZD 5J40A 5A4JA 4EPWA 2EYQA 4ERNA 5KNCA 4TMWA 1W46A 3O8RA 1TNDA 1G5RA 1FQJA 1TPZA 1Z47A 1DE0A 4I1OA 3SNHA 3OESA 1XZPA 2LKCA 1YZUA 3ZDQA 1L2TA 3CM0A 1S96A 3HPRA 2F1IA 3SJZA 3U4QB 5AUQA 4TLAA 4JVLA 3QPWA 2GVZC 5HKKA 2ZXUA 2PCLA 4DVGA 2D7DA 2J7KA 3FGNA 3SN6A 2CJWB 1L4UA 1OYWA 5AWFC 3EG5A 1M1YE 1LB1B 2FZLA 3QEOA 3CONA 4QHSA 3BE4A 4TZ6A 1I4LD 2YOGA 3CX6A 4QL3A 3RC3A 4BLOA 4RCYA 1JR3D 3Q5DA 2Q0HA 4JMPA 1RJ9B 1W0KA 5L3QA 1MRNA 1YJ5A 2ZJOA 1SXJA 1E2PA 4TLEA 1T9HA 4P3YA 1KYIA 1NN5A 1QHNA 1Z29A 1LV7A 3HJNA 5FTMA 2E87A 3DOEA 1FZQA 5EXSA 2IYXA 1KI3A 2DWQA 5AJXA 1DPFA 4YMUA 2ZJZA 4NKRA 4GNKA 4MUAA 5KDLA 4CEIB 3IPYA 5FOTA 4C30A 4ZCLA 2ZJ2A 5CIQA 4KCGA 2FSIA 5KO2A 4DSUA 1G8HA 1QHIA 1WQ1R 3LQRA 1OF1A 2G83A 4LYHA 3Q7QA 4BFZA 1Z6GA 2CEAA 1W49A 4DCTA 2J3EA 1NBMD 4KLZA 2AWNA 1NG9A 1UDWA 2ANCA 2BMEA 1KGDA 2HCBA 3I72A 4QJ5A 3GFTA 1YZGA 3MWLA 1VIAA 4R2IA 2C95A 3PJRA 4JBWA 3GP8A 2EVWX 4NPHA 3BWDD 2BC9A 4NU0A 5C1BA 5FPTA 2P3SA 5EZ6B 3FFBA 5E7MA 1KNXA 4BFXA 4WAUA 5KDDA 4M4SA 4GI7A 3H4MA 1JR3E 2GJSA 2FFBA 2GEVA 4LI0A 1OV4A 1IAQA 1RKBA 1TEVA 5L3QB 1SXJB 4F92B 3LW7A 1E9CA 4B3GA 1Y63A 1Z2AA 2OUKA 1DAMA 3NG1A 2CK3D 3Q9LA 1HT1E 1EFHA 2OXRA 2NO0A 1X3SA 4YMSA 2GWHA 3B5JA 2LKDA 4PC3A 3B13B 1M74A 3GJ7A 2QM8A 4C0KA 1W4BA 4P33A 5FBRB 2WSMA 5CDFE 3U2QA 1VCNA 2QP3A 5DGXA 2OCAA 4BFVA 2CVHA 2JJ8A 2IX3A 1MO6A 2B7BA 2CLDX 1E0AA 1S3GA 2J7PA 2DWPA 1DG1G 2CLCX 4PTLA 4EPYA 3EPLA 1UM8A 1Z8FA 3AKYA 3OFND 5KOYA 4GZMA 3GQBA 4E09A 3M6AA 4RCZA 1NBME 2C77A 2GXUA 4G0NA 3T1QA 1DVRA 4PZZA 1KDPA 2OFXA 2XXAB 4V0KA 4EUNA 4RZUA 1LS1A 1KI2A 2IUUA 4TYNA 4NH0A 1XMVA 5EUQB 2GXAA 3TSWA 1WCV1 2IYYA 3B1XA 1EFRA 1WMSA 4TWZA 5FUYA 3VX3A 4XTRA 1DAEA 4Y0AA 5E95A 3W5JA 2ERXA 4U5XA 4P0TA 5H8WA 2DHRA 2JGNA 3OEHD 1T3HA 3NDBB 3FOZA 4GL2A 3P4XA 4M1TA 4FCVA 2W2TA 4EFMA 4A15A 1EK0A 3PITA 1LVGA 2GZHA 5AUOB 3BH0A 1XJ0A 3HWSA 4M9SA 3KJHA 5SZHB 2DB3A 4UNQA 4QJ3A 1S1MA 4DUGA 1CKEA 3AF0A 2ZI5A 2AX4A 5DI9A 1GKIA 1VIYA 4NCKA 4R9UC 1X8LA 4HDCA 3D31A 2G3YA 4LJ9A 4XTCS 1ZM7A 3FWYA 3SBEA 4DJTA 3TQCA 4M0LA 1E1QD 1ODFA 1CR1A 5B58C 5J4LA 5FTNA 4M9XA 5IDVA 2O52A 3K0FA 3P4YA 1Z0FA 4QRHA 1KJWA 2QRNA 1AK2A 3RS0A 5FI0B 3NEJA 1KDOA 2J5XA 4AYXA 3TUZC 3EC1A 4V03A 4NYIR 1DAHA 4GMDA 1AN0A 1Z0IA 3TKLA 4DLZA 1YR8A 4I4LA 4TZ0A 1ESMA 4FMBB 1XD2A 3RC8A 3HDTA 4A6PA 3MCAA 4RZ3A 1G16A 4Q1BA 2P5TB 1NVWQ 3IKJA 4U02A 4B3CA 4L8GA 2VHTA 5DHFA 1NVVR 4TMXA 4HB3A 1JAIA 3CLVA 2QE7A 4DKXA 2ZJBA 4E22A 4IVPA 2QSZA 3TRFA 1WRBA 2YJTD 4OK3A 3KKOA 4Q7MB 1Q21A 1NN3A 2BOVA 3SQXA 1RVDA 3LNCA 4PPGA 1N6NA 1U90A 3WMEA 3QUSA 1G7TA 3WY9A 2BCGY 4DCSA 2X1VA 4L9WA 4AG6A 4TL9A 2O0KA 2F1RA 3K9GA 1KY2A 4C4PA 4KSCA 3HU1A 5KHOC 1RE0A 1OE0A 3DHWC 3KJGA 2CHQA 3KL4A 1OH5A 2ZI7A 3ICEA 1U2RA 2IXGA 1II0A 1VG0B 4IXNA 4XVQA 521PA 1P7CA 2F3TA 1F2TA 4AC9A 1P2VA 1E9EA 4LOAA 2RCNA 3K0FB 5J47A 5JRZA 2F9MA 2XJ9A 2IYVA 3AM1A 3L0PA 3K9LA 2ZROA 1E9RA 5B64A 4K8OA 1NVUQ 2V7QA 1E2FA 1XTRA 4A36A 2IUTA 1P61B 1XD2B 1NY5A 2WSSD 2FPKA 3IIMA 1ZIPA 1OHHA 5LB4A 4JBYA 3T1TA 4KXFB 4D0GA 4Q48A 4UQOA 4NHOA 2IT1A 5LBIA 4OL0A 1Z2CA 3K09A 4EPVA 3UXMA 3RRZA 1HT2E 3JZAA 4G5SA 4LHWA 1E1RD 1ONBA 1XX6A 1HURA 4O25A 4Q4AA 2QRZA 1CRQA 4URZR 2I4IA 3FMFA 2GXQA 2ZR0A 1C1YA 1XTJA 2ZETA 5DI3A 1IXZA 1GFIA 1VMAA 2FSHA 3LD9A 1Q20A 1QVRA 4R98A 4WZAE 5IF9A 2ZRBA 4ACAA 2ZSEA 3U3JA 2QT1A 1ZCBA 4D25A 4N0EA 2D2EA 1MO4A 1TQ6A 1DAGA 4HLUA 4UNPA 5CB8A 1U9IA 2WZQA 4A9AA 1Z63A 2WOJA 2V1UA 3K70B 3ZZUA 2AKAB 4BPBA 1G18A 4JYCA 3EIHA 1KAGA 1SKQA 2F6RA 3EWSA 4DB4A 4ZIRB 1MABA 1I2MA 4UJ3A 3UMSA 3RS3A 4US0R 1KSJA 1OH7A 1FNNA 2W6ID 3D7MA 2JCSA 3OF5A 2BHRA 2E1RA 2IYUA 1E2GA 2GA8A 2QI9C 1XTQA 4JSTA 3OEED 2CCKA 5HCIA 1V43A 3ZVRA 4TL6A 2H8KA 2IK8A 3PUYA 4LWZA 3TAHA 1NVXQ 1Q22A 1FMJA 3DZ8A 2NPFA 2VP0A 3PFIA 3TIFA 4XWAA 4Q4AB 1UKVY 3U7EB 1Z08A 3T34A 4YDHB 2QMHA 2IUSA 5G3ZA 2FEMA 4BLQA 1EWQA 5AJYA 5DI3B 3WNBA 1UBCA 5JJKA 2O8EA 1ZRHA 2A9KA 2B8WA 2IYTA 4FMDF 2JJ2A 2Z43A 3CF0A 4NYJQ 3O47A 3MSXA 4DC9A 2XOKA 2VA8A 4G1UC 4C0QC 5J4HA 3OE7A 2IYSA 3GJ4A 4WXRA 3RHFA 4O2LA 4TYQA 5FH9A 2E9SA 1XD8A 4BEBA 2J1LA 4Q1AA 3K0CC 2F43A 1P2SA 2XB4A 2KI5A 4KHZA 4EJSB 5JFGA 3QSYA 1OXTA 2AD1A 1V5WA 4RZ2A 1KK2A 5F9FA 2EWVA 4RSGA 2IXFA 2A7QA 4QBHA 4F38A 3EPHA 5KYKA 4QBGB 4I1VA 5K8TA 2N46A 4ZDJA 4JL8A 1R5NA 3B1ZA 1OIVA 3QKTA 1ZINA 1XJQA 5TV2A 2FDCA 3I62A 4FD2A 4Q1EA 1YZQA 3B9PA 2FFQA 3MFYA 3LH5A 1ZCAA 2EU8A 2GTPA 2PZGA 2QTFA 3VR4A 3PEYA 1KMHA 4KSBA 2GZDA 1D9XA 3KFXA 1JNYA 1GRNA 1N6KA 3ZQ6A 2OCYC 4ZDWA 4MRSA 1M7HA 3WRYC 1GL7A 2FNAA 2Q3FA 2DWOA 2AD5A 1L8QA 2V9PA 4Q1DA 2XGJA 2H7VA 3GJ8A 1D8TA 2ZUDA 2O0HA 3AF3A 1JQJC 4CZ2A 4KU4A 2GETA 3I32A 4Q1CA 1UFQA 1VYVA 4JLDA 3AVWA 1A2BA 1UF9A 3L2OB 2ZM5A 4XVUA 1OXXK 1CS4C 4D6PA 3DZDA 2CNWA 1AGPA 4FMCF 4LDJA 2UZ3A 1E2LA 4TSFD 3KXLA 2F43B 1GNRA 1GSIA 1SKYE 1GOTA 1SZPA 2A3RA 2WKQA 2ZYVX 1U8ZA 2ZR7A 3KZ1E 4OHVA 4IDOA 2JDID 5GVRA 4M9QA 3A4LA 3LLMA 5C4MA 4Q00A 2GCNA 4ZI3A 2Z4RA 2WPDD 1ZD8A 2HF9A 2OFWA 3OIUA 4A8JA 5JMTA 1E9FA 1MV5A 3UWOA 5KSYA 1N6PA 3SFZA 4AKGA 1G4AE 1E4VA 2ZRFA 4DSOA 5G41A 1ZC4A 1Q57A 2W0SA 1IN8A 2IS2A 4FINA 4KAXA 3W8RA 1N2CE 2VLIA 1SVKA 3KQHA 2KWIA 4DIDA 1KMHB 1K5DA 2C99A 2XZOA 4HZUA 2WV9A 1LTQA 3NHBA 3THWB 3NC1C 4DLYA 4L9SA 4YMTA 2P65A 1W36C 1D2EA 4D82A 1KZ7B 5B2ZA 1E2JA 4MKIA 1P9NA 3QF7A 1CJUC 4DCVA 1IN7A 4MH0R 4IOJA 3LQQA 1ZIOA 1T8UA 4B47A 1GVNB 4G5RA 2A5JA 1KSHA 3TSZA 1E2KA 1W4CA 3VR3A 4U7DA 1Q44A 2PT7A 1OFHA 5EXTA 2FU5C 2DBYA 4CDGA 2VF8A 1OB2A 1SVWA 3WBKA 4PHHA 2C5LA 2H57A 2AHOA 4HB4A 1N6HA 1E0KA 3PEWA 2ZTSA 2RGCA 3V4FA 2OAP1 4C0AC 5B57C 2WWIA 5G3YA 1P72A 4A8JB 2ODWA 5LDDC 1NF3A 1W0JA 3THXA 1G3RA 2KE5A 1JR6A 1IOZA 1K5GA 2YOFA 3ZYCA 1NNEA 1KOFA 1W36D 4MA4A 4RD1A 3B1VA 1OIWA 4GP6A 4JLMA 1PJRA 3EZFA 4LV8B 2RGNA 3CRVA 2WAXA 3R9IA 1E9BA 4M53A 3TAUA 5JEEA 2SHKA 2DPXA 4HZUB 2P6UA 3QBTA 1JXMA 3SJBA 2A2ZA 3D6TB 2OFOA 3EXAA 4URYR 1CIPA 2UZIR 1FMLA 2H17A 2ZEJA 2WWYA 1GDDA 4JJZA 4HUTA 2MSEB 4Q1FA 5JSZA 2REBA 4D2IA 1KI4A 2CK3A 4KI0A 1KAOA 4B6EA 4FCTA 4X8HA 2OM2A 5HTKA 4BWYA 4PC1A 2FJUA 1M8PA 3QI2A 3TK1A 1WBDA 1CR0A 2G0TA 3PR1A 1MO5A 4BFTA 1XRJA 2P6RA 3OFNA 1A1VA 5KNDA 3W6OA 4YC7A 3L0OA 5JWOA 4V0ME 4ASUD 3SDZA 4IXMA 5SZJA 5FOSA 4TQAA 3AUYA 2PMKA 1KKLA 2JLSA 4NYJR 1R8SA 4EFNA 1QG4A 2F55A 3THXB 3K0AA 3AF4A 2YWHA 1A2KC 3FE2A 4GMXA 4NDZA 3V00A 3SYKA 4G01B 2IYLD 1RRPA 1XF9A 3OEHA 3R7WA 5EJEA 1UBGA 4E03A 3ADBA 3BB3A 4TL8A 3GFOA 1T6NA 1S2MA 1JPJA 3T06B 1IONA 4NCIA 1OPXA 1KO4A 3X1DA 2OSBA 1ETUA 5FPSA 1W7AA 4BZQA 1E32A 2VP9A 1HE8B 3P32A 1WXQA 4LGMA 3P26A 4B43A 2XITA 1N6LA 4QJ4A 2IS6A 4RZXA 1U0JA 1G6HA 4IRUB 5JSZB 1KIMA 5L3SB 1ZU5A 1KJZA 1P75A 3LBHA 2IYWA 2IWRA 1NP6A 2QGZA 3TQFA 1W4RA 1E96A 2EFGA 2MSDB 3N2EA 4PO9A 1PLJA 3DM9B 2YWEA 2BJVA 1E1QA 1S4QA 2ORVA 3CX8A 3MD0A 4LV5B 3SR0A 1M7BA 2CHGA 3GLHE 2HYIC 4CGZA 1NN0A 4Z8YA 2XZLA 4DLVA 3MGCA 4Z54A 2VF7A 1YVDA 1TF5A 2QTVB 3V4RA 1IHUA 1P2TA 3AQ4A 3B2EA 4IFEA 2A78A 3O8BA 4IFBA 1VG1A 2W0MA 3U7GA 1XPUA 2XAUA 2W83A 2JLQA 1W2HA 1FX0A 1GNPA 4KFRA 3KXIA 4L15A 4DDUA 4AKIA 2ZRDA 1KO7A 3K0AB 4LBWA 2IS4A 1HH4A 2ANBA 2ZJ5A 1VCMA 3A1UA 5D3MA 1DOAA 1M34E 1G3IA 1OFTA 3ZS9A 3R7WB 3ZZTA 5HR5A 3LVRE 4JT4A 3G0HA 3ZZ0A 3LBNA 2OE2A 5JECA 4LYJA 4A0GA 3U61B 4YMVA 4A0RA 5GVSA 2CE2X 2X2FA 2YWGA 2QNRA 1KI6B 5EP4A 1VYTA 2BKEA 3HYTA 4LJ8A 1R10A 5DN6D 4A92A 1IY0A 5FUXA 5HPYB 1N5LA 1N6OA 4RY2A 4KBFA 5FOVA 2ZITA 1E9DA 4QHTA 4F4IA 4C2TA 1X8JA 1OKKD 4FN5A 5LD2C 3QQ5A 5A5GA 1JPNA 4V0LA 3KTAA 2VPPA 2V8OA 4DEYA 3ZLJA 1FNMA 4CYMA 3IIKA 5FR2A 4Z8XA 1VCOA 1U81A 4DLWA 1Q3TA 3FHOA 4IKEA 2JLYA 1NMXA 1TF2A 2RGXA 3FHCB 4MRPA 4Q66C 3T61A 5DNYB 1BIFA 1XNJA 4Q21A 4IOKA 4DRZA 2JLWA 1DELA 4N1AA 4B74A 1FX0B 1Z6AA 2GVDC 4PQRA 3B8HA 3GLFE 4KV9A 3THOA 1SVIA 1R0ZA 5D3MB 5FUVA 4TN1A 2RAPA 2W6JD 1QG2A 2ZI4A 1OFUX 3SHWA 4PPNA 1VPLA 2P2LA 3Q7PA 2R6CA 1KMQA 3RLFA 1YZTA 2XTZA 3ND9A 3VKWA 4O2RA 3I5YA 2VP5A 4Q4HA 4D4KA 2QENA 3QE0A 4WA7A 4B2LA 1E79D 2VYFA 2YWFA 2ZQ5A 4LJ7A 2QPTA 2HEIA 4ON9A 3U5ZB 4M21A 2C04A 3PUWA 2PZEA 3K1JA 1AKYA 3D3QA 2ZRKA 1VHLA 8OHMA 2WWXA 3U60B 2F3RA 1XXHE 2CVFA 4RD6A 2NIPA 3K53A 4LBZA 1S0UA 3TE6A 3KTAB 5FTJA 4L4UA 2EW1A 4JLKA 1HUQA 1WA5A 3I3SR 3RS2A 1J8YF 5F98A 1TAGA 1ZC3A 4LHZA 4IOLA 3EZ6A 3GD7A 1C9KA 5DH9A 4ZV4A 2QAGA 1QHHA 2NO1A 4IHQA 2GF0A 1QHGA 1VDZA 3W9YA 2O8DA 2ZSBA 3VR5A 1RFLA 4TTQA 4US2R 3LX8A 5FBLB 4BECA 5JZVA 1UKEA 4MYCA 1P73A 3OEEA 4TT3D 2WICA 1BYIA 1GG2A 2WMOB 4G5OA 4I81A 5FR1A 4HYYA 2IWHA 4XIGS 4KFUA 3WHKA 1L7VC 1EESA 2NO6A 4C0BA 4BLSA 4LCBA 4M22A 3PCRB 2XTMA 4G3XA 4BLPA 3AVTA 5E4FA 1E98A 4B3FX 2IW3A 4Q4HB 2XNDD 1J8MF 2PBRA 3CUEF 1XTSA 2CDNA 3BOSA 5CJ2A 2ZE8A 1MO3A 3W5IA 4XVRA 3B82A 1Q3HA 2ZI3A 3MUFA 4OK6A 3PVSA 4ZPXA 4QGHA 3BFXA 1IY1A 2ODEA 4A2PA 4DCNA 2RKOA 4W9MC 4S35A 2WM9B 2ZUCA 1DAFA 1JJ7A 1MOZA 4IDNA 4OI1A 3ND8A 4UKDA 3VFDA 4A1FA 3F5FA 1GWNA 4AYTA 2IL1A 1E9AA 3NBZC 2QMOA 4P4TA 4PAMA 1TL7C 1WDTA 2QMEA 3CPEA 4OQMA 3CH4B 1GRQA 1FPMA 3ADCA 1TU4A 2QAGB 2ORWA 1QHHB 1NG1A 1RRFA 3IILA 4L5BA 1LNZA 2A5YB 1QHYA 2X77A 3ONWA 4IOMA 2O8DB 2R62A 4UXJA 4HDQB 4B3XA 3PV0A 2CL7X 1D9ZA 3SFVA 3IHWA 1SVSA 1ZP6A 4NBSA 4UNNA 4OBEA 1GM5A 3B7GA 3P1JA 1NY6A 1R7RA 3AB3A 3FDIA 4HSEA 1F48A 2GAOA 3ZH9B 1ZM2A 3P20A 4LX0A 4Q4LA 5A0FA 1KHTA 2YINC 1P9RA 3GEHA 4MKFA 4BQSA 4DZZA 1ZD9A 1IJEA 1XEFA 3I4LA 4A0HA 4PHFA 2ZS8A 4RD3A 1T5IA 1P2UA 1NRJB 2BMJA 1CBUA 1BYUA 2H92A 3K9HA 1R0XA 4C3ZA 4PQFA 4YLGA 2VBCA 1XMIA 3PXGA 2A5DA 3X1ZA 4NYMQ 2FZ4A 4LYFA 4OQFA 4N0DA 3F8TA 2C96A 5HCNA 1G3MA 3BD9A 3NTUA 3WBJA 1PUJA 3CH5A 3QXXA 5BQ5A 1JXOA 5FBVB 3NC0C 4PPFA 3I5XA 5KU1A 4U00A 1R0WA 1F3OA 5J4VA 3AF1A 1KNQA 1Z07A 1KDRA 2F1JA 1OIXA 4NCJA 2Q9AA 2BM0A 4TSFA 4DCUA 3EA0A 2OBMA 4TMVA 4M1WA 2WTUA 1SHZA 2OCPA 3VMFA 2C78A 3H1TA 4PSAA 3IBYA 4LJ5A 2VL7A 1KK0A 4NCHA 3SOPA 2GJKA 4CT5A 4PR0A 2IYRA 2QBYA 1DARA 3CR8A 2WPDA 2G6BA 3CR7A 2YHSA 2ZREA 4P31A 1JECA 1G7RA 1Q1QA 1EFCA 3GLGE 4MRNA 1CU1A 4JJKA 2G9NA 5EE9A 2NO7A 2O8FB 2UVQA 3AF2A 2FPLA 1JJVA 1G19A 1S3SA 2ZRLA 4QNMA 3KQKA 3B6EA 4DT1A 4DDVA 3QXCA 2BEKA 4XH9B 2J0UA 5TARA 3RS5A 3WYAA 3ZQJA 1W4AA 2FN4A 1DBSA 1QZXA 2Q6TA 4JT2A 4TLBA 4LHVA 2C03A 1HYQA 1MT0A 3UANA 4JBXA 1CXZA 3QBVA 4Q18A 1NMZA 1MR3F 1T0JB 1P4SA 1TU3A 2JLUA 4TQUS 3ZVNA 2V6JA 4TMZA 4Q9LA 3IUYA 4YXWA 1XB2A 2IHYA 3VNUA 2RH5A 3T12A 3TLXA 3GLIA 1N5IA 1NLZA 2NZ8A 4LPKA 1PV4A 4C7OA 2WWHA 3AH8A 2VH5R 5EUMA 3VNVA 5KSOA 1DAIA 1DG3A 3HU3A 2QORA 1XTIA 2ZYTX 5C4GB 1BO6A 2PX0A 4X8MA 4JKYA 1H65A 3BRWD 2FV8A 2ZYWX 4PO1A 3DKPA 3AVYA 1Z3IX 3WP1B 4B34A 5AJZA 5M04A 2QBYB 3A1WA 3D8BA 4LBYA 3SZRA 3U3KA 2HCJB 1NL3A 4RKEA 1N6RA 2VP4A 1FUKA 1R5BA 4K46A 5IK2A 3RABA 4D81A 3VR1A 1D5CA 2X2EA 4GSYA 1NI3A 2BMFA 5GJCA 3VTKA 4LY6A 4DEXA 4Z1MD 1F2TB 1ZYUA 3QNUA 4HDOB 4BLRA 3KJEA 4P4SA 1R0YA 3KXKA 4HAVA 3EAQA 4TL7A 3SU8A 4DT1B 4ILEA 1ZNZA 3IIJA 4ZO4A 1KO8A 1J99A 1T0HB 4GZLA 4N3NA 4O0MA 5AJVB 4MITA 1IJFA 1AGRA 1FTSA 2J0UB 2YVUA 2AK2A 5FFMA 1XBTA 1CJKC 1KK1A 2BBOA 1CJMA 2RB4A 2JLZA 3RSLA 4PSVA 1P60A 2ZE5A 3RRMA 1XCMA 2C8VA 5JCZA 2REXB 2BWJA 5JI2E 3GJ3A 1IM2A 2QG6A 1O3YA 3CWQA 3H84A 3TBKA 2VRWA 4MYUA 3CPHA 3GLIB 1TTTA 3IGFA 3GLHA 4JZKA 2WIBA 2PJRA 4C7OB 5FOWA 2C9YA 2O8CA 1XEWY 1UBFA 1NMYA 2AWOA 3CKLA 5EXPA 2D3WA 1EG7A 4MGYR 1M6NA 2HJGA 4ASUA 2ZRNA 3EPKA 2PEZA 5GJVC 2GZAA 2PLFA 4C0JA 1I2DA 3C4JA 5GADl 5HE8A 1SXJE 1E2EA 1AKEA 1AZTA 3AVOA 5C2JB 2QQ0A 2QZ4A 3CW2A 1ZNXA 3LO5A 5K8IA 5EE5B 4X8LA 2MMCA 1E2HA 2HXSA 2QSYA 3L0SA 1NKTA 4M2LA 2GK6A 2PMDA 4ESVA 4P4SB 4ITRC 3GPLA 3N2IA 5HZHA 1OB5A 3A6PC 4V02A 3WXMA 5BN4A 2FFAA 2I1VB 1NJFA 5E7IA 1FTNA 2HLDA 4RD0A 4TMTA 1EGAA 4HATA 4DLUA 4LJ6A 1MABB 1W48A 3WRXC 1XD9A 1WBBA 3BORA 5JJIA 4IEEA 5D3QA 3RRNA 2OG2A 3AGQA 2FX3A 4ZDIA 2ZRMA 2K5UA 4DWJA 3HR8A 2DCUA 3AVVA 2PX3A 3NVAA 1HTWA 2D2FA 3U6KA 4YONB 4R71A 3TMKA 2BBSA 2QT0A 1GTVA 4NYMR 5FTKA 1LY1A 2ATVA 5BYKA 1NIJA 3KJIA 3QJYA 3ZIAD 3DVLA 1XEXA 4WW0A 5DO9A 1N5KA 2ZU0C 3AKEA 1YR7A 4PHTA 1T4GA 5J4KA 3BS4A 2O8EB 3SEAA 2ZANA 3WYFA 4QM6A 1KI8A 3R8FA 3HP1A 5AUNB 4DUGD 3H0KA 3GLFA 3IBGA 2QU8A 2ZRAA 2RMKA 5IT5A 3O8CA 1SQ5A 3AEZA 1COWD 3VR2A 2IBMA 3NHAA 4RFSA 2HT6A 1UEJA 4HLQB 1A5TA 1NLFA 2HDNB 1PZNA 2Q3MA 4Q4JA 1ZNWA 1ZW6A 1GIAA 1PLKA 3FPAA 1TUEA 2JIZA 4OI2A 1JEEA 4TQ9A 5AR1A 1OH6A 2O8FA 3TW8B 2W2XA 2CL0X 2WOOA 1HV8A 1KKMA 1TEXA 2VHQA 4JKIA 2TMKA 3QIAA 3T15A 2WJYA 1S1CA 3DL0A 4ESHA 1S9HA 1QHXA 4JIMA 3CX7A 4PQYA 1Q1BA 1AS0A 3G5UA 1OKKA 3I8SA 5K8UA 1JBKA 2GBLA 2W58A 4GBMA 5JBQA 1BH2A 2ONJA 4OI0A 2EYUA 2QEQA 3H2YA 2Y8EA 3DO6A 5EP1A 3REFA 1CJVC 1XEXB 4PXAA 1JR3A 1Z0AA 1VYUA 1U94A 3M1IA 4B44A 2F7SA 3WNDA 2BJWA 2MSCB 4PO8A 1I4DD 2AKYA 5TDHA 3MLEA 4Z51A 4ZKDA 3FVQA 3GLFB 4L16A 3ZD6A 4DSNA 4TTPA 2Q9CA 1LW7A 5EP3A 2RGAA 1Q0UA 2W6JA 4RFSB 5JRJA 2V6IA 1YR6A 3T35A 3MJRA 4Q4JB 5CDFA 5TVKA 4Q19A 4D4JA 4XSHA 3UIEA 1S8FA 1E79A 3EX7C 1Z5ZA 1KI1A 2WKPA 3TR0A 2NMVA 5FUWA 1Z6TA 2R6DA 4LHYA 3J81k 1KTVA 3X1WA 1US8A 2V7QD 4QNRA 4EPXA 1NBMA 1G3UA 2REOA 4Q02A 1NKSA 2ZYUX 4HLUC 4YDSA 1U9IC 2P0EA 3EZ9A 1RPZA 4WZBE 5K8LA 2CL6X 3GEEA 1UBEA 5DHAA 3I1FA 2QUZA 1G64A 1RZ3A 5DISB 5FBWB 5FL7D 4CF7A 3BH6A 5JS7A 1XPOA 2GDJA 3AVXA 4TYPA 1J7KA 3PUVA 3MWJA 2NPIA 4EJSC 5CITA 1E3MA 2X19A 1M2OB 1G17A 2HJVA 4KODA 4NTZA 5DE3A 4PSKA 3TUIC 2EFDB 3EIQA 2GEDA 4Q5IA 3CBQA 2QROA 4P32A 3WNCA 1GUAA 2FGJA 3ETLA 2H18A 3PENA 1RYFA 3FKSD 1E4YA 2P6NA 2Z83A 2YV5A 2CE7A 3MWYW 5JEDA 4GOKA 5CK4A 2GKSA 1VECA 3AVUA 3NBFA 5BW8A 3CO5A 4TT3A 5L3VA 2ZRIA 2QN6A 4M9ZA 1G4UR 1Y3AA 2VP6A 2GNOA 4Q01A 4QKQA 3CF6R 3MG9A 4WIAA 1ESNA 2B7CA 3A1SA 5GJWC 3VQTA 2Z4SA 2XNDA 2ZIAA 1NN1A 2R8RA 3QPVA 4NZYA 2O0JA 3C5CA 3LW8A 1EFUA 1F2UA 1NIPA 2ASEA 4RD4A 1US8B 2R44A 3H86A 5EP2A 3K0EA 3NIBA 1RW4A 2Q3HA 5DYIA 3DMDA 3TVDA 4HUQA 4JYBA 1HA3A 5JLJA 4I1UA 4ARZA 1E6CA 2Z6VA 4ZCMA 4HI0E 5BYJA 1P62B 1PLLA 4GOXA 5CJPA 1J2JA 1GZSA 2GILA 2XNSA 2ZJAA 3A8TA 3CWZA 3WYGA 4BRUA 1T3SA 3C15C 1JEDA 4ZKEA 1J90A 1AA9A 1W1WA 4OQXA 2J41A 1GRRA 2ZE6A 2PJZA 3FB4A 2D74A 3GFPA 4H1UA 3VHLB 1X6VA 3R20A 2HYDA 3DM5A 4QC2A 2PLRA 2NOAA 2ZVPX 4IDPA 4PAOA 4B35A 3SQWA 2OESA 3QXSA 4DLSA 2IF0A 1PVOA 4BASA 4LSGA 1XDBA 2C98A 2L0XA 5TB5A 3UATA 3U7HB 2J59A 2AR7A 3R9WA 4A0FA 3N70A 1HQYE 3GLGA 2DFLA 3VHXA 1FW6A 1QRAA 2WWGA 3W6NA 4PANA 3FKQA 2JJ2D 2PEYA 3RSOA 1ZM4A 2J87A 2RGGA 2WIAA 4BE7B 1JB1A 4XOIA 3E5HA 2EFCB 3B78A 3QKUA 4M1SA 4EFLA 4WOPA 2YC2C 3OAAD 1TQ2A 1Q1EA 3CRQA 4LJAA 3MRSA 1KSGA 3C41J 3E1SA 2PH1A 1JQLB 2QP4A 3AVPA 2ZPTX 3ZS8A 1F2UB 2H16A 3CB4A 3W34A 4NP6A 1XFAA 1EWRA 1JI0A 3FYHA 1W2GA 3BH7A 2XB2A 3ASZA 5JHHB 4HUQB 5JHGB 5EE1A 5KUTA 1XTKA 4QXAA 2VQSA 3NH6A 2B92A 1YHNA 1KK3A 3MAAC 1G1MA 1UEIA 1IXRC 2YC4C 3B60A 4MQBA 1HE1C 1QF9A 4F93B 2P5SA 4OYHA 4AKHA 2WJJA 1DO0A 4F91B 4BFYA 4H1VA 4QOSA 4A8JC 5BWMA 1KI7A 1OXVA 1RJ9A 3AVQA 3TW4A 3Q72A 1YKSA 2AN9A 1IXSB 4QFMA 2R6FA 4UXHA 5CM9C 5FPKA 4QG7A 3BB1A 5H70A 2IS1A 2OEPA 3PUXA 4W7SA 3I8XA 1SULA 4FXPA 3RS7A 1C4OA 1QBKC 1MKYA 1Q12A 4MDFA 4MGIR 3QKRA 1WP9A 2DFNA 3JVUA 1KY3A 2ZI9A 4WXPA 5KTYA 1P3JA 2RGEA 3K0SA 1U98A 1Z83A 1QHSA 4PC7A 3L8ZA 3O8DA 1G3QA 1GAJA 2H5EA 1DTSA 4CVNA 2WSSA 3QKSA 1ANKA 5C18A 2O8BA 6Q21A 1AS3A 2NO9A 4MRVA 3MJHA 4HB0A 4NL4H 4J0QA 4OKSA 3RS4A 1SVMA 2FMXA 2OLJA 4AIIA 1MRSA 2AXPA 4ZDKA 2QQEA 4KVGA 1G5TA 4BZPA 1E1RA 5FL3A 3IHLA 1E2IA 1H8HD 3TJZA 4TLDA 1N25A 2WHXA 2BCJQ 2GCPA 1IY2A 3AP3A 3IDQA 4FWIB 5G40A 821PA 4MKGA 3SE0A 1F6BA 5J5CA 2W00A 1SGWA 1G21E 1G41A 2ZE7A 2CCGA 3C8UA 1XMSA 4GFDA 3C7KA 2RGNC 4RD2A 3TH5A 3A1VA 4Z1MA 121PA 3FMPB 3QXHA 1EFTA 4DDTA 4HAYA 1X1RA 1XZQA 3QKRB 5KPDA 3NWJA 4FWTA 1VG8A 3RAPR 1IN6A 3LBIA 2OCBA 4C0SA 4TLCA 3RANA 3JVVA 4AK9A 3OIWA 3TUJC 2VTKA 2ZAMA 1EX7A 2OO7A 4F4JA 1BS1A 2YNMA 2B6HA 3QKSB 1TMKA 3LWNA 1BMFD 2RHMA 2O8BB 2XXAA 1UAAA 2W6IA 2FA9A 4PC2A 4Q9IA 4YMWA 1G8PA 2NZJA 3ADDA 1H8ED 1Z06A 2G88A 4JVMA 4AKEA 4V0NA 1W0JD 2H1LA 1VCIA 2ZUBA 3I61A 1BKDR 1D2NA 4IJMA 3PQCA 5CK5A 1DEKA 2BIFA 2J45A 1DO2A 2GF9A 2WJHA 1A7JA 2J0QA 1KZGB 3UK6A 2VHUA 1Z22A 1R5OA 3FMIA 2AK3A 4W5HA 4DSTA 2JATA 2OXCA 4RFVA 3JZMA 1ZMXA 4FMDB 1TF7A 1F5NA 3R9XA 4AD8A 5FI1B 4WZ6A 1A4RA 1ZNYA 4IDQA 4D0LB 3AKDA 5FOXA 1GP2A 4OK5A 1S9DA 3KQLA 1E2DA 4HEJA 2XX3A 3Q85A 4HAUA 2ZAOA 1XP8A 3EIEA 2YYZA 2WWFA 4KVAA 5CM8B 4JSYA 3I73A 3PEUA 1AM4D 1G8YA 4UXIA 4LC1A 3IEUA 4JVSB 4R7ZA 3B1WA 5AJWA 3ASYA 4HAZA 1NSFA 4M1MA 1G6OA 1KJYA 5EXXA 2R2AA 4IVRA 3AP1A 4PPQA 2OBNA 4G5GA 2ZI6A 1ZD1A 4II7A 3THYA 3VR6A 2NTYC 5FTLA 3K8YA 2BBTA 4H9GA 5JWHA 3BFKA 3GMTA 3LRPA 3KX2A 2R9VA 2GCOA 3LY5A 5LB2A 1N0VC 2ONKA 3QY0A 3ZVLA 1VG9B 421PA 4D4MA 3EA5A 3KB2A 2QAJA 2VP2A 2XSZD 4UJ5A 3U3MA 1NJGA 1N5JA 3TVTA 2BKUA 2ERYA 1CTQA 2VHJA 1G8GA 2JLRA 3VU9A 3ZIAA 4B6FA 2QP9X 2EFHB 1FUUA 3ZVMA 3BBPA 1TQDA 2VO1A 4XSGA 1LFDB 4KYUA 3VKHA 2OZEA 1RRGA 2J46A 4AG5A 2BMDA 4JLNA 3K0CA 4ABYA 2C9OA 1FP7A 1COWA 1OLOA 2DR3A 3OHMA 3Q8XB 3BIFA 5FPHA 3TSOA 5BXQC 4FMCB 1CULC 4BEJA 3W8NA 4URWR 3RDPA 4D26A 1ZM3A 1X86B 4HAXA 4FIDA 4XD7D 1E94E 5SZKB 3SYNA 3HR7A 4PHGA 4R2HA 2JJ1D 1F60A 1GKUB 4DBLC 4EPRA 1T5LA 4I1SA 2LCFA 2B8TA 1D2MA 3THYB 4HAWA 2WBLC 1SKYB 1AS2A 1U99A 4DIEA 3MMPA 1P6XA 3MWKA 2ATXA 1AJEA 4V0OA 2JDIA 3UG6A 4BUJA 3ZD7A 1OT3A 2GCOB 2ZRPA 1EXMA 3KKPA 4QBFA 4A2QA 1ZM9A 3ADKA 1IQPA 3U44A 5CB6A 1RIFA 3NXSA 5CLQA 1G5PA 2ZR9A 2CHVA 5E7JA 2QPOA 3ZGXA 1E69A 1IN4A 4B73A 3VAAA 1GNQA 1ZU4A 2QPAA 5CYOA 4QGGA 4B2PA 2ODBA 2FGKA 4KO8A 4C0LA 3I92A 2KBFA 3B1YA 1Q1ZA 2IEZA 1UKZA 3VU9B 1UKYA 1LF0A 1SXJC 2ZS9A 3PIRA 5KSZA 3OZXA 1R4AA 4QM7A 3NEYA 3R8CA 2LWIA 3QF4A 1XJCA 5F2EA 2VSFA 3FTQA 3WMGA 3T1VA 2QA5A 1OXUA 5E3HA 1L4YA 3LVQE 5EE3A 1KO5A 2JEOA 3G82C 4KLNA 4W5WA 5DIFA 3X2SA 2ZSFA 2ZRJA 2ZS7A 1U0LA 4A6XA 2G1KA 5HKKD 4UNSA 1AIPA 1XEWX 2GHIA 3HU2A 1SHKA 1E0SA 3ECCA 1CR4A 2VEDA 3EWAA 2FEOA 3EASA 3W90A 2Z5FA 2WJGA 4ZI2A 2O5VA 4F7WA 3DMNA 4Q47A 4ZIRA 1D6JA 2R65A 4V0MA 4Q7KA 2F1HA 2A30A 2JA1A 4LUCA 4CW7A 1ZAKA 1ZUHA 1W0KD 2C2HA 5BN3A 2ZU6A 2OAQ1 1SXJD 1TADA 2OV2A 4OHXA 4BGDA 4X8OA 3U44B 2IYQA 621PA 2ZSAA 2GJ8A 1VTKA 2FSFA 5AUPB 5JJLA 2P67A 4PC6A 5FL7A 4F4CA 4JLVA 3EW9A 4MGKR 4ZCIA 2G0NA 5FPYA 2QAGC 3EC2A 4EKDA 4CEHA 2PL3A 1OJLA 2XZPA 4Q7LA 1ZUNB 2R6AA 4IVQA 5B30A 3CNLA 2CXXA 3TR5A 2ZSDA 3KDSE 1KSFX 4LZZA 1XU4A 3QF4B 5L3RA 3FKSA 2WKRA 1UADA 5SZIA 5KDOA 2V54A 3IQWA 1II8A 3UKDA 4MKHA 2OILA 2FOLA 1QDEA 1R2QA 2DY1A 1G291 1Z6XA 2GESA 4URUR 3RYTC 4PX9A 2V4ZA 2FFHA 2GK7A 1WB9A 1ZVQA 5TMPA 3L82B 3IEVA 3NH9A 2BBWA 4EAQA 2IEYA 1NSTA 1P9WA 1X1SA 5LPNA 1G7SA 2N42A 3DOFA 3M0EA 1XWIA 3FMOB 3PG5A 3KQNA 5DYGA 2N1BA 3REGA 1VHTA 3UMFA 1YE8A 1IBRA 1U8AA 3RRYA 3F3YA 4AYWA 3RWOA 3DEFA 4BFSA 4B3DA 4JS0A 4EJSA 2IHBA 1UDXA 4ACBA 4RKFA 2BM1A 2KJQA 1DAKA 3SS8A 4GRAA 3BB4A 3SYLA 4URVR 4PAQA 3SC3A 2VSOA 1G8FA 1RRCA 1YRAA 2D4HA 1GL6A 2FG5A 3L0IB 1R8QA 1W36B 4LHXA 1W5TA 4M8NE 1G9XA 1CRPA 3AKCA 3LAWA 1YZKA 1OH8A 3A4MA 2KB0A 4D0NA 1FL9A 4CEHB 1QVAA 1UPTA 3QG1A 4LK2A 5GJBA 4WBSA 2GJAA 5EE0A 4JLJA 2HT1A 3W3AA 4LJ4A 3SJCA 2AFIE 2OBLA 3CZQA 2IXEA 4P4UA 3NBXX 4OQLA 4W5JA 5KPJA 3A1TA 1LS6A 2J7PD 4A2WA 3VKGA 4FI3C 4JLBA 3SBDA 1II8B 3UWKA 1K6MA 5BN5A 4KITB 1CJTC 3GEIA 4PFSA 4OQNA 5TXGA 1KDTA 3LXRA 2YKGA 1G7CA 4AURA 3OIVA 4EIWA 4HLDA 2D7CA 4B48A 2V3CC 3KKNA 5JI3E 2FE4A 2WJIA 4GPTA 4O3MA 1EFRD 5KNBA 3DDCA 3GLHB 3OAAA 2JASA 3QVVA 1E2MA 1EX6A 3L43A 3WHLA 3U7FB 2O8CB 4GT1A 4M1KA 2J0SA 2OT3B 1RC8A 4B76A 4IEIA 4M1YA 4OI4A 2R6GA 3W3ZB 1K8RA 2VHCA 2RHDA 2GJ9A 1GKYA 4NMMA 4PZLA 4Q9HA 3EARA 2XTNA 4BFUA 4LBVA 2WAYA 2WJVA 3EPJA 3QVUA 2Q21A 3DKVA 4Q7JB 3U3OA 2WWWA 4KFSA 1GL9B 2I3BA 4D80A 2G1JA 3CIOA 3U6BA 2DYKA 2ZRGA 1KI9A 2BV3A 1DS6A 2I1QA 2PZFA 2D62A 4MDEA 2G77B 2YOHA 1FOEB 4XJXA 2AL7A 3C16C 4OHZA 4B3BA 3BAFA 5FOUA 3BK7A 4DLXA 2QM7A 3KKMA 2KBEA 3HYRA 4A4DA 4A82A 4FW9A 3THWA 2ODNA 4CT4B 1B0UA 3TNFA 5ELXA 3FFAA 2ZRCA 4C2UA 4BRWA 2HUPA 4Q03A 5DN6A 2W2VA 1AZSC 1M7GA 3AP2A 4BLTA 4DLTA 1XXHA 3CPJB 3LLUA 4TTRA 4FCWA 4OJKA 1ELOA 1YZNA 1CLUA 4CIDA 3K70C 5C46F 3QXJA 1II9A 3SI7A 1W5SA 5L8VA 5JCPA 4IDHA 1XCGB 2FF7A 4KJZA 2QE7D 4CEJA 1AQYA 3NKVA 3VX4A 2VIIA 1IN5A 2XEXA 4M1OA 4NONA 1U0HC 2RGDA 4E07A 4B33A 2X8AA 2F9LA 2PCJA 3A37A 2ZRHA 5ANRB 3GJ6A 1ZJ6A 4B32A 4RVCA 1XCPA 4PZYA 3N5CA 3BC1A 2B21A 1FQKA 1E99A 3K09C 1B23P 4MYTA 2OHFA 1N0UA 2Q9BA 2WVJA 4MUBA 1Z28A 2CBZA 2GAAA 4EQ6A 4HB2A 4C9BA 4AWXA 2CMKA 1CP2A 4POAA 3ICQB 3RWMB 2V1XA 1WF3A 4LJYA 4OHWA 5P21A 3IQXA 3CNNA 3V9PA 3IPXA 2GRJA 1XPRA 1OYYA 3P27A 1KO1A 3WP0A 5G53C 1H8HA 3LXXA 4MYHA 4E5UA 3C5HA 1G20E 4JLPA 3EZ7A 4JVNA 5AK0A 3IO5A 3BJIC 4GDFA 1YQTA 3K70D 1Z0JA 2JLVA 2FSGA 3RNLA 3GJ5A 3CF2A 2DFKB 2VSXA 1YU9A 3IO3A 4OJQA 1LF5A 3EZ2A 4LV6A 1OHHD 1XXHB 4G5QA 3T1OA 4AI6A 2KSQA 4CRWB 5DLQC 4OHYA 2NG1A 2XJ4A 4JLAA 3BERA 2IF2A 4Y0VA 4YXWD 3UPUA 3LA6A 5J4YA 2FWRA 4DDWA 2C9CA 4NCNA 3SJAA 4RJLA 1Z0DA 4BFWA 4CEJB 1E2QA 221PA 3B85A 4TYYA 3OIYA 1BMFA 4DHEA 1CR2A 3KB1A 1YRBA 3DPUA 3QG5A 1H8EA 3FHTA 1N0WA 4EQ6B 3E70C 5IK2D 4UNRA 3A4NA 3ZJYA 2IYZA 4Q9JA 2NGRA 5KSPA 3KKQA 2CCJA 4LPSA 2HV8A 3S1AA 3WMFA 4XWOA 1R6BX 3KUDA 2QMUA 5FBQB 3Q3JB 3E2IA 3QEJA 1JALA 2FH5B 3BFVA 2OLKA 3CRMA 3KQUA 5LD2B 5DSZA 2HF8A 4XWKA 1GITA 4DXAA 3UG7A 1UJ2A 1TUIA 5HE9A 1P5ZB 4DB2A 2BVNA 2WMNB 1OSNA 1X8KA 2BDTA 5L3SA 4GP7A 4BZXA 1Z0KA 2D06A 1E2NA 1W47A 1AQUA 3A58B 2IA5A 3B9QA 2ORIA 1T3LA 2YZ2A 5CIWA 3CNOA 5UKDA 3Q5EA 5IHPA 3GLIE 3AUXA 1DADA 1YZLA 2EQBA 4Q9KA 2V55B 2FPMA 1GILA 1J70A 2QTHA 2BEJA 4TMKA 1ZUIA 2QY9A 1SVLA 1PUIA 4KFTA 1T91A 1ZBDA 1MH1A 1NLYA 3GJXC 4WVFA 4MGZR 1HEIA 5H1YA 2NQ2C 2AFHE 3UMRA 721PA 4B2IA
chains in the Genus database with same CATH superfamily
3QFHA 5JDIA 3A3PA 4AUEA 1FDTA 2X3FA 4CKBB 4EA9A 4NEHB 3F49S 5AMXA 4D9HA 4DRXA 4DGSA 4I46A 2JD0A 1TO6A 3DNPA 5TJ9A 4EW6A 1RYHA 4DC0A 1FMFA 5BV8A 1BXRB 1RJEA 3NM6B 4WZZA 3T5DA 4CLEA 2NADA 1P3DA 1N6IA 4KIFA 4QHYA 1SVOA 1FDIA 3HPQA 3HCDA 3ZHRA 4QIHA 4CKEB 2RHGB 4KQMA 4NY1A 4TT8A 4DLRA 1ATIA 1HMYA 1SBYA 2ZVQX 1E5DA 3GRRA 1NFFA 5B55A 3HKBB 4CG1A 1IBKB 1KI6A 2HLDD 2Z0MA 2MMGA 5AI9A 2GT1A 4ZEOA 1P5FA 1CEEA 5LU8A 4JA0A 3OZSA 2RK6A 1EDEA 2BGJA 4FBMA 3CRRA 5IM4A 1EZZA 4GOJA 1WUIS 4KBGA 4DAEA 4I99A 2IYFA 1PEKE 1YR9A 1TJ3A 2H7CA 3B8EA 3LT4A 3NHFA 4JL6A 4RJIA 4BVKA 4F72A 1S2DA 3K9FC 4ARZB 4TQGA 1KOGA 3CNQS 3L8YA 2XYVA 2D5AA 2EWWA 2ATEA 3E05A 4IO1A 4K6MA 3KUCA 4AY2A 4MUYA 5BY2A 1VB3A 3JQRA 3I1IA 4C3OB 4E2WA 2B1IA 1FS5A 3B6JA 4OFXA 4N3CA 3TG8A 4I50B 4BVAA 2OFPA 2ICAA 3H9QA 1DCKA 1XC7A 3A70A 3RKSA 2Z5GA 3G68A 2JAQA 5CAEB 4BY9E 2GVNA 2Y1DA 4IILA 3CQ9A 2WAOA 2J5RA 4BOYA 3ZCRA 3OZBA 4HPWA 1XTBA 5D1NA 4B4OA 9MHTA 1ULUA 1E4EB 3AWIA 4NYIQ 1NZFA 2QZ9A 3UGQA 4DV7B 5ITZB 1H22A 2IU4A 1VGVA 1K7EB 4MWDA 2HCRA 5EQTA 5DNEA 3H7IA 3VR2D 1YA4A 2EFEB 1KFKB 4G24A 5HM8A 5DGHA 2FPIB 5F3WB 2AZXA 2A92A 3AGPA 1YDEA 5D7BA 1XRMA 1CUFA 3R0IA 1RI3A 3CRW1 5FWDA 4K88A 2YWRA 5HZKA 4WFIA 3NQ41 3BXZA 3RVLA 5CLHA 5BSTA 4CEIA 2C4MA 1FFXB 1LQ2A 2Y9MB 4UFOA 3E35A 3C6MA 3CLUC 5CLIA 5A4JA 4EPWA 1N78A 2EYQA 2J85A 4LDPA 4ERNA 5L4SA 1TGVA 4TMWA 1W46A 2W5UA 1TNDA 1G5RA 3STWA 1MHPA 1RAAA 4EX7A 1XRQA 4NENA 4QQRA 4NZZA 3ZI4A 1XZPA 5DX8A 1Y33E 3DL7A 2G5TA 3CM0A 1S96A 1XGKA 3SJZA 3OM0A 5AUQA 2R1ZA 3S29A 4OYYA 8ADHA 3L7JA 5DCUA 2XUAA 2JGMA 2OBBA 2EJUA 3EDQA 3OX3A 3QPWA 2GVZC 3O4RA 4JVLA 4XW2A 3VPDA 1T0IA 4IUDS 1ZI8A 4TSKA 4BTLA 3BL8A 2WF9A 3D02A 4YUXA 5DHPA 1NTRA 4LE2A 4OJTA 4MR7A 2AJTA 2A33A 2CD9A 5HKOA 1BFDA 2B83A 4J9VA 4YUVA 2BY4A 1GZDA 3C8ZA 1OGJA 2OD7A 1MJGM 1T9GR 1LDMA 4TZ6A 3KSMA 1TECE 4A0SA 2PVCA 2VPQA 3Q87B 4UTZA 4I08A 5H9VA 2PS0A 4GLJA 4XZ3A 5LIPA 3M8KA 5CX1A 1SXJA 3FOWA 4TLEA 4JBNA 1QHNA 1NVGA 5FTMA 1IZYA 2JCVA 2BKAA 4XFDA 1QCZA 4C14A 1YB2A 3HMQA 3CX4A 5EFZA 4CIYA 2O8VA 2OV3A 2YIDA 4GEKA 4IDEA 1NNUA 3KYBA 5E6RA 4LJRA 4UOEA 5IH3A 3OZWA 3VJKA 1DPFA 1BSVA 1W29A 4YMUA 1U04A 1ISMA 1TYZA 1E5QA 4GNKA 3LK7A 4OHBA 5KDLA 2DU8A 5FOTA 2EWMA 1RXCA 4GWKA 3UKJA 3FCSB 4MROA 4KCGA 1P4HA 1UMDB 2FSIA 2I7CA 2MSKA 2P2GA 3HDJA 4YRSA 2R47A 3V8MA 3LQRA 4FLFA 1OF1A 1RQ2A 2JBAA 3TZCA 4BFZA 4YY3B 3Q8KA 4QDOA 3IAS6 5A62A 1N2EA 1W49A 2C3MA 1V3TA 3O9VA 3S6JA 5IANA 1RP7A 3UJ7A 2ZDGA 1PZFA 2VDRB 4JV5B 4N39A 1H5UA 4K86A 4B87A 1G8JA 3PD0A 3WFIA 5K5EA 3J81A 1E6LA 3H3JA 3GPIA 3ITDA 4QJ5A 3MWLA 4PCVA 4FFBB 2H65A 2HSGA 3VO9A 3DOOA 2AG0A 3OPMA 2FRXA 4K0RA 4NPHA 3BWDD 1Z39A 5TGTA 1ULSA 3G1UA 2A0XA 1H05A 3K1AB 3OJEA 5EZ6B 5A7GA 5T3UA 3A9CA 2PAFA 3T5BA 3FGOA 3M5DA 3OU2A 4F3CA 1PS0A 3FFBA 5AK3A 2DPLA 3B3QA 3OJCA 4GI7A 1IATA 1RCTE 3C3WA 1K7CA 3WRWA 1Q7EA 3OE5A 1EGVB 2Q1SA 3L8CA 2MINB 2WNSA 3E8MA 2JGRA 3TXXA 1E89A 1EP2B 1JSXA 1ZA2A 2GM5A 1E1YA 3COYA 2BGUA 1L1QA 4GKVA 4IMRA 4X7MA 5TR9A 1JMVA 1RE1A 4F92B 1E9CA 2ZJ4A 4B3GA 3C5VA 4L5AA 1DL5A 2QX8A 3M6IA 1FYWA 2Z9DA 3Q9LA 4S1PA 4MULA 5AKZA 2OXRA 1GGEA 1I3NA 2C2KA 1UC8A 2B78A 2GWHA 3B5JA 3DZIA 2LKDA 5CRIA 4CLRA 3IDFA 4FB5A 2OENG 4NARA 1W4BA 1XA4A 1X7WB 2WSMA 1NW5A 4IIEA 5CDFE 1NR5A 1DKLA 1VCNA 4LN1A 4BFVA 4YHBA 1YQUA 2GPBA 1MO6A 5B1HA 2X3UA 2FZCA 2NNLD 1E0AA 4EPYA 5IKMA 3EPLA 4RTPA 1Z8FA 3A32A 3BJZA 4LOKA 5GQSA 5ICMA 1IG3A 1I6KA 2QHXA 1HWYA 2QD2A 5CX4A 1P31A 5F2KA 4UCQA 1DVRA 4PZZA 2X0DA 4AZ0B 3DB2A 2V65A 4NECA 4QDKA 1WVGA 3EH1A 2FPOA 2VCEA 3JQAD 4WWHA 5DW0A 3ZG6A 1JNXX 1LS1A 1VMDA 2WINI 4NH0A 1XMVA 2ACEA 2BI4A 3MYYA 4E21A 5IUKC 4D02A 2VP3A 4K6CA 2RHOA 2RK3A 2IYYA 3B1XA 4UEWA 1EFRA 5FUYA 1CNEA 3OCWA 4O4IB 5E95A 1YRQA 4D7AA 4U5XA 3JQFC 5H8WA 3A1NA 2JGNA 3OEHD 5EEHA 3NDBB 1VRVA 5KVSA 3P4XA 4F84A 1NW6A 4FCVA 4UHCA 4EFMA 2DJ5A 2ZWIA 4A15A 1EK0A 2JI7A 1ZGGA 1A8QA 5ALDA 4YV1A 1LVGA 2PSJA 4H0CA 5H0IA 3PUKA 3BH0A 4Z49A 2V97A 1V11B 1EPUA 2RHHA 5SZHB 4DBZA 1GLNA 1XLTA 5DVZA 4F46A 5ALIA 1P8JA 2CC2A 3HHPA 1XO1A 2AX4A 1EB9A 3AR8A 3QVOA 1P81A 2P3QA 4HDCA 1PR1A 1C9DB 1KH1A 2G3YA 5IJXA 4CR7A 1QV7A 4BNWA 3ECAA 2YYAA 3V1TC 1EYZA 3VVMA 4GMKA 5JSKA 4GPIB 2OV1A 1U2GC 2ZSHA 3TLMA 5FTNA 4QXQA 3ZDRA 4M9XA 4EBBA 1UANA 3VNAA 4J16C 4YCNA 3P4YA 2Z2ZA 2AJBA 2BUAA 1IDN1 3NEJA 2J5XA 2EJWA 3WL3A 4KQCA 1V8PA 3TUZC 5K8CA 4V03A 2ZSIA 3JWPA 4EF4A 1NOJA 1AQNA 1EEXB 3HNOA 3TRKA 1AN0A 2B4KA 3FGPA 1QQ6A 2NUAA 4L95C 3ENNA 3TKLA 4PGMA 4EGFA 4WESA 3URKA 2BKVA 3IERA 1QIHA 4FMBB 3TEFA 2UZ4A 4UTVA 4Z0HO 5DP1A 1PT7A 5U9CA 3V8BA 4NV3A 5IJ0A 2WVAA 4JDUA 4NAHA 5AKGA 3BIXA 3SMQA 1G16A 3N2NA 4Q1BA 2AKEA 3M4NA 1RZUA 3PJEA 3IKJA 4WZBA 4YUWA 4ERXA 4GAEA 4L8GA 4RU1A 1NVVR 3FUXA 2BLLA 4TV9A 4D0SA 3ETGA 4XJTA 2YUTA 3RVOA 2ZJBA 1WCXA 3JCZA 1P4GA 1QJ4A 1YOVB 2ENUA 1B42A 3RJ5A 5I3ZA 3SIPA 2VDLB 4OK3A 4P80A 2JIMA 1Q21A 3GD5A 3TWOA 1N6NA 1R6TA 1HDEA 1A9OA 2ZUUA 4F5DA 1FXWA 4DCSA 4L78A 1HC7A 2F4NA 1RBYA 2O0KA 4TL9A 2QPLA 3OZIA 1KY2A 4C4PA 4CIBA 3W04A 4DV1B 4WE3A 4EMSA 5KZMB 4ALMA 2H1WA 5IAKA 4J0KA 3TL6A 1BGVA 2PBFA 2WAAA 1ECLA 1OE0A 1QWSA 1OH5A 4HOYA 1XFDA 2ZI7A 1I4OA 3LE8A 2YRXA 5KKAA 4B9AA 4EF6A 3PC4A 4B1FA 1VG0B 2OCDA 4XVQA 2J48A 4ZVRA 1P7CA 1G2QA 1P77A 3AHDA 4LGVA 521PA 3TLCA 4AC9A 4KKXB 1N4DA 1YB1A 3CZAA 3K7EA 1FNDA 3NUQA 3U26A 3IQDB 4PLCA 4L28A 1I0IA 3NWPA 2YZGA 3LT2A 4JQSA 5F4ZA 1DAOA 2F9MA 2GHRA 4BCCA 5CBKA 2XJ9A 3O73A 3LX4A 5D5QA 3GXBA 3L0PA 5A1TA 2CT8A 3BDAA 1UPFA 1N7JA 1A77A 5ADHA 1QM5A 3LP8A 4ZYWA 3KTOA 3EGEA 4WKPA 3P9RA 4X95A 1J5EB 4A36A 3H5TA 1HDGO 1A2QA 1Q3KA 2BMWA 2WSSD 4AY3A 4IDBA 3HO1A 3DTVA 1ZIPA 4FYYA 4G5FA 2B5OA 5LA6A 1M8FA 3A28A 3DJFA 1YQWA 4Q48A 1D07A 4ZAVA 2FWMX 3T1TA 2WT9A 1W34A 1WW2A 4HRXA 1QH9A 1T2DA 3R7LA 5KYUB 5LQMA 2PXAA 3WIDA 1Z2CA 2PV0A 1LVUA 4F6RB 3UXMA 4PZDA 5HIKA 2VBGA 4OFZA 3JZIA 3DMYA 4R51A 4YJKA 1CSEE 3PC7A 1XTPA 3JTMA 1K5HA 1XX6A 1BX0A 3PDIB 4Q1VA 4G1FA 3SVZA 1X3LA 3W78A 1RI2A 2P4QA 3BA1A 4IGKA 4Q4AA 1RPTA 1CRQA 1CUZA 1Z5WA 2JD1A 4QRDA 4DY6A 3FSEA 3K9WA 5B12A 4OJYA 3T9DA 1C1YA 4KPGA 1FS4A 1UOPA 1XTJA 2AFHA 2C7GA 1TTQB 2E4WA 3Q7RA 2EP5A 3JQ9C 3R0JA 4IWXA 5DI3A 2VWQA 4KXMA 2GR9A 2JJMA 1GFIA 4W5QA 4IGAA 1UBTS 1W25A 3UT5A 2IH5A 4HWRA 5B3JA 3D7LA 1FMCA 5FYQA 4E94A 2V3VA 4UULA 4MS1A 1J23A 1G60A 1V6SA 1DAGA 3OE1A 4HLUA 2WJAA 2BHLA 2BELA 1U9IA 2WKSA 2C57A 5LC1A 1ZMOA 4QSHA 2GJ4A 5T41A 1N1MA 5I7WA 2WT8A 2Y05A 1O95D 4U3JA 5ALPA 1HDIA 4PLYA 1VSVA 2AKAB 4LC9A 5E2BA 4DZRA 5B4VA 4JYCA 4TN5A 3EIHA 1KAGA 3H0CA 4TS9A 4QXMA 4GR5A 1CERA 3H3FA 5A0TA 5JAZA 3TSAA 1I2MA 4O1MA 3U4GA 3ROGA 4US0R 1X7GA 3JAKA 1KSJA 5A4MS 2XMZA 3DEJA 1YFZA 4EKGA 1OH7A 4Y6QA 5C32A 4CLHA 3GUHA 4B4VA 5JXHA 1KHHA 5EZYA 3T9EA 3VSEA 2MYPA 5A5DA 1U1DA 3ILXA 2FPPB 1USGA 4DE5A 4NCAA 1HQKA 3AI2A 4OXIA 3I9V1 1JR2A 4JSTA 4C4ZA 3B9RA 1V43A 5CXQA 1WXFA 2H8KA 3WYDA 1WMDA 3W5SA 3WL7A 3FCAA 3TIFA 3IV6A 1AKNA 2VP0A 2VK4A 3PFIA 5LZ8A 3ZHOA 4LAFA 3IPRA 1T3GA 3U7EB 4PINA 4YDHB 3TQTA 4TRNA 1LLUA 2H3HA 4BJ1A 3S2ZA 5KBYA 4MV6A 4DV2B 2PMCA 1EWQA 4NMWA 4TTSA 3K1YA 1UBCA 1N5RA 3UHAA 5JH7F 3QKIA 1MOQA 3DSRA 1P80A 1S7CA 4LCEA 4LYEA 4RH0A 4FDVA 5EWMB 4DQVA 1GQ2A 2A9KA 4RX1A 1WAMA 2B8WA 2IYTA 3OPYA 1N36B 1FLAA 2I1WA 2V6GA 2JJ2A 1RJGA 5DWVA 2Q3BA 2VWHA 2BGTA 2AOWA 3A4TA 3HU3A 5D87A 3T54A 4A73A 4DC9A 3QW2A 3B6ZA 3MCVA 1L1EA 4L3WA 4DYDA 5HQTA 4QELA 1NRXA 3EMDA 4PM4A 2I62A 1QBGA 2QX4A 4O2LA 4TYQA 1CDDA 2E9SA 2QLJA 1EXNA 1XD8A 3DBLA 4HEHA 3DCJA 3RJ9A 3KWLA 1LVHA 2EXXA 5EJGA 4EJSB 3MOSA 2B98A 1A9YA 2AD1A 5AM5A 1V5WA 2PL9A 1OXBB 3URMA 3ANLA 4RZ2A 5MGBA 5I6DA 1TJYA 2I6XA 3NNSA 3NAMA 5CT6A 2OSVA 4CM7A 2XWQA 3ZHBA 4EYGA 1YZ3A 4H15A 1YZHA 4I1VA 1I6LA 2IHKA 3VC7A 1UXOA 1M2GA 1R5NA 3B1ZA 5TV2A 2FDCA 2PZLA 4JGIA 5DHSA 4FD2A 3TTWA 1FRZA 4Q1EA 4QU0A 4YRZA 1ZKMA 3LTEA 4EMTA 3LH5A 3OZGA 4XR4A 2GTPA 2QTFA 3BK1A 3RU7A 1KMHA 4EJ2A 2JFHA 4U1RA 3QPAA 3T7SA 1JNYA 1NT2A 3HTXA 2NUTB 1C2YA 4HDNA 4CN8A 1FDOA 3OQMA 1ID8A 2X41A 4OIMA 2AD5A 1L8QA 3F6SA 4Q1DA 1E2BA 4OCZA 3M6VA 2O0HA 4K6FA 3KJFA 2WYVA 4GPBA 3FA2A 4UE3S 1SOVA 3NTOA 3OF2A 2C4HA 1UBUS 2R85A 4MYDA 1KP2A 2GETA 4P5EA 3I32A 1XVUA 1UFQA 3NPMA 3P9QA 4G81A 4MIKA 4OREX 2IDMA 4Q1CA 3QEKA 1A2BA 1RPJA 1UF9A 2QN8A 4H60A 4MARA 4ZCRA 1T9ZA 2N47A 1ISIA 4JT8A 3PYXA 1RHUA 1OXXK 3NONA 4ZD6A 1ESZA 3FDXA 2BGKA 1J1UA 1OBHA 4DNFA 2J9YB 3IAM1 1GNRA 3DBHA 2WKQA 3AINA 5TNXA 3RVMA 4AECA 4FZRA 4DMGA 2YJ4A 3KZ1E 1UK8A 3LRTA 1TT5A 5GVRA 4RULA 1P29A 4DANA 5BR1A 4Q00A 3SG0A 2Z4RA 2WFMA 4XM2A 5BN4B 5BSHA 3S5JA 5KTTA 5HKBA 5ULLA 1O4WA 4K8RB 2WP8J 3SFZA 4DA0A 4KNYA 1G4AE 4XPZA 4AKGA 5G41A 5AVSA 1Y1LA 2PR7A 2XMQA 4I6JA 4BNZA 2IS2A 3IAHA 4KAXA 4GYYA 1CZHA 3W8RA 2VLIA 2P1RA 1L5LA 5KB3A 3FHLA 6ABPA 3GLTA 1K5DA 1FVHA 5B3AA 1H2ZA 3A6LA 1D4ZA 2NSYA 3I9OA 5A71A 3ZWAA 5IJ9B 2XZOA 1NBEA 3ENQA 3ILVA 4HZUA 3K6SA 4ZTUB 3PDHA 1QTQA 5K0BA 1LTQA 3KOXA 5KTPA 4EZBA 4YMTA 1EAYA 4D74A 1BRTA 5BNIA 1JEQA 5F1YA 3AHCA 2X4LA 5DZSA 1Y6RA 2IUFA 1NVMB 5CIYA 4F9EA 3E7PA 5HUJA 1P9NA 3QF7A 2EOAA 2O2EA 1OTHA 4DCVA 2GF2A 4Q6WA 3WJ2A 3PP8A 4IOJA 3LQQA 1RVV1 3INGA 2X23A 2XWJI 3MRTA 4PAGA 1AKVA 1ZIOA 4MW2A 2FSVC 3DOCA 2VT2A 3OLXA 2WHRA 1PSDA 3FNGA 1OREA 1X1TA 3O4IA 3HUTA 1KSHA 3E15A 4DTIA 5DCWA 1EVQA 4HS4A 5EXTA 1RWBA 2DBYA 2DHQA 3QUTA 5IBQA 5DLPA 1ZI9A 5IAEA 4PHHA 5U1PA 3EBOA 4CPDA 2KX7A 1AO3A 4CUKA 3EEQA 1E0KA 2WP0A 3C97A 2ZTSA 1IUNA 1HYGA 4JP1A 1IUOA 2Q1XA 4C0AC 4LZAA 1P72A 4KSYA 3C70A 4A8JB 4HH0A 5ALGA 1JEOA 2RH8A 2WI8A 3ZJTA 3SXJA 2LE0A 4E6EA 4F1WA 3THXA 3JW8A 1JR6A 1IOZA 1K5GA 2YOFA 3JVIA 2QN7A 1PGPA 1KOFA 4C7BA 1NNEA 4L4ZA 3T3EA 1ONOA 4O3FA 4RD1A 4L9RA 3GBSA 5K0CA 3AF5A 3M9LA 4KQ2A 3AK4A 3V80A 4OMDA 4MPPA 3LT1A 2WVHA 3OKPA 2RGNA 1ECCA 3CRVA 1B1CA 3EEFA 1BA3A 1H1TA 4QXOA 3KM0A 2PIAA 3A6FA 5JEEA 2CJPA 3U4MA 4BB9A 4PO3X 3BG5A 4Z7OB 3SHQA 1QYXA 4ETIA 1JLLA 3PI6A 1U0SY 3EXAA 4F5YA 2HA3A 1CIPA 5COQA 3F71A 4JJZA 2WWYA 4FOPA 4HUTA 3SS9X 4Q1FA 1MW9X 1H85A 3LP5A 3M6LA 3TEMA 3VPXA 4LMAA 5FHRA 4FCTA 2OZKA 3GDWA 4HPXB 2PS1A 1CNFA 1Z0SA 3JYHA 4X8HA 1E1LA 2HU5A 3QVXA 1C1HA 1SWWA 2Y2UA 2R84A 3VPSA 3GDHA 5HTKA 4BWYA 4WBNF 4OKIA 4JEUA 1AKWA 1M8PA 3HEAA 2R60A 3UHPA 2G0TA 3HCCA 1WBDA 1NUQA 2PUJA 2HRCA 1XRJA 2EKQA 1EWKA 1V45E 2QRGA 1FLVA 4Z5XA 4CKCB 5KNDA 3QJGA 4EA6A 5LVAA 1CUGA 5EHXA 2FUEA 1V8OA 3OF3A 1MJ5A 4L4SA 5FOSA 4KE7A 3JQAA 1XZIA 2JLSA 4NYJR 2FZEA 2GYUA 3RUPA 1XLVA 2NU7B 2IZ7A 3UGTA 1BHSA 3EFOB 2WTNA 1R0RE 2DCMA 2QV7A 4Z9YA 4AN1A 4WNYA 4GMXA 5HKAA 3T1NA 2W37A 1GFWA 1YUMA 4F5EA 5JAUA 4DR6B 4G01B 3JWGA 4TTJA 3I5MA 1U6IA 1XNGA 1RRPA 1XF9A 2FPUA 3OEHA 3QV2A 1ML4A 4GXRA 4AP9A 4TL8A 2HB6A 4J4TA 3GFOA 1T6NA 3OD5A 2ZYGA 4GYKA 1Y3BE 1OPXA 5C35A 5L6LB 1HDYA 2EC5A 1ZD2P 2KM1A 2QVZX 2BONA 3BEDA 5AVJA 5BORA 1J8DA 1SUCA 4CMGA 1LLFA 2B3DA 1W52X 4O33A 5BQFA 3AIOA 2PXXA 3TQHA 1QDLB 2WYWA 1Q0QA 1G6HA 1SO8A 1U0JA 2B1JA 2VCHA 2ATIA 3JQEA 5LYJB 1KJZA 3ICWA 2IYWA 3TR0A 1NP6A 3NUGA 5CW2A 4QXPA 1T5DX 4QDZA 3ZWBA 4Q3BA 3SC2B 1I0LA 3DM9B 3ACDA 3H1GA 1V7ZA 2VVTA 4EI8A 2O5RA 4JODA 2ORVA 3KLNA 1S4QA 2J9XB 1KY5A 2ZUWA 3KUXA 3COVA 4MVCA 3TQQA 4UHJA 5KNBD 2HYIC 6CHYA 4A7PA 5ALZA 3F6PA 2W93A 1AXEA 2AOUA 2FFRA 2QRJA 1TF5A 2WUDA 3ZLTA 3V4RA 3LYUA 3DKRA 1JU3A 1AU9A 1I3CA 3H13A 3I1YA 1R4NB 4IIBA 3B3FA 3UJ3X 3X44A 4PYNA 1VG1A 4X1IA 1M33A 2IOQA 2FAXA 4XUDA 4QOJA 4N0MA 4Y9TA 2W90A 2JLQA 1W2HA 2GERA 4KFRA 1MG5A 4Y1FA 2GLXA 2BZSA 2JFWA 1HH4A 1D5WA 2WUFA 3A1UA 5D3MA 1TAHA 3WWZA 1ADCA 4CKWB 1YFLA 3ZZTA 3EGDA 2QS9A 3AIMA 4M8LA 1E3EA 3V3TA 5A5EA 1LGYA 1XAJA 3FWHA 4J0JA 1Z18A 5DM4A 2OC9A 1CS0B 4PRKA 2FDRA 1IU9A 4YMVA 4A0RA 2WF8A 3CINA 1X15A 3G2IA 4HNHA 5LZ7A 1JZSA 2BGGA 5H3LA 2P0AA 1WCWA 3IVXA 4UM9D 2XMDA 1VYTA 4TV8F 2W6OA 4C6TA 1EBUA 1PJCA 2BKEA 3EZGA 4DLKA 4ER6A 5M2QA 2QD3A 2H4ZA 2O6HA 1JTFA 4MDHA 3QXGA 4IIHA 1IY0A 1I9CA 4U9IS 5CURA 1KDVA 2RI1A 4HQFA 3NI2A 3SVTA 3MF4A 3ZIDA 1EINA 1TD1A 3DGFC 3BBLA 2MIIA 3Q10A 4I8DA 1S8NA 2C4NA 4FN5A 1YNSA 1XKXA 1Y4AE 1U3UA 1ECBA 1QIEA 4ISCA 2OO5C 4GPEA 1OILA 2IP1A 2VPPA 1ZBQA 2BD0A 4CG2A 3W4IA 1AZWA 4CR6A 4WJLA 4O1IA 5CJJA 2X22A 5KOJA 1QWOA 1RT9A 1ZEJA 1VCOA 3FHOA 2P9QA 3M81A 1IH8A 1NMXA 1WO8A 1X1QA 2B6NA 2HGZA 2RGXA 3FHCB 3L7KA 2HMAA 1KDZA 4V0QA 3EGWA 1XNJA 4K40A 1B4DA 4B74A 5KVCA 1UXKA 1YS4A 2GVDC 3B8HA 3D3WB 2ZWOA 5I8ZA 4HPJB 4D46A 1SVIA 2JAPA 1R0ZA 4KNVA 5IEJA 3QOYA 3ZJUA 4TN1A 3FR8A 4YASA 2RAPA 4X1KA 1OX4B 1TM2A 2ZI4A 4YRRA 5DW3A 2RI0A 4YROA 3J80A 4YJFA 2WF5A 1N8TA 1HTBA 4WY2A 3SHWA 2ES4A 2PY6A 3DVAA 3TBFA 3Q7PA 3VVBA 3QM1A 5HDQA 3TZBA 1Z38A 2GN1A 4S05A 1YZTA 2XTZA 3ZJ5A 4II2A 3HXLA 3I5YA 2X8BA 5HF5A 3DLBA 3E7WA 4JEMA 2PZAA 3D4PA 3MB8A 2ZQ5A 3WLEA 4NFLA 5GZ6A 1KP3A 2P62A 4KLAA 3GI1A 5JQGF 3L6UA 1TYDE 3GRCA 3P2JA 2HEIA 4W6QA 4ZXFA 2Q4DA 4FR2A 4HGZA 1H4VB 3PUWA 3W9BA 4RTLA 3K1JA 3IPCA 3D3QA 1FVOA 8OHMA 1O96B 2WWXA 4FZJA 2UZ1A 8ABPA 3NHRA 4ZOLF 2R00A 1EUZA 3D8TA 4K9LA 2JEYA 4RD6A 1FFYA 1UJMA 3K53A 1CVIA 4CHGA 1XHFA 3KKLA 2PGIA 1QH1B 3KTAB 5FTJA 4L4UA 2EW1A 3WQHA 4HNQA 4TM8A 3I3SR 5IN5A 1TAGA 2SCUB 2FMIA 7MHTA 4OFWA 1F7VA 4MGHA 3D6VA 2C7PA 4ZI5A 1KAQA 3R77A 1RS0A 2VJBA 3QKWA 4B3SB 1B6RA 1O94C 1RFLA 2NAPA 3GWGA 3MINA 4FLMA 3LX8A 4YCDA 5JZVA 3JQQA 4TOIA 4MYCA 4X94A 3WNZA 4CM9D 4S12A 1ZGJA 1P73A 2JPDA 1U0NA 4ZODA 5DKFA 4BKRA 3UA3A 3NO4A 3KBBA 3KCNA 4CMEC 3UY4A 1FRVA 1RQRA 2EHDA 4E2YA 2GPAA 1L7VC 2O50A 4YI3A 1EESA 4GI5A 1XZAA 1YQ9A 2B30A 1HYEA 3PCRB 3LSYA 4G3XA 3UZUA 5E4FA 3AVTA 4Z0TA 5EIOA 3M9WA 3TD9A 4KMRA 1J9EA 4TLLB 1FCJA 3RIMA 1D03A 5F7JA 2Y27A 4Y1EA 3T7KA 4IDGA 4KQ9A 3WMRA 1XTSA 2YCLA 4ZAXA 3P9YA 1OLXB 2CVPA 2YTZA 1AKTA 3G2KA 3MUFA 3DFIA 2H85A 4Y6PA 3PVSA 4FM9A 1YV9A 1RAGA 1ZUWA 4IZ6A 5C8ZA 4KP7A 3RTEA 1VL0A 3HN2A 1LPSA 2C9BA 5H59A 1DAFA 1JJ7A 1W76A 2X86A 4M1ZA 4V0RA 4CG0A 3M6FA 1IRIA 5DMHA 2R5WA 2VA9A 4OI1A 4UKDA 5AKJA 1DJQA 4A1FA 2DTXA 3F5FA 1YA8A 3E3LA 3WLPA 4NV0A 3NBZC 4LY9A 3ZWOA 3CWCA 4PAMA 4FOSA 3WFZA 3C5EA 4RORA 2ZT5A 4XB2A 2XA1A 4E14A 3CH4B 4GKBA 4UBKA 4P34A 1J42A 1TU4A 1NAHA 1QHHB 2ORWA 1NDQA 4XIFA 1T2UA 5DHUA 5AM1A 2R8YA 3GWZA 2O2XA 1LNZA 5FV4A 1YVEI 1WP4A 2R62A 3A3YA 4Q82A 4B3XA 4CV3A 4WXMA 3HY3A 4FN4A 2AW5A 1HKUA 1ECFA 1ZP6A 3A27A 4UNNA 4OBEA 5EWLB 3JQ7A 4CUJA 4HQ0A 3LG2A 4O0LA 5EKUA 3VNQA 1NY6A 4G4IA 4L57A 5ESRA 1E3SA 2GAOA 3ZH9B 3P20A 5D8DA 1F0PA 4LX0A 1KHTA 1N2BA 1P9RA 3GEHA 1ZD9A 3KUUA 4FUQA 1VIMA 1ZD3A 3C85A 4C5BA 3TI9A 2PKXA 1U63A 1MB9A 4Z3DA 1MC5A 1YT5A 2ZS8A 4IRMA 4GXNA 5KAMA 1QG0A 2D2IA 2BMJA 2FEPA 3IKTA 1CBUA 2XF2A 3MGAA 1SELA 1PFUA 1TW3A 4FR0A 4B45A 4TKVA 1I1NA 4EB3A 2I34A 3D6MA 1XMIA 4JENA 2A9FA 4PU0A 2FZ4A 3RUEA 4RGQA 3OLQA 4ZRNA 4N0DA 2R1VA 1JAXA 2QYHA 4G1MB 4TWRA 3MEQA 4YI5A 4GMHA 5HCNA 5JNWA 3I5UA 3NTUA 4IZIA 1BVRA 1PFQA 3HDHA 3LJKA 2ZJ7A 2FWBA 1PUJA 4TXLA 5FJJA 1WV1A 1DWUA 5F7XA 4QPJC 4ISBA 1JXOA 1JJAA 3NC0C 4MR9B 3V4PB 1KQPA 3I5XA 4U00A 1EHIA 2QUJA 3GEMA 4PZ9A 4QWMA 1FDWA 4XGRA 2GBIA 3S5UA 1MGPA 1AUQA 2V98A 2XUGA 3GFSA 3AETB 2BM0A 2A94A 3KR9A 3OWOA 5FXMA 3EA0A 4O2AA 4CODB 1XMOB 4G67A 1M5RA 2FUCA 1K2WA 1SUDA 3FUCA 4WTOA 3BD7A 1SHZA 2OCPA 5HF9A 5BW4A 3K1TA 4NZPA 1Z0UA 4IAOA 4M1EA 2ZIXB 4LJ5A 4NCHA 1XZCA 2WIFA 3QNMA 5CEFA 3N87A 1L5YA 3NHJA 3QFRA 4XPIA 4KDRA 4I50F 3JD1A 2E89A 4TWAA 4P31A 2I2BA 1G7RA 4FP9A 3S1LA 5A04A 4MRNA 4JJKA 1A5ZA 4QO7A 2XDYA 2W9XA 2NO7A 1VI2A 1I14A 2UVQA 1T5SA 2O8FB 1Z82A 3DDHA 4KPUA 3JD3A 1OVMA 6REQB 3W5HA 5IABA 3JRXA 1S3SA 1IHPA 2VDJA 3R40A 1Q0ZA 1TIKA 4RVNA 3JAMA 3T9CA 4NBRA 1G20B 1XSEA 5L7WA 3D8HA 4E33A 4Y1GA 3PWKA 1NM5A 1Y1SA 2NU8B 1MAWA 5T8KA 1V8ZA 2N1MA 1F12A 5TARA 4FR5A 2O3SA 2HK7A 4HTAA 1W4AA 2FN4A 2XD9A 3AHFA 1MB2A 4I55B 1X7YB 4D45A 4RK1A 5BQOA 2GBFA 2HU7A 3GV0A 3HBMA 4JFAA 4LHVA 3OM1A 5DX1A 1HYQA 1OLSB 3VU8A 1MT0A 2DGDA 3R0XA 3DT8A 1PR4A 3S4YA 2PLAA 1CXZA 4NJMB 4Q18A 4CQLA 1MR3F 3PGA1 2FB9A 5BO5A 1WHSA 3GA0A 4A03A 5ILQA 2Z8ZA 1I3MA 1W30A 5EMKA 3U7JA 3T12A 2IGTA 1UM9B 3PRYA 3GLIA 3VNUA 1FJ2A 4I1RA 1CYEA 3P5SA 4C07A 2WWHA 5ER9A 2VH5R 2I3DA 2WQ6A 1O0BA 5DRTA 3VZDA 1JZTA 1GTL1 1T2EA 3MAGA 1T5BA 4HX2A 4F9TA 4N18A 4ZAYA 1Z3IX 5K2OA 5AJZA 4H17A 4BQIA 3OLYA 3SZRA 3NJ4A 4LBYA 3CKKA 3UN1A 4MK4A 2VTEA 5ICEA 1N6RA 1EWTA 3JALB 4ZEXA 2VP4A 4D81A 1R5BA 4K46A 3VR1A 1V1JA 3QTBA 4M37A 4XGQA 1NI3A 5GJCA 5T5QA 4H7HA 5JATA 4XDHA 5AW4A 4GG1A 4LY6A 3L8MA 4LEIA 2PJUA 3RV4A 3N5KA 3EA4A 3PUIA 3KJEA 2PGJA 1PFWA 2X14A 2XUHA 3EAQA 2EZUA 1YJAA 2BEVA 1URPA 4JP5A 5AOAA 3IIJA 4N3NA 1J99A 1KFEB 2I4TA 2HSWA 4GZLA 3REQB 2H1SA 3RYCB 2IZZA 2VNHA 1M66A 3HYNA 5FFMA 1XBTA 1F3LA 4U2EA 3O8QB 3UWMA 4YCBA 5KKCA 1IDOA 4DBLE 1XQYA 1Q7RA 1V26A 3ED5A 1SY7A 5B7NA 4M8SA 4V39A 2OMKA 1J49A 3L7MA 1Z8NA 3DV0A 5LFAA 2REXB 3BMQB 2L19A 2RHBA 1L5WA 1DRJA 3GJ3A 3CSUA 3AHIA 3GA7A 3H84A 5LP6C 3DEKA 1T2CA 3E9EA 1YDFA 3L77A 4HDSB 4KRYA 4TROA 4YP1A 4ND2A 2CXSA 2J6IA 1RKQA 2R8EA 2VJCA 3WGKA 2VTVA 2BMVA 1A8SA 1NQVA 1FYXA 2PA0A 2VDPB 3ABRB 1NQTA 4H6XA 3B20A 4MKRA 1OZAA 4C7OB 4JH0A 1NMYA 3CKLA 4B3TB 1FC0A 1F51E 1I10A 2BDEA 2D3WA 2P2DA 2WT4A 2IOFA 3V2GA 4MGYR 1TM7E 2HJGA 1ZCFA 3EPKA 2WU0A 3T3OA 4YNBA 3WAGA 4LNAA 1R4MA 5LSAA 1SWVA 5GADl 1X7DA 3IBFA 1ZK2A 1Z4KA 1VYHA 1YL6A 3B89A 3A1DA 4IJUA 2ZBFA 3CW2A 3TBHA 3SQNA 4RESA 1OI4A 3FNRA 4HGRA 2HY7A 3V4SA 1Q0LA 2MMCA 4CFYA 2QSYA 5DBOA 3RFXA 3EHEA 1P1FA 4HQOA 3A9WA 4ITRC 1WOYA 3WWDA 1J2YA 2UYHA 2WQZA 4ZRMA 3E27A 3BM5A 4BVLA 1YULA 4O6VA 2ZCVA 4H6WA 3QY9A 4XVHA 5LA6B 5HSGA 3A6PC 2I66A 4UUQA 2I1VB 5F35A 1U7WA 2GPJA 3RARA 2FQXA 4V2IA 1IK6A 1FTNA 3U16A 3MQ2A 2PL5A 3FFXA 1V71A 2FW7A 4UPEA 4R9VA 2X8JB 3WGUA 1VE7A 1F8YA 2G9RA 1L4NA 4M9RA 1Z62A 2BE9A 4L75A 4FT4A 4IEEA 1MPXA 1BWRA 2EZ8A 4ZYZA 1XOIA 4C6SA 3OECA 1GTJ1 3KOMA 4ZDIA 2WHPA 3SYTA 3A6KA 1ST2A 4M8KA 4E12A 4K1LA 5HW0A 1EM6A 4DL9A 3IQZA 4AZ3A 1TRKA 3AL0C 4R71A 1BWQA 2UUCB 1JIQA 1XP5A 2WD8A 3TMKA 5DTJA 5GZ3A 1L4LA 2QT0A 3BKWA 4F8EA 3CLKA 3TFOA 1ZD5A 5CD1A 1CZNA 4MQUA 3FWNA 2R25B 4D9EA 4RJKA 1LY1A 3M7IA 4Y2QA 3KJIA 3SHOA 3HCFA 4O4IF 4J0GA 1PJ8A 2DAPA 1AUPA 2PGLA 1SK8A 4JMLA 1TIBA