2FXIA

Arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arsC
publication title Interplay Between Ion Binding and Catalysis in the Thioredoxin-coupled Arsenate Reductase Family.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase, hydrolase
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fxiA00
3N0RA 3F73A 1JYFA 3KHTA 4RK4A 5KQPA 1QP7A 1VPWA 3QX9A 3H75A 4N0QA 4HNRA 3A0RB 2PUBA 4LE1A 1VKRA 2GWRA 4PE5B 1D5WA 4WZZA 1D1QA 5FWYB 4MS1A 1M2FA 4ZPJA 3MIZA 4RK5A 4S05A 3EAFA 3HUUA 5IUJC 3L49A 3HV2A 3HSYA 5DKFA 4MS3B 1U04A 2HJ9A 3H1GA 3I45A 3MMNA 1FQWA 4Z9BA 1C4WA 2Q5CA 2YHAA 3H5LA 3LKVA 3QEMB 2PUCA 2RJOA 1GLGA 3LUAA 4LRQA 1APBA 3GWGA 4RKQA 3EQ2A 2V0NA 3EULA 1Z16A 3KLNA 2FKAA 3LMKA 4EVRA 4TLLB 2FLWA 2A9OA 2E4ZA 1UDRA 5TQ2A 1URPA 2QZJA 4RXUA 1LJLA 1MIHA 2VUIB 3IP7A 2ID9A 2JBAB 1USGA 1DC7A 3A10A 3QLVC 4KVFA 3W9SA 2JK1A 1Y1LA 3RVOA 4KZKA 3LUKA 1ABEA 1DBPA 1YS6A 5KQGA 1MVOA 4LZLA 2FVYA 8ABPA 3EQZA 1QKKA 2PUGA 2FQWA 1TJYA 4WT7A 2PKXA 3H1FA 2IYNA 5FBKA 1RZRA 4KPYA 2NT3A 1JDPA 4MPTA 1RXIA 3FFWA 3BREA 3FGZA 4MRMB 2E4YA 3C97A 1ZGZA 3CTPA 4W5OA 2XDYA 2LUOA 3CHYA 3HM9A 3K4HA 1DCFA 1JFSA 5IC5A 5TQ0B 1CEYA 4LDAA 4MQEB 5IUKC 5HQJA 1KRXA 1PEAA 3KYIB 4JA2A 2R25B 3RH0A 1ISRA 3JPWA 4NQRA 5JNSA 6ABPA 4P98A 3OQMA 1NXWA 4UHKA 1NTRA 5FWXB 3NNNA 5JS1A 2FMFA 3N0XA 1ZAYA 4N76A 5IX8A 4G0XA 1ZVVA 2L2QA 4EYKA 4IRXA 5IBQA 4QICA 4RDCA 4EVSA 2CWDA 3BBLA 2RGYA 2IDMA 1LBHA 3RQIA 4RK7A 1Z26A 3OLYA 4RV5A 3DZDA 3N0WA 1A0OA 1I3CA 4M88A 4RWEA 1GUBA 1P2FA 3HDVA 3QELA 3CNBA 4Q6BA 1OXBB 1GCAA 1TLFA 1USKA 4KMRA 3E61A 5IEJA 3L6UA 1PUXA 2WWVD 4O1HA 3SQNA 4ETNA 1FSPA 1QQBA 2LP4Y 4MLCA 4NCAA 1KMIY 3DLHA 5PNTA 3MF4A 1EWVA 3A3KA 4LE0A 3RVSA 3Q7RA 3EJWA 1FFGA 2PL9A 4EYGA 5EWLB 1JLKA 3CG4A 2QVCA 1QMPA 4XFKA 2I6FA 1D4ZA 4RU1A 4YLEA 1HEYA 2H0AA 4MR8B 4MS4B 2JVJA 3I42A 4Z4GA 1PHRA 3A0UA 1KRWA 3GBVA 2WMYA 5T3YA 4Z4HA 1L5ZA 1J56A 3C3KA 1K66A 1NXXA 3I09A 3N8IA 3O21A 4JAVC 2MSLA 2JVIA 3B2NA 4Y9TA 5JNVA 3T38A 1TMYA 3O1HB 1EAYA 4RY9A 2PE5A 3SNKA 4Z4CA 3QLUA 2M98A 6CHYA 3M6MD 4RXMA 2HQOA 4RSMA 4MS1B 2FQXA 1ZN2A 3CZCA 3HVRA 4HYEA 2WJWA 3BRSA 5DTEA 1M2EA 4G0OA 2WY2D 1E6LA 4FE4A 3D02A 1U2PA 1QO0A 4WWHA 3NHZA 1CHNA 1ZGGA 5TPZD 2OQRA 4JB0A 4RK0A 4XLTA 3H6HA 9ABPA 2FTKE 4YV7A 3BRQA 3R0JA 4B09A 4KV7A 3LUDA 4EGSA 2NZUG 5TQ2B 4E7PA 2IOYA 1JDNA 2IPLA 5BRAA 2IPMA 3O1IC 3RVLA 5EWJA 3MQ4A 4ZJPA 3CKMA 1RNLA 1DJMA 1GUDA 2KYRA 1ISSA 2VYCA 1LBIA 3IDOA 2IKSA 1PEYA 3IP5A 2FEPA 4EVQA 4G0QA 4QPJC 3JVIA 3HO1A 5F64A 2FEWB 3VNAA 1MAVA 1EWKA 3H5VA 4D74A 4N41A 2GI4A 4OLBA 1JL3A 4QYWA 3KG2A 4W5QA 1MB3A 3F6CA 3OM1A 1QQAA 2RJNA 3OO1A 3JTEA 3KKEA 1YK1A 1P6UA 4HNSA 1BAPA 5GQSA 5FBHA 1AB6A 3HK2A 5KQLA 4KRFA 1QP0A 1R8JA 1W25A 2LPMA 3DGEC 3H5WA 3RVQA 3TO5A 2PUDA 3ROFA 2QR3A 3O1JC 2PUFA 4Q6WA 5KWSA 3KJXA 1YS7A 3QX8A 1B00A 5HKOA 3OLZA 4N03A 5TE9A 3C3MA 1XHEA 4MAAA 4PYRA 1JWLA 1AB5A 2HSGA 4IGAA 4Z9AA 4H3HB 1BA2A 1VLZA 2FEKA 3UUGA 4Z4EA 1NXPA 2JVKA 1ZITA 3IPCA 2TMYA 1DP4A 3Q41A 1PNTA 2N9UA 3QELB 4YRZA 5ED4A 3T6KA 3KYJB 2A9QA 3QEKA 1NXVA 1JBEA 3RVRA 3LOPA 1Z25A 1S8NA 4ZMRA 2P4UA 4N47A 3QLUC 4NICA 1JF8A 2YHBA 5IEBA 3RVJA 2DRIA 3IP9A 5BQ3A 3UKJA 3D8UA 3ILHA 1H9CA 1JHZA 3GL9A 5JNUA 3OQOA 1YTUA 2PJUA 1CYEA 1TM2A 4TMYA 1JYEA 4OLAA 1F4VA 1LK0A 3JY6A 4KQCA 4XARA 3LTEA 3OMXA 3QLTA 4OATA 3M9WA 5DCLA 3TMYA 1Z13A 1XWWA 3HEBA 3Q9SA 4PICA 4RY0A 2FXIA 3RVKA 3LFTA 4Z4IA 4OTZA 3MA0A 4H3KB 7ABPA 1Z15A 5DGCA 4D6YA 4JP1A 5JNRA 4RXTA 2L17A 1DC8A 2HPHA 4G86A 3SG0A 5C5EA 3OLVA 1KGSA 4Q7EA 4GNRA 2FLKA 1Z2EA 2NT4A 2B1JA 1FFWA 5CNIA 5TPWA 1LJUA 2PUEA 4W5NA 4RK6A 5B3JA 4XASA 4MR7A 4H60A 3T95A 2PUAA 3KCNA 4KK4A 2MYTA 1NXSA 4N0PA 3HZHA 1DRJA 2P9HA 4S04A 3LKBA 3JS5A 1U2QA 2PL1A 4KK3A 3URMA 3O2QB 2FW0A 1YMUA 5BRJA 1U0SY 3HXMA 1U8TA 1SXIA 2H3HA 1WETA 5HSGA 1Z2DA 4FB4A 1ZESA 1OXKB 4IMIB 3OLWA 1ABFA 2PLNA 4G0MA 1YMVA 1JFVA 4L85A 5DLEA 4W5RA 3ILYA 2ZWMA 1VRVA 1ZH4A 2FSPA 3CU5A 1SD5A 4YO7A 5EWJB 3JVDA 1F51E 1GCGA 4TN5A 1E6MA 2QV0A 5JS2A 3LUCA 2NUBA 2HQBA 3GA5A 3EDCA 2NZVG 1C0EA 1MB0A 2ZAYA 4G0YA 1QPZA 1IIBA 1ZY2A 4MQFA 4EUKA 3CLKA 3DGFC 3H5OA 4JB2A 5KQMA 1SRRA 3NHMA 1DCMA 2FMIA 1NY5A 1YK0A 1Z18A 5HM6A 3F7NA 5CNKA 2MSWA 1ZHHA 1BDJA 3Q15C 4E7OA 5EWMA 2F8TA 4OG2A 4Z4FA 4MGEA 3C6QA 3SAJA 3F6PA 5TQJA 3N6VA 3H5TA 4IF4A 4ETMA 3FFTA 3GRCA 4MR9A 3MM4A 1BVHA 1M5TA 1QNLA 4QYMA 2CHFA 3Q7TA 3ROTA 1P8AA 3DBIA 2QW1A 4HNQA 4G0ZA 3T8YA 4WUTA 1ZH2A 2QSJA 3RVMA 4DN6A 2GBPA 2FN8A 2MSKA 2WJAA 4GPAA 4L4UA 2MYPA 3O74A 5CNJA 4RY8A 3CS3A 4F06A 1T34A 5IUNC 2FMKA 5KC8A 3GYBA 4JOQA 3CFYA 3RVNA 1A04A 4NV3A 3NNDA 3IPAA 5I4CA 2R4QA 2OENG 3C3WA 3OMWA 5E3JA 5FWYA 5KC9A 2F8SA 4YWHA 1SXGA 2A9PA 4Z99A 3OLXA 5CNMA 4F3TA 1A2OA 4P1ZA 2WRZA 4MS3A 2E4UA 3H1EA 3O2JA 2LBPA 2AYZA 3HS3A 3FDFA 5B3JC 2L19A 3FMVA 2QVGA 4ZYLA 4O5AA 2L18A 1L5YA 3QEMA 1E6KA 4RZSA 1NXTA 4Z0NA 2AYXA 4EYQA 3HDGA 1TVMA 3GV0A 3OO0A 3Q7SA 4YCSA 4W5TA 1RZRD 1USIA 4O1IA 1K68A 3TB6A 2R47A 3LUGA 4IMJB 3KS9A 4KREA 4YP9A 4JASB 4EY3A 1D1PA 1DG9A 2VK2A 1JFTA 2JBAA 2PAFA 3RVPA 5CHYA 3IP6A 1PNRA 4RS3A 4ETIA 1YIOA 2GKGA 2MYUA 2W42A 3BILA 3CG0A 1FFSA 3MYYA 3NNSA 5TPWB 4MR7B 3VNBA 1DBQA 4ZMSA 1ZDMA 3EODA 4YS6A 4KNYA 5T7BA 3FFXA 2CD7A 4DQDA 4LDZA 4NCBA 5JNWA 4MRMA 2IPNA 1SXHA 2VUHB 3KSMA 3SY8A 4G0PA 4YGXB 3CRNA 2PMCA 2M1ZA 5TQ0A 4F12A 3OQNA 4MQEA 2IPAB 4ML3A 4CBVA 3QLVA 5D2CA 4YR7A 2X7XA 2QXYA 2E4VA 2QU7A 3N53A 4DADA 2RDMA 3JPYA 1P6QA 4LX8A 4PEVA 2MYNA 2LIVA 1QP4A 5JNTA 4KFCA 4TLMB 1BDHA 1RPJA 2WB4A 1EWTA 4OBBA 5GOTA 4XXHA 2BGGA 1E2BA 3O75A 5FWXA 2A9RA 3K9CA 2FQYA 1JH9A 3G1WA 4FE7A 2HQRA 3KTOA 3LUHA 3CZ5A 5C5CA 1BDIA 2B4AA 5KI6A 4RK1A 4WXMA 4D6XA 5ABPA 4MQFB 1D2AA 3N75A 4F8JA 3H6GA 2R48A 1EHCA 2O20A 4EYOA 1XHFA 1JX6A 1RXEA 3QK7A 4WXEA 3EGCA 2E4WA 3GBPA 1DCKA 1YVUA 3GT7A 3KLOA 2FMHA 1NXOA 2JRLA 3TX6A 4F11A 5EWMB 3TD9A 3I5AA 3LUJA 3UK0A 2JCGA 5BR1A 3HJFA 2E4XA 3G85A 1DZ3A 1EFAA 1DRKA 4IILA 1W9HA 1Z12A 4UHJA 3OM0A 1Z17A 3S99A 5EWLA 3NBMA 4PZ0A 5TPZA 4XAQA 1M5UA 3HCWA 4MR9B 1NATA 2JB9A 5IULC 3E3MA 4MR8A 4MS4A 2ID7A 4KQ9A 3DLBA 3H5IA 1DBWA 3SM9A 4G97A 3LUFA 3P9YA 2FN9A 3HUTA 4LE2A 3O2SB 1QO0D 2CHEA 4MYRA 4RKRA 4MLDA 2GX6A 2J48A 3M9XA
chains in the Genus database with same CATH superfamily
2NZ2A 1KJJA 4JLWA 4OYHA 4P32A 1QR6A 3NAMA 1GYPA 2A2ZA 1INLA 2PCJA 2YVAA 3VXKA 2PSSA 3C8DA 5DNWA 3RSQA 1E2NA 1P9LA 2JEZA 3LY9A 4Q1CA 4BX3A 3R6LA 3UOWA 2X4LA 4HF7A 3RRZA 4RY2A 2PXXA 1GPAA 1RAHA 3KKKA 4ILEA 4Q3EA 4TOIA 1PFQA 2LCQA 1U3FA 3MWLA 1CUZA 3AF5A 3QA3E 4MV4A 2QRQA 3QKIA 2HI0A 2REQA 4TYPA 3HCEA 4ANFA 3CLUD 5L4LA 5HKLA 3B2EA 2CVOA 2HF2A 1CDEA 2IZ0A 3D6UA 4UW9A 4XVCA 3EC2A 2RI6A 1DKNA 1PHPA 3STTA 3ZJYA 1EUDB 3HCOA 1ZOPA 1RBQA 4PVCA 4J1QA 1Z82A 1XRMA 2KI5A 4KZPA 4TXNA 1ZMXA 5JPDA 2ZRQA 4JROA 2ZBRA 1CIJA 2DQSA 3FTNA 2VK8A 5ALKA 1W1UA 3OIDA 1H8EA 1DIGA 1YHNA 3FRHA 3BRCA 5JZOA 2EV9A 1U1IA 1WBBA 3S2SA 1ND6A 4JI3B 2ZIUB 1IM2A 3HKDA 4U3JB 3QLVC 3HJGA 3KE8A 2Y1FA 4E6EA 1QYVA 3X1YA 1BMQA 1TAHA 3U7IA 3IVCA 5FORA 4K81B 2YJ6A 4X0EA 1LPPA 2HDHA 4PYIA 4FFOA 4AZ0B 2GD0A 5B2FA 2PKXA 1CFJA 2HMWA 3LM8A 3H0KA 4PG5A 4B83A 3OC0A 3ZWOA 4BLVA 3RADC 3C6YA 5LCXA 1S2NA 2JFYA 2PX3A 4PFQA 1AMOA 2HT1A 5JE8A 3KDAA 2Q8PA 3WB2A 2HF8A 3B3QA 3PLNA 2W71A 3MN1A 4P2BA 4Q1VA 4R8SA 5JISA 3F67A 4RVOA 1NMSA 4W1RA 3BF7A 1ZBDA 1CEYA 1WZCA 3N2KB 2C2MA 3LW8A 5C53B 5AOVA 1W5BA 3JQDA 4ZTUB 2CL7X 2YZKA 1W0JD 3F4LA 3W78A 2W2NA 2CMHA 2O2ZA 3HMKA 5JSFA 4ZOLA 3VUFA 4I1VA 2ARKA 3W6UA 4YA6A 4FM9A 3TDNA 1NMEA 3SYMA 3NNNA 4W4TA 1PLJA 1PZFA 4LN1A 4G5OA 3HZZA 4PGHA 5BUSA 5K0EA 2GRUA 1ZVVA 3COPA 1TJ5A 2FFBA 4LPKA 3W34A 2Q5LA 4AJNA 4AY4A 1R9GA 1KVUA 3C3PA 3K0FA 5K01A 1Q5PA 2C7GA 1IBRA 2RGEA 2R5FA 3IHKA 2XYQA 1TPZA 5CEFA 4OQZA 1LDEA 2WJ6A 5JFTA 2O0MA 1TC1A 1PUXA 2ZRIA 1WNFA 2GFHA 3F0TA 4RHXA 4R1TA 4JP8A 4LBWA 5PNTA 3WSVA 3LZDA 3MF4A 4NE9A 5BURA 5AJVB 1TC2A 1QG4A 4A8TA 1Q77A 4E12A 2AUMA 3H13A 5JBIA 4QNRA 5BUZA 3EVCA 1E1NA 2WE8A 3E8SA 2O3RA 3LW7A 1UXKA 4OEHA 2A5FA 3H2YA 4HEA1 2BZGA 4RU1A 2F3SA 3HDYA 1PR6A 1T29A 1KTIA 2OHIA 3V42A 2AZXA 4Z4HA 2JHCA 3WYAA 3OTGA 1U1CA 3C3KA 4IO0A 4N5DA 3CNNA 3HK2A 2UYCA 1UKAA 2CYAA 3UWDA 3VV3A 2QSZA 3EJ6A 3KWMA 3PNLA 2MR6A 4X6YA 1M2HA 2VHWA 4YJ3B 1HH4A 1N6OA 5BYBA 3AVWA 1AURA 1JZTA 1KDOA 3PFNA 4NMLA 2ZIGA 1Z88A 2AN1A 4MB2A 3TZLA 4RXMA 3HJCA 3TYXA 4I50F 4RSMA 3NIBA 3UCEA 3TAXA 1X42A 2F9MA 3UANA 2GZRA 4AO8A 4CTOA 5K4GA 1EDDA 5DV9A 4M89A 2I2CA 4YMTA 1I4LD 1Z5PA 1F4LA 1GUAA 1NW3A 1DEOA 3E8MA 4LGCA 1CSEE 2GESA 4E0BA 4UMVA 1NRIA 3IKMB 3LLSA 3TOCA 1E92A 2G72A 2Y0BA 4M1EA 3WLJA 1N2OA 1SCNE 4KQGA 1ZGGA 5KTKA 1C1XA 1I8TA 4B3IA 2OILA 1SXJC 4QJ5A 5DH9A 5F1KA 4DLZA 3IIMA 4ZCRA 1G4AE 1KNXA 4YIKA 2NZUG 1AMUA 5FT9A 3UMYA 4HT3B 3IFSA 1CR2A 1JHAA 2IPMA 1XU7A 1U5CA 4YJGA 4Z54A 3AJDA 3UMMA 2EX0A 4QPNA 5AVWA 2JH9A 3U7QB 5C1DA 2XW6A 3P0HA 4PGAA 1ZK4A 4Q48A 4BNHA 3K0EA 4EUFA 3S1AA 3Q0EA 3EBLA 5GZ6A 2NYVA 2YIMA 3MGCA 3HO1A 2LKDA 1QYWA 4RKWA 4HS9A 4N41A 4G5RA 5DBFA 3WYEA 4BX9A 1EP3B 2I6QA 4NRDA 3MINA 3O03A 1SXJB 2D1QA 3F6CA 1GAQA 1N1EA 1VZ3A 2C2WA 3G1UA 4QULA 4ON9A 2B99A 2X2OA 3V8VA 2XUZA 4QPPA 1PJBA 1E3MA 4JVNA 2IYXA 1SHZA 2OTCA 3WB0A 2O5CA 2POCA 3AF0A 4O4JB 3AQ4A 4Z1MD 2RSLA 4C4SA 1KMCA 4CV3A 3M4JA 1JLLB 1X3LA 3A6EA 6REQB 3EVBA 3I73A 2G80A 3HB9A 2O8FB 2HWWA 3BDIA 1CQJB 2AX4A 3O8DA 4B6RA 1A9TA 3BMQA 2D2IA 5ITVA 4EARA 3G0HA 1TZKA 2GCOB 1PG5A 1YBVA 1UC4B 3QWFA 3TSYA 3O0DA 2PL3A 1GN9A 2KB0A 1IBSA 4PSVA 4L0MA 4ABTA 1YS7A 1AZLA 1JHDA 2O3TA 3OLZA 3OPVA 4U9HS 1GQOA 2QRPA 1YDGA 2V6IA 2WLSA 3FCAA 3LSTA 4MHTA 5JSQA 2WSBA 4BNJA 3IUYA 3A9WA 4UHCA 1VHJA 1OX6A 1IOVA 3EAQA 2P75A 4DR7B 4I08A 4MWDA 1H66A 3RUEA 3DOJA 2Y2UA 1BE0A 3TNYA 4QLOA 4JLUA 4BCDA 4F85A 3V8NA 5LUAA 1ECJA 1N6IA 1QPGA 3AOEC 1GKIA 3AI3A 1Z25A 3INGA 1U6JA 2X6RA 1XDZA 2ECOA 4WLEA 3Q7EA 5AVJA 2NYRA 4EELA 1BS1A 2D1RA 3LVQE 2AK2A 1QX3A 4A03A 5M5BA 1W59A 2C57A 3CEJA 1AQLA 4ZKDA 1VE1A 4F93B 1YR1A 3UJDA 4NFHA 4GMXA 2B8WA 4NBWA 2VWGA 3ZHZA 4EENA 1A95A 3DMGA 1MO3A 3I30X 5KZMB 4D26A 1F4VA 2PHZA 1QTRA 2CUNA 2ORVA 1PFWA 2OZPA 1N36B 2AI2A 2ZW9A 1ESNA 3AETB 1QVZA 1WETA 1HETA 3FYTA 1JHVA 3FB4A 4ZVNA 4H1WA 3IRUA 3JATA 2PBRA 3KWJA 4RFSB 3VJMA 5GINE 2Y1XA 3HKCA 4CGYA 5IW8A 4QG3A 4G65A 3B3AA 2GF0A 1XGKA 3CY6A 4RXTA 1ZRMA 3GQBB 2BHTA 4ZOLF 2C04A 2ZWVA 4E32A 2O8CB 2IYQA 2VF2A 4H0FA 3H3JA 2PXAA 4Q4HB 3GNQA 1IXYA 3HVJA 2QQ5A 2UU9B 1FFWA 3FTDA 2PUEA 4NBTA 4W5NA 2Y1DA 3PQEA 3V2IA 3LBYA 1ZVQA 3WK7A 4EB3A 2ATXA 3P19A 4OHFA 1QRUA 4B6SA 2BL4A 4DWOA 1P72A 1TYEB 2EDCA 2JI7A 3HVIA 4II2A 4CL0A 5JTTA 2GXAA 1HL3A 1XDGA 4TSFD 2ZE6A 1WM1A 1T36B 1PKXA 3ZBQA 2ZTHA 2MDTA 1WS6A 1VPDA 1SXIA 4JLKA 5DX1A 5IKXA 4A6DA 4ETWA 3OLWA 3IDFA 3OP1A 2G0TA 1AMNA 4IJWA 1TW2A 1G8FA 5JALA 1B26A 1ABFA 2ILTA 4JBHA 4DQUA 3IR7A 1E0JA 1R4AA 4HG2A 2V4MA 4CCAA 4D9NA 2RG1A 2Y27A 3L8GA 2BR3A 121PA 1ZH4A 4FBGA 4AD8A 2BSQA 1V7PC 4IW3B 4YO7A 5EWJB 2BFDB 3DVRX 1EG7A 4TMVA 3FDZB 5K3BA 4C7OA 4TKVA 3RTGA 2X9VA 1LI7A 2HO4A 4F56A 4HC4A 2Z98A 3NOOA 2HQBA 2Q6KA 2W6JA 3VPHA 1UCFA 5GJVC 3FOBA 2ZAYA 1QPZA 1XO1A 1KFEB 4QBHA 2JEYA 3GCZA 4DCSA 2W00A 4XQCA 1AKTA 2EWMA 4PLPA 5A5GA 3ETGA 3NTQA 3TW4A 4ARZA 3PJEA 3DE5X 1NC3A 5L7WA 2Z3ZA 3D1LA 3ZHVA 1MX1A 1KYIA 2OBLA 3EUAA 2C4VA 3EVEA 1QHSA 2J9ZB 2VSYA 3NDIA 4PIMA 4XUDA 2CYBA 1M74A 5KYGA 4RTMA 2XIQA 2F2TA 2X6TA 1VGVA 4KUGA 3UWPA 4ZI2A 5ALUA 5CLLA 4FHFA 4WH0A 5DDIP 1X7YB 4RBNA 1BS2A 2K4MA 3MJDA 3F6PA 2GKSA 4IGIA 1CNEA 4PS1A 1JPVA 2W93A 4DNQA 2G9UA 4RCVA 3N28A 3FFTA 3OZUA 2CBXA 2ZRAA 3RJMA 5BWNA 1WVMA 3B60A 3KT8A 2P1DA 3AY3A 1QNLA 3KUXA 2VF4X 4N6NA 3T3EA 3CWQA 5LKAA 4Z53A 4XE5A 4TVKA 3V9PA 1O9HA 2R62A 3PA8A 4TTQA 5MFPA 5LL6P 1SKMA 2DH5A 1I7LA 3HY4A 3R23A 2WJAA 1G9XA 3BA6A 2YHIA 4MWTA 3ZCTA 1OT5A 5A2GA 4L07A 4BJ5A 1S8OA 4GQAA 3I3OA 2GILA 2ZWOA 3DBHB 3OC6A 5GY7A 5DWVA 2WD7B 5KU1A 3TM4A 2F67A 5AM0A 3ZDYB 2OZVA 3GPDG 4HV4A 3K0AB 1DOAA 1FDTA 3CO0S 5E8RA 5JYCA 1N1DA 4Q5IA 4FGUA 5C1OA 4F3TA 2J08A 4UMFA 1YQTA 3N2YA 4FWTA 5ALWA 1YR7A 2FCAA 1Q1AA 2ZR0A 4DZTA 2E4UA 5KNBA 5DNAA 3FIJA 3HS3A 2ZIXA 4Q37A 2AB0A 1BX1A 4U8GA 2GJAA 4QUHA 3TTYA 3BICA 4KPUB 3N7AA 4FJ0A 4L8VA 3RD5A 2L18A 1G8PA 1PJ2A 1IFXA 1R2QA 1M0WA 2QRKA 2VRBA 1TLTA 3GJQA 3MRTA 1FTWA 4X45A 4Z0NA 4YRPA 4E1VA 4HADA 4KDFA 4M1WA 4IDOA 1FPMA 3TINA 5B12A 1HZZC 1ODLA 2J3HA 1XPJA 1L7OA 3WJ2A 5ICCA 4Q3OA 2DBVO 3JQCA 4JASB 3G0IA 1XKXA 4URFA 2VK2A 2PD6A 3A4NA 4YRGA 4JSYA 2ZRGA 3G2QA 1KDPA 2GARA 3F7OA 3NQ41 1H05A 1N92A 4ETIA 3FHTA 1YIOA 2I8CA 2ZBVA 1FNNA 1HRKA 2NXNA 2CDRA 4QDTA 3BK1A 2PR2A 1ADGA 1IN4A 1GNPA 4ZMSA 2CMGA 4N8EA 4E03A 2GJ4A 2OL4A 3EZ7A 1U8XX 2IXFA 5HBGA 4PX9A 2IHZA 4IOJA 4PPYA 3K6KA 3M2TA 4MQUA 5ALEA 5BT9A 3R8FA 5CB4A 1Z0JA 1Z63A 1OGYA 1M54A 4NCBA 1R4MB 1J7JA 3REGA 2VWHA 4CDNA 1QHGA 1I9CA 1NKSA 1ZD5A 2ZYVX 3H1TA 3SD7A 2A5YB 3ULKA 2FP4B 4X1IB 4OOEA 2ONYA 5TB5A 3FVWA 1WKCA 4C0SA 5KYTA 3UMVA 4KC0A 3SHFA 3H9BA 4MKGA 3SR0A 1HSZA 1TA0A 2B4QA 3BMNB 4PG4A 1JRLA 4XA8A 4KFCA 4ZJZA 1QDUA 3MS7A 3QU7A 2V5UA 3CW2A 1JAZA 2RAPA 5K2OA 2VAPA 2VTDA 4B3DA 1GAEO 2ERXA 2I62A 3K8YA 1B0UA 1GYRA 3B6JA 1CY7A 4HY3A 2AH5A 3ECCA 3PR2B 2V7EA 1MZVA 2BAGA 5CCBA 5KI6A 3KYCA 5DEIA 3D2CA 4I3FA 3F3MA 4D6XA 4HR7A 5COQA 4ESVA 4MWEA 3LX6A 4GZMA 4JKOA 1YDHA 1U9YA 1K5DA 3A4MA 1KQOA 2E5WA 4KRXA 5EPOA 3UAWA 4TT8A 3C45A 4OHYA 4BY9E 1O94A 4BQNA 4NOLA 1RLJA 4NU8X 5DXFA 4NR0A 3LL7A 2FLVA 1QOQB 1VFPA 3RYFB 1UPUA 1V25A 2CDBA 2CFTA 2I6TA 5DHRA 2YY7A 4AJIA 4QXPA 3X1MA 3ESBA 1GEGA 1B6RA 1ZUIA 4XTRA 2EF0A 4YRKA 2I4IA 1R0RE 2C9DA 4B3RB 1O96A 3OUZA 4MGYR 3RREA 4HBZA 1XNJA 3L07A 3GCXA 5HDQA 5T4HA 4C6SA 3HCWA 4NYJR 1WMDA 4QYTA 2VXCA 2XCQA 2J4DA 4FMCF 3IMEA 3H18A 4RGBA 3JQBA 1IU9A 1DFIA 1X94A 2IYVA 4ITUA 4DA9A 4D9KA 4EKNB 4BGDA 4B87A 3AKZA 3NO4A 2GX6A 4P7GA 3JRNA 1DL5A 3QYPA 1H0KA 4K87A 2B21A 4RK4A 2FZCA 1ODFA 4D98A 4ER0A 2YH2A 2ERYA 2CNNA 2PUHA 1TTHA 5C81A 3G7UA 4UU7A 2HLDD 1F60A 4JJ7A 1M34A 3TLCA 2BEWA 3OE1A 4P6VF 4PYNA 1H5QA 4EW1A 1QRDA 1PGQA 2GWHA 2HMAA 2EATA 1I80A 1EUQA 2YMPA 2GCPA 3TLGB 1FXWA 1ZXLA 3DVAB 5BVHB 4D9FA 2C5SA 2JDID 1POXA 2PLWA 3V1MA 2J4CA 3ETCA 5EQFA 3FSJX 1Z4KA 3FZGA 3FJOA 2PUCA 3RBZA 2Z6UA 3QMVA 3ENZA 3R3VA 4XB2A 1OZAA 3MT0A 5JAUA 4MPPA 1P2UA 1L9KA 1VRWA 3D8NA 3QEAZ 1Z16A 1SUIA 2F3RA 2V7WA 4PINA 1Y7HA 5DRTA 3U4GA 1QYDA 1CZNA 2R7MA 2X3UA 4LC0A 4LZPA 2AQIA 5AQ1A 1EFHA 4HVLA 3R3SA 2HJRA 1EP9A 4MVJD 2E0IA 1USGA 1C7QA 5EYPA 1TFRA 3W9SA 3OZCA 5EKDA 3T9AA 3AR4A 3NTRA 1Z4JA 3E3NA 1IG0A 2HPAA 4MRPA 5A0FA 2FZ4A 1JEJA 3EQZA 2XKBA 1W2GA 5J4LA 3N07A 3VKVA 4RDHA 1PKEA 3FWZA 4WT7A 3EFOB 3V4ZA 2RHJA 3EB9A 5D84A 3WTCA 5AM1A 3CPJB 3KPYA 4CCWA 4RLSA 4B32A 4FSDA 4MQLA 3U4MA 1KTVA 1XXLA 3GI1A 3VU9A 4GLOA 1CRQA 4C87A 3GB9A 1YOBA 2JLAA 1BDMA 1IY0A 4O29A 3ER6A 2W8ZA 3H8JA 1G21A 4QSHA 1LDGA 5EA2A 4E6PA 2OMKA 4TLAA 4JT9A 3D2LA 2NV6A 5TSDA 1ZUHA 2ZAMA 4LY3A 4UNQA 2P65A 3T41A 4JKIA 4WBNA 4JYBA 1T8PA 2R7KA 5DI9A 1I2DA 4AYTA 4CIWA 1NTRA 3CB2A 2P11A 1L5FA 1P5RA 3K92A 5FWXB 5E1OA 5E1DA 1U31A 3KD3A 5FEUA 2B7BA 3BX1A 1KZ6A 4R2MA 5ICSA 2QTTA 1CFZA 3I6QA 4DMCA 1C30B 1A9RA 3EASA 2VH5R 1ESCA 2ZJ0A 1A5SB 3OCZA 4M7RA 3HABA 4YQYA 5HIMA 3E8XA 1E9CA 3CT4A 3DZDA 4NC9A 1N9KA 4ARUA 4D46A 2PIDA 1HLGA 2JGDA 3GWZA 5CU7A 4Q6BA 4QL3A 2AC4A 3Q1LA 4KMRA 3E61A 4D8UA 3W5AA 3O6VA 4LSZA 3DLHA 3I83A 4JR1A 4W5HA 5IT9A 1PV4A 2BGIA 3NDBB 3JZDA 4ZQIA 2FDXA 4KOEC 2NTNA 2ZIAA 4B7UA 2GVNA 5JIBA 2VT3A 1I36A 1LDYA 1VJ1A 2H9AA 4LOJA 4QUGA 3RBXA 3EA5A 4L4ZA 4BMPB 5CB4F 1C9EA 2O3JA 1M0EA 3I9JA 3MXOA 3HYNA 1TYZA 2EWVA 3HA7A 3NW9A 2VJMA 5IKOA 5EZYA 2A9KA 1SWWA 2BD0A 3G8AA 4KXVA 2YC4C 4UQLA 3AILA 2YFQA 3W8EA 2R87A 2VCHA 4H4CA 4RJIA 1TUBB 4P53A 3QI7A 4DV4B 3RYCB 3T7SA 1OF1A 3NJ8A 5E4YA 1B3BA 4GR4A 2JAOA 1U7PA 1QSGA 3RYHB 4GF5A 3RUFA 2PX2A 3HCPA 1VMDA 1CZUA 2XOXA 3KO8A 2QTLA 1W34A 2FQXA 4H2DA 3CZCA 4LZZA 3GLFA 4M1SA 4LYGA 1QYRA 4CI0B 4IBOA 3HVRA 1E2MA 1OA0A 3E7DA 4O6VA 4FNGA 1IUPA 4IJMA 4WKGA 4CTJA 4ZQCB 3ZWWA 5BNFA 2QTCA 3CE6A 1JQBA 3ROEA 2IX9A 3ZDXB 3FYHA 1CUEA 2HIGA 3DS8A 1TEVA 1W47A 2I7XA 3AI1A 4JI2B 1VYUA 1FJGB 2YV3A 3K72B 1VI6A 1XEWY 4G8CA 4JXKA 3V7WA 2OQRA 1NX6A 1C0LA 3N8DA 9ABPA 2VCYA 1S7CA 3I1FA 5D6OA 1VKNA 3G79A 2YVLA 4I55A 5BV2P 1YR8A 4B09A 1BWPA 1KH3A 5JY6A 4F2GA 1N6HA 3LGXA 3KTAB 3GARA 3ZJUA 4KQXA 1N32B 4A36A 1V0JA 4CMBA 1QS0B 2KSQA 1T5OA 2IOYA 1E79D 1ADYA 2FPPB 2P30A 1T8TA 3KJGA 4RGYA 3TIIA 4LFCB 1IZ8A 1LPSA 3ZHXA 5LKRA 3N86A 1UJ4A 3Q5EA 1VCMA 1C9YA 3KOWA 3PD1A 2CZGA 4KLAA 4WZ6A 4ND1A 4UTPA 1PR2A 3K05A 1KVTA 3L9WA 1GPUA 4UUAA 1J2YA 4G0QA 4ZARA 3RIGA 3EOBI 2AXEA 2SECE 4OKIA 4ER6A 3U4QB 4PGGA 2A7XA 2GI4A 1N34B 1MPXA 4R16A 1OFHA 4BBAA 3OM1A 3VPAA 3PYXA 4GSYA 3IAFA 3K1AA 3UV6A 1EE2A 1NAIA 2OP0A 3JVEA 5AKYA 2DR2A 5IXYA 2GEKA 1EESA 3EWNA 3DSRA 5IASA 3H8WA 4JWKA 1ZEJA 3FUWA 1YOVA 3K2EA 4LXQA 9LDBA 5IG2A 3QVOA 1FXWF 2D7DA 4FYXA 5IT5A 1FU4A 2AQ8A 1J2EA 3WBJA 1K7CA 4GM1A 3KQVA 3BWCA 2SCUA 3VZPA 4CN9A 1MP0A 1SIWA 2G9ZA 1LLUA 2FRDA 3BTUA 1F5SA 1MAHA 1KR2A 4M1KA 5DTQA 5E6UA 5JR3A 2B7LA 2QR3A 3QKSA 3BWEA 1OSNA 4MCIA 4Q6WA 1C7ZA 3KWLA 4WEQA 3Q3IA 5EVCA 2CFOA 2IELA 5HTKA 1YA4A 1YCGA 3IQHX 4W7IA 4F9FA 3CUUA 5T5QA 3ND6A 1VLZA 2XB2A 2B78A 2I4OA 3LNTA 4XH9B 4JH0A 4W7HA 3IPCA 2TMYA 3PC7A 3REQB 1XLTC 4LIPD 4OJNA 1PNTA 2IFTA 2DPMA 5AW9A 3QELB 1YGYA 3UA3A 3U19A 1JFFB 1ZM7A 4ACAA 4HYQA 2FOIA 3C4VA 1E3TA 1P2DA 4BP8A 1BEUB 4PR3A 2JHAA 2FFHA 3I5YA 4FGWA 3BMOB 3E4DA 2GUWA 4LJAA 4MB6A 5E4FA 4NFYA 3GJ5A 3UKJA 1KK0A 4NBVA 3VQTA 1M1YE 2PVPA 1XVVA 1NG1A 2DR0A 2O7NA 3W7BA 4YVFA 2IU0A 3ZQ6A 1QH8B 2XBMA 5IJ9A 2C4HA 2VZ0A 2V74B 1QTIA 1ZD9A 3DL2A 4IHJA 4PFSA 5B53A 1P4JA 2UVPB 1ZVMA 4RMIA 3ASYA 2RI0A 4JGGA 2IXGA 3N2LA 4A27A 4AQ7A 4KQCA 5DX8A 1OH5A 3FMFA 2IH5A 1WXHA 2PANA 2ZBUA 3PPXA 3V9AA 1CUCA 3OICA 1FRNA 1P3Y1 2VC2B 1JQDA 2ZUEA 3ANNA 4QBGB 5H8WA 1Y4SA 2FPKA 1EX9A 4RTNA 3RT7A 3T4EA 4WBNF 3C8UA 1ZN7A 3DMFA 2HK9A 3KBBA 4P4NA 1E3DA 4OHPA 1D2EA 4S3MA 4CODB 1LX6A 1H0SA 2XQIA 2XMRA 3DE6X 5IAKA 5TPWA 4C04A 1RHRA 2EX4A 1XZAA 1Z7GA 3D4OA 3ANXA 5BP7A 3PNKA 2QW0X 3ZDZB 1EGVB 2BZSA 4IVNA 4EGQA 1RE1A 1DRJA 4Q7JB 5TJHA 3NRCA 1RYDA 4BKUA 1NJGA 3A4TA 3FCSB 3H8VA 3M6XA 4JT2A 3UH1A 1P7WA 4KR0A 1A8HA 1RKVA 2UYQA 4YAWA 2EC5A 1XEAA 1DO8A 1L7VC 1KBZA 3O31A 4G24A 5G0UA 2GNPA 3DTNA 1KY2A 3ZW7A 4FB4A 5HSGA 2QQEA 2ROQA 3E05A 3KZCA 2BR5A 3ZGXA 4I66A 2XNDA 3ESCA 3EGXB 3QTBA 3E9QA 4D4LA 4EZIA 4IXDA 4NG5A 4D57A 5JI2E 4HB4A 1UXGA 2GJSA 2QVXX 3ILYA 5HP4A 4F8EA 1ORWA 2G83A 2O14A 2ZBEA 1ZNWA 3D6AA 3DDOA 1NBHA 1AN9A 4KU4A 5EZYF 1E3SA 4N40A 4TN5A 2QV0A 3PJGA 1GG8A 3HWRA 4A8PA 4XWOA 5HCUA 2CZCA 4DCJA 1Y63A 3TRHA 1BKSB 3EIXA 3I6BA 3HFSA 5EQJB 5SY4A 1Z5VA 4RJTA 5IMSA 2IHKA 2OCIA 1GTSA 2RGWA 1K6EA 1IB6A 1AD2A 2DR3A 1DLIA 3DKRA 3BXZA 1CNMA 1THZA 1HDOA 3WE7A 1GNSA 2GK4A 5HKKD 2B8NA 1Y0BA 4M99A 5DVZA 2LZ0A 2JGAA 2H31A 3GRVA 4ZHQA 1OWPA 5MF6A 5EWMA 1O03A 2JJQA 3LLUA 1KJQA 1HG0A 2PGDA 2DF8A 3K9QO 5JMPA 1R6DA 2QAGC 5BYKA 2YNMA 2YCBA 1Y8QA 5FCDA 1R6TA 3AEKB 3M2PA 4MGEA 5TQJA 3PQDA 1OLSA 4YMUA 1TIBA 2IT1A 2I4RA 3L18A 1DKRA 1CUBA 1II9A 2GZ1A 4INAA 1GGKA 3K5PA 1KDZA 3O8LA 5HMMA 4BLPA 3H9QA 3LRXA 5G3ZA 2B5VA 2W6ID 3LZ6A 4CIVA 2XNHA 2BMWA 3VHXB 1XLVA 3WLRA 4I55F 1MW9X 2Z58A 4R2IA 1OFIA 4G8DA 1OVGA 1EAMA 4LHZA 5PGMA 4CKCB 1TT5A 2LXNA 3PXAA 2D2VA 4GPAA 3O74A 3OWOA 3FHOA 3MWKA 4JX9A 4ND7A 2YYAA 1TIPA 3D0OA 1FYXA 4II7A 4CEJA 1BDIA 2QAGB 2IEDA 3CFYA 1DSSG 2IPXA 1I10A 2EGGA 1Y5NA 4G67A 3VVBA 4LY0A 5KC9A 3UGQA 5JECA 3CW8X 3NV7A 1XCOA 4YWHA 1OASA 3EZFA 4AFNA 1RXYA 1SU8A 3ZI4A 1T1RA 4HUTA 1EQAA 3UQZA 4AKTA 3MMZA 2DSTA 1S1CA 1NNLA 4OKNA 2AOUB 1K8YB 5KDLA 3F5SA 1XSEA 4NYJQ 5DIFA 4E5PA 5K0GA 2YZNA 1ONPA 2HNBA 4U6NA 1JPUA 5J5AA 2ZS9A 2BUBA 3RODA 4BMSA 1ZXBA 2FDRA 3AI2A 3EMBA 4HDMB 4JOBA 4TN1A 3H17A 2ZTVA 5JAOA 2QUAA 1VXOA 4L4SA 1GARA 2X8BA 3LO5A 5IKEA 1WLYA 1K9SA 3IT1A 1QHHB 1BFKA 3JYPA 1WMSA 1YU6A 4Q18A 3ZDCA 2ZFUA 3RC8A 1OJ7A 4M9SA 1QF9A 4UE6A 5EINA 2ERCA 1ZH0A 4KE6A 4RVHA 5A7HA 2A94A 2NO1A 1FP4B 4KXQA 3TZHA 2P4HX 1MUUA 4X97A 4RMGA 2IV2X 4J1SA 1LLCA 4RS3A 2CNLA 2GKGA 4AVYA 2DULA 2Y1EA 4UHFA 5CM2Z 3VR3D 4IKEA 4GGPA 5ALJA 2H57A 4YB8A 4EBFA 3T3IA 3K0SA 1GKYA 3P97A 4HH1A 3F8SA 4A5SA 5I7EA 4GT1A 4O1MA 3L82B 4QGFA 1IQUA 4LHVA 4EHIA 4NZPA 4EPYA 3BOSA 2ON6A 4EI8A 1LQ2A 1L1EA 4ZT5A 1MB4A 3EEFA 1K0UA 2IPNA 4BMVA 2IIPA 2R6HA 1P29A 4E2ZA 3MCUA 1P4AA 3NBUA 4HGOA 3RNLA 1DBVO 5DMHA 1GFIA 4ZWNA 5EJ8A 3KQLA 2GH1A 4J3JA 5IM5A 5ALNA 2XQVA 1QIKA 3BAFA 5H3HA 3NH9A 2E9SA 3GFRA 4JMPA 3MT7A 4MKZA 3HVKA 3AUXA 3OQIB 1SNYA 4IH4A 4MIEA 4XYMA 3T5PA 3DYIA 3QW2A 3AXTA 1VKJA 3PLRA 4WNYA 5CH8A 1X39A 1GRNA 1ZCFA 4CJXA 3B13B 4F5DA 5AW6A 2JZCA 3ZDRA 3R9IA 3CLUC 5G41A 4QQKA 3E48A 1GNTA 3K53A 4YRSA 4JQSA 2OWDA 3L4EA 2VJQA 3I12A 3ILXA 3CONA 4K26A 2G9VA 1BXKA 3RKSA 2C1ZA 3WAGA 4DZRA 1QE0A 1LV8A 3HRKA 2GXSA 4F1WA 3Q6NA 3KQYA 4KQJA 3B78A 3MWEB 3KZXA 4R9NA 3C3BA 4QOEA 3OZWA 3A1UA 1XHFA 3EA0A 1T1SA 1ISMA 1UPXA 4OHCA 2BMFA 5AVRA 1E1CB 1UM8A 1VLHA 4UBIA 1CB0A 1PZNA 2VTVA 4HKTA 4JP2A 3UFXA 3W6ZA 4AW9A 3TX6A 5K05A 1E2EA 1Q3KA 2C0PA 5EXTA 2ZUBA 1AHPA 4MXDA 4FZRA 2R1TB 5CCXA 2YIVX 4DOMA 2PS9A 4X8LA 5K3FA 1Y3CE 5TVGA 5EKXA 2H92A 5SYNA 4BE7B 4DCUA 1OU0A 2B2XA 3RFCA 3CX8A 3F4BA 4XAQA 2WA1A 5A4JA 3D31A 5DHTA 2ZUUA 3CINA 1DPGA 2QL7A 3EYAA 4BFLA 4OB7A 1U2DA 2OB1A 2R4TA 3FLBA 3D7LA 4FN5A 1E7WA 2IOFA 4P92A 3WISA 2IX3A 2NO4A 4RX1A 4UHBA 4CKWB 4DA4A 3BQMB 5LDGA 1N2GA 3FRJA 4HQLA 1TQDA 4NMHA 2PJZA 1DQNA 3F46A 4EA9A 16PKA 2HGZA 4MTCA 4U7GA 4ZRNA 3OI7A 1IVSA 1ORRA 1DIBA 3DE4X 3EH1A 2ZIZA 3M9XA 5IK2A 4EG5A 3GROA 4F45A 5DNYB 3ZV4A 1G3UA 4XJVA 1LKZA 2Y76A 2I9KA 3WKEA 1P7PA 3A0RB 2Y71A 4QHYA 2HBRA 3ROKA 4EX6A 4PQYA 3OKFA 2XY4A 3DE3X 5CVVA 1MTOA 1D5WA 1LSSA 2A14A 4KI7A 3L4BC 4GRDA 4LVCA 1WB6A 2QTGA 4B3SB 1U9IC 1WPQA 2Q7XA 1SB9A 3NHSA 4Y6GB 1OFVA 2WI8A 5FBQB 1PR5A 4GX1A 4LOKA 5KCMA 4UAVA 1ZA1A 3DHYA 4UM9B 3EUFA 3QVMA 4ND8B 2COKA 1JG3A 4WHMA 1NN3A 1A8IA 3KDSE 2UZIR 1YDEA 4MYDA 5DLYA 4LJSA 4MICA 1UP6A 2V9ZA 1WW3A 2VAMA 3LKVA 4IPTA 4K9LA 1W4LA 1HE2A 1RAFA 3BWDD 2NV2B 3DMDA 4ZHQF 4IS2A 1J09A 3GWGA 1U1EA 4AZTA 4RTKA 4LMRA 1BA3A 3VYRB 4OP3A 5GM1A 3BWXA 3EXIB 2RMKA 2ZDQA 3FCXA 1DOZA 3ZV3A 3OQHA 5AVSA 1GRCA 4MVJG 2O8DB 2DH6A 5BSWA 3CZAA 4IYRA 3TLBA 3TRFA 2I78A 3FLEA 2KM1A 5IWCA 3VZSA 3KFXA 4K9KA 4DEVA 4JELA 5MGBA 1N1GA 1LJLA 1XAGA 4ND6A 4XVQA 3C3CA 1UL1X 2OG1A 2XB8A 3W5HA 1TK9A 4QG7A 2HBZA 2WC1A 2JL1A 1PJ3A 2VJCA 4IEFB 4BGIA 1QBKC 2ZI7A 4PHHA 1Y3FE 2M6SA 3EFEA 1YL7A 5C7OO 1EGHA 2VDLB 4BKQA 5A5FA 2F1OA 5EIBD 4MW7A 4LK3A 3VAAA 1G8SA 2ZK7A 1W85A 4LEIA 4YCCA 3HXOA 2BEUA 1V1MA 4DABA 4WTOA 5F1PA 4GZ3A 5B7NA 4HLNA 4OL9A 4GUDA 3X3HA 3EZYA 2I6SA 5M2QA 1Y6FA 3UC9A 3GLRA 1OIWA 2O6LA 2NX2A 2GTPA 4TKZA 3C97A 1Z5NA 3MLAA 4DJJA 4K6HA 1DC4A 4PZAA 4KUEA 1ZGZA 4YAJA 5IC6A 2VATA 3VBEA 4X00A 5KOIA 4HX5A 4UFNA 3TCKA 1JFSA 1IY2A 1O6FA 4HNAA 2C2BA 3ITNA 4YO8A 2HQ1A 3LPLA 1XCBA 4XWYA 4EZEA 5KMGB 2BTEA 4H6PA 3DWGA 1UJ6A 1LGYA 1GUYA 1M0SA 2NWQA 1ECFA 4XW2A 1DIRA 3PNMA 4LOIA 4NZMA 2EL9A 4E70A 2C78A 2I65A 2V6FA 5TMEA 4QTUB 4EUHA 2YCLA 1T35A 1D07A 1V7CA 4UHKA 3D81A 1GSAA 4EFNA 5KYYA 4UVHA 4K7JA 4BB6A 4A15A 1X9HA 4NABA 4G0XA 3WJ7A 3VHRA 1CQPA 5JO9A 1Z4NA 1NDQA 3EZNA 5TF4A 4DNFA 4JB8A 1ZCBA 3DAFA 4BO1A 1RJ9A 1PAUA 1DBSA 3IUQA 2VH1A 1RACA 4TV8A 1JA0A 4Z8YA 1MOPA 3GA7A 3EOZA 3KP1A 4NZ9A 3U0VA 3ISVA 4B3JA 3KYBA 1XL0A 4O4LB 1FP1D 5K2MA 4YT2A 2DETA 2GPJA 5FH9A 1WIWA 4F91B 2NSYA 2XKAA 3BJIC 3HJNA 3A3KA 3FPAA 3D8HA 2WB2A 1GPWB 4IUCS 1DU4A 5H83A 1R18A 4K3UA 1QRSA 2K87A 2PG3A 3DW3X 3ED1A 5TX7A 5BWOA 3AY7A 1E0KA 2Q1YA 4G41A 3Q5GA 4GFDA 1K98A 4TGLA 2J3DA 1SVNA 1BHSA 3DXZA 4F3YA 5FNVA 2J33A 4JAVC 4Z3DA 2CV1A 1E7RA 1NW5A 1R4NA 3GBSA 3AYZB 1K92A 3LP8A 5GGXA 2P5SA 2CL6X 1U9CA 4EEXA 2OHGA 3SZ3A 3ZDAA 2D2EA 3HB7A 3V7NA 1ORIA 2QN9A 5CGZA 3ZWVA 1F3OA 1N7IA 1LZKA 4LVNA 4Q1DA 1IPHA 3JVUA 3HDJA 1FE8A 3B8HA 5DNUA 4LZNA 3M0EA 1KDTA 2WJWA 3RB8A 3T4XA 4PAGA 5D3MB 4KQHA 4QELA 3SBXA 4B17A 4DRXA 1EU1A 2NNLD 4JJIA 5DM0A 5BSTA 3K35A 3EEOA 5KO2A 5ALZA 1YB1A 1V5GA 1QVWA 5HM8A 4LF9B 5CJ2A 2AE2A 5DJ5A 3LLVA 4HDKA 2COUA 3TZCA 4YT8A 3G9XA 5ESXA 3R7WA 3SBDA 4NJMB 3SHQA 1AU9A 3EXFB 4FDTA 5EUMA 4XLTA 2GAFA 1BXGB 5IN5A 4IX1A 4KX3A 1EKXA 1JHUA 3OVMA 2IXDA 5ARDA 1U0JA 2ZKIA 3DL0A 2VHZA 3A58B 4GGOA 3E27A 4JSRA 1E58A 1M2WA 1U2EA 3O1IC 3F9RA 4E1AA 4G0UA 1Q2XA 4I4CA 4IKOA 3MUFA 3CKMA 4M37A 3AR3A 1VIAA 3W4IA 1RR6A 3B1JA 3BJZA 3ZVLA 2RKOA 1LBIA 3GNSA 5KJEA 1T1JA 1NVGA 4UMDA 4G5QA 1IEXA 1RVV1 3L0CA 3PFKA 1QFZA 2ODTX 3MTEA 3KZNA 4G6ZA 4KN5A 4QPJC 3WOHA 1NRJB 4BUCA 2WUEA 1CCWA 5HBRA 2B1IA 4OLBA 2VQ6A 3B20A 3N2IA 2BGTA 1XLUA 1IM8A 1VMEA 4LNUA 4O2RA 3B1FA 1FFDA 4E94A 3GUVA 3P45A 1S3SA 2XQJA 3OPQA 1AKRA 3IB6A 3H83A 4M22A 4OIMA 1Z6YA 4UDXX 3AU9A 1SCKA 4GLLA 2XWBF 4V0OA 3O8OB 1QV9A 3CRZA 4DIMA 4UTVA 5EMMA 3UPUA 2V03A 1MFZA 2BE7A 3H1BA 2O0HA 1P60A 1ZCJA 3JWHA 4HGYA 4JSTA 3LOUA 1RI3A 3L8EA 2AW3A 4QUKA 4RVNA 5EIAA 2W11A 3R5KA 2C1EA 4JL6A 4JUAA 3FY4A 4MWZA 4NKRA 3RVQA 4GEGA 4CR8A 4BFXA 1ACLA 4FYWA 3G8DA 4MEBA 3T3HA 3STYA 1KWKA 3KYDB 1DXQA 1GZHB 2AMJA 1RM4A 3IXMA 3OT5A 4KSCA 5DGXA 4ZZIA 4V1CA 2NVUA 5C1PA 2QTVB 5HKOA 3ZOZA 1JEYA 3WGGA 1SHTX 2ATCA 1XHEA 4YHBA 5AP9A 2YWHA 4LYAA 3G2NA 1DJQA 4Q01A 4F4DA 4QYIA 2ZIFA 1VJTA 3IP8A 1HZJA 4E1BA 2FZ5A 4S1TA 2Y8EA 4D81A 2HRQA 2JVKA 1OC2A 1EK1A 4HVAA 5D3ZA 1NE2A 1OYWA 2VWPA 3PBKA 4EKEA 2XE6A 2ZANA 4MI3A 3K9GA 3KQSA 3QVWA 3PXBA 3R0ZA 4BVAA 4YRZA 2CMKA 2ODWA 4QVIA 1Z0UA 1E0SA 4KHZA 1FMJA 1W0JA 1IHPA 4IWXA 5AUOB 3KALA 2K7ZA 4LWQA 4AJOA 1FW8A 2POQX 2WM3A 3DVQX 3MJCA 3D8UA 5DNCA 4ZANA 4QJ4A 3BFXA 3JW8A 2ZR9A 1OXMA 1JIVA 3PITA 4M54A 4MGKR 5CVDA 5DM2A 4EHJA 2P9EA 4C0KA 1ZN9A 2H4ZA 2Q99A 2P5UA 2G0NA 3T3DA 4OATA 4E5NA 5DCLA 5FTLA 4UMEA 2FB9A 4QOFA 4DG8A 2P3QA 3OEHD 3S2GA 4CDGA 1GGEA 1HGXA 1XWWA 2EQ5A 3GJ7A 5GONB 3S68A 1AS3A 2H8GA 3HDQA 3RVKA 3R0IA 3JD2A 4NBLA 5E0OA 1E2UA 5LWQA 2OUKA 1LCIA 1SVOA 5CRIA 5GTDA 5LZ7A 3R4VA 4DMHA 5KYNA 3M9LA 4JJAA 3DR3A 4YDHB 1A9SA 4BJ3A 5MGNA 3QPCA 4MIKA 4DR6B 2JAPA 2FUNB 3AJRA 3T4UA 3TLYA 4QRHA 3LRPA 3ZR4B 2NN3C 2R86A 1UBLS 2CNKA 2WMOB 4B80A 4C5CA 1R6XA 3GDGA 3OF3A 2WIAA 3PKZA 2FWNA 2P9HA 4F4UA 2HMSA 3DMHA 3QSGA 4PC1A 5E7JA 5FL7A 4TL6A 3D4NA 3O2QB 1P0FA 3CB4A 5A4KA 2FW0A 1YMUA 4DRXB 2ZYHA 2QN1A 3W3ZB 3U81A 4URHA 3RWBA 2JAHA 4IEIA 4ESHA 1OUMA 1ZESA 1WPXA 2W0SA 5AKEA 5F33A 2QI9C 3KPVA 5JDCC 1M6HA 1VECA 3K5HA 3T7IA 4DSTA 5LFAA 1NVMB 4Y1RB 3UHJA 1HT2E 2RONA 4QGSA 4DSNA 1CVLA 2VPQA 5KAPA 4Z7OB 2ADFA 1QH0A 3R3YA 2YN2A 4QRIA 4WN9A 1I3OA 3PE3A 3QM1A 1XB2A 1MJHA 2JK0A 3EFHA 3GHHA 4YRNA 3DZIA 3ZZ1A 5FNVF 5A0TA 4FIDA 4HI0E 4IJ5A 1KDRA 1J24A 4HQFA 4R6XA 4OQNA 4NBSA 1TE2A 4PZPA 4BMDA 5K45A 4BZXA 5LB2A 1QANA 3AUKA 4EUKA 3G8BA 1WXGA 1NJ1A 1SKYE 3DGFC 4CL3A 1KC3A 1UDWA 2GZAA 5IDVA 1ZL2A 1X7XB 1SC1A 2X6QA 2P3LA 3LZCA 1NQ5A 1Z6ZA 4JGIA 3OZTA 4RHEA 5E2AA 3RYIB 3IUEA 1IHDA 3ZLTA 1C2YA 3L41A 3OAAD 4ILKA 2EEZA 2NU8A 2LKCA 4CM7A 2QRVB 3KL4A 1WHSB 2PRZA 1P9NA 4WXYB 3MUNA 5TMDA 4C4OA 3C1TA 5E7MA 1TF7A 1V7QA 3OEYA 3SAJA 4MWOA 1T8RA 2IXTA 3DTVA 3VTKA 1CU1A 3JASA 5AI6A 2PX8A 3ABIA 3L92A 1U0GA 1E5VA 2R97A 1A3CA 1FLNA 3FVRA 4YDSA 4B6JA 2WYUA 2YMLA 3R0VA 2FFAA 4QLBA 1JU4A 4JYZA 1AHHA 1P73A 3DYVA 5JD6A 3OPXA 1TI7A 1ZW1A 3TF5A 3HKBB 2B9VA 4X6LA 2GKOA 3ZJ4A 1UANA 5DHSA 5HMLA 1QGDA 1ENZA 4Z1MA 5C7IO 5JMTA 2GZHA 2NZXA 2FMKA 4OPMA 4U00A 3I9KA 2GPBA 3RVNA 4R8LA 2PJRA 5AKKA 2BJWA 2NO6A 2O2DA 3R20A 4NU0A 4OSEA 5AHOA 3ZWNA 3G2MA 1CD5A 3KOUA 5AOBA 3WLEA 1GQQA 4LDPA 1LBSA 2Q4OA 1J2RA 3BTSA 5CR9A 1G5TA 4UVDA 5LZ2A 3GPIA 3NM5A 4AZ3B 1XV5A 3RKRA 1J21A 1E6WA 1KKLA 1N5LA 2KBFA 2XVXA 3KJHA 1J25A 3FDFA 4L3VA 4N5LA 2L19A 4NJEA 2QVGA 5EP1A 2PZMA 3WOVA 1I2BA 1QO9A 1F9EA 1KAMA 2BGNA 3AFHA 3DULA 1NI5A 1RJDA 3WP1B 5LOVB 4TMWA 1SD2A 2CNWD 4RZXA 5A71A 4ZVVA 4CEHB 1DC5A 1M1YB 1ORVA 1ZH6A 4GQBA 5IVDA 1UZUA 2I5PO 3SC2B 4XWAA 4DILA 3NVDA 1GQSA 3I1YA 1P1RA 2WT8A 3THWA 1DG9A 1E94E 1RTTA 2C97A 1VMIA 5KPJA 1EFPB 2JBAA 3RS2A 3IA7A 2WVGA 1OBVA 4QRDA 3QVGA 1NNEA 2XQKA 1PNRA 1YAHA 4CF3A 1ZLYA 3RAFC 4LHSA 3FNIA 1IHOA 4BZWA 4R1MA 4I6EA 1RLUA 3A14A 5E9AA 2ASVA 3QV1A 1VHLA 2QLMA 3GAMA 1V4NA 4LZJA 3LJKA 4HB3A 4ZI3A 2X5OA 1KVSA 1G42A 2YVUA 3EXG1 4TYQA 4EA8A 1JMVA 5F35A 3TVTA 5AW1A 2G9RA 3QF4B 1JBQA 1WQ4A 2P6MA 3A6DA 4MJLA 4OXRA 3RUIA 2Z1NA 5L40A 1XF9A 3K0BA 5K5EA 2FN7A 2H29A 4URYR 5JNWA 2ZI5A 5EMHA 3RFXA 4CL2A 4XIFA 1R8XA 1VG8A 5HE8A 2G5GX 4HCJA 4M1OA 4XJXA 3LWBA 4RD2A 3AB7A 4D9BA 4YAKA 4F12A 3O91A 2J30A 4LYEA 4ML3A 3TFOA 5KTNA 3CH5A 2ACVA 4HNHA 4OQDA 3VOBA 4D6PA 1T4MA 1RFGE 5CDFE 2ODNA 4NCJA 1PUIA 2Q6TA 1T2EA 1KBOA 4XR9A 3TLMA 3AEZA 3RU2A 5CA1A 2W8BA 3ME5A 3N2GA 1X7GA 1GITA 1VE3A 2FX2A 4UEWA 5FOUA 3WLIA 1YACA 4TSFA 4C4PA 3KVVA 3BS4A 1CV2A 1KETA 2Q5IA 2WD9A 3I8XA 4ZVSA 3F6EX 5JSKA 2CEAA 1X14A 4I2NA 3T35A 1B8UA 1MX5A 3WGHA 2DQYA 1C9JA 3HYRA 2XYRA 3N76A 4KMSA 3E1SA 4P3NA 2XJ4A 5DZSA 5KAMA 3TIGA 3QWIA 3AOGA 1XZBA 4D41A 2Q3BA 4F8JA 3LGSA 2PRIA 1H2RS 1MRSA 1KI4A 1PJSA 1RRPA 2ECPA 2OHFA 2Q50A 2V7QD 1JILA 3WIDA 3EGCA 3WNZA 4ZVMA 2Y6UA 5GZ3A 3MFQA 3RLFA 2ACEA 3DMTC 1XKLA 1FDUA 2VT2A 3DF7A 1CKEA 4UHJA 3RSGA 1I7QB 3ZW9A 2ZGVA 4TWBA 3RUDA 3CISA 1Y1PA 1M7BA 2GCGA 2XCTB 4D8YA 1FTGA 2JB9A 3S27A 1PW5A 3D7NA 3K32A 1J5EB 2PSEA 3BRWD 3V8PA 2C2KA 1M2OA 3QX3A 4CF6A 3G5TA 2YWCA 2OQ2A 4XQ0A 1YONA 3FYSA 3D4IA 1E1YA 4MLDA 2QM8A 4XGIA 2VT6A 1FRZA 4CTNA 2EZ8A 1J06A 4LY6A 4ZYUA 3N0RA 3ZWXA 1DLJA 2NU7A 2R11A 1E4EA 3GPBA 4FLEA 3QX9A 4I0WB 2Q8QA 5DN6D 1H4QA 4TMKA 2C0QA 4B8WA 1YFLA 1EWQA 5B2EA 4Q7QA 2DQKA 1JDSA 4XWTA 2WSYB 3U1TA 1PZHA 2NU9A 2J85A 2BDEA 2FQ1A 3EAGA 1QIEA 2WKQA 2MR5A 5K3SA 3AERA 4ALNA 3KAPA 4YJFB 5BR4A 5K8JB 3F6YA 4S05A 1YI0A 5ANRB 4HYYA 4WY5A 1D6SA 2W2OA 1ZM4A 4DUPA 3PFWO 2WHXA 3A4YA 3G9QA 5DKFA 1L4GA 4TYMA 1ZGJA 1PDWA 2HCJB 2R5NA 3IUBA 4V2IA 4DNXA 1THTA 4B6OA 3CA8A 3M5PA 1POWA 2AC2A 2JFHA 1GADO 1S4QA 3FHCB 2YJ3A 4NENA 1DAHA 3UJ8A 3WB1A 1R9NA 4C0AC 3LCMA 4CLOA 3COVA 2RJOA 1Q44A 3KZKA 3VSAA 1LD3A 2J9RA 2WWXA 5JXJA 3QUAA 2DTXA 1TU3A 1XA3A 2ODAA 4HWRA 3ORSA 5BOSB 1T9GS 3PGA1 4OQFA 2Y0CA 1V4BA 3KR1A 3WWYA 3PXCX 1GQRA 2J41A 5FYDA 2R2AA 3FPFA 3P96A 3W4KA 2PUVA 3EZXA 3ETNA 3I2HA 5CFQA 3EDMA 3X2EA 1M1UA 1FNDA 1EHYA 1NDHA 5BSKA 5EFOA 3IJEB 2IEGA 3IAS1 1D9ZA 3TBFA 3UJBA 5KHAA 1DIOB 2XYHA 4IZIA 4R9UC 1Q1GA 2QPAA 1RYYA 4RLFA 1JP7A 4WAUA 3T3PB 3ZU2A 5BN5B 1DTWA 3KX2A 2Z3VA 3SEZA 1YHYA 3QKRB 5D85A 3GW8A 3L7AA 4MPTA 4I1YA 1GGMA 1I24A 2QGNA 4A10A 3F74A 1RXUA 4MVJI 3CTPA 3WJ1A 1EUZA 2B98A 5G3YA 1EEHA 4HRAA 4B45A 3RNOA 3CLSD 4MQEB 2Z3WA 2AR0A 3IP3A 1Y89A 3VISA 3DLPX 1PD1A 3KYIB 1O0CA 4KQ6A 1AK9A 3HN6A 1P4GA 3KSZO 4RZUA 1Q50A 4F8YA 5E9JA 4U2GA 1DUIA 2JI8A 2JI6A 1TEHA 3L1VA 4D97A 4ZAFA 4DIKA 3U16A 2RD2A 2JFWA 2ZRMA 1AV7A 2B8JA 3R5SA 3VR2A 2WFAA 3IV9A 4TM7A 4IIVA 3VOTA 1FFBA 4C89A 4EVSA 3BBLA 2Z8ZA 2I80A 4RK7A 1ZOSA 4JK3A 3NI2A 1W4CA 2BC9A 2BFEB 3PUXA 2P6PA 1P2FA 5A3JA 2XMQA 2X8WA 2AFIB 2Q5FA 2JJ1D 3NRBA 1FSPA 4ETNA 1QZ3A 2WTXA 1ILWA 1PX2A 4FS8A 3WNDA 1N33B 3SFVA 2Z4TA 2PRYA 2I76A 2XTNA 2YC2C 3ASZA 5AJZA 3RFTA 3RIYA 1QQTA 5FIUA 5I8ZA 3BGOS 1PJAA 1FFGA 4C21A 1JNYA 1ZQ9A 2AX3A 3C39A 1EXMA 2ZSKA 1MT0A 2H2DA 3OOWA 3UHOA 4OF4A 1HBJA 2GMWA 4MS4B 1FYEA 5JWOA 1SUCA 1GUFA 1GLVA 2QR5A 3EMKA 4P35A 4IJKA 3T1VA 3D4BA 1L3CA 2PKQO 1JIIA 2Z5FA 3B2NA 3A25A 1SC6A 2QP3A 4GPEA 3GELA 3WK5A 3WWZA 4Z4CA 5IJAA 2RKBA 4JBIA 4LC9A 4MNTA 3W3AD 5CA1F 2PTHA 3GP8A 5E2BA 2E18A 4BX8A 1REQA 2NNWB 5TT0A 1E9DA 1X1SA 1F9AA 4EAAA 3UMRA 3PUKA 4Q7MB 1O97D 2G8LA 3BERA 2DVMA 4NONA 1GRVA 1Q95A 2DWCA 2J45A 3E58A 3IXQA 5GPBA 4K05A 2HA2A 4IOLA 3EXHB 3U7HB 2P90A 3EVZA 3ZZMA 2WINI 2VHYA 3IBTA 3I2KA 2CLHB 1XTSA 4MW5A 4YJ3A 3UNXA 5IXSA 2XHZA 4OUDA 3PJDA 5AW5A 5FDFA 3GLGE 2F1HA 3Q88A 1Y34E 4MHSA 4CLEA 1SBTA 2FN3A 4YV7A 3D3JA 5BW5A 3E7XA 3ZLJA 2WHPA 3AIMA 3RHFA 3Q8KA 2HLDA 3BMCA 5IZCA 1JI0A 2F1KA 5J59A 3TR5A 5HFAA 2I22A 2P3OA 4L3WA 3NM4A 3PT5A 2VP3A 1KI8A 3H9JA 5JQGB 3ASVA 1UQTA 2DPHA 1ZR4A 3ERCA 3ROXA 1IY1A 4Z9FA 1AQJA 4NZNA 3AEUB 3BKXA 3TSWA 4DEXA 4BV8A 2BHLA 2ZJ4A 5K3AA 1OWLA 3IOEA 3C1OA 2O8BB 1T5LA 1XTBA 3JVIA 1E7MA 2XUOA 4N5HX 2YX1A 4YRTA 4XWGA 5EPUA 4EFDA 1SZDA 1V47A 1NBIA 3W8RA 2SICE 4I9FA 1MDBA 3CUVA 1ZC4A 3NOVA 3QKWA 1OX5A 4XYGA 3VV2A 1Z9BA 1HC7A 1CUUA 5JNLA 1Z68A 3AB3A 1Z4PX 3M6AA 4OHMA 4RMNA 1DX6A 1YK1A 3OECA 4PBTA 4CPDA 4R2HA 3LGAA 4NBUA 1H8HA 3K09C 1VPTA 4TTAA 3U7QA 3ACBA 1EK5A 4MVJA 2BI4A 4YRDA 4KGXA 3W5VA 3O2NA 1KARA 1OJLA 2NG1A 2WKPA 4NJOA 4RE5A 1U81A 1W25A 1T10A 2V7UA 5SZIA 1CP3A 1KYXA 2FZLA 5IKMA 1UOEA 4DUGA 1R88A 4PQRA 2OY0A 3TE6A 3BE4A 5IPFA 3DZBA 4FDLA 3LC7O 4FGZA 3WGYA 4RSHA 3CWZA 1GRRA 1YZYA 3IQDB 4OSOA 3W9YA 1WXIA 1JIJA 4WGGA 1UBEA 2HR1A 4YMHA 2Y1LA 2D0IA 1OLOA 4ZZ0A 2HX1A 3WYFA 1BA2A 3BIJA 1RYMA 1JLLA 1WW8A 2FEKA 1ESDA 3LXXA 4HPJB 4Q47A 1GU0A 5CK5A 2OGSA 1LNQA 4RCYA 3S2ZA 1C80A 5FI3A 4DJDC 2D7JA 4DJAA 4BC1A 4EO7A 4RVUA 1SOUA 5K0BA 5C8YA 4IDHA 2F9FA 3IODA 4D45A 5I4IA 4FLMA 4Y67A 2QTBA 4F5YA 2VBIA 3LDFA 4FYMA 2JFZA 1WZNA 4QXOA 1U7HA 2CXPA 2X40A 3ZKAA 1JIUA 3ZXSA 4AUNA 2XUGA 4HO1X 2MMGA 3WZ2A 2QRNA 4R40A 1RQLA 3GL9A 5C31A 1JFRA 3HUEA 4G1UC 4PHFA 2NO7A 1YTUA 1MTZA 3F4KA 3RIXA 3JZIA 3VI4B 5LDDC 4AP6A 4RHCA 5EUQB 4CU5A 1HLDA 1Z29A 2G08A 2ZJ5A 1RQRA 5H0IA 4ZDKA 1XU4A 1QH9A 1HNWB 5THQA 1U0OC 1QK3A 4GX0A 5D7BA 4EJ0A 5K8UA 1PQ4A 1XD8A 1UBCA 1CE8A 3O4GA 4OXIA 5FPYA 3UJ9A 1WKBA 3WIEA 5IVHA 3GH3A 3CKLA 1FJHA 1RQXA 3ZE1B 2W2XA 4Y98A 5DE3A 4X92A 3OX4A 2EKPA 2FEOA 3NAGA 5FR2A 1CUYA 1RWXA 2HPHA 2ZI3A 5K8CA 4GNRA 2WDZA 2HFKA 1PQPA 5G4KB 1A5AB 1V16A 1V3TA 1FFAA 4LBVA 4MR7A 1TXGA 5ICMA 2G4LA 3N2NA 1ZINA 5ECGC 3IE1A 4JVSB 2I1QA 3RRBA 1C9KA 2Q6LA 3E3OA 1LK7A 2P78A 4JJEA 4PNHA 3I76A 4TV9B 5KJFA 1SURA 2OKGA 5GIOE 3HLYA 5EQTA 1GP2A 1R0XA 3AU8A 2MINB 4QBTA 3MT9A 3SXUB 4AKIA 1SG6A 3SZUA 2ODEA 4ENWA 4QOJA 3RRNA 1Z2OX 3SBOA 4ZYTA 3GLIE 4DGQA 1USWA 5IH3A 1VXRA 1A72A 5ALHA 3SZMA 2J9XB 1E5TA 1X38A 1XMXA 1KMQA 2AZTA 2O8VA 3MD0A 5CBPB 1T9HA 4NYIR 1F51E 1VKZA 2WG2A 1UOQA 5JPIA 1GCGA 4XUEA 2PU5A 1NYTA 1DJNA 1P7ZA 3RHTA 3FKJA 2Y4NA 5A4AA 5D5PA 1U90A 1SCUA 3PXUA 2PZFA 4IJQA 3EGDB 4TSKA 3WNVA 4ARAA 2ZRNA 4ALJA 1OAAA 3GUZA 5EERA 4D56A 5LQUA 5E1BA 3ABSB 2GBCA 1QHNA 3CLKA 3UBTA 1NI3A 2W6MA 3P2KA 4HXEB 4U2EA 2FK7A 3F9CA 1E79A 2IYRA 2R1VA 3F3YA 3V1NA 4LDRA 2HADA 3LCUA 3DNFA 4Z7QB 5CITA 2CV2A 4Z4FA 3UGJA 1NZDA 2OHVA 2VF5X 3C85A 5JCZA 1Q20A 1GY8A 3Q6MA 4ZCPA 2O2HA 3O8RA 1ZI8A 4MINA 1E5XA 1EFLA 4YJ3F 4LXIA 2DY1A 3M49A 4UM7A 2IW1A 1YB5A 2GNOA 3AHIA 1BNCA 2EBWA 3HP7A 3OY2A 1M1NA 3P52A 5CLIA 3LVFO 1BMFD 4EB6B 2V9PA 4G0ZA 4C22A 2D13A 4AO7A 2UUAB 2VRNA 4G56A 4LQCA 4BFWA 2H0QA 3U5ZB 5ER6A 3I9V6 2YV2A 2Z8XA 3ZTTA 1C3EA 3QVXA 4RD1A 5IF9A 4RY8A 3C3EA 2DUWA 4FFNA 4ADSG 1T5TA 4KQFA 4LG1A 3HFJA 5KC8A 2WU3A 1WABA 1L5OA 3QXSA 1EP1B 2RAVA 1OZFA 1NUPA 1FX0B 5E3JA 2WFLB 3CE9A 4ZYVA 2WSSD 5BVGA 4LJRA 1MDFA 1SXGA 3TGWA 1ZNQO 5AKLA 1PGNA 1CZOA 2WABA 1PJ4A 1Q0ZA 2WRZA 3FPLA 1EFVB 2NVBA 3SYKA 4F21A 3VAZA 1DARA 1H2WA 1EMDA 2KX7A 3NATA 3THXA 5JFOA 1I2MA 3I37X 4FHDA 3ZH2A 1X74A 4YYEA 2VI5A 4LJ5A 1KEEA 2JIOA 3C3JA 1V5WA 2X9QA 2DFLA 4F38A 4A3SA 1MVLA 1GPBA 1I7NA 4IVRA 4XFDA 2Q3LA 2YUIA 1CY0A 1PZMA 1XFDA 4MVJF 1P5ZB 2ZJBA 5ISMA 4W5TA 1RZRD 2BRUA 3CYFA 4KVAA 1W52X 5B7GA 2OORC 2WUWE 3FAZA 5AOCA 1ZJWA 2EZ9A 1GZSA 1BE6A 2H59A 1O0BA 5FRDA 4IMJB 3F6SA 1XC7A 2Z09A 3AZQA 3LYHA 1FMFA 4AL4A 1JFTA 2FW8A 2FUG1 3AI7A 2BFFA 1LBTA 3RVPA 1QYCA 4YP6A 4TXJA 5COAA 5C0OE 4J07A 1I6WA 1JA9A 2BMDA 1MCZA 1Y7PA 4RGVA 5KYXB 3BD7A 4XGQA 1YKGA 1PTJA 4F2HA 1GUZA 1U65A 5JY1A 2AT1A 5K6AA 4KBYA 4YNBA 2WHQA 2PTGA 5C8YF 3FR8A 1OKKD 3O8QB 4K9SA 3NHWA 2VUHB 3WYGA 4HEHA 3MG9A 4X60A 4ZV9A 3F47A 1E2LA 3FKQA 3OU7A 4OQ4A 5L3RA 4J3NA 3SDSA 3U7JA 3UEOA 1XXHA 4ZZ3A 4KO2S 1DQPA 3QEJA 2JKYA 1T2AA 1CUIA 2GRJA 2QXYA 2QU7A 4CTMA 3PHGA 3KWFA 3JPYA 1P6QA 4IIGA 1WV0A 4PU0A 5EGSA 1MGPA 2EKBA 4TLMB 3VOAA 1KJYA 3GEDA 3ZS9A 4JNCA 5FBVB 2Y67A 1LK5A 1R4MA 4RS4A 3BDAA 3BJRA 1WEKA 3KLMX 3NEPX 4Q4LA 4BCBA 4E08A 3ZHQA 1JDBC 1SQ6A 1KI7A 3I32A 4NS4A 4G1FA 4EY5A 3P2MA 2XA2A 5HOQA 1JQ3A 1H2BA 4V03A 4WXMA 4F3RA 3FGPA 5JZVA 3ZTYA 3D6VA 3P9IA 2EJBA 4P7JA 521PA 1EVZA 4ES6A 1FFXB 3H6GA 4TQ9A 2XT9A 1JLMA 3W5DA 2B36A 1J0XO 3I4FA 4LRTB 4F3NA 2GYYA 2V65A 5LA6B 2PZJA 1VPLA 2FY8A 1IQRA 5HGJA 2EJVA 3ZWDA 3FCOA 4C2BA 2V3VA 3GFFA 3I5AA 2GAAA 3LUJA 4J0HA 3G85A 3TVYA 1K8RA 1AXRA 1SKYB 5EIBC 5ALRA 3VYVA 5EWLA 1LVUA 5TPZA 4AJHA 4DIBA 4GYYA 4RV4A 4TZTA 4DR1B 5M34A 2IS2A 1AK2A 1JDBB 4NZOA 3HG7A 3SC6A 4EI9A 2ID7A 4Q15A 4AUMA 1WB5A 3DM5A 3WWEA 4A91A 4E5KA 1V9SA 4L0CA 1BX0A 2IUTA 1QPBA 3LUFA 2Y0EA 4CL8A 2UUPA 3COYA 4U02A 3U3KA 3V4VB 5A9SB 1M9NA 5HKKA 1HTTA 2W58A 3DPIA 2JNWA 1SQ5A 1VB5A 2F1JA 2PKYX 4QATA 1L5MA 4RKFA 3R7AA 1ZUWA 2OV8A 4IIEA 1ZWLA 4RQUA 4XIIA 3DKKA 5K99A 3L8MA 5SYAA 3WICA 4N0QA 2P68A 1K6XA 4IDEA 4CCSA 1UODA 2HJVA 1YZLA 1QXSA 1S01A 4UEJA 1OTHA 4AK9A 4I8IA 1TZJA 4KKXB 2O7QA 3P9NA 2OXTA 4B6EA 4CUZA 3DV0A 2GO7A 3IHTA 5LYJB 4MEJA 1HDGO 1G20E 5JRDS 2R6JA 4FSHA 1L1FA 2RH9B 3DKIA 4JHLA 2W6IA 5DBEX 1FJXA 1LTKA 5D5QA 2QT0A 3TZBA 3TRKA 2IZ7A 1P2VA 2H00A 3R75A 3WDKA 4C4ZA 3ZKWA 2Z2ZA 1CUVA 4L6CA 4O59O 4MV3A 4AB1A 5REQA 4MA4A 5JS7A 3UW3A 4TL8A 4RM3A 3IVRA 5JLJA 1I1HA 2B6NA 1K6IA 1SVUA 2R85A 4DLRA 2JLUA 4BZQA 3GVCA 2EWWA 2QM7A 2I7CA 4OJMX 4HZIA 3TLGA 4DIOA 5HHTA 1Z2CA 2VJPA 3B51X 4N1AA 3RF7A 4WL0A 3PTZA 3SIPA 2I0FA 5I4BA 1KH1A 5K6RA 4GD3Q 3AGPA 3GEBA 3ZXYA 1VG1A 3LY8A 3O83A 1IATA 1E89A 4IDGA 4F9GA 1YUMA 3DAPA 4E2XA 4I9GA 4BNIA 1Q3TA 4R3WA 1DTSA 2MSEB 3CGGA 3W9BA 1T3SA 2LDBA 4IDAA 3NGLA 2IH4A 4BNYA 1WZIA 2IYNA 4KFUA 1OT3A 4LXHA 2QN7A 4B4WA 4KPYA 1IONA 5M29A 3TMKA 1UMKA 2YQ4A 2GD2A 1A7KA 1THGA 3P32A 5CVCA 2J3MA 4OH7A 3VZBA 3W2GA 4ZGGA 1CRWG 1FFEA 2LWIA 3AWDA 4M8KA 2FZVA 1U5BA 3OTIA 1NJ5A 1YTLA 3W8NA 3O4IA 4E46A 5A62A 2C2HA 1AG9A 2QN2A 2XZTA 3O90A 3E82A 4L4RA 4S0ZA 3SOZA 3CH4B 2Q4RA 3UAGA 4WEOA 3LT1A 1XRLA 4GSLA 4F1KA 2ONZA 4NQRA 3U5TA 1M2VA 1CLEA 1KZYC 4K9PA 1ZXXA 4XYEA 4CHTA 3SJZA 4ZOEA 3TIFA 1NKVA 1EQ2A 1FUIA 2F90A 2JJMA 2NUPA 2OUIA 2ZJ3A 4US0R 2BFBB 4O02B 4XIGS 4MSUA 4EF6A 3T3OA 2P0EA 3CQ9A 4RA9B 4DMGA 3AUAA 3WK9A 3A3OA 1R0CA 2VPIA 3ESXA 2ZRBA 3RSHA 1DKMA 3GRFA 1CBUA 3HL0A 4Q12A 4D4JA 3HDVA 1ULTA 4AG5A 2VAVA 1HDRA 1BEEA 3IQIX 5IEJA 4HLDA 3L93A 1ODCA 1NNI1 4MLCA 2UUOA 5JH7B 1PVDA 1X9GA 3M3DA 2QIPA 5KVCA 3Q7RA 3TLEA 5DP1A 3L4JA 1CWUA 3KB6A 1C30A 1JLKA 3K9NA 4Y1FA 1TYAE 3DZFA 3IILA 5BR7A 1D2RA 1N0IA 2ZSUA 5CUQA 3RYTC 4TTTS 4OI0A 4YLEA 2G9NA 2O8EB 3LQ2A 4MR8B 2JVJA 4UTOA 4EEZA 3U56A 3CW9A 3WGZA 1KQFA 2QPOA 2I99A 4QGGA 1JWAB 3OE7A 1RYNA 3MJSA 4RNDB 1GU1A 4HOYA 3ZNPA 3M34A 1V3UA 2N1BA 4J1TA 1NUSA 1OI2A 3HLKA 3BWYA 1FP7A 4TROA 3B1YA 4XDZA 4CV2A 3A7DA 3EZ6A 3BH7A 5A3VA 3SNKA 1RHJA 3KQHA 2AOVA 3I04A 4GSKA 1T91A 4ZGWA 3KB8A 4R7GA 3DJYA 4D9JA 5G0SA 1GFSA 1OV6A 2DM6A 2NZ8A 3A1VA 4DL9A 3A6KA 4IXWA 4H4EA 3IDQA 2J0VA 1BRMA 2I29A 4RJKA 4G37A 1HFWA 4FDMA 3W2TA 3IAM1 3CXRA 3OA0A 3SIXA 2OHJA 3TW6A 1UFKA 3QGMA 2UZ4A 3PI7A 3Q9UA 4J0CA 3PNBA 3PHBE 5LBTA 2PD4A 1HYGA 4GPBA 5CM9C 1TUBA 2Q41A 4MMZB 1T6NA 1J00A 4GMHA 2JJ8A 2BI7A 1BWRA 1HI9A 2X5NA 2E55A 2X9LA 3N8HA 3PG5A 5BRNA 3FBGA 4R1OA 4PQEA 1KI2A 3O4RA 4S1VA 1MA0A 2HYDA 1PK7A 2JGRA 5C51B 2V7XA 3FETA 2NO5A 2CL0X 4PX5A 3RWMB 2ENWA 2R8OA 2EYQA 4PONA 5CX1B 5CFPA 3Q2IA 4CM4B 4WESA 3DO6A 1EWRA 4UM8B 5BRAA 2GBGA 3HNPA 4E3WA 1KDYA 2X13A 1XQ6A 1QFMA 1H1LA 3ZPXA 2AA3A 1Y1TA 3ILSA 4CWAA 4DEYA 4I81A 2F3UA 2XBLA 3EIHA 1ZYUA 2OZLA 3MGAA 4FC6A 4UUPA 3A9CA 3WKAA 2NXCA 2C9MA 3L7BA 3RCBA 2BDUA 5D51S 4KODA 3KTAA 4QHTA 1YBAA 3KSAC 4QYWA 1UDAA 2Q27A 2OSBA 3K6RA 3KZMA 3NT5A 3TLJA 4EH1A 2DP4E 4AWBA 1IC6A 4C07A 2FPPA 1J23A 2OWEA 2WKWA 2A59A 3ZVMA 1N4DA 3JQ7B 4L8WB 5LBIA 3H4TA 3S5UA 2ZYRA 3FLAA 4HNSA 2JI4A 4XD7D 4HN9A 4C4XA 1KA9H 3FE2A 4P83A 1K9VF 4JJ6A 1Q1EA 2ATIA 1UIMA 2BV3A 4M4SA 1AB6A 2HIHA 1GFZA 4QC2A 3OZBA 5BYJA 4PLWA 2IOHA 2OCAA 2FE4A 3PNYA 2ZTLA 4FEAA 1F2UA 3F5QA 1DKOA 1YMQA 1ZK0A 2XRYA 4TMFA 3ND8A 3Q98A 4H7FA 1YC2A 3MUEA 3HJRA 1L5NA 4NHOA 3WLMA 3VKGA 2RGNC 4LXTA 1AXEA 2ZJFA 1GPNA 1J8FA 3AVXA 4O4IB 2UAGA 3I2JA 1XT6A 2C84A 3FPCA 1M75A 3QU9A 4QT0A 5TE9A 1JMYA 3GK3A 2G04A 2HK7A 3IJRA 4QGAA 4XEHA 3V80A 2VSFA 4YT4A 4AJPA 1GIAA 2ILVA 3I04M 3IS3A 3OIYA 3UUGA 3KKLA 1L4EA 2ONKA 3D7KA 5EMJA 2ZUSA 2HCRA 2VP0A 3LY5A 3OY7A 2X2PA 1ZFNA 3I6ZA 1DP4A 4HAVA 2RGXA 4QQRA 5ED4A 1J9GA 1S89A 1Q1NA 3F97A 3LPNA 3LY7A 4A73A 4AF8A 3HR8A 2NXJA 4HLCA 3LOPA 2PJDA 5FOTA 4BX2A 2G88A 2R9VA 2A5DA 1ZM3A 1OI7A 3GEEA 4N47A 4FZVA 3SFZA 4Z9YA 4Z9XA 3PGXA 4PLHA 5JOQA 3OKCA 4QDOA 3IEKA 3E9MA 1JG6A 4EF4A 4YYZA 4YUAA 4Q9DA 1EM8A 3PQ3A 2CUKA 5LLDA 4LCBA 3JAWA 2AOTA 3ABRB 3REQA 2KMLA 4OLAA 1OFUX 3E0QA 5EP3A 5C8ZA 3JY6A 4XSHA 2PPLA 4UXHA 1JFFA 2Q21A 5G2OA 2OVFA 2Z1DA 2EFDB 1K06A 5LJIA 1KKMA 3G89A 1Y3AA 4MW1A 1M73E 4TRRA 4L22A 3ITEA 4OHKA