2FXIA

Arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
b'MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arsC
molecule tags Oxidoreductase, hydrolase
source organism Staphylococcus aureus
publication title Interplay Between Ion Binding and Catalysis in the Thioredoxin-coupled Arsenate Reductase Family.
pubmed doi rcsb
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fxiA00
1SRRA 2PUGA 3O1HB 1EWVA 4PEVA 1QP7A 3FFXA 3HS3A 1CHNA 1PNTA 2GBPA 3SAJA 1R8JA 4ETMA 2L18A 4KK3A 3BRQA 4EUKA 4KRFA 2TMYA 3EODA 3GT7A 3JPYA 1E6MA 1Z2EA 3OO1A 1GCGA 2KYRA 5JNVA 2VYCA 1M5UA 9ABPA 3OM1A 2IKSA 3Q7SA 4YWHA 5KQPA 3D8UA 4ZMRA 1K68A 3NHZA 4W5RA 2JVIA 2PUCA 1ZITA 3CTPA 5BQ3A 1NXPA 1Z15A 3NBMA 4MLCA 1NATA 5PNTA 3SG0A 2IDMA 5KI6A 4F06A 3N6VA 1JL3A 1D1QA 3HK2A 1VPWA 1EHCA 3CKMA 2MYTA 2MSWA 3QLVA 4MR7A 1NXTA 2IPMA 3CZCA 3EGCA 2NT3A 1LJLA 3OLYA 2CD7A 1APBA 2B1JA 2CHFA 1P6QA 1NXXA 4G0YA 4S05A 1SD5A 5IEBA 3KG2A 4MS1A 4Z4FA 5EWLA 3B2NA 4N76A 5HM6A 4MS3A 5TPZD 5TPWB 2FSPA 2AYXA 1U04A 3OLWA 1QPZA 1JLKA 4FE7A 3OMXA 4ML3A 3RVKA 1AB5A 5DLEA 2FQWA 3L6UA 4P98A 1U2QA 1KMIY 3HUUA 5IUJC 3O74A 4MR7B 2L17A 3RVLA 2R48A 1Z12A 4KVFA 3FDFA 1TVMA 3E3MA 5JS1A 1QP0A 3O2JA 4MLDA 1JFTA 4QYMA 4RK7A 1YMUA 1BA2A 4NICA 4KFCA 4RV5A 4CBVA 4WWHA 2WJWA 1ZH4A 2FLKA 1QQBA 3CFYA 1NXSA 2JBAB 1F51E 1EAYA 1SXIA 2R47A 4G86A 4RWEA 3RVQA 1DC8A 2OENG 2DRIA 1E6KA 1QKKA 3JS5A 3OLXA 1RNLA 1USIA 2GX6A 1GUDA 1ZESA 3KHTA 1M2EA 1DJMA 4EYGA 2VUHB 3HXMA 4RY0A 1DRJA 3LUFA 2PLNA 2QW1A 1M5TA 3MQ4A 4KQCA 3O1JC 4PE5B 1RZRD 3KTOA 1MVOA 1PEAA 1NY5A 1ZGZA 4FE4A 4EVQA 1QO0A 2N9UA 2MYNA 2VUIB 3DGFC 2FQYA 5DGCA 5TE9A 1D2AA 2JK1A 4LE1A 4D74A 1A0OA 1A2OA 2PUDA 3MMNA 3HUTA 3LUJA 2ZWMA 4RK5A 2WWVD 2FMKA 3URMA 4XASA 3MM4A 4D6XA 3O1IC 2PL1A 3HSYA 3O2SB 4F12A 5JNWA 5IUKC 2QXYA 3LUCA 1NXOA 3IPAA 2FW0A 4KQ9A 1PUXA 4EYQA 3F73A 1TLFA 4O1IA 4EYKA 1CEYA 3CS3A 1HEYA 2V0NA 2XDYA 3I09A 3N0WA 3EQ2A 4GPAA 5EWJB 1OXKB 4RKQA 2FLWA 3RVSA 1ZDMA 1YK1A 1U8TA 2NZVG 1WETA 5DCLA 1MB3A 5KWSA 1Z17A 3K4HA 4JASB 1RPJA 1GUBA 4YO7A 3MA0A 4Z99A 1JH9A 4S04A 2M98A 4MR8B 3IP9A 2RJNA 5CNIA 4IMJB 4E7PA 4F3TA 2HSGA 1SXGA 3LTEA 3Q7TA 3KYIB 1YMVA 4IMIB 4MRMB 2GWRA 3HO1A 4ZJPA 1Z13A 1QO0D 1DC7A 4MR9A 3F6PA 3QLUA 1JFVA 2QVCA 1L5YA 3E61A 1DBPA 3FGZA 4Q7EA 1B00A 5B3JC 3A10A 4H3KB 2GKGA 2IOYA 4YV7A 1AB6A 3O21A 2FMHA 3BREA 3MYYA 3OO0A 3H5OA 1KRXA 2PUAA 5EWJA 3SQNA 4RXMA 3O2QB 2JCGA 1ZGGA 4KK4A 1DBWA 3OLVA 3SNKA 3QLUC 4Z4CA 1T34A 2NZUG 2PMCA 3LKVA 3HCWA 1DCFA 2M1ZA 2OQRA 2PL9A 4EY3A 2P4UA 4F11A 3UKJA 5B3JA 1NXVA 2QU7A 3KCNA 1NXWA 2PAFA 4RXUA 4WT7A 4W5NA 2JVJA 1BAPA 4MPTA 3TMYA 4KPYA 1BDJA 3UK0A 4ETIA 3OQMA 2IPLA 3NNSA 4O1HA 4YLEA 3HVRA 5T7BA 1ABEA 2P9HA 1EWTA 2WJAA 3EAFA 4KNYA 1LK0A 1FQWA 3CZ5A 1BDIA 3FFTA 3JTEA 1VRVA 4DQDA 3H1GA 4RK1A 5TQ2B 1S8NA 2H0AA 2HQBA 2ID7A 4ETNA 3Q41A 4G0PA 1JFSA 4LZLA 4G0QA 1H9CA 4MQFA 1JYFA 1EWKA 2BGGA 4JB0A 1UDRA 1Z18A 3T95A 3TD9A 3CLKA 4OATA 3CNBA 2MSLA 3TX6A 5HQJA 5C5CA 1CYEA 1ZHHA 3LOPA 1W9HA 1DBQA 3JY6A 4YS6A 4KMRA 3H5VA 4YP9A 5TQ0A 2RGYA 3T6KA 2E4YA 4YCSA 2L2QA 3N0RA 5JNSA 3HV2A 2H3HA 2LBPA 5IEJA 1USGA 4RSMA 1D4ZA 3LFTA 4RY9A 4XLTA 1TM2A 4M88A 4ZPJA 3H5IA 2YHBA 4EVRA 2MYUA 5ABPA 4IRXA 3QLTA 4Z9AA 3H6GA 1SXHA 4TLLB 4RDCA 3OMWA 1JDPA 5EWLB 3RVPA 5ED4A 2HQOA 4PZ0A 5I4CA 5TPWA 4N03A 3GBVA 3IP5A 5HSGA 5FWYA 4HNSA 5JNRA 3KYJB 1YVUA 1ABFA 4Z0NA 2JB9A 3RVJA 2A9QA 3A0UA 1TMYA 3GL9A 1ISRA 3N0XA 2JRLA 2NUBA 3TB6A 4Z4GA 2FN8A 4Z4EA 1NTRA 5D2CA 5EWMB 2RJOA 3RQIA 2F8SA 1C4WA 5DKFA 4OTZA 3T8YA 2QZJA 3TO5A 5JS2A 3DZDA 3ILHA 4NQRA 5FBKA 2AYZA 4HNQA 2A9RA 3S99A 1FFGA 3KSMA 1I3CA 5KQMA 2F8TA 5CHYA 1DRKA 3T38A 5FBHA 1JHZA 2HJ9A 4LDZA 1J56A 2CHEA 1ISSA 4XARA 2ZAYA 4WUTA 3C97A 3QLVC 3RVOA 2A9OA 4MS4B 3QELB 4N0PA 4HYEA 1FSPA 3FMVA 2WB4A 3LUGA 4TLMB 2LIVA 4MAAA 5JNUA 4Z4HA 3D02A 3KLNA 4KREA 1BVHA 1YS6A 3FFWA 5GQSA 3EQZA 1ZH2A 4EVSA 6CHYA 2QV0A 4FB4A 1JX6A 2LP4Y 3QEMB 5TQJA 3HZHA 3O75A 1YS7A 4IILA 1A04A 2MSKA 3NNDA 4Z4IA 3LMKA 3R0JA 4RK0A 3BBLA 1YIOA 3GV0A 4OBBA 4N47A 5KC9A 1C0EA 2JBAA 4Y9TA 6ABPA 5EWMA 5DTEA 4IF4A 5CNKA 3HDGA 1D5WA 4L4UA 1PNRA 3CG0A 4PYRA 3L49A 3MIZA 5IUNC 3QELA 5BRAA 4TN5A 2FEKA 1YK0A 3NNNA 3LUDA 1L5ZA 1XHEA 1DCKA 1GCAA 3C3WA 3DBIA 3H1FA 1JWLA 1JBEA 3CG4A 5GOTA 1KGSA 2L19A 4H3HB 5E3JA 2LPMA 4EYOA 1LBHA 4QPJC 1PHRA 4XFKA 3GYBA 3EDCA 3N8IA 2PE5A 3DLHA 1OXBB 1MB0A 2FMFA 2WRZA 5KQGA 1EFAA 2FMIA 3N75A 4RU1A 2FTKE 2E4UA 4XAQA 1P2FA 1F4VA 1DCMA 1ZY2A 4O5AA 3JPWA 4DN6A 3H1EA 4KZKA 1JYEA 5HKOA 4UHJA 4PICA 4B09A 5KQLA 2E4ZA 4N41A 3ILYA 3P9YA 3H6HA 3M6MD 3OQNA 4RY8A 3LUHA 2VK2A 5TQ0B 5CNJA 4TMYA 4OLBA 3KJXA 4HNRA 4LX8A 2PUFA 3NHMA 2FXIA 2QSJA 4P1ZA 4MS3B 3RVRA 2Q5CA 2GI4A 5IBQA 1Y1LA 4JB2A 2FQXA 4MGEA 5T3YA 2FVYA 4RKRA 4W5QA 3QK7A 3DLBA 2PUBA 3JVDA 3RVMA 3G1WA 4JAVC 3ROTA 3RVNA 2IYNA 1DP4A 1VKRA 2O20A 3H5TA 4NV3A 4DADA 2FEWB 4QYWA 5CNMA 5TQ2A 1XHFA 3QX9A 3ROFA 1E2BA 4MS4A 4YGXB 2B4AA 3HJFA 3HDVA 3Q15C 1QNLA 2HQRA 3KS9A 1Z26A 4G0XA 1Z16A 4IGAA 4NCBA 2I6FA 2A9PA 4ZMSA 1TJYA 2FKAA 5FWXA 1E6LA 3OLZA 3I45A 3IDOA 7ABPA 4OLAA 1RXEA 1U0SY 1P6UA 2FN9A 1ZAYA 3QEMA 5F64A 2MYPA 2IPAB 4XXHA 3CHYA 5C5EA 1LJUA 2WY2D 1PEYA 3HM9A 3BILA 2PUEA 2E4XA 3OM0A 5JNTA 5BRJA 1RZRA 4N0QA 1BDHA 4MQEB 2FEPA 2IPNA 4WZZA 1Z25A 5IC5A 3F6CA 3K9CA 4LDAA 1MIHA 4WXEA 1JDNA 3GWGA 4QICA 2R4QA 1DZ3A 3GRCA 4GNRA 4Q6WA 1USKA 2CWDA 2QR3A 5IULC 3KKEA 1JF8A 3G85A 1VLZA 4JA2A 1W25A 3H75A 4MYRA 5KC8A 2PJUA 2E4VA 3C6QA 3JVIA 3M9XA 1P8AA 4RK6A 1U2PA 3MF4A 3SY8A 4WXMA 4JOQA 3GBPA 3M9WA 2ID9A 4L85A 1DG9A 4E7OA 3OQOA 2NT4A 2W42A 3C3KA 1ZN2A 4RZSA 4MRMA 1K66A 5TPZA 1MAVA 1FFSA 4MR9B 2R25B 4D6YA 2RDMA 3RH0A 3DGEC 5FWYB 4YRZA 3IPCA 4MR8A 3F7NA 3EULA 1QQAA 3QEKA 3BRSA 4RS3A 2YHAA 4MS1B 3A3KA 3HEBA 4F8JA 3H5LA 3LKBA 3QX8A 4JP1A 3LUAA 3Q7RA 4LE0A 4YR7A 3LUKA 2X7XA 4Z9BA 5IX8A 3IP7A 5BR1A 4ZYLA 3A0RB 3W9SA 4RK4A 4Q6BA 2JVKA 2WMYA 3EJWA 4LRQA 1ZVVA 4G0MA 1URPA 4H60A 4OG2A 4EGSA 4G97A 2HPHA 2E4WA 3IP6A 1GLGA 1XWWA 3I5AA 8ABPA 1KRWA 3CRNA 4G0ZA 3H5WA 4G0OA 3UUGA 1QP4A 3CU5A 4LE2A 2QVGA 1IIBA 4KV7A 2PKXA 3SM9A 3C3MA 4NCAA 4RXTA 4W5TA 1RXIA 4UHKA 3VNAA 3KLOA 1FFWA 3Q9SA 3VNBA 2J48A 1YTUA 1LBIA 3I42A 1QMPA 3N53A 4W5OA 4MQFB 5FWXB 1M2FA 1Z2DA 3GA5A 1D1PA 2LUOA 4MQEA
chains in the Genus database with same CATH superfamily
1JR3E 5CB8A 3O1HB 2FW6A 1G6Q1 1QH1B 1PNTA 2GRAA 2RE8A 1N3LA 2P27A 3M3HA 4I9NA 3RK4A 2Y1GA 3I28A 3BFKA 2ZANA 3DAOA 1CUXA 4JI7B 4J0GA 3AGPA 4ZCPA 5C8XA 1DLJA 1DRWA 2OQIA 2XQVA 1JTFA 3ZBTA 4H6PA 4UNSA 3STVA 3RU7A 4QOJA 2OYRA 4D6PA 1VGVA 4OHRA 1EE9A 2ATCA 1C4XA 2WWHA 1SIOA 2V7XA 3RAPR 5KNDH 2D3WA 2HPVA 3A7EA 2RG7A 4C0QC 1B2LA 2C31A 1H4SA 5LMUB 1GU7A 3Q7SA 3HN6A 1RZVA 2P0AA 3WFIA 1BEZA 5C31A 3QPDA 4W5RA 3SK0A 3DMHA 1FFXB 4IKEA 4IDFA 3O8CA 1T9HA 2XI4A 3SG0A 1JEYB 2XQFA 1RBYA 2H8GA 4IVRA 4KGZA 2ZVQX 3HK2A 3U9SA 1UXKA 4CT0A 3AUTA 3OKCA 1K6IA 1M3SA 1KHHA 1RJ9B 4FQ7A 1JHAA 2OFWA 3K0KA 3DW3X 4O0LA 4PSVA 2VNHA 1TECE 1X19A 2IL1A 5JMWA 4HDKB 2W00A 4G0YA 4PBRA 1Y98A 4TM8A 3D5TA 5EWLA 1YFLA 2R7KA 5TF4A 3RROA 2R62A 3IIJA 2OC4A 3GY0A 2G83A 1FMJA 1DT5A 2PKRA 4JLNA 4ML3A 2RKWA 2VBCA 2XUFA 4MLZA 4I0WB 1MV8A 1K5HA 1UEJA 3WLKX 1FFDA 5IUJC 1DAKA 4LN1A 3DFUA 2DTDA 5JS1A 1VXOA 2IY8A 2NSLA 1YOVB 1UKEA 5LP6A 2CB0A 3WGHA 2J5BA 3SJUA 1AM4D 3IQGX 3L7MA 4JFRA 1VE3A 1JIKA 1W30A 1S6YA 2I99A 2GRJA 5FFNA 2FLKA 5L40A 2I62A 2CZGA 2J6BA 3QVTA 2WJHA 1WUIS 3C70A 5DBOA 4UZFA 3P9NA 3T06B 1K9SA 1E6KA 2WAAA 1N2ZA 4ZOEA 1RBZA 2UUOA 3W79A 1M2EA 2WDZA 1KEEB 4A1FA 4BRZA 4NESA 4PN7A 5CDFE 1AK2A 2YVUA 1YZVA 1DRJA 2XMBA 4BMSA 3Q8MA 1SR8A 4R8SA 1Q92A 4ZVNA 1M5TA 3VPHA 4B7CA 4R2WA 3BTVA 5KUTA 1M8FA 4TMFA 4NMXB 1O8CA 3RS9A 2G4LA 2GILA 5KPDA 3ZGXA 4C7KA 2VUIB 2Z0MA 4JQCA 1WHTB 1HRKA 1VKOA 2NYVA 1X1DA 4K87A 2Q0XA 1XALA 5L4SA 3FPBA 2XIQA 4WW0A 2GPBA 4D8UA 1P31A 1X6VA 4H7JA 3NG1A 4KGDA 4UDXX 3TPFA 3ANXA 5A3QA 3ZLTA 4BQSA 4QKQA 1I10A 2Q3BA 3GUHA 2BI8A 3NPMA 3NWJA 4OA5A 4X92A 3SYKA 5BQXA 4OI0A 3NASA 4KFSA 1KEEA 1TIBA 1E61A 4C87A 4GQBA 3QWIA 2QYSA 3N0WA 2C0QA 3H9UA 3GJXC 3LUBA 1BRMA 3LC7O 16PKA 2CWWA 1E1KA 2QLMA 4KLAA 1OTHA 4QATA 3TM4A 5EIXA 3WMWA 4IDPA 4MHSA 2W70A 3D8TA 4EHHA 1WETA 4Q1AA 5SZHB 2HFJA 3SHQA 5AD1A 1UKBA 4NBUA 4B6PA 1A4XA 2CN1A 2QA5A 2R4UA 2Z5LA 4C5CA 4WZAE 5BMVF 1KWKA 1HQDA 3CRZA 4LNAA 1F20A 1FU4A 3RTBA 4O4JF 5CFQA 4DCJA 2HV9A 1CUIA 5C18A 4L0MA 4JVNA 2GN6A 1CEEA 4U9UA 3ZWDA 1GPNA 3X3HA 2J9XB 4M9ZA 2ESRA 4IMJB 4PYMA 3TSWA 5JSQA 2I1WA 3ZZMA 4DAOA 5A03A 2GEFA 1O6CA 3BB4A 2R6ZA 4LYYA 4INPA 3ITNA 4JSTA 1MJFA 4GF5A 1ZJYA 2QD3A 1ZXXA 3A37A 3GRFA 2JHGA 1IQUA 4DSAA 4UAUA 1QK4A 1ZCBA 3FGZA 1AXGA 2WJGA 4OEHA 2H06A 2J4DA 2RCYA 4FQ8A 4NF2A 4WI1A 5J9FA 1HNNA 1LBQA 3CLSC 4JROA 1KEZA 3G0CA 5ALRA 5BSEA 4MVJE 2IZ1A 3DD5A 2DPGA 4DYHA 4O4IB 2YN4A 3TTYA 1AKMA 1LKZA 4F9TA 3A1NA 2FU5C 5E6RA 4C29A 2QL6A 1DBWA 3LRTA 3GZTB 2XUPA 1C8KA 4J0JA 3QLUC 1OYYA 4QDOA 1YFZA 1CY8A 3PUWA 4AUEA 2CNOA 3BRWD 3HWSA 3NWEA 3GCXA 1YV9A 2XT0A 4YHBA 4KLCA 4AJKA 4R1UA 3UAZA 3FA2A 3RVBA 4QG7A 1CZUA 4ALNA 4HGQA 3OSUA 3T5PA 2XNKA 1UJ4A 4XIYA 1IY2A 1NBMA 3IMGA 2VDRB 3WGZA 1ZU5A 1GTMA 1SOAA 2Y99A 3JD0A 1X2EA 4YLEA 4RTPA 3R9XB 3CZ5A 3QY9A 4WKOA 1WWKA 5JSZB 1N2GA 5IRCD 2H48A 4O4HF 5AI9A 4B75A 1VYUA 4LOLA 3WLRA 2YHUA 3EXIB 3Q40A 1GA1A 5DLDA 4BX8A 4L1KA 5E1BA 2F3TA 4EHJA 1JFSA 1QIJA 1LK5A 2H4FA 3BTSA 3U1BA 4PO9A 3FAKA 4RNCA 5AK3A 3UHOA 4LGVA 4U2FA 2QV7A 2IZ7A 4FS8A 5CT6A 2V0GA 3OJLA 3GRYA 1NJ1A 1FYDA 2ZCJA 2NXEA 2OCBA 1IL0A 1QC5A 4LKOA 5CT5A 5HQJA 1OFIA 2WD8A 4UE2A 1DBQA 4BJ6A 3AF3A 4QTYA 3K32A 5KKNB 1Z22A 3OU2A 3LC1O 1TPZA 3DTNA 2YRWA 3DEFA 1UBRS 3NKVA 4AC9A 4EP1A 4R0MA 4R0NA 5AW8A 1JECA 1PJ3A 3U44A 3K5IA 1SOWA 3F4LA 4KFTA 3UAGA 4GH5A 5C80A 1RKUA 2FOIA 3VPDA 4BRSA 3I1FA 5L45A 2D06A 2X7HA 1HUQA 1TM2A 1U2GA 1XL1A 2GM9A 3OCYA 4UUAA 4ZPJA 3TLBA 2WAOA 1CDZA 4L27A 2APJA 2HNKA 2XOEA 1XNQB 1TKBA 3IQEA 1I7PA 3GLHA 3T7AA 4MUNA 3QLTA 2HREA 4ARCA 2IHVA 1NUUA 1MP0A 2OXCA 3S6JA 3BHIA 5FAXA 3SE0A 2LRHA 5C9ZA 2IELA 4ILEA 5EWLB 4JX9A 3SC6A 1G20B 3MRSA 4C7MA 3PQ2A 3N8GA 1OPXA 3GH3A 3RYTC 1QUFA 2NUPB 1W36D 2A0XA 4HNSA 4Y1RA 2LV8A 4O8CA 2JB9A 3RVJA 4F4FA 4D4JA 4B82A 4OBWA 3U80A 3AHIA 4EG0A 1G59A 5F1OA 1YUNA 5EWMB 1P3JA 3LNTA 4H4CA 1JDJA 2BKUA 1LBEA 3G2NA 3H99A 4OO3A 4WCDA 3T5TA 5ITZB 5ILGA 4U0KA 3FOWA 3G7SA 2ATVA 2VRNA 4EMUA 3ZE7A 3EZ9A 1RRGA 3NYQA 5HUQA 3HKEB 4I55B 2E7ZA 5ERGB 4FCTA 3NGMA 2C4HA 3Q8WA 3NH6A 4A8PA 3KRTA 1U3GA 4E1BA 3UXHA 2P9JA 2YR0A 3V33A 3OIVA 5A2QA 1O4WA 3LX8A 1Q0LA 4GLOA 3UMBA 3A7DA 2J5RA 4QOIA 4JI3B 1XQYA 4P2BA 1O57A 1OXVA 4LV8B 5H80A 4GFDA 3BMCB 2FPLA 3H3FA 3MD9A 3QVXA 3WS7A 4I7EA 3QLVC 3W9BA 3FKSD 4EB8A 1GKUB 2HNAA 3OWXA 2VJMB 1WMDA 2E5LB 1LQ2A 2IP4A 2WB4A 3CQ9A 3EXHB 4CM9A 4CLRA 5BPHA 2Q9CA 4Z8YA 5KNDA 1RYYA 4YCNA 3HKCA 4QD3A 1UT5A 2FR8C 1JBKA 4P93A 1BVHA 3FNEA 3OPXA 3F9RA 3U0VA 4QZVA 2HN9A 1O94C 1PR3A 4JYAB 2W37A 1QGZA 2X5OA 3HNRA 3KZXA 1UJMA 4NBLA 3CW9A 4UULA 4XGRA 5HFJA 4DHWA 4EUSA 4N5NA 5TQJA 3IVAA 2V9PA 4MP3A 3QW4B 1S3FA 3AUJB 2P9GA 5DX8A 2OK8A 3HJHA 4AULA 1NY6A 4MVXA 1IULA 4ISCA 5KC9A 2RHDA 3DONA 3O84A 1SBCA 1UXJA 3FUXA 1V47A 4R31A 5EUBA 3RHFA 4EHIA 2VTBB 3SZOA 3MFQA 2AE2A 3GBSA 3AU9A 5EKSA 3B3AA 1SU7A 1P5FA 1ODIA 1BA3A 1U99A 4KHZA 5IAOA 3GMSA 2NQ8A 3E18A 3E8MA 4I19A 3OQPA 4MUJA 5FUYA 2BFBB 3FTDA 1XRRA 4LXXA 5AVJA 1RQNA 1H2FA 3DUFA 4HQLA 3KDPA 5I3CA 3I6ZA 4F7WA 3DV2A 4QPJC 3C3EA 1BO6A 2QDXA 1P4RA 4MVJI 4DXDA 1R9MA 3PI6A 5ALXA 4K0RA 4NBWA 3WFZA 2YZMA 1PWZA 1REQB 2VDJA 5FYDA 3RLFA 1EAMA 2ZT8A 5AYVA 3I9MA 4S0ZA 1YZTA 2GVDC 4LECA 2EQAA 1K6EA 3AU8A 4WLNA 1W87A 1KOLA 2CVOA 4KBGA 5C1BA 1O96A 2FWMX 1RFGE 2V97A 3TLJA 3U1TA 3H1EA 1GYPA 4UHJA 4J07A 1I4LD 1SUCA 1GITA 1NE2A 3CB2A 3M6XA 2E4ZA 2IHJA 4J8PA 1NNSA 2I9PA 3ILYA 1UODA 1T6NA 2VH5R 4LC1A 1W7AA 2BKLA 1M72A 5K2MA 5AK4A 4PIMA 2BONA 4R4JA 5REQA 1ICIA 1WMEA 4PZ9A 5CB4A 4JOBA 5L9AA 1ST2A 5CK4A 1L7PA 1YU9A 4RACA 3JALA 3ZHOA 3EWAA 1VL6A 2PS0A 3BDAA 1J20A 2O14A 3C0KA 4I5EA 5BWNA 2XCLA 1MHTA 4Q03A 3DLBA 4AZ0B 3RUEA 3RVMA 3GPCA 3O4IA 2J45A 4JUAA 2ZBUA 5DHQA 4ZN6A 4Y2PA 4F0JA 5AW2A 4I3GA 3FE2A 4WJKB 4E1AA 4F91B 3PF8A 2DX7A 3QA9A 3DQPA 3PU6A 2BKVA 4BBZA 3KR9A 1KI9A 1NZFA 1IPHA 3QX9A 3K16A 5B1HA 5K6AC 3UXYA 3FBWA 3LD9A 3OP4A 5TMBA 4MB6A 2HQRA 4DV6B 3FNHA 1AXEA 1R8QA 3RFCA 3TJRA 2FP3A 4ZANA 4ZMSA 5HIIA 3X1KA 2ZIAA 2CCGA 4YX9A 1HQYE 1Q3TA 1AJEA 1NOKA 5AJXA 5AUOB 2QRJA 2BGJA 4OQEA 2IZOA 4XGIA 2FP4B 2ID8A 2J6HA 2ZOSA 3CEPB 4JLPA 2I2AA 2VDNB 5B2ZA 5BP7A 4RLFA 4WCVA 4KUGA 4TX1A 1E5QA 3ELBA 5A6VA 1RRVA 3H5RA 5JNTA 1WHSB 3WXBA 1Q91A 4OKNA 5JYDA 2FWNA 1P3DA 4ZOBA 3RC7A 3WADA 4ND3A 2M6LA 2I6XA 4L8VA 1C80A 4LDAA 621PA 1OWMA 1KZ6A 2BPOA 2BD0A 3H86A 5EP2A 3ZK8A 4DLAA 4YDSA 4K28A 4CQMD 1IK4A 1FDTA 1MRNA 1SY7A 2FHPA 3GN2A 5EKXA 2P6PA 4TTPA 1ECPA 3VR4A 5IJAA 3FR7A 2HWXA 3JYOA 5IT5A 3GROA 1D03A 2XRYA 2D54A 3JQ8A 1TK9A 3V1LA 1MVLA 1LCIA 1AHNA 2XA9A 1KJJA 4HBZA 1R4MB 4QU5A 2E4VA 4JWTA 3C6QA 5J58A 4HY3A 3C3DA 2PZLA 3OCVA 4HLDA 4J4HA 3I9NA 4RK6A 3VOBA 3LBYA 2OUIA 2ZE8A 3DCJA 3OIGA 3BJMA 4MQ6A 3IB3A 2CYCA 3HZOA 1GADO 1J2EA 2CHUA 1ODSA 4O2BB 4Q48A 3EY4A 3U9LA 3EGIA 4TWIA 5JDCA 4Q4DA 3R6TA 1KH3A 3COYA 2HF2A 3RRFA 4RULA 2GBFA 2X1MA 4DUZB 1MORA 3I2GA 1JW9B 5FD8A 3RQSA 3L92A 4RF4A 2HZ7A 4C7BA 4O02B 1VKZA 1J0BA 1F0KA 1I3KA 2BMVA 4EZIA 2HA2A 1FBNA 4I8XA 1JEQA 1FJ2A 1M83A 3ANTA 3QM1A 2OVBA 1CQIA 4UNPA 2VHWA 4LE0A 1UK6A 4V0KA 3O92A 4CCYB 3KKMA 2JJ1D 2WJ4A 2EGGA 2DQYA 2VF8A 3ZU5A 5KOHB 2HJHA 3D7SA 1GFZA 4RENA 4BNFA 2BBOA 1GPMA 3OZBA 2WTBA 4LRQA 3IBFA 4QUEA 1NUQA 1Y3CE 2DBQA 4M1ZA 4CUKA 5FBVB 2O4CA 4GOKA 4EGSA 1HNXB 2ZJAA 4JGIA 1XWWA 2JH3A 4GVLA 1FMTA 4RAOA 3ZV7A 4DMUB 2QTLA 4R2IA 5DYNA 1KO5A 1A2BA 3AR3A 3CU5A 1G2OA 3PR2B 4LE2A 2LCQA 2XNCA 1R4NA 3PNVA 4UNNA 5DVZA 2YXLA 3UUFA 4TLDA 3VO9A 1Z82A 3MRTA 4RXTA 1RXIA 3K0AB 3T3MB 4Q9JA 2OXEA 2AJBA 3JARB 4CIAA 4C4OA 1C1YA 3V32A 5HGJA 2GN9A 2JI4A 3PUIA 3H4VA 4W5OA 5D87A 1IIRA 3PHLA 5FWXB 5TDHA 2HHHB 2QUKA 2GESA 1D2HA 1JR3D 5K3OA 1QFXA 5ALSA 2X0JA 3QEJA 3SEFA 3VR4D 4GL2A 5F78A 2WWGA 4LYDA 4A1OA 2V7QD 4ACBA 4HQOA 2FHSA 1LV8A 2HUPA 3NI2A 4JP5A 3P2EA 3W5CA 1Z8FA 1S3IA 1U4OA 2AQIA 3LVFO 4ETMA 2BR4A 1G7TA 1TRHA 4GZLA 5DEOA 3ST7A 2BGRA 3KVRA 4LGMA 4CN9A 4LHWA 4KRFA 2EJTA 1T15A 1LFAA 2I6TA 1A9QA 1AGNA 2YS6A 2ZVPX 2FH5B 4L0QA 5CFPA 3RUCA 3NAQA 3RUIA 5FUXA 3AKEA 1MJ5A 2EC5A 4V1CI 1DC5A 1E6MA 5HKLA 2I8LA 1ARZA 1GCGA 1KS2A 5JNVA 1VPLA 2H1OA 2PKQO 1GGHA 5GJVC 1JXQA 4YWHA 1YGPA 2BFCA 5K0NA 1TZKA 2HMTA 1J8QA 3N6RA 4BMZA 4YPVA 2PX0A 4ZO9A 3M83A 2ZJ3A 2A58A 3C98A 2BDUA 2HK8A 4FGUA 1OHHD 2IXTA 1D1QA 1FK8A 5HKBA 2O8EA 2V03A 3L9XA 3M2TA 2FGKA 2VF4X 1A71A 3EPJA 3E15A 3D54D 1Y4SA 1SHTX 1XOIA 1ZGAA 3DVRX 3O94A 3OZDA 4M60A 4OAQA 4AIIA 5B4VA 4Q24A 5I5GA 3QYJA 3STWA 3L4JA 4ZI5A 1B8NA 1CQJB 5FA6A 2EEPA 2ZSJA 1GZSA 2R7AA 4Z0HO 5HS4A 4UUMA 3ZHUA 4U2KA 1KVUA 1SBNE 1WP9A 2LZ0A 3TS1A 3H6KA 4YV2A 1A2KC 4A8JB 2AHOA 5IVDA 4BFTA 4R8MA 1MV5A 2EBHX 4I55F 3OIDA 3TZBA 5JWRA 1GZDA 1V96A 1B14A 2WG1A 3O3OB 2RHCA 4QRDA 4TTSA 5B2FA 1WB5A 2NO0A 1NU8A 4QXQA 2VJLA 5F4BA 3RVDA 2O7QA 1GZ4A 1IXRC 1DKRA 4MLDA 8ATCA 2FPPB 1WUKS 2VHEA 2DC1A 2PL3A 2G71A 3PDCA 3HRHA 3IILA 4RPLA 4RVGA 3GP8A 2HO5A 3GJ7A 1S9HA 1T2VA 1IVYA 2Z8YM 2WJWA 5FI1B 4YRBA 3WMFA 3DFFA 3FJOA 2I87A 3GJZA 3S28A 1IHXA 2PQMA 4R7ZA 5U4QA 1QOPB 3CEJA 1Z0IA 2HA4A 2QJFA 2WM8A 3C3BA 3JARA 4FWIB 1IUKA 1YDGA 2J3QA 3R3JA 4TL7A 4YUVA 3SBXA 1YHYA 3VR0A 4DF3A 1F8XA 3PGLA 4JEHA 4QUDA 3F1LA 4RY2A 3NTLA 2B0JA 2YN0A 2G5CA 3NTUA 2GEBA 1SKAA 4S1WA 1M7GA 1H2XA 4JLKA 4OJYA 2AFIB 2J31A 2JAQA 5E1MA 3VR5D 4BBAA 2CBXA 1OOEA 1NT4A 2SHKA 3CX7A 1AT1A 2RGWA 3W05A 4F56A 5DRTA 3LUJA 1G7SA 1SN7A 3V2HA 4ARBA 1S2OA 2XWJI 4BMCA 2WD7A 3G7UA 1E4YA 3HSYA 5AOCA 4D6XA 3E6AA 1WSBA 2ZS9A 4HVTA 4EFDA 1XTBA 2PBLA 3DZBA 1AS2A 4WX2B 3U4HA 2I55A 5EG5A 3KKQA 4KPGA 5CYOA 3VGPA 2O54A 1L1QA 3BJIC 2CXOA 2ZT7A 3AVYA 2OYSA 2J0EA 3HVKA 3OD5A 4NE7A 3UCEA 3WGJA 1XMXA 4A8HA 1KJQA 5THQA 4EGJA 1N2BA 1DIAA 2W6JD 4B2LA 2XUGA 2FAXA 4DNFA 4YI5A 3UOGA 1GQOA 4GPAA 4YJ3A 4JR0A 5EIBD 2IY7A 1F7UA 2B8TA 4RKQA 3KLMX 4MP8A 1WW8A 4K6OA 4NFYA 3RC9A 4HYQA 3S8MA 2BFDB 1U8TA 5CVTA 2VATA 1ZMXA 2NQTA 2Q3CA 4RZXA 2IBTA 2NVUA 1GGEA 4K1XA 2VK8A 3H2HA 3UJCA 3RC2A 5AICA 2YVAA 1HDIA 1SBTA 1UMDA 3FPLA 1K7SN 1C0PA 4LBZA 1Y8RB 3RARA 1R3DA 3B6JA 1N5DA 1WDLA 3BGWA 3MPUA 1OV6A 2C4NA 4LNUB 4RHEA 1NSTA 1U1GA 1ONOA 2F1IA 3NDIA 1VSUA 4C7OA 4NTZA 4KB5A 4QNMA 2HSGA 1BG6A 2PEYA 2VHQA 3TTXA 3NOOA 1BDMA 4G26A 4JVMA 4IMIB 3K2IA 5BXQC 2WFLB 3VSDA 3BMXA 2IS2A 2HDWA 4JUFA 4I4TF 1JFVA 4NC9A 4UZSA 2PYDA 1GTZA 1PFUA 2PZMA 1N9GA 1P1IA 2X8WA 3A4YA 3I6YA 4YUYA 2DWQA 4Q00A 1EBUA 4ZODA 3BC1A 4YV7A 3COZA 1IWBB 2HQ1A 3HCAA 1NM5C 3O8OB 1XFDA 2NYAA 3C15C 3CM0A 1AH2A 1KRXA 3AR7A 1XQ6A 5EWJA 1PVDA 1DV2A 4NL4H 1MUUA 1PZEA 2JCGA 1DFIA 1KQNA 3E5HA 5C7YA 4KXFB 2C1XA 1GRNA 4EKEA 3B5EA 2NZUG 2PMCA 2VK1A 3PD1A 4HP8A 3IALA 3BF8A 3ZY6A 1PDVA 3MJDA 3PZRA 1QYDA 1BWPA 2OORA 3DMDA 3ELUA 3GLHB 3LG2A 4D7AA 1B6RA 5ALMA 2DBRA 2BW0A 1AKWA 2GRUA 3DMTA 4DL9A 5CA1A 3PA8A 2O0JA 1TK2A 3M4NA 4N40A 4NYMQ 3I01M 4RDXA 1FPMA 2WPNA 3Q6NA 2EZ9A 5J4HA 1POWA 3BMNB 3ZVKA 4BKRA 3HCOA 2IEIA 4MKGA 5E9AA 4JC0A 4DQDA 1VBFA 4E4TA 3E9EA 2EW2A 1HORA 3WX0A 2YC4C 4DQVA 4HZGA 1PUIA 1KK1A 2WHPA 3GMIA 3PF9A 1TA0A 1ZOPA 4MQFA 4BZXA 2RHTA 3U7GA 5AJTA 3B36A 1GSIA 2OUKA 5TT0A 1YS9A 5BN3A 3H42B 3ZIAA 5YASA 4K40A 4HGPA 3GZ4A 1WLSA 1Q0SA 3F2VA 1XCMA 4JBHA 4UBNA 5G4LA 3T3GA 1SFRA 4JLJA 4DYDA 1XLWA 3C5WP 3HU2A 3QNWA 3R3YA 2PXXA 6PFKA 4E51A 4FINA 2QENA 4ZXPA 4MROA 1DADA 2H3HA 4EF5A 4BB9A 5JANA 4ER3A 1LUAA 4UFNA 3S40A 1K6MA 2UV8A 4AMVA 2AZDA 2UYOA 4M88A 1F2VA 1HURA 3VC7A 2JCYA 4UMEA 4ALJA 6AT1A 5LKAA 1X2BA 1QORA 3BK1A 1UBNA 4V1CA 2R66A 5IJ0A 2BM0A 5C1OA 3AL0C 4AO8A 1AKTA 3V7NA 2CDBA 5FA8A 5IARA 4YV1A 1RAFA 3UHFA 2WSYB 1XZPA 1DELA 4PZUA 3CUKA 4DQKA 2NZWA 3WA6A 3OQIA 1X14A 2JHCA 3V42A 1IAQA 2BCEA 3IJEB 2Q27A 1JEDA 1FUYB 1Y6ZA 2VO1A 3IURA 3KYCB 3PHHA 4ID9A 1F5NA 4A7PA 2C1EA 1JA1A 1JDBC 4KQ6A 1PZMA 2RONA 3FPGA 3S1AB 2CMFA 2BEVA 2UVQA 2WABA 2WHEA 1VTKA 3AG6A 2FN8A 3QBJA 5BV7A 4Z4EA 5LM3A 5D2CA 2ZI6A 3UC5A 2YZGA 4ZU6X 5KWVA 3QNMA 4D43A 3T8YA 4JENA 1HG0A 3SZRA 1DSSG 3W3AH 4DIFA 3ILHA 4FHEA 1PE0A 4W82A 3VAZA 4BLVA 3IIIA 1EB8A 1JHYA 1K75A 3U3KA 1XMQB 4U6QA 5C34B 4JZYA 4TTTS 4AS2A 5TGDA 1RI5A 5IHPA 1BEUB 2LKCA 5F1KA 3P45A 1IB6A 4PCUA 2YN2A 4HRVA 2C97A 4WNIA 4G5RA 4P6VF 4XYMA 1XZKA 3FLAA 3SC4A 1LDNA 3JQ7A 1E0JA 5ESDA 5K8JB 1BWSA 3SQOA 4AZSA 1JKMA 3GAMA 1R6AA 1SOVA 1GFWA 1FFAA 1VHQA 1B73A 2HJ9A 4HWOA 5DX1A 3WLIA 5DM60 2ZAYA 3L7LA 2YV5A 4OVKA 1BVRA 1TVCA 3RVOA 3LW8A 3QELB 3OFJA 3SPXA 2PD6A 3EA4A 3N87A 4NPHA 4EY6A 1Q1ZA 2P1ZA 5JZOA 2LIVA 2RHHA 3PEUA 1M0TA 1EGVB 2DWOA 2R65A 3BIWA 4DSOA 1S8OA 4WBNB 3KLNA 1RRFA 2WINI 3AR8A 3KZVA 4IEEA 1UKVY 1DTEA 4IDGA 4RESA 4XR4A 3EVTA 4FCCA 2WIJA 3GLFE 3HA3A 2OECA 3G1TA 2LP4Y 3HZRA 3N2LA 3LQFA 1HE2A 1XA4A 2WG2A 3QEMB 4AJ4A 1UFQA 1EX1A 5HG0A 3LMKA 1QHEA 2M1XA 4YJGB 5EMKA 5CB4B 1W581 3AB3A 3GRVA 3QVOA 4UHEA 3L7KA 1PQYA 3H4IA 3EISA 3H1PA 1YZKA 3PPVA 3W4IA 3FCYA 1XCGB 1QH8A 5K3SA 1AA9A 1NT2A 2O7NA 3M89A 3QELA 4DIEA 5K6RA 1GPBA 1UBLS 2VHXA 4MMZB 1ZOSA 2FEKA 2DFTA 4EUHA 1H1DA 1Z68A 2GASA 1YVPA 1EGHA 1DCKA 1YDMA 2ZWPA 3PNMA 4LK2A 5JAZA 1JBEA 1NRWA 1SHLA 2C8JA 2YV4A 3DLAA 3ZNOA 1GQFA 3RWMB 4ARZB 1ZSNA 2H9AA 2L19A 2MMGA 2GSWA 2PEZA 5KYYA 1VI2A 3FJYA 4KQEA 1G8FA 3B5JA 3BDIA 3ICPA 4HQNA 3ML1A 3O3MB 4X3OA 5CFMA 1PHRA 4KC0A 2I8AA 3U37A 3TVTA 1C7QA 4Z7QB 3ENKA 5CXQA 2CLDX 4D8YA 3D7MA 5E2BA 3EFOB 3T41A 1HXHA 1P7ZA 1UDWA 2EDCA 1E6EA 5DGTA 2IGTA 2DPYA 3O1LA 4IINA 3V4ZA 1WPRA 1AKUA 3H3JA 1S7CA 1DCMA 1ZY2A 3D0RA 2C77A 2GD6A 4DA0A 4YT2A 3UYKA 4CLOA 3QKRA 3HDTA 4QLAA 3F90A 3OQ1A 4NK5A 4RPGA 4PQFA 1LB1B 1I3MA 3QG1A 1BZYA 2R0QC 2WLTA 3P9YA 3RNLA 2MWMA 4YJHB 2HLPA 1HT2E 4KR2A 3VRHA 4U39A 4YRFA 3INNA 1ZVKA 1M1ZA 2VPIA 1R88A 5I7HA 1M0SA 1HKUA 4LOIA 4URUR 1MOPA 3IIMA 4X63A 3Q8XB 3V3TA 4UOQA 1LBSA 4JMLA 2J3JA 1N2XA 3G68A 2GPTA 2H9YA 2IYNA 1KO1A 2P9BA 3I4FA 4MVJH 5BSUA 4YACA 1X1AA 1KWGA 1LW7A 2P6NA 5A0VA 4M7RA 4QYWA 4E11A 2XRFA 3BEDA 3R7WA 3NAMA 3ZWAA 4F9EA 3BE8A 1VBKA 3QVMA 1KKMA 2VSOA 3OY7A 5EEHA 3V4FA 3N70A 1SUFA 5L4LA 3EH1A 4KXLA 4P7GA 4K5QA 4RH0A 5AJVB 1RYHA 3OT4A 4HYYA 4N7BA 4MQ5A 5DIZA 3IDOA 3GLVA 3COSA 1NBWB 1TGYA 5GY7A 3UJ7A 4GPZA 1M1NA 2V4UA 3QEMA 1QQTA 1ISMA 2X8JA 4GP6A 5FLKA 1PYGA 1XIVA 3ACBA 3BSWA 3PUXA 3GRKA 4MI3A 4P80A 3RJ5A 4V39A 4EELA 2UUBB 3IKTA 3CHYA 3V2IA 4K7JA 2VPZA 5C5EA 4XKJA 4OH7A 3A1VA 1RPNA 2FMUA 2CJXA 2V6JA 5KO2A 2VRWA 1LDGA 1FP7A 2CLCX 2EIHA 2XGMA 2H1VA 1RWOA 1XD8A 2XYPA 4MQEB 2R79A 4P4GA 5CDHA 5E3HA 1Q6YA 3EOAI 1LPBB 5IC5A 4D96A 3ILXA 4KQXA 4Q05A 5M34A 4LMAA 2OAGA 4PXSA 1QIEA 2JATA 1VKHA 2OSVA 5BUCA 1KYXA 1AUVA 1I6MA 2BELA 4KACA 1UDBA 4R1PA 1B74A 4WRRA 2R4QA 3KFVA 4FBGA 4XWYA 5DM1A 4PONA 2AEFA 3MS4A 4HN9A 3QUTA 2AXEA 4LHSA 1WZIA 4NRDA 4W9MC 2XVXA 4ZU1X 3CVXA 3MWEA 4PPNA 4TWRA 1KMHB 1W93A 5DHTA 3JD2A 2QRKA 4Y2UA 5H16A 2KMLA 3BCHA 1U7UA 2PJUA 4MUGA 2KWIA 3PL1A 4FC6A 4X84A 3SNHA 3QTBA 3MF4A 3BEOA 2FUEA 5B4TA 1HT1E 2A86A 2QF7A 1MAUA 1UL1X 5HRUA 4INOA 5KTNA 1OXTA 1NPTO 3A1DA 1O89A 1ZI6A 3DZHA 1AQUA 1SVUA 4J0QA 4X8MA 5AVTA 3D8RA 1ZN2A 5EKUA 4MOWA 3NEAA 1E59A 4CFZA 4PY2A 3EDOA 1RP7A 3PQ7A 2Z09A 1R0RE 4O63O 4AX8A 3CZ4A 4ALKA 1PG0A 3WGVA 1TQ8A 1QQAA 2CW5A 2PFGA 2ZJ4A 1G9XA 1XNJA 3KELA 1EFHA 2O2GA 2HZBA 3QEKA 4JZKA 5CT9A 1L7XA 2GN0A 2ZVDA 3D1JA 3D7LA 3IC5A 5FL7A 3IDQA 5BRNA 3DBRB 3ROQA 3QX8A 4WK0B 2YDXA 4RIHA 2P67A 3A05A 1FTGA 3R3SA 3IQIX 4TUYF 1CD5A 2EIXA 1D2EA 2JFHA 2P7IA 3ON5A 2K2QB 2Y1KA 1C9DB 1MC5A 3EXIA 3P2MA 4GBMA 4MK4A 2JJYA 2AN1A 4KLZA 4EJ2A 4MEBA 1PTKA 4CUJA 3P9SA 4LWPA 4G97A 2A9FA 1U6IA 1FNSA 2JFNA 5EC8A 3WKDA 4TYWA 1V5FA 4DMCA 4G0OA 3L5KA 3CRQA 4G89A 4MV1A 3QZUA 2KE5A 3WR5A 1QP4A 1UPUA 4EPTA 2B5VA 1HSOA 1G6HA 3DM9B 4ATNA 3V8PA 4JYBA 5AUNB 2AZ4A 1NURA 3E2PA 3P9QA 5HR5A 1MG5A 4IDDA 3G9ZA 3U60B 5CLQA 3I9KA 3Q7IA 3GEGA 1QMPA 2ABWA 2OR3A 1DKQA 1FFBA 1MRZA 5ITVA 2JIPA 2F43A 1TL7C 2LUOA 4D9BA 3FUVA 3QOXA 2CDCA 1OAAA 1RKQA 2ZIVB 2IUSA 1CLUA 1EBBA 4NEHB 5FI0B 1QTRA 3D6TB 3HS3A 3I92A 5F5LA 2GHIA 2AJ8A 4GR4A 3BRQA 3EVGA 1JJIA 1DX6A 1XKXA 2IOFK 4RL6A 4YCJA 1AMNA 1FNNA 5LMZA 7MHTA 5AT1A 1X3SA 5E7JA 2G9NA 3ZK7A 1HR0B 2NZYA 3CLVA 3PKJA 4RF2A 1K7EB 1NYTA 2C0CA 3BD6A 3MTJA 4HSEA 4Y2JA 3S55A 5JZSA 2J0QA 3OO1A 3A3NA 4PS1A 5BYJA 1VJGA 5KVVA 4QOEA 4KFRA 1ESCA 2HGSA 3WHLA 1O97D 3D8UA 3M4JA 5JJCA 5BT8A 3JASA 1M76A 1YOBA 3O3CA 3OHSX 1GTRA 3QEOA 2JLBA 3CR7A 1CDEA 2C95A 3HXTA 3B1XA 3UANA 4HCJA 3NM6B 1QK5A 1V48A 4MO2A 2HYDA 2IYOA 2IUFA 2PWYA 4PPGA 4ZRNA 3N3BC 4FS3A 2MSWA 3MJVA 4WY5A 4F5EA 1T10A 3P4XA 3WGOA 4S1VA 2H5LA 3RASA 1ISGA 1P6QA 5G3YA 3WB0A 4DIOA 3H19A 4QBHA 4S05A 3WWDA 3IBSA 1LSSA 4Z4FA 4K8RB 3TINA 1IE3A 1Z2OX 3BUSA 3JQ8B 2OILA 5HM6A 4U02A 1X8KA 4IH1A 3CVVA 3GUCA 3IA7A 1GT6A 4TKUA 3N6XA 3B8EA 2MT9A 1U31A 2BMFA 4GVPA 4IIJA 3HCPA 2IS1A 2QN8A 2NO7A 3UAWA 4KVFA 5KB3A 5E6SB 4UBJA 5J3JA 3D6UA 1CIPA 1MX9A 4JMPA 5EXEA 3GDHA 3LUPA 4DCPA 5JLAA 3T4XA 4CQJA 3AUUA 3GT0A 4RV5A 1E3MA 4MNTA 3MT9A 3NS7A 3O4RA 5D1NA 4FMBB 4YC7A 1GRVA 3E7DA 4HEHA 5FPTA 1Z4JA 2CDRA 1LPPA 1SXIA 1UZMA 2Y0EA 1JQKA 4JP8A 3WBFA 4AKSA 4C20A 3UT5A 4QJ5A 1Z4OA 1JDZA 1NI4B 4W5JA 3CX3A 2DRIA 4IOKA 5A4FS 3OLXA 1RNLA 2ARKA 4DABA 2XCSB 1G8MA 4B6FA 1DQPA 1Y1PA 1D04A 1ZM7A 3IULA 4A0FA 1GTJ1 5JS7A 3E8SA 2A78A 5D5QA 1YDHA 3D7KA 4KWIA 1YS2X 3GDOA 5EE1A 1NN3A 3BTUA 4KE6A 1E3WA 3KTOA 3F9IA 3VFDA 3W06A 2K4MA 2QL5A 1QCZA 1Y4UA 2DQZA 3QKIA 4B7UA 3EEQA 4IOLA 3ORRA 5BV1A 1ZCZA 3FSGD 5GONA 1ST3A 4AZTA 4N8SA 1E77A 4FDUA 1YQTA 3SOPA 5EMLA 4YONB 4DXAA 4E5MA 3PC2A 2W6QA 4FYIA 1PGPA 2J3MA 3OPQA 5ALFA 3AJRA 1V4BA 1SCAA 3O1IC 3LWDA 3RODA 1PFQA 2ACWA 1XTUA 1EJ0A 3FB4A 2VDMB 4PLWA 2JJ2D 4DNXA 3K3PA 4DG8A 4BLOA 1FJGB 1TLFA 4TXMA 4ZCIA 5EIAA 5LSAA 4HDNA 1VIDA 2D1TA 5I4KA 4N82A 1U2TA 2D0OB 2CCKA 3KQQA 3SS7X 1DJPA 1B76A 4OB7A 4E14A 3U16A 1LC0A 3K9GA 2JLAA 1YK1A 2VNIA 3W78A 2NZVG 3GLHE 2O5RA 4YUZA 4A15A 5E6SA 2QPLA 3GGPA 1BDBA 1R27A 4YAWA 2B7LA 1PR1A 2O7RA 4YP5A 2JGMA 4D8XA 1Y9DA 2JJ2A 1MC4A 2ZDHA 2ZYUX 4CCWA 5IK2D 1AHPA 5E7MA 3DJYA 3TAUA 1BKSB 2Z83A 5UKDA 1R0KA 3HY3A 5TMPA 2OWEA 2YYSA 5HDQA 3OJWA 4OI2A 3DEHA 1Q0QA 1AQIA 3DC7A 4MV8A 3SX2A 4YAEA 1UQUA 1VA4A 4C78A 3ANNA 4DV0B 3OCCA 2ZZNA 3WLNA 2I4RA 1HDOA 4LPSA 3NHSA 4ZJPA 5IDWA 1WKVA 5LZ5A 3NO4A 5KPJA 1RR6A 1ULSA 5JU6A 3TDNA 2FSUA 1Q7RA 1W76A 3QLUA 3Q2IA 3H9EO 2YINC 1RWPA 3MMPA 3LSTA 5L3SB 2CNBA 1FDWA 2C9MA 4QOFA 1Z5GA 4MRNA 2BMEA 2XX3A 5AH0A 3RYIB 3WSTA 3T3OA 3QEBZ 3LRPA 3DDUA 5CDGA 4IUBS 2OXFA 4BMVA 3RIYA 1GDHA 1K3FA 3JQQA 3LZDA 1I3OA 1TTHA 1IWOA 2XHEA 1FLDA 2DFLA 5ARDA 1SC1A 1YL5A 1M2KA 2CUNA 4MVJM 2AN3A 1LRJA 3L1HA 4XSVA 3DYIA 2XUAA 5GMOA 1ENYA 5JAPA 1EUDB 3H1AA 3K96A 3QFRA 3R3UA 5B3JA 3D3KA 3FPEA 1KP3A 3GLUA 2QU7A 4ZT2A 1XVAA 4LYAA 4OQPA 2PAFA 4YECA 5BQPA 3TKLA 4FM9A 5K4HA 4DIUA 1YCGA 3E48A 4O1HA 1IDN1 3NNSA 4F2GA 3KALA 1KBQA 1N1GA 4ENTA 1WVIA 4CMHA 1IVSA 1QH0A 5TX7A 2HV8A 3ZJYA 5H0IA 5JVDA 4NR0A 1UM8A 3Q87B 4X1IA 4B3GA 1GNTA 1MW9X 4OXKA 2HQBA 4ZJZA 3VJMA 2EFHB 1RJWA 1O03A 3KYDB 4IVQA 4YJFA 3ELWA 1MZVA 1N5MA 2WT9A 4I3FA 4JB0A 4FLFA 2QPAA 4NE9A 4QDUA 4ZQGA 1A7AA 3H2BA 1N2HA 4Q39A 3LHFA 4RD0A 4PG5A 2AFIE 3RTAA 3ZVRA 2KLBA 2WMOB 5DP2A 1LRLA 2ZSDA 4LBYA 4PHGA 5IT4A 1L5VA 3EMBA 3NETA 4PPQA 1KZHA 1UC9A 5H70A 4EO4A 4YCSA 4B2IA 2B99A 3KOZA 5JW6A 1ZR2A 3T1HB 1P17A 2N1BA 2Y0PA 3BQMB 3KU1A 2O8CA 2DE0X 1SCNE 3IDSA 3VI4B 3EX7C 3MLBA 3GFPA 5EA2A 2H5EA 5KVCA 2AK3A 4Q3EA 3AM5A 3D9QX 3MWGA 2EHJA 4N0MA 1M54A 3D4BA 2EX4A 2JGAA 4RKFA 4QECA 2YKGA 5H02A 1MTZA 3PFFA 4PSCA 4TLLB 1E2GA 1LSOA 3SBOA 2OA0A 1RWMA 4PZ0A 4IDNA 4FW9A 3OOHA 3OJXA 1VMAA 2P2LA 2C58A 1N2CB 1VECA 2ZIXA 3IP5A 4X94A 4Y7CA 4Q9KA 3QY0A 4MGHA 5L53A 4LMBA 1MNAA 5CA0B 1FEZA 1J99A 1WCV1 1ML3A 1YVUA 1TAHA 1GYQA 1DU4A 3GA0A 2HF7A 3DDWA 4LVOA 2XLBA 4DCOA 1O7JA 2HYIC 1P74A 1XEWX 3ASZA 3N0XA 1JKJB 2C2MA 2GPNA 4JBGA 3EDQA 4IJQA 1IK6A 1S1CA 1YBHA 3C8MA 1EFPB 1T0HB 3AUSA 1AS0A 4H7DA 4JLDA 3K70D 2WICA 2NO6A 5JS2A 5JH7F 1JG6A 1JLHA 1NVTA 3T52A 3CT6A 3Q6MA 3FVRA 4UARA 1MF7A 1P1BA 4REQB 3T35A 4ZGBA 2AYZA 1ZMOA 3OEHA 4HNQA 4X85A 1J23A 2BGKA 5IXSA 1XAGA 1Q2XA 2NO1A 3G23A 2CSUA 2RAUA 2PS9A 1W4ZA 4N1AA 3VR1A 2IODA 1PZXA 2OV4A 3GD7A 1BU8A 2Y1FA 3S1LA 1GRQA 2SECE 2BHLA 5FBHA 5H3LA 2QU8A 3GRPA 5JYBA 1Q14A 2C3OA 3I2IA 1ISSA 1DDOA 1CP3A 1ZA2A 2C5EA 2QTCA 3GGDA 521PA 5B6PA 3C97A 4V0NA 4JV5B 3A3YA 3OM9A 3BHNA 1VJCA 1E7WA 3PUHA 4HYEA 4BNVA 4H7PA 1Q1GA 4D9HA 3FOZA 1XG5A 1UPTA 3EPHA 4HXFB 3IVXA 1YS6A 3MIIA 3AVUA 1VI6A 3GVHA 3UMFA 5C7IO 3G9UA 2GPYA 5FBLB 3T9BA 4Y1EA 1PZGA 2GH1A 3CX8A 2FZVA 2QEQA 3EIHA 3TPZA 3M5CA 1P2UA 4XYGA 5DYTA 4YH1A 1P60A 2R5FA 4QRIA 2E85A 1K0FA 2ZJ7A 1ZIXA 4JJ8A 2AOUA 1DFGA 1QVWA 4ZOQI 4F72A 2CUKA 3AR9A 3HABA 3JQAA 3KB1A 3EXHA 2VR1A 4US0R 4X6LA 2G82A 3COVA 1DINA 4NHOA 4DDUA 5CIYA 1ILWA 3GNSA 1RIFA 3AY3A 4G0NA 4MDHA 4Y0VA 5EJ7A 1EB9A 3HWWA 5IT0A 2MHCA 1Z83A 4ME6A 4CKWA 1A7KA 3NNNA 3QU4A 4KXVA 1N0UA 2XBUA 3VR6H 5MDHA 1VYHA 3H1FA 4C76A 5DM70 3FLEA 2P2DA 4L0DA 3RLIA 4JU8A 1J70A 5I8PA 4R41A 5CRIA 1CSEE 4BBPA 2FMTA 4X00A 4BAGA 1MCZA 2WYWA 4F3RA 3ODPA 1PFVA 2SKCA 3RJ9A 5GTDA 1K5PA 3F5FA 3N8IA 2ZRNA 3QSGA 5KCZA 4L9AA 5LJIA 2W2QA 3RKUA 3BCUA 3PX3A 5K3AA 4XWAA 2E4UA 2Z30A 1M2OB 4YRGA 1P2FA 1RCTE 1FUKA 1XA3A 2GJSA 3LDHA 3EVNA 3RU9A 1UFVA 3UWDA 2GJKA 2QLBA 5THXA 3JPWA 3HXQA 3M34A 2WWXA 2O2IA 2YZNA 2YWHA 4MV6A 3WRXC 1AQ6A 3WRYC 3ZJUA 5GAJA 1XTPA 4DA4A 4MEJA 2Q8PA 2FPOA 2CNLA 2AOTB 4TMYA 1N8KA 2GTPA 4OLBA 2GN1A 1FCJA 3DFKA 4TV8F 1WF3A 5KX5B 2OCLA 1L5SA 2XLCA 5H82A 1Y1LA 5IBQA 3HFGA 4DIMA 2VF7A 4DNQA 1R0BA 2WWWA 3RBAA 3WNDA 5GZ6A 3JVDA 3JQBA 3C5EA 3P2KA 4YASA 4ZI3A 5MGNA 3HJGA 1WPXA 2OD9A 1EG2A 3UHJA 3OUUA 3GJ5A 2ETXA 1ES9A 1S2MA 2BHTA 2PWZA 4JBXA 3S70A 1B0UA 3TBHA 1X7XA 1GG5A 3BAZA 2PHZA 5G02A 3VX3A 2X3FA 3W5BA 1OYWA 3IPXA 1TTPB 4K05A 2FZEA 4PINA 1IG3A 4G4GA 1GNRA 1I7QB 3AOEA 5B4UA 4HOYA 1RHQA 3DA8A 1GPH1 3SYMA 1K6JA 1CEQA 2UZAA 3COPA 3I45A 3O3NB 2ORWA 4Z86A 4ZT4A 3WAJA 1IJKA 3SHOA 3OECA 1E3SA 1U1EA 2QR5A 2BFAA 4FEEA 4HX5A 4D57A 2FA9A 3VH1A 3PWZA 3EW7A 4Q1EA 2W6CX 1P2VA 3ZE6A 4ZARA 2Y1OA 1FDOA 1PEYA 2FOLA 2JFFA 4NFLA 3WJAA 2ST1A 1UT8A 5JTUA 5T4FA 1XZQA 4Y1FA 4XWWA 4B3MB 4ZZIA 3HCDA 4ND6A 1GILA 3I37X 2HU2A 3L7OA 2I1QA 2A0KA 4MVJD 5F5NA 4WKPA 5CT8A 2W4IA 2FUG1 1QYWA 5IBPA 1KERA 1ZL2A 3MAGA 1P5JA 2AW5A 4EKIA 1NNI1 3KEOA 3I04M 2IYRA 4QFBA 1X7HA 1MABB 1EQ2A 1C2YA 2QTZA 2YWCA 3L0OA 5DN6A 2C99A 3CRVA 3HN7A 2O4UX 4GNRA 1IWPB 4RGQA 2YFHA 2B1QA 4NU8X 3QKTA 4A0HA 4JFAA 5H5JA 4BJ5A 1KO4A 5F1YA 2HD4A 1X13A 3G8DA 2H65A 1G1MA 2IYPA 3LPLA 1D3AA 3NIWA 3R3WA 4KYIB 5E7IA 5TS2A 3DE4X 4MYRA 4TS1A 5KC8A 2XUDA 3IUNA 3TRKA 3EIOA 3CNOA 2D5LA 1KYYA 4JC8A 1SVKA 3JVIA 5AVRA 2R84A 3PGJA 2A59A 1P2DA 4HDKA 4WXYB 3K1AB 4E2XA 1O1YA 3KQYA 4RFVA 2GDJA 1T8RA 1FFCA 2FFJA 4E09A 2W42A 2DR0A 1H1LA 2Z5FA 1PLLA 3M9LA 1K66A 1P1CA 4I2VA 1E99A 3OQIB 4L3OA 1XZNA 1YRBA 2R25B 3HMQA 2P62A 4H1VA 1TZCA 3QBDA 5ALPA 1TJNA 3QENA 4LHXA 1EFVA 3N76A 3UKOA 4B87A 4YP0A 4C3OB 1C1DA 4LXIA 3PC6A 2C07A 4F5YA 3HCCA 6REQA 1U2RA 1JAIA 5JHHB 3I61A 4O4JB 3P5SA 3ZIAD 1ZPDA 2VXCA 4QBTA 5BR1A 4MVJF 4D9JA 4DLVA 2P4HX 3PNKA 2JGLA 1T1GA 4NI5A 1HC7A 3A6ZA 3D6NB 2HI0A 1C41A 1MJHA 1DOAA 1P0QA 1W5EA 2M32A 3L7AA 2GCNA 1QFZA 3CA8A 4RD4A 1PFGA 5KWIA 3K2BA 3LECA 3OA2A 4RWZA 1QU3A 2YTZA 2GD2A 1YDEA 1KY4A 1L7DA 3HBLA 5WRFA 4U9HS 5FEUA 4JI2B 1AXRA 4QTUB 2PKXA 4YIHA 2X8AA 3PV0A 5EHZA 1O87A 2IXFA 3VNSA 4W5TA 2C04A 4ERXA 3MS2A 3KZ1E 2W0SA 4YPFA 4C4SA 1TYEB 4BE9A 3AYXB 3PPIA 4MB0A 3ZD7A 1XK7A 4B0PA 3DV0B 5CM8B 5JZVA 3IJRA 3LGSA 2QIPA 3SZUA 1LJLA 3BGVA 1JU3A 4WBNF 1G6KA 1SQGA 3VU3A 3FFXA 3IOMA 3VV3A 2ZB4A 3QQPA 1E5VA 1D07A 3SAJA 1CR0A 3IP3A 4NXNB 2C9BA 4LXQA 1X87A 1E0AA 4DB4A 1EGAA 2VYND 5C7OO 3AF1A 4YT5A 3OT1A 3PWKA 3A6KA 3OTQA 3W2EA 3DL0A 4LBVA 3REOA 1EGMB 1PV1A 2CMKA 2ZUCA 3KHKA 4K9RA 4P0TA 1M1NB 3X44A 4XTCS 2XB2A 2WIFA 4I50F 4UNIA 5F98A 5F51A 1GG8A 4G6ZA 2E55A 4OH1A 4UMVA 1FXSA 5AKZA 3OZWA 1KQPA 3OG9A 5IF9A 2O05A 2GOYA 2ZRFA 5C51B 2NU6A 1SCJA 2YRXA 1BMDA 2GYYA 1ZUD1 2RIRA 1XXHB 4MWCA 3IPLA 4HDSA 4XUGB 1NXPA 1ONPA 1S02A 3LY9A 4NOMA 5E8JA 1NZJA 1FX0A 3R7WB 1HMPA 3MELA 1VPWA 2AUMA 1OFUA 2E4AA 2F59A 4GD3Q 5D85A 4YYZA 2MSDB 1I2CA 4LWOA 3WYNA 4AF8A 2P5SA 2HAEA 1GM5A 1KQ3A 2RB5A 4YFYA 1DKOA 1J07A 3QXJA 3R7DA 4FBLA 4CIVA 3OESA 1QNFA 2RH5A 1ODJA 2Q62A 2VZ0A 1XVLA 5K3BA 5T5QA 1Y4AE 3G2QA 2R00A 1GGKA 4K8OA 5D8DA 1CFJA 4N8DA 3DFMA 2Q28A 2B8WA 3LGXA 2P2YA 3L6OO 5KJFA 4J3NA 1ZR4A 2HRBA 3KQMA 1U2QA 3HB7A 4Z7OB 1V16B 3TB4A 1KVSA 1XR3A 5T57A 3U4MA 5JJIA 2D4AA 2JH8A 3AXTA 2GK3A 4AWBA 4JLOA 4AY3A 4DTIA 4G5HA 3DOOA 5B6IA 3BULA 3E5MA 2OQ2A 4DPKA 1QLJA 1GPWB 3JWEA 1CZHA 4LFCB 4I6JA 1BD3A 1EK0A 3Q0TA 3SF0A 1U1IA 2WOOA 3CF2A 4Q3CA 2OENG 1UWLA 1MDFA 2HM7A 2OAEA 2YNMD 5C4MA 4QBIA 4B17A 3U19A 4YT8A 4EYGA 1GNQA 4POAA 2VUHB 5K0TA 3G79A 3SJAA 1I4DD 2EW1A 2B82A 4JJAA 1NC3A 5E4JA 1KZ4A 1YONA 4PVDA 1WSWA 2QW1A 4ILKA 5TB5A 3B51X 4Z0PA 1OWLA 5IKOA 1BHO1 1DCTA 3WWZA 4DKXA 4YYEA 5BSVA 3DD1A 4YQZA 1JBQA 3F74A 2H1LA 3EXEA 3ZKAA 1WOMA 4J3FA 1XD2B 3K09C 4KVGA 3WNCA 2ZYAA 1YZQA 4K03A 3STTA 1S96A 3OU7A 4X7PA 1W5FA 4CLHA 4HAOA 2XVAA 1GAWA 3AEUB 4GAEA 4X1KA 4JBLA 1FMLA 3DV9A 5A0TA 2QXYA 2YVQA 3M1YA 2EKLA 4A6PA 1BXGB 4HAZA 2H18A 2JGIA 1GL3A 1FNDA 2FW0A 1Y5NA 3R23A 1GL7A 2XTMA 3OUZA 4Y6SA 5AI8A 5REQB 4R71A 4R51A 4YRRA 3U7IA 3EVZA 3U56A 1CEYA 2YZKA 3H13A 1W1WA 1CUSA 3RS8A 1I24A 2PD3A 1PD1A 2OFPA 2XNHA 1B8UA 4NCNA 4QNNA 4G9GA 4GBGA 4Y9DA 2X13A 4HVLA 4HB4A 1S01A 1J25A 3KE8A 2IEGA 4TTIA 3LXUX 4BZPA 4OHYA 1TZMA 3SDSA 1FSZA 5HX7A 3DW1X 5ERYA 5L7WA 1GVHA 5CXXA 2Y9PB 1T13A 3DF7A 3OOJA 2QI9F 1V5WA 1OGJA 5CVVA 5LOVF 1QHNA 5M5BA 1IXSB 4S04A 2ZREA 4GOND 3NBXX 3MSCA 4RLHA 1SIUA 2RJNA 2CLKB 4XQEA 5CNIA 4F3TA 3BH7A 1TLTA 1SXGA 2AEJA 2Z95A 2IF0A 4MW9A 4QGHA 4TV8B 1C3OB 3A06A 5HRAA 3F98A 1O6FA 1TJ5A 13PKA 3FKJA 3LVBA 3VSCA 3HM2A 5JSUA 4JXXA 2JLVA 1HQKA 1DC7A 3IRUA 3A6JA 3B9PA 1BVUA 1JSZA 3OY2A 4KKVA 2PFKA 1DX4A 3AKYA 3EXG2 2WTUA 5CMLA 4R2MA 4BNXA 3H84A 4TLCA 3EAQA 2OORC 3AW8A 4P3PA 1V7ZA 3NU1A 1B93A 3CWCA 2X9GA 4HF7A 1Z28A 4NV0A 5DI3A 2CLSA 2AH5A 4AQ7A 2ALJA 3ZWQA 4N5MA 3AQ4A 3DF9A 2OB1A 3SFTA 5EJ6A 1V3VA 3FIJA 2AX3A 1X7WA 5JCXA 5EOVA 2NV6A 1D2GA 2Z8ZA 5HBGA 4XDHA 1NM5A 1EXDA 2DGDA 2PL9A 4H4DA 3EWIA 5LIPA 2J9GA 2C20A 4FKMA 1OT3A 2W2LA 3F6BX 3KCNA 4Y6RA 1SIWA 4E15A 1KU6A 4ZCMA 4ZDKA 3V8EA 3U3RA 3A9CA 3TMYA 4E70A 3NUZA 1G18A 1QXSA 4UATA 1NMXA 3AKDA 4HAIA 1S5PA 1SXQA 1LU9A 1SBIA 1JFFB 3K4PA 3ZVMA 1FQWA 3C1UA 4ZREA 3TVYA 2AN4A 3EARA 1S7GA 4XLZA 1I5RA 1M6NA 3FM9A 4D42A 3VC3A 1FOEB 3K15A 1D5CA 4V38A 3G1UA 3R4VA 2IX3A 3ZHTA 4G8BA 5K2OA 4BV8A 2EF1A 3JATA 3IGFA 3LPMA 3IPRA 4M53A 4F4UA 4R68A 1US8B 4OATA 1ZCAA 3IBTA 1QGDA 1V11A 2VWGA 3R0VA 3WBJA 5H1YA 4G63A 4IQFA 4UZEA 4GXTA 1KMNA 4RKYA 1NF3A 1T3HA 5TMEA 1UXOA 1L5QA 4P4LA 4OLFA 5CH8A 4NBVA 3Q7QA 1MG0A 2E4YA 3U2QA 3ZOKA 1WTAA 2DMRA 1USGA 1Z06A 1ZK3A 3GEPA 1AK9A 1T8TA 3TQIA 3CUYA 3O83A 4PAWA 2IA5A 1DZIA 3HFJA 3NBZC 5FNVA 1MAWA 2BFFA 1RC0A 4AG3A 3VC2A 1U7TA 2GEDA 2YHBA 2QOEA 3L6EA 3PBKA 2RHOA 5G0TA 5FBRB 4CUZA 1UBHS 3WLEA 2HKIA 3USZA 1Z5PA 2F17A 1O6GA 4KIFA 4EW2A 5ED4A 1ZD3A 2YFQA 1BQEA 1UEXC 2FSSA 3JQBC 3PC4A 1ZXLA 3MWJA 4DA7A 4XCQA 3GNQA 3KT3A 1AGYA 1XZEA 5KIAA 4M2LA 3DVQX 2XDQA 3R0XA 5JQGB 3P4UA 1O9HA 1PJRA 4P92A 4EG8A 3M6AA 3S81A 1E2EA 4Q47A 4KO3S 4XM0A 1FX0B 4ZOLF 4BNJA 2QZJA 2P90A 5F77A 1USUA 5IN5A 3EMVA 2EJVA 1H93A 3LT5A 4OSPA 4EWLA 3QIAA 1IPFA 4YJ2F 1POXA 3ONNA 4RPHA 1TCBA 2QAGB 1LS1A 1MU0A 3KCQA 2G1JA 2I8CA 3KSMA 1YUBA 1A7UA 1YJBA 2J30A 3C14C 3CGWA 3KBBA 3NBYC 3U3XA 5LB4A 5GIOE 3OQBA 4AFNA 2VH2A 2AVNA 1DG1G 3EH2A 2A30A 2VHYA 2W2OA 4OJQA 2AMFA 4MI9A 1V1RB 2WJVA 4P5DA 1X1EA 1GPUA 2A5YB 3WLAA 3L7IA 1I1OA 1UMCB 3A9RA 3DE0X 1Z6YA 4YCMA 1EFRA 2I3BA 1FNBA 4W63A 4AZ3A 4EB6A 1I6KA 3GJ4A 1JAHA 1VBNA 2GXUA 3BXHA 3LUGA 1QAOA 1XSEA 4FFBB 1Q1BA 4HXGA 4FLEA 1I2AA 3A1EA 2ISCA 3R09A 5BY2A 5BW6B 1K4YA 5AM4A 4LQCA 1ZH2A 3P27A 4R2XA 3IOBA 4ZDWA 3VQTA 3TSAA 1A9XB 2YXDA 5CBPB 1LV7A 4GLFA 5BOVA 3TL2A 2GPWA 2QIOA 4H6WA 4CLRB 5THKA 2KBFA 2ZAOA 4IX1A 4PYKA 2VN8A 2WMDA 2BGUA 4GKKB 2W4QA 3USES 2ZR9A 1RWKA 4DC0A 3T1NA 4ER7A 5IVKA 4LYJA 1A9PA 2PS3A 3FYUB 3R0QA 2BJVA 2IC5A 4Z1OA 1ESMA 1DPGA 1UIRA 5B6JA 1MA0A 1FL9A 2G08A 3CINA 3RRJA 3LX5A 3GLFA 3C3WA 5IAKA 5IJZA 2VSYA 1C3LA 1KGSA 5LQSA 3AP3A 2QRUA 1Q1NA 2HJWA 3DWIA 3KR0A 4J1TA 4R1QA 5LP1A 3D2BA 1S0UA 4KX5A 4YRCA 5SY9A 4BS9A 3OKAA 1PK7A 2PMBA 3IL2A 3KB8A 3TGPA 1G3QA 1OX4A 1T5TA 2WRZA 4UEWA 4Z3OA 2BM8A 2L82A 4N6OA 1E0DA 1G60A 2P4SA 3G2KA 3PR3A 5HJEA 2N47A 2GCIA 5JBNA 1SXJB 2Q5IA 3UK2A 4KZKA 1QFYA 4MVJG 3L02A 4D9CA 4OP3A 3E9QA 1JLRA 1NLFA 3L8EA 4AD8A 5KTSA 2QNRA 2YMPA 3O8QA 1MEOA 1PR5A 2WTMA 4N0DA 3M6VA 3TLYA 5DASA 3GLGA 2YQ5A 3UAVA 2FG5A 3EDMA 1F8FA 1XWIA 3I53A 2Q5CA 3TR0A 1A9YA 3FPJA 5L3ZA 2CEKA 3QSYA 4RKRA 5CG1A 3UGKA 4XVRA 5JY1A 2OXRA 1Y3HA 2OZVA 2WIGA 1YKGA 1UC4B 2V7GA 4KJXA 1VHTA 1AURA 2ZJOA 4O3FA 2UVPA 2XCOA 1Q1QA 2ZUDA 5CNMA 5HMLA 1EBFA 2ZCVA 1A4RA 4G24A 4B46A 1HY3A 3NR2A 3U3OA 1ZUHA 1KTIA 1YQWA 4QYIA 2ODAA 4QT0A 3ZWCA 1NUSA 1V7QA 3CIOA 1NMEA 1YZYA 4G1BA 5JDCC 3HADA 4IWYA 1OT5A 3C4JA 3LZ6A 3QE3A 3TJMA 4ER0A 1RM3A 4D4LA 5KTMA 3UATA 3MGCA 1AIPA 1Z34A 5FLEX 1DUSA 2PNFA 4YUXA 1ZAYA 3VHXB 1KFJB 4ZAZA 1U94A 1YR2A 2OPBA 2IPAB 4BJHB 1FNMA 4C0HA 3PQ6A 3E53A 3AEQB 3NIGB 4BQRA 1TJPB 1PGNA 4UAVA 3BILA 4RTNA 1H2HA 1CY2A 2JC3A 1GKKA 4XPZA 2ZIUB 1B0ZA 1YZFA 1SHUX 4GKJB 2F64A 4A8JC 2HMSA 5FHQA 3D8SA 2FEPA 2YMLA 4A0GA 4FI3F 1KYZA 1AN0A 2H4ZA 4R54A 1H4VB 1BFDA 2H00A 2HSDA 2Z04A 1JDNA 1K8QA 4OXQA 4K9NA 3CMMA 5HIKA 3AILA 4CDRA 2PLWA 3LCUA 1BHJA 4PPFA 1QUEA 1EFKA 4EF6A 4OREX 1NJ2A 2OVFA 5EE3A 3TEFA 3WKEA 3IBCA 1FDRA 5CYFA 2NUTB 1QVVA 1U0TA 1U5BA 2AD1A 4JLWA 2RGAA 2OHHA 5ENDA 4YP1A 3JTMA 2O2XA 4RYLA 4PSDA 2ZULA 1GO2A 1E4OA 4GKVA 4LJ6A 5DT2A 3B70A 2WTAA 4LWZA 2UYGA 2K7ZA 2FV8A 1N5IA 5LUBA 1N4AA 4GEGA 4JD5A 1Z3CA 3TJZA 5A1JA 1I2BA 1C4KA 3LKDA 2CGEA 4RQUA 2QP4A 2P5YA 4G8JA 4CM8B 4GM4A 2X22A 3DBHA 3BXPA 1X94A 5MF6A 1K92A 1U28A 2CE2X 2XTZA 1M2OA 3BS4A 2G1PA 4WOKA 4NABA 4D9NA 3HCRA 4D6YA 2ZB7A 4YRZA 4XJXA 4GWLA 2FUG6 3KSZO 3SU8A 2Y93A 3FRIA 5CA0F 1MLDA 4EYEA 1UWKA 3OICA 1XEXB 1CQJA 4WCFC 4GYJA 2PSJA 3FNBA 2UZ3A 1HA3A 4PR3A 5LOVB 4HZUA 1IUOA 2BOVA 4TMKA 4RVFA 1X1BA 4ZYLA 5FA5A 4R0VA 3VDQA 3EJWA 1FFHA 1RHKA 2AOWA 3HGTA 4NEGA 5IYZF 5A3SA 4P81A 3RAJA 1ZVVA 3OJEA 1R0LA 1T0BA 3IP6A 1GLGA 2AZMA 2ZI9A 1V8FA 1MGPA 3VC1A 1FRVA 1YH3A 1FTYA 1M2WA 4GPD1 3PEVA 1QJ4A 4J0IA 1S3GA 1PJ4A 3JQRA 4FHZA 4G5FA 4GM0A 4IEFB 4EPYA 4ZZ1A 3HLYA 4U7FA 1WUJS 1XP8A 2W8BA 3DP9A 2Q9UA 4NCAA 4A36A 1CNFA 1MQ8B 1TW3A 2IS4A 3GPLA 2A0YA 3M8KA 5KSOA 3NB0A 1IVNA 3ZZTA 4BV9A 1S2GA 3I64A 1Q3KA 3E03A 1OB5A 1XTZA 1EIWA 1I30A 3QUBA 4F92B 3COJA 3IB6A 3NHWA 4N3GA 2AMVA 2CXSA 2DFPA 2OCYC 2OY0A 1QFSA 2C2XA 2GBLA 5LLSA 3VI3B 4ENWA 3UJNA 2VJKA 1A97A 2Q45A 3G8YA 4PZEA 4F85A 1ULBA 1XELA 3I6BA 3BJZA 5DWVA 2Y2VA 3LQRA 3C16C 2HL6A 5CYPA 4G09A 2FJPA 1TIKA 2XHZA 5A4JA 1RYFA 3FNRA 4OQXA 2E37A 1GXSB 1H22A 4UM7A 3DBRA 3E0QA 4F5WA 2F3RA 3PFWO 1M5UA 1SJ9A 1U1FA 2QGFA 3IAUA 2NU9A 3ES9A 2X2PA 3NHZA 4HHEA 4INAA 4F6RB 2IHNA 4DLPA 4D3DA 3G2LA 4DXHA 2C2HA 3BQNB 5KI6A 3F47A 3FFBA 3Q10A 2WF7A 1VBMA 3DJFA 2AFHB 3FYTA 3N6VA 3R8FA 4L07A 3SSAA 1IJFA 1EXMA 3DOEA 1KH2A 2ATIA 3FBTA 2VQSA 1FTNA 1LQTA 3K6JA 4H27A 3D7NA 5AXAA 1J1UA 3GZJA 4NONA 4YTEA 1N33B 3C4QA 1N2CA 3B7PA 4DLSA 3RSQA 1H6AA 1JG1A 3KJEA 4HN2A 5HTKA 2IVFA 3HO6A 3QFHA 3Q8KA 1OXMA 1DBSA 3SJZA 4F7DA 1BJKA 3LDFA 2QI9C 1SVNA 2A1IA 4OXNA 1Z73A 2K6GA 2ZRJA 4LY3A 3B85A 4DCMA 5I6DA 2B1RA 3VSAA 2Q3FA 3GGSA 3H8JA 4CEHA 3HM9A 2OGZA 1TVMA 1N5RA 4A0SA 5AVXA 2UZ1B 5JJ5A 4CF4A 3H2JA 5KYXB 2H1HA 4ND1A 1OCEA 5GV7A 4XWOA 4QYMA 3TEJA 4KV9A 1FVFA 3A1UA 4RK7A 3V8QA 1UBTS 5KX5F 3QPWA 3HR7A 3EIQA 2OCGA 4NFSA 2X86A 2IWHA 4GWGA 1TX4B 4WWHA 3EDRA 4U2EA 4K3VA 1W75A 1V6CA 1V11B 4PLHA 4XFDA 1ZL0A 1NXSA 2A1TS 1ZC4A 1HDEA 1EAYA 2R47A 2ZB8A 3E9NA 1IOZA 1C7FA 3GJ6A 4WMLA 5FIUA 1LH0A 4HTFA 4HQFA 4RS4A 3S68A 4TKVA 5HRCA 4B76A 4GDFA 1NBAA 3TZ6A 3IYLW 5EINA 3RSHA 2CXTA 2ZUSA 4R9SA 1SGWA 4IP0A 3M4XA 4BVGA 1COZA 4L4SA 3UT0A 3ZWBA 3MJEA 2QG4A 4LZOA 5J1SB 5CH5A 1WHTA 3H1BA 1YZ3A 5F2NA 3P8ZA 2N9UA 3DGFC 3DMFA 4Y2XA 3AEYA 1MOSA 5BUZA 5C3MA 4LISA 4OJTA 4ZO8A 4OHKA 3MMNA 3B12A 4RADA 4CM3A 2KX7A 3CH4B 4OL9A 2XTJA 4EHBA 5M29A 3RJTA 3AP1A 3P0RA 3F3MA 2H3EA 4D3YA 1I0IA 3VX4A 3ROEA 3DR5A 4KAXA 5FT9A 5NLLA 3UK6A 2NACA 4CI9A 3UGTA 4I9FA 3GHHA 5TJ9A 4LFBB 1YJ5A 3F6SA 1HOXA 2UXDB 4MKRA 1SD2A 4YQFA 1OZ0A 3PUZA 1P5HA 3CS3A 4NMLA 3RABA 3VXKA 3FUWA 2V0NA 2XDYA 3RUAA 5JEDA 1U63A 5KNBD 2JD2A 5HWSA 5CTAA 4MIYA 4MTLA 4PQYA 4JUCA 1OLXB 3CNNA 2YJ3A 1PJSA 3JU3A 4YCLA 2ZGVA 1I4TD 1SU6A 4KO2S 4DPMA 1DEAA 2G17A 1ZP6A 1LWOA 2WLSA 2QQ5A 3A9TA 1RQGA 1UWVA 2Z56A 3KAKA 4FFSA 4UEOA 4B31A 2BEVB 3VKHA 4II3A 4B6OA 1XU7A 2HO4A 2EF0A 4LMPA 1L1RA 4B79A 1P4JA 2J3EA 2UUPA 4Z99A 2FOXA 4ALIA 2JLZA 4B45A 1WQ4A 3ZKWA 1YNOA 2VG8A 2M98A 3C8DA 3JZDA 5IU6A 4O2LA 1Q0ZA 4MR8B 3ZU6A 4DMGA 1E2KA 4ND8B 4PLPA 4MP6A 1PP4A 1WCIB 4J7AA 3IAM6 1WU7A 2B35A 1MB2A 2JZCA 2QX6A 5ETJA 2RFLA 1OROA 4YBRA 4A6XA 2ZUEA 3RO7A 2FPRA 4P3OA 1BGXT 1ZVJA 1U28C 2QN2A 5ALVA 3RKSA 3RUFA 4AO7A 1T4CB 2AS0A 5JPIA 3MUFA 4R16A 3QVLA 5I45A 2DUUA 5JEEA 1F1BA 3ZGNA 3A10A 2I76A 4H08A 1ZIDA 4H3KB 3M3DA 1L5KA 5KTTA 3FLBA 5FLYA 2ZRCA 4M0CA 4FU0A 3MYYA 3WSVA 1G2PA 1F2DA 4C1NA 5I9LA 2TS1A 4XFJA 3THWB 5JYEA 3SQNA 4HAVA 3ENVA 4RXMA 4V0SA 4AMUA 2M9MA 3CNLA 2P4EA 3LLUA 1N57A 3HDQA 3SNKA 1T34A 5LVAA 1V5EA 1ULTA 1Y1QA 4F11A 2OQRA 1Y6FA 4R40A 1A9RA 5I7WA 1ULUA 2QR2A 4Z3DA 2F3UA 2VCEA 1KJZA 1KJIA 3F49S 4OP1A 5J2UB 2Q41A 3QFCA 1B3RA 2ORED 5IDYA 1WBDA 4HZIA 3IE2A 3ZI7A 1WZUA 3IMFA 1RWNA 5CTJA 3UK0A 1KAOA 1E1QD 2IPLA 3I30X 3OETA 4XWKA 2H1IA 2VYFA 3RBXA 2P9HA 3BAFA 2XTAA 3T9EA 5C8ZA 3AEKA 3JQ9A 2A7QA 3MJCA 3FFTA 1ITZA 3E27A 3PSAA 4ER5A 2XAUA 3BM5A 1PK9A 1QO7A 1NXQA 4E5VA 2RGBA 1RRKA 2FSHA 3DO6A 3X2SA 1A77A 1CV2A 1VJ1A 5CCEA 3AVTA 4WN3A 4GSKA 4L0CA 5DLQC 2P78A 4KMMA 4UHHA 4AP9A 5TV2A 1JR2A 4BO4A 3GCDA 1TIPA 1TB4A 2GJ9A 3JYLA 1FLVA 4OBXA 4WA7A 5FOUA 2QQGA 3ZIUA 3JY6A 3F2IA 5EUQB 3HE3A 1SO8A 4KMRA 4MV7A 2GCOB 1SCUA 4YP9A 1C7RA 1E2PA 2VAWA 4UHFA 2I6QA 4UTXA 4Q34A 2I2FA 4C3VA 1FMCA 1JMVA 2LBPA 5IEJA 3SIXA 2WAXA 1JT2A 4IRMA 1DJLA 5D5PA 3S2YA 5K9ZA 4XLTA 4F6CA 4BY9E 2WNHA 3HMKA 2WOJA 3H5IA 4LYEA 5A6SB 1M6VA 3QX7A 2MYUA 5AKHA 5LZ7A 4UOZA 2FR1A 2BT4A 4H9GA 4D4GA 4FFRA 1C3VA 1HFKA 1Z6PA 2N46A 5FHRA 4LWQA 1X42A 4LOJA 3FOFC 3HJBA 4OAOA 3Q12A 3GB9A 2P3QA 3QI7A 4Z49A 3IUJA 4WZ6A 4DT1B 1ZJ5A 2PJRA 4LJ4A 3K7EA 4MV0A 1BXKA 2OFXA 4NMWA 4UJ3A 5K3CA 3DNPA 2OEPA 3K1AA 1J49A 1QZTA 4NYJR 4B6GA 3FTEA 2FGJA