2FXIA

Arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, hydrolase
molecule keywords Protein arsC
publication title Interplay Between Ion Binding and Catalysis in the Thioredoxin-coupled Arsenate Reductase Family.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fxiA00
3P9YA 4EVSA 4RK0A 4MR8B 1RZRA 4HNSA 4Q7EA 2V0NA 2M1ZA 3GRCA 2NZVG 3QK7A 3QLUC 3OLYA 1JH9A 4RXMA 1JFTA 1MVOA 3JPWA 3LUKA 1J56A 2A9OA 2WRZA 3MIZA 4NCAA 1GCAA 1R8JA 4MS4A 5CHYA 1TM2A 5IBQA 4E7OA 4PZ0A 5JNWA 1NXWA 4KREA 3QLTA 4F3TA 2E4ZA 1NXSA 1AB6A 4EVRA 4B09A 1LJUA 1D5WA 1DBQA 4EYOA 1DBWA 3QLVA 4WWHA 2CHEA 3QEKA 3BILA 3HUTA 2IPNA 4RXUA 1FFGA 1L5YA 1ZGZA 1HEYA 2ID7A 4YP9A 3F73A 4RU1A 3LUDA 3TB6A 2QXYA 4GPAA 5FBHA 4NICA 1DC8A 3F6CA 2JCGA 2L2QA 3DZDA 3H5OA 3CKMA 2B4AA 2PUAA 2DRIA 3KJXA 2RJOA 3OMXA 3MA0A 4YV7A 4W5QA 1Z25A 2FQYA 2PUGA 5IX8A 3HXMA 1YVUA 2FMKA 4TLLB 3HK2A 3RH0A 2FEKA 1D1PA 2A9RA 5B3JA 1SXGA 4RZSA 3BREA 1BVHA 1M2EA 2NT3A 3KLOA 4KV7A 5JNUA 3T38A 6ABPA 2QVGA 3SNKA 4KVFA 1AB5A 3CHYA 5TPWB 1K68A 1Z2DA 1JLKA 1CHNA 4G0QA 5JS1A 2JVIA 3TMYA 4RDCA 2FN9A 2QSJA 4Z99A 3KTOA 5FWXA 4N03A 5TE9A 4WT7A 4S05A 1Z12A 3RVLA 3ILYA 5KI6A 4RK5A 3MF4A 3KKEA 1Y1LA 3OM0A 5IUKC 3RVRA 3SAJA 3CNBA 1ABFA 4G0OA 5DCLA 4Z9AA 3H75A 4MS4B 4O5AA 2CHFA 1KRWA 1D4ZA 1QQBA 2KYRA 3HO1A 3OLXA 2MYTA 1QPZA 4P1ZA 4IGAA 2R4QA 3JTEA 3N0RA 4LX8A 4D6XA 2JVJA 1S8NA 1U8TA 3JVIA 3OLVA 5CNMA 3CRNA 4EY3A 5KQMA 2F8TA 1QP4A 2FN8A 4O1HA 3KS9A 3OQNA 4ZMRA 3M6MD 4N47A 5KQGA 1A2OA 3MQ4A 3RVQA 4XARA 4RXTA 5PNTA 3CS3A 1MB3A 3A3KA 3CLKA 1DG9A 4JAVC 2PUEA 1YMVA 4Q6WA 4RK1A 5IC5A 3T8YA 3C3MA 3C3WA 4ETNA 3A0UA 1YK1A 2WMYA 4KQ9A 1QQAA 2VYCA 1P6UA 1PNRA 1NTRA 3H1FA 3BBLA 4WZZA 3SY8A 3NNNA 2FEPA 1U2QA 3Q41A 3D8UA 3NBMA 5F64A 3K9CA 4RSMA 3EGCA 4KFCA 2HQRA 4DQDA 4JB2A 1DRJA 4YGXB 2PAFA 2QVCA 3OLZA 4G0PA 2BGGA 3W9SA 5HM6A 5CNJA 4EUKA 2M98A 3GV0A 2YHAA 1PHRA 1DCKA 7ABPA 2Q5CA 3Q9SA 4UHKA 4KK3A 3SM9A 4MYRA 3OO1A 4XASA 1KMIY 2ZWMA 3B2NA 3FFWA 5JNVA 3NHZA 4OBBA 4RV5A 2L18A 1RXIA 2QV0A 4RY9A 5TPWA 2GWRA 4FB4A 3LKVA 5FWXB 5EWMB 2JBAA 2MSLA 1JBEA 4YRZA 5E3JA 4O1IA 1BA2A 3F6PA 1MAVA 2LIVA 1JDNA 4MR9A 3M9WA 3VNAA 3H5VA 3O74A 4ETMA 3N8IA 1C4WA 4LE1A 3RQIA 5JNRA 3JPYA 4Z9BA 2LP4Y 4G0YA 5KQPA 1ABEA 1JF8A 4P98A 3FGZA 1E6KA 5IULC 2FQWA 4ZYLA 2IKSA 1JX6A 2XDYA 3FMVA 2MSWA 3EJWA 1DCMA 4RKQA 5TQJA 3N53A 4L85A 1JDPA 3LMKA 1E6LA 4MS3A 3IP5A 4WUTA 5EWLA 4YR7A 1H9CA 1B00A 1XHEA 3IDOA 5D2CA 2HSGA 1XWWA 1ISSA 1APBA 1IIBA 1NATA 3CG0A 2PUDA 2IPAB 2WB4A 3RVMA 4EVQA 3E61A 2FMHA 3DGEC 1BAPA 3IP9A 3N6VA 4JASB 4RK7A 4ZPJA 5JS2A 3RVNA 9ABPA 3O21A 3Q15C 4YLEA 1A04A 4LE0A 3TX6A 5JNSA 3O1JC 5KQLA 3N0WA 2E4XA 3H5LA 1GCGA 3MMNA 3H6HA 4LZLA 4MQEA 2PUBA 3KYJB 3LFTA 4JP1A 3O1IC 1TLFA 1U04A 3GA5A 5TQ2B 2JVKA 4Z4GA 3QLUA 1LBHA 4YCSA 4F11A 1GUDA 1JFVA 2MYPA 4ETIA 2F8SA 2LUOA 3HZHA 1U0SY 3LUAA 1Z13A 2VK2A 3OLWA 1QP0A 4RWEA 3Q7SA 1ZN2A 4OLBA 2MYUA 1GUBA 1NXXA 4JA2A 3CFYA 2AYXA 4N0QA 4MLDA 4WXMA 4N76A 4H3HB 1BDJA 1QO0D 2JBAB 4RS3A 3ILHA 1ZITA 1TVMA 3MM4A 3DLHA 2LPMA 3IPAA 5FWYA 2R25B 3QEMA 4OLAA 4LE2A 4MR9B 1FQWA 5DLEA 5EWMA 3OQMA 3IP6A 1NXPA 2WY2D 1RNLA 1M5UA 1YMUA 1RPJA 5T3YA 4H3KB 1L5ZA 3F7NA 1OXKB 3T95A 3OO0A 2FMFA 4G0XA 1WETA 3Q7TA 3TO5A 2FKAA 1F51E 1D2AA 2CD7A 1FSPA 4MR7A 3GWGA 3OM1A 3RVJA 2GI4A 2PLNA 1ZH2A 1LK0A 3EAFA 3FFTA 4MS3B 4XLTA 3EDCA 2LBPA 5EWLB 3GL9A 4PICA 3I45A 2FXIA 4WXEA 5BR1A 4D74A 4Z4FA 1ZY2A 3O2JA 4LRQA 5DKFA 4CBVA 3KSMA 4M88A 4G97A 4MS1A 2PUFA 1JFSA 3GBVA 1Z17A 1PEAA 1FFWA 4UHJA 2A9PA 5FWYB 3OMWA 4G86A 1JWLA 2E4WA 4Y9TA 3OQOA 4Z4IA 4DN6A 4LDZA 3DLBA 3D02A 1C0EA 1USGA 4HNRA 4KQCA 3CZCA 4HYEA 2PMCA 2VUHB 4MQEB 3MYYA 3SG0A 4RKRA 2IDMA 1U2PA 2P9HA 1EWKA 2QU7A 1YIOA 5EWJA 2QR3A 5FBKA 3LTEA 2L19A 3L49A 5TQ2A 1KGSA 2N9UA 4G0ZA 2FLKA 2AYZA 3Q7RA 3VNBA 4EGSA 1GLGA 2HQOA 2NT4A 2WJAA 4PE5B 2J48A 4TN5A 2HPHA 1NXVA 1BDIA 3LUCA 3HS3A 3LUGA 1SRRA 5KC8A 1JYEA 3O2QB 5IEJA 1DJMA 5JNTA 1EFAA 3HSYA 2IPMA 1TJYA 2NZUG 1FFSA 2QW1A 5IEBA 1SD5A 3QEMB 3CU5A 2R48A 3QELA 4KMRA 4MGEA 1VRVA 1D1QA 3HDVA 4EYQA 2IPLA 2PE5A 2RDMA 2A9QA 1A0OA 2YHBA 3HVRA 4N41A 2W42A 2PL1A 1USIA 1M5TA 1E2BA 4G0MA 1W9HA 1JHZA 2FSPA 5C5CA 4MR7B 1I3CA 4QICA 4XAQA 1EAYA 1QO0A 2L17A 4Z0NA 4F06A 1Z15A 4IMIB 1ISRA 1LJLA 2RJNA 5BRJA 1P6QA 5TPZD 1QKKA 3H1GA 2RGYA 1Z16A 3DBIA 1JYFA 5BQ3A 5HSGA 4KK4A 2ZAYA 3O2SB 4MS1B 5GOTA 5C5EA 3NHMA 2WJWA 2PKXA 3R0JA 2PJUA 4EYGA 3KYIB 1QP7A 3G1WA 3BRSA 3HUUA 1ZHHA 2GX6A 2JK1A 3IP7A 2FTKE 4RK4A 1T34A 1DBPA 8ABPA 2JRLA 3EQ2A 1DC7A 3UUGA 1MB0A 3ROFA 1NY5A 3O75A 3K4HA 4MAAA 3KLNA 1YTUA 3HV2A 3BRQA 5EWJB 5HKOA 2H3HA 4QYMA 4YO7A 3T6KA 5KWSA 6CHYA 1F4VA 2E4VA 4GNRA 1ZVVA 3H5WA 1BDHA 2MSKA 4F8JA 3KG2A 4TMYA 2IOYA 4RY8A 4Q6BA 5DGCA 5KC9A 2OENG 1P2FA 3SQNA 4ML3A 2X7XA 1YK0A 3G85A 3RVOA 4KNYA 3JY6A 5TQ0B 3QELB 5CNKA 3RVPA 3FFXA 2B1JA 3QX9A 1RXEA 2HQBA 3GYBA 1VKRA 3RVSA 3RVKA 4XXHA 3NNSA 1UDRA 2TMYA 1NXTA 3C6QA 4ZJPA 4IMJB 2FMIA 3EODA 1NXOA 3S99A 3UKJA 1CYEA 2FW0A 1DP4A 1KRXA 4OG2A 1ZGGA 4MRMA 3A10A 1USKA 1ZH4A 1Z18A 4MQFB 5ABPA 4Z4CA 1CEYA 4ZMSA 1RZRD 3L6UA 2CWDA 4JB0A 4F12A 1PEYA 3N0XA 1Z2EA 3GT7A 4QPJC 1ZESA 1SXIA 3JS5A 5IUNC 1URPA 1TMYA 4HNQA 4RY0A 4LDAA 4W5RA 2FVYA 3HCWA 3LOPA 4FE4A 3C97A 1ZDMA 2P4UA 3H5TA 2QZJA 4OATA 2IYNA 5CNIA 4NQRA 4MR8A 1XHFA 2E4UA 3URMA 3N75A 3HEBA 1K66A 3TD9A 5TPZA 4D6YA 5T7BA 3LUFA 1W25A 5BRAA 2NUBA 5GQSA 2E4YA 4TLMB 2PUCA 3FDFA 4W5NA 3UK0A 3CG4A 1PNTA 3QX8A 4W5TA 3NNDA 4Z4HA 4H60A 5ED4A 1EWTA 4DADA 3I5AA 4MLCA 4N0PA 3HM9A 4MPTA 4Z4EA 4EYKA 4OTZA 5I4CA 1QMPA 4NV3A 3EQZA 4PEVA 1E6MA 4KZKA 2O20A 4PYRA 1JL3A 4E7PA 3GBPA 3EULA 2OQRA 3IPCA 2VUIB 2HJ9A 2H0AA 3KHTA 3M9XA 3ROTA 1QNLA 1DRKA 1MIHA 1SXHA 3JVDA 2WWVD 4FE7A 2GKGA 5TQ0A 1OXBB 1P8AA 2I6FA 3KCNA 2ID9A 4IILA 3I42A 3DGFC 5DTEA 3A0RB 4KPYA 3QLVC 3CZ5A 2PL9A 4KRFA 2GBPA 4XFKA 2R47A 4MRMB 1YS6A 3H1EA 3O1HB 4NCBA 2JB9A 4JOQA 4L4UA 1M2FA 1DZ3A 1LBIA 3LUHA 2MYNA 1EHCA 3E3MA 4MQFA 3H5IA 3LUJA 4QYWA 1VPWA 3CTPA 3LKBA 1EWVA 4W5OA 5HQJA 4IF4A 4YWHA 5IUJC 3C3KA 1YS7A 4RK6A 1Z26A 4IRXA 4YS6A 3HDGA 1ZAYA 3HJFA 2FLWA 2FEWB 2FQXA 5B3JC 3H6GA 3I09A 1DCFA 4S04A 1PUXA 1VLZA
chains in the Genus database with same CATH superfamily
4NSNA 2I34A 1M2WA 4RK0A 1UOQA 3R3YA 3T7IA 3QLUC 4E30A 3OLYA 1BEUB 5FJJA 4IH4A 2DPHA 2WKWA 3JD2A 3KEFA 1NZDA 4FSDA 5HMMA 5G1PA 1S8FA 1W4BA 4XQ0A 4YV1A 5DN6D 3MTJA 2EZ8A 2WD9A 4PHFA 3E70C 4PX5A 1WO8A 3VR5H 2EATA 3WGUA 5IASA 1OT5A 1P3Y1 1EUCB 1MD9A 2FLVA 4D5EA 5JI3E 1RW4A 3B8EA 3QEKA 3LV8A 1QG6A 2PH5A 4QC2A 3VHXB 1N92A 3GLIA 5C31A 3TW4A 4H15A 2PX4A 3UXEA 4ZO4A 3RUHA 4RU1A 3ZCTA 1BMFD 1UDWA 4GVPA 1G6KA 2X8LA 2AB0A 1EEXB 1US8B 3MHPA 2OBNA 5KQSA 4DMMA 3DZ8A 3N58A 4LI3X 3D8SA 3ZJ5A 1T2VA 3DEKA 3PE3A 4TMKA 2JEOA 4C4SA 1LGYA 1YZTA 4CM8B 4B4WA 4DA6A 1KMMA 5BSVA 1LU9A 3H2KA 1DUVG 1G7CA 1L1QA 1L5OA 1K06A 2CYBA 5FF9A 1UDAA 3F3KA 1D1SA 3KRTA 4LMRA 3RH0A 1AS2A 4HO1X 1J0BA 3FVTA 4MUKA 2QXUA 5DV9A 1IUOA 2DLNA 3HFGA 3LZCA 2ZRLA 5TMDA 4D9FA 1YR9A 3R7NA 1TAUA 4Y2SA 3ZHRA 4ZOLA 1J2RA 1TTTA 4H6WA 5GZ3A 2H7VA 1DJNA 1SOUA 3WKBA 1FNSA 3OJXA 4KFUA 3HBMA 4CMIA 2XH8A 1EB8A 4HNUA 3CHYA 2UZ0A 2OAEA 4ZKEA 5IANA 4ZZ0A 3HGQA 4E1BA 5JLJA 2PX5A 4G0QA 5K0ZA 3BRCA 3HBJA 2DY0A 2O2JA 1BXRA 4TTSA 1XMQB 4L5AA 5K4GA 1NP7A 4QQKA 3GPLA 2IH5A 3U7JA 1DAOA 4DRYA 1EKXA 4FPXA 5K7SA 4F3YA 4XWGA 1QHHA 1EBBA 5J1SB 2C00A 4HGZA 1CULC 3KETA 1QU2A 4OHWA 4RVGA 4X91A 3C3EA 1YMQA 2XOKA 1FY2A 1DEHA 1NX9A 2A88A 2YXNA 4GKBA 3DLCA 3FHCB 1TZCA 1WP9A 2HAEA 1EFPA 1RJWA 4LDQA 1LC0A 1XMJA 4OBXA 1B6SA 5H1YA 2FI1A 4IGAA 4KBGA 5EL0A 1C3JA 5B2ZA 3N2KA 2GN6A 1V26A 1KS2A 4WA8A 5DJ5A 3C5EA 3CIOA 3C39A 5TMEA 2DHCA 2IJGX 1TQ4A 1Z56C 3SZUA 2FSHA 2XUKA 3LLSA 2ZSDA 3TM4A 3Q3JB 2EHJA 5LXTF 3IPRA 1JVNA 2WV9A 1HORA 2ZZNA 4GQIA 5KQGA 2R5NA 5GJVC 3VR1A 4MP3A 2NZ8A 1R74A 5AQEA 4LOIA 4Q4JA 4UAVA 1F17A 2OO3A 1TQHA 3A06A 3G0OA 5CMLA 3TVYA 1MHPA 3G2QA 2XWSA 2WMYA 3D3EA 2LRHA 1I24A 3UICA 5G40A 3L7LA 2VK4A 1H2XA 2VPZA 3LPAA 4BFYA 4CIYA 4FDLA 2J7KA 1UZUA 4KR7A 5C7YA 1U3FA 4EFMA 2B7CA 3LP5A 5F7OA 1PWXA 2W48A 4ZOLB 2Z58A 4YGXB 1ECPA 2XA9A 2F8LA 1WSAA 3MRSA 3GV0A 4QVGA 2XB2A 3GJTA 4CMIB 1TZMA 4IFTA 2LCQA 4C0XA 1U9ZA 5I51A 4M1QA 1G8HA 3GK3A 1FDUA 2ZEJA 4FGZA 4I50F 4KK3A 1GRNA 4RZ3A 4WRRA 1L2TA 1EE1A 1Y98A 3NHZA 3VVMA 3H9BA 4AJIA 2GPAA 3JQDA 4CKCB 2CD9A 5K0BA 4HOYA 1S5PA 2KJQA 1M6HA 4ZEVA 4YUYA 1W88A 3NHWA 3KKNA 4CLDA 5EWMB 2JBAA 4B4OA 1QHHB 2VRWA 3WQBA 3HB4X 1ZCJA 1M75A 3EX7C 1W35A 3IMEA 1DKPA 1OX6A 3D2AA 2CNOA 2JGEA 2HA7A 3LY9A 5G4KB 3QVGB 4C7XA 4YECA 5F76A 2C9ZA 4E6PA 4CLOA 2IS1A 1PT5A 1EA7A 2H51A 2PS9A 3RQIA 5JNRA 1P4GA 5DDIP 3V4SA 5BSGA 1QLWA 1WB6A 2OZVA 1N77A 1XSEA 3RIXA 3ZNPA 5AVQA 4P98A 4EZBA 4PV7A 1ETUA 3OFVA 1Z5VA 2IKSA 4NZYA 4XWOA 1SUWA 4K40A 4QELA 4W99A 4WVLA 4QKQA 1I10A 2DWQA 3N2KB 3SZGA 1WXEA 1YL7A 2MSEB 5TC4A 4EPTA 1E6LA 4IRMA 3NHPA 1BHJA 1CX9B 1JW9B 4ZC1A 1ZOSA 1WXWA 2Q46A 5IDWA 3HFRA 4FZ3A 3FLAA 2XKJE 3T5CA 4OXIA 1IBLB 1B6GA 4FFLA 1NW6A 3U3ZA 1LLDA 2PZMA 3R9IA 2C88A 3GLVA 3AR2A 3FPSA 3D4BA 3K15A 3L0CA 3QY9A 2WB4A 3OOEA 2P65A 2J45A 3DZCA 4LJKA 4CM3A 4DR4B 3CLTD 3N6VA 5JS2A 2X3YA 3HSKA 5DISB 4BVLA 3MCVA 1U0OC 3KD2A 3Q15C 1R4NB 7ADHA 1CW2B 1G20B 2JFQA 1L5HB 2GRAA 2V4MA 3BA1A 2SECE 3BA6A 2IW3A 5F52A 1OB5A 1C1YA 3GJZA 4KBFA 1Q57A 4OJQA 3GGSA 1K7YA 3GRAA 1Y4ZA 3JAKB 3OJEA 5ICFA 4BNIA 5IPFA 1ZLXA 4OQEA 3BDIA 3M2TA 1U0LA 4HF7A 4UVDA 2ZT7A 3A32A 1VRCA 2I71A 2JGNA 3AIMA 2WNIA 5DZSA 1HFJA 3B1ZA 4JEMA 1EVJA 2XWPA 4KQMA 5HCNA 4PG7A 3W06A 5J4LA 4BP1A 1PVOA 4FEEA 5FPKA 2BMJA 3UJ7A 2OWEA 3OA2A 2OM2A 2PGJA 3E9RA 3RUDA 1LH0A 2OOSA 2GK4A 3JQ9C 2FJUA 2XCLA 4R1MA 1UFKA 2Y1OA 5DASA 3SS8A 4RWEA 3MCAA 5KYKA 2NIPA 1XQXA 5C52B 3FZQA 2JD1A 3HRIA 2HQSA 4HXYA 1W88B 1JSCA 4OOFA 1JSLA 2BDEA 4WXMA 2JBAB 4OB6A 1PBNA 1A2QA 1YKSA 3DB2A 2I33A 3QKIA 4RS3A 5CX1A 1HFWA 4CZ2A 4KFSA 1SAYA 4CLOB 4DSAA 3CO0S 3DE0X 4EH1A 2CXSA 5C4GB 1K6JA 2WNSA 3A9SA 3KLMX 2GBLC 2FFQA 4KGXA 1GQ2A 4L5YA 3R2JA 4LJRA 1FOEB 2GGSA 3FB1A 4I6JA 1OTHA 4OCZA 4XH9B 5JRJA 1XEAA 4O4LA 2PVPA 3RASA 2G9ZA 1P61B 1VHLA 2Q3DA 4X7RA 1GU0A 2NO5A 2R66A 1OB2A 1NVVR 1L4KA 1WIWA 1EUYA 4REQA 3GN2A 4XSVA 4D98A 4LXGA 3E9QA 4E15A 4P8RA 1MN6A 4FFRA 5KTSA 1HYHA 4B45A 1ZY2A 1UM9A 2AW5A 1OIVA 4ND7A 4FCWA 1PZFA 1WV0A 4HRXA 4WERA 3RRJA 4DQLA 1FRFS 4CF5A 1Q7BA 1UKAA 3OE1A 5H83A 3V1TC 2X2OA 2PUWA 3GBVA 3IOYA 5L3RA 2YJ5A 3LCRA 4GPEA 4QWWA 2ZSHA 1J5EB 5LQDA 1JWLA 2E4WA 1A9RA 1LUAA 1XRNA 3OQOA 4N40A 4LDZA 1FRZA 4C9BA 5LU9A 1HO3A 3IEMA 5D6NA 4ZYZA 2WK1A 1YHYA 4X63A 4B4DA 4IOJA 1CQWA 3QUQA 2YOHA 5YASA 2G0TA 3AR7A 2BZGA 2IDMA 5JHGB 2YV3A 4HLNA 5CCXA 3ENNA 3HUDA 4ZODA 2B69A 1NVBA 1AS0A 4OQ4A 2QR3A 3IURA 3H2GA 1SIOA 1VSQA 3N8KA 3NEYA 1AA9A 5LOVA 2EP8A 3H9EO 4BAGA 3MOIA 4ZHSA 5BYBA 4XDZA 2N9UA 4DJEC 4GOKA 3Q7EA 4MWEA 4UU0A 3SJ7A 4Y2GA 1DCTA 5JU6A 4OIMA 1UKZA 1Y3CE 2VDWB 3OICA 4TQ9A 4V38A 3W2TA 4OQZA 1Y7LA 2P5YA 2JJ8A 3WO1A 1LDNA 2YIDA 3CN7A 2OCAA 3HJBA 4DLTA 5CX1B 1Q1GA 5D01A 4PBSA 3EB9A 3OESA 5CDTA 1VJ5A 3EQ6A 1L5FA 3WWDA 2DFVA 3OCZA 5ITZB 1BSVA 2W83A 2AEEA 2Q3BA 4MPDA 4RV4A 2EFCB 1RMTA 4TMXA 2DQSA 2YXPX 5DNVA 3R7AA 3GY0A 2DCUA 1I4EB 3PU6A 4O4LB 1MO4A 3A6HA 4PYLA 4P2BA 4DREA 1QHXA 1GARA 5CBPA 3CF4A 1KEEA 2WPNA 2ROQA 5U9CA 4DDHA 4F06A 4Z0NA 1QHSA 5EHGA 1XNJA 1N75A 1T5IA 4REQB 2RJNA 4IXMA 2C2GA 1IEXA 1Q5PA 1SCAA 3EVZA 3OCWA 3ROZA 2CUNA 3SOZA 1CJSA 2Z3WA 1SCDA 4G5HA 1B2LA 1WA5A 1GR1A 1TIBA 3KU4A 3GC6A 1EPUA 3L77A 1UT8A 2WJHA 5LBIA 3BHNA 2V5AA 3VO2A 5EERA 4YRSA 4HV4A 1FDVA 4E4RA 1PJZA 3VR6D 3KYIB 1Q3KA 2NXJA 5FLEX 4BEVA 2P68A 4NDZA 3JD1A 3SOPA 2HMSA 3EXFA 2HMVA 3CF6R 1IHXA 4IZOA 1XOIA 1T2UA 4RVSA 2AZDA 3TZBA 2IZ1A 1RPTA 1U7HA 2XNCA 3TRJA 4GC5A 3K4HA 2QTLA 1E63A 1V2GA 4A9AA 4JLVA 3RVBA 3FYCA 4JUCA 5JZOA 4GSLA 4BAUA 4F0JA 5LOVB 3CLSC 5JJLA 2R2GA 4L07A 2EEZA 421PA 3AFNA 1LBEA 4GNRA 2B5VA 3GJYA 2P8JA 5EKXA 3N2IA 4B7XA 1DXOA 3DEIA 3KWFA 3QVMA 2J9ZB 1BE8A 4BGVA 5KC9A 2OENG 1KYXA 4DCVA 1B0ZA 1P2FA 1SVKA 3I0MA 1X6VA 4QG7A 1ZMXA 2JRCA 4LYDA 3PE4A 2R6HA 3WNZA 3PJEA 3A1FA 2OA0A 4G2NA 1RZVA 1C50A 3MLEA 4M38A 1EK1A 4LJYA 4LF8B 4ZHQF 4ZGWA 1Y6JA 2NLOA 3LY7A 3RS2A 1NXTA 2X2PA 2X6RA 4WLEA 5DK6A 1J6UA 4JB8A 2FFAA 2DMRA 2AFRA 4KQWA 5KCMA 4NFLA 2GSDA 3E23A 3ZGVA 3PFGA 3N59A 4DDMA 3NGXA 3OETA 1RI3A 4WLUA 2EP5A 4MRMA 3K96A 1NL3A 1ZH4A 2G28A 4FONA 5AXBA 2CYCA 3VNQA 4QUEA 4EG8A 2YQ5A 1I0LA 4IFIA 4RE6A 5EJFA 1D2NA 3IHKA 3T1NA 4EO7A 4TQUS 4FXPA 3QOYA 4JOBA 5DH9A 2GHTA 2HBZA 2X42A 3V8NA 3PDCA 3K5HA 2VG8A 4GEKA 1BX0A 4Q4AA 3OIGA 1HKHA 2JATA 2CBZA 1JSRA 2KWIA 4LZNA 4R1LA 4J1TA 4MR8A 5LZ4A 1HBJA 3MJHA 2E4UA 4KJXA 3U4IA 5ADHA 1IM8A 3PA8A 1XZAA 3WGMA 1MAAA 3U4HA 5F4BA 5ALLA 1J5PA 1PD1A 5AHXA 1DKNA 2RHRA 4IDOA 1A2BA 3CG4A 4DF3A 1PNTA 5BNTA 1IZ9A 2FZEA 4UM9D 1HLGA 1XZDA 2Z8ZA 2ARKA 3ER9A 4EY7A 4LI0A 1KU0A 4FGWA 3TEMA 2CK3A 4RTQA 3GOQA 4YRKA 1IC6A 1Y3IA 5CCDA 3BQ9A 1ZGJA 1E3DA 2YJ6A 4JSYA 4OXKA 3UQYS 2FX2A 3B1FA 3OEHD 4HLUA 4M49A 3MS7A 4OP1A 4OJYA 3HVKA 2ZBUA 2IXEA 3RYFB 4F2HA 4TQAA 1B74A 1Y5LA 1N8NA 4PYRA 5JRZA 4HDQB 3CCBA 2NPIA 5DHSA 4CRWB 3TCNA 2CLEB 5AVVA 5K0LA 5ICSA 3PPXA 1J70A 2B5OA 3RIHA 1GGVA 1KYIA 1W1IA 1PQYA 4TKMA 2JH3A 2H8KA 3DBOB 4INAA 5TQ0A 4BVBA 3JU3A 5LP1A 3GUHA 4DIBA 1YQXA 1L5KA 4B7ZA 3C3PA 1XO1A 4JROA 1UWKA 4DR2B 3Q8XB 3ILVA 4I4TA 3ANYB 3AP1A 1XXLA 2IF0A 3MTQA 4WK0B 1RPAA 4KJZA 1Z5WA 4MRMB 1L1RA 1G5QA 1VHDA 1BQEA 1PWEA 5AW8A 1NOJA 2GPBA 2WICA 3KWJA 1O8BA 1UBEA 3PNVA 1H0HA 4GDMA 4X1OA 3VR5D 4YAIA 3UGJA 1V0JA 1IBMB 3OHPA 3CKLA 3D3NA 4FZRA 3TZLA 4DMHA 4F5DA 2WYHA 4AN1A 5LMNB 4IEIA 1MJ5A 2NACA 4O4JF 4YJGA 4K46A 3D59A 3HG7A 3QVWA 1LLUA 1PZEA 1R5OA 3M3HA 1D6MA 1HFKA 1IVYA 2VSFA 3WBJA 4Q4AB 4OQNA 3RBAA 4OKNA 2FLWA 3BD9A 3ZWCA 1FP2A 1KSHA 4P7GA 1EDZA 4YRIA 2VTBA 1Y6GA 2Q6VA 4P3KA 4BFVA 2BGMA 4MR8B 2K7ZA 3PEFA 4RDHA 2V0NA 1XLWA 3GFTA 5JFTA 2WQ7A 2PKWA 3NTQA 4MW0A 4ZTBA 4DV4B 3PLNA 4OHMA 3KHSA 3DM9B 3F5QA 2NYRA 5ENDA 2AZ4A 5AVSA 4OM8A 3TLCA 2FWIA 3QLTA 2PSEA 3HZRA 2VUUA 2GD2A 3E82A 3PQ3A 2ZS8A 2B8NA 4GOOD 1A1SA 4HLCA 5NLLA 4WLNA 4B09A 5D6OA 4D9HA 4RJTA 2PQMA 4Z54A 2ATIA 5BR4A 3QFFA 2IE0A 2IVFA 2AG8A 2EIHA 1L5YA 2I76A 3BHIA 3A4TA 1GFIA 4DW8A 4HFMA 1J21A 1S2OA 1TO1E 1Z8FA 2JC3A 2RHCA 3CISA 3D2CA 3GLIE 4AZ3A 1ECCA 4N9WA 1NNUA 2CDCA 4DV7B 4B7CA 2Q99A 3A9CA 2ESRA 2H8GA 4AY2A 4PQRA 4DV2B 1K6XA 2QR2A 3H13A 4PVCA 3RWMB 4BY9E 1Z25A 3SEZA 4LXTA 3QFSA 1OLOA 2D54A 1XU4A 4FNAA 2HX1A 3UHAA 1SXGA 5AKGA 4Y6QA 1N6LA 4UHBA 3RS5A 4I4TB 4PF1A 3ZXSA 4CG2A 4PLVA 3QVJA 1AZLA 4R1OA 4FFNA 5A6VA 4KVGA 1PFUA 1AKYA 3O9MA 1K5GA 3PITA 5TVKA 3VNSA 3W90A 1DG3A 3T38A 1K1EA 1H1LA 1OI2A 3V4PB 1HV8A 2M6RA 1Q7RA 3IOEA 4GX5A 4IS2A 4MWSA 4L4RA 4NEQA 1EDBA 2YZNA 1PW5A 3G2KA 3WGVA 4F3CA 3I04A 3CW8X 1TW3A 1ZVMA 4YJGB 4G56A 4B47A 3E84A 3B48A 4Y0NA 4ZQBA 2J0VA 4MZDA 3ABOB 3KTOA 3SNHA 2O4UX 4LYHA 4F3NA 2VTBB 3OCJA 3WE7A 5DCYA 2H5JA 3SSNA 2XUGA 1IOWA 1H2BA 3A6GA 4YVFA 3CZMA 1T2EA 5DOVA 2QX8A 3KUCA 3ECCA 1ZGCA 2BL4A 4G0OA 4EJSC 3KR2A 3ETJA 1BN7A 3BUSA 3LP6A 3HB7A 3COYA 2DJ5A 4L74A 2CZCA 3QMVA 4RGBA 5J3JA 3HJRA 4AJKA 3KSDO 2KYRA 4R0VA 1PWHA 2MYTA 2R65A 3A6ZA 4HEQA 3TQRA 2FDRA 1GL9B 1A4UA 4LFCB 1Q91A 2CVHA 2XVMA 3CVOA 3IXLA 5JDCC 3PEVA 2YS7A 2QE6A 1N6PA 1B73A 3P5SA 2F3RA 4JEIA 3UXYA 4A10A 4BFCA 3H42B 3W2GA 2WU1A 3RG8A 4DT1A 3OFND 1UZMA 5A3QA 4L73A 4WA7A 4B6EA 4UTRA 1XTSA 4WX2B 3U5TA 3JYPA 5C51B 1T1JA 2Z98A 5FEMA 1L7OA 2DH5A 4MEBA 1C30B 2XJ4A 4BO0A 4AZ3B 3RUPA 1U9IA 1PEDA 4F1WA 3MWDA 4E31A 5PNTA 5AH0A 2PLWA 2FYTA 3A11A 3EISA 3F4BA 3O91A 2AFIA 3B70A 2KW5A 3K20A 1KI6B 1V48A 2IOHA 4AMZA 4CMCA 3F5FA 1U9YA 3E7PA 1T8WA 4N7JA 2H9YA 4A6EA 4BVHA 1J1ZA 4YCLA 4WZZA 5EOVA 1MAUA 2LDXA 1DOHA 2E21A 4QGHA 4JQCA 2G9RA 1WQ4A 4Y1FA 5BYAA 1ND5A 1O5OA 2C2BA 3P2YA 1NBAA 1ZK4A 4JC8A 2QVCA 2CNNA 5AXDA 1YB2A 2B0CA 1YVDA 3WA6A 1F6DA 3WP0A 4BNYA 1H1LB 2YHAA 4MWOA 2ASVA 2AG5A 1COWA 1QFYA 3VH1A 3WJ1A 7ABPA 2ZVQX 1KORA 2EZTA 3VI4B 4CF6A 1QZTA 4PCVA 4US0R 3A3PA 5TEVA 4KI7A 1JU3A 4MJLA 3VKWA 4LSZA 5EJ9A 3CA8A 4H08A 5K3FA 3MAJA 4BKPA 3AUJB 3F9IA 2JIZD 2VYFA 4LTMA 1I3LA 2AVNA 1F12A 2QTMA 4KRGA 4WZAB 2BVNA 5E3JA 4OXYA 4H0FA 5LA6B 2BEUA 4JP2A 2DKOA 5EPOA 3BMNB 3CYFA 5LWHA 1E2UA 3R9XB 1MU0A 5AM3A 1O5TA 5FIUA 1WCV1 3UB4A 3OCYA 3FUTA 3JPYA 3MJTA 1PL8A 1RAFA 4DR6B 2IWHA 1HXHA 1HLFA 4C89A 3SZMA 1JX6A 3O1LA 1T4CA 3IEXA 3OSUA 4EHNA 3DMRA 3F71A 2WG0A 1MQ8B 4F7WA 4FIDA 4KGZA 1WVGA 5I6DA 4JFAA 3C4JA 5FPQA 4JLJA 3TK1A 4MS3A 4TZTA 3OT4A 2FA9A 3ENVA 4EUNA 4OD0A 3F0TA 2I62A 1LPNA 1XQWA 1XTQA 4V0KA 3W9YA 2HSGA 1ISSA 1SGWA 2Q9AA 1XEFA 5IDYA 3MWDB 4UBOA 4DA8A 1CRWG 3LZ6A 3P0FA 4ZAXA 2A58A 2QAGC 1KBQA 2BTQA 2RGCA 3QWFA 3IA2A 5J40A 2AFIB 5IJWA 2UUBB 2HJRA 1G6HA 1OXXK 4W7HA 5FWYA 4D43A 3F7MA 3GQVA 3OUTA 1RHMA 1U3DA 1I7PA 1N4AA 3N0WA 5FTJA 4ZEOA 3VDMA 3GVPA 1AKMA 1CR2A 2UUAB 1FXWA 1Y8AA 2VK8A 4JMPA 4D9GA 1NJSA 1TIKA 1WMSA 1MH1A 2H08A 3NKLA 1CE8B 4LVUA 4ENVA 4ND6A 1UL1X 4JY7A 4UFNA 5CEEA 4PX9A 4LS3A 1II0A 2Q2QA 1HKUA 2HEGA 4II7A 1G5IA 5E2IA 5I7RA 2Z4SA 3G49A 1Z6XA 5BYJA 3ZZTA 4CKEA 3QVOA 1SQ5A 5JI2E 1NQ5A 2QRVB 2W71A 2D2EA 3BK1A 4KQHA 4M22A 1W9MA 5K3FB 2F2TA 1MC1A 4YCMA 3FGNA 3K0CA 1DAFA 4URZR 3U4CA 4OA8A 4P22A 1QQTA 1KDPA 4RAQA 3KLPX 4EGFA 1YR3A 3O31A 2O1XA 1MAWA 3DLHA 2BEUB 4MYHA 4CL2A 1UT6A 4QU8A 3D1LA 3IBTA 1KAEA 4FVTA 3VOAA 1OBHA 1JV2B 1RPJA 3GWZA 4NHEA 3RAGA 3K6RA 1QCZA 4DNQA 3O8OA 4G9BA 2SBTA 2ET6A 3GP5A 4Q4LA 2C3YA 1P0MA 3C7DB 4UXIA 3QYJA 1GCUA 3COPA 3EFBA 5BN4A 1T4CB 4TTAA 3CWCA 4N5DA 4W1QA 4X60A 1SUAA 5BWCA 3PQ2A 1G8MA 1H8EA 1NAIA 4G5YA 1AZSC 3TD2A 5ADVA 4UARA 1WZ2A 2ZRHA 4MS3B 2IZ7A 4CQMD 3U60B 2WDPA 2FZVA 1TPZA 5KWEA 2VTVA 1WMDA 2AD1A 1DBVO 4RYLA 1FPMA 1Y5NA 2VXOA 3AIOA 3FNRA 3TNJA 4DSUA 1T1EA 3V8RA 2BTQB 1X19A 3C1AA 3OFJA 3O73A 1NE2A 3JQ9A 4ZAYA 4AYWA 1OFHA 2A9PA 2OGTA 2QI9F 5FWYB 4QJIA 3VSDA 5L4SA 4HEA1 2GBCA 1V5GA 3DUWA 3Q1LA 3QIAA 1RRCA 2JW5A 4BNJA 4HNRA 5M2QA 1OILA 1PNOA 3CZCA 2ZBVA 4HUJA 1ELOA 1MDBA 4GQAA 4Q9DA 4K9MA 3O94A 4GMXA 3FPHA 4EI9A 1Z7GA 3PVZA 1ORVA 1ZPDA 5AK3A 5C1PA 4XVRA 2HBYA 3P20A 4BNDA 1UIRA 2GDZA 4I08A 2DUWA 5HKKD 4U6QA 1I51A 2FDXA 1HQCA 1V6CA 4CKEB 4AX8A 2LCFA 2YL2A 4IP0A 1BDBA 1GG9A 5LYJA 3ZJ4A 4IV0A 5U4QA 4U0JA 4EGSA 3RV4A 1Y1SA 4FFSA 1Z5GA 3F8SA 3ESQA 4E33A 1TCBA 3HSSA 4RLQA 1PYDA 2BJVA 5JNTA 4JYMA 2BY4A 1RI5A 3MQFA 3NAMA 4JC0A 1TJYA 1H2YA 1C7JA 4F9FA 1PR3A 4JVSB 3VPCA 4B6JA 4IH1A 1N2GA 2GXUA 3ZX4A 1MP0A 2OZLA 2W2KA 3PFHA 2GPWA 4HJXA 2CHVA 4TLBA 5JAUA 2UZ1A 3ZHSA 3PJRA 2RHGB 2W42A 3CSUA 3PHHA 4ZICA 2C9OA 3Q8WA 4I4CA 5BN4B 5J2UF 4GGPA 3NOOA 4BB9A 4C0QC 4MV7A 5H3CA 1ZI8A 1P75A 3IAS1 1GSOA 2R97A 1IJFA 5JZSA 2XW6A 4NK5A 2V4UA 3HACA 1ISRA 1TU0A 4AKEA 2G4LA 3WGYA 2ZP1A 4OJNA 4V39A 1SU4A 2F9FA 3N7AA 4DLZA 3INGA 1P9RA 4XDYA 5COBA 2FY8A 4A8JC 4IHJF 1FLNA 4XEUA 5KSPA 7GPBA 1UMBA 2EJCA 2O2XA 3L8YA 2ZAYA 4RCYA 4IHQA 4F2GA 5HVNA 4IIJB 4R8VA 2PQ6A 4BE7B 4KXFB 1HT1E 2PKXA 3MWGA 4MA0A 2H18A 3A1SA 2DUJA 2HMTA 4R1QA 4EENA 3SDZA 2C54A 1T9CA 1GQYA 3TFOA 5ERYA 1USVA 4XUGB 4A0SA 4BZPA 4EZIA 3LHIA 3SN6A 4BNDB 2V7BA 1W5AA 4OFBA 5EJIA 1HX7A 3RWOA 3BRQA 4O4IF 2PIDA 1A97A 2PXHA 3MW8A 4PLCA 1B8VA 2CVQA 4ECAA 4HQOA 4TMTA 3GFRA 1W8DA 5JOQA 3ZV3A 2QTRA 4MCIA 1O8CA 3GH1A 3WLTA 5LYJB 2YMMA 1ZVVA 3VR2A 1QF9A 3URKA 2OESA 2F55A 3M4NA 1K6IA 2J4FA 1DIAA 3L0BA 3OU2A 3SSMA 4KXWA 4DJ5X 3T0FA 4G3XA 4YAKA 4B6RA 1D2MA 1TD9A 4HH0A 5AJWA 1Y82A 2XAAA 3Q9UA 4TT8A 3FFXA 2B1JA 4V03A 2C8LA 2OZLB 3U4MA 4H7KA 2I91A 2GFHA 2O5CA 1Z2PX 3RVKA 2ZUBA 4B40A 3U26A 4P0QB 1G21A 721PA 1ZNXA 2D59A 2EHDA 4G5OA 3EUWA 5GONA 5TV2A 2RB5A 1DP4A 2AEMA 1MG0A 1JBQA 3S68A 4OG2A 2WMOB 1S1CA 4W1PA 3SLKA 1USKA 3SYTA 3FNHA 4DCNA 4P4GA 2AI3A 4RZUA 4R05A 4ZMSA 5BWBA 3HKDA 1PKXA 1UT5A 1ZFNA 3ICVA 1OA1A 4QAQA 4UCFA 5F78A 4YV2A 1JXMA 2XQIA 1Q1ZA 3TNLA 1CF2O 1ESDA 2RARA 3C41J 3A4IA 1VIMA 4RZIA 1UMBB 3ZIAD 2JJ1D 4S1PA 3B89A 1NNI1 3UMFA 1QWOA 2XHZA 2GHRA 2HYIC 1ID1A 1L7PA 2J46A 1SC6A 3VSBA 4QL3A 1NYRA 2J87A 4TXJA 1E3WB 1KJ9A 2VBFA 3PNYA 1I6KA 1Z4OA 3HEBA 3LXRA 2VHWA 2JCSA 1N6OA 5AKJA 5HE8A 6ADHA 5T7BA 2WZQA 3PQFA 4JLAA 3G0GA 2WVJA 2CFCA 3PC2A 4OI2A 1AU9A 2BDTA 3DMGA 2EZ4A 5CA0F 1QF7A 4DCPA 4MXDA 3PWTA 3NNDA 4K86A 3R1IA 3Q0TA 3B1WA 3LWDA 4ZQGA 2P3SA 4I1UA 1VA5A 1JG7A 1G2PA 2BBSA 2QG9A 2WJ3A 2Y66A 4JCCA 4U9IS 4X20A 1GTMA 2PQ0A 2WYIA 3C8DA 1RE0A 3VZRA 9MHTA 2RGGA 2C2KA 2H2HA 2ZRPA 1LBTA 3P9NA 5I4CA 2V3CC 3NM4A 3E9EA 4MAMA 4ZOQI 3R7WA 1XAGA 2BGTA 2VPPA 5JD6A 4XYMA 4ON9A 2FRXA 3W5SA 4E2FA 1SCUA 4PLHA 4I6EA 5E4TA 4ZV9A 4HSGA 1JKXA 1N5JA 2A9FA 2ZUSA 3MGCA 3OZUA 1KPIA 3OG9A 4Y2YA 1MEOA 4J2TA 2J67A 3KFLA 4GYWA 5G0TA 5H7XA 4KX3A 3KCNA 3TNYA 5K4HA 1V1MA 1WBJB 1VMDA 1G21B 1QX4A 2VP4A 3L0YA 4CLXA 1X77A 1NSFA 1PYOA 5AUQA 2GTHA 2TSYB 3NBAA 4XTCS 5HIJA 4Q24A 5TR9A 4BC1A 3TR6A 4JOQA 4X0EA 2XZLA 2RJ3A 1CIPA 3EZ2A 2V65A 3HKDB 3B85A 2DC1A 5EPUA 1CUJA 3DNMA 4FINA 4YONB 4BZQA 1ONNA 4Q12A 5JEDA 2HTEA 3TXYA 2OG1A 2ZQZA 4IX1A 1JI0A 1OD6A 3KPJA 4U7TB 2JDID 1I01A 4XD7D 4YCAA 1IOLA 3KHUA 5AKLA 2H5IA 1Y9AA 2AOTA 3BE5A 4PPGA 3VPXA 2F43A 4RGVA 4RJLA 1B8PA 1L5WA 3EUEA 4PWZA 5IAGA 3GHYA 3H6GA 3LO5A 2JZOA 5F3DA 1K7EB 5EHNA 2GOYA 1ZR2A 4EVSA 1H4TA 4MPJA 1PV4A 2PUTA 4G24A 4I8XA 2VJQA 4TSFD 5F33A 1KK1A 2QM7A 4RXMA 1J56A 1E2IA 3G8AA 4AG6A 1GCAA 4CGZA 1GN8A 3T4UA 4PZ0A 1G0NA 3ZHQA 3MJDA 5HRAA 3DV0A 4WEOA 2FV8A 2FZKA 3NASA 4A15A 3L0PA 4OB8A 1IPFA 5I4IA 4M7RA 2OECA 3NFYA 1PO7A 1FSZA 1KVSA 2GAOA 4BO5A 1NE7A 4X20B 3HN7A 3AONB 3RWBA 2CHEA 3VGPA 5KU1A 1FFGA 2A9KA 4TL8A 5KJFA 4YP9A 4I2VA 1LC3A 3IVGA 4A16A 4PO1A 4UEOA 3R7WB 3THWA 2AE2A 1KBOA 4MV1A 1Q1EA 2I5PO 4DJTA 5KHOC 1DC8A 1Y9JA 3BL8A 5KYXA 1W30A 2UXBB 3AM1A 1IATA 1SCUB 3CKMA 2BLLA 1T3LA 4UTOA 1YH3A 2FPPA 3JVEA 3RBVA 1TVCA 2Y71A 1EGHA 4U8GA 2WAOA 2ZIFA 3WKEA 1YVUA 3KXPA 3LHSA 2Q4OA 3REGA 4ALKA 1V1MB 2VDMB 1D1PA 3WLQA 5U1PA 3HLKA 4W6QA 4UFOA 2XUFA 4WOPA 5J2TF 2J07A 1RYFA 3LX4A 2YXBA 4M0UA 5B6PA 3WK9A 1HTBA 1LTQA 2NT3A 4YC7A 3VPBA 1RM4A 4XSHA 1NQXA 3EVAA 1S4MA 4DYVA 3HDYA 5EE0A 1ZM2A 1M8KA 4R5HA 3WK6A 3AUSA 4BQQA 3ZDCA 3T3GA 2CXPA 2Q1TA 5A3SA 2W4QA 1Z2DA 2Q8QA 1FK8A 1VKHA 4JENA 1ACMA 1JPJA 1Y7TA 4KG7A 4M53A 1YIDA 2AOTB 2EARA 2F43B 1SK9A 1A8SA 2FN4A 1KI3A 1XNHA 2NWQA 1XTIA 2VSQA 3SDSA 4FYYA 4D8UA 1IIRA 4KLRA 3C2QA 4GLBA 4QVKA 3IHWA 3EGIA 2K2QB 5DCLA 5I7EA 2UYHA 5AHWA 1A8UA 4R1NA 5U4XA 4W1SA 4A3SA 4R2HA 4YYZA 5IG2A 2SHKA 1EK6A 2CW5A 2WF5A 1PT8A 2JGRA 3MAAC 4Y2TA 4MCHA 4Z0HO 2C7RA 4BLWA 1JKMA 1Z0FA 1ESNA 3E0XA 3ADDA 3ASYA 1XXHA 3I2YX 1DAMA 3NX4A 4AP6A 5BUCA 3KALA 4J3NA 5HQ3A 1DBRA 4Q7MB 5HS4A 3THWB 1BMDA 1B15A 3Q98A 1J99A 3HKBA 4MKZA 1F2UA 5J4KA 5KYXB 4MWCA 3ZWAA 1OYOA 4MA4A 3A3KA 3LRPA 1V37A 2PUEA 1U1CA 2FPPB 2W11A 2YJ3A 2Y99A 1AO3A 2FQ1A 3FWHA 4JD5A 3OQIA 4P33A 4QDKA 3TW8A 1Q1QA 4H7DA 4I14A 2AFIE 1OI4A 3R6TA 1NTRA 2F90A 3ZV7A 2YWXA 1YR2A 3E7WA 4Z86A 3RSLA 1M6WA 2W4MA 3P9PA 2RGBA 1RR6A 4UASA 3FFAA 1Q0PA 3WWYA 4Z49A 3OECA 3QRWA 5JIBA 2W93A 2UUCB 2QP3A 3NBKA 1XX6A 1ZRMA 4EJSA 1OWPA 1UP6A 1S89A 3P4YA 5DP1A 3A1UA 2BJWA 4LRXA 4QBTA 3L06A 2VHJA 2HA6A 5JDCA 1EFTA 3OZRA 3VC1A 2UYGA 1NQAO 1NC3A 3HP1A 1T5DX 2QN8A 3KM0A 9ATCA 1UC5B 1ZH0A 3K53A 4YCNA 1CUFA 1HQYE 1PNVA 3E9NA 5D7BA 2OUKA 1VB3A 3CB2A 3O7WA 2OBFA 1KVQA 2LIVA 3V1MA 2ZB2A 3DTVB 2HW8A 1DAHA 2A0UA 1IY8A 3O74A 2C8VA 1QB8A 5FHQA 1DJPA 2GAFA 1T5BA 3KCQA 4FUQA 2PS0A 1Q6ZA 2BHRA 3EGWA 2OKGA 5CH3A 3CNOA 1NDUA 2CL5A 3PFBA 2FB9A 2P40A 4JVNA 1GKKA 4OREX 4ZYVA 1SRQA 2G09A 3GG9A 3H65A 4CM9D 1CEEA 2GJAA 1Z4IA 3DLPX 3EJWA 3GF4A 3LGAA 1RRKA 3QXJA 1GGEA 5FWDA 4WUTA 4DUPA 2YJNA 5EHQA 1KH1A 4GNKA 2EFDB 3Q88A 1I2MA 2JAQA 5D2CA 1DC3A 2H4JA 3MTAA 1C80A 1E96A 4N3AA 2ZBDA 1F2UB 3HDQA 1KYYA 4OP2A 1JDVA 1UP4A 1Y5IA 3IMFA 4QNNA 3RM3A 5LZ7A 3FZEA 1PQ4A 3EGEA 3F7OA 3GGGA 1DO2A 1GG2A 2JFYA 4Y6SA 5FULA 3W9BA 4ZGBA 3JRWA 1L0BA 1EP9A 4ESEA 3OQIB 4QTXA 1LVUA 3TW8B 4CNBA 1XMSA 4FMBB 5JNSA 4HZUA 5ALEA 2C0QA 3C5VA 3BXOA 3CZRA 3P2IA 5IXYA 3TL3A 2BELA 2I1VB 2Q62A 2B34A 3ZNOA 4J91A 1FNBA 4NEHB 2O2EA 5E6RB 2WLTA 3ZGXA 4RPHA 3S2FA 2B9EA 4EJSB 4D8TA 1KEUA 1NPTO 1P9LA 4CKXA 1N8KA 2IEBA 4CJXA 3CBQA 2D5CA 4DUZB 5C32A 2MR5A 1TM5E 3GCXA 5AP9A 1H4SA 2H54A 1M2KA 2BH2A 1DV1A 3DA8A 3G5UA 3NHSA 2HH9A 1AS3A 3ISVA 4BMYA 1JH8A 1ZA2A 4DLKA 1V9LA 4ZRNA 2PKQO 1B2RA 3RC7A 4Q1EA 5IJZA 3T3NA 2VPWA 1WUHS 1NU8A 4M6WA 2ODEA 2QX6A 3VAAA 3VR4D 5KCZA 3NTVA 4LXUA 5L7WA 5CIWA 4MPRA 5E4YA 1M6YA 4FIZA 1YMUA 2QAGA 3UH0A 1OH8A 3BG5A 3LXUX 3DAFA 4B46A 1MENA 4E5UA 1E7WA 3EHEA 4A27A 2R8EA 1ZWLA 3VAYA 3HXQA 1T15A 3NVKI 3WLKX 4EY5A 1MV5A 4AJPA 2LTAA 1R50A 2NVWA 2ZANA 1J2EA 1V9SA 3GWGA 5FI3A 1DMRA 1KIAA 1NMEA 1Z4LA 5AW9A 4CMJA 5DU2A 3PRJA 4A6XA 4M1SA 5K0SA 3UA4A 3O8DA 2OHGA 5ENZA 1FS4A 3GPCA 5HOQA 4W7IA 3GL9A 1OMOA 1V25A 2PWAA 3K30A 3LL4A 4DV3B 1GZVA 3VPHA 1Z22A 4UJ3A 3V7NA 3SYRA 2I80A 4C0WA 2Z5GA 5HW0A 4CBVA 4JXJA 4G97A 2B3TA 3ZIDA 2Y2UA 2P6UA 1ZNYA 5KNDD 1U98A 4JIGA 2NADA 3TQOA 3K5PA 4QUKA 4A5OA 1R0WA 4HXGA 1BVYF 1C0LA 3LPMA 1M8JA 2X86A 2CDBA 1LLQA 2Q3LA 3A25A 2DULA 2Z2ZA 4FFOA 2PSFA 5DBEX 1C0EA 1BGWA 4XX1A 1R6UA 3FUUA 3LQ2A 4M0FA 4F4FA 1JXQA 3ZOZA 1R8SA 1SOAA 4OUDA 1WB5A 4MEJA 5AKKA 3FYSA 4FJ0A 3VM6A 4JELA 1USUA 1TAQA 1EK0A 3VOBA 1VPVA 2XA2A 3HDHA 4A23A 4ZOLF 4D6PA 3EZXA 2P7HA 2HXGA 4XGRA 2E18A 1Z2NX 2L19A 2WWIA 4I1RA 5DLDA 3NHRA 3ZCUA 4DMLA 3H7AA 7YASA 3S8MA 3GUVA 1DXQA 1LTKA 3Q7RA 1RACA 4NVRA 5KYYA 3LW8A 2W2MA 4ME6A 4COOA 3L9XA 1JBKA 4L27A 2C03A 3LUCA 2A92A 5CVCA 5HTKA 3ZVRA 4INJA 1A8QA 1JT2A 4BKMA 3THYA 4F71A 4WN9A 4M6WB 4KMRA 5AKEA 5A3VA 4C30A 3M2PA 1UK9A 4Z2YA 5BR7A 3ZTTA 1T6BY 4K9OA 1XTZA 1AIPA 5D5HA 1T9GS 1LB1B 1YZLA 2QAGB 3OP4A 5H9WA 3UV6A 3EIXA 1XTBA 4PZDA 3Q8LA 3PD0A 1C14A 3GRPA 1K2VN 4KMSA 5J9FA 1NU6A 3TBKA 2E0IA 1SVIA 2QVLA 1HDXA 2PL1A 3ZCSA 3HP7A 4LOKA 1WR8A 1UZNA 3A6LA 2B1GA 3PICA 1VIYA 5LJLA 4I8DA 1XZNA 2XOKD 3WYGA 3O92A 1KMQA 3AY7A 4FGSA 1PJQA 2DT5A 4IXDA 3KE9A 3VPGA 4G0VA 1B8NA 4ALLA 1Z2CA 2VHCA 1OI7A 2XHEA 2R9VA 3BTSA 2VAPA 3EDMA 3FROA 3HN6A 4OP3A 4MPPA 5EHXA 3L8ZA 5FR2A 2C7BA 5IAEA 1GGKA 5IBRA 1XPOA 1GAEO 2X0DA 4RM2A 1IJKA 5IZ4A 3CR8A 1SVOA 5DX1A 2NSYA 2J30A 2QG6A 3BRSA 2QL9A 3MUFA 2VNSA 1KE2A 3L82B 2AS0A 2W2QA 3SHFA 3W8RA 3SE7A 3WYBA 5BUQA 4F93B 1GRVA 2W00A 4JR2A 4EHFA 3C74A 3C7AA 1U8AA 4OUDB 2OK7A 4JKIA 3C6YA 1KFEB 2FSIA 3ZWOA 1K7FB 1MZPA 3UN1A 4B3JA 5BYKA 3K9FC 1MC4A 1BDMA 4DEXA 2BKXA 3AEQA 2CLFB 3QU7A 5CYFA 2DM6A 3T6KA 4TWZA 6CHYA 1JKIA 3UHOA 5DULA 1M1XB 3RUCA 3WISA 5KO2A 2VI5A 5FTLA 3AWDA 5KYYB 3QEBZ 1A8HA 1MT0A 3DJFA 2HA5A 1N9KA 4RJJA 3GEMA 1JIUA 1G4UR 2IOYA 1RYHA 2OORA 2PGAA 2EWMA 3THYB 3WHLA 3HCDA 3NMUF 4K9KA 3PFWO 2FQQA 3MTGA 2CYAA 3BERA 1VCIA 2Y1GA 2ZI3A 1U2DC 4A8JA 1W5FA 3GFQA 3KDAA 4QXQA 2AG0A 4J1SA 3UJ9A 4JT2A 3TZCA 4PYJA 1N57A 3A3YA 1TJ3A 3K8OE 1LPOA 2YFKA 1UDRA 5K01A 1T9HA 3UKJA 4HGYA 3AT1A 1JDBC 4MRPA 3O03A 1QKIA 2WHPB 1G21E 1S3FA 2BFBB 3MEQA 1F6WA 3WL6A 2IL1A 2IHJA 1RWKA 4P92A 1JR4A 1FLAA 1YDWA 4NX2A 4HUQB 2VXBA 1OFUA 4NP6A 1G41A 1OWMA 4HNTA 3TIIA 4ASUD 3ONDA 5JPDA 1JEDA 5AI6A 1Z2EA 4BMPB 4F5ZA 4KXUA 1OGIA 3N2ZB 3G8YA 1URPA 2ZSJA 1TMYA 3CH4B 4L0QA 1AKUA 1ZJJA 2I29A 3QPVA 1ZW6A 2H2AA 1KXJA 1CT9A 3O9VA 4AL4A 1DKRA 3D7SA 3ETGA 3O8QA 3E35A 2QZJA 3AY6A 1UJ2A 3I30X 4EF6A 3O4VA 5CITA 4AJOA 2POCA 2CLDX 4TYMA 1IHDA 3JD0A 3TD9A 1J0EA 5TPZA 2CF5A 2P78A 3RNOA 3UK7A 1UAGA 1RAHA 3DE3X 3ET4A 4NE9A 2K2WA 1YKGA 4LJSA 4ZD6A 3F3SA 2Z6QA 3A2NA 2E4AA 4GLFA 1WSWA 2ACKA 2Q7XA 1N7JA 3P8ZA 3MJSA 4QM7A 4HI0E 1XGKA 4OX9B 5FNZA 1P17A 1YB5A 2O9JA 5AJZA 5E4FA 4N0PA 4DADA 3GJ4A 1GYPA 3T41A 4KE9A 1A76A 3OX2A 2WIKA 3S2SA 3VTZA 1K4YA 3LL7A 1WDWB 3WP1B 3ZNQA 5JEEA 1P62B 1UAYA 4PTZA 4DRZA 3DOFA 4ER0A 1D04A 2HIGA 3S8EA 4DG5A 4PZCA 5C81A 4N12A 2Q4DA 2X0KA 2BGJA 3ZE2B 4CT4B 2RD2A 3B3JA 2YV2A 3V4FA 4YHBA 1NSTA 4A8JB 4LX0A 2LWIA 3GGOA 2P79A 3H6KA 4H4DA 1UKYA 4RLFA 2GT1A 2Y1EA 1TOAA 2GKGA 4R7TA 1G5RA 1ZM7A 3SYNA 5LLSA 4AD8A 4EW3A 1KERA 2ID9A 4EKNB 1VLHA 2PGOA 3G79A 1N2JA 2V6FA 4TS1A 2OYRA 3G2PA 2LW7A 3BDAA 4JJIA 5JLAA 2J0UA 4H1HA 1J9GA 1AO0A 2A1UA 4Q18A 1WXHA 4XKJA 1C2YA 2Q6TA 4OL9A 4WXHA 1QDLB 4E1AA 2R62A 1PR5A 5EJ8A 2VJMA 5LUBA 3ERCA 5JPCA 3LYLA 4XGNA 4IJMA 3E3MA 1XNRB 3LUJA 4DGSA 3CNNA 4YXFA 3ELWA 4P3NA 4ZZ2A 1ZN9A 1E3TA 3K9QO 1LRJA 3IOBA 5B64A 4C88A 2WTMA 2VA9A 4XWYA 3HJFA 1MC5A 2Y1XA 2IXAA 3D8HA 1KEVA 1XRMA 8MHTA 4PYQA 1Y9DA 4URHA 4A2PA 5AVRA 4S04A 2OHXA 3HNPA 4OOEA 4D3FA 2AUMA 1KETA 4PFSA 4FYXA 1JHXA 2NZVG 3ETDA 4JLPA 3L6EA 1UIMA 3ZCRA 2O57A 3C7CB 1FQJA 4MJ3A 4QXMA 1JPUA 3K2BA 4R9NA 3MIZA 3AL2A 3B9RA 5BSTA 4FQ5A 5IBQA 4E7OA 2FR8C 4KREA 1V5FA 1HZZC 3BWEA 1XLTC 2GYWA 3KQTA 1D0SA 4UDNA 2WAMA 2HT6A 2OFWA 2WIFA 3ED5A 3CY6A 1UKEA 3WMFA 4O25A 3AVPA 5CB8A 3CC8A 4DOMA 4ZQFA 3D8BA 4EB0A 1QKJA 2ZJBA 5IAJA 2ZSKA 2XODA 5FO0A 4BX3A 2V6IA 4HLDA 5B4TA 3KE8A 4QUHA 3TQCA 2BOVA 5A9RA 2O7VA 3INNA 3EZ6A 3PC4A 4FUTA 4R8RA 1YDGA 2BHTA 3OIVA 1U9JA 4NYMR 2BFDA 2BI7A 4NH4A 1K3TA 5AICA 1N5OX 1UEIA 4GGOA 3H1PA 2NAPA 1NFRA 4ZQEA 4ZCPA 3UPDA 3LLVA 3QUTA 3LPNA 2OXEA 4D4JA 4QD3A 2YKGA 2YY6A 3L8EA 1U5CA 3ZXUB 2Q0XA 1L4LA 2H07A 3NAQA 4EFLA 4BO8A 1KOFA 1DIOB 3F6RA 3S2EA 2Q4RA 3GFVA 4RHXA 3FNIA 4OGFA 3K8ZA 4GIBA 2A1UB 4UNNA 3COJA 2I22A 1KI1A 4S35A 3BTVA 1VDZA 4YPOA 3PWZA 1QBKC 1B3RA 4KYTA 5DEOA 5EIHA 1L7VC 3R7SA 3SNKA 3ZE1B 4D9MA 4DJAA 2NXWA 4KO2S 4RNDB 5DGDA 5EZ5A 1N5IA 5TPWB 4B17A 3ZDDA 1N1DA 2CE2X 1GQQA 3EMDA 2ZYUX 2CFSA 5I9LA 1XVUA 3CMCO 1OLSA 1OU0A 2IQIA 3H5RA 1VE1A 3KV3O 2FJ0A 4F91B 2QRJA 4U2KA 4YUAA 1KJZA 2ZU0C 4P32A 2RAFA 4KR2A 2CJXA 5TE9A 2PT9A 1H94A 3VHRA 3BGIA 4EHDA 1T1SA 4IKOA 5IUKC 1BE6A 2Z2JA 1FRNA 2Q5LA 2PO7A 1R9GA 4NG4A 1XK6A 2ECQA 2OCXA 3H75A 3OMLA 4GI7A 4AJ4A 5KSZA 4ZTZB 4CUZA 1EFLA 3MGGA 1EJBA 1S2DA 4N8DA 4P31A 1TZBA 5GGYA 1P0PA 4Z3OA 2GN8A 4KQXA 2AJCA 4HNAA 2KBEA 4F2DA 3RSFA 4NXMB 3BGVA 1CP3A 1GA1A 3E5NA 1SULA 1SY7A 5LKAA 4PNEA 5G02A 5J59A 2QPOA 1GPNA 1YJXA 3JVIA 2ODQA 3GO4A 4BNUA 3G2IA 5JBIA 5KQMA 5JANA 3GRUA 2XKKA 3KS9A 1L6RA 1XXHE 2PMEA 3D8NA 3R44A 2XSZA 3FVRA 4PSVA 3AF4A 1X1RA 4OFZA 4N47A 1QNFA 3QHQA 5AW1A 1QZ3A 2XZDA 3O7MA 3CX8A 2DHQA 1P2TA 1Q22A 2K87A 2Q6KA 4L9AA 1W5EA 5GV7A 1ECJA 1PIWA 2FSVC 1ES9A 1M2VB 2MSDB 3N2YA 4PYOA 3MMXA 5L7YA 5EKTA 3UJHA 3SQOA 4BUCA 5C9ZA 2FEPA 2I4RA 1J0XO 2FF5A 2OCPA 2BMEA 3ITDA 3Q41A 1KZ6A 3K9CA 1F1JA 2Y77A 4HSEA 2IW1A 1ISGA 4HGNA 3DXYA 1W0JA 1L8QA 1RAGA 1CZRA 2H59A 2X8JA 4LBVA 4BFTA 1PP4A 2W0SA 2DQKA 4KYVA 5KTRA 5C5IA 4PGHA 3MT8A 2R6DA 1AGYA 3L1IA 4G67A 4QGGA 1WCXA 3II6X 3HPRA 2OB1A 4H6PA 2FMUA 3STTA 1HZJA 5INTA 5FO1A 3F67A 2PGXA 2AOUA 1JMVA 1OLSB 3MWLA 4MNTA 1LDBA 4RS4A 4XPIB 5H16A 2GASA 3I23A 3R3XA 2RGNC 3U4GA 4TL7A 3X43A 1KFCB 4K03A 2NYAA 5MN5A 4TLCA 5AXCA 4BNNA 2BEKA 1KVRA 3GQBA 2UVQA 4EW1A 1XTPA 3N8IA 1LPBB 4LE1A 4DLUA 3N2GA 2FWPA 2Z43A 5K9ZA 1QYIA 1IY0A 4DAOA 1FMFA 2DG2A 3ZU3A 4F21A 1O57A 1XCGB 4HNAB 2VNIA 3OE7D 2XDYA 3FMVA 2YFYA 4HT3B 4CIDA 1EZZA 2EDCA 3E5MA 1ZIYA 2X1HA 3INRA 2CLOB 4ND4A 5DTIA 2B21A 2WVHA 1N1GA 2UVPA 2X2EA 3DWGA 4MITA 3RFXA 1KOGA 1B00A 2GEUA 5REQA 3UJ6A 5I9MA 2I6TA 4BO1A 3OZCA 2C7OA 3U7FB 4TQGA 4RHTA 1T5SA 1PJLA 3GVXA 4RIIA 1A2KC 4Q9NA 1GT6A 1IYZA 3RUIA 3UUEA 4KQFA 1CFZA 3WRXC 5EE1A 2X7HA 1HNWB 2PS1A 3E61A 4RAOA 5EKSA 1THTA 4IMPA 1IBKB 4JASB 4Q4CA 4RPIA 1OY1A 3OKAA 2CMFA 3CRZA 2M6SA 4XM2A 4WKOA 1LJ8A 4BLTA 3B6JA 2GERA 2X0FA 1QHIA 3NGMA 4ZXFA 5LVAA 1ZM3A 1V4NA 3MFYA 3P2EA 3GGJA 4I9FA 2VHVA 1SBCA 3H2YA 4FDAA 2X8JB 2C31A 5DHAA 3WGHA 1V1RB 3HVUA 5I7AA 1A9QA 2N42A 1F9AA 1WWKA 2JVKA 3PL5A 2EGHA 4H7PA 5CK4A 1H4VB 1LBHA 3RFUA 3COVA 5LM3A 4EKEA 2ZYVX 4V1CA 4MUYA 1E64A 1KY2A 4QOIA 1AC5A 2D62A 3BIJA 3LYHA 1JG2A 3FUCA 5JC8A 2VK2A 2AOUB 5ICCA 1FFHA 1MTZA 3K9WA 2A1TS 1VPEA 2CXHA 1A72A 2R86A 2X4GA 3P0EA 3NYQA 4LV8B 2RGDA 3SC6A 3ILXA 2JEZA 4H3HB 4J7AA 3L7CA 4TKLA 3EPJA 3U44A 2C7VA 3MM4A 5HJ5A 1KYVA 1P72A 1U8UA 1TB4A 2XB4A 1JEQB 1MORA 1FP4A 1PZNA 3ADPA 4QFMA 1DB3A 1QO7A 2ISQA 2Q29A 2YHIA 4G09A 2V7PA 5GPBA 3ZWQA 3BL6A 2G1UA 3FMOB 3N2GB 4D8XA 1EYZA 3K9NA 3PFIA 3VV2A 2RC6A 2DPYA 1JJVA 1TM3E 2NNLD 3CLTC 5FBWB 5TS2A 4B2LA 3RG2A 3ZHZA 2VWHA 1TC1A 5DLQC 5E2BA 1F51E 3UH1A 3F6SA 1KDRA 3TQTA 1YRAA 4A5SA 4GL2A 3CVVA 4NMMA 4ZZ3A 4XOIA 4ZO6A 2ZFUA 4ZT5A 2FMXA 3C3BA 2PS3A 2HF8A 4N6GA 4U7HA 3TOCA 3B7GA 5F4ZA 3ZXIA 4AO8A 2O7SA 1W1UA 2UVPB 3RK4A 5REQB 1DDOA 2GBIA 2JAPA 5JTUA 4TTRA 3DF7A 2Y8EA 5CVVA 2HRDA 3GJ8A 3DVQX 4MUMA 3RIYA 2KPOA 2GXSA 2QYOA 4GPD1 3D9QX 5LP6C 5A6SA 4TOIA 1M2JA 3A37A 3O0TA 3WIUA 3V8QA 4O2AA 5K6RA 1M1NA 3DLTA 1SUBA 4OHCA 4P5EA 8AT1A 2BTEA 1HY3A 5G3YA 2Y1DA 5CH5A 2FWNA 4X44A 3UB3A 3NHAA 3CUVA 4D92A 4DCSA 1USGA 4YP1A 5BN3A 4RETA 4EHJA 5K5EA 3K0EA 1JHYA 1NHWA 2QX7A 3DONA 4M1KA 3D6FA 1U2GA 1CS0A 2G9UA 5CLQA 1SKQA 1A5TA 1N5RA 2I54A 1QH8A 1BS9A 1OJLA 2P9HA 1PR0A 3CF4G 3RTBA 5AD1A 5LMUB 2QLFA 1W6UA 3R5XA 5L3QB 4N82A 4WOCA 4PAGA 5LB2A 4CG1A 1OC2A 1LDMA 3OZTA 4Q05A 4AMVA 3PBKA 3DFFA 3H05A 4M9UA 4V1CB 2FLKA 5I9BA 4HAZA 3O8CA 2JLVA 1X92A 4O1MA 2WJAA 3M4ZA 4MVWA 1NVWQ 4L08A 5EI5A 1BDIA 3D31A 1Q0ZA 4LMAA 3TQIA 1X9GA 2FGJA 3E7FA 2P9BA 2Q4TA 3U44B 5FOTA 1DHRA 1QIIA 3G9QA 3VDNB 2G08A 2CL7X 5G0VA 3FOWA 3QP9A 3CZ4A 2YHIB 5DI3A 3F7TA 1ZJ5A 2PZGA 1BEEA 3PQEA 1ZNZA 2A9QA 1A0OA 5LA6F 2O3RA 2QMHA 4DR3B 1SVNA 3OQHA 4HJRA 1W47A 3FHJA 4M7PA 4NS1A 2F3UA 1QGED 1M1ZA 1VGQA 4LC0A 1ADFA 3OTWA 2FEOA 3STUA 5ERXA 2C4VA 4MGKR 1IDOA 1XD2A 2X8WA 4TLDA 1NI5A 5EMHA 4HADA 4PGAA 2L17A 4WLOA 5FAKA 3AHCA 1ZMBA 4LZPA 2MHCA 3WJAA 3QHAA 5HE9A 2I3GA 2DVMA 3CW9A 3B6EA 3PCXA 4JLMA 1Z9BA 4L72A 2XZPA 3RU3A 3S2YA 1AUXA 3SHTA 1Y6QA 2R85A 1XQ9A 2C4TA 3MMZA 3L7NA 4K3VA 3AQIA 2K4MA 3WWCA 5L3SA 1E5QA 2OZPA 4ZT6A 2MWMA 2NUPA 4NCNA 4Q1FA 2IZ6A 4KI0A 5A6SB 4BN4A 3KXDA 4MDFA 4EF5A 2IS4A 3NHMA 4L02A 1H0SA 1SBTA 1XMOB 3ZW8A 2ZSEA 4O2AB 2OAQ1 4C4XA 3U49A 1E4YA 3HABA 5LCXA 3RKSA 5BN3B 4Q1VA 3JQBC 4D82A 3GIDA 4WKBA 4BDSA 4GM0A 4KC0A 3X44A 1VSBA 3ZWKA 4ARCA 2V8OA 3H9UA 3DZIA 4YN3A 1CS0B 1O87A 4HAXA 1BMTA 3P94A 2A84A 1QH8B 3P9QA 3U3RA 4TVOA 3LXXA 4FCCA 1G8JA 4E2WA 3S81A 3GROA 1R1DA 2AOWA 3BSYA 1XZCA 1YBMA 5E7QA 2ZK7A 5JMOA 4M89A 3PR2B 4B87A 4D3SA 4JQZA 3H11A 3OVMA 2C61A 4FW8A 3MTBA 3I9LA 3LC2O 1CQJA 5D51S 3UO8B 4B2PA 5DCWA 3G2LA 4B6FA 4F8JA 4Q6BA 2VKQA 3P1JA 3NBXX 1COWD 3SQNA 4QPCA 1NI4A 3QPBA 4GVXA 3ST7A 3ODPA 3UGKA 1FTWA 2WFAA 3E27A 3V1LA 3H5NA 4X54A 5HYVA 3STXA 2QRUA 3K2IA 1WABA 2IOFK 5FADA 3RVSA 5BV8A 5C8XA 1GQRA 1NKTA 3DFIA 3G59A 4FFMA 1NDHA 1FIUA 4NPHA 3JQ7A 3DHWC 1REQA 3QZUA 4NBSA 4BNZA 1Y3BE 2RH4A 2HNBA 1E2QA 4MMYB 4R8MA 1C1DA 5AYVA 2QUAA 3Q72A 5IVIA 1ZGGA 4UNIA 2H4HA 3IVXA 1T4BA 3JARA 1T36B 1YSCA 3NXSA 3O84A 3WDMA 1RZRD 1SUIA 2GHQA 3AEZA 2X15A 3BWYA 3NAZA 4UHHA 2R1TA 5IDXA 1Y89A 4ZAFA 3U13A 1ZHFA 2WP0A 2W2TA 3JS5A 3R40A 1RAAA 1CUVA 1E1DA 1JQAA 3I6YA 3TR0A 5BR8B 3ECSA 3PEYA 2NUPB 4NU8X 1YB4A 4WY2A 4NFYA 4IJ5A 3I52A 3GRZA 4X71A 5JD4A 2ZJ0A 3QG1A 4O2BA 2X0RA 4AKTA 2FH5B 3QVSA 1YRQA 4QEDA 1SU8A 4AS1A 4P5PA 4C4OA 4R31A 1XFAA 4HGRA 5JSYA 1I32A 3ROKA 2XMSA 5BSWA 5H59A 1F0KA 1OA0A 1UZLA 3GN1A 3N70A 4MO2A 2C0CA 4I5EA 1LQUA 1N2OA 2HO4A 3AM5A 2YS6A 4LUCA 4R8LA 2NUBA 1BJKA 1RIFA 2ZGVA 3D8TA 4ZDWA 4IEEA 4A0GA 1V3VA 4JL8A 1E7MA 4Y2VA 2KX7A 2FWMX 2GZ1A 2VPYA 1YIAA 3QFTA 3UWDA 1QRAA 3T06B 2A5DA 4PBRA 3ZKAA 2YWBA 1C7FA 4FEAA 4RKWA 5FOXA 3ZV4A 4URFA 1T91A 1ZUIA 3ANTA 1GQOA 1R4ZA 4TTJA 1HM5A 4PLGA 3H11B 2BLNA 3UMRA 3JYHA 3EQZA 2G8LA 2JJMA 3DXFA 4PC3A 5ESWA 4DKXA 5DGXA 5JZBA 2CZQA 4GZMA 3I53A 1N33B 1OTYA 4QTYA 2G7ZA 1NI4B 3MGKA 4WKGA 4YCDA 3U7QB 4BX9A 3QJYA 4BBPA 4C0BA 2H0AA 1EMDA 3MOSA 2DCMA 4A0QA 1N34B 2DQ4A 2EL7A 3SJAA 3L0OA 2PGIA 1TRKA 3DEHA 5HOEA 3IGFA 1TFUA 3JQ7B 1V3UA 1REQB 2RKOA 4IZIA 4Q3CA 3CZ5A 3CZPA 2JIRA 1ZS9A 3T9BA 4TV8F 4D4LA 2FRDC 1YS6A 1M0WA 2DR2A 4G23A 3JARB 5F7XA 3GJSA 4L4UA 4DARA 5A4KA 4OM7A 5K2MA 2A86A 3DMHA 1U80A 4EUHA 5CW1A 1GCIA 2R1TB 5ENVA 3FTQA 4TKZA 2ZVPX 3ICOA 3PFKA 4YJHA 3SP1A 3GFBA 1FMJA 4A03A 4CKBA 4E5SA 3AKZA 1K5PA 4IF4A 3E9CA 2H06A 4WLVA 3C3KA 1RQLA 4TLEA 3ZYZA 4OAOA 3ZHVA 5CDUA 4YX9A 4O2BB 4YP5A 5F1KA 4IH9A 5LDDC 4I5IA 4RTKA 1F60A 3DW1X 4IIJF 3IAXA 1XRLA 4C22A 3MG9A 4ZP1A 4O02B 2VDKB 1QF6A 1HE4A 1CUUA 3EK2A 5FTKA 1FCJA 3TOZA 1QIKA 2XWBF 4KP7A 1R9JA 2B2CA 2AV6A 3SX2A 3T9FA 4ENRA 5HPYB 1U2SA 4P0PB 1AV6A 2D7CA 3OI7A 3KJIA 3RIGA 3P9CA 1BCRA 1AB6A 4S1NA 5TT0A 1GPJA 3CRRA 1SVLA 4F4JA 4TMWA 3IAHA 5C1BA 4U6NA 3NPMA 3QE2A 1DKMA 3CX3A 1XJQA 1A5SB 2IVZA 3RR2A 3AI3A 3ZHTA 1NA5A 4E5VA 4HDOB 3NP9A 3VH3A 2CXQA 1NV8A 1C3EA 3DV9A 1DDIA 4AQDA 2JGLA 3NP7A 5E1OA 1QH0A 1KOLA 2E5LB 2DRIA 2CL0X 1G1MA 3SZ3A 5ALZA 4MEAA 5DEIA 3V2UA 1Y7IA 1P8JA 3DR3A 3IIKA 1DNPA 3VDQA 1CF9A 2GJ8A 1MKYA 1CQIA 4MYTA 2QIPA 4ZANA 1YQUA 4UU8A 2EEPA 2EV9A 1TKBA 1UBCA 2Q6IA 2ZCJA 2J8ZA 4BCBA 3HBFA 1G291 2CLCX 2JLBA 1CUCA 3BVPA 4KAJA 6YASA 5AI8A 1U0TA 4TXMA 3OIYA 3NDRA 3AOEC 1XR3A 5K0JA 2XTNA 2ZRAA 4US1R 1HMPA 3PTAA 3RBXA 1K4MA 4RNCA 3QBVA 5BP7A 4YJHB 1HZZA 1XLTA 4TGLA 1YE8A 4CKBB 1IJEA 2AR0A 1LX7A 1ORWA 1CHNA 2Y1KA 2ZR7A 4YPFA 1ST3A 3ZU5A 3AVTA 3I9FA 2BM8A 1XKLA 3DO8A 4QEZA 1YNOA 4RDXA 4DWJA 1T2CA 3SLGA 2VO1A 5CVDA 3R0IA 2HC9A 2Y9MB 4B3HA 1ENZA 4KVAA 2CDNA 4QPZA 2HTFA 4HQRA 5EPEA 1D4FA 1NPYA 4G07A 4Y1RA 4UCQA 4B33A 2A9JA 4CM7A 2JHGA 3ILYA 3IKVA 3Q4GA 3UUWA 1E98A 3B78A 2WKQA 3KUDA 5GZ1A 1M6VB 1DC5A 1ABFA 3JZMA 4OYYA 5ALRA 3SAJA 2OQ2A 1CZLA 2EKLA 4M8LA 3LA6A 3DFUA 4M9QA 3CVYA 3DE6X 2C2OA 3HO1A 3PI6A 2PPVA 1LS1A 5C7LO 1UWVA 2QRPA 2Z4RA 4PRLA 3DDSA 4N3CA 1N5KA 1W29A 3E8MA 1OYYA 2CV1A 2C1EA 1AA6A 1DC6A 2VJOA 3GEGA 4C7OA 4EIWA 2H16A 1CJBA 2YMPA 3CZ9A 1I3OA 4LWZA 4XRRA 3UJ3X 3OLVA 1P3JA 1T2FA 4CVNA 4RVCA 5BSEA 3BH7A 4RSGA 2QQ5A 1YASA 4N5HX 2IELA 3C5HA 2ZR9A 4NE7A 4GM4A 2HCBA 1TEZA 1EVIA 3M6MD 4IQ8A 1M1YA 1JA0A 5CB4F 2PV0A 3I1FA 2BFMA 1X87A 4IINA 2JGKA 1KHTA 2GN0A 4DBVO 3CLKA 3HBNA 1N6KA 3KOXA 1I3KA 2HRBA 4XDGA 5IC5A 1BROA 4R81A 4V2UA 2FW8A 5CK5A 5EG5A 2Q5FA 1CQIB 4ZKDA 2W2XA 3LQKA 1PNRA 1UBHS 2VN8A 1YCGA 3B20A 1OH6A 3F9CA 3ND8A 3IBSA 3UJBA 5MN4A 5AVYA 4KTVE 3KSUA 5AKZA 1I1OA 1P9OA 2ZYSA 3NIWA 1VYVA 3DB1A 1NVDA 2FXVA 5FORA 4YT5A 3VBEA 3HY6A 2AG6A 3IAUA 3BL5A 1GGJA 4A91A 5IH7A 1QVWA 3LRTA 3NH6A 4GKKB 1G9SA 1N3LA 3MGAA 3H2SA 4J0CA 2Q5QA 1JHRA 4UHKA 2I55A 1LKZA 3MCUA 2BKEA 3OO1A 2WVGA 4LOLA 4C5AA 3K5WA 4MIKA 1G18A 1H5UA 1JHAA 1XYGA 2XGSA 5GM1A 5C46F 1MDFA 3H9GA 4N0EA 4WZ6A 1YC5A 4P2GA 2ZROA 4FB4A 2AEFA 2DBVO 1N3BA 3F4KA 3G7UA 4G5XA 4Y1RB 3D1VA 3PUKA 1I4DD 1KYWA 1WF3A 1E9VA 5A3JA 3PXXA 1YRYE 2F17A 1V4VA 1RYEA 1Z62A 1LTHR 4BQOA 2AJLI 5DXAA 4UM7A 1PZXA 1Q83A 1PU2A 2A8YA 1NUTA 4CMEC 5K6AC 2ZSFA 3SJBA 1EJ0A 2C3OA 5FNVB 3RANA 1R8YA 1YVEI 3KR9A 4BQPA 4C7OB 4ZCLA 3BE6A 4OV6B 3UV3A 5FLYA 1AHHA 1P0CA 3JX9A 1L8OA 3T7RA 4AU1A 4RLHA 2OXFA 2J3LA 3GUUA 3ZI4A 4GOMD 4TM7A 2ZDQA 2WTAA 3LF1A 1RQRA 4JA0A 5K8VA 5CB0A 3KWLA 4QLBA 4R2IA 1D5CA 1M1YB 1F8GA 1CIJA 2XCRB 1L3CA 2CVOA 1RFGE 2H0RA 4MUHA 5D84A 4M2LA 2AXQA 2P8SA 4Q7JB 4I55A 5BSKA 3P9KA 2OQIA 1QYCA 2IPAB 2XKBA 4NNOA 4FJ2A 4OHBA 3AQ4A 1KI4A 3VC7A 1C3LA 1XWFA 3UJPA 3K9GA 2P2SA 3O1JC 4L5JA 1C0IA 1M34A 3AX6A 4YPVA 4M0KA 2MSCB 3VZCA 3HV0A 3LD9A 1R9NA 1WZUA 4LSMA 1ADYA 2LKDA 3I0NA 4M36A 4V24A 4X1KB 1P1CA 3CO5A 3H83A 5CCEA 1LV8A 3Q10A 3TGWA 4ZYYA 1V11A 1E62A 3G3EA 4JI0B 1QYRA 3L40A 3R5SA 3W1WA 4MIOA 1HNXB 1X13A 2B83A 1P0FA 2GD1O 4C2AA 2D1TA 4NJEB 3IAM1 1FNMA 4AZ0A 4M9ZA 4AURA 1XD9A 5BWMA 2HR1A 3UGQA 2LUOA 3K0KA 5CAEA 2G1KA 3CRQA 5DMHA 3H4VA 3KOYA 1QP0A 4M8KA 2O05A 1ZJYA 4JS0A 1ACLA 2GCNA 1XA4A 2ZCUA 3DOEA 4N0QA 4TTVA 4LF9B 3C16C 4KTTE 3ENQA 5DYGA 1IXSB 1SKAA 2MMCA 2IXDA 4N76A 3GJ6A 4RPLA 2VQSA 2HKIA 5K8IA 3HFSA 4ZOAA 1GU1A 1VYTA 2W90A 4NG5A 3M70A 2LKCA 3K6JA 3KUKA 3VVLA 1ODJA 3IP6A 1RNLA 3ANNA 1NQWA 1TXGA 2YYAA 5IC6A 2WM2A 1D7OA 1ZD4A 2X5OA 3ABSB 3HCPA 3WRXA 5KUTA 1BCSB 1C1HA 3WS7A 3TO5A 2GLUA 5DNDA 4ZT2A 3C1TA 4DJFC 1JT9A 2HB6A 3AKYA 1D2AA 1LLFA 2CD7A 3JTMA 1LEHA 8OHMA 2MR6A 3M5CA 5IN5A 2D3TA 2DWOA 2PLNA 1SG0A 3KVVA 3LDHA 4LF6B 1RAEA 3NTUA 4NS4A 1O97D 4R54A 4REOA 3W1EA 2C2XA 4NL4H 3ZCXA 4WXEA 4N8SA 3KKMA 1R0ZA 3R77A 1XTKA 4U6SA 3EN0A 5TIIA 3VI3B 3V8MA 1RXVA 1M6NA 1DIHA 1YF3A 3KSMA 4I55B 1FUEA 4LCBA 2D5AA 3OY2A 1XZJA 1I1NA 3ADOA 3ZWDA 2QPAA 4M0LA 2B4KA 4PQYA 5IVKA 3E9ZA 3HBAA 3OOWA 2QN7A 5BWOA 1XBTA 4UCXA 2YH2A 3MZ0A 5DM1A 3ULKA 3H4MA 4AP5A 2C07A 3DVAB 3UC9A 2R8RA 2I2XB 1FDSA 1IEWA 3K32A 1JPVA 1UEJA 4HDKA 4N6OA 2FZLA 4AKGA 1X8KA 3G0HA 2DBZA 4IVQA 2WD7A 4BFXA 2QN3A 1BOFA 5JXIA 3EF0A 3LTEA 4AZ0B 5BT8A 4IS3A 2D4HA 3L49A 3HKCA 3QH4A 4RV9A 4UVGA 5TQ2A 3EW7A 1I6WA 2SKCA 3UT6A 3DUFA 4DNOA 1C9JA 1RYDA 2NT4A 2EWVA 3GAZA 4XUCA 4ZVKA 1N32B 4RUKA 1GUAA 2AQHA 1XU7A 2R8XA 4M1YA 1EVLA 1YT5A 4YI5A 1T0HB 1OPXA 3HSYA 4OJKA 3E22B 3AR4A 1YJ5A 5DBGA 1SD5A 4DNFA 2R48A 5GWXA 5ILQA 1EX6A 3DT9A 1LLCA 1T3GA 1X2EA 2QM3A 4ZVPA 3O3MB 4CEIB 3NORA 4OQQA 1YZGA 1N6IA 4FLEA 5IBCA