4MGYR

Selective activation of epac1 and epac2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
total genus 47
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgyR00
4KI0A 3K0FA 2YYZA 4TMVA 1EFRD 1HE1C 1LS6A 2RGAA 3A1WA 3CH5A 1KAOA 4H1UA 2NO9A 4MKHA 5JECA 2GBLC 1YE8A 1JNYA 2ZI9A 2Q0HA 2DFNA 2AKYA 1CJKC 4TL7A 4Q7KA 1JJ7A 1WDTA 2ZREA 2JDID 2VHQA 4C0HA 3DKPA 5BXQC 4G5SA 2ATXA 1E2EA 1T5LA 3EZ9A 1I2DA 3LW8A 4CYMA 1VHLA 5HE9A 5JRZA 1E1RD 3FMIA 2C9CA 2FNAA 4DCSA 1GZSA 3B5JA 3G82C 1TQ2A 2RCNA 2SHKA 3W5JA 1P7CA 5JS7A 1NI3A 1I4DD 1Z28A 1KK3A 3LH5A 4MGKR 1P9NA 4MRSA 1J90A 4MRVA 4XD7D 4KFUA 2EYQA 4MUAA 2P6NA 1NF3A 1ZCAA 5B30A 4DRZA 4M53A 1ZM4A 3BAFA 1QHNA 4URUR 1X1SA 4HUQA 4JL5A 4JSYA 1TADA 2FZLA 4KFRA 3NEYA 2GILA 2G77B 3LBNA 4YQFA 3O8RA 3EWSA 5EE0A 3T61A 621PA 3B9QA 4TT3D 3J81k 3Q72A 1SKYB 4TQ9A 2IYXA 2PMKA 1EX6A 3CRW1 3QXJA 4ZIRB 3U2QA 1SGWA 3QVVA 3IEUA 1GRQA 1D5CA 4RSGA 1TF7A 1TUIA 1E0JA 2B8WA 3QKSB 1W4BA 3QEOA 2BMJA 4GFDA 4N0EA 1N5IA 2D74A 2BBTA 2BCGY 1ZP6A 3DZ8A 5JSZB 3RYTC 2V55B 4EPYA 3DMDA 3V4RA 2V1UA 3K0CC 1DEKA 4RD1A 5KSZA 4BGDA 1R0XA 1XB2A 1FUKA 1NBMA 4KFTA 3IDQA 3K70C 3OEHA 4TYNA 1OXTA 3C15C 4R9UC 3BERA 3WHLA 2JDIA 1Z0KA 1PUIA 2QM7A 2QMHA 4FI3C 2IS6A 4OL0A 1N5KA 2B7CA 2WHXA 3L82B 4FN5A 4KAXA 1UKEA 3Q9LA 3FHTA 2J9RA 2IA5A 4F4JA 2ERXA 2W2XA 2CCGA 2A30A 5L3SA 1UDWA 1E9SA 2CLDX 2CVHA 3B1VA 2ZI5A 3A1UA 2HLDD 5CJ2A 3ONWA 2GJKA 5FPYA 4KODA 3HU1A 2CHGA 4LUCA 1DPFA 2NO0A 1AM4D 3GCGA 1RW4A 1J99A 2ZVPX 4B2PA 1T3LA 2UZ3A 4NH0A 5G3YA 3HU2A 1YJ5A 2NQ2C 3IQXA 3OF5A 4X8LA 3DOEA 1CIPA 2AL7A 3UWKA 4DLRA 2GBLA 5AWFC 5EJEA 1JI0A 1EFCA 3LFUA 2OM2A 3TR5A 4BQSA 4R2IA 4C4PA 4EPXA 4XSHA 1II8B 2QBYB 2NGRA 2ZYVX 3TW8B 2XZPA 4DLXA 4C0AC 4E09A 1F5NA 2HV8A 1VIYA 2ORIA 3R20A 2V7QA 4A0HA 4ZDWA 2J7PA 4IEEA 4IVRA 5TV2A 2GXAA 3W90A 4B3CA 3WMEA 2RGBA 4MYTA 4U5XA 1YRAA 2BKEA 2IF2A 4YMTA 3CRMA 1P2SA 2EFEB 2IC5A 3CWZA 3IIKA 5DIFA 5ANRB 4B35A 1PVOA 3L43A 4JLOA 3RWOA 5EP3A 4U02A 3TMKA 3A36A 2C77A 1SVSA 5JCZA 3L0SA 5HCIA 1Q1BA 1Q3HA 3AQ4A 1FL9A 1XMVA 2VRWA 5D3QA 3VR4A 5KSOA 1S3GA 3PG5A 4TLCA 1P3JA 2QRZA 5JI2E 3BD9A 1HH4A 1WQ1R 1XJ0A 3PVSA 3QE0A 4P33A 1XTIA 4LJ4A 4PPQA 2MMCA 1JBKA 2BEJA 3IBYA 3N70A 2VF7A 3QOFA 4NYIR 2R6AA 1ZCBA 3KTAB 4FCVA 2IYUA 1E9EA 2PCLA 4EFMA 2XNDD 5DLQC 2QE7A 1U90A 3D8BA 3FFBA 5JI3E 3AKYA 4KLZA 2QAGB 4DVGA 3CX7A 1VECA 4NTZA 3QPVA 1AKYA 4QGAA 1WB9A 1M74A 3ASYA 3BXZA 3IKJA 2X77A 5EP2A 4G5RA 1XCPA 1NY6A 1OH6A 4NCKA 2ZSBA 1E6CA 1RRGA 2Q9CA 4JYCA 3EIQA 3SC3A 2WMOB 2ZU6A 5H70A 2O8EB 4AI6A 2J0VA 5LDDC 1UBCA 5JEEA 2VP5A 1GITA 1M7HA 4LWZA 1QG2A 1T3SA 5SZJA 1WE2A 3K70B 2D2EA 3VQTA 5L3QA 3ZD6A 5A4JA 2CL6X 2C98A 3X1ZA 5FTKA 1D6JA 1FMLA 2I1QA 1GNPA 2OSBA 3EW9A 3Q7QA 5AUOB 3NDBB 1NKSA 4W9MC 4Q66C 3ZS8A 1VG9B 3ADCA 3LLUA 4B32A 2LKDA 2OE2A 4DDTA 4NCJA 1VCIA 4LX0A 3BIFA 4UQOA 2IYWA 4A0RA 5HZHA 3L8ZA 1KHTA 3N5CA 1RRCA 2ZJ2A 4ILEA 1X6VA 1F48A 2CBZA 2JJ2D 4HI0E 1BS1A 1A5TA 1NN5A 5J5CA 3IGFA 4CT5A 2GJ8A 4LYAA 4ACBA 2GEVA 5CK4A 4ZPXA 1W4RA 4XTRA 3WXMA 1T91A 2XAUA 4OI2A 4R2HA 3BB3A 2VA8A 2GCPA 5KDLA 1VHTA 4JLVA 4O0MA 1G3RA 4GOKA 1S1CA 4QC2A 3LY5A 3QKUA 1AZSC 5BN5A 2Z4RA 1E3MA 5KNBA 4TLBA 4AC9A 4QHSA 1KMHA 3F3YA 3K9NA 4EQ6A 4PZYA 4S2EA 3U7EB 4DJTA 1VYVA 2IWHA 1GNQA 2CCKA 2G1JA 1J70A 3KFXA 1F60A 3TIFA 2BDTA 2Z4SA 4JMPA 3BK7A 3QXHA 1CTQA 5F98A 4DKXA 2J5XA 2Z83A 3E1SA 2QN6A 2UZIR 1CRPA 4KV9A 2R65A 2WWGA 1HT2E 2F55A 3LX5A 4N3NA 3Q7PA 4F91B 4EDHA 5SZIA 1IBRA 2BWJA 1G7CA 1L4YA 3B6EA 2FFBA 1KJZA 1PLLA 1G7TA 1TX4B 4IKEA 4Q01A 2REBA 2DY1A 4FW9A 4QFMA 5GJCA 5EE1A 5FOXA 1LY1A 1R0YA 4OHXA 5JJKA 4ZI3A 5EUMA 2C03A 4OK3A 3CONA 2C96A 2ZROA 4TMTA 2O8DA 2A78A 2O8EA 1IXRC 4LJ7A 5AJZA 1IXSB 4YONB 1A2BA 2HF9A 5TB5A 2N42A 1UKYA 2QP4A 2B8TA 3B7GA 3ND8A 4IVQA 4BZXA 4NMMA 2KWIA 1QRAA 3GJ5A 1W36B 1AS3A 2OILA 1NVXQ 1XTRA 2A5GA 4ZCLA 4BFVA 3WNDA 1COWD 1KY2A 1VMAA 4GP7A 4JLKA 1P61B 1KSGA 2IYLD 1JXMA 3I4LA 5IRCD 1ZYUA 1SKQA 1MO4A 3K9HA 1XCMA 1E9DA 3W9YA 1G8YA 5EXPA 4D4KA 3NH9A 3P4YA 3QXXA 4LHVA 4DSNA 5FPTA 3GEEA 4R7ZA 1FFHA 1Q1ZA 2ZM5A 3LRPA 4IDHA 2VHCA 4Q48A 1EFTA 2NZ8A 2QQEA 2ZRBA 1YZTA 3PEVA 2Z0MA 2AD1A 1KDTA 4DUGD 2IS4A 2OAP1 4TLDA 1DS6A 3W8RA 4IOKA 4DLUA 4M1OA 4NP6A 1OT3A 2QPTA 4IDOA 3K9GA 1DO2A 2WJGA 2EWWA 1R8QA 3TKLA 5ELXA 2ZEJA 2N1BA 2VHUA 1E2LA 4DDVA 1T8UA 2FG5A 1J8YF 5B57C 5GADl 2IF0A 3X1YA 1Z6XA 3H86A 1NVWQ 4IXNA 4C0SA 3O8BA 2RGCA 3TSZA 1M7GA 3GMTA 2WPDD 2JLVA 3C41J 4AG5A 4CZ2A 5KYKA 2BIFA 3BS4A 1IY0A 4LBYA 2A5DA 1Z6AA 3RWMB 1LB1B 2PZEA 3HR8A 1NVVR 2ZRFA 3CF6R 5TARA 5FBVB 1YZQA 5KSPA 3PR1A 3E2IA 1J7KA 4RJLA 2ONJA 4BECA 3AVXA 1TPZA 2D2FA 2FSIA 2ZYUX 3UKDA 5FOVA 2CCJA 3BH7A 3EG5A 3QUSA 3T5DA 5FI1B 3WRXC 1E2NA 1B0UA 1XEXB 4TTRA 4LJ8A 4LV5B 2O8FA 4Q9IA 4FWTA 2QNRA 4CEJB 3GP8A 1XXHB 5FTJA 2J7PD 2V9PA 3E70C 4DLTA 1Z0AA 1JALA 2F1JA 1Z0FA 2DWQA 4PAMA 2DWPA 1X3SA 4OJKA 3GJ0A 1A1VA 2PJRA 1ZINA 2ANCA 3RRZA 4G5OA 3ZYCA 1XJCA 2GXQA 5GVRA 5JBQA 1FUUA 4URVR 1UBFA 1NN0A 2AWNA 2IEZA 3GLFB 5IT5A 2ZRLA 2CLSA 1KNQA 2CNWA 4DSOA 2QROA 1W49A 4M22A 1R2QA 5J40A 2GCNA 2FEMA 2Z6VA 1X86B 2ANBA 2X8AA 3BFKA 3OIYA 2IYZA 2PEYA 1S96A 1Y63A 1CEEA 3WRYC 1NLYA 3AKEA 1G5PA 1ZC3A 4KSBA 3C14C 3W3AA 3AVYA 1NIPA 4L15A 1GKUB 4Q9HA 3T06B 2ODNA 2GETA 4A4DA 2RH5A 1WBBA 3TSOA 4AK9A 2YWFA 3JVUA 2EW1A 3NG1A 1S3SA 5F9HA 1NMXA 1U81A 3R9IA 3LXRA 2P2LA 4JVLA 4Q4AA 2ODWA 3O47A 3AB3A 2ZAOA 3U4QA 4LSGA 3MWLA 3I32A 1S0UA 2OEPA 1G9XA 3AEZA 4TL6A 4OK5A 4Q1BA 4IDNA 4RZ3A 4D82A 3TSWA 4LHYA 1UAAA 3NXSA 2Z5FA 4EUNA 4M0LA 1VYTA 2MSEB 1DAEA 3CUEF 1DAMA 1AS0A 1ESMA 1CKEA 4TQAA 3UMSA 4WZAE 4AY2A 2BMEA 2AFIE 1CR4A 5C18A 5EP1A 4ZIRA 2IYRA 1P60A 4MRPA 3OZXA 4EIWA 4LYJA 421PA 4CEIA 2VSFA 2QM8A 3O8CA 4TYWA 1UFQA 2IXGA 2W83A 4US1R 4NYJR 3ZH9B 2MMGA 2DFTA 4MYCA 4NL4H 3SJBA 2C04A 3DDCA 5KOYA 3X1XA 3VFDA 3THXA 1EFUA 2W6IA 4PTLA 4FMDF 4C2UA 1N6RA 1XRJA 3AF1A 2PT5A 3L0IB 221PA 2VPPA 3RRYA 4W5WA 3CNNA 1OYWA 1TMKA 2F1RA 3I73A 1Z08A 1P4SA 4JLPA 4D4MA 4KBFA 3VMFA 5EE9A 3KXKA 3KQHA 4HB4A 1P72A 3Q3JB 4PXAA 4NCIA 3CO5A 1W4AA 2JEOA 4NYJQ 2G83A 2YVUA 3DO6A 1DO0A 1SQ5A 3KKMA 1IJFA 4US2R 5E7IA 3EPLA 4EPWA 2J0UA 1Q3TA 1YR9A 4QBHA 2DBYA 5FTNA 3U60B 4LC1A 1E1RA 2F6RA 3I61A 4BLQA 5AUQA 1V5WA 1ANKA 3DM5A 1W48A 4Q7LA 1G4UR 3T1TA 3DVLA 3NBYC 1C4OA 1R0ZA 1PLKA 1SXJE 2XTNA 1FW6A 4B6EA 4QBGB 3RRMA 3KQNA 3C8UA 3WBKA 2KI5A 3VHLB 3K9LA 4UNQA 1LVGA 5LD2B 1NBME 2XGJA 1E4VA 5HKKA 1KI9A 3ECCA 1FQKA 2FEOA 3BGWA 3GLFE 1TNDA 4LJ5A 3G5UA 2B92A 1W46A 4CEJA 4M1TA 1GOTA 4B74A 5SZKB 3A6PC 1DAFA 1FTNA 4KSCA 3TUZC 3DHWC 3E5HA 4C0QC 2ZJZA 1CJUC 4KU4A 2YWEA 4ITRC 1KYIA 1UF9A 3R7WB 3QBTA 3U3RA 1ONBA 2FN4A 3L0PA 5DISB 3RS2A 3UMFA 4R71A 5DYIA 4M21A 1OYYA 3CR8A 4HZUB 3EPJA 3QNUA 1RFLA 4I4LA 1DAHA 1UJ2A 2PCJA 5C1BA 1A82A 1US8B 4POAA 3PQCA 3KX2A 2ZS8A 1N25A 5AJVB 2QMUA 5IK2A 2FZ4A 5FBQB 4IVPA 1NNEA 1GAJA 2AXPA 1U9IA 2FX3A 4B3XA 1EWRA 2D06A 3I72A 2ODEA 4JYBA 3B82A 3CRVA 3FHCB 4IOJA 1ZD9A 2MSCB 2W0SA 1H8HD 1XEXA 1ZAKA 2XSZD 3UPUA 4C9BA 4ZDJA 1VG0B 2RGNC 4MYUA 1JR3A 2YOGA 1KNXA 4A92A 2GAAA 721PA 5TDHA 3REFA 1G6HA 1KO7A 5JHHB 3QXCA 1EESA 2CK3D 2JCSA 4PQFA 4NPHA 2WV9A 1FZQA 3U7GA 4JL6A 1AQUA 1TL7C 1SHKA 1Q57A 2W6ID 5IDVA 3SHFA 1FTSA 5IK2D 5C4GB 2AN9A 4QM7A 2FFQA 3GLGE 3GLHA 2BKUA 2ZS9A 5CM9C 2RAPA 3NHBA 2IXFA 2AK3A 1DAIA 2WSSD 4LHZA 4LYFA 5L3VA 4BE7B 1F2TB 1P75A 3T34A 4AYWA 4BUJA 2GDJA 4JVNA 4NBSA 4A2QA 2ZJAA 4RVCA 4Q7MB 2CJWA 2FFHA 3THWA 1XJQA 3H0KA 2ZRDA 1JEDA 1MV5A 1R10A 3MWJA 2AXNA 4TTQA 4MDEA 1R5BA 2WSMA 3QEJA 3MWKA 3CNLA 3SYNA 2W0MA 5HZKA 4M2LA 1HA3A 3QENA 5JWOA 4EPVA 4M1KA 1GKIA 1LF5A 4RD6A 3TLXA 2ZE6A 4TLAA 2CLCX 2FOLA 1E94E 1VKJA 4R98A 1NP6A 1F3OA 4M9SA 3SN6A 4HB0A 1FOEB 3B9PA 2OFWA 5KTYA 2KB0A 3TRFA 1W36D 1QHGA 3CBQA 5CYPA 4AIIA 1IHUA 3I8SA 1X8JA 2C8VA 3MG9A 4NU0A 5B2ZA 2OUKA 4OI0A 1U9IC 3SYKA 4A0GA 4Q1EA 3UG7A 1TQ6A 4ESVA 3CM0A 3RDPA 2QZ4A 4HDCA 4DT1A 4Q5IA 2A5YB 1L7VC 3SJZA 3RS0A 4HLUA 3FGNA 2QL6A 4Q4JB 1BH2A 5JMTA 4TQUS 2DFKB 1HURA 4LJYA 3WNCA 4ZI2A 5GJWC 2Q9AA 4WAUA 1U8YA 3OFND 3QG1A 2GF0A 3B1WA 3GJXC 3AF3A 1ZVQA 1E2IA 2OCBA 1UKZA 3DPUA 3ADBA 3EZ6A 4G1UC 1CS4C 1GL7A 4DLVA 1T3HA 2EU8A 2F3RA 3GLIE 2ZTSA 3DM9B 4WZBE 2FDCA 1KY3A 2GWHA 4OQLA 4HDOB 3EIEA 2IXEA 2V7QD 5DH9A 1RVDA 2H7VA 1XF9A 3KFVA 4Q7JB 4YC7A 4AYTA 3FFAA 1AN0A 1P5ZB 1OH7A 1ZIPA 2ORVA 5EXSA 2IUUA 1K8RA 3ND9A 1FP6A 1Z63A 1GG2A 2WBLC 2W00A 5EUQB 1KMHB 3SFVA 3VNVA 1FPMA 2YJTD 2R6DA 2WMNB 4JLJA 4B76A 3ZZTA 2WKQA 4JKIA 4IW3B 5L3SB 5KO2A 4BEBA 1MABA 4PC1A 2ZRNA 4PX9A 5CYOA 1M6NA 1WCV1 2XJ9A 3SNHA 3VKWA 1A4RA 4BWYA 5HCNA 4IRUB 4IJMA 4IOMA 1CJVC 3OEEA 2EVWX 4Z8XA 3ZVNA 5HR5A 4MH0R 1CBUA 1E79A 2H92A 4DUGA 4ZKEA 2CDNA 4FMBB 3LVQE 3U3MA 1BYIA 2CK3A 1N6KA 2LKCA 4RZXA 3CW2A 1E9FA 3AVOA 3FB4A 3ZD7A 2NTYC 3X1DA 4FMDB 1JR3D 3QI2A 3QKSA 2R44A 3FKSD 3CNOA 2J0SA 1EWQA 1KK1A 2QPAA 3MMPA 4Q4JA 4WBSA 1H8HA 1I4TD 4TLEA 4QNRA 5J4KA 2WSSA 4BLRA 1BIFA 4KJZA 5K8IA 4B71A 1T9HA 4D81A 3GJ7A 2OO7A 1N6LA 1KKMA 4OQFA 4HAXA 3D6TB 3EIHA 2LCFA 1XPOA 3R9XA 3VAAA 5JJIA 2W6JD 3CH4B 1KDPA 3I8XA 5DGXA 4F4IA 1CF4A 1NG1A 1G7RA 1RE0A 4JVSB 3FKQA 3W34A 4D80A 4A36A 1GWNA 1G5RA 4HUQB 2FSGA 1AIPA 3Q5EA 1JQJC 2JA1A 1E98A 5CLLA 1SVLA 1KI8A 3RSLA 4JLNA 4LJAA 2GEUA 2F9MA 4WW0A 3EWAA 4HUTA 2OBMA 2OZEA 4HAZA 3TBKA 3FYHA 1IN4A 4K46A 3CWQA 2CMKA 3KXLA 1E9BA 2ZRAA 4QJ4A 3PUWA 1JPJA 4G5GA 1G17A 3JZMA 2QY9A 2P67A 1DARA 3RVBA 5L8VA 1YVDA 2AD5A 1XD9A 5JZVA 1LV7A 3QQ5A 3NC1C 1FNMA 4GSYA 1KSJA 4O25A 2D62A 5GVSA 3HDTA 2B7BA 2GAOA 4JBWA 4OKSA 4RD0A 3C5CA 2ZJYA 3HJNA 5CIQA 3BE4A 1M34E 1QHXA 2HDNB 5DSZA 1G5TA 2GEDA 2DHRA 4JLAA 1AZTA 2FA9A 5EQTA 1VG1A 1US8A 1ZUHA 3DEFA 4YMUA 2O8CA 3BBPA 3QKRB 3BFXA 2R6CA 1K6MA 5IHPA 2RMKA 3VNUA 4E22A 2QUZA 1YRBA 2NO1A 1XD2B 1IQPA 4G5QA 4V02A 3K70D 2C9YA 1CP2A 1OE0A 1QVRA 2IEYA 1JQLB 2YWHA 3GLIA 1OFTA 2WVJA 3CX8A 4QRHA 3DZDA 5JCPA 2BHRA 4FD2A 2J0QA 4OBEA 4XVRA 4I99A 1J2JA 4JVMA 2UVQA 2WWIA 1NMYA 1IONA 4TT3A 3KZ1E 1KGDA 1XMIA 4QBFA 2FPKA 1AGPA 4EQ6B 2FPLA 2N46A 3TUIC 3U4QB 3BB1A 1CR0A 1W2HA 3A4MA 2GHIA 4PR0A 4DB2A 1SXJB 1RJ9B 1XX6A 1VCOA 1G3IA 5K8TA 1RRPA 2WKRA 1HT1E 3A37A 4NONA 1RJ9A 2GESA 2PLFA 1OW3B 3FMPB 2PMDA 4US0R 1W5TA 4BFZA 4LDJA 5FOSA 4BFUA 1Z2AA 5G41A 3GLGA 1ZD1A 4D2IA 4KVGA 4ON9A 1JAHA 4EJSA 4MKIA 1SVOA 1AGRA 4B6FA 3IHWA 4GOXA 1T4GA 3KUCA 4RD2A 1GVNB 2OBNA 3GFTA 3MFYA 3VR6A 1XD2A 1E2MA 1YZGA 3VR2A 5FL7A 5JWRA 1NKTA 3DL0A 2PZGA 3AF0A 4OK6A 1X1RA 4PC3A 5FL3A 1NSFA 4GI7A 1K5DA 1OKKA 1E0KA 2VO1A 1OFIA 4HAUA 3U6BA 3SBDA 4A0FA 2PL3A 2F43B 1GL6A 2R62A 1GIAA 4CEHA 1VDZA 3AVQA 2QPOA 1IN7A 1WBDA 2ZR0A 3BH0A 2GA8A 1L4UA 1EFRA 1YR7A 5FUYA 2YV5A 1GL9B 1YZUA 2A5FA 2GF9A 2QT1A 5DI3A 2ZJ8A 2QT0A 3NC0C 5A0FA 1E1QD 1EK0A 4PPFA 3EC1A 3RS5A 2J0UB 5SZHB 3KKOA 4MA4A 4EPRA 3I92A 4YXWA 2GJ9A 3EA0A 2XX3A 3NBFA 5CB6A 2O8CB 4B3BA 2O8BA 1O3YA 3ZVRA 5J4HA 2D4HA 4Q03A 2XB4A 4M9ZA 4PPGA 4NCHA 2ONKA 5CB8A 4LBWA 1HUQA 5DHAA 4OHWA 4A15A 1TUEA 4F38A 4BRWA 4YDHB 3I62A 1W0KD 4ARZA 2H16A 1T6NA 2PX0A 1OXXK 1Q1QA 2H5EA 3U3JA 3U61B 1XPUA 1NY5A 1NVVQ 3KTAA 5UKDA 4Q18A 2FJUA 4HYYA 3UWOA 1CR1A 4HDQB 2VEDA 4A6XA 1MO6A 3LWNA 4HAVA 2ORWA 1LW7A 1ZJ6A 2RGEA 5DI9A 3K0FB 3LW7A 1E69A 3ICEA 5JEDA 4X8MA 4Y0VA 5E3HA 4HLUC 3PJRA 2RHDA 2CVFA 1F6BA 4TZ0A 2O0HA 1N6PA 3LD9A 4UXHA 1IY2A 4QKQA 5B58C 2AHOA 2QGNA 4URWR 3CIOA 2J59A 3B1XA 4V0NA 1VTKA 1E2KA 1XEWX 1Z07A 4PHTA 1G18A 1P9RA 1W5SA 2FSHA 3KKQA 4DDWA 2ZRGA 1XDBA 2V54A 3GD7A 5CK5A 5E4FA 3QXSA 1CLUA 1MO3A 1QHSA 4P3YA 1EX7A 4CIDA 3H4MA 4UJ3A 1CRQA 3TUJC 1EG7A 4Q47A 4QJ3A 3C7KA 2VHTA 4IFBA 2QAJA 4Y0AA 4B33A 1P6XA 1OV4A 4X8HA 1E9RA 3AM1A 4EFLA 3LVRE 4M9QA 4D4LA 3WHKA 3GEIA 1XP8A 4MKFA 3AVTA 4Z54A 2GCOB 4URYR 2D7DA 4DCVA 3R9WA 2QU8A 5G40A 2CJWB 1SVIA 4Q1DA 4EJSC 2O8FB 2MSDB 1U8AA 1VG8A 3NVAA 4GT1A 3TVTA 1J8MF 4QHTA 3CF2A 2JLRA 4QM6A 4BASA 1E32A 2BBOA 5FUWA 1XXHE 1M7BA 3WP1B 3WYFA 2J87A 2NG1A 2EFDB 4M1SA 2CL7X 2G88A 2WM9B 1H8EA 2X19A 2BC9A 5FL7D 3AP1A 1NMZA 3RRNA 4HZUA 3RABA 2WWXA 4V0OA 3EX7C 5FFMA 4O3MA 1JEEA 1E2DA 1E2PA 5HE8A 2JIZA 3ZIAD 3LDAA 5J47A 2QE7D 1W44A 1XXHA 2FH5B 2XITA 5JJLA 1C1YA 4C0BA 3TQCA 1OFUX 4NYIQ 1JECA 2HCJB 5FOWA 1OB2A 4DDUA 5EE5B 1E2HA 1G3QA 1G8FA 1UBGA 5JRJA 2FFAA 2V1XA 4DEYA 3N2IA 1E2FA 2F3TA 3RS3A 4LJ9A 3KUDA 2I3BA 3GLFA 4MRNA 2V4ZA 1KJWA 5TVKA 1OH5A 1G3UA 1X8KA 1X8LA 2BJVA 1DG1G 3A1VA 2ODBA 2R9VA 3NEJA 2JJ1A 2KSQA 3L2OB 4QOSA 3D31A 4DB4A 1W36C 4LYHA 2RHMA 2RGDA 3REGA 1NL3A 1RYHA 4BFSA 3OESA 2WIAA 1UKVY 2P65A 2GZAA 4JLBA 2ZI7A 3CR7A 1G7SA 1MT0A 2RGXA 4F4CA 1GNRA 4PAQA 4YMVA 2DPXA 1KTVA 2GVZC 4A8JB 2C78A 3UMRA 1F2UB 1S9HA 1F2TA 4AWXA 3K1JA 4UNPA 4GMDA 4F7WA 4PO9A 1P62B 1GILA 2BMFA 2X2FA 3T1QA 2HT6A 3ZJYA 5J4YA 1U0LA 5KDOA 1T0JB 2BJWA 2FF7A 1UEJA 2RB4A 3KJEA 3PITA 1G1MA 1LTQA 4TMXA 3R8CA 1SVMA 4ARZB 2WJHA 2OFXA 4A9AA 4D0NA 1GP2A 4UJ5A 1K5GA 3PUVA 4D0GA 2IK8A 4V0ME 5BYKA 2VP4A 2VSOA 1G19A 4IFEA 3FTQA 4YXWD 2AKAB 1Z47A 2W58A 3B2EA 5J4LA 2AFHE 4YLGA 1SZPA 1N0UA 1ZM7A 3W6NA 2VIIA 3IILA 5BYJA 3O8DA 1W0JD 4Q9KA 4B34A 4J0QA 4F93B 1GM5A 1QHYA 3VKGA 1E0SA 2B6HA 1II0A 4JJKA 3WMFA 4L5BA 5HKKD 3W5IA 4TYYA 4KXFB 5AJYA 1KI6A 4LCBA 2YKGA 3TAUA 1R6BX 3GLHE 3AKDA 3JVVA 1NJGA 4V0MA 1TEXA 1KI1A 121PA 2EWVA 4C0KA 3RS7A 3EARA 3U44A 2BMDA 4QHYA 3SHWA 1H65A 4L9WA 4A2WA 4XOIA 3THYB 1LFDB 2ZSFA 3BH6A 2QRNA 4NZYA 3GJ6A 3KJHA 5DO9A 1SHZA 1WF3A 3LNCA 1U8ZA 2YOFA 3CRRA 1IN5A 3P32A 5FPSA 1RKBA 4Q9LA 1ZIOA 3HR7A 5E7JA 1FP7A 2K5UA 3LA6A 3QKTA 4OI1A 2ZJBA 4FMCB 2FV8A 2BVNA 3UG6A 1G8GA 2J3EA 3EZ7A 4EJSB 3GJ8A 2GTPA 1G20E 3IUYA 1Z83A 3KDSE 1UM8A 2ZANA 3B85A 4WOPA 2EFCB 2L0XA 1WXQA 2Q6TA 4N0DA 3WP0A 4D26A 4D6PA 2JAQA 4GRAA 3OHMA 4PZLA 3FOZA 4HB3A 1NG9A 1S8FA 1SVWA 4P4UA 4TN1A 2JLYA 1HQYE 1KK0A 3EPHA 1P73A 3IHLA 1ZUIA 4HATA 1TTTA 5KUTA 4CVNA 2ZSDA 1W7AA 1KI6B 2BCJQ 3CPEA 3FDIA 1SXJC 3B13B 2OXCA 2QMOA 3B8HA 3A4NA 1ELOA 1T5IA 2O52A 5FUVA 4ASUA 1O87A 1ZD8A 1OH8A 4KVAA 1OIWA 4XVQA 1E2QA 4B47A 3NTUA 4LRWA 4L9SA 3MWYW 4DCUA 2JLSA 2OV2A 3AH8A 521PA 2ZVQX 4H9GA 2BEKA 4Q19A 4Q21A 4I1VA 2VQSA 4M1YA 3ADKA 3SS8A 1KI3A 1TQ4A 4ZKDA 4RKEA 3LX8A 2OLJA 1MRNA 1H8ED 4PPNA 1VCMA 3W8NA 1NN3A 3CPJB 3FPAA 2J46A 1HQCA 2ZRJA 4PC2A 1ZNXA 1WRBA 2LWIA 2ZI4A 4LPSA 1R5NA 3KKNA 5LB2A 4C0LA 2O0JA 3KJGA 4DCTA 1D9ZA 1RRFA 1YZKA 2GZDA 2QTFA 5FOUA 2W2TA 4Q4HB 1N6NA 1OIXA 2CHQA 5DHFA 4WXRA 1RZ3A 3RC3A 3K53A 2Z43A 1XFAA 3GLIB 2GJAA 1S1MA 3P20A 4W5HA 5EE3A 2FMXA 2NOAA 5K8UA 4WIAA 1A2KC 3KKPA 5AK0A 3P26A 2A5JA 1QZXA 5CIWA 1EGAA 3D7MA 4A8JC 1KJYA 2WKPA 4NHOA 5K8LA 3I5YA 1MR3F 3ZDQA 5DI3B 2FSFA 2KJQA 4PSVA 1ZNZA 2G9NA 3RLFA 4DHEA 1ZNYA 1D2MA 4TSFA 4M9XA 3K0AA 2E1RA 1XU4A 2G6BA 3F5FA 4I1OA 4PHHA 2EFGA 3MLEA 4D4JA 3AGPA 4MRRA 4TYPA 3P1JA 3UXMA 4B3GA 2XXAB 1IOZA 2Q3HA 4A6PA 2XJ4A 2O8BB 4URXR 1JJVA 4P4SB 4HAYA 2CE7A 2A7QA 1OPXA 4IEIA 3LO5A 4DBLC 1Q44A 1UEIA 2ZSEA 4QL3A 1PV4A 1P2UA 1M2OB 2DYKA 1WA5A 2PX3A 4S35A 4PC7A 2GVDC 3ZZ0A 1T8TA 2CXXA 2QTVB 4FINA 4BEJA 1GSIA 2F9LA 2QA5A 3EXAA 3AV0B 6Q21A 3X1WA 2JGNA 3GFPA 1Z29A 3K09A 2JLUA 2IYSA 4CEHB 1LNZA 4Q02A 4GP6A 3SQWA 4U7DA 2I4IA 1KO4A 3I3SR 4DSUA 1YHNA 4B75A 2O8DB 3PV0A 3VTKA 3BORA 4BFTA 2HJGA 2V8OA 3EAQA 3PCRB 1E79D 2OHFA 3I5XA 1MOZA 1XTJA 2IHBA 5GJBA 3CZPA 1AQYA 4OQMA 1LF0A 1W4CA 8OHMA 1U2RA 3EZFA 3F8TA 2IUTA 4OQNA 3WYAA 1S4QA 2GK7A 1OXSC 2YOHA 1AJEA 4W5JA 2JATA 4C3ZA 2HXSA 1E9CA 3NWJA 4I1SA 2FU5C 4Z51A 1W47A 3BB4A 1IJEA 4UXIA 1FMJA 2KBEA 3RNLA 5LPNA 4JBYA 2OLKA 4HLDA 2G1KA 5AJWA 1YZLA 4JBXA 3SI7A 2FWRA 2ZJOA 1Z6TA 3UIEA 5BN4A 4NYMR 3M4YA 3OE7D 3FMOB 3A58B 3TNFA 5IF9A 4KYIB 3MSXA 1IY1A 2R6FA 3OAAD 3W3ZB 4LK2A 2YC2C 4ZV4A 4DT1B 2ZE7A 5C4MA 2IYQA 2QTHA 4B43A 1ZMXA 2IBMA 1DADA 4KCGA 3UANA 4DLWA 4JT2A 2C9OA 4JS0A 2O5VA 2A9KA 1CJMA 2BBWA 1ZM9A 3U3KA 2OCYC 4LBVA 1KIMA 2FGKA 4G0NA 3SZRA 3LBIA 3ICQB 1COWA 4V0LA 3AGQA 1CXZA 2Q3FA 3BWDD 3Q8XB 4C7OB 3LXXA 5FOTA 1JPNA 1Q21A 2XXAA 3JZAA 3RAPR 4ZO4A 4AKGA 3PFIA 3W6OA 2J41A 2GNOA 2XZOA 2P0EA 1E4YA 4V03A 5F2EA 3MGCA 4IDPA 3SU8A 2ZRKA 3QF7A 1RC8A 3M0EA 4AKEA 1QHIA 5DN6D 1A7JA 1HYQA 4XIGS 3RC8A 1OJLA 4Z1MA 3AVUA 1DE0A 1EXMA 2WIBA 3T1VA 2ZSAA 4G01B 2WOJA 4CRWB 2ATVA 2WPDA 4XSGA 5TMPA 2FGJA 1GTVA 821PA 1XWIA 4M8NE 2ZYWX 3SDZA 1OHHA 1XMSA 4KLNA 3AVVA 1R5OA 4QNMA 4QGHA 4A1FA 2C2HA 4E5UA 1GKYA 2QAGC 4HB2A 5CDFE 1Z0IA 3K8YA 4JLMA 2BOVA 2UKDA 5BQ5A 1G291 1QHHB 4FCTA 2QENA 1Y3AA 3K0EA 3HP1A 5KSYA 1E2GA 1Q20A 4JT4A 5BWMA 3CRQA 1OKKD 2O0KA 3VR5A 1ZBDA 3PEYA 3EA5A 3MD0A 3TW4A 1ZRHA 2WTUA 1BO6A 1W2GA 4RD4A 4RFVA 4RCYA 4ACAA 1OHHD 3K0SA 5C46F 4LY6A 2ZI6A 1MH1A 3PXGA 2PEZA 2VL7A 4TMWA 4ESHA 2QQ0A 1HTWA 4GBMA 1KDRA 4GZLA 4Z1MD 2DFLA 2PLRA 2YZ2A 3HYRA 4ASUD 4GDFA 1ZNWA 3N2EA 2JJ2A 3RSOA 2NZJA 4QXAA 3PEWA 1L8QA 3RANA 1KI7A 3SBEA 2WICA 2WJYA 4BFWA 2ZPTX 4U00A 2P6RA 3QSYA 2P5TB 2E87A 2TMKA 5KDDA 1OSNA 2QI9C 3QF4B 5KPDA 5LBIA 4XJXA 4OHYA 4LPKA 2QEQA 3FE2A 5FTMA 4X8OA 4QGGA 3BC1A 1ESNA 3QPWA 5E7MA 2ZRIA 4C7OA 1AKEA 1FNNA 1II9A 1KO1A 3WBJA 4ZDKA 5F9FA 2IYYA 4B2LA 2F1IA 3CX6A 1TAGA 1LS1A 1QF9A 2JIZD 3FVQA 2OXRA 3H84A 3ZIAA 1TU3A 1R8SA 1Z0DA 5JFGA 3R8FA 2ASEA 1XEFA 2CL0X 2XNSA 3D3QA 2VP0A 5G53C 2IL1A 4CT4B 2GXSA 2XOKA 3U7HB 4XWKA 3PUXA 3B1ZA 2D7CA 4Q9JA 4EKDA 1U98A 3L0OA 2ZXUA 4WVFA 4TZ6A 2H57A 4XVUA 1UDXA 4JIMA 4TL8A 2F7SA 3IIJA 3LAWA 1Z06A 4Z8YA 2H18A 4TYQA 1DOAA 2EFHB 1SXJA 3OEED 5BW8A 4HLQB 2ZETA 2BM0A 4DCNA 4PFSA 1QG4A 1YR6A 3NKVA 3VHXA 2R2AA 1P2VA 3MRSA 3SFZA 1S9DA 4Q00A 2Q3MA 1G41A 2ZJ5A 4PANA 1MABB 4RCZA 4JLDA 3GFOA 3WMGA 4AURA 3NDPA 1Z6GA 1B23P 3CB4A 1XMJA 1KO5A 4RFSA 1RIFA 5E95A 3DOFA 5EZ5A 4MDFA 4RZ2A 2ZYTX 2AWOA 3AF4A 1Q0UA 5EZ6B 4Q1CA 1NIJA 1E99A 1OIVA 4A2PA 4PO1A 3T15A 2OAQ1 3B78A 1HV8A 3GQBA 4FIDA 4DXAA 4PAOA 3S1AB 3M6AA 4BLTA 2W6JA 3LBHA 1KI2A 2ZRCA 4K81B 3TVDA 1MO5A 4WA7A 3ZVMA 2OT3B 2X1VA 2ZRHA 1TEVA 2GJSA 3TK1A 2WAXA 4P31A 1OXVA 3AVWA 3GJ4A 4I1UA 3T12A 2OBLA 1N0VC 5KHOC 1TF5A 5EXXA 2NPFA 3QG5A 1G6OA 4BLOA 5L3QB 4B2IA 3AUYA 3QF4A 1KMQA 2OCAA 4RY2A 5JWHA 2OG2A 1XD8A 1KZGB 2E9SA 1R0WA 3RS4A 1PJRA 3HWSA 4EFNA 5L3RA 3TQFA 1KDOA 4V0KA 3AP3A 3SJCA 1GRRA 2JJ1D 1ZM3A 1Z22A 4KHZA 1ZU4A 4JL8A 3SQXA 4WXPA 2QGZA 2OFOA 4N1AA 1IAQA 2FE4A 4TTPA 4DEXA 4MGZR 3THWB 2JLQA 3K0AB 2NIPA 4E07A 2QP3A 5DE3A 1EFHA 2HYIC 2OESA 1G3MA 1AK2A 3BOSA 3GPLA 1DVRA 2QP9X 4B3DA 3UATA 1XTKA 1YR8A 2IHYA 4IXMA 2REXB 2WJJA 3A8TA 2H17A 3ETLA 5EXTA 5BN3A 1Z6YA 3IO3A 1DAKA 3PUYA 1NRJB 5KNDA 1BMFD 4Q1AA 2F43A 3EZ2A 3L8YA 1P9WA 4HLCA 4TMZA 4BFYA 1OB5A 2YC4C 3DKVA 3PEUA 5FI0B 4NE2A 1U99A 1NLFA 3THOA 3MJHA 2NO7A 2IWRA 2REOA 2IYVA 1L2TA 4KYUA 4B3FX 4UXJA 2XB2A 2GRJA 5D3MB 2R8RA 3SR0A 4UNNA 1F2UA 1VCNA 2ZE5A 1N0WA 2VP6A 1BMFA 1TU4A 3HPRA 4L8GA 1KOFA 4A8JA 4DLYA 4XWOA 3TR0A 1N5JA 4RFSB 1CULC 4NDZA 4CEIB 2ZI3A 2WWYA 3ZGXA 2PJZA 2QSYA 2WWFA 3NIBA 2ZITA 2GCOA 4O2RA 4L4UA 2B21A 1T0HB 2WOOA 1TQDA 2V6IA 2ECKA 1U94A 4O2LA 5DYGA 3TGPA 4IHQA 5KU1A 2QORA 3SYLA 1HY3A 2JASA 5M04A 4JJZA 4JZKA 3S1AA 1JXOA 3SJAA 1XNJA 1N2CE 2HJVA 1E96A 3VU9A 1GDDA 3T1OA 3Q5DA 1D2EA 2CHVA 3OFNA 3VKHA 3AVPA 3SOPA 1WMSA 4YMSA 3VU9B 1XPRA 2JLZA 2A3RA 3OIUA 4PZZA 3LQQA 3CLVA 2J1LA 2QSZA 3QY0A 2FPMA 4LZZA 5FBWB 5AJXA 2ZUBA 5FH9A 2BM1A 2J7KA 3WNBA 5H68A 4DSTA 3U5ZB 2PBRA 1WP9A 3FWYA 1KZ7B 3MJRA 4TMKA 2ERYA 4AKHA 4M1WA 2HLDA 4FWIB 4LC0A 5JS8A 1SKYE 1N3BA 2JJ8A 4URZR 1NVUQ 1N6IA 2AR7A 4BLSA 2J45A 4GL2A 2VP9A 4DLZA 1Z8FA 2ZIAA 4F92B 5GJVC 1W0KA 3LV8A 2ZAMA 4LHWA 3T35A 3P4XA 1HE8B 1SXJD 3IQWA 1OFHA 2P6UA 1FX0B 3RHFA 1KAGA 3X2SA 1IM2A 1U0HC 3NBXX 3HYTA 4DWJA 4DZZA 3MAAC 1VYUA 3MUFA 3V4FA 1KI4A 3IIMA 5CLQA 3OEHD 3QJYA 4GOJA 4FXPA 1KSHA 1Q12A 5A5GA 4IOLA 1UPTA 4LV8B 4PO8A 4TL9A 5H8WA 3GEHA 2RKOA 5J4VA 2WWWA 5DNYB 1XBTA 2WAYA 1I2MA 4KBGA 4XH9B 1GRNA 4DIEA 1G16A 4BZQA 1PUJA 1S2MA 4CDGA 1Q22A 1ZW6A 2AK2A 3GLHB 4MGIR 4OQXA 3UK6A 1CR2A 1VPLA 2VHJA 3KL4A 2Q21A 3NH6A 4AG6A 4K8OA 4PHGA 2XTMA 2ZRPA 2P3SA 3T5GA 3CZQA 1PZNA 4OHVA 4C30A 1JR6A 1U0JA 5JSZA 3C4JA 3KQUA 4M1MA 2GZHA 1E0AA 1G4AE 4XD7A 3V9PA 1QVAA 1PLJA 4PC6A 1ODFA 4RD3A 1N5LA 1CU1A 2XSZA 4W7SA 3G0HA 3FKSA 3B1YA 4P4SA 2NPIA 1QDEA 3VX4A 2IUSA 3H2YA 4YDSA 4EPTA 4CF7A 1D9XA 4BRUA 1NSTA 3NBZC 3ZS9A 3OE7A 4Q4HA 1XCGB 5JHGB 4Q4LA 4ZCMA 3HU3A 4KO8A 4JSTA 3MCAA 3CKLA 2R6GA 3NHAA 5AUPB 2QBYA 3SEAA 4B73A 5C2JB 3LLMA 4MKGA 3PENA 4CGZA 4ABYA 1FQJA 3ZLJA 5B64A 2D3WA 1N6OA 5HPYB 2PT7A 4RZUA 1M1YE 4LGMA 5TY0A 3U6KA 3KXIA 1IN8A 4LHXA 2C99A 1XTSA 4LBZA 1HEIA 3H1TA 1JB1A 3PIRA 3QIAA 2V3CC 1TF2A 4GPTA 1W0JA 1JAIA 2G3YA 1IN6A 2ZE8A 5KNCA 4PSKA 4BFXA 5G3ZA 3GLGB 1ZU5A 3ZZUA 2WJIA 3AP2A 3FHOA 4AYXA 1DG3A 2AX4A 2I1VB 1RPZA 2NO6A 5HTKA 4LV6A 1YKSA 4MYHA 2ZQ5A 4MUBA 3VR1A 3TJZA 3TE6A 3M1IA 3KQLA 1GUAA 5FPKA 4QBIA 1KO8A 1OLOA 3THYA 2DWOA 2GKSA 4NCNA 4IDQA 2ZR9A 4DLSA 4H1VA 1YQTA 2C95A 3BJIC 4Q4AB 3R7WA 3K0CA 4P32A 4KITB 4DC9A 1SULA 1N6HA 5CM8B 2V6JA 1XTQA 1DAGA 1UBEA 4ZCIA 5F3WB 3AF2A 1R4AA 4L16A 4CW7A 2BV3A 2KBFA 4OJQA 3KB1A 2QMEA 2ZUDA 2VH5R 4QGFA 3ZQJA 4HEJA 3BFVA 4LOAA 2HF8A 4FMCF 1RYFA 5DN6A 1M8PA 4AD8A 2XZLA 1II8A 5FUXA 1W1WA 3ASZA 1XZQA 4ERNA 4TSFD 2GXUA 5D3MA 3KQKA 1P2TA 1NN1A 5FBLB 2HCBA 2WJVA 5LD2C 2YNMA 5LB4A 2HYDA 1I4LD 5FPHA 1Z5ZA 4HZIA 4QG7A 3U7FB 3W6PA 4D25A 3WY9A 3KB2A 2YHSA 4D0LB 2G0NA 1DTSA 2A2ZA 4I81A 2NMVA 5CITA 3U3OA 3A1TA 1Z2CA 2ZU0C 4UNRA 2HT1A 2WWHA 5CJPA 1G8PA 1NLZA 1E2JA 2F1HA 3DMNA 3IO5A 5P21A 2VSXA 3U44B 1D2NA 2Q9BA 1KK2A 2ZUCA 2DCUA 3B60A 3OAAA 4BZPA 4AKIA 1AA9A 3EPKA 4GNKA 3IEVA 5CDFA 4BPBA 5KPJA 4P0TA 4PQYA 2RGGA 3QPUA 2VP2A 4EAQA 2P5SA 1ZUNB 1NBMD 3CF0A 3OIWA 1SVKA 1QHHA 1G8HA 3VX3A 2CEAA 4LI0A 1BYUA 3I1FA 5FR2A 4ZDIA 4HSEA 1G64A 4KFSA 1E1QA 1E9AA 4C0JA 3FMFA 1BKDR 2QAGA 2VBCA 5EP4A 2XNDA 1ZM2A 4II7A 2DB3A 3BRWD 3SE0A 1MKYA 2CE2X 4JKYA 4A82A 2ZS7A 4QJ5A 4BLPA 2PH1A 2KE5A 2G0TA 4G3XA 3Q85A 4MGYR 2JLWA 2WZQA 4YMWA 1D8TA 3VR3A 4DIDA 2XEXA 2YWGA 1Z3IX 2VYFA 5AR1A 3EC2A 3AUXA 4PHFA 1FX0A 2IYTA 2VF8A 2OCPA 2IS2A 3TAHA 2CNWD 5JLJA 1R7RA 3C5HA 3THXB 2ZRMA 2HXYA 3ADDA 1KSFX 1UADA 3K09C 2XOKD 1YZNA 2Y8EA 3A1SA 4WZ6A 3TH5A 2H1LA 1QBKC 4FCWA 4UKDA 4GMXA 4LJ6A 4MITA 4B44A 4E03A 4XWAA 1OXUA 5FBRB 1MRSA 3OIVA 2EQBA 2VLIA 4XTCS 1Z0JA 1CJTC 1JR3E 3QVUA 4PQRA 3WYGA 4C2TA 3QBVA 2HEIA 5TXGA 2IT1A 4M4SA 2XTZA 3V00A 3AKCA 4Q1FA 1YU9A 2GK6A 3KJIA 5H1YA 2DR3A 4TWZA 1ETUA 3GJ3A 4NYMQ 2IW3A 4UNSA 2HUPA 3P27A 1ZC4A 1DELA 2EYUA 4B48A 5FTLA 2PZFA 1XZPA 2QG6A 2W2VA 3QKRA 4RKFA 3ZQ6A 5AUNB 1NJFA 3CPHA 1AS2A 3F0TA 1V43A 5FR1A 2VTKA 3PUZA 1G21E 2IS1A 2ZR7A 1OF1A 3IPXA 4OYHA 4P4TA 3EASA 1BOFA 2RGNA 2IX3A 4PSAA 3A4LA 3ZVLA 1GFIA 4MQBA 1XEWY 3IPYA 2YINC 2H8KA 1IXZA 1KKLA 1Q1EA 3LQRA 4GZMA 1DBSA 3C16C 3HPQA 2X2EA 4OHZA 4OI4A 1C9KA 2JLXA 3IBGA 2BBSA 4HAWA 4NKRA 2C5LA 1VIAA
chains in the Genus database with same CATH superfamily
1QIHA 5KYWB 3OPMA 2HHLA 2FHPA 1KGSA 4GGOA 3A2NA 3PHJA 4H1UA 3IVXA 1W2WB 2GBLC 5E2AA 1BJTA 4KRYA 3BXXA 2OYSA 3DMTC 5IDXA 1CJKC 1K6JA 4BKMA 4TL7A 3KYCA 1ZJ5A 5K3SA 3TIIA 3EMKA 1G38A 4HWGA 4A5OA 1L4LA 1Q0SA 2UXDB 5DYWA 5BXQC 4G5SA 3ELUA 3LW8A 3LUFA 3HGMA 3LP8A 5ESDA 2OP1A 4CYMA 1VHLA 1X0VA 3TD6A 4FZJA 2C9CA 1R6XA 4X62B 3U0BA 2OY0A 1T5TA 3V7UA 1KZHA 1QONA 4KQEA 2Z1DA 2RCNA 4O4IA 1RQ7A 2MINA 1XVTA 2IPMA 2HFKA 1FFAA 1R4NB 3LH5A 4MGKR 3R4CA 2GVNA 4C6TB 4NE7A 4DHWA 4KFUA 3AHCA 2H2DA 4D3ZA 3NUGA 4DRZA 3MT9A 4M53A 4DF3A 4E11A 4HDRA 1X1SA 4IUYA 4RU1A 3G2OA 3P9RA 4JL5A 3Q4GA 4U7PB 5ICFA 3D0QA 4OKNA 5LQSA 3NEYA 2FPUA 1EDBA 3K5PA 3VYSB 1IPHA 2JKVA 4M8LA 2K7FA 3O8RA 3EWSA 4LS3A 3ZNOA 4OKIA 5DCWA 3DOUA 3LPLA 5EQDA 4IO1A 4BMSA 2VKTA 2RARA 3RJ9A 3CRW1 2GTHA 3U4MA 3QXJA 4ETNA 3U2QA 4G5HA 3P9NA 3KL2A 1NUHA 4ZCPA 1NJ1A 1TT7A 3TTYA 1C7IA 4HTFA 4JODA 1TEZA 1QFJA 3QHQA 2WEKA 3OC6A 5DIZA 4RK6A 2BMJA 1W85B 4GFDA 4L9AA 1N5IA 2D74A 1ZP6A 1I5OA 1PZEA 4RXTA 5CEEA 2V1UA 3A9SA 3DMDA 3V2UA 3K0CC 1DEKA 2NVUA 3IEIA 3LXUX 1ENOA 4XASA 5K0TA 3UWDA 1GJRA 1DUIA 3LBFA 4ZQCB 4WCFB 4ALLA 4OP1A 2XOEA 4GRIA 3OY7A 1TKRA 4HH0A 5HQ3A 5FXMA 4J07A 4G85A 4JP3A 2IS6A 4MJ3A 2R751 1GPJA 5G0SA 3LUAA 3RVRA 2JC3A 4CN8A 1P0CA 4YJ2B 4ANFA 1QCCA 3Q9LA 4WFKA 3FHTA 1I3KA 1NBWB 2C0QA 2NZVG 4CMGA 3T3IA 1H9BA 2P68A 1SXIA 3MB8A 3AEQB 1XA4A 3WNZA 3U9TA 3HKBA 3W1VA 1NBIA 2WTMA 2XUHA 4F4JA 1OV6A 1PJ3A 5KWEA 3ZCUA 1RQGA 1ULSA 2RKBA 4GR5A 1UDWA 2QX9A 1TA4A 1WXGA 3GARA 3K2QA 5CJ2A 5LA6A 2H4FA 3NDJA 2GKOA 3TQRA 3D6UA 2IYPA 1ML3A 4EB0A 3W5DA 5HF9A 2OGZA 1AM4D 1MX5A 1MV8A 3ZGVA 3REQB 3E53A 2X8WA 3SZGA 4NH0A 5G3YA 1AO0A 1YJ5A 4H7IA 3ETCA 1YJQA 1EQ2A 3DZIA 1RWPA 1CIPA 2AL7A 3MMZA 4OM8A 4X41A 4BVJA 5AWFC 4BNDB 4WQMA 4DLRA 3LFUA 2QIOA 3AZOA 3R09A 1W4ZA 2DAPA 1MEOA 2HDHA 3SPXA 2XT9A 1Q7EA 4EPXA 1GZ7A 5B5SA 5HG0A 1II8B 1GTMA 2VJCA 3TW8B 2YL2A 4AZ3B 6AT1A 3GIDA 2N0SA 1B8VA 4XB6B 1LK7A 1JIJA 2FPWA 2ORIA 1YRHA 3R20A 4NQZA 2J7PA 4ZDWA 5IW8A 4A0HA 4N3AA 5A5DA 2RGRA 1D03A 2H52A 1QAMA 4ZU1X 4B3CA 4MYTA 3K4PA 5A7GA 3L6OO 4X5OA 1L7EA 2BKEA 1I32A 4XYMA 2R00A 3ETNA 3CRMA 3CLUC 4X1OA 4DBLE 3IIKA 3W05A 3CWZA 5EHNA 1A8UA 3L43A 1YVPA 3RAGA 3UJDA 3WX0A 1CIJA 3MS7A 3EEFA 2V6GA 2XMQA 4RDIA 3W3AH 1TO6A 2DLDA 5FWXA 3B9RA 1E6WA 4Y1RB 3V34A 1SNYA 4OAQA 1HNNA 2PKQO 3NWPA 1L4BA 5AKZA 1Q3HA 4BVLA 2GS9A 4DMKA 2Y1EA 1GU0A 3WNVA 4DCJA 1P3JA 2H5LA 3U1VA 2PRSA 3PVSA 2G9UA 3LP5A 3QE0A 2GN0A 4JITA 2GZ2A 4PPQA 1I7DA 3ZZMA 4QTUB 1F06A 4O1HA 3DV0B 3NVDA 4EGFA 4GC5A 3CE6A 5F77A 1D4ZA 2HHJA 2DZDA 3RIXA 3VISA 2O2XA 1WM1A 3G3EA 2FZCA 3VPSA 4LTNA 3ROFA 1E9EA 1EFLA 2HIMA 3AI2A 4C6TA 4C7XA 1NBOA 5L9AA 5L6MB 3CMCO 1ESZA 2A9VA 4MW4A 3FFBA 3D8BA 1NVMB 1EK1A 2Q0SA 5K3FA 5JAUA 1FNDA 1GTL1 3DLAA 2QAGB 4FQ5A 4GPEA 4R8MA 2C1EA 4DVGA 2OWEA 3I2KA 2ATCA 2ZBUA 1I94B 3VXKA 1VECA 2RI6A 4NTZA 1AKYA 1C50A 1G1AA 2NU9A 4H7DA 3SXJA 4Y2QA 5BPFA 2PE5A 4V1CI 2P6MA 3ITKA 5EHIA 1F0PA 2RC6A 3NBKA 4NSNA 3G2NA 2ZSBA 2H8GA 1HLFA 1XK7A 2ZXEA 1L7QA 4HN2A 4X95A 3T52A 2ZU6A 3KPJA 5KX5F 3MCVA 3FIUA 3KAJA 2MSNA 2JA2A 2PSFA 4L9RA 7AT1A 4LZWA 4LXYA 4N5LA 1E63A 4C29A 4RK7A 4U6NA 2F64A 5LKRA 2HRRA 3HJRA 1CY1A 1VI6A 1GITA 4WCFC 4Y9SA 3KLOA 5SZJA 1WE2A 1QVVA 1U2GA 2AUMA 2E2WA 4YP1A 2IXTA 4YAOA 2VZ8A 2GPWA 1NXWA 4IIJB 2FRVA 1FSPA 3HLKA 3DAGA 5FTKA 3MK31 3QFTA 1VLJA 4KGDA 4LMRA 3AM4A 4CCSA 3I12A 2OENG 2I1QA 4LXGA 2ORYA 3CTMA 3GWGA 5AUOB 2XYGA 4NABA 3NDBB 4P1ZA 4Q66C 1TUBA 4QZVA 1E5LA 1R0LA 3ZS8A 3ZCSA 2VDOB 3L5KA 2GHTA 3LLUA 1F7UA 4G9BA 5LJIA 2WUDA 2XHEA 3DOIA 5AKJA 1VCIA 3FPLA 4LX0A 4UQOA 2NXJA 5HZHA 2E4AA 4S1OA 2OHVA 2JD1A 2X0EA 1XZEA 1RZUA 4H7HA 2ZAGA 5HDBB 2CBZA 2JJ2D 3EQZA 4IHJA 4CT5A 2G9VA 2WG0A 4Z4EA 1B93A 2BPOA 3NHWA 3PXDA 4LYAA 2GEVA 2VPTA 3BMXA 1GYQA 4X3OA 4IVNA 4XTRA 4KR6A 2HQOA 4YRIA 1ESCA 2I9PA 3KD2A 2PTHA 3BB3A 3ZV6A 1CEYA 1C29B 1W52X 4ED9A 4JLVA 1JHQA 4GOKA 3R6DA 2Q5JA 4EGSA 3PWKA 1RIIA 3P2KA 1VPVA 5C52B 3ZDAA 1SD1A 2VH1A 4AC9A 1KMMA 1ZK4A 1G2OA 1WXDA 3STHA 3U7EB 1LZKA 1T2UA 1H6DA 2IWHA 3UCXA 2CCKA 4DYDA 4EX7A 1J70A 2ZIGA 4I66A 3PPIA 1F60A 4TXLA 3G6WA 1ZDMA 4O08A 2VFAA 3BK7A 4RPKA 3WSVA 3COWA 2Z83A 1CR6A 2QN6A 4ROSA 3T7DA 2NU8B 1OTXA 4LFCB 1Q7BA 1Y7LA 4D43A 1BQ3A 3RRBA 3HP4A 3LX5A 3Q7PA 1T3ZA 3N74A 3ZY3A 5JFOA 4LHEA 4EDHA 3MB5A 1TT5A 3O1IC 3VMMA 3OIFA 1TX4B 1T0UA 3PSAA 1H94A 1FRQA 1Y3FE 2I2FA 1TGVA 2I4LA 3IESA 2WYUA 3C7CB 4OA5A 4TSKA 3DKIA 4QG3A 4KQMA 1KDZA 4KXNA 2GEJA 4Z86A 4MMYB 4QFMA 1A4UA 1ZVVA 4OHXA 4EYQA 5A5FA 3OJ0A 5JJKA 5GAJA 2C03A 4OK3A 2R1ZA 1UFRA 2C96A 1I3LA 5DW0A 4TMTA 2QT9A 5C1DA 2AW3A 2NUAA 1T6YA 2O48X 2Y3IA 1IXSB 4RWEA 3T0IA 1Y4AE 1HYBA 2N42A 2VDPB 2B8TA 9ABPA 4ZARA 4NMMA 1MF7A 1RWXA 1WBJB 2PAAA 3GJ5A 4CL2A 1AS3A 3DQQA 3R5JA 5T6BA 2OILA 1PHRA 3EWIA 4FHZA 4XCXA 1NVXQ 3BG5A 1WWKA 3N05A 2E18A 1WB5A 1COWD 1LPPA 4GRDA 2P9CA 1SUAA 2YFYA 4H3KB 5L3ZA 2IYLD 2MCFA 1BE1A 1JXMA 2DE0X 3W06A 2D1SA 1EK2A 2BKXA 3I4LA 3HYCA 4JBIA 3L02A 4EJFA 2HR1A 3ACBA 4NARA 4FTWA 3K9HA 5BQPA 4YCMA 5L53A 4KR3A 4K6GA 4M8KA 1XCMA 4ENUA 5EXPA 2ZUTA 5K3OA 4QOEA 3KR0A 3GFFA 4LHVA 4UM7A 1TCCA 2C7QA 2AW5A 1TA9A 3T54A 1FFHA 1Q1ZA 2ZM5A 3KKLA 3LRPA 1EFTA 2R1VB 4IHJB 4LKOA 2QQEA 2ZRBA 4EYGA 1JQ5A 4F8JA 2QTZA 4AY6A 1J25A 3H9BA 4DUGD 2IS4A 1T13A 3TL6A 4RTRA 2PBZA 4C5BA 1EI9A 5EJ6A 1CFJA 1U0SY 4DLUA 4L4ZA 4ZMSA 1SQGA 5I9BA 1HE3A 3IAAA 3JQ7B 5K99A 5PNTA 3K9GA 3FBGA 3SG0A 3V6MA 2WJGA 1P5JA 1R8QA 3TKLA 2OMEA 3E9DA 5EMNA 2ZEJA 2N1BA 2VHUA 3OKPA 2GFQA 1JN0A 2E4ZA 2FHSA 3EVGA 3KYDA 5I9NA 4RX1A 2HRZA 1Z6XA 2GEKA 5DTIA 3ZG6A 3OLWA 3DDWA 2D0PB 3TTXA 1AXRA 2DFVA 4IS3A 3UYKA 5C5DA 1GXSB 3TSZA 3M83A 3GMTA 1A4IA 2KPOA 1QV7A 3UJ6A 1VB3A 3FCYA 2YWDA 4CZ2A 5KYKA 2XF2A 1LW6E 4BL5A 4RTLA 2FJPA 1P31A 2Q29A 3TMAA 1UODA 4IF4A 1YK0A 2A5DA 2I91A 2AI3A 2QTLA 3RWMB 5KC9A 2AQHA 5INTA 2PZEA 3HR8A 1QP4A 2GBPA 2ZRFA 5FBVB 1YZQA 1TZBA 3RS8A 3ZW9A 2WV7A 4UM5A 1U0EA 2BGUA 2P41A 5JY6A 5K03A 3K6KA 4HT3B 3NAMA 2ZUEA 3JYLA 4X61A 3TRDA 1PSDA 3MJTA 2RC5A 1XEAA 3F5MA 4NDNE 4ZPJA 2CCJA 5FOVA 4DM7A 4ZJYA 2AH5A 3KO8A 5COBA 3WRXC 3EB9A 2A0YA 5C8YF 4WV3A 3HYSA 5BUZA 2QNRA 4U2EA 1ILEA 3EVZA 2WHPB 1WHTB 5FTJA 4MGHA 3PC8C 1RQXA 1Z0AA 3DHEA 1XTTA 2DWQA 1UP4A 2DWPA 3F1LA 4NK4A 3QFRA 3M3DA 3WLNA 2GYWA 4OJKA 2I62A 3CRZA 3SZOA 4FHGA 3C4QA 2ANCA 1WQ3A 2ZPUA 5K9ZA 1H2ZA 4IIEA 4RMNA 1M2GA 1XQYA 4LN1A 1MB0A 2I80A 3UHOA 1T6ZA 3ZBTA 2A94A 2ZB4A 4P9NA 5E1BA 2CLSA 3FIJA 4R3WA 5BNTA 1ACJA 4LZPA 3KV1A 3FPFA 4PLWA 4DSOA 5ICEA 3KJZA 5A3QA 3BTSA 5J40A 5CT4A 4MO2A 4FYHA 5H83A 4L3VA 2FLVA 1BW9A 1XZFA 5DTRA 2ANBA 4HN9A 3BFKA 4KVFA 4TKMA 5AP9A 1ZJWA 3QUAA 4BOYA 1Y63A 3HDHA 3WRYC 3DLCA 3AKEA 3L7CA 2GN2A 1JHXA 4WK6A 4KSBA 4IIYA 3OPVA 4ZT5A 5T57A 1NIPA 3ZIDA 1V47A 3HO1A 1PZXA 4Z3OA 2GETA 1UUFA 5IN4A 5AJTA 4RDHA 1HWYA 4AK9A 5MN6A 5DRYA 2JEZA 5B3KA 1NMXA 1YZFA 3LXRA 4ZC8A 1I6WA 2JFPA 2NVBA 4P83A 5H3CA 5M34A 4Q4AA 1A1SA 4CKWA 2I55A 4Q7EA 1WPQA 3AB3A 1BRTA 4JDUA 5G0WA 1WCIA 3JVEA 3I2GA 3EVCA 3JQAD 4OH1A 2BM9A 4O29A 2OFFA 1USWA 1N33B 4TZKA 4BNZA 4UCXA 4WJKB 1S0UA 2Z30A 1T5HX 1LJ8A 3T5AA 1OU0A 4E14A 1YA4A 3AJ9A 3EXG2 1UAAA 4F84A 1JYSA 2A0WA 2Z5FA 2VJDA 3E9MA 3IEPA 1D3AA 4KOEC 3T7AA 1VYTA 1CZKA 1X1QA 1DAEA 3SDBA 3IA2A 4QLBA 3LU1A 1WULS 1QLJA 2PUVA 2C54A 3UMSA 3KB8A 1BS2A 2I22A 3HY3A 4TQAA 2IELA 2DLCX 1JQAA 2BMEA 2GO1A 2QRJA 1K8ZB 5D87A 2A9QA 4OAPA 1A5SB 3WLJA 2IY7A 3OZXA 1C0PA 4ENTA 4LYJA 4EX6A 4H27A 4U2KA 3PC4A 1NT2A 3GVIA 3O8CA 1JQBA 1LLQA 4US1R 1W35A 3IUPA 2CXRA 3SXPA 2DFTA 3QFSA 4MYCA 4NL4H 2FSUA 1JR4A 3SJBA 2E48A 3WJ7A 4OFBA 5T3UA 3L7BA 4C21A 3FFWA 2J5BA 3THXA 3D0RA 3I0ZA 4DC0A 4PTLA 2GO7A 4MLPA 1JLHA 2E6UX 3PHLA 3O3MB 4Y1RA 3CLHA 4ZT3A 5CFOA 3FWPA 3VU0A 3NORA 3NCTA 4E5VA 4I5IA 2NM0A 4IGIA 1OYWA 4L1KA 3I73A 5AW0A 3JQ9A 1G8JA 1P4SA 5B7PA 5EIXA 2BGIA 5ESXA 4KBFA 4XQCA 1ZUWA 2YDXA 3WJAA 5HJ5A 1GGJA 3KQHA 4RTOA 3WMXA 4IY1A 2J9XB 3ZDRA 4D6XA 1QZ3A 1OAKA 2CXSA 1O1YA 1ZGBA 3SLGA 4E21A 1IJFA 1USGA 1W581 1IUOA 4ZWNA 4O1MA 1GGKA 4JV5B 1E1RA 2BEUA 2G08A 2CXOA 3MAJA 4U2FA 5AUQA 4IWXA 2PYDA 2DPHA 3HSKA 1W48A 4Q7LA 2H0QA 4Q15A 1DCFA 1DQZA 1K06A 1E8NA 1WTCA 2NTJA 3WYBA 4ZZIA 2ADMA 5ICGA 3OQ6A 1XRPA 3P9XA 4X92A 5ECYA 5A6SB 3AHEA 4QBGB 3ND7A 1TYZA 1H6BA 4AJHA 3C8UA 5DNDA 1TCVA 3K9LA 2B4TO 3O8QB 2ZUSA 1LVGA 4GMKA 2Q28A 1LPOA 1VL1A 5J5AA 1RBMA 3SJ7A 4CMIA 1YF3A 3HVHA 1KETA 2VZ9A 3CLRC 4UU7A 1BN6A 3QIVA 3QU7A 2XGJA 1DOZA 2BFEA 3ECCA 1FQKA 1TM2A 2FEOA 5DN9A 5B2EA 1TNDA 2EBWA 2XKBA 4LJ5A 3UM9A 2CT8A 5TF4A 4KWCA 1U5CA 4A2CA 4CEJA 2KLHA 1WSDA 2B78A 2P69A 4NH4A 3NW9A 4WEOA 1YCGA 3IT0A 2CYBA 2JAUA 1DAFA 4KSCA 5EJ8A 4MDYA 3J7TA 4EO9A 2SBTA 2ZJZA 4KUEA 1CJUC 4KU4A 2YWEA 1JEAA 3ROTA 2I7XA 1EFPA 1JVNA 1U3FA 2VJMA 3CH6A 1D8AA 3JZFA 3QE2A 4K9PA 3AESA 2PY6A 5GZ6A 1I8TA 1KEPA 3EOZA 3TX6A 3UMFA 3X0DA 4C4RA 5BR7A 4KX5A 1E6EA 4I4LA 1RFLA 4JQYA 1DAHA 3FOWA 1UJ2A 1SH7A 2PCJA 3G1UA 4XEHA 3USES 3ZUPA 5C1BA 2XF8A 3C7TA 3PQCA 4H08A 1EDDA 3RBZA 3ZY4A 2JJYA 2QN2A 5IK2A 5TPWA 5JJ5A 3CZ4A 5THKA 4R54A 1Z18A 3ZXSA 4CL3A 4LZNA 5FFNA 4RYLA 1DX9A 1UCFA 5KSWB 3RTBA 2OGUA 4AMZA 4ZZ3A 3E9YA 3ME5A 4YB8A 1M83A 4YT4A 2HA7A 2ODEA 2Q8PA 3B82A 3BCUA 4XRRA 1WDKA 4TMYA 5CYFA 1AGNA 3BD7A 2E4VA 1H8HD 1HF3A 4BEVA 1OA1A 5EXDA 1N1MA 3AYXB 3SBXA 3IS3A 4ZDJA 5FX2A 1VG0B 3NIGB 1SR8A 5LR6A 4Y2VA 3LUHA 2GZMA 5EINA 4F2PA 2FX5A 2Y6UA 6GPBA 1G6KA 1U28C 4AY3A 4PQFA 1KE2A 3INGA 5CT9A 4DCOA 5BQXA 5EJFA 3U7GA 1IBMB 4GYYA 4PYNA 2XA2A 3BMOA 1KHHA 2EZTA 1DEOA 1T24A 2YYYA 1SCUA 1R8YA 5G0TA 1TVEA 3T3EA 3N07A 4HDSA 4F60A 3T0FA 5BP7A 3V97A 4AZ0B 4R2KA 3JATA 2QNIA 1P91A 3LPDA 4GKBA 2AK3A 4L07A 1DAIA 1B14A 4YRGA 5KINB 2IVFA 3OQOA 1F2TB 2R96A 3EXFA 1RI4A 2AF3C 4G97A 4AYWA 4BUJA 5GGYA 4NBSA 3KCQA 1WB9A 2EL9A 1YB7A 4MINA 5I9TA 5B7NA 3NGLA 4Q3LA 1I14A 2FDXA 1KQPA 2PZJA 2Q4EA 4FYPA 4Q7MB 4RW0A 3DD1A 5A05A 2D5IA 4BXOA 4MDEA 5CVEA 3BXGA 3LUCA 5E6UA 5LXTB 2WZDA 6PFKA 1A9YA 2W0MA 1EM8A 5HZKA 4M2LA 3QENA 1USIA 4NVRA 1MENA 1UPUA 2RIRA 4MUEA 2I2CA 5IAKA 4HQFA 4EPVA 1LF5A 1QH9A 3TLXA 3ES9A 4X97A 5JVDA 4WESB 1VL5A 4TTTS 3FCUB 3VBCA 2RAVA 2OV8A 4O8ZA 1V96A 5C34B 3KHSA 2PX4A 3DCNA 1F3OA 2FCRA 1UXHA 2R1VA 2Y2UA 4P2BA 3TN7A 5JRDS 1W0CA 1ZHFA 4PGFA 1UC4B 3FVWA 3FWHA 3HJUA 4KR9A 3ZBPA 1NPYA 5CYPA 2EEPA 3I8SA 4TTIA 1KXZA 1ZOSA 2P4QA 4O4IB 2MSLA 4R5MA 1ZISA 4F1WA 1U80A 3Q8LA 4OJNA 1B1CA 2WY2D 1FDUA 3OU2A 4AZWA 3CM0A 5FLKA 1XMPA 2GD6A 1K4YA 2JI8A 2W43A 1TIKA 1NR7A 1GA4A 1Z3CA 2QZ4A 2EBHX 2R68A 3E61A 4H4EA 4YP5A 4BIIA 4EKNB 3EUEA 2B98A 1L7VC 3QYJA 1LTKA 2JH3A 4KG7A 5AVOA 1IBSA 5T4EA 3WBFA 3PGLA 5J2UB 2A1IA 1N5MA 3ROZA 1BH2A 5BV7A 2WAOA 2BKAA 2XNCA 2JFFA 2ACEA 1IBCA 4TQUS 3N39C 3A9WA 5FA8A 1Z68A 3VPBA 4BJHB 4ZI2A 1SZJG 1Y8AA 2DUMA 4GXTA 3HYLA 3ZD9A 4Z3DA 5KJFA 1N7GA 1X7GA 1R9NA 2DHCA 3GJXC 2I2AA 2XKAA 3A6LA 4BVGA 1QPGA 4QGSA 4XYLA 5BVGB 3EUWA 1F0KA 4DLVA 3ILVA 1GL7A 3R0QA 1SA0A 2H5JA 2F3RA 2ZTSA 4EBFA 4IMRA 8GPBA 2EZ9A 1F4LA 1SC4A 2DP4E 3W1WA 3TOCA 2FR1A 2CUTA 1BJRE 3M6FA 4GF5A 2FWIA 1VBMA 4MI9A 5DFAA 1WCIB 4TZTA 3H65A 4CUZA 5ECWA 1EFPB 2IXEA 5DMXA 4F2WA 4RPCA 3SHOA 1SCNE 2FX2A 1B2RA 2VCHA 1XCBA 1ZNQO 2V7QD 3AIIA 1VPTA 5F7ZA 3RUDA 4HQ0A 2O54A 1QYXA 3FFAA 5BSEA 1YK1A 1P5ZB 1M2VB 3B7WA 5D00A 3W4IA 1KEEA 3GB9A 1BX0A 3LC0A 3OQVA 5EXSA 1M10A 5FF9A 2RBEA 3OE4A 1K8RA 2LDBA 3A1CA 1FP6A 2Q1SA 1K7SN 4Q3EA 1UQUA 1GG2A 2WBLC 4KN9S 2JBAA 2G7ZA 2QJOA 5EUQB 2UZ0A 1P5HA 3BE8A 3GFVA 2R7AA 3NJ4A 3VNVA 1Y42X 1YIOA 3FB1A 3NPMA 3DZFA 2O8NA 3NHMA 3P0HA 2QLFA 3GA0A 3G5LA 1Z35A 1VJGA 2B6NA 2HPVA 5FEMA 5KO2A 1Z62A 3IBFA 1YE5A 2CVQA 4J4BA 1SBTA 4MLCA 4BEBA 4RIHA 2GCIA 5LA6B 4PX9A 2O3RA 4QSHA 1WCV1 3TTTA 4IRUB 4I3GA 1C80A 4IJMA 4NV0A 5IPFA 1CJVC 3NEPX 3OEEA 3MMSA 4M54A 1FCJA 5IS2A 1ZSYA 2WT4A 4P81A 1E79A 1PTKA 2H92A 3B38A 4QE3A 2VAMA 3JQPA 4UU1A 1L5OA 3QWHA 1OFVA 3R0XA 1WETA 3GDWA 2CDNA 1G20B 2QW8A 4FMBB 4CQNA 3DLPX 3LF2A 3EFHA 3LVQE 1C2TA 1F9AA 1PQPA 4D0SA 5IG2A 4MQEA 2VWGA 4RF3A 2VF2A 3NEAA 4RZXA 4CXMA 4IXDA 1PV1A 1KVRA 1TZKA 1OAOA 1VSQA 1X19A 2BI7A 4BDTA 1YMUA 3HSYA 2PS9A 4BNDA 1EAYA 1MAWA 1BWPA 2FSPA 3HMQA 5AHRA 4OGKA 4WBSA 4JY7A 4X00A 1TK2A 2O6HA 3DTVB 3SS7X 3TM5A 2G1PA 4JLWA 3IYLW 4TLEA 5B37A 3UAZA 4CMBA 1Y4ZA 2WSSA 3QLVA 5K8IA 3E9ZA 1CZNA 1T9HA 4WKOA 2C8JA 4N8SA 3KXPA 1UPBA 2IUYA 4HAXA 1B3BA 2LCFA 5BVGA 3WV5A 4D92A 4UD2A 5B1IA 2BFEB 3UA4A 1CY2A 4DREA 4X3CA 4A36A 4JVSB 3FKQA 1PDOA 10MHA 4IILA 2C4VA 4BO1A 1G5RA 4W6QA 2FSGA 2JA1A 4FZRA 2WF7A 2WTXA 1KI8A 1VL2A 2YASA 3RSLA 1S7GA 4JLNA 2GEUA 3ZLTA 1QXSA 3P2YA 1ZITA 3NHYA 4V1CA 5LLTA 4RESA 4KSYA 4V2IA 2DG2A 4QDXA 2X0DA 2R7KA 2C94A 4CCYB 1W29A 4H6PA 5CB4A 3PUWA 2I3GA 1G9TA 2A9OA 3QZUA 4R4JA 3SLKA 3WK4A 2ZYAA 1G17A 2QY9A 2P67A 1DARA 4MIKA 3ZWWA 3ER8A 2JZNA 3AFHA 4NULA 1I01A 1XD9A 2ISSD 1ZMTA 1CFZA 1M0SA 2NZWA 3M89A 4AUEA 1N32B 4GSYA 3DOOA 3X1MA 4R69A 1KKUA 2GAOA 3MWDA 1SURA 1T43A 2ZJYA 3HJNA 1ZA2A 3BE4A 1UKAA 2XA1A 1CUFA 3WAKA 4RGBA 1G5TA 2GEDA 3DDZX 5BVHA 4O8CA 4R1LA 3LGAA 1J2EA 3E0QA 1U0OC 3F46A 4YREA 4MWCA 5EJ4A 2O8CA 1L8XA 2HMAA 1DKUA 4I5FA 3DO5A 2RG7A 3BBPA 4Q39A 4AWAA 2ZJ3A 1L1EA 1W94A 3AEUA 3QKRB 3IE0A 3VNUA 4MR9A 5FHRA 2DT8A 4E22A 3RPEA 3U4CA 3UXHA 3I9OA 2JAWA 1DBRA 1PV2A 2GF2A 2IQ5A 5LA6F 3ZHQA 4ZVRA 4Q93A 2P9QA 1U7ZA 3CR3C 3R1IA 4ZYYA 5SY6A 2O50A 1L1FA 1OFTA 2IZZA 1V2GA 1DC8A 3CX8A 4K7JA 3I9KA 4G41A 1DQPA 3DZDA 4YGXB 1O08A 1PG0A 2BHRA 3M70A 3OWOA 4ND8B 3RBVA 1I33A 1XZIA 3HM9A 3QLUC 4JVMA 2UVQA 4YQZA 3W5CA 2QR3A 4R9SA 1NMYA 1PJ8A 2FEPA 1XMIA 3ANNA 3GUCA 4QBFA 2DFDA 5C51B 2FPLA 3HM2A 2Z2ZA 3U4QB 1WB6A 2GHIA 4DB2A 1ADCA 1S3IA 4YBRA 1RM5A 4CG2A 1ODIA 2X6TA 3W9BA 1ONOA 1RRPA 4YLYA 3A37A 4NONA 4I4CA 1I9CA 4ATNA 1PR2A 2J4FA 3GGJA 3IXLA 4BFZA 1P4JA 5FOSA 3VYTB 4BFUA 4KZPA 4QPPA 2IUFA 4ZOLB 5IKPA 3HZOA 1S2LA 2OXEA 3ETDA 4ON9A 1JAHA 4EJSA 2JBHA 5AQ1A 4LF4B 1NATA 4MKIA 3OKCA 1AGRA 5BUCA 3IHWA 4IHKA 2IZOA 1JVSA 2W9XA 4RD2A 1NQAO 3RYFA 3AEKA 2W2PA 1UIRA 4D8TA 4A16A 4XM2A 5AI5A 3MFYA 3SF8A 1XA0A 3K3PA 3UBTA 2E55A 2HL6A 3ROQA 3VR2A 4M87A 4Q82A 2P5UA 3GJTA 2H00A 5FL3A 1DJQA 3KALA 3L9XA 5HHTA 1B0ZA 5JADA 1K5DA 2AQIA 1OKKA 2C2GA 4HTAA 3HBFA 2VO1A 1Q0PA 4WD3A 2Q2QA 3ONNA 1GL6A 5TVGA 2R62A 1GIAA 1V48A 2AUNA 5K45A 1C9DB 2QPOA 3G9ZA 3I0MA 1B00A 2XOXA 1FBNA 1DT5A 4CKEB 5MN5A 2GA8A 4HX9A 1YR7A 2YV5A 4IDEA 4AY4A 4CCWA 2FP4B 4B7CA 4C87A 2CMHA 2HNKA 1WX1A 2ZJ8A 3C6ZA 2WFLB 3ICWA 4GNRA 1RWBA 1EG2A 2HU2A 3KOUA 1E59A 2FWNA 3WWZA 3JAMA 2ZPAA 3RS5A 4CT0A 1ZEJA 3KKOA 2GLTA 4MA4A 4JJ7A 4EPRA 3FNEA 5HMLA 1RLUA 4KR2A 5BQFA 2G72A 3OEYA 4PCUA 4PLVA 3NJ8A 2Y0DA 1K8QA 1UT8A 1QFMA 4B3BA 5CB6A 2O8CB 1Z16A 1H3NA 2D4HA 4D98A 4LHSA 1I7QB 1U1EA 2ONKA 2JIDA 5DHAA 3NM5A 4M1QA 4JX8A 1QCDA 1K5HA 2BFFA 5A1TA 2DULA 5B1SA 3I62A 1Z7EA 1VL6A 2PX0A 1OXBB 2CBGA 1MW8X 4CLOB 2EKZA 3MC1A 1Z5GA 4AFNA 5F52A 1NY5A 2Z98A 4WACA 1GARA 2WF8A 3OCXA 1XSEA 1MO6A 1G63A 3VU3A 4WUVA 3LHFA 3JAKB 5DI9A 2RGEA 2DH5A 3A2KA 3TLGB 1E69A 4KNVA 5JEDA 1J9GA 5E3HA 4JHXA 3RUAA 3CVXA 2CVFA 4P7JA 5H4GA 3PJRA 2OBBA 2AXQA 2DXIA 4QKQA 1D4AA 3IHTA 2RI1A 2AHOA 2UYQA 1NUQA 2EEZA 4H15A 4V0NA 5IBRA 1XEWX 4G0PA 4JOSA 4PHTA 5L6LB 1L4FA 1P9RA 1W5SA 2FSHA 2H31A 4BMXA 4DDWA 5U9CA 1CUUA 1Z5NA 3EXG1 4LQCA 5E4FA 5CFRA 1QYIA 3QXSA 1QHSA 1QV6A 3KUKA 3PGA1 2P7IA 4Q47A 2QPLA 5DVZA 4N76A 4BNNA 1U5BB 4EYKA 3FOFC 3TCNA 2Q1YA 3AM5A 2FSVA 2PUGA 3OQBA 3GEMA 1AURA 3ENKA 4MJ7A 1E9RA 4EFLA 4WINA 1XZBA 4D4LA 4P7GA 2RHTA 1L7BA 2YHIA 5G1NA 4Z54A 3AVTA 3K16A 2XUPA 4E3ZA 1SVIA 3KB6A 4Q1DA 3SC4A 4EJSC 3DEKA 2CWWA 3FM9A 1PJBA 1VG8A 3NVAA 1JQKA 3EUFA 2IGBA 4QHTA 4LDAA 1NONA 2GYUA 3EEIA 1YFLA 4Q3CA 1N1EA 4QM6A 3QBJA 1XLTA 3DAPA 3PFFA 4HEQA 1E32A 2BBOA 2HA5A 3D1LA 5I3ZA 1M7BA 1T2FA 3H9CA 4W4TA 3T7KA 2J87A 1DFGA 1NU8A 2EFDB 1LA2A 2ODTX 3JQEA 1AV6A 3C3PA 4F5YA 1DXOA 4RMHA 2FWAA 2CFCA 1LD3A 4K6MA 3WGIA 2B1IA 5CBKA 3DKRA 4RK1A 3LNTA 4CIBA 2G70A 5FL7D 3TEFA 3EGXB 3PYXA 4KAJA 2WWXA 1MJHA 3EX7C 4D9NA 5FFMA 4O3MA 1F6WA 1E2PA 4CKYA 3P8ZA 3T3HA 1UWVA 1BXZA 2QE7D 2R00C 3LDAA 1W44A 1JLKA 5ILGA 1CE8B 2YV2A 3WDKA 2J3MA 5DRTA 4IUDS 3T7SA 3R3JA 1B4DA 3TQCA 4C0BA 4CGYA 1OFUX 2WU4A 4YASA 5FOWA 4F8YA 4DYHA 3JYNA 2POCA 1Z4IA 1E2HA 4Y2UA 2GMWA 5CR9A 5AI0A 5EE5B 5JRJA 2IYOA 3E18A 3OHSX 1NQTA 1NURA 2CJPA 3ITNA 3N2IA 4MYSA 4TXHA 3ZK8A 4K3UA 1ST2A 5JD6A 2HSEA 3GLFA 1IQ0A 4BB0A 1Z7BA 1XQWA 4NC9A 3Q5GA 4FLFA 3K1YA 3U7RA 4A03A 5A9RA 5SYAA 1PU2A 2PKEA 3A1EA 1DU4A 3ABRB 2KSQA 3L2OB 4QOSA 1W36C 1LBHA 5CDFE 1W8DA 1LLUA 3SGLA 3V5NA 3RVPA 3JPYA 3R6LA 3REGA 1C9MA 3ED1A 5A5EA 3A1FA 1C8VB 5CA1A 3W04A 1UKVY 1CY7A 2GZAA 4JLBA 1CZLA 3CR7A 1M8KA 2X0RA 4RE5A 1XKTA 3A4YA 6CHYA 5I01A 1G7SA 1MT0A 1EUQA 3RAFC 1L5VA 1GNRA 4YMVA 4CCYA 3SEQA 2OHXA 4NIMA 2ZWIA 1T0IA 2I2WA 2PKCA 1BHJA 2Y99A 1GGMA 2C78A 2V6BA 4OM7A 3UMRA 4CKXA 3ZXYA 3IT3A 1F2TA 4GOND 4AWXA 3K1JA 2WVGA 4PO9A 1P62B 3O0TA 5TS3A 2X2FA 3NYWA 5TGDA 1X3LA 2IHTA 3T1QA 4DR6B 3II6X 3ZJYA 1TRHA 5G02A 1O94A 2BJWA 3KLPX 1UEJA 4BP1A 3O9VA 3U13A 2W6MA 4B0PA 4O2AA 3R8CA 3L93A 1U8UA 1XYGA 5AVJA 3DA8A 3NWOA 5BY2A 5J9FA 4A9AA 4DLWA 1X7YB 3LWBA 3TLJA 4BVEA 4D0NA 4CLDA 3VOAA 1A71A 2R8ZA 4Q12A 4UJ5A 4HAOA 4D0RA 1C7QA 1EM8B 1TUBB 3BAZA 1FRFS 4IFEA 1NW6A 1EGHA 1C1DB 2VQ6A 4OHMA 4EZBA 3PJFA 2F4NA 2O5RA 3HP7A 3M6MD 3ODPA 3B2EA 5D6NA 1IOWA 3AONB 1FFCA 2AB0A 1DWOA 1ZM7A 5G1OA 1CUEA 3UK7A 3O8DA 1W0JD 3HDJA 1YRYE 1FVFA 4GXRA 2RHWA 4V1CB 5T41A 3EDOA 2UU9B 2UYGA 3AHJA 1GM5A 3W0LB 1E0SA 3LL7A 3UHJA 4BBZA 1GLVA 5AJYA 4NNJA 4JBGA 3LBAA 2EP7A 4S12A 2FTKE 5EWJB 1IWOA 2P1RA 3RVDA 4XARA 1NJGA 4V0MA 4EK9A 3F4BA 4YFYA 4EEKA 1NPDA 1J20A 2Q3CA 4ARUA 2RDMA 5BV1A 1TJ4A 5IF3A 1FYXA 3P2EA 2BMDA 1S8NA 3AFOA 2XCOA 4QHYA 1H65A 3SHWA 1GNSA 3H7IA 3AJEA 4KXWA 1U02A 4V24A 4XGRA 2I65A 4XOIA 5KCZA 2H2AA 2FUG6 2ZSFA 3IAHA 3QVWA 4NZYA 3GJ6A 3O94A 5J2TF 1SHZA 4E51A 4EUNA 2NV2B 2YOFA 2OXFA 2IIQA 2WYIA 5I4CA 4BRSA 3H99A 1E3DA 2BZ1A 3HB5X 4YACA 3M33A 3HJFA 1QGZA 5M2QA 1RWNA 1NQVA 4FMCB 4WH0A 3S1LA 3D4LA 5DM1A 2A59A 2J3EA 2EKPA 3LWDA 3O3OB 2ID9A 4GR9A