4MGYR

Selective activation of epac1 and epac2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
150
Chain Sequence
b'EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 47
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgyR00
2QTFA 3SC3A 1ZNXA 2WSSD 4KBGA 1NLYA 2ORVA 4XVQA 4Q18A 1KI4A 3D7MA 4B48A 4NCIA 2QAGA 3SYNA 2EYQA 2WJHA 4RZ3A 2RGNA 2IYLD 4GPTA 1GAJA 3AF0A 2QE7D 4URZR 1CRQA 1XP8A 1G7CA 3TUZC 1KK2A 3RC3A 3FHOA 2FSHA 1OIVA 4EFMA 4YQFA 3B2EA 4TYPA 3RS4A 3F0TA 2HYDA 2F7SA 4ZO4A 5DYGA 2D3WA 1H65A 4H1VA 5J47A 3T12A 1FTNA 1F48A 1OKKD 4WAUA 2FFAA 2Q21A 2C9CA 3P26A 4B3CA 1GP2A 2BBOA 4KFRA 2QBYB 1Q1ZA 1Q1BA 2D2EA 2FPKA 2IYZA 3BB3A 3A4MA 3C7KA 3FVQA 4KU4A 3IDQA 3WRYC 1E9CA 5GJBA 521PA 4PHTA 1SVWA 1M2OB 3G0HA 2OO7A 2WMNB 2P65A 2CLDX 2HUPA 2D4HA 3B7GA 3TH5A 4XTCS 3RWOA 3WHLA 1P9WA 1OXVA 2CHQA 4DLUA 2OESA 2XNDD 3PUZA 2CCKA 3A58B 3NBZC 2EW1A 4Z8XA 4A2QA 1M34E 1TQ2A 1V5WA 2AR7A 3GEEA 1VYUA 2ZRLA 5FTKA 1CIPA 3VR3A 4P4SA 1QVAA 1XMVA 1KYIA 2B8TA 4HAZA 5CK4A 4U5XA 2QGZA 1MO4A 1Y63A 2G88A 2YWGA 4JLMA 5AJVB 3LY5A 4TLAA 1XTQA 2IYQA 5DIFA 1Z6AA 3M4YA 2YKGA 1P2TA 2GDJA 2O52A 2PJRA 1E98A 1NKTA 1QHGA 4TL9A 4XOIA 2WPDA 4LUCA 2BIFA 1OFIA 2ZETA 3NBYC 1ZINA 3C15C 3DPUA 1WE2A 2PLRA 5JCZA 2I1VB 2VLIA 4HUQA 4C0HA 2G0NA 4HB0A 2IS6A 5CB8A 1IHUA 4PC1A 1WCV1 5AK0A 1VCIA 1R5OA 4E03A 2QG6A 2AWOA 3OIVA 5C1BA 3SFZA 3KXKA 3PUVA 3GFOA 3AVUA 4JVNA 4LJ5A 5FOTA 2QL6A 3KFVA 2ZUCA 3HU1A 2WVJA 1QHNA 2ZRBA 4RFVA 5EZ5A 4M1KA 3EIEA 3OE7D 4ZIRB 3GLIA 2HJVA 1YKSA 3LV8A 2YOGA 4Q48A 3RS5A 3FWYA 3NVAA 4NONA 1GITA 4BFVA 5KSYA 4C0QC 3TQFA 2WWXA 4LPKA 1N6IA 2JASA 4DLVA 4B35A 2DB3A 4IHQA 2A7QA 1GUAA 4KFUA 5J4LA 3BK7A 1SXJD 1VDZA 4Q4AB 5M04A 5LB4A 1ZD8A 4OHXA 4B3BA 2WIBA 4O0MA 4HUQB 2QEQA 2QPOA 4Q4JB 2Q0HA 1U8ZA 4RD4A 4B2IA 2OCBA 1HH4A 1G19A 1T3SA 4C2UA 4BFTA 1J99A 2VHQA 4LYFA 4RVCA 4QHYA 2ZYTX 4MUBA 1COWD 4QNMA 3GJ8A 5EUMA 2EWWA 1E69A 1N5IA 2QT0A 2WZQA 3MAAC 3RWMB 3GLIB 3QE0A 3R7WB 5CDFE 3KJHA 1Z0KA 1QHIA 2P3SA 3LA6A 4YMSA 5SZHB 2ZRAA 2QROA 4CW7A 5AJYA 1M7HA 4Q7KA 1M7GA 3EZ9A 2GETA 1NY6A 2VRWA 2ZRMA 5FBWB 1RVDA 2ZRFA 4GZLA 3LQQA 2XZOA 4N0DA 3AVWA 1T8TA 1UEJA 4B3XA 3CRMA 1ELOA 1W4BA 2J7PD 3DZ8A 2ZJ5A 4HI0E 3K9GA 2DHRA 3ZIAD 3JZAA 3DL0A 1E2KA 2JEOA 3NIBA 1U81A 1DAEA 2DPXA 4Z54A 1P61B 4KLZA 3PEYA 5FBRB 3CR8A 4JYCA 4Q21A 4PQYA 1E9FA 1KI3A 1K6MA 4B34A 5TMPA 1XPRA 4DCUA 3PUYA 4CT5A 5J4HA 4A2WA 1PVOA 4G01B 4UXIA 3L2OB 5KNCA 1GL6A 4D6PA 1X6VA 3BC1A 3VKHA 3A36A 1FTSA 2ZS9A 2VSXA 5FL7D 1U0HC 5E7MA 4DXAA 4IDHA 5KSZA 1RE0A 2IYSA 4IW3B 1PV4A 4B44A 1JBKA 1KK1A 2VP5A 2R44A 1YR8A 1E9AA 1N0UA 4DUGD 2GZAA 3EZ6A 5KDLA 2GJ9A 2HV8A 4LX0A 3V4RA 4A9AA 1VCOA 2QP4A 5FPHA 1SQ5A 1UKVY 2RGCA 3IGFA 1N6LA 5FPKA 3SJZA 3T5DA 3WYAA 4A8JB 1S96A 4TMWA 4B71A 4ZV4A 2JCSA 1U90A 2L0XA 2ZRIA 2DWOA 3H86A 2QRNA 4JZKA 4B76A 4V0LA 3PFIA 4CF7A 2JAQA 1W2HA 2V55B 3KKOA 4LYHA 3W6NA 1G20E 2QP9X 1NN1A 4URWR 4DHEA 1JR6A 4JYBA 2XTZA 3KQHA 4LV5B 4N3NA 2O5VA 3QKRA 5KPJA 1MKYA 2ZRNA 2HYIC 1DAMA 4EUNA 3PEVA 2QTVB 4Z1MA 5L3QB 1II9A 1ETUA 3I32A 1RJ9A 3A1UA 1GRNA 1KK0A 1VYTA 3OEHA 1IN7A 4E5UA 4F93B 2AWNA 2GK7A 4TMZA 1XPUA 1SULA 5JHHB 1UJ2A 3LWNA 3CX8A 3U2QA 2R6GA 2UZIR 2YJTD 4M1OA 1VECA 1VYVA 4M1MA 4HSEA 4UNRA 3NBXX 1G3UA 5AJZA 1XTRA 1R0YA 1XEFA 4G5GA 2VP6A 4YMWA 4C0AC 1K5DA 4ACAA 1OH8A 2R9VA 1OPXA 2H17A 1I4LD 2QQ0A 3B1YA 5JRZA 4BFYA 5BN3A 1OIWA 2FGJA 4Z8YA 1A5TA 1RC8A 4FMBB 1E1QD 4JBWA 1LW7A 4LJ6A 2W83A 3ZZ0A 1U9IC 4B2PA 4AIIA 1XB2A 2ZQ5A 3IKJA 3OIUA 3LXRA 1RJ9B 1ZAKA 4I99A 5LBIA 4G5OA 3TR0A 2ZE8A 3TRFA 5L3SB 2X2FA 1ZCBA 2O8BA 1D9ZA 3IQWA 5JJIA 2FH5B 5EE9A 2GXSA 2OAP1 4PZYA 2QP3A 1EFCA 2C9YA 4LV6A 4BFWA 1YVDA 2J45A 1F2TA 2ZE6A 1YU9A 4MGYR 4ILEA 1CJUC 4R71A 3A6PC 1IOZA 4M9XA 2A30A 5BN4A 4W5WA 1TTTA 5IRCD 1NVWQ 2D62A 1FFHA 4MYTA 3NKVA 1NG9A 4JKYA 1GM5A 2OG2A 4JLDA 4JVMA 4LWZA 4JL8A 4ESVA 2DFTA 2XJ4A 4MDFA 4GOKA 3DVLA 2ONJA 2A5FA 2CL6X 4JKIA 1CJMA 1EWRA 1XDBA 1ZM4A 3KDSE 5E4FA 2V3CC 2O0KA 3K70B 4EFLA 3B5JA 1BS1A 4HAUA 2FU5C 3ADKA 1Q21A 3GJXC 2YZ2A 4EPRA 2V7QA 1N6NA 2Z6VA 3VHXA 821PA 3ADCA 3OEEA 3GFPA 3QPWA 2XXAA 2FN4A 5J4VA 3I92A 1U2RA 2GA8A 2WWHA 2JA1A 3MJRA 3WY9A 3W6PA 5KDOA 4EKDA 1EX6A 1F2TB 4CT4B 1ZD1A 2J87A 1NMYA 3B78A 5K8LA 2QENA 1EFRD 1SKYE 3DOFA 3U6BA 1P7CA 2H7VA 4JVLA 4XD7A 2K5UA 4NYIR 1JALA 4NCNA 1XTIA 3CX6A 1UDXA 5FBLB 1OYYA 6Q21A 3UPUA 1KSHA 1E9DA 2GJAA 2OEPA 4PAOA 3QG1A 1RRGA 5KYKA 2GVZC 3HU3A 5JWOA 1SVSA 1W36C 1NLZA 1XMJA 3SHWA 4QBHA 4LJ7A 3CWQA 5TDHA 2YHSA 5L3VA 3QEJA 2IUTA 4QGHA 1E2HA 3RLFA 4DJTA 4QJ5A 1GKIA 2XB4A 1IN5A 1L8QA 1W4RA 5DI3B 1E96A 1KO4A 2AD1A 1XPOA 1E0JA 2XXAB 5L8VA 4TLBA 2ODBA 1X3SA 3FMFA 4U00A 5B2ZA 4TLCA 2A5DA 1ZC3A 2ZJOA 1IM2A 2ODEA 1P60A 2C8VA 4JJZA 3EA5A 1TEVA 3SJAA 1LF0A 2PMKA 4MRSA 1S8FA 4NH0A 4RZUA 4QOSA 4TL7A 3DMDA 1AGRA 3OEHD 5FUVA 2LKDA 4IOMA 1W0KA 4LYAA 2BBWA 4JS0A 1QG2A 2IWRA 4MKGA 2VHUA 4RZXA 1H8EA 4GP6A 1XEXA 2GAOA 2DFNA 1LF5A 4C0SA 4GSYA 3WRXC 3EZFA 3K0CA 1ZNWA 2WTUA 2BC9A 3F3YA 1OXUA 2PZGA 1L2TA 2CVHA 1HTWA 4LJ9A 4KFTA 2RGEA 1HE8B 1AS2A 3TSOA 1UBCA 2IYVA 3SHFA 1NBME 1ZBDA 3U60B 1IY1A 2AN9A 2FEMA 1DO2A 2ODNA 5BXQC 2CNWD 1D9XA 1Q1EA 1EFHA 1F2UB 3EIHA 4QJ3A 3GJ3A 2G77B 4CGZA 2JLRA 3I4LA 2DY1A 2BVNA 4IEIA 2FX3A 4BPBA 1X86B 3A1TA 4LBVA 3ECCA 2JLSA 4I1VA 2ZI9A 1YHNA 1OHHD 3GCGA 4NDZA 4V0KA 3K70D 4IEEA 4NBSA 2J9RA 3SDZA 5FUWA 1D6JA 1NVVR 4FCVA 4EJSC 4BWYA 1SXJE 3RABA 3GMTA 2EYUA 2OZEA 3EWAA 1E3MA 1GRRA 3VR6A 1U8AA 5SZJA 2ZSBA 1JAHA 3WHKA 2FEOA 3BFKA 3W9YA 2HLDA 1DAKA 2SHKA 2G83A 1YZTA 1XXHA 4AC9A 1EESA 5DGXA 4NPHA 4US2R 5JEDA 2CLCX 4CEIA 1H8HA 2NGRA 3QPUA 2QQEA 3X1DA 1BH2A 1E0KA 2KJQA 1OXTA 3NWJA 4KBFA 1J90A 3T15A 2FNAA 3QXCA 1E2EA 2QN6A 3DOEA 1GZSA 1Z28A 2CJWA 1F3OA 2ZVPX 3CIOA 1JNYA 5FTNA 1MR3F 4B6EA 4M1TA 2DFLA 3RRYA 4DSUA 2H18A 4MYCA 4KYIB 4YDSA 2NG1A 5BWMA 1W48A 1Z5ZA 3IPXA 4QRHA 1OXSC 3TK1A 4Q1FA 2V7QD 2W6ID 3AP3A 3UWOA 3K53A 1QHHA 1N6RA 4A4DA 1N2CE 4TL8A 1JEDA 4C0LA 1M74A 5DHFA 3WBKA 2KBFA 4KV9A 4B33A 1VG0B 4DBLC 1XXHB 3QENA 1Q3HA 4HATA 3SYLA 3M1IA 5IDVA 4KAXA 1TQDA 4YONB 4M1YA 1G9XA 1UBGA 2G1KA 4XH9B 2NO9A 1A2BA 4FXPA 1J8MF 2X77A 1AS3A 5GJCA 3X1XA 4Q1EA 2GBLA 1W44A 2CK3A 3MG9A 5JEEA 3Q72A 4ZDKA 1R0XA 3GLHE 5FTJA 1Z07A 1Z6TA 4J0QA 3CW2A 4W5JA 4TSFD 5FH9A 1F60A 1KDOA 5KTYA 1ZM9A 2HJGA 4LV8B 4V0NA 1N5JA 4TQ9A 4Q1BA 4GOXA 2VA8A 1Z6XA 2FG5A 3RS7A 4DKXA 1W7AA 4FCWA 1TU4A 4DVGA 1T9HA 1GKYA 2JDID 3HJNA 4F4IA 3L43A 4JL5A 2GCNA 3PJRA 4LRWA 3L8ZA 2IHYA 2IXGA 1QHYA 4AY2A 1YZGA 4ACBA 3KQKA 5KSPA 1V43A 1XJQA 4OL0A 4OQNA 2F6RA 4OKSA 3DMNA 5FPSA 5FBVB 1OV4A 4W9MC 1QDEA 1BMFD 2NOAA 4HDCA 3HWSA 2V54A 2VSFA 2J59A 2XZPA 2WOJA 1AJEA 2C99A 1KSJA 4F4CA 1H8ED 4OHWA 2W0MA 1ZM2A 1U0JA 2D2FA 4M9ZA 4RJLA 3MMPA 2VF7A 5LB2A 4KLNA 3VU9A 2ZJZA 4L5BA 2Z4SA 3B1VA 1L4YA 3VR5A 2J3EA 1KK3A 1DG3A 5AUPB 4FD2A 1R7RA 3S1AA 1KMHA 5EE0A 2GTPA 1C9KA 4EPYA 3ZDQA 1XD8A 1IONA 4P3YA 4JJKA 5HKKA 1KI2A 1MH1A 1X8JA 4EAQA 1E9RA 3DHWC 4MKIA 2Z0MA 4F4JA 4QG7A 4JLVA 3ZLJA 2AFHE 5LD2B 5A0FA 4TLEA 4Q7MB 1FQJA 2QAJA 621PA 3NH9A 1TEXA 3TMKA 3SEAA 4B2LA 1OF1A 2GVDC 2KB0A 2ZSFA 3K0FA 1KJZA 4WXPA 2GESA 2Z5FA 3G5UA 1ZM3A 3CRQA 4AYTA 5FOWA 1S1MA 4LGMA 4DIDA 4DLRA 4KSCA 2ZU6A 5DI9A 3WMEA 3MGCA 5A4JA 1YQTA 1I2DA 3HYTA 1F6BA 3HDTA 4IOKA 5K8UA 1JQJC 3VU9B 2IF2A 3O47A 1FP6A 3QPVA 1MO3A 1VPLA 2I3BA 4OK5A 1N0VC 2W6JA 3GLGE 2D06A 1D2NA 3WP0A 2OLKA 1KMHB 4I81A 4BRWA 2H16A 4PZZA 4X8HA 4OI4A 1PZNA 2QSZA 3N70A 2JLWA 2CXXA 4TMTA 2R6DA 3UXMA 4PQRA 4TYYA 4DDVA 1JPNA 5JI2E 2C2HA 3CRRA 1E4YA 1OE0A 1XMSA 1KDTA 2KE5A 3TQCA 4RD0A 3OZXA 3HPQA 3B60A 4PC2A 2WIAA 1S3GA 3SU8A 3K0FB 3ZS9A 1JXMA 3W3ZB 2O8FA 1IY0A 1W5SA 4PANA 3VR4A 2R6CA 4NYMQ 1KAGA 5B30A 4JMPA 5AJXA 3UMRA 4URYR 5IF9A 3RSOA 1ZCAA 3FHTA 2AL7A 3LBIA 3T61A 3G82C 3TW8B 2VP0A 2AKYA 2OCPA 4IDPA 1SXJC 5JI3E 1DPFA 4TTRA 2YOFA 2ANBA 4Z51A 1CR1A 3THYA 3HR7A 2PMDA 3GFTA 4DLYA 1OB5A 4DLTA 1OT3A 1KKLA 3SBEA 1XBTA 4IVQA 1A1VA 5AUNB 5TY0A 5UKDA 1GVNB 2A5JA 1N6HA 3C14C 3E5HA 2C03A 3M6AA 4PHHA 1P9RA 3DO6A 2AXPA 5EUQB 1DARA 1UEIA 1XEWY 2HT6A 3AKEA 4Q9HA 5FOXA 1IXRC 3D8BA 1S9DA 4GRAA 2QAGB 4RD2A 1NN3A 5CJPA 4Q4HA 5EE1A 5DN6A 2XGJA 4BECA 3I8XA 3R20A 5LPNA 4QHSA 2E9SA 3HPRA 1KMQA 1VG9B 4RZ2A 2WAYA 4B6FA 3R9WA 2B6HA 2J46A 3L0OA 3CUEF 3KXLA 2NO0A 4BFUA 5DNYB 5HE8A 1QHXA 1T8UA 2FZ4A 4WZBE 4PC7A 3UKDA 4TYNA 2Z4RA 2OBLA 2P6NA 1YR7A 1CULC 4OI0A 3LAWA 4TL6A 1S9HA 1VIAA 1R5NA 5EE3A 4MUAA 1QRAA 1KGDA 1HY3A 3RRMA 3P4XA 2VL7A 1LS6A 4RD3A 1FL9A 4GFDA 2BCGY 3A37A 4LK2A 3NG1A 3PUWA 3ZZUA 1N6KA 4S2EA 4A0RA 4Q4HB 2PEZA 5CM9C 2IX3A 2GJ8A 3SYKA 1NIJA 1NN5A 1IY2A 2ZE7A 1G8GA 3OESA 1N25A 3OAAA 4P4TA 2WKRA 1MABA 4P4SB 4JLOA 2YV5A 1HEIA 2REBA 3GP8A 3ZZTA 3MLEA 1LY1A 4MRNA 4MRVA 1OSNA 4UNNA 2HXSA 3MCAA 4AYXA 4A1FA 1GRQA 4FIDA 2GZHA 2HEIA 2ZAMA 3TAUA 4MQBA 1X8KA 1FNMA 3LW7A 4LZZA 2OUKA 2PCJA 3W8RA 4IXNA 1Z63A 1OH5A 3CR7A 1CF4A 4UJ3A 1E79A 4RKFA 3VHLB 1ZD9A 3AF3A 3ND9A 4DLZA 3QVVA 5H8WA 2IYRA 4N0EA 1SVMA 2FSIA 2DWPA 2YWHA 1R0ZA 1G3QA 3I1FA 4IDNA 2QSYA 4IVRA 2JLUA 3TUJC 5K8TA 4OJQA 2ZI5A 4RD1A 3IHLA 4HLDA 2XNSA 3EPJA 1QZXA 3AF2A 1S4QA 4KJZA 4D4LA 5GADl 3P20A 2PT7A 3CLVA 2W6JD 1XCGB 1UKEA 2GEVA 2BBSA 1TNDA 5FPTA 3LDAA 3X1WA 4DEXA 3RC8A 4DB2A 3NTUA 4PFSA 4NYJQ 4A6PA 3GLGA 1N0WA 2ZREA 4QFMA 5EE5B 3KJIA 4PHFA 4K81B 4Y0AA 4AK9A 3U6KA 1QBKC 1JR3A 4NKRA 4XTRA 4TQAA 3EPLA 3OIYA 4QKQA 3FFBA 3KTAA 4RY2A 1OJLA 1XZQA 4OHZA 4F38A 4ARZA 4ON9A 4OQMA 1XCPA 4IOJA 3IBYA 2XTNA 2IYUA 3P32A 3A4NA 4Q4LA 2NTYC 2VSOA 3ONWA 1OLOA 2NO1A 1II8A 2VHTA 5DO9A 1CRPA 4WVFA 1AA9A 1E2NA 3K1JA 1GNQA 1HURA 3L0SA 3LLUA 4BZXA 2ZXUA 1XD2A 5H1YA 3KJGA 4DZZA 2WSMA 5CLLA 4K8OA 1KY3A 1S0UA 1KJWA 221PA 1UFQA 5FUYA 4DB4A 4POAA 3UATA 2BOVA 4NP6A 121PA 1Q12A 4JLBA 4QBGB 4UKDA 3UMSA 4BGDA 5IK2A 1YE8A 1XMIA 1AQYA 4TTQA 5B64A 4PO1A 1EG7A 1ZNZA 2BKEA 4O2LA 3BJIC 3TGPA 4V0OA 3U7FB 3SS8A 2Q9AA 3DEFA 5HPYB 2BJWA 4PPNA 1PUJA 4AI6A 2MMGA 2W00A 2XSZA 1NLFA 1D5CA 3KTAB 1DVRA 4E07A 1Z0FA 3O8CA 1Q44A 3BH6A 2J1LA 3FFAA 2ERYA 5TV2A 3VNVA 2IYWA 2ORWA 4A15A 3ZH9B 1II8B 3U3RA 5E7JA 1ZW6A 3PVSA 3DM9B 4HDOB 1XD2B 3U44A 4CEHA 3L0IB 5FOVA 1Z83A 1Z2CA 4BRUA 4DC9A 1LNZA 2W2VA 4EPWA 4AD8A 4D82A 1CBUA 4A8JC 1UBEA 4QC2A 5FL3A 1UKZA 2WPDD 4B32A 4AYWA 1J8YF 4BFZA 2BMFA 3GLFE 2O0JA 2H57A 1P73A 4Q19A 4NHOA 4TN1A 1T3HA 5CYPA 3B6EA 4NE2A 2XEXA 3DM5A 3ZVNA 1P2UA 5CB6A 5JJLA 5HTKA 3QI2A 4DSTA 4M21A 1Q57A 3QF4A 1RW4A 1Y3AA 2CE2X 3AKDA 2UKDA 1P62B 2BHRA 3AUXA 3TR5A 1WBBA 2Y8EA 1G8HA 3VQTA 3I62A 1T5IA 3Q85A 3WBJA 2REOA 3PEUA 4UJ5A 2E1RA 3OAAD 1NP6A 3LVQE 1RRCA 4WA7A 1ZNYA 3AKCA 1XF9A 2BM0A 4NL4H 3U44B 2FPLA 2RAPA 5FI0B 1GNRA 4CEHB 2FA9A 3EPHA 2ZJ8A 4KVAA 1P72A 1Z3IX 2Q3HA 3QKRB 4LHYA 5JSZA 3FYHA 3QEOA 1DELA 1G18A 3BBPA 4DT1A 4PPQA 3T1OA 2PLFA 2QRZA 3KFXA 1T91A 4YC7A 2WJGA 2P2LA 4UNPA 5KNDA 1CR2A 1VMAA 2R6FA 2OLJA 3F8TA 2J0QA 3GJ4A 3IEUA 2NMVA 1VCMA 1XEWX 3DZDA 1KHTA 1YZLA 5FUXA 1XJCA 3A1WA 3BXZA 2WWWA 3FKSA 5JJKA 1MO5A 3DKVA 1E79D 4FMCB 3OFNA 5KO2A 2YOHA 2X19A 3FPAA 4URVR 2ZPTX 3SFVA 1IBRA 2GNOA 5CIQA 5CYOA 3CX7A 3A1VA 1Z06A 1A4RA 1FMJA 5HCIA 4Q9KA 3UIEA 3VNUA 3U7EB 2REXB 2VPPA 3FHCB 1IQPA 2P5TB 5EP2A 2C77A 3RNLA 2HXYA 5CDFA 3BGWA 1T3LA 4JIMA 1ZU5A 1GIAA 1UADA 2JIZA 2ZUDA 1C4OA 3IO3A 4CDGA 3Q5EA 2FDCA 2B92A 4LJ4A 4ITRC 3ND8A 1W49A 3J81k 2V1UA 4XWAA 4N1AA 3TW4A 1ZUHA 4IDOA 2WMOB 4RSGA 5GVRA 3R9IA 4E22A 2O8BB 3ZS8A 2A5YB 3QVUA 4DSNA 4LDJA 4D25A 2ZE5A 2FMXA 4ZI3A 4A0GA 1DADA 2V8OA 1ESNA 1P3JA 1IN4A 4C30A 5KU1A 4W7SA 2RB4A 1UDWA 4M8NE 4D0NA 3FTQA 4UXHA 4ZDJA 2DCUA 4GBMA 3K70C 3PG5A 3WNCA 4WZ6A 4ASUA 2ZRKA 1R8SA 1Q1QA 3CZPA 2EFEB 5KUTA 1I4TD 1NIPA 3KQLA 3T34A 4HB3A 1LFDB 3GEIA 1R6BX 4Q9LA 3N2EA 2HDNB 4NYJR 1NSTA 3SE0A 3MJHA 3ZGXA 2WJYA 2JGNA 2XSZD 4PC6A 1TX4B 4UXJA 1G7SA 3LQRA 4ZKDA 2ATXA 2FOLA 4PSAA 3ICEA 4QGAA 2ZSEA 1G1MA 1JQLB 1E2MA 1A82A 2GRJA 4TYWA 1W4CA 4P4UA 1GTVA 1A7JA 3V9PA 3KQUA 1T6NA 2CCJA 3AUYA 1Z8FA 3K09A 2CL0X 2JJ2A 3W3AA 2MSCB 4US1R 4JLNA 5E95A 2WWFA 4DWJA 4G5SA 2OFXA 3MRSA 4E09A 3TBKA 3GJ5A 1WA5A 4LHZA 4Z1MD 2OV2A 3IIKA 4MH0R 5F9HA 2OE2A 3D3QA 3C16C 3HR8A 1XFAA 3PITA 1DTSA 1EGAA 4RCYA 1BO6A 1B0UA 4V0ME 4LJ8A 5D3QA 2I4IA 1U94A 2JJ1A 1KZ7B 3ICQB 3GLFA 3H2YA 1P2VA 4IKEA 5B57C 2IW3A 4FINA 1BOFA 1BYIA 1XTJA 1YR6A 4EJSA 4C2TA 2QZ4A 1NG1A 3R8FA 1SVIA 2GXUA 4US0R 2FF7A 5HE9A 2WJJA 2QM7A 4WOPA 3BIFA 3EC2A 4MGIR 5TVKA 4XWKA 1AKYA 2IUSA 2TMKA 2QA5A 2PJZA 3B82A 4CEJA 1S3SA 3B8HA 3H84A 2BV3A 1YRBA 1NY5A 3ASYA 3LVRE 2JJ8A 3PQCA 4FMCF 3X1YA 3VR1A 4IDQA 1KI7A 2GXQA 3LW8A 3V4FA 3ASZA 4OI2A 3RVBA 2BMJA 3VAAA 4EIWA 4P0TA 1GL7A 3RRNA 4B47A 5CJ2A 2IS1A 3X2SA 3OF5A 4IFBA 3LXXA 1NNEA 1EFUA 3I61A 1BIFA 2GF9A 2PT5A 3B1ZA 4H1UA 4PR0A 4L4UA 4AG5A 1XEXB 1DAHA 3WYFA 1S1CA 4FW9A 2ZM5A 1TL7C 5P21A 2CBZA 2ZS7A 4PX9A 4EDHA 1J2JA 4EPXA 1R10A 4JT4A 4NZYA 4B73A 2CEAA 2J0UA 2QORA 2BCJQ 3M0EA 3L82B 4DCVA 1SZPA 2IC5A 4W5HA 4CEJB 4YLGA 4IFEA 4LPSA 4C0BA 2PZEA 5EXSA 3AF4A 1GILA 4DEYA 1E1RA 2HT1A 2J0VA 2F1RA 4L9WA 2CE7A 3ZVLA 3QF7A 3THWA 421PA 1NMXA 5AWFC 1NL3A 2ZJ2A 3AVPA 4LBZA 3EASA 3KXIA 4M22A 4KXFB 2GILA 4QM6A 2GCOA 2XTMA 2YYZA 2F9MA 3T06B 1MRSA 1KOFA 2WICA 4BEBA 4BLTA 2O8CA 1E0AA 1VKJA 4JLKA 3RSLA 5EP1A 4QL3A 1G8FA 2CLSA 5DHAA 3OEED 3ZJYA 3B1WA 4PO9A 1U98A 1G3IA 1ZM7A 2EFGA 3QXXA 4PSKA 4AKHA 2BKUA 3RS2A 2GJSA 4OQXA 4CRWB 2CMKA 3C8UA 2A3RA 2GF0A 2WSSA 2J0UB 4HYYA 3CH5A 2B7BA 4TMXA 1MV5A 4LBYA 3NHBA 1ZYUA 2NIPA 3IUYA 4XD7D 4ASUD 4QBFA 5F9FA 4CEIB 4K46A 4ZDIA 3B9QA 4GOJA 1Z08A 2ZAOA 4II7A 4C0JA 1NJFA 2KSQA 2IWHA 3THWB 3SN6A 2XITA 1FW6A 1KI9A 3LX5A 2WKPA 2CJWB 2WWIA 1E2LA 1GWNA 3SQXA 3LNCA 3CKLA 2O0HA 2O8EA 5JLJA 1GL9B 1OKKA 1CKEA 2QPTA 4JLPA 5C4MA 3QXSA 2B21A 3A1SA 4JLAA 4BFXA 1QHHB 1XNJA 2RGDA 4QGFA 3LD9A 3ZQ6A 1SVOA 1WQ1R 3Q8XB 4Q47A 2P6UA 2BMDA 4D0LB 5HCNA 2CL7X 4IJMA 1WF3A 3RRZA 1KI1A 3FGNA 3IILA 3CBQA 1ZC4A 3I3SR 3AVTA 4QXAA 4HLQB 1R8QA 2XNDA 2RGGA 3JZMA 2R8RA 4UNSA 1SKYB 2WJIA 2F3RA 3KL4A 2YC2C 2G0TA 3QQ5A 1OIXA 1W0KD 2PEYA 1T0JB 4U02A 5FOUA 2NO7A 2AKAB 2W2TA 3QG5A 2JLVA 1E6CA 1W0JA 1YRAA 2WHXA 1NJGA 2W2XA 4AKIA 1TPZA 4YMVA 1KIMA 2GWHA 3C5HA 3R9XA 1LS1A 5DE3A 3WP1B 1JAIA 4KHZA 1P9NA 4DDWA 2GZDA 1BKDR 1FNNA 1ZUNB 2C04A 4M53A 5JZVA 2CHGA 1UBFA 3MWLA 1WDTA 4Q1AA 2JATA 4M9QA 2A78A 4DDTA 3Q7QA 4L15A 1M6NA 1E9SA 4LY6A 2CVFA 3I73A 4A2PA 2EU8A 1GG2A 3NDBB 4JT2A 1NBMA 4R2IA 3KKQA 2KBEA 2Q9BA 1RKBA 5GJWC 2WJVA 1B23P 3FOZA 2BBTA 3BFVA 2DBYA 1P6XA 3CWZA 3OE7A 1E94E 3QOFA 4PO8A 4BZQA 3PR1A 5JS7A 1ONBA 3IEVA 4AKGA 1U8YA 4M2LA 4D4KA 4LI0A 3UANA 2VF8A 4H9GA 4UNQA 4LC0A 2LKCA 4Q9IA 1E2QA 2ANCA 1Q3TA 1Z22A 1IN8A 4YDHB 1MO6A 5HZKA 1G291 3BAFA 1VIYA 2HF8A 3E2IA 3QUSA 5A5GA 2IF0A 3L8YA 2VEDA 2HLDD 1SXJA 2OFWA 1T5LA 3CF6R 5DYIA 2F55A 2QMUA 4KFSA 2IYYA 3S1AB 3T35A 1FQKA 3CPEA 3EXAA 4GP7A 2OAQ1 2IXEA 2ZU0C 1YZNA 4B43A 4A6XA 1H8HD 2P67A 2RMKA 3BERA 3FB4A 1GKUB 2B7CA 3LFUA 3T5GA 1N6PA 2DR3A 4BUJA 2D7CA 1QVRA 2EFDB 3REGA 2ERXA 2PL3A 2IHBA 2J5XA 2FSFA 1R5BA 1W5TA 1COWA 4NU0A 4TT3A 4X8OA 2OHFA 3R8CA 3A8TA 3QKUA 3LRPA 1CS4C 4Q1CA 5AUQA 3O8BA 2FFQA 2AK2A 2ZRGA 3NHAA 4OHVA 2ZJBA 2RCNA 1DAGA 3VR2A 2GEUA 4S35A 2G1JA 3IHWA 1ZIPA 2OBNA 2QBYA 4Q5IA 1T0HB 3EIQA 3W34A 4KI0A 1P4SA 1CEEA 1RIFA 3IIJA 3SQWA 3NBFA 2CHVA 3H0KA 2J7PA 2RGXA 1SXJB 2VTKA 1ESMA 3K0EA 3KX2A 1NVXQ 4OJKA 4EFNA 4LC1A 2OFOA 5DLQC 4HUTA 4XSGA 3D31A 1VG1A 4BLQA 3ZIAA 1LB1B 2ZI4A 2ZI6A 3OIWA 1Q22A 2WV9A 3KUDA 1M7BA 1ZRHA 3LX8A 4I1SA 4WW0A 2HF9A 2CK3D 3TJZA 3NEJA 4MYUA 4AG6A 3TUIC 2PZFA 3QY0A 5BN5A 3LBHA 2FWRA 2FJUA 1D2MA 1TADA 1N5KA 5FL7A 2O8FB 3PEWA 1X1RA 2YWEA 3E1SA 4HLUC 4PPGA 2ECKA 2XJ9A 3FMOB 3GLHA 5HZHA 2IEYA 1E9EA 3EW9A 3IIMA 2ZTSA 3SR0A 2Q3MA 4DUGA 721PA 4JBYA 1IXSB 2VP2A 1PJRA 3SOPA 4BZPA 4MKHA 2IS4A 5DH9A 3THYB 2QAGC 1E2PA 1U99A 1CJKC 2EFHB 2RGNC 1LVGA 2ZRCA 5KSOA 4G3XA 3WMGA 3VX4A 2VBCA 4UQOA 1YZQA 3GJ6A 3GQBA 3THOA 4ZIRA 4MGKR 4O2RA 4Y0VA 3AVVA 5EJEA 5FTLA 1P75A 1E4VA 3K9LA 4A36A 3W8NA 2IYXA 4L16A 1W0JD 5IHPA 1TF7A 2FPMA 1XJ0A 2FZLA 3K9HA 3I5YA 1CU1A 1W2GA 1ODFA 4XWOA 4B3DA 3GLHB 3T1TA 3SJCA 5EQTA 3B1XA 4M1SA 1DOAA 2BEKA 4Q4AA 2ZR9A 5JS8A 1G5PA 3JVUA 3QIAA 2ZSAA 3KJEA 5F2EA 2OCYC 1UM8A 2KWIA 4Q4JA 4PHGA 2J7KA 5HKKD 1TUEA 1CXZA 1D2EA 2JLXA 2Q9CA 3SBDA 1KSGA 3T1QA 5ANRB 1NBMD 2ZRJA 4NCJA 3Q3JB 4PC3A 4FI3C 4HAVA 1VG8A 4YMUA 1L7VC 3U7HB 1IAQA 2OT3B 3R7WA 1ZU4A 4GI7A 2ATVA 1VHLA 4WIAA 3AKYA 2IK8A 2J41A 1G64A 1E0SA 5FI1B 4G5RA 2BDTA 1KAOA 4XVRA 1XZPA 3RS3A 3REFA 3OHMA 4Q7JB 1E1QA 4M0LA 3SZRA 4C9BA 4YXWA 3KKMA 1MT0A 5TXGA 1M8PA 3EAQA 2V6JA 4FWIB 1HQYE 1CTQA 2JLYA 1FMLA 1MABB 4HZIA 3RHFA 1OFHA 3K9NA 2ZEJA 3H4MA 4MYHA 1RZ3A 2VO1A 3TNFA 1RPZA 1VHTA 1DG1G 2XOKA 1HUQA 4F7WA 5LDDC 2IYTA 3AM1A 2FFHA 3KB1A 3VKGA 2ZS8A 4TT3D 4TMVA 4NYIQ 3GPLA 2RH5A 3NXSA 1J70A 4HAWA 4LHWA 3WYGA 4ZCLA 5G41A 5KHOC 5TB5A 4OQFA 2ZYWX 1KNQA 3AB3A 1JEEA 4IOLA 4P31A 1CP2A 4M9SA 5FBQB 5G3ZA 4LHVA 4URXR 4BLPA 3QBTA 1R2QA 3W5IA 4GT1A 2X2EA 1R0WA 4D80A 3N2IA 5JFGA 2UZ3A 3VX3A 1Z29A 2IL1A 1HYQA 2OSBA 2V6IA 4G5QA 4KO8A 4Q1DA 4TMKA 5JWRA 3ZD7A 1NF3A 4LJYA 2C96A 2R62A 4M4SA 5AUOB 1SKQA 2FGKA 3FKQA 4NCHA 4G1UC 4A8JA 1I4DD 1AM4D 1KZGB 4I1UA 2IEZA 5C4GB 1DAIA 5G53C 3PV0A 3VTKA 4AKEA 3GLGB 5H68A 3EC1A 3EZ7A 1AN0A 1FPMA 1FX0A 4QHTA 4JLJA 4D81A 1G4UR 4RCZA 1E9BA 4PTLA 2YINC 1HT1E 3SNHA 3RAPR 1KJYA 4FCTA 1JB1A 2C5LA 3CO5A 4C7OA 2F1IA 4ARZB 2O8DA 2GKSA 4M1WA 3GJ7A 2C95A 1W46A 4A92A 1EFRA 4URUR 3VFDA 1E2DA 5DN6D 3K8YA 4Q01A 2PCLA 2ZITA 1QG4A 2ZI7A 4HAXA 5L3QA 2UVQA 1ZP6A 4R98A 1WB9A 2EQBA 1TF2A 2NZJA 2R2AA 3NDPA 1G6OA 4NYMR 3V00A 1JJ7A 2RHMA 2XX3A 3KKPA 4ZKEA 1IN6A 2H5EA 4GNKA 2HCBA 1RYHA 2I1QA 2ZYVX 4B74A 1FUKA 1OH6A 1JPJA 5CIWA 3ADDA 2VYFA 3FE2A 1DO0A 3K0SA 4F91B 1U9IA 4GDFA 1E32A 1KI6A 2FE4A 1E2GA 1RRFA 3AP1A 2AK3A 4TZ6A 4MKFA 2VIIA 5EP4A 1LV7A 1FX0B 1VTKA 2LCFA 3FDIA 1XU4A 4DLWA 1XWIA 4BFSA 2C78A 2GXAA 2GCPA 3CM0A 5JMTA 4O3MA 3NC1C 4C7OB 1AIPA 3C5CA 2O8DB 3U3KA 4JSTA 3AEZA 1ANKA 1XX6A 4Q66C 5JECA 4FWTA 1NI3A 2ZR7A 3FMIA 1AZSC 1E2FA 5B58C 2VQSA 3QBVA 4OK3A 4CVNA 4R9UC 5J5CA 3LH5A 1CR0A 4HZUA 4EPTA 4U7DA 1FUUA 1NVVQ 1O3YA 1P2SA 2NPFA 3SJBA 3BORA 1WRBA 4QBIA 1AZTA 5BW8A 5L3SA 3U4QA 3I72A 3MWJA 2P5SA 3CF2A 3SI7A 2H92A 1GFIA 2QMHA 2VHJA 1GSIA 5BYJA 3Q7PA 1KI6B 2YWFA 3LLMA 1OFUX 1HQCA 1HV8A 1DEKA 2IUUA 3HU2A 3QF4B 4BASA 5GJVC 4KCGA 4Q9JA 1YZKA 4KODA 4AURA 2ASEA 2CNWA 3C4JA 3AV0B 1G8PA 2RHDA 1N3BA 4OBEA 4O25A 3CF0A 2A5GA 4FMDB 3X1ZA 4XVUA 2ZRPA 4YXWD 2F9LA 5H70A 4MRPA 2QY9A 2F1HA 4OYHA 4QGGA 2OXCA 4DLSA 3THXA 1FOEB 4HZUB 5AR1A 4IVPA 5EP3A 5CK5A 1MRNA 2IT1A 3CRVA 1QHSA 3PIRA 1OHHA 5JRJA 1VCNA 5JSZB 3W90A 3WNBA 3GD7A 1KDPA 2ZRHA 3VKWA 3U4QB 3I8SA 4DT1B 2H1LA 2XOKD 3MWKA 4TTPA 1JR3D 3BWDD 1XXHE 1O87A 1T4GA 3UWKA 2V9PA 3FMPB 2DFKB 3NEYA 2J0SA 1AKEA 1YR9A 4DCSA 1CR4A 4HB4A 1XRJA 2N42A 4BLOA 4D4JA 2QPAA 2VP4A 3AH8A 4X8LA 1KI8A 4PSVA 2MSEB 4I4LA 3ZVRA 2ZJYA 1DAFA 5HR5A 3QXJA 4B3GA 1CJTC 4KYUA 3AF1A 1W47A 2DWQA 2XB2A 4ESHA 3TIFA 2VP9A 2FV8A 1ZJ6A 3TSZA 4DCNA 3LBNA 2NO6A 3Q5DA 3C41J 2GK6A 3U3JA 3THXB 4GL2A 4BQSA 5IK2D 2A2ZA 2EFCB 3EARA 2CDNA 2CCGA 5C2JB 4HLCA 2AD5A 1DBSA 3IPYA 5SZIA 4D4MA 1FP7A 1DS6A 5DI3A 4D2IA 2ZUBA 3CNOA 4TYQA 2QMEA 5FPYA 3BD9A 1I2MA 2W6IA 4WZAE 2P6RA 4QM7A 3I5XA 1Z0IA 1G5RA 2QM8A 1G3RA 1UPTA 1W36B 3TKLA 2FSGA 1NMZA 4R7ZA 4F92B 4BLSA 2N46A 5GVSA 1D8TA 1NVUQ 1G7RA 3TLXA 3K0AA 3PUXA 1CJVC 4LYJA 4BE7B 2W0SA 2G6BA 2AX4A 5J4KA 3AVXA 2XAUA 2RKOA 2WWYA 1JXOA 4KVGA 5EXXA 1GOTA 2EWVA 4ZI2A 1OH7A 1Z47A 1M1YE 1QF9A 2E87A 4CZ2A 1NN0A 1PLLA 8OHMA 2C98A 2ODWA 2QI9C 3LO5A 3CPJB 3O8RA 1ZVQA 1G5TA 5E3HA 1KO8A 3AP2A 1Z0JA 3B85A 4A82A 4JVSB 2F43A 1S2MA 2XZLA 3MFYA 1AS0A 1G4AE 4TSFA 3RYTC 4QNRA 1OFTA 4KITB 1KY2A 4CIDA 5KOYA 3KQNA 2N1BA 2ZR0A 2WOOA 4QJ4A 4XSHA 2OCAA 2OBMA 5SZKB 4NMMA 3KB2A 2Z43A 3AGQA 1JJVA 3EG5A 2ZVQX 2JDIA 3GJ0A 4DDUA 1TAGA 1NSFA 5C18A 1F2UA 2Q3FA 2WBLC 3ZVMA 2B8WA 2MSDB 2D7DA 2IS2A 1HE1C 3K0AB 2BMEA 1K5GA 1N5LA 4KSBA 2DYKA 3QKSA 2GJKA 1G21E 5J40A 5FFMA 1XCMA 1ZUIA 4L8GA 5CITA 1OYWA 1BMFA 2WWGA 3EZ2A 4IRUB 5F3WB 2NZ8A 3QKTA 2F3TA 3TE6A 1AGPA 1UKYA 4C3ZA 1RRPA 2OXRA 2D74A 3CRW1 1IXZA 2F43B 3TVTA 4Q00A 3QSYA 1RYFA 1TQ6A 3UG7A 1NRJB 3EA0A 4FMDF 3O8DA 4MGZR 1ZMXA 4Q03A 1K8RA 2BWJA 3K09C 1SGWA 3ZD6A 3GLFB 1Z2AA 3FKSD 3U3MA 2C9OA 1IJEA 2AXNA 3OFND 5CM8B 3BRWD 2QT1A 2Q6TA 5D3MA 3D6TB 4LBWA 4EJSB 1E2IA 2ZROA 1W4AA 3BH7A 1II0A 3WXMA 1KO7A 2AHOA 3QKSB 1UAAA 4TWZA 2IXFA 4HEJA 4WBSA 5G40A 2YC4C 2F1JA 3AQ4A 3BS4A 4LSGA 3IBGA 1KNXA 2JLQA 4RD6A 1KO5A 1CLUA 1JECA 2OILA 2YNMA 4D0GA 1W1WA 1UF9A 3GEHA 1PLKA 2MMCA 5L3RA 5AJWA 1EWQA 2JIZD 2WKQA 3PCRB 2FFBA 3CB4A 2NPIA 3UK6A 1PLJA 2RGBA 3K0CC 2R6AA 1E99A 3QNUA 5DISB 5J4YA 1W36D 4XIGS 4PPFA 2V1XA 5JBQA 4DSOA 1RFLA 3ETLA 2QTHA 3HYRA 1HA3A 1OXXK 3IO5A 3AVOA 1LTQA 4JSYA 4R2HA 2H8KA 3CNLA 3MWYW 3EWSA 3NH6A 3E70C 5D3MB 4B3FX 3DDCA 4EQ6A 3P1JA 3EPKA 3BE4A 4L9SA 1HT2E 4A0HA 4I1OA 1WXQA 2GAAA 4LJAA 3AVQA 4Q7LA 1FZQA 2ZJAA 3BFXA 4NTZA 4WXRA 3W5JA 5JHGB 4MA4A 3TSWA 4CYMA 3EX7C 1TMKA 1SHZA 5BQ5A 4DLXA 2ZIAA 4HAYA 3L0PA 3U5ZB 1WBDA 5FTMA 4ZDWA 2LWIA 3RS0A 4TQUS 3QJYA 1L4UA 3P27A 5JCPA 1XTKA 3DKPA 2QE7A 4PQFA 2KI5A 3KUCA 1US8A 3P4YA 3RANA 1Q0UA 4LCBA 2ORIA 1OB2A 3HP1A 3IQXA 4OI1A 1AK2A 1G3MA 1KO1A 2QNRA 2P0EA 2GCOB 4JL6A 3Q9LA 2A9KA 4TZ0A 3T1VA 1Z0AA 5EZ6B 4HDQB 1GDDA 2O8CB 1C1YA 4RKEA 3KKNA 2VHCA 1TF5A 1PUIA 5EXTA 4C4PA 4MITA 4EQ6B 4NCKA 5F98A 1Z6GA 1N6OA 1KSFX 5G3YA 2JJ2D 3TAHA 1XD9A 4OK6A 4OHYA 2BJVA 2X8AA 3U3OA 3F5FA 2QUZA 4Q02A 1JI0A 2ZRDA 2YVUA 5BYKA 2NQ2C 2PBRA 3B9PA 1G7TA 5ELXA 2GHIA 3KZ1E 1KTVA 3B13B 5E7IA 1DE0A 2WAXA 1U0LA 1X1SA 2JJ1D 2PH1A 5FR2A 4ZCIA 1US8B 3PXGA 3QXHA 1SHKA 3U7GA 4JBXA 2X1VA 5FR1A 4V0MA 1WMSA 4IXMA 2QU8A 2VH5R 4RFSA 2O8EB 4ERNA 3VMFA 5C46F 4XJXA 3CPHA 1G17A 2OM2A 1EK0A 1F5NA 4FN5A 3MSXA 4DCTA 4OQLA 5KNBA 5TARA 2HCJB 3BB1A 3U61B 3MD0A 4DIEA 1E2JA 3CZQA 1OW3B 3ZYCA 2GBLC 3BOSA 1Z6YA 3A4LA 1J7KA 2ZSDA 3CNNA 5EXPA 3W6OA 2ZYUX 2V4ZA 5K8IA 1SVKA 4V02A 2GEDA 3N5CA 2G3YA 3GLIE 4DRZA 4ZCMA 2IBMA 4AWXA 1G6HA 2AFIE 3UMFA 5KDDA 4GZMA 2JLZA 5CLQA 3ADBA 4ABYA 1KKMA 1Q20A 2PX0A 3H1TA 4LOAA 4BLRA 4ZPXA 3UG6A 1IJFA 2ZANA 2R65A 3JVVA 2BM1A 4PXAA 1YZUA 2QGNA 4RFSB 1EFTA 1ZIOA 3RDPA 1TQ4A 4P33A 1AQUA 5LD2C 4YMTA 1MOZA 2EVWX 1Z0DA 1EXMA 3CH4B 3AVYA 2Z83A 4V03A 1NKSA 2ZI3A 5DSZA 4C0KA 4PAMA 4D26A 1G16A 1P5ZB 4MDEA 2IA5A 3BB4A 1G8YA 5JWHA 1GNPA 2RGAA 1SVLA 1TU3A 2ONKA 4EPVA 4X8MA 5IT5A 4B75A 4MRRA 3AGPA 2BEJA 4P32A 1E1RD 1WP9A 1EX7A 4PZLA 1X8LA 1G41A 4GMXA 3NC0C 1YJ5A 1R4AA 3WNDA 4A0FA 4PAQA 4HB2A 4BEJA 3CONA 1TUIA 5FOSA 5KPDA 3WMFA 1BYUA 3MUFA 1KDRA 4HLUA 4LHXA 3ZQJA 1JR3E 2PX3A 4TLDA 3PENA 2QMOA 2W58A 4G0NA 2WM9B 4GMDA 2G9NA 3TVDA 1A2KC 1XTSA 3BH0A
chains in the Genus database with same CATH superfamily
1RMTA 1PVVA 3HB4X 4W8GA 3HKEA 1Y1QA 2QTFA 1EX1A 3K5PA 2X14A 1ZNXA 1T10A 2NAFA 2BFWA 3EGWA 2ZDQA 3LUAA 4R9RA 5HKLA 4FKMA 4ZJUA 1RYEA 4PYMA 4YWHA 5KKNB 3V8PA 2UZ0A 1QYIA 4YB8A 4U2KA 1BE0A 1CS0A 3EVTA 4RZ3A 3OQ1A 4QQ8A 5DLYA 2IYLD 5LQNA 3S3TA 2PG3A 1GAJA 3ISJA 2VDKB 3RK0A 3DCNA 3R5TA 3WRXA 1XP8A 1Y89A 3DA8A 3KDAA 3R0IA 3GMIA 1I4OA 1KK2A 1XVTA 3AJEA 3GH3A 3TUZC 1UWLA 3FHOA 4EFMA 5AIAA 3F73A 3D8RA 1OXKB 3RS4A 1ISPA 2F7SA 1X19A 3L4BC 2PA0A 5DYGA 4C5AA 5BRAA 4WWHA 5F73A 1Q7RA 1WBJB 1NF8A 2PS0A 2Q50A 4NBUA 3VH2A 1TZKA 2ZXEA 1DDGA 4F8JA 1GP2A 1P44A 4YRTA 1XHFA 1Q1ZA 2FEPA 3T7DA 4QQRA 4H4DA 2PPVA 1KZ4A 3IDQA 2HJHA 3NP7A 2NV6A 2BMVA 2PD6A 4PHTA 1SVWA 1DINA 5JVDF 1O2DA 2OO7A 3ASVA 4OB7A 3B7GA 1RKQA 2OV1A 4EY6A 4BEWA 1P2BA 1ETHA 4OJYA 4XQGA 3DBVO 4JC8A 3WOVA 4WN9B 3F6BX 5KYGA 2GSWA 2YCBA 1BE6A 4E7PA 2HRZA 3A58B 3W5SA 2Q4BA 2X8LA 3ZKAA 3OJLA 9LDTA 1NXPA 3ZXSA 4A2QA 3HO6A 1M34E 4REMA 4C7MA 1L5VA 3EIWA 1VYUA 2C5AA 2BKAA 3BXXA 5K9ZA 4EI9A 1QVAA 3MTQA 4U7HA 5CK4A 3RFFA 2YCLA 4KDFA 4NMHA 1Y63A 2YWGA 1WXWA 5AJVB 3RR2A 3S1SA 1O7JA 2X13A 2Q5FA 4WESA 2GDJA 3N5KA 2BEVB 1NKTA 1K63A 2MINB 3UF0A 4D3XA 4KUEA 3CEMA 4M38A 3UWSA 2I66A 3PPIA 3N6RA 3NBYC 1BQEA 1JJAA 3BXHA 1M72A 1ZINA 3GP5A 3P4UA 1E3IA 1AUVA 1L5ZA 2VLIA 4C0HA 3IQEA 1D2GA 4OF4A 1RWXA 1PGOA 2FPSA 1I14A 3V34A 3VNQA 3LKZA 4MARA 1WX1A 2V5VA 3G9ZA 3P7MA 4LWPA 1VCIA 2C7BA 5LNK1 4LRUA 2AWOA 1OZFA 4I9NA 3I2IA 4IIDA 5C1BA 2R97A 3OZGA 2CDAA 1NULA 5FOTA 3GLIE 1NVGA 3KFVA 1HR0B 1H5QA 4UU7A 1K4MA 5KJEA 4D8VA 1ZIDA 2FN3A 4M1KA 1E64A 4B8ZA 3OE7D 3GQBB 4K0KB 4BNMA 7MDHA 1F12A 4E5KA 3RBAA 3LV8A 1OY1A 2VSYA 2AFIA 3MLAA 4U3JA 2ZBFA 3FWYA 3G0IA 3VH4A 3VYRB 1I6KA 1GITA 4ZREA 3QLUC 3TQFA 2WWXA 3C97A 1D5WA 4OHCA 1XCBA 4V3BA 1XC7A 1ZI6A 3F71A 4KQGA 3WGIA 2FDRA 4OLHA 2P9ZA 3IAM1 5JNLA 1GUAA 1M1UA 3FVWA 1GZHB 5K3BA 4P82A 2GCIA 4QYMA 4HZGA 3U9SA 3IP8A 4Z0TA 4M87A 5REQB 5M04A 5DM70 1ZD8A 4OHXA 4B3BA 1E4EB 4F45A 2PZ8A 4R5HA 4MHSA 1JIKA 2QEQA 4BP9A 1M8JA 2RIRA 4KDCA 1CUUA 2Q0HA 1UT6A 4RSHA 4YCAA 3HH8A 5LUBA 4B46A 2OCBA 4UTXA 2KX7A 3BXGA 1T3SA 4B4VA 4C2UA 3EGVA 1YB1A 1RI5A 3ES9A 3IAXA 1BWRA 3ACCA 4I8DA 1KEPA 5T5QA 4BFTA 4LYFA 2D6FA 4H7IA 2HTFA 4DQUA 4Z4QA 5KWEA 3GJ8A 1RM0A 2QT0A 1E69A 4BKUA 2B69A 4IP0A 1PSDA 1T2VA 1X9GA 3GG9A 4HNAB 3H11B 1QHIA 1M6WA 2PX2A 2P3SA 3PQ6A 1DOZA 1B6SA 2PIAA 4MV8A 5KB3A 3ESAA 1L7DA 4M1QA 4CR6A 1HMPA 3QVXA 2GZRA 4U5QA 2OQIA 2AF4C 1RVDA 3TO5A 3D3EA 2G80A 3AVWA 3DOIA 2NACA 2Q99A 4MUGA 1T8TA 4R7TA 4B3XA 1OD6A 1PJ4A 5HIMA 1NBIA 3V33A 3CRMA 1ELOA 1W4BA 5A3JA 3DZ8A 2ZJ5A 3K1ZA 4HX9A 1NI4A 2QTBA 5L40A 2QVYX 2WRZA 5I8ZA 1REQB 1WDKA 2JEOA 4O4LA 3JASB 3U7QA 3ZLTA 3A6GA 4QDXA 1SPBS 3K5IA 4KQFA 4LMRA 2BTOA 2E89A 3G6WA 2AMYA 2B4KA 2GCEA 3FTCA 4CDRA 4CHTA 4HHEA 2I03A 3VTZA 1K6MA 4I50F 5TMPA 5KAMA 3PSAA 4DCUA 1U9YA 3FKJA 2HWXA 3STTA 4A2WA 1B15A 2PYZA 4MUJA 2NYRA 3E4CA 4D6PA 4NFSA 3D5QA 3R6TA 2GFIA 3P2MA 4RHCA 2NP6A 1PYDA 2XRMA 4C08A 4DXAA 1C0KA 1U31A 1U7ZA 1Z7EA 2R4QA 5KSZA 1PV4A 4QE3A 4R0NA 4B44A 4BE4A 3IEMA 2XMZA 1E9AA 3MWDB 1PEKE 3W2HA 1Y5IA 4BX2A 3F78A 4UHKA 1AUQA 3RASA 2HV8A 3ZU4A 3AYXB 4F2GA 3V4RA 4GG1A 3PX2A 2QP4A 5FPHA 1YD7A 4N49A 1SQ5A 3PHHA 1N6LA 1U4NA 3T5DA 3OCZA 1PJQA 1E3JA 1U04A 4H77A 4TKMA 2EJVA 2I78A 1W8DA 2CJPA 3SOZA 5HILA 2ZRIA 4LISA 3H86A 5DCWA 2QJTA 4NAUA 4UULA 4A5OA 3R2JA 2PUCA 1HDIA 1RR6A 2Z8ZA 2XVAA 1YVEI 4LYHA 4RPHA 4B6GA 3QVGA 5JQGF 3C3XA 4URWR 4CLOA 2OOKA 2V4MA 2XTZA 3NTOA 4LV5B 4PCUA 2O5VA 3A9SA 2PQMA 4NWIA 4R69A 4BP3A 4EUNA 1M33A 3KCNA 3PEVA 3K6KA 3GG2A 4DR2B 4Z7QB 3ZWMA 3O4HA 3QV1A 1II9A 3HFJA 5L3QB 1XKQA 1SUDA 5C0OE 5CCEA 3HM2A 4QUKA 4KKXB 1KK0A 3OEHA 4C07A 1I2ZA 2A14A 2EKLA 4E5UA 3PWKA 1JHQA 2X9LA 1SXIA 1ORIA 1TIBA 2IU3A 4RFLA 5TT1A 3UW3A 4F21A 4X7RA 1XPUA 1UIMA 1DI0A 3IQIX 1AD2A 3U2QA 2R6GA 1YGYA 4IYRA 5KOIA 1MQ8B 1X1TA 2AW3A 4M1OA 3MHTA 1I4EB 1M67A 4DUPA 1S01A 2O7SA 4BCBA 1M2JA 4YMWA 2KS6A 2VP6A 3T3GA 4LG1A 4NBWA 4ACAA 4AZ3A 3PNYA 1YQGA 3CVVA 2X1LA 2ACEA 3VGPA 4TQGA 3TQHA 3OCUA 2POCA 3EGXA 2G1PA 3PT5A 5L3ZA 2XQFA 5IS2A 2BUCA 4W5OA 1XHLA 2OGWA 2OHIA 2ZATA 1IMJA 1P4GA 1E1QD 2JD0A 3DL4A 4FMBB 5C8YA 4DLNA 4F96A 2NTJA 4YJ2B 1CP3A 4B2PA 4II2A 1Y8QA 2JIDA 3LPAA 3OIUA 4QBTA 4AIIA 3VISA 3VU1A 4IJUA 1RJ9B 1CQIA 1L1RA 2BP7A 1E63A 3LTNC 2C00A 3KHKA 1N33B 1S7GA 1ZSNA 4G5OA 4DMUB 4IFTA 2X2FA 3ZKWA 2ZTUA 5FEUA 2O8BA 4MQMA 2NU8B 1Z8DA 1QB8A 1RLIA 1B6TA 3KPWA 5EHZA 4XX0B 2FH5B 3B3JA 4Y30A 5EE9A 1TT7A 4XUEA 3AU9A 1U1DA 3UJCA 4HVCA 4BFWA 1YVDA 2I33A 4P3PA 3BA6A 3GUHA 3OBIA 1R12A 1GFWA 2ZE6A 4BMNA 1LSJA 4MGYR 4R71A 1CJUC 1TT5B 2I4TA 4S1TA 3W6ZA 4M9XA 1EUYA 1CR6A 1LDEA 5BN4A 1TTTA 2A1UA 5A1JA 2UDPA 3JW8A 1NVWQ 2Y92A 3EVZA 3K6JA 4HRXA 4ZAGA 4DAOA 3ZGNA 3USCS 1DFHA 1GGNA 1BCSA 3I9FA 3L18A 5K6AC 4JKYA 1BMTA 3W5VA 5BN3B 3GJRA 2QRPA 3QU5A 4J0CA 4JLDA 4U6QA 5CA1B 1UDRA 2WVHA 2PH5A 5ECWA 1ID8A 3WADA 1P1CA 2CXHA 4RIIA 2JJMA 2ZIFA 3AHIA 4BEVA 3AEUB 1GTZA 3AFOA 4GMFA 4PQEA 3HNPA 1ML4A 2A9PA 2V3CC 4EFLA 1PR6A 1XDZA 2ECOA 1QC5B 2FU5C 3MHPA 3O6VA 4IUCS 3RFTA 3GJXC 1T5SA 2JFXA 3N7UA 4EPRA 4IH4A 2V7QA 5LMZA 1N6NA 2Z6VA 2W2MA 1NZJA 2XXAA 1QYXA 2FN4A 5B3JA 5J4VA 4PWYA 1B4DA 3MJRA 4HWGA 3NB0A 3W6PA 1FS6A 4EKDA 4ZTZB 1NW8A 4CG2A 3D7SA 3K8OE 1SFRA 4LZJA 1F2TB 2H48A 2J87A 4YCLA 5FPPA 1JKIA 2Y1KA 4POOA 1FF9A 1M8KA 3QWHA 1EFRD 3E9MA 4DCPA 2JBAB 3DOFA 5HIAA 1P7CA 2H7VA 1WF6A 4XD7A 3VH3A 1JBEA 2XDQA 4FOTA 1Y8AA 3H13A 3UPUA 1E9DA 3P52A 3E15A 1O89A 4IWNA 4PRYA 1TOAA 4CHGA 3OUTA 1HYBA 4QWMA 1SVSA 5JWOA 1W36C 4PZUA 3KR9A 4MW9A 1F9AA 1KIFA 3SHWA 4KQXA 3ORHA 3EEOA 4XZ3A 5L3VA 1ZXXA 1IBLB 2JGMA 1UAGA 2YIMA 1UBUS 1H1LA 3KUUA 4D42A 5I9TA 5ILOA 1IN5A 1YR2A 3AEQB 1LI5A 1AKUA 4LNHA 1PL6A 4U2CA 4GI3A 4PX5A 3TXYA 4K9NA 2PWBA 4S04A 1E0JA 4FSHA 4QDTA 5BPHA 2Y2VA 3PNPA 1L7OA 4WLVA 2ORED 2QTTA 1UBLS 4R6WA 1O5IA 2ODBA 2YHUA 4HWTA 3FMFA 2V98A 4U00A 4K1LA 3UJ9A 4B3TB 4DHWA 4YXFA 4HC4A 5AVUA 3IESA 2GTHA 1LJLA 1SU4A 2WEKA 5FPQA 1SURA 3KQSA 4OX9B 4JJZA 3EA5A 2KM1A 3SJAA 3G2OA 1LF0A 5KTTA 1U8XX 2PMKA 3CLUD 1P7WA 4MRSA 2HR1A 3HKCB 3JQFA 1CUHA 4G0WA 4RZUA 1PT5A 2AYZA 2JZOA 3DMDA 3WGZA 4CIWA 5DIZA 4ZT7A 1U63A 3OKPA 2LKDA 3CVXA 1FRZA 3JAWA 1IIBA 1QP0A 3S1LA 5JROA 3DL7A 4LYAA 1N57A 4JS0A 3AL2A 2W22A 4JXKA 4P38A 1GN9A 1O6GA 2VHUA 1H8EA 3AIOA 4MKGA 2WA2A 4GP6A 3DOOA 5C31A 5JFTA 1DKQA 1NBHA 2DFNA 1LF5A 1YNOA 2M1ZA 1GGMA 4ZTBA 3OOHA 4LRYA 2BF4A 3GXBA 1U0FA 2R1UA 3FGOA 3QFSA 1IEVA 4XVHA 2CVHA 1QF6A 2BGMA 4ZGGA 4KFTA 4YJ3A 4C14A 3ZDAA 1AS2A 4M54A 4CIAA 4ESOA 2XYVA 1UBCA 5HBGA 1OT5A 1WUKS 1ZBDA 1IY1A 1YIOA 3I45A 3WLLA 3R1IA 4QJ3A 3NJ8A 5LQKA 3GJ3A 1VGQA 3B9BA 3UZUA 3S8EA 2JLRA 3ECSA 1LBIA 1TECE 1YFKA 2BVNA 1MNQA 3P5SA 4BPBA 1N0HA 2VWQA 4HH1A 2G63A 2AG1A 5F3RA 1T9KA 3FDJA 2JLSA 1YR3A 2XD4A 3NTLA 4XIFA 1LCIA 2AN3A 3AZOA 4EGJA 5HW0A 2DU8A 3EXFB 3HA5A 1YHNA 1OHHD 2BHLA 3GCGA 4MX8A 2I6QA 4V0KA 2CXNA 1RC1A 4F5YA 5JPCA 4H7PA 4BB0A 1A5ZA 2C2WA 3HG7A 4NBKA 4FCVA 1OLUA 4BV2A 3AEKB 5FV7A 2CVOA 3A1EA 2EYUA 2GK4A 3EWAA 4PFQA 4D9EA 1FA9A 4IIJF 5K7SA 1JEYB 4MYRA 3NYWA 3W9YA 3MT0A 4AY6A 4B4UA 1AXEA 4L08A 3UMBA 1EFKA 2JD2A 2MWMA 5B3LA 1NJ8A 3O1IC 4HTFA 3R7FA 1F0KA 2IODA 4OSPA 3H6GA 1P5RA 1ND5A 4US2R 5JEDA 1FU7A 3A27A 4L3OA 4K6CA 4KGDA 2O20A 3NAZA 3EISA 4MP8A 3S2YA 2NGRA 3QPUA 1I1NA 2JFOA 3CX3A 1BH2A 5K1ZA 1NZFA 1E0KA 1E5LA 1QHEA 1VKHA 4RCVA 4Y1RB 1MN6A 2KJQA 1ULUA 1K4KA 2QW0X 4N8EA 2QZJA 3T15A 5AW8A 1H3NA 2IZOA 1E2EA 3AU8A 1GZSA 2QUIA 4B09A 2FPWA 2HXGA 4L76A 5CH8A 4DGQA 3M6LA 2CJWA 1UXGA 4MV6A 5M5BA 1YTUA 3GXOA 5DM1A 1Y1LA 4P4GA 3RRYA 4DWVA 2H18A 1D2AA 2QRUA 4KYIB 3AUKA 4H6VA 1HNNA 5BWMA 4FNOA 1JIQA 4WKGA 4EABA 2J5QA 3HDVA 2JFPA 1FMFA 3TK1A 2WR8A 1GGJA 1GT6A 3IT1A 1ZGCA 3ZDEA 3MMXA 1QHHA 1GDTA 1N6RA 4A4DA 1N2CE 4TL8A 2H51A 5DHFA 1DWQA 1A50B 5KAPA 3WBKA 4F2HA 5AVTA 2ZB7A 3NDRA 1XXHB 3QENA 4WCFA 3SG0A 3UBMA 4DBLC 4HATA 4B7ZA 5JTTA 2VNAA 5IDVA 1TQDA 4HAOA 3OA2A 1MOSA 4YONB 1UBGA 2IHUA 2ZUFA 3GAFA 4D9GA 1O6BA 3GLUA 4CL8A 4ZZ2A 3VI3B 2CMDA 4FXPA 3IUEA 3ITKA 5ALPA 4E4RA 1IJKA 4UEWA 3EQ7A 4JQYA 4MEJA 2DCMA 4M83A 5GJCA 4BNKA 2H52A 1Y7LA 2WAAA 4KQCA 2YJ3A 2CK3A 3MG9A 5JEEA 3Q72A 1R0XA 1Z07A 1NHGA 1Z6TA 4HGZA 5DSTA 5SICE 4YAKA 4NMXB 3U48A 1OYVA 5ARCA 5JPIA 3FLBA 5FH9A 1HYHA 1H6AA 5KTYA 1D4FA 3Q15C 1L7RA 4IM7A 4WFIA 3F5DA 1PWHA 1Q15A 2O2GA 4MPJA 4N65A 4O6VA 2VA8A 2FWPA 3TL3A 5D6OA 3F7OA 3Q7EA 5GONB 2JDID 1L9XA 2VC2B 3SJUA 4JL5A 4PYNA 1Y5MA 4WZAB 4EATA 4NCBA 1GPAA 2GCNA 1HC7A 5FORA 3FDZA 1IZ7A 2H54A 3C7TA 3IBCA 1YB7A 4G9GA 4H17A 4RGYA 5HUQA 3KQKA 4AY2A 5DMXA 4OQNA 1JKMA 1W75A 2ZT8A 4OKSA 1X70A 2FZKA 3DMNA 4E12A 2OCIA 1KP9A 1FNDA 3IOCA 3AJAA 1SC3A 5K45A 3BJMA 3GOQA 4J0GA 5COBA 4W9MC 2TSYB 4DV4B 2GB4A 2PFSA 2FG7C 1KYQA 3MRVA 2SKDA 1KVTA 1FJXA 2PT6A 1A2QA 3OECA 2JI4A 2CV2A 3S70A 5CB0A 3GEGA 1E59A 1JDTA 1NPTO 2AEMA 3JD2A 4U39A 5E6SA 3O2SB 4YFVA 3FBTA 4IQ8A 1QO9A 3BQ9A 4XRRA 3HVRA 3ONDA 1U0JA 4HBGA 4QU9A 2V65A 5IT4A 4NNOA 2D2FA 4W8OA 4M9ZA 3VDQA 1HKHA 4EHNA 3HDHA 4GPIB 2VF7A 1Y9AA 4TS3A 5CNJA 5LB2A 4KLNA 1O6CA 5TR9A 2ZJZA 3OPYB 4L5BA 4ZOLA 2Z4SA 5TQ2A 1ECFA 1R66A 1Z35A 1QGED 3H5OA 4OKNA 5AI9A 5G0WA 3VR5A 4L85A 4KN8A 3DBLA 5IEJA 3B5EA 3Q1KA 4MQ4A 3KVNA 1IHPA 5EE0A 3KOZA 3DKRA 2Q0XA 5ECDA 1XD8A 2EJCA 1ZIXA 2A9JA 3LYUA 3PXAA 3V46A 4EPYA 1Q74A 1KI2A 5HKKA 5C3UA 2MR6A 2D5AA 4AXBA 1E9RA 1YKGA 3NRBA 3KQPA 5G0VA 3TRHA 2B8EA 5ITZB 4GX0A 5JXJA 5LD2B 5A0FA 5JNRA 1H2ZA 4PYLA 4YRLA 5A04A 3NH9A 1NC1A 3HCAA 4CIYA 1NRIA 3SEAA 5BMVA 1KJIA 1DUIA 2GVDC 4WMLA 2KB0A 2BFEB 1GLNA 1KJZA 3TZEA 2Z6UA 1CYEA 1L5WA 5LLDA 1QE0A 3D5TA 2Z5FA 2C1ZA 4MVJM 4X84A 5IN5A 5CG1A 4XJSA 1OI7A 5CVJA 3FYUC 3M9LA 1RCFA 4C1NA 1K3FA 2PT9A 4FBLA 4RK5A 1K92A 5A4JA 3JWJA 4HNRA 5CUQA 3VR6D 1V11B 1F6BA 4IOKA 1H4TA 2D54A 4AMYA 1HOTA 1S8AA 5AW6A 5K8UA 4JP3A 2IF2A 1OGJA 2NUPA 3KYBA 1EQ2A 1OZAA 1FP6A 1UZAA 1GQSA 1MO3A 1VPLA 3ELDA 3N74A 3O47A 4OK5A 1N0VC 4LDNA 1JAYA 4S3MA 4ZCPA 2HBZA 3GLGE 1D2NA 3MWGA 4I1RA 5LP6F 2VATA 3NXKA 4ROSA 5CGQB 4PZZA 2Y0EA 4FYKA 2GPSA 1XFDA 3N70A 4EUEA 2E1PA 5JJ5A 1E4YA 5ILQA 1J0CA 4HDNB 4JEUA 1UP6A 3TLGA 4PRKA 3B60A 3BCUA 4B7UA 2WIAA 5FNVF 2H9IA 4NQRA 1WU8A 4OBWA 4S24A 5JAQA 1ILWA 1J0AA 2AF3C 4YMIA 3ZS9A 5LYJF 3DXFA 4G1BA 5EEHA 3G23A 4I4TB 1UM9B 3HHEA 5TMDA 4QVIA 2IUEA 4NYMQ 2R1ZA 5B30A 5I45A 3TRDA 1AX9A 5IF9A 2OGUA 2IEAA 1MTOA 3LF1A 4R1LA 3T61A 3TW8B 1C1DB 2MSKA 2OCPA 2VP0A 3A9VA 1SXJC 4WA8A 3KVYA 1PS0A 3ETCA 1ENZA 5JI3E 3H3JA 2HBYA 2YOFA 2ANBA 4Z51A 2JIOA 3DMYA 3RVMA 1DFGA 1Z6QA 2V7UA 4TWIA 2Q2NA 3KK0A 1OB5A 3DONA 1DKOA 2B5WA 2ZT5A 3HVKA 4IVQA 3SBEA 5AUNB 1YK1A 3RK4A 3JALB 1YE5A 3L6RA 4CCSA 1OREA 1E7QA 2JANA 1P9RA 4J0JA 3MBIA 4MZDA 4QOFA 4LYYA 1CIJA 2A9FA 4RM2A 3RRBA 3DLBA 2H4JA 1M0SA 1LW6E 1JEAA 1NQTA 2P79A 2IZ1A 4BL5A 3K9BA 1S9DA 3N39C 1OGIA 2GPTA 4GRAA 4G86A 1K8ZB 2QAGB 4QODA 1P1KA 4D97A 1C41A 4G4SO 2WB4A 4BECA 3R20A 1EINA 3RUFA 5LPNA 4QHSA 1VP9A 1EUDA 1PYGA 1XTBA 1SBIA 2GOYA 3DFUA 3IP9A 3T9FA 4RZ2A 2VDUE 4DJEC 1GHTA 2VDPB 3H6HA 4Q24A 1J42A 3HYCA 1G8JA 3VAYA 4YRDA 3WYDA 5EQFA 1GA4A 1XVIA 2F3QA 1XKLA 2J46A 2I34A 4LRSB 2HWYA 4CF3A 3L0OA 2XAAA 4B6SA 1HDEA 3QJGA 1RWNA 3K0KA 2C5EA 1A8IA 1VBFA 5DNYB 2HHHB 4DWWA 1EVYA 3AF5A 4PC7A 2ZB2A 5ALXA 3AUJB 1KJ9A 3V4SA 1FFXB 4FB4A 2FUCA 2ZTMA 3RD5A 2P6NA 3Q0IA 3LAWA 3JQGA 5IH7A 4KRYA 1S9HA 4DR6B 3LRXA 1EK2A 4IGEA 4OD0A 3ZCPA 2YN0A 4Q16A 4CCYB 2YZGA 3ZR4B 1KGDA 3QA3E 2DUUA 4HMOA 3U9TA 5JT1A 1K2WA 4JXZA 3MUEA 3UV6A 3K0HA 3U49A 4GFDA 3A37A 3IUBA 3SEQA 3D4OA 3QE3A 1TM5E 2AVDA 3PRYA 4IF6A 2QRKA 1NGSA 1SXGA 2PEZA 3OHPA 4EO4A 3TPCA 3PF9A 5J5VA 3KBBA 2QW8A 3HBMA 3VR4H 1JG6A 1IY2A 3CLRD 4MS1A 1R0SA 4DY6A 1M2KA 4RQAA 3IVAA 3AY6A 1HFKA 1MABA 5GV7A 2YV5A 4YPVA 1EH5A 2REBA 4UVIA 3ZZNA 4QFBA 4D8YA 1DTWA 3MLEA 3IJ5A 4ZAWA 4ES6A 3M4ZA 4CT0A 2HIAA 1O1YA 3OJOA 3HN7A 3KZCA 2JGAA 4QOGA 4UNNA 2HRBA 4RA6A 1M75A 3GUYA 3I9OA 1PR3A 4DTIA 4PLHA 3HCDA 1GXSB 1BQ4A 1F5SA 2B5OA 1G5HA 1KXJA 1TGYA 3MRXA 4LZZA 5IJAA 2OUKA 5BSRA 5H9WA 4QZVA 2MU1A 1A4UA 4IXNA 4LFBB 3NBMA 2HY7A 5KTSA 3AOEC 4GAEA 1QKKA 2FSVC 2QTRA 3V2UA 3FRIA 3HI6A 3ND9A 5J23A 3JQDA 3OZBA 4K9PA 4XM1A 4YRQA 2AQ8A 5EPOA 3WGTA 4C2BA 2IYRA 2YHBA 4Q3OA 3HXLA 1P8JA 1SVMA 2FSIA 2DWPA 3MBKA 5HK8A 4C3VA 1XRNA 2X8WA 3FHJA 1H5NA 3W6UA 4CMGA 4JUDX 4IRMA 5BWNA 3OTGA 4RD1A 1KAMA 4HLDA 1J5EB 3EPJA 4HFJA 1S02A 3TQIA 3KP1A 3WNQA 3T5MA 2XMPA 2PT7A 3CLVA 5CFOA 4O4JB 1J9EA 1UWVA 3PK0A 1UBJS 2XWQA 3X1WA 4LXXA 4DB2A 2ZAGA 3F4BA 3N2ZB 1KDYA 1CUYA 5DGDA 1N0WA 2F00A 3KB8A 4JX8A 3VPFA 4PHFA 4K81B 5T8KA 4AK9A 4Z53A 1TZ2A 3LDUA 3U6KA 1QBKC 1JR3A 4GIBA 3K5WA 2C0CA 3PDJA 2I4RA 4TQAA 4ZI7B 2XKBA 1DU4A 1QORA 2FMFA 4QKQA 3DZHA 3A31A 3FFBA 2YHIA 4RY2A 3FHLA 2C3MA 2Q5LA 5DW3A 1ULTA 2BGWA 1XZQA 4AL4A 5ALMA 1FFEA 5A6SB 1NUTA 1UINA 2YWDA 2XTNA 4L95C 2HRCA 3GEBA 2VSOA 4IH1A 2F8SA 4QIHA 4DYVA 1CRPA 4EHAA 2D0DA 4GZ6A 4QASA 2CLOB 2ZIWB 3Q3IA 2YFHA 3IBFA 3RTGA 2YW2A 1N92A 2WSMA 1LD3A 5CLLA 2HD4A 3MZ0A 2KPOA 2NXJA 4KYVA 2BDUA 5DP1A 5FUYA 3T0FA 2FW1A 2BOVA 3ABZA 121PA 4QBGB 1ISRA 1NNI1 3JQPA 5IK2A 1C9EA 1XMIA 4ZODA 3ZHBA 1SB9A 4XYBA 4R84A 4ZQBA 4CLDA 1CV2A 5B64A 3NWBA 3ETEA 1ZNZA 3ZV5A 4O2LA 4ALKA 4RH1A 3RG8A 5K8LA 3LDHA 3F1KA 4YJGB 1FSZA 3TX2A 1FXWA 2IV7A 3VKFA 2Q62A 3DEFA 3O8LA 1P1JA 2BJWA 2BI4A 4N6NA 4WINA 1CNMA 1NVMB 4PPNA 2JCYA 4AJOA 1PFGA 3GUCA 2MMGA 1NLFA 1D5CA 3BTOA 3KTAB 1DVRA 1KVQA 1U2PA 3E7PA 3NJ4A 3RFXA 3SS9X 4E07A 1EXDA 1Q44A 2P4SA 2ZUUA 1T1SA 1GPWB 1OWNA 2XB9A 3I9V1 3PXCX 1MOQA 2CZQA 2ORWA 4NAVA 1SQ0A 3H5NA 3LHDA 4NU8X 1MENA 4EW1A 4RLSA 3PBKA 3L7BA 2FZCA 2YBDA 4EPXA 3U44A 1XD2B 2P9FA 1M2GA 2VS1A 5FB3A 1RYZA 2PZJA 3C87A 1Z2CA 3RTBA 4BRUA 5CB4B 1EVZA 1DBPA 1QV7A 4EPWA 4RULA 2WYWA 4D3DA 1K5HA 1CBUA 1SR8A 4P2BA 4A8JC 2XDYA 2ZIZA 1Z82A 4HDSB 4YAJA 5JC1A 2RIPA 3UN1A 1UKZA 3PD0A 1A76A 4M9UA 1RZRD 1VLZA 4AYWA 1KBZA 4I4NA 3FPSA 4BFZA 1TLTA 4L74A 1U2DA 1JVBA 2BMFA 1QBGA 4L8FA 3GLFE 3PVCA 2O0JA 4CFZA 8MHTA 2H57A 4Q19A 5CYPA 5D3KA 1P4RA 3DM5A 4U2GA 1P2UA 3X1KA 2Q3JA 5BR7A 5CB6A 3QI2A 2HA2A 4DSTA 4CLRB 1R4NA 4PGMA 3QF4A 2CE2X 4DSUA 1RS0A 1P62B 2BHRA 2PUHA 2UKDA 3QHPA 2Y8EA 4GR5A 4KNVA 4YBRA 5EKDA 4BO6A 2NTVA 1SM4A 5HGXA 3NIWA 4V0SA 3LCMA 3NPMA 3VC2A 1TKRA 1PWZA 1L5GB 3SWWA 2JGJA 3WQRA 3FUTA 2GPNA 3AB8A 4J7UA 5A3RA 4AG3A 1QFSA 2OENG 3WLTA 4UJ5A 4PNEA 2COKA 1SC1A 2CD9A 2GPAA 3LVQE 3OAAD 1ZNYA 4FZJA 3WYEA 4YT2A 4IJVA 1YJAA 4CEHB 4BO2A 5FI0B 3ETGA 5F9MA 1Z3IX 4LHYA 4DSAA 3IKTA 4QA9A 4NJMA 3H5IA 1G18A 3D4LA 2OORA 2PLFA 1G0OA 2R66A 3OCWA 4G1CA 4RVUA 3KFXA 2WJGA 2P2LA 5KNDA 1J8VA 2CUNA 3SGLA 1XHEA 2A33A 3ESBA 2R6FA 4GE3A 4KJXA 4L4ZA 5BQFA 3QIVA 2J0QA 3G8AA 1VHDA 5EZSA 3DZDA 3UKOA 1WKVA 1YZLA 2XD9A 3OZFA 2CSUA 4E21A 2QJRA 4MVWA 4JI2B 3MFQA 4QT4A 5JJKA 5JAIA 2CNOA 1AQNA 4XWWA 2X9NA 5T4FA 5BOSB 5KO2A 4LJSA 3JQBC 1KWGA 1JU3A 2HK6A 3ZJUA 1ZUD1 4ALJA 4DV2B 1GLVA 4XYMA 3BEDA 3C1UA 3F9RA 1W88A 3EA4A 1OBHA 4YH1A 4C4TA 1Z06A 4RXTA 2Q3CA 1A4RA 2O14A 1G8MA 2O7RA 3KYDB 4Q9KA 4K3UA 3UIEA 3H1AA 3KUXA 4QGBA 4DMMA 3F98A 2REXB 3DV2A 3PEEA 1W59A 1SXQA 2IPXA 3COSA 5EP2A 3ZDBA 1M8GA 1Z17A 5CDFA 1T3LA 1N7HA 1Y4DE 1GIAA 4TOIA 2ZAYA 1IWOA 4RH3A 3RJMA 5EZYA 5KEIA 2ZUDA 1QS0B 1E5DA 3GELA 3Q5EA 3RSHA 3KT8A 4YMHA 2FDCA 4N76A 4JITA 1FIUA 4QSHA 1W49A 1X87A 2R11A 2V1UA 1M6VA 4N3AA 2AZDA 1HT3A 4B82A 3P2EA 5JBIA 2ZZNA 3KUKA 2HQRA 1WV1A 1ZUHA 3IQZA 3O1HB 5CT9A 4PGFA 2X4LA 4S05A 2QNBA 2WP8J 3AI3A 2CSXA 5LM3A 1Y4AE 2I67A 3ZS8A 5LOVF 5AVJA 4UAUA 4KZPA 2YJ6A 1FFCA 3G8DA 4D25A 5KYVA 2FMXA 3OOJA 1PW7A 2GFHA 1J5XA 2XVZA 3FG9A 3GT4A 2IX9A 3NFYA 1P6QA 5CVEA 3A05A 2VQ6A 2V8OA 4A0GA 1P3JA 2VK8A 5KNCD 3PCXA 3BM5A 4U9UA 4DA8A 1IN4A 4ND1A 3K94A 2YX1A 1CUXA 1XZBA 3QU7A 5AVKA 2OV3A 3FTQA 3ZYZA 1XL1A 4ZDJA 2DCUA 2XXBA 4GBMA 2J3JA 1D6SA 3I2KA 3PG5A 3TLEA 4ASUA 1HXHA 4RLQA 1Y3BE 2XCSB 1R8SA 2DSNA 4J29A 5A9TA 3RU3A 1I4TD 1EDEA 2TRSB 4HWSA 3GEIA 3DTVB 2ET6A 1ZXLA 4MWEA 2C57A 3CPSA 1SD2A 2FSPA 1EYZA 3N2EA 3ZEAA 5JH7F 3IE0A 3SE0A 3MJHA 3PTLA 2WJYA 1P9OA 3SR3A 2JGNA 2XSZD 3HRIA 3H9CA 1Y3IA 4FYVA 4PC6A 5I9NA 4GOMD 1G7SA 4WLEA 4XAQA 5F12A 3LQRA 4ZKDA 3ICEA 1WTCA 4PSAA 3UJDA 5KQPA 1X7WA 1JQLB 1KC1A 1E2MA 2PM8A 1U0TA 2YZMA 3K1AA 1W4CA 3HJCA 3NKLA 4P4UA 1GTVA 4V39A 1UXHA 2PKCA 5D7BA 5F21A 2ZQYA 1B7GO 5HF6A 3V9PA 2NTNA 3RYIB 4AKTA 3TF5A 3GA7A 3DG9A 1PSWA 2W2NA 2PTHA 5JCZA 3K09A 3CZRA 1HG0A 2BGRA 2JGDA 4G2TA 4JUIA 3LDGA 1TZBA 3W3AA 2MSCB 5DNEA 3RTCA 3TTSA 1E1LA 4US1R 1M2WA 2ACVA 4JHLA 3DTYA 4OMUA 4O4HF 3GJTA 1ODLA 2ERCA 2WTBA 1TK3A 1Z38A 3TBKA 4OQZA 4CR7A 1UDBA 2BGKA 1RBZA 3OZVA 3IIKA 4MH0R 5EG5A 5K05A 2AMLA 1QF7A 4TKUB 1H0RA 1EGAA 1EAYA 2ZUVA 4IGIA 2OMEA 2QQ5A 5D3QA 5H82A 5HDQA 1QQBA 1E8DA 2JJ1A 2PL1A 2QTAA 1ZHHA 3DMHA 5AW9A 3ICQB 3SSOA 2RCYA 3RC9A 1Y3DE 3W5AA 5ALLA 1V25A 3MWEA 3LX4A 3RUAA 3LSYA 2FG6C 4X93A 2IHKA 3NDIA 1BYIA 3UA3A 4A2CA 4IPTA 5JARA 2H4HA 1JDSA 1KEUA 3GDOA 1NVBA 2A88A 5CBKA 2QZ4A 1EFVA 5M29A 1OX5A 3ESRA 3JAMA 1GEEA 1XLWA 4XKJA 2VCYA 3WSWA 1CHDA 2WJJA 5EIFA 3ZV4A 2E6KA 3B51X 1M2VA 4TTJA 4XB2A 5TS2A 2O2XA 3NEPX 3BIFA 4ML3A 4WOPA 2GAIA 3N8KA 4XFKA 1QGZA 2AZTA 1DPGA 3QVLA 3UGJA 2O4CA 2PPLA 2TMKA 2V6MA 4QUAA 3H84A 5KTPA 1G20B 3S2FA 1YASA 1IG3A 2JW5A 2MYUA 3PQCA 3R6DA 3KIPA 4FMCF 5ALEA 1UR5A 1ONNA 2GXQA 3LW8A 5HIKA 4MWTA 3F6EX 3OT1A 4DR1B 1DBWA 1YS7A 3GNTA 4V3CA 4H60A 4OBBA 4QDJA 2IS1A 3WK4A 3FIUA 2RHOA 3VU8A 4R1PA 3P2OA 2J9YB 5CHYA 3OF5A 1MDBA 3LXXA 2FWJA 3I61A 3OSZA 1BIFA 3KAKA 3IOYA 2PT5A 1BA2A 3B1ZA 3NWPA 4H1UA 4PR0A 4L4UA 2WQZA 2ZWOA 4EA6A 1GNLA 4UFOA 3LLCA 4AS2A 1HDOA 3D2CA 3G59A 1OVGA 3QX7A 4EDHA 1J2JA 1PQYA 1ZN7A 1S8OA 3IIIA 4Y2XA 4A0SA 4R1MA 5B58T 1NE2A 2CEAA 5AI5A 2F3SA 4UTPA 4B4WA 1YS2X 2Z6QA 1NNUA 4MWSA 5KC9A 4I36A 1Q84A 3IEPA 3NM6B 1XZDA 4W5HA 4ZZ0A 4YAWA 2WHPB 4IFEA 4LPSA 2W8ZA 4CEJB 1TJ5A 4Q1VA 2ZJ6A 2WJPA 3S7ZA 3W8FA 3LP6A 2Q6VA 4D4HA 4R31A 2OVBA 1XQWA 1UOQA 4W6QA 1FTWA 3THWA 3QF7A 421PA 4ZZ1A 1X92A 3HN2A 4QAJA 4I3GA 3ZU3A 1DX9A 2GILA 2XTMA 5JY6A 3TTVA 4DV5B 3T06B 3TQSA