4MGYR

Selective activation of epac1 and epac2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 47
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgyR00
4WZ6A 1NN5A 2OFWA 2JIZD 4HAUA 4P4UA 1X3SA 3SHWA 3UMFA 3U7GA 4IW3B 2FFAA 2EYUA 1N5JA 2NO6A 2HXYA 4MA4A 4PHTA 4II7A 1AKYA 1N0WA 3JVVA 2PJZA 3GEIA 1G7RA 2O8BB 4KO8A 2PEZA 1YZNA 1GKUB 1KO1A 1XMSA 5E7IA 5FOSA 4DLYA 2F43B 3KXKA 1ZM2A 4JSTA 3T1QA 3QPWA 4MGIR 4A6XA 4MKHA 2IUUA 2P65A 4HI0E 4BQSA 2G0NA 5EXSA 4ZIRA 2EU8A 1J99A 4B6FA 5IRCD 2W6JD 4Q1FA 4PANA 2D3WA 2JIZA 5J4KA 1P2TA 1ZU5A 3QVUA 2V8OA 1E3MA 1A5TA 4A4DA 3GLHB 4LRWA 3D6TB 4C0BA 3MWKA 5L3VA 1X8LA 2F7SA 4LUCA 1WA5A 5FOXA 4LJ5A 1PLLA 1NBMD 3CNOA 2IYVA 3AVOA 4JSYA 4Q9JA 1W36C 5CLQA 3GJ3A 1SULA 1CR1A 3SFVA 3WP1B 4KSBA 3ND9A 3A4NA 4D0LB 2G1JA 2Q3HA 2VQSA 2IYXA 3MMPA 4AYXA 5EUQB 4TWZA 4ZDIA 4RZXA 2YNMA 1XD8A 3AF1A 2CLDX 3THOA 3RVBA 5BN4A 4IOLA 1N6LA 2W2XA 2R6AA 2VBCA 2W6JA 2ECKA 3BFKA 2O8BA 2JLWA 1K5GA 1Q20A 2F6RA 3SU8A 4DC9A 2WWHA 4M8NE 1KKMA 2GEVA 3IEUA 2F1JA 1ZD9A 4YMUA 1KSHA 4E22A 2WJJA 1RW4A 1GNQA 4QGHA 1NBMA 3K9HA 4EPVA 4JYCA 3TSZA 1OB2A 3B8HA 1G5RA 2NGRA 4GZLA 1KSJA 4M22A 2CDNA 2UVQA 4BRUA 1GVNB 4KBFA 3V4RA 4PO8A 3NHAA 1CJTC 2QSZA 1P9WA 2BBOA 2WM9B 1E4YA 3FFBA 4KLNA 1BS1A 3ZIAD 1KJYA 1TF5A 3GJXC 3CUEF 4PO1A 4DLWA 4U5XA 4Q9LA 4MYTA 1SHZA 1Z6YA 1M7HA 3KZ1E 2QPOA 5G3ZA 1R6BX 5P21A 1D2MA 3K0AA 3CB4A 3R7WB 1DBSA 5AUOB 1AKEA 2OFOA 4NCHA 5EJEA 5KTYA 2ZE8A 1G6OA 1KDTA 1VIAA 2CL6X 2N1BA 5H8WA 4P4TA 3QKSA 2QP3A 2NPIA 4HLQB 1YR7A 5KUTA 4FINA 3HWSA 2R8RA 1XEXB 2Z4RA 2X1VA 1JJVA 1NJFA 1KI6B 1UEIA 4DDUA 4BZPA 1NP6A 4OHXA 4PPFA 2ZRCA 2NO0A 2R6CA 5C18A 4LDJA 4XJXA 3OIUA 1F2UA 3ZIAA 3VU9B 2P5SA 2H17A 1MRNA 2I4IA 4PZZA 4ACAA 4P32A 1C4OA 2WPDD 4DT1A 2XZPA 2JEOA 3R8CA 1H65A 1E9EA 4V0ME 1UKEA 3LXXA 4E5UA 4F92B 2FJUA 3C8UA 1I4DD 1IXZA 4B2PA 3MWLA 3RRZA 1JAIA 3C41J 1KK2A 5FFMA 2ZI4A 4A36A 1P9RA 1TTTA 4NYMR 1RYFA 4H1VA 4V03A 4I1OA 1SKYE 2GJ9A 2V54A 4EQ6A 1C9KA 4M9QA 4TT3A 3CLVA 3DZDA 4LPSA 4A92A 3R9XA 1W36B 4LOAA 4PXAA 3EPKA 3RS2A 2R65A 4OL0A 1G4AE 1MH1A 2ZS7A 5FTLA 1E2MA 2NZ8A 3A36A 3UWKA 1A1VA 4BRWA 1N6PA 2WPDA 5CIWA 2WKPA 3W6NA 2PT5A 1O87A 3FMIA 1VDZA 2VYFA 4W9MC 3KQLA 3RC3A 4B48A 4QJ4A 2GTPA 3AKEA 2ZRGA 3ZQ6A 2ZJ8A 4JKYA 1XTKA 3SQXA 2R6GA 2C95A 3QEJA 5EP1A 2C9YA 4RKEA 2V1XA 1P2UA 1G7TA 5FTMA 4BLTA 3F3YA 3MSXA 4NKRA 5HZKA 5L3SA 2GKSA 2AFIE 2WAYA 2R9VA 5E4FA 3GFOA 3M6AA 4NCNA 3CPJB 1CULC 3I8SA 4PAOA 4I99A 4QHYA 4ARZA 2RGEA 1UAAA 3AP2A 3QXHA 3ZVNA 2HJVA 2V1UA 1OYYA 3A4LA 1G1MA 2YHSA 2CVFA 4PZLA 4XWAA 3IILA 4E03A 1FMLA 4FMCF 6Q21A 1E0KA 4Q02A 2REXB 3MJRA 1U8AA 4G5OA 2YOHA 2NOAA 3FYHA 2OEPA 1O3YA 1GITA 1ZCBA 4BLOA 4WZBE 3AKDA 3GJ7A 3NIBA 3PUXA 3UATA 4CZ2A 4DDWA 1D9XA 1T8TA 1G6HA 1TEVA 1PZNA 4RZ3A 1R5NA 2ZSFA 4GT1A 4HAWA 5DIFA 2QT1A 1JR3D 3T35A 3W3AA 2CCJA 4PPGA 2GRJA 2QEQA 3BB3A 3DEFA 3DVLA 4MGYR 3U44B 4XTCS 1E2JA 1J70A 4PC7A 1XD2A 4A2QA 3UWOA 3TMKA 4AKHA 4YMWA 1RZ3A 2AL7A 3MFYA 4FCWA 5C4MA 4DB2A 4MDFA 4B75A 5JWHA 4BPBA 1Z07A 2ZJZA 3BIFA 1KAGA 1YZTA 2H18A 1Z5ZA 1KNXA 1DO2A 1P72A 1COWD 1IXRC 1G3IA 4TTRA 4LBYA 2CJWA 3R9WA 4IEEA 1VYUA 5D3MA 2PL3A 4GBMA 2XITA 1XEWY 3GJ8A 2A2ZA 3IIJA 4HAVA 4CEIA 5EE9A 2BM1A 1XCMA 3U3OA 1VHLA 4ZCMA 3RSOA 3GLGE 4HZUA 4UXIA 4U00A 1H8HD 2HYDA 2DWOA 4JLMA 4NZYA 2XJ9A 2CK3D 5FPSA 5LBIA 2GZAA 3Q7QA 4IHQA 1CR0A 1E2HA 2Z5FA 5TV2A 1WB9A 1JXMA 4EJSC 4URUR 1TPZA 3TGPA 1S3SA 3K1JA 3NEJA 1ZU4A 2B92A 2DFNA 3SHFA 5BWMA 4QM6A 1D5CA 1FX0B 2ZS9A 2J0VA 4WXPA 2B6HA 2CMKA 1W0KD 4NYJR 2WWIA 1P61B 3IBYA 4ZDWA 4FMDF 5JWRA 5FTKA 3LWNA 1E2DA 2ZRDA 2ZRKA 3F5FA 2V7QD 4Y0VA 2VHCA 4JJZA 1BYIA 1CJMA 3CRQA 4LJ7A 3GJ6A 4IFEA 1E32A 1W44A 3A1VA 1KSFX 3DMNA 2CK3A 3EXAA 3FDIA 3EC1A 4QRHA 3UK6A 3VHXA 1LS6A 1GAJA 1J7KA 2AKYA 1AZSC 5JBQA 2OBNA 4FIDA 1W1WA 1YZKA 3DOFA 3K9LA 3SQWA 3U2QA 2YWEA 3NVAA 4C0KA 3PIRA 4Q4AB 2P2LA 2AKAB 3AB3A 5ANRB 3I32A 4WXRA 3ZH9B 5KDDA 2BKUA 3I8XA 2CBZA 1W0KA 4L4UA 1NRJB 4TMTA 1I2MA 1JEEA 2JLQA 3CX7A 3KJIA 4P4SA 1WE2A 3AEZA 4C9BA 4ZI3A 1Z2AA 3BERA 2ZR7A 4EPRA 2NO1A 4Q1DA 2FPKA 3EAQA 3QNUA 1G16A 1XMJA 3HR7A 4Q7KA 3K0CA 4MRPA 5KSYA 4ZPXA 1A7JA 2GETA 4MITA 3QPVA 2OXCA 1CTQA 2NQ2C 1KI9A 2QRZA 4TMKA 1P73A 4I1UA 5DN6D 1W47A 1FFHA 2IEZA 2DCUA 3ONWA 1BMFD 1QBKC 3Q5EA 2QGZA 2VO1A 2OUKA 4CEHB 3ADBA 1OXXK 4HSEA 2EFHB 4Z54A 3GLFA 4TLDA 3CW2A 5FTJA 2IS6A 2REOA 2VHTA 3GEHA 3P32A 2JA1A 1HE1C 4LYHA 4OQMA 2J7KA 4Q9IA 5TY0A 3C15C 3AVYA 4LBVA 4L16A 3KFVA 4ITRC 3B5JA 4XVRA 3FHTA 1NVWQ 4GP7A 5KSPA 1G3MA 1G19A 4IOKA 2DY1A 3IEVA 3W8RA 5TVKA 1KTVA 2ZRLA 2MMCA 4QOSA 3P27A 4UNRA 3MCAA 1OIWA 1EESA 1DAIA 2OE2A 2ZAMA 4TLEA 4Z8XA 4D4KA 1N2CE 3UXMA 1R2QA 3B2EA 2QBYB 2NO9A 2OT3B 2G1KA 1XD9A 1BMFA 2ZM5A 3E70C 4QGGA 4EJSB 2G88A 2BVNA 5G53C 3ZZTA 1W7AA 4V0KA 1YRAA 2ODNA 5CLLA 4M1MA 4N1AA 1H8ED 1U0HC 3QBVA 2KSQA 3CRW1 1G20E 1DE0A 3TNFA 2WJIA 3DZ8A 1KNQA 2CE7A 3FE2A 2ATVA 5KDOA 1FPMA 3GCGA 1FMJA 5A4JA 1KY2A 4W7SA 3SJAA 1GZSA 4DVGA 4RY2A 1V5WA 2QAGC 4EKDA 4B3GA 4HLCA 4LX0A 3PG5A 4DLXA 2PZFA 3PJRA 1OLOA 3GFTA 1GWNA 2VL7A 1DAEA 4Q9KA 2OCBA 4LBZA 2PX0A 3EIQA 4CDGA 4MGKR 1IY2A 2ZU6A 1GNRA 3I4LA 3OESA 4MUAA 1YR8A 4QC2A 3ADDA 2ZUBA 1ZD8A 4LJYA 5EP2A 4IDPA 4LJ4A 4Q1AA 5G3YA 1R10A 4LY6A 5IK2D 1OFHA 1AN0A 1KI7A 4CEJB 3Q85A 4TLBA 2VA8A 4DXAA 1UFQA 3ZGXA 3T1VA 1TUIA 2HF8A 3AVWA 5LB2A 1IN5A 4JLNA 1OPXA 3LY5A 4JBXA 1ZW6A 3L0OA 4LYJA 5EE5B 4A8JC 3MRSA 4URWR 4PR0A 3VNVA 1Z0DA 3BXZA 4OQLA 1AA9A 3K0EA 1XWIA 4YXWA 1SHKA 2XAUA 2Q9CA 4NU0A 3NBYC 1M7GA 1ZRHA 4R2HA 5CB6A 2HYIC 2A3RA 2RGAA 1LS1A 3TVTA 1E2FA 4O0MA 5EE0A 4XWOA 3N2IA 3H0KA 1BOFA 3EA5A 4DDTA 4P0TA 3IUYA 4TQUS 1EFHA 4WOPA 4IDOA 1TF7A 4U02A 3SJZA 1AGPA 4BFZA 2YWGA 4BZQA 2WBLC 1FP6A 2PEYA 1SKYB 2C77A 1TQ6A 4D6PA 3S1AB 1ZNWA 3U3KA 4BFSA 4D0NA 4HUQA 2RGNA 1Z8FA 2JLYA 1G8FA 1XBTA 2JLSA 2GCPA 4EPYA 1BO6A 3C7KA 4QHTA 4WIAA 4IOJA 521PA 4P33A 2WIBA 4DLTA 4C7OA 5JS7A 3REGA 5F3WB 3B13B 2HLDD 1OFTA 1AIPA 2B8TA 2ZQ5A 1EX6A 3WNDA 1M74A 1OT3A 4NCJA 1T0HB 3T1TA 1FQKA 1KI8A 3O47A 4R71A 3GFPA 4LJAA 1NG1A 2VF7A 4X8LA 3V4FA 2WWXA 2IS4A 2GVZC 3B85A 2LWIA 4PPNA 4RD3A 5B30A 4Q01A 4AI6A 1CBUA 1Z06A 2IEYA 1TF2A 1FP7A 1MO6A 1KI4A 2NZJA 4OQNA 3ZQJA 1XEFA 2QAGB 2OCAA 2QL6A 5SZJA 3QF4A 1XMIA 3PXGA 3ICEA 1PLKA 2KWIA 2QMHA 4AD8A 1G8YA 1I4TD 1WP9A 4CVNA 3T1OA 2PX3A 2QY9A 3K0FA 2RMKA 1G3RA 5JHHB 2O8EA 2JJ2D 2HLDA 5J40A 1N6RA 4EUNA 2XNDD 4RCZA 3GQBA 2XSZD 4MKIA 4Q5IA 4AIIA 4JKIA 3HU3A 2CHGA 1TNDA 1N6HA 1R7RA 2ATXA 3D31A 5JFGA 3KXIA 4HB3A 3FVQA 2QTFA 3QKUA 5FPHA 3OFND 3Q3JB 3GEEA 3NKVA 1LF0A 5KNDA 3QXSA 1AQYA 2WJGA 3EZ7A 4KCGA 5AJWA 1TQDA 3KFXA 1P2VA 1SQ5A 1E0SA 4YLGA 1XMVA 2Q3FA 3KKNA 5EUMA 2H8KA 1T91A 3NEYA 1A2BA 3U3MA 3UG6A 3QG1A 4PAMA 1KSGA 1DO0A 4MGZR 1ZM7A 1MO5A 5KOYA 4A8JB 2FA9A 5TDHA 2J0UA 1XNJA 1PJRA 1ZUHA 3Q7PA 3TQCA 1E2PA 2ZUDA 4G5QA 2ONKA 3C4JA 3PENA 3AUXA 5HPYB 2XNDA 4C2UA 3I5XA 4IXNA 1T9HA 5K8IA 4MRSA 5CYOA 2FZ4A 4JVNA 1CS4C 2DBYA 1GNPA 4DSOA 1UDWA 3OFNA 4HAXA 5AK0A 4Q03A 4AYWA 4LSGA 3Q8XB 4RJLA 1IY0A 3CIOA 5F9FA 4D4MA 3TSOA 1VECA 2C9OA 1Y3AA 1K8RA 3FB4A 2VP5A 5FOUA 4NL4H 2J46A 2RGBA 1WF3A 3K09A 2VHJA 3K70D 1J8YF 1JALA 2PMDA 2GESA 2QU8A 3QG5A 2WSSD 4RD4A 1G3UA 3PUYA 1G5PA 3HYRA 4H9GA 4TL6A 4A6PA 1XRJA 2WV9A 2ZRIA 2R6FA 2JJ8A 3UMRA 4ZIRB 2VEDA 3CM0A 1RKBA 2BEKA 5HTKA 3GLFE 3TQFA 4AG5A 4C0SA 1YJ5A 3FKSD 2NMVA 1W4RA 3A58B 3UPUA 3NC0C 4LJ6A 5JECA 1L2TA 1OIXA 1ZBDA 3K9GA 4IFBA 5A0FA 1JB1A 3QE0A 4LI0A 3NWJA 3WNCA 4DCUA 1II9A 2QA5A 4JLVA 1FNNA 3TVDA 3ASYA 1MO3A 3LVQE 4KHZA 2V4ZA 3TW8B 4Z8YA 3HPRA 5GADl 4AY2A 3EARA 3RWOA 4URZR 3U60B 1ZYUA 4F4JA 4JLOA 1U9IA 4ZDJA 4XIGS 4OI1A 2QUZA 2WSSA 3NBFA 4AG6A 3N5CA 5KNBA 4RD1A 3H2YA 3PCRB 3NDBB 1YQTA 5AR1A 2TMKA 2LKCA 2IXEA 4C0LA 3GLGA 3FKSA 2XB4A 4OJKA 4B73A 5L8VA 3SNHA 2VP9A 1EX7A 1FZQA 2F3RA 3BC1A 1IAQA 1ESNA 3OIWA 1VYTA 1XU4A 1KI3A 3KB1A 1G291 2XTZA 3I1FA 4PZYA 2MSCB 2HDNB 3GJ5A 4BFUA 2OFXA 1S9HA 3EWSA 3QPUA 2WWGA 1TAGA 1VG8A 4B35A 2X2EA 2XTNA 2YZ2A 1SVSA 1ZNZA 3LBIA 3LX8A 1GM5A 1CR4A 5L3RA 3BD9A 3ADKA 2GVDC 2AHOA 2JGNA 2C03A 2XB2A 2WKQA 4X8HA 1F3OA 3VX4A 2JJ1D 3K0AB 2ZJAA 4LV6A 3RDPA 2ZJOA 1HURA 4RD6A 3TK1A 1R8SA 2ODBA 5CIQA 3EIHA 1I2DA 4B34A 1VG9B 1G7CA 3QKSB 2D06A 1VHTA 1ZM9A 4ZO4A 1VCMA 4M4SA 3A1TA 1M8PA 3WBJA 2IUSA 5UKDA 3DOEA 3F0TA 2CHQA 3OIYA 4KYIB 5KPJA 3EPJA 2ZI3A 3AVXA 4DLRA 2I3BA 2FOLA 4JJKA 2OCYC 3O8RA 2KJQA 2JATA 3J81k 2H92A 1YHNA 1OKKD 1F2UB 4RZUA 4OYHA 4BFWA 1BH2A 4FXPA 4DT1B 2JJ1A 1E1QD 2FFQA 5DI9A 1ANKA 1ZIPA 4DEYA 2GJSA 2IS1A 1JEDA 1W48A 2FDCA 4Q7JB 1HV8A 1NF3A 2FX3A 5F2EA 2O8DA 3W6PA 2J7PD 3IPYA 3O8CA 2GHIA 5HR5A 2FWRA 4JYBA 1E94E 4M1TA 1CP2A 1UKVY 1XTIA 2AFHE 2WIAA 3TUJC 1KI2A 2BBSA 1CJVC 4EQ6B 1Z0AA 2GXAA 3CRVA 1VPLA 3DO6A 2DB3A 1Q3TA 2ZRJA 2RAPA 4Q1EA 2ZI7A 1IHUA 4JLJA 1UBFA 2D62A 4M1OA 1OKKA 4C3ZA 4KAXA 3VFDA 3KJHA 2DFLA 2R2AA 2G83A 4Q47A 2ZRNA 3A1WA 3SN6A 1L7VC 3QBTA 2BJVA 1P6XA 1Z3IX 2C5LA 3LD9A 4LYAA 5DYIA 1DAGA 3BRWD 1E1QA 2IYRA 3LLMA 1E96A 2DYKA 2FEMA 1QHNA 1XXHA 1Q1BA 4AKIA 4TT3D 3H86A 1XJ0A 3AKCA 2WWWA 4LHZA 2XNSA 4DRZA 1L8QA 2J7PA 2W0SA 1DVRA 1GL9B 3B9PA 4TZ0A 4WA7A 1SGWA 1JPJA 4B32A 1PLJA 2OCPA 3GMTA 2QMOA 3PFIA 4IRUB 4TTQA 4V02A 4XSHA 2VTKA 3DM5A 5L3SB 1XX6A 4YDHB 1Q3HA 5L3QA 4BE7B 4BFYA 1HA3A 3JZMA 1OW3B 2UZ3A 3KB2A 2BBWA 1GRRA 2VH5R 3KUCA 4MYHA 4I4LA 4C0HA 2GCOA 4TYWA 3CZQA 3NBXX 2VP4A 5LD2C 3U7FB 2RB4A 5LDDC 2GK7A 4UNQA 1NN0A 2EFEB 2CNWD 2OESA 3U4QA 4FWIB 2QTVB 1TEXA 4TZ6A 4HLUA 2C78A 1ZD1A 1K5DA 2PZEA 3RAPR 1KDPA 4DSTA 3GLIE 1MKYA 5FBQB 4BLPA 4F38A 4TLAA 1E69A 2QNRA 4EPTA 2IA5A 3VR2A 3UKDA 1SXJE 4TMWA 1G21E 4TL8A 1E1RD 1VCIA 1OXTA 4QKQA 3TSWA 3QI2A 1E9BA 1XD2B 221PA 3F8TA 2JASA 3QEOA 3OAAD 5B2ZA 2KB0A 3QY0A 1DPFA 3T5DA 1PVOA 2VLIA 5LB4A 1DG3A 1YKSA 2CNWA 3EWAA 1T5LA 3WP0A 4CF7A 1OH8A 1ZJ6A 5SZKB 1EG7A 4BLSA 1EXMA 1VYVA 1XTQA 2HJGA 3EPHA 2D4HA 4Q9HA 2Z0MA 1FW6A 2CJWB 2ZPTX 2C96A 4NYIQ 5D3MB 4EFMA 5CJ2A 1G17A 1NY5A 1WMSA 4NTZA 1BKDR 4CEIB 1W5TA 3BBPA 3AVPA 1N5IA 3WYFA 3SZRA 4HZUB 3CNNA 1E1RA 1YR6A 4UXHA 2YWFA 4F7WA 3D8BA 2ZE5A 3BWDD 4QFMA 3BJIC 4US0R 1WBDA 1NVVR 2WJHA 3OAAA 2J0QA 2FEOA 2GAOA 2R6DA 4KJZA 4KBGA 1NNEA 5AWFC 3U6KA 4LZZA 1UEJA 4ZCIA 4FCVA 1QVRA 2QGNA 3LV8A 5IDVA 1K6MA 3HDTA 1XJQA 4AWXA 4TL9A 2H57A 2ZEJA 3WNBA 3DPUA 2R62A 4D4LA 1R4AA 4XTRA 1AJEA 1W5SA 4NBSA 3MGCA 4HYYA 3AQ4A 2AK3A 1W4CA 4K81B 5AUQA 1A4RA 1LTQA 4JL8A 2XX3A 1HT2E 2IHBA 5DHFA 4C0JA 4MDEA 1YZLA 1HQCA 3IBGA 4OHYA 1EGAA 1KKLA 1IQPA 4JVSB 3MG9A 2V6IA 2WJVA 3DMDA 3EW9A 4LV5B 3FMFA 2ORIA 1OH7A 4N0DA 1IONA 5FPYA 4LC0A 3AVUA 1DARA 5LD2B 3IPXA 4IVRA 3R20A 4L8GA 1JAHA 2BIFA 4GSYA 4TQAA 1NI3A 3FMPB 4JVLA 3CR8A 3WMFA 1ODFA 4NDZA 3DKVA 3TH5A 4P4SB 2ZYVX 3W5JA 4B74A 2BV3A 4DLZA 4KU4A 3VR6A 4QL3A 2B21A 1IOZA 3LBNA 4PHHA 4LGMA 1R0XA 2YV5A 3D3QA 3LFUA 4DB4A 2XOKA 3WYGA 3BH0A 3W90A 3I73A 4KFRA 2JLZA 1GP2A 3W8NA 4BLRA 4PHFA 3FHCB 1GKYA 4NHOA 1NSFA 2PCJA 3KL4A 2A5FA 4G1UC 4HUTA 4TYPA 1ZC3A 1G9XA 3WHLA 2EFGA 1XB2A 1ESMA 1YZGA 3IQWA 4A2WA 3TUIC 2GK6A 2ZYUX 3C5CA 4FMCB 3LLUA 2BBTA 4EPWA 2I1VB 2JDID 2NTYC 4MKFA 2L0XA 1E2NA 1MT0A 2CLSA 5HKKD 2EFDB 3GLFB 3QUSA 1NMZA 1I4LD 3WY9A 4EFNA 3PUZA 3EX7C 1XPUA 2A30A 3H1TA 1W0JD 4GOKA 4PSAA 4M2LA 1VMAA 1Q44A 4JS0A 4AKGA 1Q21A 1YR9A 4HEJA 3RRNA 3I62A 2PCLA 2PT7A 2JLXA 4JL5A 3H84A 1R0ZA 4DJTA 1QZXA 1G18A 2V6JA 3LQQA 2RGNC 3IIKA 4FN5A 2O0KA 5FH9A 1RRCA 2GA8A 3RSLA 1AK2A 4O2LA 2JAQA 2AX4A 1XZQA 3ETLA 3MLEA 2WAXA 4OQFA 3EZ2A 4FMBB 2D74A 3BH6A 2IF0A 3RRYA 3WMGA 4GP6A 1FTNA 3THWA 3I92A 1X86B 2JDIA 2X19A 5EXPA 5DHAA 3UANA 4Q4JA 1TADA 3ZJYA 4JT4A 5HKKA 5GJBA 3VKGA 4RKFA 5AUPB 1QHHA 3GJ4A 2Q21A 1P75A 2CCGA 3LBHA 2J87A 5EXTA 3FWYA 4ZCLA 1W0JA 3TKLA 4G5SA 1Z6GA 3ND8A 4LHYA 3SEAA 4P31A 1JR6A 1M1YE 3LRPA 4YMSA 1NIPA 4R7ZA 5E95A 5FL7D 5DO9A 1Z6TA 2Q9AA 1D6JA 3ASZA 3SYNA 5IF9A 5JMTA 2OLJA 4J0QA 2EQBA 1LV7A 2IUTA 2PLRA 3QKRA 3U3RA 4B6EA 1RRFA 4JLDA 1KMHA 2OAP1 1J8MF 3V00A 1Q1QA 5C4GB 3EIEA 3MWYW 4JLPA 1NKSA 3B1VA 3TR5A 3DHWC 1XXHE 3GLHE 3JZAA 2BCGY 4S35A 2FSFA 3ZS9A 3CO5A 4OHVA 3SYLA 3ADCA 3C5HA 3RRMA 5JZVA 4B3BA 1CLUA 1YZUA 4FMDB 4Q4HA 4BZXA 4DLSA 2KE5A 2N42A 1M34E 5FL7A 4IKEA 1PUIA 4CW7A 3CPEA 2ZJ2A 3NHBA 2RH5A 2ODWA 1DTSA 3BGWA 1Z6XA 3VNUA 1NLFA 4IJMA 5EE1A 1Z22A 2FG5A 4ESVA 4C30A 3T12A 3FGNA 1Z47A 1US8A 1F2TB 1DAFA 2WKRA 4HB4A 3ZZ0A 1VCOA 5KNCA 1NKTA 3X2SA 4ESHA 5KHOC 3CH5A 3X1XA 5AUNB 5FBRB 5FUVA 4GMXA 1KZGB 1SZPA 1ZUNB 2B8WA 2VRWA 3PEUA 1TL7C 3KQHA 4B43A 4M1KA 4Q1CA 2ZE7A 4BECA 4EDHA 121PA 3SBEA 4WBSA 2W00A 1N3BA 1Z0KA 4A0GA 3RLFA 4RZ2A 5K8LA 2OM2A 2QE7D 3BB4A 3X1YA 4XVUA 2ZRBA 3B7GA 4YXWD 3KJGA 1JQLB 3K09C 1XP8A 2VP2A 1E2EA 3P26A 4MUBA 2AWOA 3ZVMA 1S0UA 2KI5A 3SOPA 3HJNA 4FW9A 2PMKA 3K8YA 3RNLA 3LX5A 2J5XA 1RYHA 4HUQB 4Q48A 4A1FA 4ABYA 1SVLA 1XEWX 3AM1A 2ZANA 4HDCA 2DR3A 2C04A 1LFDB 4C7OB 4NPHA 1UM8A 5JS8A 2PJRA 2BC9A 1XDBA 5JHGB 1LF5A 5K8TA 3I61A 4EFLA 2FZLA 2ODEA 5JWOA 3SC3A 1XTRA 2AK2A 4NYMQ 3ECCA 1F2TA 1HYQA 1A82A 1P3JA 2AXPA 4BLQA 2BM0A 5FR2A 2QE7A 5CK5A 4DCSA 5AJYA 5E3HA 4UJ5A 3U7HB 1U9IC 4B2LA 3K70C 5H68A 4B33A 3IO3A 2XXAB 4TQ9A 3CRRA 2H5EA 2O5VA 1OE0A 4XVQA 5FBLB 4AURA 2HF9A 4LWZA 5HE8A 3RABA 4M9ZA 1AS2A 2PZGA 2A5GA 3QF4B 3OEHA 1HUQA 4WW0A 1G8PA 2FPLA 1U90A 1ZINA 3QF7A 2ZVQX 4GPTA 1U8ZA 4Z1MA 3P4YA 4PC6A 3K0FB 1FL9A 5EE3A 2O8EB 5AJXA 5B57C 3B1ZA 1LY1A 2NO7A 1II8A 4JL6A 2P6RA 2YVUA 5A5GA 5KPDA 3C14C 3H4MA 3VTKA 1D9ZA 4IVPA 2W2VA 4C0AC 2ZYWX 2PLFA 2HT6A 1Z83A 3ZD6A 1NSTA 2Z43A 3LVRE 4H1UA 3V9PA 1Q22A 1XCPA 1E2KA 1XTJA 2WZQA 4QM7A 5FOTA 2A5JA 4M1SA 1KK0A 3TRFA 2XZOA 3ZLJA 1ZM4A 1ZIOA 4URXR 3QJYA 4QGFA 1TQ2A 1MABA 3GPLA 1RIFA 1LVGA 1Q0UA 1NJGA 2EWWA 1M7BA 2C8VA 2J0UB 2YINC 2ZTSA 4Q7MB 4LJ8A 3BFVA 2AD5A 4DUGD 5CJPA 3ZD7A 8OHMA 2ANBA 1SXJD 2YKGA 1NVXQ 1JECA 3EZ6A 1U8YA 1Z28A 4BEJA 3LH5A 2XXAA 3RS7A 4TTPA 4V0NA 2C99A 4PPQA 4GOXA 3ZVRA 1KO5A 1X8KA 2XEXA 2IF2A 3B82A 2ANCA 5DGXA 1OH6A 2QQEA 3LAWA 4Z51A 3K0SA 1SVOA 2FFBA 4MH0R 1P7CA 1JR3E 1WBBA 1ZUIA 3EG5A 3G82C 3GLIA 5BW8A 4B3DA 4WAUA 1CF4A 3PEWA 3FFAA 4LCBA 4DEXA 3THXA 4DUGA 3P20A 1KO7A 1SXJA 3KJEA 3TAHA 4I1SA 1OHHD 1B0UA 4K46A 4AC9A 2GF0A 3AVQA 1QHYA 1ZP6A 5H1YA 3IIMA 4KYUA 1Q12A 3CBQA 2FV8A 5IT5A 2D2FA 4G5RA 2GEUA 4HB2A 1YRBA 1RE0A 2WMOB 4DCVA 1HE8B 5CITA 4LV8B 5DNYB 2CXXA 2F1IA 2EVWX 3K70B 4YDSA 4MRRA 1RVDA 4QG7A 3AF4A 2IT1A 3AGQA 4FD2A 5D3QA 2ZXUA 3VMFA 4O3MA 5F9HA 2IYTA 5BQ5A 5BYJA 4OHZA 3QXCA 4IDHA 2Z83A 3A8TA 2C9CA 3GLGB 1HTWA 1IJEA 2QT0A 2QTHA 4BASA 1OHHA 5DH9A 4FWTA 4DZZA 2QPTA 1KO8A 4F93B 1N25A 3CF0A 4XOIA 1E9FA 1S8FA 2VIIA 1S1CA 4C0QC 2HCJB 2GF9A 3RWMB 1XFAA 3KTAA 2P0EA 1KOFA 3WXMA 5EXXA 5TXGA 2YJTD 4NE2A 3HU2A 4IDQA 4C4PA 5EZ6B 4DIEA 1Z63A 2FSGA 1J90A 1JXOA 4RCYA 4NP6A 3Q9LA 1CRPA 5EQTA 2RHMA 3OEEA 3ZZUA 1E9SA 4BFXA 1Y63A 2F9MA 5KYKA 1U2RA 1W4AA 2IYSA 1TU4A 4B44A 1SVWA 4ZKEA 4AKEA 1N6NA 3KKMA 3TE6A 1ZVQA 4PQFA 2VSFA 1XCGB 3RS3A 721PA 4D0GA 4YC7A 1E2QA 1G7SA 4BFVA 4U7DA 1E9AA 3SDZA 2RGXA 1Q57A 1VG0B 4GFDA 4LHWA 4RVCA 3GJ0A 4L5BA 4AK9A 1BYUA 4ZKDA 1CIPA 2QRNA 4PO9A 1Z29A 2XGJA 5JRJA 4G3XA 4KI0A 3RHFA 4CRWB 4DIDA 3PITA 1T5IA 1XZPA 2UZIR 2ZE6A 3SS8A 4D4JA 2BJWA 1OXVA 1FUUA 5KSOA 1OFIA 1IJFA 1UKYA 4UNPA 5CDFE 4UKDA 2SHKA 4HB0A 5JI3E 1LW7A 4ZI2A 4YONB 2QORA 1G8GA 2ORWA 1RPZA 1G4UR 2R44A 1F6BA 2G9NA 2BHRA 1F60A 2J41A 1T3SA 4JZKA 3G5UA 3KQKA 2BMEA 5GJCA 1W2HA 3HPQA 1GL7A 3THYA 5CB8A 2O8FA 4QJ3A 1GFIA 2O8DB 4XH9B 4POAA 3AVTA 1AS3A 1T3LA 4JMPA 1KY3A 3AP1A 2MSDB 1D2NA 3OE7D 3CZPA 4KLZA 1N0VC 2BCJQ 1FTSA 4GNKA 4G01B 4OK5A 2FN4A 4I81A 4JLAA 4KFSA 1AM4D 1LB1B 1U81A 1Z2CA 1T4GA 3LA6A 4OI4A 1NMXA 2A5DA 4BEBA 1HEIA 2XZLA 2C98A 4GMDA 3AV0B 4Q66C 2WOOA 3B6EA 2ZS8A 5HZHA 4EIWA 4PQRA 4TMVA 1W2GA 1XXHB 5J5CA 5DI3B 1IY1A 2H1LA 2V3CC 5FPTA 1HQYE 3O8DA 1BIFA 1OSNA 4L15A 1EFCA 1T8UA 3TLXA 4RFSB 3CKLA 1ELOA 1P9NA 2ZREA 2ZSDA 3NTUA 2G6BA 1RRGA 4B76A 4M9XA 2ORVA 2XTMA 4IEIA 4X8OA 3WRYC 1DELA 5JSZA 3EASA 3OE7A 2ZRFA 5KDLA 2F9LA 5J4YA 4Q18A 4LK2A 5GJWC 4KSCA 1CXZA 1HY3A 5L3QB 2RHDA 2WTUA 1TQ4A 3KKPA 4M53A 5H70A 2DFKB 1QHIA 3X1DA 2FGKA 2GCOB 1QDEA 1W46A 3DL0A 3IHWA 1TMKA 2BKEA 3QIAA 5SZIA 3ZYCA 2LCFA 3E1SA 3LW7A 1PUJA 1R0WA 2ZI5A 3SJBA 1G64A 1X6VA 1Q1EA 2FE4A 3U4QB 1E0JA 1Z08A 4NCIA 3KQNA 3PEVA 2IC5A 3FKQA 2XJ4A 1A2KC 5HE9A 3W6OA 2F43A 1G3QA 1FQJA 2VHUA 4BWYA 2D7CA 3CONA 4QBHA 4F4CA 2A78A 3B1YA 4DLUA 2O8CB 2FMXA 2J3EA 4EPXA 1NVUQ 2MSEB 2ZI9A 3VAAA 2GZDA 1ZNXA 4IDNA 5GJVC 4YQFA 1Z0FA 1N0UA 3SE0A 3GLHA 3LO5A 1E9DA 5DI3A 5SZHB 2VHQA 1P4SA 4N3NA 1DS6A 2JLUA 1S9DA 2RGGA 3NH9A 4RFSA 3PQCA 2HEIA 1WRBA 2IXGA 2LKDA 1R5OA 4XD7D 2J45A 3WMEA 1L4UA 4ON9A 3BH7A 4PC3A 2IYYA 1KK1A 1XTSA 2HCBA 3L0IB 2JLVA 4D25A 3I3SR 4NONA 3UIEA 3VR3A 1S96A 1UBEA 1GSIA 2IK8A 2X8AA 3L0SA 2QP9X 1KDRA 1SVIA 4HATA 4OKSA 2GCNA 3PUWA 4HDQB 3LQRA 4KV9A 2GBLA 3QOFA 1CJKC 3LDAA 4TN1A 2GWHA 2DFTA 2F1RA 1E4VA 2CE2X 3QKTA 1II0A 4RFVA 3SJCA 2O0HA 2AWNA 4WZAE 4B71A 4WVFA 3DM9B 2JLRA 1KO4A 2QZ4A 3PVSA 3QXJA 5FI1B 3VR4A 1E99A 2IYUA 5BN3A 3CRMA 3PUVA 2O8CA 1IN4A 3LNCA 3DKPA 2MMGA 3K0CC 1G8HA 4XD7A 2OV2A 2IL1A 4LPKA 5FL3A 5FPKA 5KU1A 1KIMA 1QHSA 1UBGA 5KSZA 1GRQA 3SYKA 2GXUA 3A4MA 3GP8A 3IO5A 3OIVA 1QG4A 5G40A 2ERYA 3BS4A 4PFSA 4P3YA 5EP4A 1UDXA 4A0HA 3C16C 3R7WA 4B3CA 2DHRA 4R2IA 1G41A 5JEEA 3CWQA 2YC2C 1E2GA 5DSZA 2N46A 2A5YB 2Q9BA 4W5HA 4G0NA 1KMQA 3KDSE 3TIFA 3FTQA 4L9WA 1DOAA 2WOJA 1CR2A 3FPAA 1XEXA 1E79D 1EK0A 2QENA 4W5WA 1KI6A 2IHYA 4TYNA 1XPRA 1S2MA 2OHFA 3KKOA 3TBKA 1FUKA 2OLKA 1W36D 3M0EA 4TMXA 4Q4LA 5FBVB 3EZFA 4ILEA 2ZU0C 3VU9A 1GG2A 3ZVLA 4C2TA 4OK6A 4M1WA 5JJKA 4F91B 3R8FA 4KVGA 3WYAA 2NIPA 2OSBA 3IDQA 4RD0A 2ZSEA 3WBKA 2EW1A 3OZXA 2VSOA 2H16A 1D2EA 2FFHA 2JCSA 2G0TA 3BE4A 3L2OB 1Z0IA 3AP3A 1E98A 2ZSBA 4TMZA 5DISB 3NDPA 1E79A 5G41A 4A82A 4PAQA 1J2JA 3PR1A 4HDOB 1RFLA 3RANA 4NMMA 3TUZC 4HAZA 5C1BA 3QXXA 4R9UC 5C46F 1AQUA 4TYYA 2RCNA 2Z4SA 1KK3A 2E9SA 5FTNA 1F5NA 3U3JA 3VX3A 4L9SA 2XOKD 3AGPA 4QXAA 1QG2A 2ZIAA 3IHLA 4GOJA 1QF9A 2IWRA 5FOVA 1Z6AA 3R9IA 1EFRD 2B7BA 2QP4A 3A1SA 3E2IA 3P1JA 5TARA 2E1RA 5E7JA 1X1RA 3JVUA 4US2R 4KVAA 1VIYA 2QI9C 1W49A 2WWFA 4BGDA 5HCIA 1RJ9B 3BORA 1KHTA 4NH0A 3WRXC 4IOMA 2P3SA 5K8UA 1NIJA 2GILA 4KFTA 5FR1A 2RKOA 5JJIA 4QNRA 2WMNB 2O52A 3THWB 2VPPA 4M1YA 4M9SA 2K5UA 4Q21A 4Q4JB 3B78A 1R5BA 3HR8A 4D82A 1GKIA 2IXFA 1CKEA 1QHHB 2NG1A 2P6UA 4LHVA 4CIDA 4F4IA 1OH5A 2VF8A 1EFRA 3U6BA 1JR3A 1RC8A 2HXSA 1CU1A 4DWJA 1E0AA 4KXFB 2FGJA 3LW8A 1NLZA 3L8ZA 1KZ7B 1FOEB 2CLCX 2QPAA 1TUEA 3K9NA 4OHWA 4JIMA 4OQXA 3VR1A 2D7DA 3REFA 4MRVA 3U5ZB 2E87A 2W2TA 5BXQC 2F3TA 3EC2A 4O2RA 2P5TB 3QKRB 4MYCA 4US1R 3GD7A 2CEAA 1C1YA 1COWA 1KMHB 2AN9A 1S4QA 4ERNA 4ZDKA 4CT4B 3QSYA 4XSGA 3RS0A 3U44A 5EP3A 5C2JB 4PSKA 3TW4A 3PV0A 2F1HA 1VG1A 4ZV4A 3ZDQA 5J4HA 2YOGA 4GRAA 1RJ9A 2ONJA 1XF9A 5JI2E 4Q4HB 1ZC4A 1L4YA 2J9RA 2ZJ5A 3MD0A 2ZRPA 3UG7A 1H8HA 1YU9A 5FOWA 5KO2A 1E6CA 1YZQA 4KODA 1OF1A 3E5HA 4QBGB 3IGFA 2W83A 3CX6A 1R0YA 1GIAA 4QBFA 2ZJYA 4A15A 3CWZA 1US8B 2OZEA 3MJHA 3DDCA 4G5GA 2GJAA 1E9CA 2WHXA 2HV8A 4AYTA 5CK4A 4D2IA 1GILA 4HAYA 4A2PA 2QG6A 2NPFA 2A9KA 2P67A 1QHXA 2ZI6A 3X1WA 1V43A 2ZYTX 5HCNA 3NBZC 1B23P 3TR0A 3MWJA 5BN5A 2ZJBA 2AR7A 1IN7A 1D8TA 2ZETA 3CR7A 3WHKA 2CL7X 3PEYA 1NBME 1MR3F 1S1MA 2VP6A 2V7QA 5EZ5A 2YC4C 3M1IA 5ELXA 2DWPA 2BDTA 1FX0A 2X77A 2GXQA 1M6NA 1ZM3A 2C2HA 3L0PA 2OILA 2W0MA 4HLDA 2OBMA 4DSUA 2X2FA 4OK3A 3A1UA 3W5IA 1IN6A 3AUYA 2ZVPX 3MAAC 4TYQA 1NN1A 2O0JA 1X1SA 4MKGA 3W9YA 2BMFA 3KUDA 3VQTA 3BK7A 4JBWA 1WCV1 1OV4A 3CNLA 4QBIA 1YVDA 4FCTA 4NCKA 1OXSC 4UXJA 5TMPA 4GL2A 5M04A 1AZTA 1SXJC 4JVMA 3OF5A 1HH4A 2IS2A 2CL0X 2J0SA 5J4VA 1JBKA 1ZCAA 2OO7A 3D7MA 4DKXA 4EAQA 4YMTA 5B58C 1P2SA 3L43A 3K53A 2H7VA 2FNAA 4Q4AA 2BWJA 3T06B 3FMOB 1DG1G 1T3HA 3VR5A 1U98A 3SI7A 2GZHA 2GXSA 4K8OA 2FU5C 4RSGA 3TAUA 5CDFA 3T5GA 1VTKA 2Y8EA 5DN6A 2KBFA 3B1WA 4CGZA 3RC8A 4DBLC 2GJ8A 1KJZA 4TLCA 4ASUD 5BYKA 4DSNA 2Z6VA 2IW3A 2GDJA 1OFUX 2W58A 1XJCA 4MQBA 4PHGA 2G3YA 4D81A 1U99A 1JI0A 2GNOA 2QROA 2GAAA 4D26A 3VKHA 5CYPA 1T0JB 2QM8A 1JJ7A 4A9AA 1JNYA 3AVVA 2Q3MA 2J59A 2AD1A 4CYMA 1II8B 4Q19A 1TU3A 4DDVA 4QGAA 1DAMA 3VKWA 3QENA 3W34A 5J4LA 2YYZA 2IYLD 2WWYA 4JLKA 2OAQ1 3RYTC 4OJQA 4D80A 1ZMXA 4CEHA 3OEHD 1N5LA 2OXRA 2CVHA 1WDTA 4X8MA 2OG2A 4UJ3A 4B3XA 1NL3A 2ZRAA 5CM8B 4ASUA 4Z1MD 3KQUA 3Q5DA 5CM9C 2YOFA 4V0LA 4JT2A 2QAJA 4PX9A 5AJZA 2CHVA 2Q0HA 2QM7A 5E7MA 2IX3A 2QSYA 1QVAA 3SR0A 1S3GA 3SFZA 4LBWA 1MABB 3MUFA 3IQXA 2FSIA 2VSXA 2B7CA 4UQOA 3NXSA 1CJUC 2IYQA 2GEDA 3KXLA 2KBEA 1N6KA 4JBYA 1H8EA 2EYQA 2ZUCA 4Q00A 2W6ID 4UNNA 4DHEA 2QBYA 1AGRA 1IM2A 1N6IA 1UADA 2ZSAA 5DLQC 4LHXA 2IYWA 4TL7A 4EJSA 3QVVA 4E09A 2EWVA 3RS5A 4PC1A 1FNMA 3FHOA 4Q7LA 1SVKA 5DYGA 5DE3A 5LPNA 1SVMA 1DADA 1VCNA 4HZIA 3NH6A 1GTVA 4DLVA 2AXNA 2ZRMA 4ACBA 3GLIB 3VHLB 821PA 3CF2A 1NLYA 1KYIA 2GJKA 1QHGA 4LYFA 2IYZA 2PH1A 3THXB 3W3ZB 2G77B 2UKDA 2BEJA 2W6IA 1IXSB 1SXJB 1CRQA 3EZ9A 3N2EA 3IKJA 3AH8A 5IK2A 5GVSA 4W5JA 5FI0B 1N6OA 4B47A 2WICA 2FF7A 2ZROA 4XWKA 3EPLA 2QMUA 4URYR 3NC1C 4BUJA 3TJZA 1NVVQ 1CEEA 1QRAA 1UJ2A 3UMSA 5JCZA 4QHSA 1UKZA 5F98A 2RGCA 1UPTA 1U0JA 2ASEA 4FI3C 2Q6TA 5JRZA 3KKQA 5JCPA 4CEJA 2WVJA 3U61B 4DCTA 5JLJA 3KX2A 1SKQA 1X8JA 3OHMA 4PTLA 4V0OA 1ZAKA 2IBMA 3AF0A 2ZITA 1EWQA 3M4YA 1GRNA 2BMJA 4GDFA 3G0HA 1WQ1R 4BFTA 3CX8A 4O25A 1XPOA 3CPHA 3HP1A 4OBEA 1MOZA 1KJWA 1IN8A 4R98A 4ARZB 4Y0AA 2FPMA 1GOTA 3HU1A 4GI7A 2ZR0A 3CH4B 5TB5A 1E2LA 1NN3A 4KFUA 4MYUA 4V0MA 1OIVA 1NG9A 3KTAB 2ZRHA 1KGDA 1NY6A 1W4BA 2A7QA 621PA 2DWQA 2QQ0A 1TX4B 4N0EA 2QMEA 5JEDA 4NYIR 4IVQA 2P6NA 4QNMA 5AJVB 2OBLA 3AF2A 3EA0A 4KITB 2F55A 1ZNYA 2WSMA 3AF3A 3S1AA 4LC1A 1T6NA 4PSVA 2HT1A 3O8BA 1EFUA 4PQYA 3U7EB 4URVR 1DEKA 1RRPA 3RS4A 421PA 2REBA 1EFTA 1U94A 1OYWA 4JLBA 4B3FX 4QJ5A 1F48A 1JPNA 1MV5A 1U0LA 3OEED 1UF9A 2EFCB 3HYTA 4CT5A 3QQ5A 4NYJQ 2FSHA 5FUWA 1N5KA 1KAOA 2ERXA 4Q1BA 2HUPA 1M2OB 1P5ZB 3B9QA 4E07A 1YE8A 4PC2A 3SBDA 3BFXA 1E9RA 4YMVA 3NG1A 1E2IA 1LNZA 2JJ2A 2PBRA 2WJYA 4IXMA 4TSFD 2XSZA 1ONBA 3B1XA 1P62B 1VKJA 2VP0A 3A37A 1AS0A 1GL6A 1KI1A 1MRSA 1P60A 3B60A 3T15A 3X1ZA 3T61A 2QAGA 4GZMA 3T34A 3THYB 1OJLA 4RD2A 3N70A 2ZR9A 2GBLC 3AKYA 2O8FB 1WXQA 3LXRA 3CF6R 5FUXA 1JQJC 1ETUA 4UNSA 2V9PA 4HLUC 1MO4A 1NMYA 3ZS8A 5IHPA 4OI0A 3FOZA 4OI2A 3L82B 1Z0JA 2D2EA 1KDOA 2RGDA 3BOSA 1DAKA 4MRNA 4S2EA 1Q1ZA 3BAFA 1EWRA 2CCKA 4M21A 1UBCA 2I1QA 1GDDA 1G5TA 3Q72A 3P4XA 4TSFA 2ZAOA 3A6PC 4DCNA 4A0FA 3I72A 5FBWB 1R8QA 2IWHA 2J1LA 1GUAA 2FH5B 1HT1E 4B2IA 3I5YA 1DAHA 1IBRA 5FUYA 3ICQB 2QN6A 2V55B 4A8JA 2BOVA 1OB5A 4I1VA 5J47A 5B64A 4M0LA 3BB1A 2YWHA 5GVRA 3L8YA 1OXUA 4LJ9A 4A0RA 5JJLA 2DPXA 5JSZB 2BMDA 1PV4A
chains in the Genus database with same CATH superfamily
2HMSA 4MUGA 4N3BA 4UMVA 1NN5A 2P2ZA 1Y48E 2K4MA 2Y0PA 5D3ZA 1O5IA 3SHWA 1A9PA 3UMFA 1Q77A 3MWFA 1AQLA 1KFJB 1I30A 2NO6A 1KU6A 3FJOA 2V1UA 1S01A 1BXRB 2YJ3A 3NBQA 2GD2A 1GZHB 1IHPA 1P2FA 2GPBA 4OHBA 3OT1B 4ZRMA 3GEIA 2VFAA 3HLKA 4QLOA 4BYGA 4JLUA 1FLVA 4V1CI 4GX0A 3TCNA 4F5WA 2O2YA 4DW8A 2O50A 3KAQA 5CH5A 4J2TA 5E7IA 1PW7A 3C3WA 3S2GA 4AX4A 5BQOA 4LEIA 1MW9X 3EVZA 5AHXA 4C06A 4YRZA 1ZM2A 3K6SB 4PVCA 4BZWA 3BWYA 3QPWA 3CLSC 4YJHB 4MKHA 3TLZA 2HZBA 2P65A 3C6BA 4HI0E 4BQSA 5EXSA 1J99A 2BFBB 2CMFA 4JROA 2W6JD 2XMSA 4PANA 6AT1A 1MBZA 4N39A 4R01A 2JIZA 1GPBA 3FRIA 2VYQA 3O0DA 1DXOA 2W2OA 4C6SA 4C0BA 4JVOA 1GQRA 4FQ8A 4JNKA 4FZRA 4N5MA 1KEPA 3FCCA 4N41A 1NBMD 3CNOA 4ZTUB 4JSYA 3FNFA 1W36C 2XRFA 1CZRA 1PIWA 1FE8A 3GJ3A 2W6NA 2IZZA 3JQAA 1JH8A 4KSBA 3QFRA 2PGXA 2J9FB 4D0LB 3JAWB 4B40A 2G1JA 3HL4A 3N0VA 4V2UA 1SCBA 3RSFA 3TTTA 5B1EA 2ZTUA 1HSOA 4H6XA 2Q8PA 3G5AA 3PDUA 2IYXA 1ILWA 2DG2A 2PWAA 4Y2HA 5DNVA 4ZDIA 2YNMA 5CBPB 5AOCA 1RCTE 2XVMA 3ZK9A 1HE3A 2YDXA 3IOMA 2VWQA 1A98A 1HDEA 2XOEA 4DWVA 5BN4A 2VBCA 1REQB 1MG0A 2ECKA 3BFKA 2O8BA 3ZXYA 1Q20A 2CZGA 2F6RA 2P9EA 3FRJA 1EK5A 1VFPA 3AESA 3BWVA 3JQPA 3SU8A 1C3LA 1DJMA 2FJPA 3K31A 4ZEXA 4X7BA 4YMUA 4MVWA 3MJTA 2D2IA 2WJJA 4C29A 5K3FB 3FZNA 1WR8A 5BN3B 2C4NA 3T7EA 4JYCA 3M2TA 3CZ5A 3L7LA 2JFNA 4AUNA 1QRUA 4EFDA 4NF2A 4A26A 2AUTA 3B3JA 2UVQA 4BRUA 1O4WA 1SBCA 2PO7A 2VVTA 5E3IA 4PO8A 3DZIA 4G4SP 1Z8DA 1CJTC 1PSWA 3H87A 3MYYA 5ALEA 3ZV5A 5GTDA 1E4YA 2YFYA 3ZUGA 4QTUB 3ZIAD 1J5XA 2XNKA 1KJYA 3FJYA 1D2RA 3BPSA 2JI7A 1E3TA 3GJXC 1ULUA 4U0JA 1SVUA 1OBFO 3HO6A 3FLAA 2ERCA 4GWKA 1UJBA 2OFPA 1ZJ4A 4L4YA 1ZKMA 4RFLA 4RZQA 4WJKB 3P5BA 1OU0A 4MYTA 5BV2P 3PXUA 4CLOA 1HE2A 2QPOA 5G3ZA 1NV9A 4PX5A 3WX0A 5P21A 3CB4A 1RPJA 1DBSA 2XF8A 3TI9A 3KBBA 5ESDA 4B2YA 5AM2A 5BPFA 5EJEA 2ZE8A 5G0TA 4WXMA 1G6OA 1KDTA 3R5SA 3PNSA 3TKYA 5H8WA 2JIMA 4L72A 4CBVA 2QP3A 2NPIA 4E5PA 4HLQB 2ETVA 4KNWA 4PLVA 4BQRA 4FINA 3BIXA 3QELB 4N3CA 4ENUA 1EK1A 1XEXB 3OIDA 2FI1A 5I7EA 1ODJA 1KI6B 2IHVA 2JNWA 1UEIA 4DDUA 4RIGA 1NP6A 4H7FA 4MB2A 5HP4A 3T3GA 4PPFA 2VOEA 1E8DA 2OKGA 4KGVA 4JZYA 3HL0A 1LC0A 1JKIA 16PKA 5DNUA 5LQNA 2M32A 5KOHA 4FOSA 1C4KA 1Z25A 4ND1A 2WVAA 2VZLA 2ZWOA 3K1AA 1VIDA 3GXBA 1QG0A 2CGEA 2NV6A 3JXEA 4P32A 2XZPA 4QYIB 4F1WA 4ARCA 4FFDA 3U3DA 2AJDA 1NNUA 2J07A 4WMLA 4CQLB 3C48A 2Y99A 1Y7PA 5IEJA 2BGLA 1O96A 1I7NA 2PZLA 5K20A 2IXBA 3A1CA 3HS3A 3AINA 3K16A 4I0WB 2YXBA 2GD6A 1SQ6A 3C8ZA 3P9IA 5LZ8A 5JAHA 2K2WA 1TTQB 3L8HA 3QPDA 4RE6A 5EKUA 1N1GA 1TTTA 2P7HA 4XEUA 5BVHB 4V03A 2GJ9A 3BXGA 4LZLA 4EQ6A 1GU1A 4TT3A 2GEFA 2YY5A 1M1NB 3JWIA 2Q62A 2C31A 1JBQA 2PA3A 4A92A 1B8PA 5GINE 1KVQA 1CLEA 3ICWA 3EPKA 2HTFA 5J5AA 1QYVA 1T8RA 2BL4A 4G89A 2VF4X 2R65A 3NOOA 4W82A 3CX4A 3OLYA 1POWA 2ZS7A 2BZSA 3A36A 4MWZA 4OLJA 4WNCA 2C4HA 1DQPA 2JGLA 2NU6A 4BRWA 1CUZA 1I1NA 2RK4A 5B37A 4AMZA 3W6NA 1DV2A 3KQLA 4JOCA 3DLBA 3SC4A 4B48A 1F1BA 5AW8A 2GTPA 3DMYA 4W9NA 4YBRA 1HO3A 4YQYA 3RARA 3ZQ6A 1ZJJA 2ISSD 2PBFA 4GF5A 1XTKA 4GP9A 5MFZA 1F8FA 2R8ZA 1DC7A 1H1TA 3AEKB 3E15A 3CUSA 4CN8A 4NBWA 4H4CA 3ZKAA 4BLTA 1YI8A 2C61A 1F0NA 4IXWA 3ACBA 3FZQA 4LDNA 2R8OA 5U4XA 3A6GA 1HSZA 3MSXA 5HZKA 2GKSA 2CXTA 5C1OA 4BHTA 5E4FA 5HHTA 1YA4A 3R5TA 1GNLA 5CU7A 1UAAA 4I99A 1EM6A 5F78A 4PN3A 3WGNA 3BE6A 4G41A 2HJVA 3HLYA 5HUJA 3W2IA 2MT9A 1JEQA 1OYYA 2YHSA 3O21A 1NOJA 3IILA 4DL9A 1FMLA 4EJ0A 3D6FA 2QTVA 4EATA 2REXB 4BVJA 2Q2NA 2PKCA 1U8AA 4R1MA 4G5OA 4INZA 4Z86A 2Q1YA 2YOHA 1TVKA 2YFQA 3X1KA 2Z6UA 1GITA 3LCUA 3DE6X 2HX1A 4CGYA 1PDWA 4D8VA 3AKDA 1A88A 1LPMA 1Y8RA 3R0VA 1G6HA 1PGOA 1ZD3A 3LCMA 2X0NA 2ZJ4A 4FONA 4R0MA 4JSRA 3E5MA 4GMKA 4XPZA 3F8WA 4GT1A 1Z12A 4HAWA 4DMCA 1JXAA 1HT0A 1K98A 2V74B 3AHGA 3PX2A 1MHTA 2X0JA 3DEFA 3DVLA 4I5GA 2IKSA 5M34A 3U44B 2ID7A 5CFQA 3M9XA 4B4OA 4PC7A 1FDRA 5LYJF 2WYUA 4A2QA 5JYDA 2C4MA 1OZHA 4IRXA 4AKHA 1QHFA 4G8DA 3TMKA 3W5SA 2FZ5A 2QYTA 2C7QA 3FOAA 2L69A 1R4MA 1C9NA 2FRVA 4FCWA 5AXCA 4NG4A 1TYCA 2NXJA 4MDFA 3RAJA 2GNAA 3L1JA 1KU0A 1Z07A 1D03A 3EQZA 1JHYA 1FDTA 2X9LA 2ZJZA 2FRDC 3ZR4B 3WMRA 5BSTA 1GGEA 4R5MA 4ZVRA 5AYVA 1Z6QA 4KZKA 3IQEA 1COWD 4GW3A 4CF4A 5JH7F 3F47A 4JQSA 1LK0A 4TTRA 1O94A 3C6ZA 3AFNA 1T1RA 3E6AA 3SS7X 4ZI7B 4CL3A 3L8MA 4FE7A 5D3MA 2PHZA 5HQ3A 5K5EA 1VSVA 2XITA 1H6CA 3F9RA 3GJ8A 5H9WA 4I4NA 4UASA 4Y1RA 3RGGA 3QRWA 3QEBZ 1N1EA 5EE9A 2ZULA 4KEAA 4PEVA 3EMVA 1CERA 1FBTA 4YCBA 3K1TA 2YV3A 3ZY6A 4RMNA 2DWOA 4JLMA 4NV3A 4NZYA 1EDBA 3JR3A 4UHEA 4UE2A 4ZREA 4JI2B 2FN3A 5IHXA 4YDRA 1SURA 1TIBA 2X9GA 5FNVB 4TGLA 1IC6A 3D3KA 4KXMA 2CEKA 1QDLB 2V65A 3WLQA 1TZMA 1WB9A 2JLCA 2OYSA 3TO5A 4NULA 3EK2A 3GJRA 1KEUA 3VPAA 1S3SA 3K1JA 1ZQ9A 3NEJA 1EVQA 1ZU4A 2G5CA 3KFLA 4NFSA 4D6XA 4ZHQB 2ZS9A 2FRXA 3D02A 3LUDA 2F62A 4BAGA 4KH1A 2I99A 3K32A 2WSBA 2X76A 3JYNA 1DU4A 1E1MA 4JC4A 5FEMA 1R15A 3I4CA 2V9ZA 3TLCA 2BFPA 3H5RA 4EABA 1WF6A 5TPZD 5AW4A 2VHCA 3OJFA 4R6XA 4FR0A 1CJMA 5EPOA 3VR0A 2AOXA 4JBIA 2RE8A 3GJ6A 2BFCA 4IFEA 1HFWA 2NV2B 4C7JA 4UREA 1KSFX 1SG6A 3EC1A 3UK6A 2FZWA 3VA7A 2CFOA 5T4EA 2Y1GA 5CA0A 2LP4Y 3HE3A 4JFAA 1ATZA 1J8VA 1O6BA 2MCFA 3LQ2A 1H4TA 4FIDA 5FJIA 4WOKA 3GZNB 1XZLA 2E4UA 5DPMA 5F7OA 3DB1A 4S0XA 1RSZA 3NOQA 1EUDA 4C0KA 1BQ4A 2YVKA 3G6WA 4BN0A 1PNOA 4WGGA 1M1ZA 2WF8A 5JS6A 4EB8A 2VCHA 3ZH9B 1WP4A 1KVSA 1DRKA 1W0KA 2CBZA 2Q5LA 2UVDA 3BULA 4NAHA 5AXBA 5BSRA 4P4SA 4B7XA 3GLKA 4E5NA 3AEZA 4LN1A 4GKKB 2O54A 1FYDA 5J59A 3TG2A 2FPKA 2PNFA 2DETA 1NF8A 3QNUA 2AG8A 4AJKA 2WE8A 4ZCPA 1G16A 2BJHA 2GZ2A 4YRKA 1NVFA 1VE6A 2FUNB 2OSVA 3B1KA 4Q7KA 4X3OA 1H2XA 5MFPA 4MITA 4UM5A 1YZHA 2GPAA 3QPVA 4HAOA 1MX1A 2V7TA 2CWDA 1KI9A 1T1EA 3U9TA 2E6KA 3I45A 3NHKA 5D6NA 3TRJA 4IG4A 1FFHA 3CKMA 3V9AA 1OREA 1RWKA 2ZYGA 5DV9A 2AQ8A 1EK2A 1QJCA 3CLUD 3JQEA 2H48A 2DCUA 5CFZA 2QGZA 2VO1A 3GUUA 2OUKA 3N6RA 2H1RA 1KY4A 3BRSA 3HA7A 3E03A 4ZK2A 3ADBA 2F8LA 2EZTA 2QHXA 4XJSA 4OKNA 2DWUA 3MPUA 1RRMA 5K0EA 3WL5A 3GEHA 4B4WA 2JA1A 2FR1A 2QUIA 3R6DA 4OOFA 3V2UA 5H81A 1ZCJA 1KQNA 4FFOA 3FHTA 4GP7A 5KSPA 4G26A 5F23A 3FNEA 3P94A 3FM9A 1KTVA 1Y4UA 2YWXA 1FP2A 4UNRA 1M2JA 1U02A 3II6X 4MUEA 1EESA 2PANA 4HWPA 3CG4A 4I8XA 5PGMA 4D7AA 2BKLA 3LLCA 4L9AA 4Z8XA 3TMYA 1QLJA 3MGKA 2HIHA 4MARA 4D4KA 3P0EA 1G0OA 3MBKA 2QBYB 1LPSA 2NO9A 2OT3B 3I0ZA 4I1PA 3GFQA 2ZM5A 1Z73A 3OPYA 3E70C 4KOAA 4UPVA 3FCUB 3N8NA 4EJSB 1NU8A 1FFWA 2PUVA 2ACVA 4FDAA 1SUSA 3IJ5A 2W6CX 3JARA 3ORSA 4Y2GA 2JVJA 4IX9A 2XKKA 4YAGA 4ZU1X 1U0HC 3FOEC 2KSQA 4CU2A 5IYZA 3GN2A 4R8VA 1SU6A 4DN6A 4D41A 5EZYA 3CLTC 4QOGA 1KNQA 2CE7A 2Y1FA 2RHCA 2O4CA 2HR1A 2PMCA 4N8DA 2C59A 3QMWA 1C9DB 3JQQA 3LU1A 4HH1A 3I52A 1CNMA 1X7DA 3WZ2A 4PS1A 1XOIA 4HUJA 3ODGA 3PC6A 1LK7A 2C29D 3USES 1LZLA 1OLOA 2D0IA 2VAWA 1AK1A 2A33A 5I7AA 4QDKA 3CVUA 2VL7A 4ETMA 3OETA 4MQ5A 1PL6A 2OCBA 1XL1A 4UTOA 4ZJPA 3EIQA 4KUEA 4NJMB 3VO1A 4JODA 3QTTA 4RKYA 1JPVA 3ADDA 3M4XA 3N8GA 2QLTA 1PF7E 3NNSA 2R3SA 4LJYA 5K03A 1PR3A 3E1GA 3N7TA 1UBNA 3O8NA 1KS2A 1ULHA 2JBHA 4LJ4A 1QIIA 1R10A 4LY6A 5IK2D 5DOZA 4CEJB 1KI7A 1YU6A 3LXMA 5EVCA 4TLBA 4DXAA 1NBIA 3DAPA 1UFQA 1UKBA 4HGYA 2Q99A 5HRCA 4BCBA 2R1VA 3AVWA 1IN5A 2GYUA 3EEIA 3AM5A 5IJAA 4IJVA 2ON6A 3LY5A 13PKA 1JFRA 1W5FA 1THZA 2CLLB 3NUQA 2GEBA 1PNRA 4J4BA 2Y66A 4B83A 5CDUA 1R8JA 1Y9EA 1Y98A 3GEDA 4NIMA 1Z0DA 3FPJA 3JASA 5AICA 2GUGA 2PUFA 1SUDA 4OQLA 3RFUA 1RP7A 1UT8A 1XWIA 2XAUA 3PXBA 3QX7A 3VYSB 1K88A 3VR4H 4DFDA 4EP1A 1NJ8A 1ZRHA 5IAAA 1NOKA 2RGAA 1YRHA 2DHQA 3LG2A 1KBQA 4EI7A 2IDJA 4O0MA 3W5HA 3A6FA 5C4IA 5I8WA 4IQ8A 3K92A 4UU8A 4MJ3A 4IIUA 1ODTC 1BOFA 4WEOA 2ZWIA 1IRIA 5F77A 3RI3A 4EY5A 2JD0A 5KJ6A 4P0TA 2YXDA 4WOPA 5E6RB 2DUUA 1N5RA 4IDOA 3U4MA 4U02A 1M5RA 2GVNA 3SJZA 1YNOA 1U7DA 2YWGA 1J09A 3ZE0B 5HMLA 4JP3A 1FP6A 1W9MA 2PU7A 3B5EA 2QVYX 3T4EA 4K6FA 2BKAA 3BJEA 4GUAA 1SR8A 1W6UA 1Y8CA 4D6PA 1KFCB 3S1AB 1JQEA 3HB1A 1XA0A 3U3KA 5ESRA 1Z8FA 2GH1A 2VJCA 3TZ6A 3WNZA 4DZRA 2P1RA 1T2UA 2QTGA 4AP9A 3C7KA 2LXNA 1BMTA 3I83A 2F4VB 3WJ2A 5I7HA 5GGYA 4C7OA 2RI1A 5JS7A 4JGGA 4JB8A 4EMTA 4IFTA 1GYRA 4EO4A 3UYKA 3B13B 2H00A 4R2JA 1A72A 2CBXA 2HXGA 3WNDA 5TEVA 3F71A 2JLAA 3T7KA 3ZE9A 4DLNA 4NCJA 2W2PA 2OQIA 3NYWA 3PFKA 4NPCA 3WTBA 4D3XA 2VDMB 5D5QA 3L7BA 3UFXA 1Y4SA 4Y0NA 1UIMA 4XOUA 1Z7BA 2GVZC 3B85A 4LNUA 5DT2A 5KNDD 3DKRA 1BRMA 3PPWA 4Q01A 4Z99A 4AI6A 1CUCA 3IDSA 3NGMA 1KP9A 1TF2A 1UK9A 4O4JF 2H2HA 1A8HA 1VOTA 3ELUA 4RDIA 3K0KA 2ZYDA 5HIMA 1XEFA 3ZBUA 1PW5A 5C32A 4WINA 2GGSA 4IMPA 5SZJA 3QF4A 2F9FA 4Q3AA 3ND5A 3STTA 1IZ7A 1R3UA 2QMHA 3GX1A 1PS9A 1NJ1A 4IDBA 3FZEA 1Z2PX 3OTHA 4WK0B 2DLCX 2J32A 3UC5A 2R8PA 3OQMA 3FOBA 2PV7A 1G3RA 2O8EA 1BG6A 2JJ2D 4J0DA 3TEJA 5J40A 1N6RA 4UCXA 4O8ZA 3GQBA 4DCGA 4JKIA 3HU3A 4F4IA 3EY9A 1R7RA 4EZIA 3HBAA 3KXIA 3AR6A 5HIKA 3FVQA 2PH7A 5FPHA 5ALUA 3Q3JB 3NKVA 4JYAB 3OPXA 5ICEA 1SOAA 4KCGA 3QJ5A 1ZKDA 1QGYA 1A4XA 2C0CA 1IHYA 5KTNA 1U5BB 4HFRA 1E0SA 5CXSA 3EFOA 1TRHA 2H8KA 3IS3A 4QFBA 1SK8A 4ZO7A 1MP0A 2Q45A 1C0LA 1UP4A 4E5DA 4MGZR 4N54A 1EFDN 1E3JA 2I2XB 1BS2A 2VJLA 2FA9A 5GMOA 2J0UA 2G28A 1AU9A 2AA3A 4WLUA 4J7XA 1ZUHA 1E1CA 3VU3A 5F9MA 1UBTS 2DC1A 2NPOA 1E2PA 3FUUA 4G5QA 2EHDA 4DA0A 2JD1A 3EE6A 4C2UA 1HYGA 4UMFA 4AN4A 3PQ4A 4EUFA 2AFIA 2F3QA 4C4SA 3DFIA 4IXNA 2WM3A 4YPFA 3PX7A 2C20A 3DPSA 1U7OA 3C8HA 1CS4C 1MO2A 1PNTA 1UDWA 3OFNA 2QRPA 4HAXA 1NI4A 5ALPA 3RFFA 1ETHA 1ZUWA 3F7MA 1O57A 1YJXA 3Q8XB 4MCIA 4R3WA 1JMYA 3CIOA 5E2BA 1GG5A 3DV0A 5F9FA 1BFKA 1VECA 3ER9A 1Y3AA 4QGBA 1RTTA 2ODAA 2ZB7A 3D6VA 2H4JA 2I2WA 4NL4H 5ALIA 2J46A 4EELA 3HJGA 1Q1GA 2FWNA 4J9VA 3OX4A 3K70D 1JALA 2PMDA 2N0SA 5DHUA 1XDUA 1N2XA 1YQGA 1EBFA 1G5PA 2WU0A 3HYRA 3I28A 4N8EA 5KNBD 3QW2A 5J63A 1UJ5A 2AF4C 1RWPA 2MYTA 5JFTA 2JJ8A 3TQRA 3K1ZA 3UMRA 1RKBA 2R8BA 3DQZA 1MCZA 3PIDA 4WRRA 1XDSA 3KU4A 3HUEA 4C0SA 2BLLA 4B6GA 4CJXA 1E1LA 3IXLA 4JEHA 1GA1A 2F1OA 3L4BC 4JR1A 4C6RA 5BVGA 3WO1A 2CLMB 2R6R1 1CV2A 1YFZA 2HBRA 1VB3A 3AI7A 4LI0A 3C1OA 4XDZA 3F5QA 5DF1A 3A04A 5TC4A 4DCUA 1II9A 3RODA 1LI5A 3JQAB 2Z3WA 1TGYA 2X5JO 4GG1A 4JLVA 4MV7A 3GLRA 2H1VA 1AMOA 1T26A 3N9IA 4J43A 4ENRA 1LQ2A 4Z8YA 5L4LA 1JSCA 3HPRA 1TKBA 3U60B 1DIOB 5BURA 1AO3A 4HRAA 3GNQA 1FRVA 2GBIA 3DWFA 3R0IA 4JLOA 4KQ2A 5D00A 3RRXA 4XIGS 4P54A 5LIPA 2O2SA 3SZUA 3TCXB 2IZ1A 5IZ4A 4RV9A 3HC7A 4RD1A 1TQHA 1Z38A 4QD3A 4RM2A 4YACA 3LWBA 5BN4B 3MQFA 3RASA 3UOGA 3ORHA 5AR1A 2LKCA 4EA7A 2PGAA 3GLGA 4ZO9A 1JLHA 1J0AA 5DNEA 3DTYA 1FNSA 1ACMA 1I10A 2GPTA 4BGEA 2OORA 5CMLA 3AESB 2A94A 1FZQA 2BM8A 3OX3A 4M36A 5EJAA 1ESNA 4WD3A 2A1TS 1CUFA 3OIWA 2L17A 2PZ8A 5DXAA 5ENDA 3KB1A 1KI3A 1G291 2BRUC 1IEVA 4YFYA 4F2DA 1MX3A 1KRHA 2LV8A 4H7KA 3T94A 2I7DA 3SQDA 1S9HA 2V9CA 3EWSA 4Z9FA 1SUAA 3WGJA 4MI9A 2HA5A 3AJ9A 3GI1A 2XTNA 3U4CA 3OSUA 2YZ2A 5CFOA 1CEYA 1TIKA 2VRCA 3LHDA 5TS2A 1U7TA 3L84A 3ZIDA 1GSHA 4J7UA 3R9KA 4F6RA 1D2CA 2GA9A 3E9YA 5B36A 2C03A 2SKCA 2B3DA 2WKQA 2HNBA 4OGKA 4X7RA 3SC6A 2Q6LA 2GNPA 4XDGA 4I5FA 1LX7A 4RY8A 4CLOB 1CDOA 1OBCA 1FNBA 4UDYX 1IWOA 2ZJAA 4BJ5A 3HACA 5AHKA 4D97A 1HURA 3UZUA 2ARKA 2CMHA 1TZCA 2POQX 2W43A 4K8RB 4X00A 4KDFA 2OTCA 1G7CA 3PKIA 2DBZA 4JXXA 4FM9A 1FFCA 4ZO4A 4P34A 3ETJA 5IVDA 3A1TA 1H69A 2IW1A 3TS1A 2W8BA 1XZGA 3GIDA 1GCIA 4GBED 4WBXC 3OLQA 3FX2A 3N1UA 4GE3A 3KKEA 4F97A 3WI7A 1QX3A 2X8LA 3FYTA 1XTTA 3MNFA 5DCYA 3SSMA 1QPGA 4J91A 1AT1A 4U7HA 1WCIB 3ROFA 3TXXA 1ZK1A 4RZUA 3DWGA 1P4AA 3ZHOA 1NJ5A 3AUTA 4BFWA 3PTZA 4BRZA 5KOHB 3K1AB 3VZCA 2H1HA 2C57A 3NXKA 5EA2A 4B82A 1G2IA 2KS6A 1L5HA 3EDMA 4B3SB 2JJ1A 3LKZA 4OAOA 1F0YA 1E1QD 3QVGA 5JVDA 4OGGA 2GTIA 2JI8A 3FBGA 5JQGA 1U1CA 1XCLA 5KYVA 1O96B 1XMOB 4DA6A 5JJ5A 3OBIA 2FDCA 4G8BA 2XGOA 4Q7JB 4CIYA 5KX5A 3N53A 1AXGA 2BR3A 1KOLA 2R5NA 2Z95A 3KBOA 4RW0A 1JJBA 4UBKA 1O0BA 1OYVA 4AX8A 5ISMA 3GOHA 3E18A 1P31A 3NI2A 5IZCA 3LYAA 4U7FA 1KI2A 3O2SB 5AJUA 2ZUSA 4EQ6B 2A6PA 4PM4A 3O93A 3UGJA 1M6EX 1SIBE 3LX6A 1Q3TA 3DUFA 3MQ2A 3GGPA 2X1LA 4Q1EA 4R1NA 3WIUA 3WQBA 2ECQA 2ZKIA 2BELA 2D62A 1G60A 2MIIA 3BMNA 3ZHQA 5EJ2A 2JHPA 4KAXA 3VFDA 3PZRA 2NU6B 2R2AA 3IH5A 2ZRNA 4JBGA 2C5LA 1DAGA 4EKEA 2A9FA 4C4TA 4S1WA 1XXHA 3RWBA 4Y6PA 4JJ7A 4X3CA 4KE7A 2WNIA 4AKIA 1OI3A 4NEHB 3PQ8A 3RSSA 3THRA 1UDCA 2G25A 2ZUFA 2Q1UA 1DVRA 3B9PA 3MOGA 2VI5A 2VHZA 1SGWA 4AUEA 1JPJA 2QRQA 3M6UA 3OU6A 1PLJA 1WZIA 2OCPA 3GMTA 3LWZA 2CF6A 3BA1A 4TTQA 4V02A 2VTKA 4YJFA 3SXUA 1F8UA 4KMSA 3R3JA 5L3QA 3AV3A 4B46A 4F11A 3HP7A 5EY5B 3DOCA 1HA3A 1DV1A 1Q0SA 3HMQA 3RUDA 1OW3B 2UZ3A 3FZYA 3KB2A 3KUCA 3RTGA 3ZWBA 1JEOA 4MYHA 5M7EA 1XRNA 2GCOA 2BZ1A 3CZQA 4EQZA 1NW3A 4U7TB 3EEOA 1NW7A 3D54D 2I5PO 3PQ6A 4UNQA 2EFEB 1I13A 1THGA 4H7PA 4NWIA 2DM6A 1G20A 4FWIB 2QTVB 5CLGA 1KYQA 2VUHB 4TZ6A 4HLUA 1X38A 3QVOA 1V6CA 1ZD1A 3TG8A 1TVKB 6NULA 1C3VA 1K89A 3SVLA 3HSYA 5J9FA 3BGIA 2QVBA 5ED0A 4C0WA 1MKYA 1PEKE 1Y8RB 3GRZA 4TLAA 3TD6A 1UK6A 5K0BA 4EPTA 4EHDA 1RNLA 2XQGA 3MJ4A 1VA5A 3VR2A 3UKDA 4HJXA 2GUWA 1G21E 1ZZGA 2DBVO 4YX9A 4E31A 2XECA 3M6WA 3MCZA 1JLMA 2EKLA 3F8TA 4DLLA 1GUZA 2HDWA 1GPYA 1LLDA 1T3ZA 2M6LA 3VZBA 1FFYA 4K05A 3I34X 5B2ZA 2KB0A 5BN1A 1USKA 4E1VA 3COWA 1YQXA 3TQQA 2VDWA 3TDKA 4G0YA 3GEGA 5LB4A 3KNZA 4UU0A 4P92A 3TSYA 4CF7A 4BKUA 4WI1A 3RKUA 2JGAA 2ZSUA 2OYRA 4ZI7F 1COZA 1T5BA 4AMGA 2NAFA 1WU8A 3RREA 3EPHA 3EPRA 1MMFB 2D4HA 4UBJA 4EHNA 1I0IA 2M9MA 2B34A 5B7PA 3GFGA 2DEUA 1FW6A 1G59A 4FGJA 3H18A 5HQ3B 3PZBA 4NYIQ 5D3MB 3LWDA 1FFGA 4M9CA 4EFMA 2D1QA 2XD9A 4R1UA 5T8KA 4YP9A 1E2BA 4Y1RB 4IFIA 3SSOA 5JXJA 3KOUA 2X5OA 3MMSA 3BRQA 2C4UA 2JJYA 3QE2A 1JV2B 3ZCTA 1E1RA 4L5AA 2QQ5A 3VNSA 3T5CA 1JMVA 4LI3X 5FNVF 5M3BA 4F7WA 1N8KA 4B6JA 4EY8A 3O95A 1DWPA 3EDOA 2FEOA 2GAOA 3NUGA 4KJZA 2GPWA 1TLLA 3V4VB 1NNEA 3HY3A 1QGAA 4ZHQF 3U6KA 3H2SA 1UEJA 1P2GA 1T9BA 4DBVO 3C6QA 4C4XA 1QVRA 3ZWYA 3I3OA 5EXEA 4AIRA 4ZXPA 5J5VA 5L6LB 5B2FA 3ZY5A 1X15A 2JI4A 3TFQA 4TL9A 5D87A 3OZTA 4MVJM 5JDCC 5L7WA 3IUPA 2AI1A 3IBFA 2R62A 1R4AA 1AJEA 1YI0A 4B5LA 3LBAA 5AUQA 1A4RA 1PJAA 1LTQA 1TCVA 2J4FA 2XX3A 4K5QA 4NU6A 1KE1A 3N2KA 2IHBA 2PSJA 4GRDA 3ZZMA 5GONA 1F3LA 2BFCB 5AM0A 1DRJA 2NSYA 1W35A 4JVSB 2HK7A 2YIJA 3QI7A 4N5IX 1RYEA 5CA0B 4G1EB 3G02A 1JLKA 5LQSA 4PO3X 3WGIA 1I4WA 4LVCA 2ORIA 1OI4A 4OQEA 4D3DA 1OH7A 2RIPA 4G67A 1UC8A 4N0DA 3E9EA 4QYTA 1Y3FE 2B4QA 4LC0A 3CMCO 4EBFA 2JHAA 5G0SA 3ZCUA 3QBDA 5LD2B 4L8GA 1JAHA 1HZZA 1JVNA 2O07A 4PFJA 3NHJA 1G8SA 5TF4A 1PTJC 1NAIA 2FXVA 4YDQA 3R7LA 4AQYB 5HVNA 1OFUA 5KVSA 4OMDA 4DR2B 2C8KA 3COVA 4I36A 4N47A 4FFVA 3S1SA 2O23A 3KVNA 1DQSA 3I8OA 4P4SB 5BWNA 2AF3C 1OLSA 3SHTA 3BF8A 2PFSA 4H1WA 1FFXA 1XROA 4KU4A 3OG9A 3VR6A 4ZRDA 5HEKA 1QLWA 1MAWA 4QL3A 1L1EA 3CYFA 2J9GA 3LBNA 4LGMA 2MINA 4P3OA 4B6OA 5KTKA 1QF7A 4EA8A 3R41A 2JIQA 4CTJA 2XOKA 1WMFA 2VPIA 3BH0A 3IPCA 3NJ8A 4R9NA 1G8AA 1N75A 3JYHA 3ROXA 1H4QA 1YRQA 1QR2A 4HRVA 5CX4A 2PCJA 2YJZA 3FCEA 2NU8A 3VMMA 4HUTA 1ST3A 1SUWA 5C5IA 5K05A 2P5UA 1G9XA 3WHLA 2GM5A 2IV7A 1G8JA 4KXWA 1DC5A 4A2WA 2G1UA 2UYOA 3H16A 2PXHA 2I1VB 2J9ZB 2CLEB 2NTYC 3G1UA 2FE1A 2L0XA 1B8UA 2QVCA 2QQFA 2V5UA 3N58A 4P35A 1XDWA 3WKEA 3ZE1B 4X65B 5HM6A 1WEKA 1D2AA 4BOYA 3UFBA 3X0DA 2A30A 4YROA 3DCNA 5DK6A 1IU9A 4KLRA 3PE3A 2XWJI 2C2XA 4PSAA 1Q44A 3PIIA 4OYLA 2EP8A 1YR9A 4HEJA 3I5UA 2XYHA 4HY3A 2IQ5A 3LECA 2QX6A 1OV6A 3UJ3X 1NT2A 4Q39A 5C80A 1B6GA 2RG7A 1QZXA 2RGNC 1CB7A 4NBTA 4KXQA 1PJCA 3FFWA 3RSLA 1AK2A 3BICA 3PWTA 3VOBA 4A8PA 2GYYA 2YQ4A 2AX4A 4LY0A 1FLNA 3UV3A 2WAXA 1QO7A 4M7WA 1VKHA 3BH6A 2OCIA 1B0ZA 4HNQA 1R0LA 3WA6A 3DUWA 3BILA 3I92A 3OPYB 4EG3A 4YAWA 3H1AA 4Q0MA 5DHAA 5HKKA 5GJBA 4MTCA 2WJAA 3JARB 4YP6A 3RC1A 2HBQA 5AUPB 1C0IA 1ECCA 2X4DA 5KSWB 1DQRA 1RLJA 4Z9XA 4GR9A 5I7OA 5L53A 3LBHA 4V3CA 5BR8B 2ORYA 3CW9A 2PWZA 2XVAA 1U7UA 1YQQA 4G5SA 1DINA 4G85A 5C7LO 4P31A 5IYZB 1H9CA 5E95A 5EZYB 1IUNA 1MB9A 1XAHA 3PD1A 3WWYA 1D6JA 4IJ5A 2F3UA 2BPOA 4RH3A 4MVJP 3SYNA 5C37A 3PWZA 5IF9A 5JMTA 3FSGD 1U9ZA 1E7RA 2EQBA 1GNVA 1T8YA 4B6EA 3QKRA 4QRDA 1NE2A 1RIIA 5ITZB 2BMAA 2H3EA 4K1XA 1J22A 3HSKA 2W42A 1J8MF 1V8BA 3IAAA 5HW0A 3V00A 5KNCD 5C4GB 4KMRA 4OSPA 3EIEA 1NKSA 1NW5A 3DHWC 1XXHE 5E1DA 1EP1B 1HXHA 1MB4A 1EVLA 2F67A 2YRFA 4S35A 5F7ZA 3CO5A 3U4GA 3ZS9A 1FTYA 3DVQX 5KYGA 4MOWA 1PVDA 4QWMA 3RYIA 2CFSA 4PNEA 3Q8LA 3QA9A 1USIA 1I3KA 2HA6A 5LP6F 4DLSA 2KE5A 3MT9A 3A1EA 4LIPD 1CNFA 2N42A 3RJTA 4OH1A 4WBNA 3BDAA 1GZDA 4C5CA 4ZOEA 1AKTA 4IKEA 4CW7A 1TDJA 3NHBA 2R1VB 3BGWA 4IZIA 4DIBA 4FX5A 1J06A 4IJMA 3X2FA 1THMA 2ZDHA 4C30A 3TB6A 3U37A 4ESVA 3V7FA 4BQIA 4DNFA 4NAVA 3CZRA 4FFPA 2D1YA 1NPDA 4LG1A 3PKJA 1W52X 5B4UA 4HB4A 1RBZA 1I3NA 3I58A 2Q50A 3RC2A 3X1XA 2ZQYA 3P2MA 5FUVA 3K71B 1SZPA 2B8WA 3FDXA 1C8LA 4ZAYA 3RF7A 2C97A 1XCJA 5HILA 4OJNA 1SZCA 2VDNB 1TL7C 2IIQA 1SO8A 4I19A 5IAKA 4N5HX 5TVGA 4DANA 3NIGB 4Q1CA 1P1BA 2ZUVA 5H59A 3WLOA 2E4ZA 3SBEA 3WGUA 3C1TA 4XCVA 2W00A 1XR3A 4HFNA 5SY4A 1PZGA 1HDZA 1B1AA 4A0GA 2F48A 3A6KA 1QFYA 1P45A 1YBMA 4Q7QA 2QE7D 2P77A 1KYYA 2RHGB 3X1YA 1J7JA 3B7GA 2LW7A 1H2WA 4IZOA 3L6EA 2J8ZA 5L7TA 2B5OA 3P9YA 1DOHA 4AMBA 4HHEA 3SOPA 1Y5MA 5BW4A 3HMKA 2PMKA 3LT2A 1F2DA 4FT4A 4YAJA 2J5XA 3EVTA 1RYHA 3K15A 3RTAA 5IG2A 1SRQA 3DFKA 5IKXA 3AHFA 1N9ZA 2X86A 3AM1A 2ZANA 1XALA 3PDJA 2HEGA 3W2EA 1HNWB 3VYWA 2YS6A 3MTBA 1I0LA 4C7OB 3ZLVA 4NPHA 3IPRA 4JB2A 1OZGA 1DBIA 1XDBA 4DCOA 5KQPA 5L9AA 2B25A 4L5YA 3KUKA 4YJDA 2X8BA 1G5IA 4AO7A 2FY8A 1X7HA 5DCLA 1HYQA 3LQFA 3CA8A 1DCKA 1RMTA 4FXOA 3UWSA 3UFXB 3OKFA 5JPIA 5JNLA 3BSSA 2XVZA 4C7MA 5DZSA 4DV2B 2HF7A 4LNUB 3OJWA 4RPJA 3OM0A 2PLAA 4L02A 1A0OA 2C0PA 4Q16A 5FKJA 5NLLA 3L93A 3U7HB 3D1JA 3H13A 3MT0A 1F6WA 5H68A 4P9NA 1YQDA 2XA9A 4RMHA 3NRCA 1N3YA 4XYEA 2Q7OE 5A2GA 3CRRA 2IIVA 2O5VA 2WM8A 3AFGA 4C2AA 4DR7B 3I64A 2WAMA 2X2OA 4M0UA 3RABA 3U81A 1AS2A 4CMKA 5JD5A 2BEUB 5ETJA 3HVHA 3QF4B 3QU5A 1CCWA 4EGAA 3BVPA 4E5SA 1Z2NX 3QVJA 1U90A 4RSRA 2V7XA 4Z1MA 3M4ZA 1Q0RA 1UMDB 4BS9A 2O8EB 1X3LA 2IGBA 2IPOA 5AJXA 4FYKA 3WHPA 3B1ZA 3F4BA 5C7YA 3R75A 3GQBB 1X80A 4XJVA 4DQVA 2YVUA 3K0HA 4X6YA 5BYBA 5KTPA 2JFXA 5BNZA 3DVAB 2DPGA 5JNWA 1KJJA 4RQAA 3CEJA 4PF1A 3VTKA