2FXIA

Arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arsC
publication title Interplay Between Ion Binding and Catalysis in the Thioredoxin-coupled Arsenate Reductase Family.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase, hydrolase
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fxiA00
1BAPA 3GYBA 3Q7RA 4M88A 1D4ZA 1NATA 3RVJA 4LE1A 1BDHA 2YHBA 1MIHA 2JVKA 2A9OA 4G0OA 4RK1A 1NXSA 3FGZA 3OLWA 2FQYA 1M5TA 3HZHA 3MIZA 1U2PA 2RJOA 4YGXB 1Z26A 1VKRA 1NXWA 2DRIA 1PEYA 2CHEA 3QLUC 1ZH2A 3SQNA 2PL9A 2ID9A 4XLTA 1TMYA 3G85A 4JASB 4Z4HA 1RXEA 3HO1A 2GBPA 1MVOA 1YK1A 3EQ2A 4RXUA 3H75A 2OQRA 1EFAA 1D2AA 3S99A 3H5LA 3L49A 3UKJA 1ZN2A 5TPZA 2WRZA 3HM9A 2HPHA 1DG9A 1KGSA 3EGCA 3KCNA 2IPAB 3GBPA 1HEYA 4MLDA 4PYRA 1KMIY 1XWWA 3TMYA 3IPAA 2R47A 1JX6A 1CYEA 3OO0A 4PEVA 4YS6A 2VUHB 2E4XA 3MQ4A 1KRWA 1NXVA 3O2QB 3O1IC 1NXPA 3MMNA 4B09A 3C97A 3B2NA 1USGA 4RK0A 4D6YA 4XAQA 1BVHA 3H5TA 5EWLB 1GCAA 3CG4A 3C3WA 3N8IA 1EWKA 4JB2A 3M6MD 1E6LA 1QP0A 1T34A 1FFGA 4MS1B 3ILHA 3RVKA 2GWRA 3KYIB 4W5OA 1EWVA 1PEAA 3LUHA 4FE4A 2IPNA 1FFSA 2GKGA 5HM6A 4EYKA 2GI4A 3QLVC 4UHKA 1PHRA 4QPJC 4IILA 4LZLA 2JBAB 2NZUG 4PICA 3A0UA 5TPZD 5C5EA 1YTUA 3OLXA 3CHYA 3DBIA 3I09A 2L19A 3QX8A 4NQRA 5JNTA 3KKEA 1A0OA 4YV7A 4Z4CA 1Z12A 4KPYA 5EWMB 1JDNA 1EHCA 1QP7A 4GNRA 1LJUA 5GOTA 1A04A 4KQ9A 3EQZA 1U8TA 4EGSA 3CS3A 1YIOA 3OLVA 3OM1A 4S04A 5EWLA 1WETA 2QW1A 3I42A 3OQNA 4HNRA 4MS1A 2PUGA 5BRJA 1ZGZA 3H1EA 2KYRA 4MR8B 3SNKA 2VYCA 5IC5A 1LBIA 3FFXA 3HCWA 4RKRA 1GCGA 4YWHA 2JBAA 1JH9A 3OMWA 2PJUA 2JK1A 1ISRA 2R48A 3SY8A 1ZHHA 2RDMA 2FW0A 4OG2A 1C0EA 3O1HB 4CBVA 1VLZA 4LDAA 1Z17A 1MB3A 1VRVA 3CG0A 3T8YA 1TM2A 3GL9A 5KI6A 1F51E 2E4WA 3FDFA 4KREA 2M98A 3KHTA 2CWDA 1DBQA 1ZVVA 4YR7A 5TQ2B 3ILYA 3CFYA 3ROTA 2E4ZA 3MYYA 1PNRA 3HXMA 3HEBA 4NICA 1QO0D 3DGEC 3MM4A 2H3HA 4RXMA 3RVRA 2RJNA 1GUBA 7ABPA 4RKQA 2FEWB 3QELB 4TN5A 2QU7A 1L5ZA 2WB4A 4KFCA 5T7BA 3H1FA 3HS3A 5KC9A 4NCBA 1JHZA 3NNSA 1ZESA 1YVUA 2MSWA 3LKVA 2A9PA 4ETMA 1ZH4A 4RV5A 6ABPA 4RK4A 2E4VA 1ZY2A 2FTKE 4ZMSA 4N76A 1LJLA 1FFWA 1JFVA 3HDGA 4D74A 3JVIA 3N6VA 2HQOA 2L18A 5IEJA 3E61A 3JPYA 1QNLA 4LE2A 2A9RA 4N0PA 1MB0A 5IEBA 4O5AA 2L2QA 9ABPA 5TQ2A 5JNUA 2PUBA 2QXYA 2IYNA 3BREA 3RVOA 1YK0A 3O74A 2PAFA 1DCFA 3QELA 4O1HA 1DCMA 2PLNA 1Z2DA 4F11A 3H6GA 4W5RA 1A2OA 1CHNA 1SXGA 3GV0A 3HUUA 5F64A 4WT7A 4H60A 2FXIA 4OLBA 2FVYA 1QPZA 3MA0A 3RQIA 1AB5A 2RGYA 2VK2A 4TMYA 1DBWA 4W5QA 3A10A 3BILA 4PZ0A 3O2SB 1W25A 4ZPJA 5DCLA 5TQJA 1SXIA 3LMKA 3KG2A 5CNMA 2LIVA 4XFKA 4JB0A 4EYOA 1DJMA 4TLMB 2IPLA 1TJYA 2FMKA 1Z13A 2WMYA 1P6QA 1YS7A 3JPWA 5B3JC 1ABEA 3E3MA 5E3JA 3KSMA 4Z4EA 1OXKB 3LUGA 4ZYLA 2X7XA 1FQWA 3GBVA 5IBQA 4G0YA 4Z99A 2MSLA 5TPWA 4HNQA 1D1QA 3KLNA 4JAVC 2JVIA 3QX9A 5TQ0A 3UUGA 1OXBB 5KWSA 4F3TA 2QVGA 2QSJA 4PE5B 2QV0A 2PUAA 4KVFA 2FN8A 3F7NA 1ZDMA 3GWGA 3OO1A 1YMUA 4MRMA 4QYMA 5T3YA 1K66A 3JS5A 3Q41A 2HQBA 4N0QA 3LUDA 4RXTA 4G86A 3TO5A 2I6FA 1MAVA 6CHYA 4HNSA 3A0RB 4JOQA 1W9HA 3QLUA 4MR7B 3CKMA 5KC8A 4KK3A 4JP1A 3KS9A 2MYUA 4YO7A 4XXHA 1ZAYA 3LOPA 2VUIB 2J48A 4L85A 4EVSA 1JF8A 4G0XA 5KQPA 2FSPA 3FFWA 3HK2A 4RK6A 1Z2EA 2P9HA 3IDOA 3RVPA 4F06A 1QP4A 3SG0A 2LBPA 5CNIA 2LUOA 4MGEA 3QK7A 3D02A 1XHFA 3EODA 2FMFA 4P98A 3BBLA 1P2FA 5CNJA 4KZKA 4KRFA 3HVRA 3JY6A 2WJAA 5CHYA 1JL3A 3CU5A 2H0AA 8ABPA 2PMCA 5FWXB 4Z4IA 3I5AA 1QMPA 4OTZA 5KQMA 2FEPA 3LUJA 1F4VA 1M2EA 2HSGA 3O1JC 1KRXA 2JB9A 4ML3A 1ABFA 2WY2D 4KK4A 2FLKA 1VPWA 2OENG 2PUEA 4MLCA 2WJWA 3N0XA 5FBHA 3K4HA 3OM0A 3JTEA 4MR7A 4Y9TA 5BR1A 1RNLA 3GA5A 2E4UA 4DQDA 5D2CA 1U04A 4YCSA 4RY9A 5ED4A 4WUTA 3LFTA 3QLVA 1JWLA 3CZCA 4EVQA 1EAYA 1LBHA 1E6MA 1QKKA 3RH0A 3IP9A 3VNAA 2LP4Y 3RVNA 4MR9A 4EYGA 1NTRA 5FWXA 5JS1A 2ZWMA 3UK0A 2M1ZA 4QICA 3T95A 2IPMA 3ROFA 5C5CA 5IUNC 2GX6A 5DTEA 3DLBA 1Y1LA 2PKXA 4HYEA 4Z0NA 3T6KA 3H5OA 1GLGA 2AYXA 4D6XA 4F8JA 4XARA 3R0JA 3H1GA 2MYPA 2HJ9A 3H5WA 4WWHA 5IUJC 4S05A 2Q5CA 2N9UA 1DRKA 3O2JA 1QQBA 3M9WA 2TMYA 3CRNA 3Q7SA 2QR3A 5JNVA 4QYWA 3FFTA 5HSGA 1URPA 4E7OA 4MYRA 1PUXA 3EULA 4MPTA 1R8JA 3OQOA 2JCGA 2PUFA 1L5YA 1ZITA 4MQEB 1Z18A 3LUFA 4RK5A 3CTPA 1B00A 4IMIB 5GQSA 5IUKC 1BA2A 5TPWB 4H3HB 5JNWA 1BDIA 5ABPA 3T38A 3IPCA 4Q6WA 2QZJA 3IP6A 5TQ0B 2W42A 1JFSA 1C4WA 2FKAA 2NZVG 4Z4GA 2IKSA 4ZJPA 3HUTA 3O21A 4DN6A 4F12A 1Z15A 3NHZA 2IOYA 2V0NA 2XDYA 3NNDA 4MRMB 5KQLA 3L6UA 4RY8A 4ZMRA 4KNYA 2ID7A 2O20A 1DRJA 4W5NA 3RVSA 3QEKA 3LUAA 2LPMA 1U0SY 3OQMA 1M5UA 3K9CA 1XHEA 5EWJB 5TE9A 2F8TA 1NY5A 2P4UA 4YP9A 1DBPA 3OMXA 4UHJA 2PL1A 1DP4A 3H5IA 4MQEA 4DADA 4EYQA 4YLEA 3RVLA 4W5TA 4L4UA 1D5WA 1E2BA 3EDCA 5IX8A 1D1PA 2FLWA 2PE5A 2PUDA 4EY3A 1NXOA 2A9QA 2IDMA 4H3KB 5CNKA 3N53A 2E4YA 1S8NA 3NBMA 3HSYA 4MQFB 2FQXA 3RVQA 4E7PA 1SD5A 3HJFA 1J56A 5DGCA 4KV7A 4KMRA 1P8AA 3KYJB 2FN9A 5FWYB 4NCAA 4EVRA 3TD9A 3KLOA 4Z4FA 3P9YA 1QQAA 4LDZA 1RXIA 2R25B 2BGGA 4RSMA 3F6CA 4N41A 1ISSA 1TVMA 2B4AA 1Z25A 2NT4A 3C3KA 3GRCA 3BRSA 4Q6BA 4Z9AA 5EWJA 1IIBA 3TB6A 4ETNA 2FEKA 1SXHA 2MYTA 3LTEA 4G0ZA 5IULC 3SM9A 4MS3B 3DZDA 1Z16A 4G97A 3LKBA 1M2FA 2JRLA 1USKA 4OATA 3F73A 3QEMB 3H6HA 1FSPA 3BRQA 1ZGGA 2PUCA 2NT3A 1TLFA 3I45A 5HKOA 4MR9B 2MSKA 4NV3A 4MQFA 4WXEA 3LUKA 4OLAA 1K68A 2B1JA 4IF4A 4RDCA 3LUCA 3QLTA 4LE0A 1SRRA 5B3JA 3O75A 5FWYA 2R4QA 1YMVA 3NNNA 4RU1A 3VNBA 2FMIA 4G0QA 4Q7EA 3NHMA 4RS3A 5JNRA 4MAAA 1QO0A 5PNTA 1U2QA 3IP7A 5FBKA 1E6KA 4O1IA 3Q9SA 3DLHA 2L17A 4IMJB 4LRQA 4MS4B 1NXTA 2ZAYA 4MS3A 1EWTA 3EJWA 4RZSA 5BRAA 3KJXA 1LK0A 4RY0A 4JA2A 2MYNA 3CLKA 1DZ3A 2YHAA 3QEMA 1RZRA 1JYFA 3GT7A 1I3CA 5I4CA 3N75A 3W9SA 3OLZA 3FMVA 3IP5A 1UDRA 2FMHA 1PNTA 4FE7A 1JDPA 4RK7A 4XASA 5EWMA 3RVMA 3EAFA 4YRZA 2F8SA 4P1ZA 4WXMA 1APBA 1AB6A 5DLEA 3TX6A 1DC7A 1JBEA 4N47A 4WZZA 1H9CA 5KQGA 3A3KA 1P6UA 3C6QA 1CEYA 3JVDA 3C3MA 4G0PA 2CD7A 1JLKA 4ETIA 3CNBA 1DC8A 1DCKA 3KTOA 4MR8A 1BDJA 2JVJA 3OLYA 2WWVD 4LX8A 2QVCA 1YS6A 3HV2A 3M9XA 3D8UA 4MS4A 4GPAA 3N0RA 4N03A 2HQRA 3DGFC 3H5VA 5BQ3A 1GUDA 4G0MA 1JFTA 1RPJA 3Q7TA 4IGAA 1USIA 4Z9BA 1RZRD 3N0WA 3CZ5A 3G1WA 5DKFA 5HQJA 2CHFA 1JYEA 4OBBA 4FB4A 3F6PA 3Q15C 2AYZA 5JS2A 3URMA 3HDVA 2FQWA 5JNSA 4TLLB 4EUKA 3MF4A 4IRXA 3SAJA 4KQCA 1NXXA 2NUBA 4RWEA
chains in the Genus database with same CATH superfamily
5K6TA 4C88A 2WOOA 3C6ZA 1Q0TA 1ECJA 1TPYA 2AR0A 4J0EA 5HIMA 3N2GA 2EOAA 2QEQA 1NXSA 1JSLA 2W4MA 3ONFA 4OFWA 4OIMA 4A8HA 3ZZ0A 4DFDA 1XZNA 3IDQA 4ZV7A 3CGWA 3T35A 2VP2A 3GUYA 3D4IA 2QN1A 3JAKA 3AI7A 3IVXA 1RJDA 1XA3A 4HX9A 4Y9UA 1XHLA 5AHKA 1DRUA 4YP7A 1PW5A 3SQNA 4YACA 2HJSA 2Q2WA 4Z4HA 1G59A 2XOKA 5EINA 5A7GA 3AUFA 3A2NA 1PWEA 3TSWA 3VXKA 3HO1A 1MAHA 4F3YA 1CZKA 1D2AA 4HH4A 3S99A 3C3PA 3AH8A 3DZBA 4ZCTA 2WAAA 2ZFUA 2FRVA 2HPHA 2Q0HA 3NQ41 3PEVA 3D59A 3DJYA 1GPWB 2IUUA 1IXYA 2XRYA 3FOFC 4ZAGA 4MGZR 5CVDA 4DNQA 4MLDA 2GPAA 4HUQA 4EPWA 4GLBA 2H5LA 3EDOA 1CYEA 1Q57A 2F3SA 1HX7A 4G5XA 1BOOA 2PMEA 2WWIA 3PUVA 4RF3A 2Q8NA 4A9AA 5EE3A 3IBSA 4WXHA 2XUKA 4XAQA 5BSKA 2C07A 2VF5X 3KT3A 1ORRA 2ZSJA 2D13A 3CRZA 3ADOA 3PC8A 4LTMA 4RIFA 4C7BA 1RD4A 2VDWA 3N8IA 1XRJA 4TXJA 3ZI4A 2W6JA 5F9HA 2YYZA 1LFDB 1NJFA 4P54A 4WBSA 4IHAA 4MS1B 4DSNA 4LDRA 4LN1A 4ZQBA 2ZTHA 2AYYA 1LXCA 4KWHA 5KB3A 4KQ6A 3P2OA 4O1MA 1SUBA 2IPNA 4II2A 1JSZA 1YKGA 3C98A 4Q12A 5AUNB 4RHUA 1T5LA 2WU8A 4HAOA 3CCCA 3S2YA 5L4NA 1D2HA 5I45A 1N2XA 3O4VA 4LYDA 4B7ZA 2IDZA 3HJHA 3OBIA 3VPCA 2D0PB 3QE3A 2VDOB 5ALRA 5IKXA 3L6DA 4XZ3A 5E95A 3K8YA 1L7MA 2GZAA 2QRUA 1GAQA 1AGNA 1EHCA 3C5CA 3DBLB 2HGZA 3U9SA 1BXGA 2G4VA 3B1KA 5T4FA 2P7IA 1SKBA 1XQWA 3LCUA 3OHSX 4IZIA 1GGKA 3WKAA 4PIVA 4EG5A 4R0MA 5F1OA 3OM1A 2CVOA 3HYRA 4L5IA 5FEMA 4DQKA 1PJ8A 2V5VA 4IZOA 4DLUA 3UMMA 2WK1A 3NAZA 5FB3A 3PGMA 3NVDA 5FI5A 1IPHA 1QK4A 1IY0A 1UBOS 2IIVA 1EXNA 2RI1A 4IMPA 3DD5A 1CJKC 4QTUB 1TQ8A 1LFAA 3ZK7A 5HOEA 2W2MA 3BD9A 3HBAA 4NU5A 1WR8A 4CG2A 4E03A 4I6EA 2XB4A 1P9OA 1O8BA 2PNJA 2WM8A 3RS7A 5ESDA 4C78A 2HL6A 4UNSA 1KAOA 3B52X 5AKIA 1NZDA 1T13A 2JK1A 2ZLBA 1TCCA 3FOAA 2X3FA 3I76A 1CUWA 2KMLA 1CUVA 3DFMA 4H4CA 2JS7A 1R6UA 3QWAA 3DULA 3PVCA 2BY4A 1FSSA 4X20B 4QUKA 4HDNA 3RK1A 2VF7A 1AUOA 1XEWX 5FLKA 1E99A 4C89A 2GJSA 4UMVA 4PBRA 3REQB 3WB9A 3V80A 4QQFA 2OB1A 2YBDA 5DX0A 5BQ5A 1QP8A 1UP7A 1W8DA 1Y7HA 1NVFA 1EAMA 3CNOA 3DV0A 2I2BA 3NANA 5CFNA 2YN4A 3IAM6 3GVCA 1KORA 1FK8A 1IUKA 1NBAA 2QN2A 2ZSFA 5IP5A 3B12A 3SBEA 4WA8A 1SA0A 3LPNA 3EN0A 4LJKA 2QRVA 1UMBA 4KRYA 3DBHB 3K2QA 1EK0A 3W9UA 4AFNA 4NCBA 4XYMA 1NM5A 2ZRFA 1KP9A 2I4LA 5A3SA 4BFWA 3K92A 1I1QB 3PF8A 1ZY2A 4RJ2A 4M1EA 1MJGA 5FFMA 4DC0A 4Q3EA 2OXRA 1LPNA 1G4UR 2GLUA 2VTVA 3JD3A 1SBCA 2EGUA 1CVIA 1E1NA 1BG6A 1X14A 4FT4A 2CXUA 2HQOA 1QLJA 2DHQA 3UAZA 1AKEA 1ZP6A 4TM7A 3W8EA 3DWEX 1J8VA 4L8GA 2GJ8A 1HYEA 3GEHA 1YMQA 4G8DA 4R01A 2OQVA 4CT4B 1XKXA 2GCOA 4RTQA 3S28A 4LRSB 1N5RA 2RB4A 2OOSA 2H1SA 1U9IC 2GZ1A 3GT3A 4OKSA 1QNFA 3L46A 5B12A 2HK6A 1E61A 1GPAA 3D0RA 2CVZA 4RFSA 5GOZA 1IOVA 2O3TA 3E2PA 3OPNA 1KZ1A 2E21A 5AI6A 1TUBA 3JWPA 1D9XA 3AUTA 1KS9A 2H2FA 2I1WA 2ONZA 2QI9C 3S2SA 1ODJA 3ZCRA 3D4BA 2CVHA 1ZHFA 5F64A 1U9YA 4AXBA 2GN6A 1ILEA 3DH0A 3N1UA 5BPFA 2PLAA 5HG0A 4DV3B 5L3SB 4E2YA 4L95C 1PT7A 5E7QA 3ZIDA 3O4HA 5BN1A 1QPZA 5HMMA 3GLQA 1Q0UA 2WSBA 3B8HA 3VNSA 3F8WA 1B6GA 2PCLA 2FPIB 1Y8ZA 821PA 1OWLA 1ZOLA 3E2MA 1D04A 1GPLA 1M76A 3EZ2A 1QYCA 2R6FA 1PD1A 3LMKA 3WIBA 4BQNA 3LCMA 3SF8A 1AJEA 3PU6A 3H7AA 3ZQ6A 3ZHVA 3HSSA 4R2WA 3QQPA 4REQA 5F4BA 4RD3A 5GVRA 4BX0A 1XMQB 5E1DA 3ZDCA 4ZVKA 2HSWA 3L7NA 4HI0E 4CZ2A 3IVAA 4WESA 1ZUWA 2V55B 3MK31 3LQ2A 2VPTA 4JJ4A 2X5KO 2H1OA 1MTOA 1N1DA 2FEMA 2ISSD 3ABSB 3IPYA 4WY8A 4DY6A 1NXQA 4MW2A 5DGTA 3GT4A 3KVVA 3Q87B 4JU9A 1SCUA 2GVDC 5GM2A 3NBQA 3QX9A 4KLCA 4MQLA 5JMTA 5GIOE 3AJ9A 2OHHA 4G25A 4LXIA 2VJQA 3MQ2A 4KUEA 5TGZA 2HLDD 4PGGA 4CQLA 2CVPA 4LF5B 3DE4X 3AHEA 1B6SA 1PTKA 1Y3CE 1U2RA 1QZUA 1UWVA 4L08A 4L8WB 4NJEA 5EJ5A 3E70C 4PZYA 4L7VA 5JISA 3TINA 3BE4A 1AX9A 4OI2A 3RVDA 2X6TA 4EL0A 2Y4NA 4HWRA 4Q3OA 3AKCA 4QXPA 3JCZA 4QLOA 3LF1A 2JLVA 2IEAA 3AC0A 2NUTB 1X9GA 1Z83A 4RD0A 1HV8A 2J48A 5KQPA 3E3AA 1JEAA 2E48A 4JUAA 4RE6A 1S0UA 4W9RA 4N0EA 4YI5A 1YOBA 3KWLA 5EL0A 1GYQA 1ORHA 4LJSA 2GAOA 5GAJA 4KR2A 2CHGA 1KSFX 2YWHA 4FJ1A 3E3LA 5AUPB 1C9NA 1E0AA 2WU4A 3MTJA 3UIEA 1SVOA 2J5BA 3DYBA 1IVSA 3I1FA 4ZT5A 2EXXA 4DJTA 2ZUWA 2QLFA 4FFVA 1ISGA 3I8OA 3ZXUB 1KEKA 3QFHA 1TCVA 4H7IA 4GDMA 1UCFA 5EJGA 3MS7A 4A36A 3ED1A 2QUAA 2DFVA 1D09A 1HL7A 1P80A 1F6BA 2EQBA 4F56A 4DJAA 1Z6YA 3C5WP 5FTMA 2GZSA 3NGLA 1JHQA 2WV9A 1VPWA 4J91A 1GTMA 3D2CA 3L7CA 3UOGA 2WJWA 3GGDA 5DGDA 3R5FA 4YJ3A 4QYTA 8AT1A 3PA6A 2CD9A 4RLFA 1QV6A 2Z4RA 3KT0A 3K5PA 1VMKA 2BEKA 4S1NA 4Z3DA 4H0CA 4CL0A 5ILOA 4K28A 3QLVA 1K9VF 3PC3A 4UE2A 1T6XA 2PS1A 5JSZA 1VHTA 3RBAA 3VR6A 1W4BA 1G60A 1ISJA 3RWBA 1QKKA 2R97A 3OZGA 5KTSA 2AEEA 3VNAA 1EK2A 2DVMA 3E7FA 4MR9A 2DP4E 5TEWA 3IAUA 3TLYA 3V2UA 1KC1A 3UCEA 3D3JA 5FWXA 5JS1A 1B6TA 1YDEA 2EW8A 2FWBA 2Z8XA 3OY2A 4N5NA 2H5IA 2XNCA 1N7GA 3IEIA 3DB1A 4BNNA 4XQGA 2JANA 1JA9A 1KETA 1SBYA 1HM5A 4G01B 2YOHA 1EFHA 3R9KA 3TE6A 3TTTA 4OY3A 5A06A 3QG1A 4JUBA 1F4PA 1PJBA 3LLCA 4RW0A 3TZKA 2GO7A 1LSJA 3F6YA 1U2EA 3ELYA 2CCGA 3OAAD 4I9UA 5IVIA 1TGVA 3LHIA 4HDMB 2VTBB 2P4HX 3QUTA 5AWFC 3IMGA 4IP0A 2OPBA 2QAJA 1KDPA 5AJHA 4AQYB 4CEHA 2A1UA 1JQAA 5DT2A 2WSYB 2GJ9A 1N36B 4EJ6A 2ECOA 2PZEA 1M1YE 2IU3A 4AMUA 1N77A 3X1YA 2EP5A 1WJGA 2OZKA 1RI1A 2OV4A 3MTDA 4PIMA 3P2KA 4D0GA 5AP9A 3L6RA 3UCXA 5BOSB 5L7WA 1L5YA 1CX9B 1Z3IX 3SEQA 3ZCTA 4TQAA 4B3DA 3GJ8A 1RE1A 4J2HA 1OXSC 4GMGA 3S40A 2ZYVX 3UAOA 3U60B 3JR7A 5EIEA 1K8QA 1MC8A 4IDHA 2AFIB 3CZ9A 2W42A 3P7MA 2HZ7A 3AY6A 2FE1A 4KFTA 1ZSNA 2Q8PA 4D8XA 3FSGA 1UPBA 1E2QA 3BQMB 3SC6A 4GOND 1NRJB 2IXAA 3L1JA 1S2OA 2QKYA 1QVRA 2QORA 3CZRA 1PJ2A 3GN1A 4BCDA 4UNIA 4RZXA 4KNYA 4Z0TA 3HDYA 2PBRA 5DI3A 2O20A 3A4MA 4HNAB 4HATA 4JL5A 2XMBA 3OT1A 4RVFA 1RADA 4GVLA 3T7RA 3VH2A 4ESVA 3PPXA 2JPDA 4FFBA 4TQ9A 3EIFA 3ER8A 1RLUA 3R3WA 1O95C 5TE9A 5JCJA 3VDQA 1UKCA 3RQSA 1XIVA 1Q95A 2H1CA 2PMBA 3BICA 3CPJB 3LK7A 1DBPA 3MWLA 5FOVA 2YH2A 4U6QA 4L4UA 3D6TB 1YS2X 2PUDA 3F4KA 2C5BA 2CK3A 3E1KA 1YS4A 3QUAA 3JQ7A 2DQYA 1DWQA 4AT1A 1XMVA 2P9JA 1YONA 4RL6A 5CNKA 2JGAA 1SZCA 3F1KA 4LXUA 4P4SB 4AJNA 1NQWA 2WJ6A 1HFJA 2R6DA 1HY3A 1GGNA 2UUPA 2X7JA 4RZ2A 1GGVA 5ALPA 4CLHA 3WO0A 1TIPA 2EEPA 3UAVA 2EX1A 1CQXA 3QKIA 4RAOA 2OK7A 3UV3A 1XEFA 1PJ4A 2XY4A 1EFVA 4ND4A 1KO8A 1RAGA 4R2IA 4CF6A 1QQAA 5A3RA 1P77A 2JJ8A 4HKTA 1F14A 1H66A 1FXWF 1O96A 4IHJB 4QUDA 4RHXA 1GZDA 1M72A 3CV3A 3CVUA 2NT4A 4KDFA 2XMRA 4HDOB 3NCHA 4O4IB 3IT1A 5TJ9A 2YN2A 3EFBA 2PSJA 3R74A 1QGAA 2FNAA 1XTJA 3LX6A 4HUTA 3RAFC 2J9FB 2X9GA 4N65A 4F1KA 4L5BA 4R1TA 5KTRA 2GGSA 4PTYA 3PJGA 1R74A 2EKLA 1RWPA 3KR1A 2HYIC 1O4WA 2ZWIA 4QU5A 3ABZA 2QT9A 2HRCA 2RK4A 2PZ8A 4LRUA 4NZYA 2GEDA 2H92A 4K2HA 4M53A 3WGYA 4E2XA 3F47A 3EDYA 4IUDS 2WU1A 3PXGA 1A8PA 2PX2A 5ITWA 3RBVA 3FB1A 1T2CA 2EFDB 4L4XA 5K6AA 1AMOA 4XH9B 1JR4A 5K0ZA 4DLWA 1RQPA 3BQNB 3IP1A 3OJOA 4LJ8A 4GX2A 1M1NB 2RI0A 2DKOA 1DKNA 3QTLA 1Y6GA 5BT8A 3SVTA 4UDYX 4XVHA 3T9AA 3Q8LA 8LDHA 2XE7A 5CPFA 2VPPA 4JBLA 3IQGX 5J4HA 5JOQA 1ESMA 3K2EA 4EGFA 3AF4A 3SU8A 1DPGA 1U65A 1JAYA 4ENPA 1Y3FE 3E22B 5CDFA 2PS0A 1KZHA 4COOA 1IAVA 1KPHA 1HETA 2Y1KA 1GKKA 4KFUA 4V38A 1I01A 1I2MA 3DMDA 4MW6A 4F4FA 4A03A 5IJZA 1NYQA 4H15A 3ICWA 4BMZA 3K70C 4LSGA 3N75A 4PBTA 4FWIB 4L8YA 4KZPA 4CM9D 3P1JA 1QLWA 2VWGA 3DOOA 3EPKA 3DZGA 3FNEA 4HAIA 4WXMA 3H2SA 1QHSA 4OHYA 3PGKA 4E51A 1D6JA 2BI4A 2V6BA 2HK7A 3NHSA 4O8ZA 1RBMA 1ZRHA 2Y9MB 4FFOA 4QUBA 4V39A 1JMVA 4E32A 5C1DA 4QYSA 5JZSA 3EVEA 1ZEMA 1HDRA 3H19A 3K0FA 2FCAA 2NVOA 4QHTA 3EVGA 3RU7A 4C6TA 2ZIAA 2OZEA 4XWAA 3OA2A 2UAGA 3PUJA 1CIJA 2F6RA 3KQSA 3G9UA 1R0WA 3HKBA 4JU8A 1L5LA 3FR8A 3GQVA 4PS1A 2GZMA 2JVJA 5GJBA 4MS4A 5L51A 1E1QA 2GKSA 3N0RA 5HTKA 3X1WA 3GLKA 4YHBA 4BO0A 4BX3A 5KBYA 1UXHA 3DAGA 1SC6A 1EHIA 1GUDA 4DV6B 1RVV1 3H8JA 3M5PA 2O8CB 3Q7TA 2ZETA 4R54A 4HGZA 3N0WA 2C94A 2QAGC 3RIGA 5FNZA 2VTKA 5CP8A 4MRVA 2UZIR 4G1BA 1PSWA 3DHVA 2H4XA 2Q49A 1N8NA 3CBGA 4OJNA 1Z36A 4R1MA 3ZN2A 2P6PA 4BNDB 1Z29A 3Q3IA 3RARA 2SBTA 4CKCA 4ZQFA 4KUGA 4UU1A 2CV2A 3MF4A 3LVBA 2O8EB 3TRHA 1L4EA 1UM9A 1Q0SA 5FOTA 5DHSA 4FYWA 3RO7A 3IA2A 5K8IA 1D3AA 4QXOA 3RVJA 5C2JB 3QVUA 2YMMA 3EZYA 1XZJA 1ISIA 1C30B 3AM4A 3KSBC 5J1SB 1T9HA 3G5TA 1PR0A 1S9HA 3ZCQA 1BJTA 3JQRA 3VR0A 1IM8A 5TVKA 1E6CA 3SZMA 3TNYA 5DMXA 5KC8A 1HTTA 5KWJA 2VAPA 3N0VA 1NHWA 4P7BA 4QFCA 4EKGA 4DHEA 2JD2A 1T6NA 3LKZA 2XQIA 4D4GA 3OPVA 2C1ZA 4R8LA 3Q3VA 3QW4B 1OH7A 3DNPA 4I55A 2Y0PA 3QA3E 3NC4A 1IEWA 5E1OA 2OGZA 3KD3A 1CRQA 2QJWA 3H6KA 2GEVA 1OFUA 4RFVA 1W9MA 2R9VA 3ND6A 1J7KA 1IRIA 1BW9A 1UJ4A 4OA8A 1OLUB 3BSSA 2IPAB 4M0UA 4TSKA 3UJNA 3TLXA 3GLUA 2IS4A 1ZKDA 3TMYA 4BLSA 3OO0A 2YDYA 5CD9A 1VLHA 3AVXA 1FFXA 2J41A 2YIVX 2XA1A 2W6ZA 3VO2A 3C97A 4O4IF 5KKNB 4CEJA 4LX0A 1RAEA 2AEFA 5JPCA 2VBIA 2YNMD 2H2IA 2ZJ3A 1MO3A 3FB4A 3BDAA 1ZA1A 4OHUA 5EWLB 2XT6A 1YASA 3EQ9A 4P31A 3ZE2B 1OTHA 4FONA 4GVPA 1V26A 4IDOA 4B6OA 2OZLB 4Q9JA 1YR8A 1FFSA 3WLQA 1VZ2A 3ZNOA 5CG2A 5HM6A 3WGLA 4EYKA 1MZPA 4JJEA 5LN1A 4RIHA 2IS2A 3V8PA 2SKCA 1ZJ4A 3GPBA 1RWNA 2V1XA 4TQUS 1C8KA 2ETXA 2Q4BA 2J3QA 1YL6A 5C80A 1SUFA 4AAYA 2R84A 2XRFA 2L19A 3IJEB 1SVKA 3GRFA 1ZVKA 3OCJA 5JXGA 3RSLA 4FQ5A 1PJQA 5D51S 5EWMB 3VVMA 3FNQA 1DIAA 4L5JA 3JYNA 4I6GA 3S8MA 1QP7A 3DSRA 1CNMA 4IJ5A 2BP7B 2WT8A 1WCXA 3LCCA 5EIAA 1P3DA 3RRXA 1U9ZA 2QZSA 2P4EA 3SC4A 2ZTVA 2QTZA 1GEEA 1NFFA 4X24A 4QELA 3AMVA 2C92A 5A6VA 2ZBFA 1V7CA 3H1EA 4LJ5A 2X0DA 3TBHA 4DCJA 4E1AA 4YUYA 1EXDA 2NSJA 4MA5A 2Q07A 5FV4A 1F5NA 5KVAA 4RKRA 5KX5B 2P0YA 3F49S 4B6EA 3COZA 4IX1A 2W11A 1SXQA 2GUGA 5B1IA 3IAXA 4HXGA 1YB2A 2ZW9A 2R48A 1T3ZA 2IZ6A 3TNJA 4ENWA 1I3MA 2AN1A 2RDMA 1R3UA 1GUFA 3AR2A 3IOMA 4HFJA 1ZUNA 4OREX 3LWZA 3DL0A 3LLMA 2IC5A 4A7PA 2V6IA 1GRVA 3E5MA 4QPZA 4UEOA 2Z98A 4TTRA 1A50B 2WD9A 4PM4A 4FS8A 5J1TB 1CZHA 3ZD8A 1QG0A 2VHZA 2QTBA 1JJ7A 1VLJA 2YYSA 5NLLA 2AEMA 2G82A 2M98A 3HXPA 3G0BA 2JAOA 4IDBA 1P1BA 3IQEA 3TSCA 2C04A 2E4ZA 2O0MA 1NDHA 1IDOA 4WJKB 3QE2A 3PQCA 2WJIA 3EZXA 3QKSA 2WR8A 2FPSA 2O2EA 2I8LA 2H3HA 4BV3A 3EWAA 2DTXA 3QOFA 1PLLA 4B79A 2YJGA 3H1FA 4XRRA 1VL0A 2WOJA 2EF0A 1XZCA 2OSBA 3LLUA 4UHHA 1VECA 2QRJA 4BO2A 2A4KA 2VCEA 3GIDA 4MV4A 1NAHA 4R1OA 5LB4A 1PFYA 1QLHA 3MC1A 3LT2A 5IH7A 2GFIA 4IJVA 4Q3AA 4F3CA 1LJLA 2KS6A 4UNRA 3QY0A 1C3VA 1TKAA 2WVHA 1NPTO 3DEJA 4D74A 1V9LA 2I22A 4JSTA 4UCXA 4YJGB 1Y8CA 2X0RA 3E61A 5JAQA 2WHEA 1Z5NA 4NECA 3JVEA 1J0CA 3TYXA 5AI8A 2C2MA 3K0BA 3W6OA 3WLTA 2V59A 3EISA 5LQRA 4ZT7A 2R8EA 9ABPA 3KU1A 3J81A 3IP3A 1EXMA 1MV8A 2A78A 2Y2VA 3K1TA 2CSXA 4QNMA 4WERA 1JEQA 5FL7D 1W59A 4DSZA 1GDTA 5BVHA 1LGYA 3S1SA 3P0JA 2NUPA 3O74A 3TZLA 5KSZA 1IEQA 1N6HA 2CJWB 3QE9Y 4KYVA 5JCZA 1JHPA 4OQDA 1E1YA 4BQSA 4GU5A 5LYJB 2C42A 4MUXA 5BORA 2NXCA 2P5TB 3HCOA 5JCPA 1O9HA 2WU0A 3DMPA 3ND9A 3LT0A 1IUNA 4QBKA 4QOEA 3ZHOA 3A9TA 3VMMA 2B1GA 4IINA 4KMOA 7GPBA 5IXJA 5FHRA 3GLGA 4BFSA 2PU5A 3A36A 3BB4A 3C85A 2RCNA 5LXTF 1QQTA 1TI7A 2AKYA 3HVKA 2OO5A 2A1TS 2BJHA 2QUBA 3HCDA 4PZ0A 5H3LA 4QDKA 3E5HA 5CTJA 1LRJA 4HS4A 1JXMA 1OFVA 2B83A 1R6DA 5GADl 1IZ9A 3KG2A 4R9RA 1E7YA 2A1IA 5K0LA 4R71A 1BWSA 3R5XA 4J3FA 1E92A 4FZ3A 1FLNA 2QT0A 1HE8B 2DH5A 1QE3A 1SKMA 2GM9A 1TPZA 1TM4E 4GDFA 3ET5A 2ERYA 4ZCRA 2WG0A 1QS0B 2BFEA 3HC7A 2ZPTX 5CK4A 3DE6X 3FOCA 3D4NA 3ECSA 3VYWA 2MSLA 1C5KA 4WBXC 2X9NA 2GK3A 1Q1NA 2IHJA 4GXNA 4OHWA 4HNQA 1E5DA 1P4RA 1ZIXA 3ZXXA 1TK2A 4AKSA 1ZIPA 4O2AB 5AO9A 3L4SO 5DK4A 4JLDA 1AUPA 5A4AA 1NOKA 2O1WA 4KVFA 4PU0A 421PA 3I64A 3GWGA 4YNBA 1RXWA 1U4OA 4BNIA 3TE7A 4QULA 3FUTA 4DDUA 5JS6A 1D4AA 2I6TA 1N3YA 3WK6A 1G9SA 4G86A 4RMHA 2WJVA 4BGIA 2JBHA 5F12A 2QPOA 4MB6A 1LPOA 2Q99A 2BD0A 2QDXA 3A0RB 1NSYA 2Q1TA 4US0R 5CB4A 3PDIA 2CFSA 5H1YA 2MYUA 2QYSA 4RVGA 1ECBA 1JFLA 4RHYA 3F6BX 4L85A 4L57A 4Q7MB 4U9IS 3JD2A 3FFWA 1XZMA 4YP5A 4QUAA 4ARBA 1P33A 1YI0A 1BHQ1 2ST1A 4DWVA 1QP4A 4N01A 1DQRA 5I48A 1BE0A 3VJRA 4LISA 1JKMA 1TL7C 1E2LA 1TK3A 2RBEA 1VCMA 3TCKA 2R96A 2XUGA 4ALKA 1MOSA 3K9WA 2LE0A 2QE6A 4FSHA 5C8YF 3CU5A 4MB0A 2ORIA 4QJ4A 5LP1A 4DLVA 1WKVA 4RNCA 1GLVA 2PRYA 4HQLA 1XVUA 2PMCA 4Q3CA 5JSKA 2VRCA 1ISFA 2J31A 4L6CA 2KM1A 5EIWA 2DERA 3AEUB 4C0BA 1GSAA 1NN0A 5ELXA 1W5BA 2NV0A 4Y6SA 2OSVA 3IIKA 4BJ5A 1XTZA 1JZSA 2WAOA 4XM1A 3TLZA 4RTKA 2DBVO 5JRDS 4OVKA 5LBTA 2NTJA 2O07A 2ZIGA 1E96A 3BF8A 5JSHA 3M4JA 4NL4H 4R6XA 1XDBA 3OM0A 4UUBA 3OURA 2PXAA 4FYKA 3B38A 5IAGA 3AL0C 1G98A 2P5UA 2CB9A 4EF4A 4LYJA 2FZ5A 4X94A 2EBHX 4YTEA 3VC7A 1JVNA 1FMLA 5JO0A 4I1OA 4WTOA 1N7HA 5ENDA 3V4PB 4JI4B 1WXFA 3IO3A 4WUTA 4OX9Y 3CKKA 2IVFA 3CZCA 1FDVA 2FPMA 5EI5A 1ZJZA 2VJCA 4AK9A 2QL6A 1UODA 3UWDA 1SNYA 2JDIA 1T5IA 3RVNA 5DTRA 4YMGA 4E21A 2O8FB 2IV2X 1C7JA 3FG9A 4X71A 3Q6NA 3JALA 4QYIB 2RH4A 1H5UA 4P4LA 4HYYA 1NE2A 4PCVA 1T9ZA 2EKPA 3JQQA 2GEBA 1T1RA 2PT9A 1OAAA 1BZYA 3RAJA 4BTVA 3A1CA 4EW3A 4PRZA 1C8LA 4JY7A 5FOXA 5FA6A 4AMBA 1NUSA 3DG9A 1L8OA 1TF5A 1Z07A 1F7VA 1YNOA 1OQAA 3AXTA 4MUEA 5J5VA 5E9QA 2VZEA 5FBQB 4Z53A 1P74A 3HY3A 5LYJF 4E46A 1BHO1 1IIRA 3HL0A 1W88B 5DXJA 4FB5A 4R16A 4MULA 1J25A 3IT3A 3WBKA 4L27A 5DTIA 4PSUA 5J43A 3NUQA 5HCUA 4CLOA 1V39A 1NJ1A 1R4NA 4WL0A 5DNCA 2VRBA 4KDCA 3OQOA 3CINA 1AGXA 1U0BB 1YL5A 5EQDA 1GG9A 1KFCB 1OBCA 4GLFA 3X2EA 1K0FA 2YHUA 5B53A 2CF6A 5HZMA 3GLFB 2QG6A 4HZIA 2AW5A 3I2YX 1DUVG 4JLAA 2WTBA 3O8CA 1E89A 4GQAA 4DMRA 2H2AA 1XYVA 1Y7PA 4Z4GA 5DNEA 4C04A 1PWHA 2G8LA 4QQ8A 1QWSA 1X70A 3E05A 1U7UA 1V1RA 4GQIA 2FPPA 4QOGA 2IPOA 5LQSA 5KQLA 1B74A 3DOCA 1JPNA 2C7QA 3OG9A 4YDSA 2I4RA 4YT5A 4TKMA 3DDZX 4X0EA 3LA6A 4Q1VA 3GQBB 4EDHA 5LP6A 1PK9A 4YMWA 3UYLA 3WK8A 5DYNA 1U02A 2AHOA 2E1PA 1A4UA 2V7UA 1S2LA 2CNLA 1NY5A 2JI8A 1C4XA 3NAGA 2AX3A 5EXXA 3PEYA 3HRIA 4X1OA 4P83A 1ESCA 1O6CA 3QBDA 3TQCA 1M2KA 1TO1E 3MFQA 4C0KA 5BXYA 2P9FA 5KSWB 4YLEA 3HUDA 4R3WA 4MI1A 1E6WA 1AQYA 2I3DA 2QOEA 4PCLA 5CLLA 3TW4A 4RADA 3G8AA 3P9QA 1WBBA 5ESWA 1JT9A 3ZY5A 4Q4DA 2G25A 3SVZA 4WBNB 4DA4A 3VZBA 2DHEA 1TGYA 4QLAA 4R9SA 4YPVA 5C35A 3A4LA 1OHHA 5K0GA 4G8JA 2FG5A 4U3JA 3HPRA 4CR7A 4KMRA 1EEHA 1F2UA 3VDXA 5HKKA 2Z83A 3QJGA 2Z9DA 4WZAE 2Q1XA 3AGQA 3EGWA 3KB8A 1Z6PA 3D9QX 3U4HA 4DV5B 2XGOA 1L7RA 1NBME 3P9YA 2R6HA 4W8OA 5JI2E 1E3SA 1VHQA 2JGDA 4BMVA 4KBGA 2B4AA 1T36B 3I5XA 4PZUA 3QKWA 1WCIB 4L5AA 1VMEA 4F46A 3L07A 5E9WA 4INJA 5FRDA 2CUTA 2VKQA 5EYPB 1VYUA 1OILA 1HT3A 2YYYA 3FGOA 5AOCA 2VDRB 3I39X 1ZMBA 3EGVA 5G41A 1BX3A 4EPYA 4QVIA 4QG7A 5E2AA 1ESDA 1GQSA 1IHXA 3L05A 2O8VA 2M6SA 3BD6A 1JHRA 4CQNA 4DR6B 4EG0A 5JI3E 3K1ZA 4LA4A 1I3LA 3UJHA 1NM5C 1PS8A 4OJYA 2D5LA 3I45A 4F5DA 3RC9A 1IG0A 1Q50A 2R1VA 4ZPXA 4YMSA 1GQFA 2XCTB 2CBGA 3K6SB 2JH3A 2Z57A 3V4LA 4IO1A 1J8DA 1MPXA 2BGNA 2HHAA 5C5IA 1QIGA 2FH5B 2PSEA 4IF4A 4ZI7A 2HQSA 1CIVA 3AR4A 3FCEA 1X80A 3WWOA 3DE2X 1X9IA 3ANYB 3HV0A 1KPIA 3DDNA 3I3OA 4QWWA 3RKUA 4G1EB 3NHMA 4CTJA 3EY4A 4WECA 4BB9A 5AVSA 3UA3A 2V74B 3OZUA 3SZRA 4E2ZA 3U48A 1SG0A 1DQYA 2JGNA 1NP6A 1Y4UA 2GXUA 2F67A 3GYGA 1E1RA 3EBLA 3LQKA 1OX5A 5BWBA 1JRLA 4KYIB 3F74A 2E7ZA 1R0XA 3EJWA 2M6KA 4C5CA 1O5IA 4RABA 4PC7A 5CU7A 4QJ3A 5LM3A 3ZU4A 4H7KA 3UMRA 4EFDA 1OXVA 1XVIA 4R51A 4ZO8A 1TQ2A 1JYFA 5EIFA 3ZKWB 5ERYA 1TMKA 1ENYA 3V00A 1T3GA 1I3NA 1CFJA 2NTYC 2YHSA 2ZSHA 3OLZA 3OE5A 5B1EA 4EO4A 2ZDHA 2IJGX 1D2RA 2JEOA 2RMKA 5D85A 4P86A 4H77A 4YJ2B 4HN9A 3EFHA 1GN8A 1EP1B 3JV7A 4LS3A 2CUKA 5IVDA 1O7JA 3JWGA 4LDNA 1R5BA 4ZHQA 1G6HA 3QVKA 2QW0X 2D7JA 1ZCJA 4J9VA 1WUTA 4B75A 3DHNA 4TWIA 3E53A 3FOEC 2BM8A 3ZJ4A 3DYVA 1WIWA 3SZOA 4BFYA 1N8TA 4RLHA 4R3UC 1MORA 2P5YA 4YAKA 8OHMA 2NAPA 4MVJM 3CEAA 3D0OA 1YHYA 2XUIA 4I7EA 4N03A 5E6UB 3ENZA 4BQRA 4TKVA 1JG2A 2NXJA 4URHA 5KWIA 3AWDA 2YWRA 4QDZA 3ONEA 4TTVA 1XDGA 3DDOA 3L41A 3PL5A 1GR1A 1V8PA 4JYZA 1JFTA 3RIXA 1TT7A 4JXKA 4LJ6A 4YCMA 4J0FA 5JCXA 1XT6A 3A6PC 3HDVA 4DJJA 4AICA 5IS2A 2FPLA 4FFDA 4ALMA 2CZCA 2JGMA 2BEWA 1CUDA 4L75A 4AJ9A 3FHJA 4MQBA 3WRXA 5AIBA 1BWPA 4P4TA 3G82C 2G80A 3U0VA 4M0CA 4K81B 2DJ5A 4N7MA 1W76A 1ONBA 1W48A 4PG7A 4ZP1A 4D4LA 4DVJA 1M5TA 3MIZA 1GPKA 4E94A 1GUZA 5T8KA 3KSZO 1Z26A 4HAWA 1KJIA 1SOUA 2ZOSA 1CY8A 3EWNA 4IH4A 1G5IA 1AKVA 1MHPA 1PWXA 3BH0A 3DB2A 3P9IA 4FW9A 4G89A 4WK4B 1AGRA 2V9ZA 1EGHA 1U7WA 2A33A 3B13B 3BXHA 1J5EB 2QUJA 3FF4A 3OJLA 1A2KC 4IH9A 1D9ZA 2N1MA 4YUAA 2HIAA 2ZSBA 3ITEA 5LWHA 1GV1A 1VYTA 4FP9A 4OQFA 3PFBA 4IRMA 4E3ZA 4I1IA 3QNMA 4JYCA 2CYAA 4DCNA 5LQCA 1DG9A 1RJ9B 4B4OA 2HI0A 3BCSA 3EWIA 2ZRGA 4JJ8A 4MVJI 3PNPA 4ARVA 4A10A 2JEZA 4FIZA 2PDAA 3D3WA 1Q5PA 2BZ0A 4KN6A 4PEVA 4R69A 4RWZA 2E4XA 4X8HA 1LNZA 2WSLA 2VUUA 3DW1X 5I47A 3QJYA 4U7WA 4BKQA 1GZ3A 4KXVA 1V9CA 4J0QA 4XKJA 1GTL1 3B53X 4D9GA 2CUNA 5KNDA 3WO1A 1RLJA 2WVGA 5KYXA 3U1TA 4MDEA 1HDGO 1RWBA 3BGOS 1QP0A 4MKFA 5AD1A 1SIUA 4HBZA 7ADHA 1A7AA 1QE0A 3A6ZA 4W5OA 3UMVA 2FSVA 3MFYA 5D87A 3A2LA 4QGBA 4L3VA 1FQJA 3AIOA 4NEQA 1QTIA 4TVKA 3NGXA 3SDZA 3QLVC 3MERA 1JJVA 4RJLA 4IILA 4LXHA 4EHNA 2GHTA 4B32A 3E58A 1JECA 5TPZD 5L40A 1JTFA 1KO1A 4A15A 4V0MA 4AMZA 3NRJA 3QX3A 1QZTA 3PNKA 2CMDA 3W5UA 5B57C 5JNTA 2DE0X 4PIPA 2BT4A 4CMEA 4M1QA 4RPJA 5KTTA 1Q2XA 3HMKA 2XCLA 3BGSA 3SYLA 3PHBE 4I8XA 1TA0A 3KKOA 2ZS9A 2EBUA 2JAQA 4UE6A 1PGOA 3TLMA 1YQEA 4B83A 2P41A 1Y9ZA 5IZCA 4DMHA 4X64B 2Z6UA 4KJZA 1PS9A 4URFA 3MWEB 2VQSA 4R2HA 2N1BA 3OQNA 4F96A 1DO0A 2V5AA 3JQ8B 3ETNA 4TTJA 1Y98A 5BYJA 5BN3A 5A2QA 1WBDA 3PFKA 4MZXA 2OG1A 3KQNA 1NPDA 3UJ8A 3VR6H 3LO8A 3SNKA 3RTGA 5IC5A 5SY9A 1J8FA 1PNVA 5DNAA 1LV7A 3G0OA 4PLGA 2WNSA 4WLFA 4YJ2F 3VZDA 1US8B 3EGXA 3KOOA 3QV1A 4O4HF 1J07A 5TT1A 1I5OA 3AVWA 1PZGA 2JK0A 3AJDA 3CZMA 3N9IA 1VKZA 4I8DA 1HEIA 2Y1GA 3LUBA 4OG2A 2PPLA 3B1WA 1RLIA 1VLZA 4JELA 5DJ5A 2DH6A 2CSUA 4JI3B 1Z17A 3HU2A 4C1NA 3T8YA 4HH3C 4WINA 3QKRB 3GH3A 4ITVA 2JLYA 3RSFA 1F51E 2QE7D 4MIOA 4RD6A 3KAPA 2CWDA 5IDVA 4HV4A 3GXBA 3V4ZA 2IIQA 5CFRA 3RBXA 3FFAA 2GR9A 2PFSA 3KUUA 1FNDA 1P6XA 3WLOA 3ANLA 4C5AA 4DWJA 4AY6A 5LQAA 4UTPA 3EPPA 2FZGA 1OBOA 1MO5A 1TZKA 2PX4A 2R5WA 1Z7BA 3PK0A 3ZHCA 2IH4A 4NMMA 3HCRA 1GUBA 1NHGA 2PYZA 1F4LA 1AGPA 1Y1TA 4C0QC 1GNRA 2GPJA 1CYDA 2J59A 4IG9A 1V3UA 3W5AA 3AFOA 5DHTA 3RNOA 3KQLA 16PKA 5K8CA 5LUAA 1T4GA 2G6TA 2W8BA 1JJBA 4GSLA 3ZCVA 1C3JA 4BEVA 4MI3A 3ACBA 4AZWA 4Q48A 1EBFA 2ID4A 3LCJA 4OU4A 3RIEA 1G20A 2RHCA 3TEFA 2NYAA 4QE3A 3N6VA 3UB3A 1BMQA 4PRKA 1OB5A 1H5QA 1K7YA 1AQUA 2EIXA 3GCGA 1XI2A 5AMXA 1HE2A 3I9V1 3W8DA 4BBPA 1YA4A 4N48A 3L0ZA 1RYYA 2FSHA 2L2QA 4O5AA 4X61A 2ZATA 1OU4A 5FPYA 5LL6P 1RZVA 4CUZA 5KIAA 2FWAA 2EGHA 4A1FA 4XYGA 2GSDA 5A0FA 2PUBA 2B78A 3EMVA 3HZRA 4PZZA 2ZUBA 4ZIRA 1TZ2A 4TMFA 2PAFA 1W1UA 4WHMA 3ETDA 3EXFA 3FTFA 1KIAA 4O1HA 2ZWAA 5KYGA 3RV4A 1SZPA 3PHCA 2CDNA 3ZLBA 2W4QA 2J5KA 3H6GA 4EHAA 5JXIA 1Z0FA 1V41E 4DB4A 4XPIA 1KFKB 2J3IA 3DLTA 5ALJA 5COBA 1L7OA 2FXIA 1R0CA 4KRXA 4QOJA 5FPKA 2CV1A 2NSLA 5HYVA 1XCJA 1HMPA 4NZOA 3CGGA 3DOUA 2D0OB 3BBPA 3O2NA 2AG1A 4R8KA 5AH0A 1OX4B 1W25A 2F4NA 2IHBA 2VAXA 1GFWA 2ABWA 2IODA 4G4JA 4JLSA 4JEMA 3VKUA 3KHUA 3OFSA 5SY4A 1BDHA 4G1CA 4OQPA 4RYLA 4YDQA 3V55A 5BR7A 3ZBPA 4WZBA 3VA7A 3GJ0A 2QTMA 4UQPA 3UAYA 4LNHA 1ZMTA 5K6AC 1DVRA 1H9BA 2IE8A 4H1VA 1YQQA 1DMSA 1E32A 1MBZA 4WFIA 1F12A 4KSYA 2NPFA 2BR5A 1GRRA 2OMEA 4D5EA 3U4CA 3O1LA 3T1VA 5F7XA 4PANA 1UEXC 3ZWBA 5HUQA 4GKVA 1T3TA 5EJIA 3ORSA 4XB6B 3B1JA 3VNVA 1WXEA 3RCBA 2HA7A 5A5GA 2JVIA 2AZ4A 3OUTA 1XO1A 4JWTA 1K7SN 2YJ4A 1A5BB 3AZQA 5IVKA 1DKUA 2ZRMA 4NE2A 4NENA 2QP4A 2W6MA 4G2NA 4OQLA 4RLSA 1O9BA 3C14C 5H5JA 6LDHA 3KX2A 1SQ0A 4HDSA 4HB2A 2HQBA 5AVWA 5MGNA 1YAHA 3TO5A 1HRDA 1IY2A 2YYAA 3ZQ4A 1Z62A 1JKJA 2OB2A 4MH0R 5AM0A 1TF2A 1FFHA 4XX0A 3AF0A 4K9PA 3FLEA 5LMUB 1FUKA 2HU8A 3X2FA 4YMHA 5A2GA 3R44A 4IIBA 1UXOA 2W2KB 1ZBQA 2IH5A 3CLVA 3AJ8A 3QVOA 1GITA 1S1MA 4R2JA 4UFNA 2YVKA 2VCYA 1KY2A 1PDVA 2FYTA 1ZINA 2G07A 1DTWA 3DAYA 3HYNA 5K51A 2IU0A 3W8RA 1IZ8A 2ZB3A 3KDPA 3QFCA 1UFRA 3H2YA 4X1KA 2HJGA 3ZZNA 4BFVA 4O08A 4WKBA 2Q1UA 3R0IA 5THKA 4EB6A 2Q8QA 3HDQA 1CT9A 4NYMQ 4ZI2A 4MP8A 3UMBA 2WSMA 1CUIA 1DXYA 2DFDA 3LC1O 3SZLA 2AZDA 1RXCA 3BRWA 4MW4A 4KQXA 1CRPA 1H42A 6PFKA 1EP9A 1D7AA 3HCCA 4G1MB 1O5OA 1JSCA 1VCNA 2WHYA 5E6SA 3TQIA 4D8TA 5JU6A 1M2HA 2UXDB 2AOTA 4OUKX 3WYCA 4BQIA 1NU8A 4C0WA 2H0QA 5DLYA 2ZYDA 3AP1A 2EDCA 3FYSA 3KJIA 3K4HA 3RUPA 3FYCA 1J49A 1NRWA 2NX2A 1DJNA 3S55A 5J47A 3R1IA 4NZ9A 3LQQA 5D3MB 4Y9TA 1JEDA 2HCRA 3GA5A 4NX2A 1BYUA 2HHHB 2Z04A 2A58A 2OTCA 5EQFA 3ZQJA 3DMTA 1H4SA 2O50A 3WLMA 2VP0A 1EAYA 2DT8A 4GMXA 4Y30A 5IANA 1MRNA 1JJFA 2WG1A 3F3KA 4JR2A 2HV9A 3KKKA 4LMAA 5HF5A 1M83A 1DHTA 1NN5A 2FOLA 2FSGA 2KWIA 2W2LA 3KNZA 4TTTS 5DTMA 1PU2A 5TARA 3R6GA 4BJHB 4F97A 2J46A 1ZNZA 2CFRA 3DCNA 2NSDA 3NWOA 1HE1C 2VSXA 3L8MA 5FBRB 4XSHA 1QIMA 5C5CA 3VU3A 2GX6A 2IY8A 4F7WA 5HUHA 2AHRA 4F5ZA 5LBUA 1JQEA 2G7MC 2QK4A 4D43A 1Y8QB 1KOLA 1ZI8A 3BWMA 2JLQA 1KGDA 4FEGA 2K87A 3NXKA 2RE8A 1LZKA 5LNK6 1ZIYA 2GBCA 3R0JA 4WASA 4WWHA 1BRTA 1JHYA 4PWYA 2VDQB 3STUA 1IUOA 4FEYA 4KSBA 4BUZA 4ER3A 3L1HA 2ZAIA 3A3NA 2QR5A 3CRNA 4FKZA 4XD2A 2QX9A 2ID8A 2VHQA 3Q88A 3GP8A 1RXUA 4QX6A 3U49A 1U3WA 1KEEA 2ZJZA 2G4CA 5C32A 3ZHQA 4S3MA 3VUEA 5EC8A 4JWKA 1Y7LA 1S89A 2B0CA 4LHZA 4OXYA 3F0TA 5GQSA 5I01A 5TPWB 3CWQA 1ZN9A 1XK6A 3G0DA 3KYCA 5JNWA 2C54A 3WGGA 3T38A 3KQVA 1DG3A 3AM5A 3BWBA 2QQ0A 3TAXA 1NVUQ 1CTQA 3MCTA 3SIPA 3EX7C 5HKAA 3TQRA 1WDMA 4NBTA 3FVTA 4ZJPA 4BAGA 3ZNPA 4G5HA 1WP4A 1BE1A 1KWGA 5JZ9A 4DA0A 2H1FA 1I10A 4KUHA 1KQPA 3GJ4A 5FNVF 5FBZA 3HUFA 4F6LA 3MJFA 4YMVA 2PTGA 1S2MA 3K53A 5C1OA 5BNIA 3RUIA 1AKYA 1K89A 1ZLYA 3R41A 4D9KA 5CDFE 1I1OA 4NU0A 4HVLA 3LXRA 1A9TA 1KBQA 3K9CA 2P65A 1GADO 1SOWA 4BV2A 2VYND 3T3IA 3OESA 1HF3A 2PG3A 4FFPA 3U44A 4RLQA 1M1YB 2I8CA 3OFND 3K0CA 3P20A 1E3WA 2UVDA 4MQEA 3GCXA 3HFGA 1C2TA 4F6RB 2YMPA 4FCCA 3EGIA 1EX9A 3GFFA 5IX8A 2V6MA 4JT2A 5D86A 4M22A 3HNPA 5IXYA 3BCUA 1RLOA 2Z8YM 3D7LA 2DYKA 3FE2A 5DX8A 1GAXA 4E7PA 3WDMA 5I9BA 2PJDA 1Z4QA 4X63A 2EQ5A 4TLEA 1G7TA 5KCMA 5KINB 4XR9A 4ZMBA 4EVRA 3L8FA 5LWQA 4TM8A 2RHDA 3HKCA 4URVR 1NPYA 1DC6A 5JALA 1J99A 4OYLA 1HYGA 5DF1A 1IDN1 1YJ5A 1N5LA 1JT2A 3UFBA 4ESEA 3UUFA 5FWAA 3BRSA 4QFBA 1IZ0A 2IZ0A 3T0IA 3SC2B 3HP1A 1SXHA 4KPUA 4RANA 3GEGA 4WJLA 4RTLA 5ITSA 4J0JA 4XGKA 3FZNA 4B84A 4BFUA 4PNPA 3IQFA 1UXGA 3Q5GA 3RADC 3FZEA 1OLSA 4F45A 2ZE5A 1IY8A 3O0TA 4CIAA 3KQOA 1IWBB 1F0KA 1GYPA 2JHCA 4DYHA 4U5QA 1WZEA 3R4CA 1R12A 3CSUA 3GA7A 4K6KA 3OKPA 5DZSA 3RPEA 4XDZA 3O8QB 2RHWA 3KB6A 3QVXA 3FVVA 2B2CA 3W78A 3QLTA 2HDWA 1EX1A 3Q98A 1J0DA 3H9EO 5BSWA 2QM0A 2R8PA 4HRXA 3NHLA 4P5PA 3QPAA 4UQOA 4BBJA 5KJ6A 2AB0A 1YZQA 1CDEA 2F7SA 2XVYA 4RS3A 2H2GA 2NO0A 3MCAA 3U9LA 4UM8B 3MMPA 1ZHOA 4D41A 3IJRA 2I2XB 3LDHA 3W6NA 5D00A 4JQCA 5FADA 4HYQA 3B5JA 4LF8B 4WNIA 4B3SB 1IQRA 2QX4A 1Z8FA 1L5WA 5JD6A 1KQFA 2DR3A 2XRZA 3H0KA 3EVAA 2FDRA 5ADVA 3MTAA 1IATA 4IIJB 3L0SA 5ARCA 1I6LA 3I5MA 5HBRA 3QTTA 5C4GB 3MWGA 1VSBA 4XSGA 4KL8S 5JLAA 5AM5A 5K8TA 1PNTA 3NOQA 5ICMA 3WLJA 2V1UA 4M2LA 4YRTA 5T4HA 2F8SA 3PLAE 1APBA 5IWAB 1BXRB 1WD7A 2Y93A 5ER6A 2CNNA 3PFGA 1DARA 2QTHA 5FLYA 3OJFA 5H83A 2LKCA 2OO5C 5KQGA 2Q50A 5M3BA 2WTEA 4X65B 2IU4A 1VL2A 4V1CB 5E4TA 1CKEA 3QYAA 4MQ6A 5DHQA 2BM1A 3HADA 3MCZA 1FYVA 2P91A 1RQ7A 5JVDF 1ML4A 3JSAA 5C18A 3CLSD 3IBYA 1LF0A 4JUCA 4YCNA 2RH9B 2PGXA 1O58A 2A1TR 3T4PA 2PUFA 5L3QA 2QD1A 1E4EB 2XLCA 2YOFA 3MJCA 5EMJA 3W5IA 5AXDA 3RT7A 2P2ZA 5F78A 3SJ7A 4C3ZA 2RIRA 3COJA 1NLMA 3WGQA 3R3YA 1UT5A 3CY6A 2FW7A 5JS2A 4X1IA 1I2DA 1MOQA 2A0UA 1O9GA 4M98A 3W8FA 1EWYA 1O5TA 5ED0A 2HXYA 4Y9SA 1PEKE 13PKA 1MC1A 1YJXA 3SD7A 3GNTA 3SYKA 3TKLA 2XRMA 3TFWA 1M7BA 3EXIA 1IQPA 5FL3A 4EAAA 1V25A 4K5QA 3RAGA 5JFGA 2ZSAA 3JVUA 3OTIA 4RK1A 4ON9A 5BUCA 5FUVA 4YP0A 5EP3A 2WKRA 3C70A 1H2AS 5REQA 3YASA 2YTZA 3HZHA 2FPXA 4X9XA 1YOVB 4LF6B 2QRKA 3QVGB 2GETA 3R3HA 4EO9A 4F9GA 2C2OA 5ETJA 2O5RA 3CRRA 2CHEA 4WA7A 4IXDA 3WIUA 1GPUA 3T7IA 2HR1A 2AG8A 2O23A 2XVZA 4P3YA 1MVOA 3EQ2A 1AA6A 5A0VA 2XMQA 1HDYA 1V6AA 2Q3MA 3H75A 3KVNA 1E20A 4L2IB 3RIMA 3LKDA 3ZHRA 1SIWA 1JKXA 1H3EA 4BNUA 3PTZA 1HE4A 5CDHA 2WRZA 3EH1A 1W19A 1I2AA 3KCNA 4PLHA 2P79A 5BO5A 1GG8A 2ZUCA 1VCHA 5JE8A 4PYRA 4P2BA 1MTZA 4XD7D 1B8NA 3U7FB 1NMSA 2SICE 4CV3A 4MGYR 5DMHA 1RXYA 4DM7A 1VA4A 4ZDIA 1SBZA 4W1RA 5CM8B 2QGZA 2O7RA 4TWBA 1YBAA 1QO7A 2QU8A 3D0KA 4M0KA 2P2SA 2XB9A 1I51A 3S2FA 1A9OA 3PGJA 4JB2A 2B35A 4TT3D 1RQNA 2VT6A 5KZMB 2Q3LA 2DHDA 1WKCA 3BMCB 3GFQA 2PQ0A 1G9TA 1EWVA 3S4YA 3V8EA 3B3QA 5B1SA 1SAYA 2RI6A 1M2OB 2PJZA 3FROA 1Y80A 2VJOA 4JBHA 3IQHX 3RC7A 3CQ9A 3G7SA 4B4KA 2P3QA 2FPIA 5HVNA 1KIFA 3RFXA 1EQAA 1I80A 4DMLA 1DUIA 1SM4A 1P4AA 2AS0A 3NDPA 1PHPA 4FR2A 2OLKA 4RQAA 4BMDA 2L42A 2UYHA 2C7OA 3WNQA 1LJUA 2P1ZA 4OSPA 4H1HA 4A8PA 4OJQA 4Z1OA 4MO2A 1F8YA 1FRZA 1PJLA 3LPAA 3VOAA 1UDWA 1V7PC 3OC0A 3NBZC 2WICA 3INGA 4GPBA 3Q7EA 1YIOA 2I7VA 3AV0B 1QWOA 2BL4A 2C4KA 3OLVA 4P33A 3TXAA 2QP9X 4C4YA 1PT5A 2IXFA 4O4LF 4RKWA 1ICIA 1N25A 3HJBA 5ARDA 3QYPA 1S4MA 1PR9A 1PL0A 1P5ZB 2SNIE 4L72A 4RTRA 1QC5A 4C9BA 5KHOC 1NC1A 4JLPA 4CTOA 5BRJA 3UJ9A 1G66A 4MR8B 3NM6B 2P6RA 2DZDA 1G1AA 1FU4A 4P4GA 5K8UA 4MIKA 1LBIA 3ZVRA 3OIGA 3WGUA 3GLGE 4C3VA 1YO6A 4DCMA 1XL0A 2L0XA 3QWIA 4OHRA 1H6AA 2B8NA 5FBWB 1KJJA 1T9DA 1COWA 4J1QA 3ORFA 5JMPA 3RANA 4CNQA 5H3HA 3WNVA 2Z2ZA 1YZLA 2WVJA 1YS9A 4KR9A 4D81A 2YQ5A 1XTSA 1NF9A 4FINA 1ZL0A 3ZS8A 4G5SA 3VO1A 5FUQA 1JILA 3ULKA 1NJGA 2E6KA 1UJBA 3P9KA 4KN9S 4PHFA 3GL9A 4NH0A 2HBRA 1ONOA 3A14A 4Z2AA 3ESCA 3FDFA 3G5MA 2IIPA 4NCNA 2BFBA 2QN6A 3LBHA 4BZZA 1ZVVA 2HY7A 1Q44A 1E77A 1P3Y1 2FCRA 2PKRA 1AUXA 3DEAA 2PGLA 4IBOA 3B20A 1L0BA 2YX1A 4YR7A 3MYYA 5C52B 1O95D 2G1UA 3PR2B 4Y2GA 5KSYA 1E3LA 1I1HA 2AWNA 3PQ4A 5DP2A 5KQSA 1EVYA 2WQZA 3HXMA 1QO0D 1P31A 3DGEC 3MM4A 2P9TA 4EA8A 2ZGVA 3MUFA 3N8HA 5C1IA 3LL7A 2BDUA 4BO9A 1FXWA 5LP6C 4C3OB 3K70B 2DAPA 2QX7A 1L5ZA 1DFHA 1TLLA 3ND8A 3O82A 4FOPA 1VXRA 2WJJA 2EEZA 3E7PA 1IZ7A 1PIWA 4GPZA 1H05A 3WLRA 2MSWA 2CBXA 5BVGA 5CM2Z 1AXRA 2ZBUA 4RVNA 4LHSA 4MUMA 2FTKE 3ACDA 4JT9A 3E0XA 3H3XA 1UPCA 3M6XA 3UANA 3PWTA 5IJ9B 1IZYA 5A5FA 3W4IA 2AUMA 2Z5FA 4FZJA 1AHPA 3NTLA 4LJ9A 2H2HA 3ZHYA 1G41A 1VI5A 1FS5A 5CK5A 3UMYA 5CJ2A 1J42A 1PV2A 1TZBA 3HYCA 1BFUA 4D4KA 2WJGA 1UBEA 3K72B 2WW8A 3V42A 1VKOA 3KZXA 1SVUA 4XR4A 3IILA 3BG5A 4OJKA 4AJPA 3WYDA 4YUZA 2JLCA 2GN4A 3RVOA 3TH5A 3Q2IA 3AR5A 2V9CA 3NBFA 1L5MA 5C7YA 2HBYA 5FKJA 1GD1O 3ICPA 5IT5A 2OXIA 4JNKA 1H2YA 5KAPA 5I9IA 3DXXA 3SJBA 3HL4A 3AY7A 3DZJA 4RSHA 3ZWDA 1LS1A 1VE3A 2VYQA 4HQOA 1CLUA 3P32A 1G5PA 3A3YA 1WMDA 5ALMA 5FCDA 3LHDA 5IAJA 4D4HA 1P2SA 3ENKA 1C3EA 1C0IA 3OIVA 2UZ3A 2PVSA 3NB0A 4EKIA 1XALA 3CH7A 5G0UA 4CMAA 3IL2A 1AOXA 1C7RA 1XJQA 1KJWA 3HJAA 1BYIA 1KMHA 4N3BA 4U1RA 3IT2A 3GVXA 1F5SA 5KYVA 3DE3X 4IJMA 4AUKA 4NJOA 2REBA 3O4FA 4ZVOA 1IN6A 2W6OA 4P3KA 1ISMA 2FN4A 2WMYA 3I4FA 3HA3A 3L02A 4WIAA 2COEA 1SU7A 1Z0KA 3A1VA 4QECA 5F1KA 4FILA 1M10A 1C29B 3D6HA 4ZAXA 2W2XA 2V0GA 4KDRA 3K70D 3TK1A 1WHTB 1SUAA 2UZ1B 1T9KA 3HRKA 2BM9A 3IUPA 1A9PA 4YAJA 3H1BA 3ZUGA 1J20A 3NX4A 3BGVA 1FW6A 1Z75A 5BW5A 4J07A 1GCOA 1P9LA 3D1JA 5LQUA 1SQSA 1G0OA 1XD9A 2B1QA 2QJFA 2AFIA 1OXBB 2YFQA 1TU3A 2LRHA 1OUMA 3E2IA 4JYBA 2D2FA 4K9OA 3HO8A 1ZISA 4PE5B 4IOMA 5H68A 1JXQA 5EE0A 5T3YA 5GONF 5U4XA 1UK9A 4KR3A 2ACVA 1T5SA 4A0RA 3CB4A 2D1TA 3PTLA 2H9AA 1I6KA 2NVBA 1A5ZA 4LCBA 5HRUA 2XXJA 2J0UB 5JJKA 1WULS 2GD6A 2Q6OA 5B3LA 1DLIA 3UGQA 1RZUA 4F1JA 4G41A 1QIDA 4INPA 3CE9A 3QLUA 1EFLA 2O0KA 1T1GA 3FOZA 3UPTA 2VH2A 4RKYA 4BWYA 1JF8A 5G02A 5FORA 3W06A 1SFRA 3C7KA 3WLLA 2BFFA 1CUSA 4CWAA 1LLQA 1CR6A 3SG0A 2ODWA 4B87A 3U81A 1V3VA 1EDDA 1RI5A 1TO2E 4D25A 3RS4A 4FDMA 1P2FA 4JN6B 4ZVPA 5HF8A 4EFLA 2X1HA 1C9EA 1C9JA 3PPWA 3QRWA 4ITUA 1DTSA 1FP4A 4WOKA 1T8RA 2IQIA 4CM9A 4KW7A 4P4SA 1I4TD 4BMNA 2VRWA 2ZWPA 4GI2A 1MHTA 2ZPAA 3M6AA 3OJWA 1CS0B 4XCXA 4F4JA 5KQMA 1SCKA 3EEIA 3IH5A 1SOMA 1O89A 1PT8A 5AW8A 1DZIA 3BS4A 4XEHA 1G8HA 3JU3A 1L7QA 1RAIA 2O14A 1NUAA 2R6CA 3PGA1 1B6RA 2DLDA 2UUOA 1XCMA 5DYGA 4AG3A 3ILVA 5EZYB 4FQ8A 1EUYA 1HBJA 3DC7A 4QPDA 4R2XA 3WRXC 2C4UA 3ESDA 5FA5A 4QU8A 3IALA 5G3ZA 4J4BA 2Y0CA 2WKQA 4O4IA 4NOLA 5FTKA 1DFGA 3TFOA 3QUBA 1YC5A 3RC2A 3H86A 4DJFC 1KAHA 5JANA 4DG9A 1DEHA 1OZ0A 1NBOA 2P2DA 4OGWA 4W99A 2J9FA 3I9JA 2A57A 4DRYA 4UQLA 2BKXA 3D4PA 2PSFA 2IYLD 5T8KC 4Y0VA 2AV6A 3INTA 3RH0A 5BYAA 1A4RA 3JQBA 1BEUB 1UC5B 2V6GA 3HACA 4DY4A 1JDTA 4AZ3A 1TUIA 4RX1A 2NAFA 1A95A 1GN9A 1XSEA 2PX8A 2Z5LA 1J24A 3NVAA 2NU8A 4DXDA 5DM70 1A76A 1YJAA 4PYMA 1DOAA 1QR6A 4FUTA 4W63A 2IDKA 3OIDA 2NZXA 3V7NA 4BFXA 4DIBA 1ZK1A 2V7QD 4BNXA 2R7LA 3UJDA 2RHJA 1F2TA 3R3UA 2C8VA 4DMFA 3H9BA 1QIJA 3UJAA 1K5HA 2Q5EA 4CIVA 3ZV3A 2OE2A 3M1IA 1T3LA 1OIVA 2MYPA 4G4IA 1D2NA 5JPDA 5E2BA 3UUEA 4LZAA 4LQCA 3O2JA 4KLNA 5IZ4A 4QSHA 4UARA 1T9CA 3UMJA 5G53C 4RQTA 4WUVA 4ZVMA 4G0UA 3IESA 3BXEA 1O94D 4QIHA 5AKZA 2NMVA 1Z18A 1X38A 2BIFA 3N7TA 3F4LA 3X1KA 4FI3C 3NIFB 3GF4A 4BQPA 2FSVC 2ZB4A 1J8YF 1SCNE 3EXG1 3PXEA 4I9GA 5IDWA 3UMGA 4MW1A 2XQJA 4DLPA 1KH1A 5AVKA 1ZJ5A 1TA4A 2ETVA 3GFTA 1N0WA 2X41A 1LJ8A 2N42A 3MG9A 5E4FA 1ZO8A 4MV7A 3I9V6 3LQRA 4NOJA 5IRCD 2VN8A 3D7NA 2ZZKA 2GBGA 1FVXA 3WIVA 4AKTA 1GXSB 1DEOA 1XZGA 2YNMA 3BTVA 1PFKA 5DYWA 3JZAA 3OF5A 1QAOA 1E9VA 1Z0ZA 4YRFA 1MUUA 2OBLA 1U8AA 4DILA 4CN8A 5IZCC 5DSZA 1ULHA 4UM7A 2O1XA 1P5RA 4GKBA 2DY1A 3D8NA 1DB3A 2AC2A 1ZCAA 4U7HA 3KUDA 1KHHA 4D8WA 5AFSA 4OQMA 3UUWA 4QYXA 3TXXA 4YFVA 2FSIA 2QNIA 1LCIA 3INYA 1MEEA 1ODSA 2H4FA 3VBEA 5CVVA 5K0CA 1Y3DE 2HYDA 2PKQO 2ZUTA 3TR0A 3NBMA 1ZEJA 2CLFB 4MVXA 3AY0A 3SJZA 4MUBA 4G63A 4JOCA 2E85A 3ZYCA 4BAUA 4ZEWA 1RRMA 3S2ZA 4B73A 3QPCA 4R98A 1P1FA 4JLUA 4IJQA 3OTHA 3GAZA 5ELLA 3M81A 4B33A 2QN7A 2B21A 3Q4GA 2R25B 4KH1A 1LI5A 3K1JA 2PVPA 5DBGA 2A67A 1ISSA 1KERA 2CJFA 3BF7A 5AI5A 4TGLA 1CNEA 1QQ6A 3C3KA 1M74A 1N4AA 4Q6BA 1O54A 5EJ4A 5EWJA 1YWGO 5L4LA 1R9GA 1YA6A 3D6JA 1XU9A 2R6ZA 2VXOA 1FYFA 4H16A 3SM9A 4B81A 3NFYA 4CU5A 3SQDA 1M2WA 3E3OA 2JRLA 4FZ5A 1VBFA 5F21A 1USKA 2PT7A 1RS0A 4QPCA 5F77A 3LPCA 4OAPA 3F90A 1R88A 3VX4A 1OLUA 3VU9B 4DQXA 2ZM5A 2CXQA 3C43A 3QMPA 4FJ2A 5A9RA 2UUBB 2DETA 3HBFA 2AK2A 2LGJA 1Z47A 1AUVA 3H9CA 4HFNA 1WMEA 4JB8A 4I1VA 4B82A 1NF3A 5LXTA 2BMVA 1U63A 5KSOA 1YFKA 3LW7A 2GPSA 4Y7DA 3T5DA 3ZGXA 2R4QA 3PX2A 4JBGA 3AO0B 5J2UF 1F20A 3IJ5A 5B7PA 1HWYA 3D1LA 2OG2A 2FRXA 2W6PA 3FDZB 1USUA 4J76A 4WZAB 5EXTA 4C22A 3R8FA 1RMYA 2HREA 4N7BA 3ZDXB 2OZLA 2ZWOA 3D5EA 4KNWA 4F5WA 4O1IA 3KBOA 2ZG6A 2JL1A 3CJTA 1Z74A 4ZGGA 5BRAA 3CUTA 3AF3A 2HMWA 1VIYA 5H16A 3W90A 2VEDA 1WSBA 4FXOA 1RT9A 2O54A 3QEMA 1SWWA 4O4JF 3IEPA 4UUMA 1NVTA 1T6YA 1VG1A 3TGWA 3MGAA 4LOJA 1BS2A 4EKNB 3D7SA 1QG6A 4XASA 1NDUA 1JDPA 2DWCA 5EWMA 5JS8A 3JWJA 5CX4A 3C7DB 3MBKA 2I2CA 3JQGB 3OICA 3W2IA 2BP7A 2AI1A 3AG6A 2WWHA 2GN1A 1UP6A 1P1RA 5BSVA 1DS6A 2DPXA 2JKZA 5EIOA 4YRAA 1NVEA 3K5WA 1UH5A 1BGVA 5AKKA 1BFDA 1KAEA 1KMNA 1WDLA 2P77A 1P2GA 4AO7A 3C3MA 1MC5A 4G0PA 1VKHA 1AZSC 4Q19A 4WXYB 1ARZA 1KI4A 1E2HA 1T0JB 4RH0A 2WDZA 1TIKA 1K6XA 1LPSA 2WZDA 3ESAA 3KTDA 2W5UA 4KR0A 2QVCA 4XGQA 5E0KB 4KCGA 4CG3A 3JAKB 4CLRA 4GPAA 4LHVA 1V48A 5A5EA 1VPTA 2P9ZA 2QQEA 4I50B 1PZXA 5BQXA 3FMIA 4BBAA 3TTYA 3CW9A 3PR1A 3HLTA 3ZEAA 3RF6A 1TKBA 2OC4A 9GPBA 4V0ME 1JYEA 2QMOA 4Y2VA 4FB4A 1H9AA 1Z08A 1U3DA 3FETA 4UE3S 3UPUA 1DC3A 2FQWA 2X42A 4G0NA 3K05A 5C8YA 2IW1A 5E7IA 5KNLA 4HUQB 4YJHA 4DANA 1TE2A 4JBWA 2G1PA 3UICA 2FEAA 4Y2JA 4U8GA 4BZXA 1X7YA 3IOCA 4MHOA 5TMDA 1QB8A 4BNJA 3GAMA 3ORQA 3E4CA 4UHBA 1FDIA 3KSUA 4H27A 1A72A 2VRNA 4QRHA 1NBMD 5I5GA 2VDWB 3KEQA 4YGXB 1VKRA 4CIXA 4DCUA 3P4UA 4EX7A 2MOKA 4YIHA 2FZVA 3TAHA 1CVLA 4P0TA 4X8LA 3RF7A 2BSAA 2CLSA 4ZGWA 3D3NA 2VWPA 3NJ8A 5LJIA 1TMYA 4NIMA 1YF3A 3PI7A 3C1TA 1CP3A 1C7IA 1J90A 3KJGA 2NO5A 1E9EA 1PZMA 1FP7A 3MPUA 4HDCA 1NR5A 3F78A 4YLGA 5IK2A 1N9ZA 2HNBA 1OI2A 2C4WA 4Y2UA 4HRYA 4RCYA 1DI0A 3BQ9A 3O7MA 4J1TA 4NYMR 4EARA 1TB4A 1JX6A 2DTDA 1QYVA 1YQGA 4PC6A 4Z5XA 1BO6A 2W48A 1VLLA 2UUAB 3WFZA 2G83A 4JCCA 5ESRA 4DW8A 1G8AA 3COPA 1A77A 5ALNA 3OX2A 5HZGA 1IB6A 4ZOAA 4D6YA 2JJYA 1XELA 4M9XA 1E8DA 4MVJF 3UGJA 4Z3OA 2CJWA 2ODBA 2GPBA 3EB9A 3LY5A 1T34A 3M6UA 4UU0A 1HTWA 5LYJA 3NAQA 4B6PA 2C9BA 2OAEA 4B6JA 3V1UA 1PD0A 4KYTA 4KFRA 3TRKA 1DKRA 4HWTA 4IICA 5AVOA 2XOKD 2H57A 3ABQB 4XSVA 4PAMA 3DMTC 1CR4A 3EQ6A 4E5SA 5JJCA 3DAOA 3C3DA 3DWIA 3OHPA 1DAIA 2CFIA 1G20E 3CHYA 2B7BA 3TIGA 1YZHA 4N82A 4EG8A 5AVXA 3Q8KA 4OIFA 2POCA 4C7VA 4HDNB 2JH9A 3CF2A 4P3NA 4TMWA 3KV1A 2QRLA 2BC9A 5AM3A 2YXPX 5A3QA 2ZRLA 3PYXA 1KYXA 1RAAA 3BCHA 5EKDA 4P2GA 3G8BA 1W87A 2E3JA 2NQ8A 3DV0B 1CETA 1BX0A 1Q1EA 1KEWA 4ZKEA 2JEYA 3DF7A 4CN9A 1CW2B 4CRWB 1OLXA 4K46A 3WKEA 5HTOA 5DN6D 5IH3A 2NU9A 2WMOB 4DWOA 4L5CA 4F8EA 2HV8A 1SEVA 4HNRA 2QRVB 1WSWA 2W6JD 2WA2A 2ORYA 3V2HA 5BQFA 3NM5A 4MCJA 4Q39A 4YCBA 3UY4A 4O2AA 5JPIA 2VH1A 4IV8A 1PL6A 4YWHA 1EEXB 4DA9A 1WX1A 4U0KA 4C07A 1QFSA 2JD0A 4IEIA 5B37A 3VR3A 3RSZA 2DXIA 3UOAB 2XB6A 2CFOA 3KOXA 5DCWA 2IIBA 3K9HA 1KYVA 2QZ9A 4R9UC 4C2UA 3K32A 2ZYWX 3QUSA 3FJ1A 3W7VA 1IEXA 4WZBE 4AP6A 1O77A 1T1SA 3GG9A 2Y8EA 1B16A 4W9MC 3PUXA 4W1SA 3F7OA 3G2NA 2GCOB 2K6GA 3IOBA 2VO1A 4KVAA 1ZLXA 4TMZA 5K3AA 3ROTA 3ZUPA 3AR9A 4NHOA 5FOWA 4QKQA 1J2TA 2DB3A 3KUCA 2ZT8A 4K9LA 2GCEA 1B14A 3VSDA 4QOFA 5AVZA 5FH9A 3DZCA 1ID1A 3HO6A 5JSFA 1JLLB 2Z3WA 1V0JA 1ZH8A 1BKYA 2FJ0A 2JAHA 2EAUA 1TUBB 2QU7A 3TJRA 1LDBA 4Z8YA 3GRRA 3ZDRA 4B3CA 1BRMA 5AK4A 1O6ZA 5FUMA 4QXMA 3V9PA 1XAGA 2ZRCA 3S1LA 4RV5A 5K9ZA 2JLRA 3ZV5A 2C31A 2CFTA 2P9QA 3SDBA 3A32A 3M4YA 1LPBB 3K0CC 3DD1A 3EZ6A 4F5EA 4DB2A 4XQCA 2WD7A 3WLAA 1WHSA 2H65A 4UPVA 2O2XA 3K0HA 3CF0A 5CT6A 2CLHB 2OFFA 3QFSA 3RTDA 1FU8A 2VKTA 1VP3A 1Q77A 4DEXA 5H8WA 5AK0A 1EWQA 1M0EA 1SB9A 2W2PA 4IWNA 3DDUA 3D2BA 3OI7A 3SF8B 3PHJA 4FIDA 2ZIZA 4KQFA 1JE1A 4HN4B 1MG0A 4RPCA 5FP0A 2GXQA 4BIIA 4REQB 1NMZA 3BZBA 4FCVA 5I3CA 4L0CA 1NVBA 3U0BA 3H9QA 2IYAA 2QLLA 4LOKA 1QHHA 2IZ7A 4TTIA 4XFDA 5DPMA 1PNQA 3PIIA 4GNKA 4WESB 1PUJA 3FAZA 1RCFA 2IK8A 3QELA 2IH2A 2TECE 4UBLA 1Y4DE 1V16A 3IUBA 2FP3A 4F11A 3UZUA 1XTUA 1SXGA 1PFVA 3FTQA 1P1IA 3ZWOA 4QYIA 2ZANA 2OFOA 3CKLA 1WUIS 5LC1A 3HVUA 2VJMA 4R9NA 4RGYA 1L7BA 2PSDA 1ZJ6A 1XNHA 2NACA 1SBHA 4KBFA 2RC5A 4OSOA 4FD3A 4UMFA 3RQIA 2HPVA 4EJMA 2R65A 3G2JA 3I9MA 2CFCA 2G88A 3RASA 1KWKA 3THSA 5EKSA 4NTZA 3VPBA 2IEDA 1A4IA 1S2NA 2CUZA 1O0BA 3T12A 1NLZA 2PKEA 4D7AA 4AJHA 4K05A 1SXIA 1TM1E 4P4NA 1W0CA 2D00A 4ZT3A 2VHYA 3DUWA 1U28A 4RULA 1GM5A 1B3BA 2A3NA 2P3SA 2ZVDA 1EFCA 1VJTA 3CEJA 3FA2A 3ONWA 4I4TF 1Z6TA 4JVLA 3JQFA 4HJXA 4MLZA 1AXGA 5EERA 1UFKA 3KOUA 3PNLA 4H9GA 1FYXA 3WWYA 1MDBA 2H1WA 1R8SA 4L15A 1EHYA 3CF4G 3I92A 4B3GA 3TTXA 1U2TA 1XLVA 3L0CA 3E7DA 4TRNA 3QNUA 3VTAA 1USVA 2E4AA 2X58A 4Q4JA 3IVCA 1DX9A 4FFRA 4QDOA 4LW8A 4FOTA 2ZROA 4WADA 5LLTA 2XUZA 3KLNA 5KOHA 1JDBB 1GO2A 3VTZA 5KNCD 5KWSA 4D26A 1PYGA 1AKMA 1ZD9A 2QVGA 1YB5A 3IODA 1V4BA 2GTHA 3RD5A 3UA4A 4LTNA 5DBOA 2OYRA 1TOAA