3MLBA

Banadd in complex with inhibitor 1_02_1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords nicotinate-nucleotide adenylyltransferase
publication title Complexes of bacterial nicotinate mononucleotide adenylyltransferase with inhibitors: implication for structure-based drug design and improvement.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 56
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mlbA00
3QTBA 1N2OA 3S3TA 1TYBE 1J21A 4KR9A 1S4MA 1D2RA 2VXOA 4ZCSA 3TZLA 3P0JA 2JANA 4Q16A 4HPWA 4R2MA 3N8HA 4KR6A 4OUDB 1JIIA 3CVVA 4MUKA 2CUZA 3CLSC 3CR8A 2JA2A 3SEZA 4MWBA 4HK4A 5EKDA 1TQ8A 1U0BB 1O95D 2A4MA 3CVWA 2QTMA 1T6YA 3F3MA 3N2YA 5LM3A 3A05A 5KCMA 1KORA 4I6JA 5FO0A 3DPIA 3X1KA 2CV2A 4ZT6A 1OWNA 1EXDA 4CQNA 1O97D 1GPMA 2O8VA 4MW1A 4EFKA 2CYCA 1F7UA 2BTEA 2IP1A 4HJXA 4EG1A 3KT6A 4ZT7A 4U8HA 2QUIA 4EGAA 3FH0A 1QRTA 4YP6A 2IJGX 4EG8A 3ND7A 1T6XA 4I6GA 3JXEA 2X0KA 1PG2A 1WQ3A 2A1TS 3VU8A 2AZXA 1HYBA 1O96B 3AKZA 3CVYA 4MQ6A 4MUHA 1N2GA 5TS2A 3UOWA 3PNVA 4OUDA 2WQ7A 1NUTA 4ZT5A 4MUGA 3LCJA 4DDKA 2V0GA 1QRUA 1MAWA 1H3FA 1PFUA 3ZXIA 3FG9A 2VTBA 3FOCA 5TEVA 2DUMA 5AHWA 1M8JA 1F7VA 3AFHA 4CDMA 5DK4A 2DEUA 2HZ7A 1QRSA 3IMGA 3CLRD 3ZIUA 2GM3A 1KKUA 3ZUGA 4YP5A 1QU3A 1KQNA 2B7LA 1JZQA 4MVCA 1EFPA 3UMVA 4QBTA 3IVGA 3P0IA 1YI8A 1OD6A 1T9GS 1IQRA 2OQ2A 1XNGA 4AQ7A 3RBAA 4XFDA 1VL2A 1LI7A 1H1TA 1MRZA 3FWKA 3VGJA 1KP2A 1NYLA 1IH8A 3C8ZA 2CV1A 4H3SA 2QUJA 4MW7A 1WOYA 2CFOA 5LLTA 1KQPA 2DLCX 1YUMA 1N2HA 1QU2A 4KPUB 1WXGA 4MW9A 4L2IA 4MWCA 2A86A 1KP3A 5HUHA 2J07A 1VBMA 1GLNA 3G6KA 3NV7A 4WNYA 1YULA 2JAXA 1I6MA 3SZGA 1OWLA 3NBKA 3RJZA 1K4KA 3N05A 4MUJA 3H9BA 1TYAE 1N77A 4XFJA 3SP1A 3ZJUA 1WQ4A 2J5BA 5J59A 4MAFA 2HMAA 2Z3VA 3D6UA 4EG5A 1KH1A 5H7XA 1J09A 1JECA 1UFVA 1V47A 3IH5A 2PXHA 4R0NA 1ZH0A 4ARCA 1B6TA 3L92A 4EG7A 5BNZA 1IRXA 1PFWA 2PIDA 4JYZA 4NATA 4MUEA 2D13A 4KPUA 1O94D 4NX2A 2WB2A 4MW4A 1Q77A 1MAUA 2A7XA 3M5WA 1NUUA 4CT0A 4XSVA 4MUNA 1WKBA 4YMIA 3COYA 5HUJA 5DEOA 4I6EA 2C5SA 3MXTA 3IOBA 1NUSA 1X6VA 3GUZA 1O97C 1VBKA 4MWDA 5IJXA 4QRDA 1YUNA 1ZUNA 1EFVB 1J70A 2DERA 1ZJWA 1KH2A 2E89A 1DNPA 5FNZA 1NZJA 2A88A 5KWVA 2NZ2A 1P7PA 2E21A 3Q12A 1OWPA 3MMXA 2WSIA 4PBRA 4TS1A 4NAHA 3H99A 3IDFA 3CVXA 3ZJVA 4EF6A 3IOCA 1NSYA 4MVWA 2AG6A 1JEEA 3IMCA 1EUQA 3INNA 3ILVA 4QREA 1G59A 1M8FA 1GZUA 4GRIA 3D6VA 1EUYA 3COZA 3L93A 3RK1A 4DNXA 3AG6A 4JXXA 2NSYA 3CLRC 2CSXA 4ND7A 2A1TR 1NURA 4MWEA 1LI5A 3BL5A 3OTWA 1G8FA 1NI5A 1O6BA 5TEWA 2PG3A 1EFVA 5J5AA 2QUKA 1N2IA 2X3FA 1N1DA 1XNJA 2PFSA 3GMIA 3PRHA 4ZCQA 3U1VA 3LE8A 4NDAA 3DLAA 3DO8A 3UY4A 1U7XA 2OV4A 1SURA 1H3EA 1KAMA 1TEZA 2V0CA 2H2AA 4R2LA 2XRZA 1QTQA 3SDBA 3RHSA 2Z08A 3TQOA 4CDNA 1O96A 1OWMA 3CLTD 2QUHA 1M8KA 4RPIA 3ELBA 5J58A 1YIAA 1I6KA 4MVXA 1N2BA 4YP7A 3PNYA 1T9GR 4HJRA 4J75A 3ND5A 2O5RA 1JIKA 1IFXA 4MLPA 3KT8A 1U7DA 4A91A 1GTRA 4MW5A 3AIIA 3IVXA 1ULHA 1K92A 2E18A 4U7JA 1XJQA 4EG4A 5F23A 1NUPA 4FZJA 2IELA 3G5AA 4G6ZA 1KH3A 1MOPA 4JXZA 1X8XA 4F4HA 1I2DA 1T6ZA 2ZP1A 3TS1A 4GU5A 1O0BA 1IQ0A 4ZT3A 3IOEA 1G8HA 1O94C 3Q10A 1GAXA 3ND6A 3P0HA 4MULA 4OJMX 1F9AA 1R6XA 2QJFA 2PZ8A 4MUFA 3LOQA 5LFAA 1NP7A 1H3NA 1ZH6A 3GLVA 4E1AA 3MUEA 1KAQA 1WY5A 3IODA 3E27A 4NAUA 4MUIA 2A84A 5FO1A 1F4LA 1JILA 1O95C 4PY2A 3KT0A 3IVCA 3COWA 1MJHA 1N2EA 2CYAA 4S1OA 3UK2A 1OBCA 1J1UA 1N78A 3HFJA 5JBNA 3CLUD 2YY5A 4Q93A 4G5FA 3QTTA 4PBSA 3ZXSA 2GOYA 1JGTA 1JHDA 3ZGZA 1J20A 1VLHA 4ZT2A 4PBTA 4YBRA 4DDHA 1TYDE 4U63A 4WSOA 4X0EA 1PFYA 2HGZA 1LW7A 2X1LA 3SYTA 2DR2A 3K32A 3N9IA 4ZT4A 4EG6A 3PNBA 2J4DA 4K0RA 1OBHA 1R6TA 2BYTA 3RFFA 1U3CA 3K9WA 1WXFA 1IQUA 3MLAA 4K03A 3NBAA 3COVA 2GKSA 2J08A 3Q4GA 1GTSA 4DLPA 5DASA 2DXIA 2VTBB 1Y42X 3CVUA 3H9CA 4ZCRA 1FFYA 4J76A 4DDMA 3CLSD 4F3RA 1QQTA 2XRYA 3MLBA 2QJTA 4UZEA 1IVSA 5IHXA 4MVYA 4MW2A 4BWVA 1QJCA 2Z09A 3CA8A 3X1MA 4DE5A 1KQOA 2I1LA 2DETA 1EFPB 1QNFA 3UC5A 3TZEA 3HV0A 1O0CA 2CV0A 2YWCA 1GN8A 1M8GA 1R6UA 5DB4A 3HL4A 1TYCA 2ZUEA 1N75A 3CLTC 3VRHA 1JEDA 2CYBA 2X1MA 4RUKA 3FHJA 1JIJA 4NZPA 1RQGA 3HZRA 3X1JA 3ZJTA 3PXUA 1EE1A 3AG5A 4JZYA 3TQIA 1N3LA 2A1UB 5TGTA 3FIUA 4KKVA 2EJCA 4MW6A 1WJGA 5K0TA 1M1ZA 1U3DA 1MB2A 1OWOA 2WQ6A 4L2IB 4ARIA 2EL7A 4KR7A 2R5WA 2AKEA 3ISJA 4MW0A 1JZSA 1WXHA 1N2JA 3SEQA 3TNJA 4EG3A 3A4IA 4G5YA 5K0SA 1K97A 2PZAA 3A04A 3DV2A 5HG0A 1G8GA 2DPLA 3IUBA 1COZA 4ZCPA 3SZ3A 3KT3A 5KHAA 2ZUFA 4ZCTA 1O5TA 3FI0A 2YWBA 2RE8A 1Q11A 2QTNA 1IHOA 1Q15A 3RK0A 1Q19A 2QJOA 4UZFA 4JFAA 3H05A 1BS2A 3FNRA 1PG0A 2A1UA 1NUQA 3FDXA 1MBZA 1K4MA 1FYDA 1M8PA 1WXEA 1WZ2A 1YIDA 1WXIA 3QE4A 2H29A 2PZBA 3OP1A 3A2KA 2J09A 5H16A 4P2BA 2RD2A 4ND6A 1TFUA 1KR2A 1MC1A 3P52A 1ILEA 1A8HA 1M83A 2D5BA 1JMVA 1I6LA 1CT9A 3IUEA 3G59A 1XNHA 2TS1A 2QTRA 3CLUC 1J1ZA 1VBNA 3HGMA 3FY4A 2G36A 2D54A 3HMQA 3AL0C 1PFVA 3I05A 2CT8A 1MB9A 1V8FA 3KFLA 2YXNA 4AS1A 2E0IA 3FETA 1EJ2A 3H97A 4DJAA 3IMEA
chains in the Genus database with same CATH superfamily
1BX1A 1ZIOA 1N2OA 2BN4A 3T5DA 3CW8X 5LOVF 3VOTA 1W76A 3AEQA 3T6KA 1KDRA 3RUAA 1XEXA 2WVHA 1L6IA 1T3TA 3RTGA 5CFRA 2AI2A 3W5IA 3C3KA 3EGIA 5AKKA 5ARBA 3V8RA 4JJKA 2XWJI 5JO0A 2F3QA 2VXYA 4ALLA 1PGQA 1YH3A 5I01A 5TC4A 3AR2A 4AK9A 1RHRA 3DVQX 4WLUA 3UAYA 4WK6A 2NX2A 4RANA 5F1YA 2XT6A 2ZTUA 5GVSA 2H1SA 1J7JA 1FYVA 2EAUA 3T9DA 4CLHA 2ECOA 4GPZA 3MQ4A 1WB9A 1P8AA 4JBWA 2O8VA 2OGZA 2GPYA 5B57C 5LXTF 4RPCA 1SUWA 2HJWA 3AH8A 3PIIA 3QI7A 4LGYA 3RYHA 3UHOA 4JT9A 3LCUA 1J06A 3KT6A 4JKIA 2XUAA 1W4LA 3D4PA 4U8HA 4HBGA 2G25A 4Q47A 5DULA 3SYNA 3VFDA 3HBLA 3JQ8B 1SRQA 4YP6A 4EBBA 1A2KC 2JGRA 3PE6A 1I7PA 2RKWA 2X2OA 3ASVA 1WQ3A 4B3SB 1OR8A 3VHQA 1TCBA 3CY6A 2JLWA 4P3XA 5FAXA 3MQFA 1L5OA 1L3IA 1GG9A 2BHTA 4QFBA 4UNPA 2NZWA 2IW1A 4LJKA 2GJ4A 1DFGA 2J6HA 3ZGNA 4EJSB 4R6XA 1Z4MA 5K3DA 2V58A 4REOA 2DQSA 3IT1A 3EDOA 1T9DA 2WQ7A 2WJPA 2J9FB 5K3CA 3CEJA 1FUIA 4NE2A 4HZUB 3BXHA 2XYPA 3OETA 3EMVA 3ZS9A 1XTZA 3MFQA 3Q0IA 1SHZA 5DBEX 2UYQA 4J91A 4MUAA 3DQPA 5JZ9A 4R5MA 2QS9A 4XLTA 3TG8A 2BSAA 3OFSA 4PANA 1MEEA 3O4JA 3AVXA 4X1KA 1Z29A 3WWPA 2H2FA 1L8AA 2CHFA 2WF7A 1GUBA 1ZBDA 1XQYA 2VLIA 1QFYA 5IRCD 1UT8A 2GA8A 2O19A 1T5LA 3NWEA 3GWGA 4LRYA 1RC8A 3OWXA 4QZVA 1EFAA 3LPAA 4BP9A 3N28A 4ND8A 1D2AA 1LPNA 3I2IA 3BEDA 1GGFA 1JPUA 1IY0A 3P9SA 4IUYA 3R7BA 4D3FA 3SEFA 1UMDA 2C2ZA 2REQB 4Y2SA 1HG0A 4W5TA 4GFDA 4YHBA 3IUYA 4CKCA 4LYGA 3ZDAA 3RHFA 2VO1A 4TKZA 2BELA 5H80A 4V02A 3JQ9A 2CHGA 4BO1A 3WDLA 1SOVA 3OJCA 3HBFA 1QQ5A 5AW2A 2QUJA 1AU9A 3ZD6A 1ZS9A 2EHJA 2IHTA 1N57A 2FWNA 3GVCA 4WKPA 4B7UA 5E4YA 4G9BA 5EHXA 1HDOA 2NXNA 2DFNA 2HWKA 3ZYZA 4HV4A 1IWBB 1DBSA 4ZZ3A 1B8PA 3EZ6A 4TLMB 3QEBZ 1Z0AA 4DLSA 5JYBA 1VCMA 4OHCA 2Q5EA 5JC8A 5HX7A 3EZYA 1LEHA 3L6BA 4PFQA 3VYUB 2XADA 2BDEA 2AKYA 2DGDA 2REXB 2YWRA 4XTRA 4M9SA 2B5VA 4YRCA 2ZSUA 3A1NA 1IULA 2J32A 3FTEA 4O8CA 1GA4A 3B3AA 1I3KA 1AOXA 5AHOA 3RJZA 3REQB 3PWZA 3T95A 3UXEA 3K9NA 1NX6A 1SKQA 1ZOPA 2COKA 4E2FA 5KSOA 1NP6A 5ELXA 3O8OB 1CS0A 1K98A 2Q2WA 4LY9A 16PKA 4GW3A 1E9EA 3IEUA 4LHYA 3IH5A 2XAAA 2QG9A 3OFKA 5IU6A 4RHTA 4QTYA 5L4LA 3PR2B 3WLJA 1H8HD 1G291 3MS7A 1J9EA 3A3KA 3AOGA 3BILA 4C3UA 2NU6B 2N42A 4B0PA 4ER3A 1BGVA 3LQRA 4N0QA 1EJBA 4ZYYA 4YP1A 4MW4A 2H5EA 1NE2A 1M73E 1VL8A 2DUUA 2GFHA 2IOYA 3HKBA 4KAAA 1ETUA 5IJAA 4E5YA 4YAUA 2OBNA 3IUJA 1C0EA 2R97A 3HBMA 3PHLA 4IEFB 3T7EA 1YMUA 4EX6A 1OTHA 3KC2A 3OIDA 3S1LA 1T29A 1Z2EA 3BKWA 3A36A 2P1RA 3C6MA 4U39A 1XVAA 3DVSX 3AERB 5EWMB 1KYTA 4DCOA 3K70D 5DHQA 1O9HA 4LV6A 5IJXA 1JG4A 3OZVA 4HFJA 2X4IA 1JFLA 4OQEA 5DN9A 4FXOA 2W2KA 5JH7B 1R1DA 2FFBA 1QWSA 2O7QA 3E5NA 2FWJA 2Y1GA 1SAYA 3I3OA 4GLBA 2CFRA 3S44A 3KL4A 1VLMA 3SHFA 4DL9A 1ZINA 3WL6A 4OQFA 3O75A 3TVYA 3UMFA 1VIYA 1X7ZB 3D0RA 4TTJA 1T5IA 5EFZA 1NN1A 2YN0A 1BA3A 2ZRGA 1NQTA 2GCOA 3IV9A 2EX0A 3JYNA 3MCAA 2HLDA 1XB2A 5CR9A 1X14A 1JIQA 2JPDA 4HQNA 5LQNA 2FQWA 3U4AA 2CB9A 3HUEA 5KTKA 4GLOA 1NVEA 4YJFA 1X3SA 3WFZA 3HRIA 4YT2A 1L1EA 3EPPA 1YR6A 1NW6A 4X94A 4CR8A 3ANTA 2XUKA 4LWOA 2A9RA 3L93A 1TVCA 2DBZA 1B8NA 4JUCA 4Q3LA 3RC9A 2HT1A 1IZ0A 1QZUA 4X44A 3D3JA 3KKNA 2M1ZA 1OXBB 1BMFD 2YJTD 1EM8A 3O94A 1PCXA 3M6LA 4TLEA 4WESA 1JJ7A 5FIUA 3QE2A 3RH0A 3HVRA 3WL8A 1QHFA 3BRSA 1XJ0A 3HWSA 4BQSA 1ORTA 2P9HA 4F4IA 3I6YA 2I99A 1U8EA 1XMOB 1UBEA 1NR5A 2GNPA 2YXLA 2AXPA 3Q98A 5EIBC 4ZCQA 3B3FA 5E1MA 4TUYA 3KHUA 3GD5A 5LYJA 2DFTA 2IBMA 1GPDG 3D8NA 4IZOA 4YV0A 4X6UA 1NTOA 2BCGY 3AEKA 2XGOA 3BMCA 3CNQS 4P82A 4XWGA 1ZONA 4Q4HB 2JC3A 1H2AS 2AWOA 3WNBA 1K7SN 3IP5A 4R2LA 1KO1A 2XI4A 5FUMA 3SDBA 1NVWQ 3ZU6A 2TMGA 3DE4X 3R7DA 3WGKA 3A7DA 2CHVA 3IUNA 4J16C 3DS8A 4LTDA 1IU9A 4Z8XA 2Q3BA 1UBGA 1TQDA 3OD5A 4E15A 2XUOA 3PL1A 3QQ5A 5CFNA 1SQFA 1ZDMA 4N6OA 5JNWA 4MVXA 2EZ9A 3A4VA 2MYPA 3MOGA 5AWFC 3EHDA 4EPTA 4XWOA 1T9GR 4UE6A 3TE6A 2ZXUA 3TN7A 1F20A 4DIFA 1C2YA 2XB8A 5E4FA 3INRA 2O5RA 1XAJA 1IFXA 3HJAA 2LNDA 2PH1A 4I50A 1FS5A 4Y0VA 1UAGA 3CYFA 3JQEA 3RTDA 3TSZA 1UXIA 2B83A 3ZKAA 4EA6A 3FYUB 1HC7A 2F67A 3COJA 2IHKA 1NFRA 3B12A 5KNBH 5IDVA 3AI7A 2EYQA 1D6NA 3M34A 1UQTA 3K8OE 2RK4A 2UUOA 4R83A 3P26A 4GX1A 1HT1E 4RF2A 5LP1A 3C87A 4FX2A 1IY1A 1TLFA 1QDEA 5KWSA 3N70A 2CK3A 4RH3A 4UTVA 4WNCA 5LKRA 1MOPA 3C8MA 4IXDA 3QENA 4JV5B 4IV0A 2ZIWB 5F2OA 2ZSFA 3Q15C 4P4TA 5BYJA 1WNFA 1ONPA 2PLAA 4YAJA 2B2NA 4R3UC 2XA1A 3PPWA 2AC7A 1UZUA 1XG5A 5DDIP 1MNQA 3B1ZA 1DKUA 1IBCA 3OP4A 4KQIA 3KOOA 4EHKA 4C7VA 4I1UA 3ORSA 3V00A 4BECA 3MWGA 3P0HA 4HOYA 3FMPB 3EN0A 3RIYA 3VR5D 3EEFA 3ZZMA 2Y1OA 3LOQA 5DT2A 1AUPA 3ZV3A 4F8EA 4QASA 3M9XA 1Z6YA 3R3JA 2I34A 3IOMA 4II3A 3PIDA 1GTZA 1P0QA 2R11A 1Q5PA 1US8A 1N5JA 3OIUA 4J4BA 4UHEA 4WRRA 3CUYA 4KITB 1RQ2A 3EUAA 3R3WA 4JJ7A 4RPHA 5CX1A 5G0UA 1SG0A 1H22A 1ZJZA 4PY2A 4ARZB 4F5WA 3HCBA 4QDJA 4WBNA 4YMLA 1I4OA 2P2NA 3KEFA 2Q3HA 5FI3A 4MINA 2OAQ1 1YBFA 1N7IA 1U8YA 1IONA 5DTMA 3RUIA 2PSFA 4WCVA 5I8ZA 3DNMA 4BP8A 1CUWA 8LDHA 1V11B 4KRYA 1QK4A 4TV9B 1P9NA 4EHDA 4W9MC 4Q93A 3AY7A 1WOMA 1XRQA 2JI7A 2J59A 4MA4A 1O7JA 2OEPA 2OT3B 1CRQA 3OE1A 2H06A 3QWAA 3R6GA 3V2IA 1BJKA 1XK7A 2C8KA 2YJ3A 4IKEA 4U63A 2YJ5A 1WMAA 2QQFA 1XVUA 3LUJA 3QMVA 3AF4A 4FSHA 2RGAA 2NO7A 2CVQA 4ZJUA 3SYTA 3COPA 4P7GA 2MWMA 4RKWA 2WWHA 1MO4A 3R0QA 3C4VA 3W2EA 3ZHXA 4NENA 1P3JA 1P80A 3GDOA 4K0RA 3ORYA 3RFFA 2IXTA 2WRZA 3KB6A 1SQ5A 3DQQA 3M9LA 4RMHA 5DK6A 1OB5A 4O08A 3FTFA 4IR7A 3RU2A 4PYNA 2FP3A 4QDUA 4ARVA 4W9RA 1GNLA 2VG8A 1C2TA 1LQTA 3GBPA 3JRNA 3IBYA 3K0HA 4WXHA 2OXEA 5LZ8A 4W5RA 3BD9A 1CBUA 2TMKA 4XW2A 5E6SB 4D56A 3CLKA 3GEPA 2O3TA 3ZE8A 3JQGB 3C7AA 4ZCRA 5J2UA 3ET5A 1ETHA 3OQNA 2OHGA 2DR3A 3NOQA 1VYVA 4ETMA 1GGNA 2BH2A 1MVNA 3SS8A 2ZDQA 4BWVA 3KSRA 3QZUA 5CEJA 3H16A 4H4DA 4DE5A 4CL0A 1XVIA 4UTXA 3P2OA 5EP3A 3LSYA 2BOVA 2JFBA 2RGWA 4MTLA 2GF9A 4AJKA 4PPYA 3ZOKA 1GEGA 3HKDB 4CTMA 5LPNA 3DAGA 1O2DA 1GQQA 3EVCA 1O89A 5H3HA 2JFUA 2HU2A 3CLTC 4TQUS 2BGWA 1L9XA 4PV7A 2CJWA 3NATA 2V7VA 4I08A 2IUUA 4CPDA 5F7JA 3CPSA 2PUCA 2LRHA 5DRTA 3E7PA 4JELA 2DYKA 1X1SA 4BMSA 5BSHA 1MX5A 4LWPA 3OZRA 1ISFA 5BWOA 5IDQA 3FIUA 3RAGA 2P9TA 1VJTA 3MF4A 3RE1A 1WJGA 3UN1A 1NXTA 1G4AE 3AF0A 3PIRA 1B0ZA 1SCAA 1JQBA 4UHDA 1UBMS 5LJIA 3AM3A 1F0KA 4MMZB 5CG1A 2DHDA 1G8AA 2CCJA 4JLWA 3TM4A 1YRQA 3KU4A 5ECGC 2IRWA 2FZLA 1V1MB 1A96A 1ZH8A 2KI5A 4A8JB 2YV5A 3KV1A 5E3HA 4UUPA 3AEZA 2XGSA 3TPCA 5CYGA 2QAGA 1PJBA 2A30A 4KGZA 2Q2QA 1G8GA 1E66A 1SHTX 3OCJA 1OJ7A 3O9MA 4HDRB 4PAOA 4OI1A 3TOSA 4DHWA 4BEWA 5FLXA 4I1PA 1GLGA 4DR4B 1DJMA 4JDPA 2IHJA 2EL9A 2EQ5A 3K09A 2RE8A 1RMYA 5L6LB 3DH0A 2Q1UA 3HDVA 1H1LB 5TRTA 3QU9A 1GQYA 2PWZA 3RFCA 4CG3A 3PC8C 3EQZA 1Q19A 4CLRB 1JEAA 2ZIXA 3D2AA 4FQ5A 4B6JA 4GEGA 3F78A 3TTXA 1E9RA 2R62A 1E1LA 3S2YA 5FLKA 4YYEA 1FX0B 3E2MA 4G85A 4MV4A 4UARA 5T6BA 4ALKA 1AXRA 3MK31 3QA3E 1T34A 1YR1A 1FNBA 4FP9A 2Z83A 5SZKB 1K27A 5DHTA 3GRVA 1C8BA 1V25A 3ACDA 2C07A 2QV0A 3BCHA 3H9JA 2FR1A 3KOWA 4G63A 4KQ2A 5DM2A 3ETHA 5KYXA 1WF3A 3ZQ4A 1SR8A 1U8FO 3P4XA 3DC7A 3IA2A 1ND6A 4INAA 4XH9B 3R7NA 3ESAA 5H82A 4HN4B 3ZWYA 3HHEA 1LQUA 4H7JA 1MQSA 1N2CB 4TROA 2BJHA 4F12A 4PIMA 2R2GA 5FTMA 1A9XA 2YJNA 5JS1A 4MVJI 2ZYRA 4PCLA 1J1ZA 4WCFB 5ULLA 3KQHA 5FBZA 2XW6A 2I7TA 2V7XA 2YZKA 1FDSA 3U9SA 4AM8A 2O54A 3HGMA 4X6XA 2J5RA 4CUZA 1VL5A 3EGXB 2CUTA 3BDVA 2Z4RA 1KE1A 2ZREA 3KB8A 4QAQA 5KJEA 1IOWA 2OK8A 1EWQA 2I03A 4XX0B 2Q4BA 2RK3A 5IBCA 1ZW1A 4EPWA 1DEKA 1TCVA 4LOAA 1ADFA 2B34A 3GZJA 2P4QA 5DX1A 1X1QA 3UG6A 1GJRA 3IB6A 4DUGA 3E1SA 3RTEA 1GM5A 3CXUA 2WUEA 5GGYA 5HM8A 4N6NA 5TDHA 4OX9Y 1QUFA 2A5DA 4U0JA 3NJRA 2FZCA 3E9QA 1ZD1A 4IDAA 2SBTA 4KR9A 1JU4A 1S4MA 2PX0A 2UVPB 3LAWA 4ZQGA 1V1JA 3N0XA 2J5XA 5LOVB 3OZWA 4NS1A 3ROEA 3WWZA 4OUDB 4PNHA 4EATA 1MOQA 2HHJA 2PKXA 1JIIA 5JNVA 1V26A 1YR3A 3PKZA 4CGYA 2DZDA 4CKYA 2A5GA 1QX3A 1J8QA 3CHYA 5KZMB 3NVKI 4X8MA 1T2AA 3G89A 2A4MA 1FRNA 1GSAA 1UJMA 3LPLA 4K6OA 4CM8B 2GN2A 1EQUA 3EZFA 2AVNA 5BT8A 2O5CA 1KORA 1BCSB 4JMPA 3CNLA 3F96A 4MW1A 3RS5A 2F9FA 1DC4A 2ZWMA 5DISB 3STUA 1QZXA 2NGRA 3G5MA 5KNCA 4DSAA 3OAAD 3PHBE 5EKUA 5EC8A 2R5NA 1HDRA 3Q3JB 2FNAA 1S3GA 5FULA 2AEEA 1ORHA 2FLKA 1J0EA 2Q4DA 4Q3NA 2SCUA 3IX7A 3TOXA 2IODA 3HBNA 4AJOA 3DGEC 2ECPA 2ZI9A 4IAOA 2EHDA 3PDCA 3QYAA 4UVDA 3FFWA 4UKDA 9LDTA 1HYBA 1O96B 2H52A 1AV6A 3AKZA 4QBIA 1UBHS 4Y1FA 1AS3A 1H65A 3ZH2A 1NL3A 1NKTA 4ZP1A 5B1IA 2AMFA 3S27A 4BFXA 1Q7GA 5IT4A 2JAQA 3SEAA 1YBMA 1FQOA 1LPBB 3B5EA 2G9RA 1SZPA 4LDQA 4JBHA 3L1VA 1RC0A 2PZMA 3HGQA 4B48A 1XTKA 1C81A 4URZR 3WNDA 1WPRA 2AMVA 2QLMA 1WP4A 3QU7A 4F97A 1FVFA 5EJ8A 1G8MA 1OXMA 1S01A 4RLHA 4FDMA 3USCS 3I61A 2WVGA 4MKRA 3TQQA 1TVKA 2X7HA 2PX6A 1HNZB 3DDHA 3X1WA 3K2EA 2H1WA 3I9JA 1RPZA 1QVWA 1Q1AA 5JHGB 1XZHA 4F46A 4ZARA 4ZVTA 1KKUA 3DV0B 5SV2A 4XUDA 1PTJA 1PK8A 1NQXA 4EDHA 1ZD2P 1FU8A 4ZA2A 2IZOA 4KMRA 1EVLA 3E18A 1L5RA 2O06A 2PSDA 4DDUA 3BWCA 4KI0A 1TT5B 3UJAA 5MN5A 2GCIA 2J85A 3DBHB 5EKXA 1Z38A 5HIIA 3HCRA 4EB6B 2FG5A 1CSEE 2VJAA 4M6WB 2FR8A 1TKBA 4R81A 1QCDA 2J3EA 1E8MA 1MVOA 2IXGA 2QRGA 1K6MA 3E70C 3FKJA 1GL7A 1MRZA 1PWZA 4IRUB 1FRZA 1FQKA 3TWOA 4CTOA 4WINA 3HABA 3DFKA 4KI7A 4UM9D 2AG0A 1LF5A 1C9NA 2CEAA 3L1IA 4MW7A 4EUKA 2V7UA 3OE5A 1XCGB 4GMGA 5FYQA 2AOTA 4M76B 4UQOA 5GV7A 1S3IA 3EC2A 5KOHA 2CLSA 5HIJA 1AHHA 2OE2A 3CU5A 3TUJC 1Y1QA 5GZ3A 2HSJA 2FZ5A 5EJ2A 2SKDA 1CUXA 3C14C 4QELA 3OFVA 1P4RA 3JZDA 5JY6A 1L9KA 2XQGA 3RR2A 1TM4E 2R85A 1PYDA 3BCSA 2CDBA 2NSDA 2NVOA 2WQZA 3CZCA 3L04A 4J0IA 2HCFA 3UIEA 3V4PB 5JUWA 4X6YA 3KR9A 4DA0A 2VHQA 4BY9E 1W88A 1W5FA 3A70A 3PSAA 2OD7A 5K1ZA 5KYUA 1NI4A 4KNYA 2AG8A 4EPVA 5A5FA 4F3KA 2EKBA 2R7LA 4ZQEA 1UBOS 3O0TA 1NXSA 2EBFX 4P31A 1W94A 4FM9A 221PA 2Z3VA 4MR9B 5CNIA 4B44A 4DQUA 5FLEX 1OVMA 3QHPA 3IQEA 4F0JA 5ERGB 1D7AA 3PC4A 5AHKA 3OM1A 4F6LA 1TEXA 2CLHB 5IJZA 1DWQA 3H5AA 2ZB3A 2QN1A 1IRXA 1UC9A 3C0KA 2BKEA 3KKKA 3WYFA 4FR5A 2IVFA 5GGXA 2WUFA 3F6SA 4XIFA 3PYLA 1UKZA 1AC5A 3GZ4A 3MWYW 1WXDA 3Q7IA 4GXRA 1N33B 1R9NA 1WVIA 4HGOA 5FA6A 3WGVA 1QV9A 2V96A 1WKBA 4YMIA 1WZNA 4FVTA 5ENDA 5BOVA 3C3EA 4KXWA 2QZJA 4J7AA 4B4DA 2UU9B 5CDFE 3HU2A 1AF4A 1W4ZA 5BSMA 1C9KA 3RM3A 2C7OA 3ERCA 1EMDA 1CUGA 2OENG 3G2KA 5EWJB 1E2KA 2G04A 3AZPA 3THWA 4RXUA 2QPOA 3L0CA 3E8MA 3I92A 4MRRA 2RGCA 2Y1KA 4QBKA 5IVPA 1Z74A 5BNFA 3FAZA 2ZRAA 4YALA 1ULBA 4QHYA 4WZAA 5KYGA 5GM2A 5K0GA 1DVRA 4MR8A 1P7PA 1MABB 2P67A 2GWHA 1F1JA 2VPZA 4R2HA 4DA4A 1AGNA 1TVEA 2VHXA 1JA1A 2W6JA 2Q07A 2YBDA 2XTAA 1Q3TA 1UXJA 3ELDA 1WY7A 3DPSA 3H99A 4G0PA 4NYJQ 4P5DA 4A3SA 1PJTA 4CM9D 3NETA 5L40A 4NF2A 1ZC3A 2F90A 1JFFB 3NM6B 4EEKA 1LDMA 3PNQA 4NCNA 3WO1A 2BEKA 3A2MA 3NPAA 1RMQA 2QENA 5H5JA 2VWHA 3INNA 3CRMA 1M8FA 3H8SA 3GHYA 4GRIA 3V8EA 4DUGD 2R44A 2NN3C 3AXSA 3UH1A 4EEZA 2G1PA 2NYVA 3U6BA 5AJUA 3A6ZA 4NYJR 5BQPA 2AOXA 3AFNA 3I8OA 4ZAZA 3TXYA 1HBJA 1GCGA 1UDRA 2PBFA 2VNSA 3INYA 5B7QA 4KH1A 2Y0CA 4KUHA 2WD9A 4QOSA 3CZRA 1Q92A 3R40A 4YT5A 1X9HA 1XELA 5F51A 3VKGA 2AN1A 4KX5A 2IZ0A 3NBZC 1AA9A 2O1SA 2ZEJA 4I8DA 4P81A 4TQAA 2F48A 4L3VA 1DOHA 3Q6MA 1CDEA 2FOIA 4XX1A 5TGDA 3S29A 4B6FA 5EHZA 2RBEA 5C7IO 1IZ8A 4TGLA 1CUHA 4YWJA 4FD2A 3T1QA 2JGIA 4WY8A 1DBRA 3WZMA 4CQMA 2HMVA 3UY4A 1YAHA 5KYKA 1RRFA 3TYXA 1JQAA 1N2CE 2HU8A 3ET4A 3FLBA 5IJ0B 4GOMD 4LVOA 1GDDA 2HMSA 1U5CA 1Y8QA 2PH3A 1K6XA 1DARA 5HMMA 3SHVA 5HQ3B 3BTUA 4ADSG 2ZS8A 2QTTA 3JQ8A 3WR5A 2XE8A 1SKBA 5K2OA 1GAJA 2IYRA 2X23A 1RXWA 5AMXA 1K06A 1EWYA 3TQOA 4KTVE 1RTKA 1OWMA 3MJEA 1RE1A 3STYA 2WUWE 1IJBA 2QNRA 4UJ3A 3AHGA 1HYGA 1LJUA 4AU1A 4BFZA 3B9QA 3RVSA 5IX8A 5MN6A 4KPGA 2WVAA 4DIUA 1ZN7A 1R4MA 3NNDA 4EJSA 4G41A 1RZRD 2FY8A 2J5KA 2YW2A 3K0FB 1HZZA 3NTXA 1Y1KE 1H05A 1M2WA 4HZUA 4J75A 2I4LA 4RD0A 4RAOA 1U0OC 2ZI4A 1PBNA 3G02A 5T41A 4P0QB 4B8ZA 3BBPA 3CZ4A 2NO9A 3QXCA 1BN6A 1U3FA 4Y2UA 1IBSA 3ZZTA 4G5OA 4LC1A 4LOIA 2LCIA 4LDZA 3HM9A 2ODNA 1HLGA 1E79A 1T5BA 1XDGA 4PM4A 4QNNA 4D0RA 4D6PA 3ZDQA 2X0JA 4Q02A 4M99A 1USKA 2CLEB 2GLUA 1ORWA 4QDOA 4Y67A 5IBQA 1PSDA 1JG6A 5K0NA 1I2MA 4F2WA 5F1PA 1WKVA 1EINA 3WHLA 1T1RA 1LS1A 4OK6A 2D0PB 1FX1A 4AJ9A 4E2YA 4OP2A 1VIMA 2REQA 1IJFA 2V7BA 5E95A 5KX5F 3FPHA 4PSCA 1TU3A 1NXXA 1ULUA 3H9GA 3HH8A 3B52X 1ICIA 4AICA 3OFND 4CE6A 3DB1A 4UNQA 4RX1A 3KSMA 2VK8A 1PL0A 3G2OA 1F9AA 1R6XA 4OJMX 4DAOA 4EECA 1K5GA 4IG9A 4N41A 1N25A 2P77A 1TGYA 1OBFO 1ES9A 1ZH6A 4ZYLA 2OCLA 5CLIA 2DHQA 2WWTA 1G3RA 4RD2A 2MYUA 5AI9A 5JAMA 4KXUA 2A84A 3K70C 5KS2A 5EKSA 2FH5B 3A28A 4XDYA 3DDOA 5LBIA 5C4MA 4M7OA 4PLHA 4XB6B 4RJ2A 1RRVA 2R6GA 4M83A 4IJMA 4RV9A 2ZVJA 3WL5A 1HDXA 4NNJA 3NP9A 3MERA 1U1EA 4DWOA 3DBLA 3RS2A 3RSCA 4OHPA 1VLVA 2RH8A 4L76A 4JB8A 4QUEA 3KXPA 1GFIA 3ZE6A 3REQA 3W5DA 4AKGA 1X8KA 1CZHA 1ZVQA 4DR7B 4GVXA 4KQ9A 1QH1A 1XA0A 3SD7A 2D5LA 4GOLD 2VFAA 2XPCA 2BGUA 1CUEA 3D5EA 4BX0A 2Z8YA 3O8OA 3HEMA 2IUYA 3O3MB 5IK2D 3ZOZA 1HT2E 5E3IA 3SQLA 3H04A 3L46A 4G4IA 5JSUA 2R47A 4EG6A 4Q3OA 1X15A 1PQUA 5EESA 2XD9A 1OBHA 2Q2OA 4DVGA 5FA8A 4UTNA 2PTGA 2I2FA 4FEEA 3R0ZA 4KLAA 2QAIA 4HLCA 3DMFA 4BZPA 1A2BA 1PNQA 2CNOA 3NG1A 5A2QA 5KB3A 5LZ7A 2C9DA 4TRMA 2JFQA 1HOXA 3OPMA 4OFZA 5D51S 3DNFA 3PFFA 4EJ0A 2JAPA 2G1KA 1G20B 4EVRA 4M49A 4PPQA 3ABOB 2O6LA 1FPQA 3AHJA 2GEJA 1M6NA 3IDOA 3PQ3A 4YONB 4XQEA 1KFBB 3DV9A 4Q0MA 4F85A 1E7SA 3G8AA 3KKLA 2G76A 1POWA 4R54A 1JI3A 1NOIA 2XMPA 3AERA 1J2YA 4QJ5A 5EWMA 4I2NA 3RRYA 1QNFA 5BSFA 4Z4FA 3M2TA 1O08A 2R4QA 5IMSA 4WFKA 3U26A 1BWSA 2MSCB 3V7YA 3LC0A 2Q9CA 1NG1A 1B93A 3BH0A 3WKBA 4E31A 1HMPA 4M9CA 3LBFA 4OMDA 4UCQA 2HCBA 1GFWA 1N9KA 5SYNA 1T2UA 2B20A 2VDWB 3KAKA 1Z15A 3TDMA 1CJSA 3K9LA 3V5NA 1X7ZA 1KZ1A 2VRCD 3F8SA 3PPVA 4EVIA 6ABPA 3HSYA 4QYMA 5G0VA 3ABIA 2FYTA 4FK8A 1KJNA 3O8QB 7REQB 1BVUA 1JJAA 5I9IA 1JG2A 4PHCA 1S7GA 3JAKB 3CX7A 3UJ6A 1XQVA 4AKSA 3OEHD 3D7NA 1GCOA 1LDBA 2G72A 2WT9A 3B2NA 4JSRA 4H3HB 2FQQA 1UM9B 1WD7A 5FR1A 2EF0A 2ATVA 1PNOA 5TQVA 1PBTA 2W98A 4B3DA 2ZANA 2QUAA 2PWPA 4LXTA 5HFNA 2WJ6A 3TTUA 3G8YA 3QPUA 2H5IA 3U48A 1AMOA 5E6UB 5ISMA 4GIBA 3VYTB 2R8PA 4G5YA 4K1XA 1ECJA 5JJLA 1TC1A 2WMDA 3DZBA 2PS1A 1EFDN 1GZ7A 2BEUB 1FW8A 4L4ZA 1E7QA 4PRYA 6GPBA 3KT3A 3MMZA 5CT6A 5KHAA 1QK5A 2O1EA 3IUSA 3RYIB 3HP4A 1D0IA 3R20A 5GTDA 1CEYA 3KJFA 1A8SA 3C3CA 3LHKA 1UQRA 5GY7A 3LFHA 2WR8A 3I4LA 3TTYA 3AKYA 5TR9A 1OH5A 4Q4HA 1K68A 4ESVA 4YCBA 5CDSA 2EBHX 1W34A 4FLMA 4FFSA 3AESA 4DZTA 3DTVB 3TNYA 4UUOA 4RFLA 2ZB8A 3RKSA 4N8EA 2HJVA 1X42A 4LOKA 5AJTA 4Z0HO 4BXOB 2QW8A 3AR5A 4U2BA 1SA0B 3L3BA 5DW3A 3KP1A 4JLBA 3TE7A 3DULA 4M21A 4ZI7F 2P6NA 1N1EA 1Z07A 4OATA 4P2BA 2JG3A 3ELWA 2EW8A 5FA5A 5HK8A 3MILA 3P19A 4UUQA 4M1ZA 3EFBA 2NYUA 1A8HA 4KQFA 4NMXB 3V7UA 2FKNA 5TMDA 4C2AA 2H5JA 4X61A 5K3OA 1VIDA 2ZCVA 1GZ6A 2HGSA 1KGDA 3GB9A 3IQXA 1U2RA 1K9VF 2TS1A 4Y2HA 3TM5A 4W7IA 4S12A 5JD4A 1U0EA 1WUIS 3DE5X 3BSYA 1L4MA 1LV7A 3FYUA 3IBSA 3KM0A 2C1EA 2O2XA 1GA6A 2H9YA 4H4EA 4Y2PA 4IJ6A 1R0XA 3ZWCA 5BUQA 1IY8A 1OH8A 1Y8CA 2ISQA 4FOOA 4QTUB 2NVWA 4C0LA 4L74A 4EF4A 1RLUA 3LW8A 3UJ3X 4IFBA 1HE5A 4RAQA 3A1TA 2IV7A 1JUDA 3RNLA 4AS1A 4BJ5A 1ZIPA 2X9VA 3JU3A 2HO4A 2QVZX 4YH1A 4YI3A 3T7RA 1SKYE 4GI7A 4HAUA 2XVYA 2QGNA 5AVSA 5JBIA 4FGWA 5D6NA 1XRRA 3G0DA 3N6XA 3DMGA 4ZI3A 3DT6A 3QFCA 1C3VA 1PNTA 2X0FA 1TA9A 1VMKA 2C2GA 1DIOB 5DKFA 2QVCA 2MYTA 5MHTA 4UNSA 3DYBA 2M6RA 3FDZA 4Q24A 2KMLA 5KKCA 4PYOA 4LC0A 1O57A 1GPKA 1WDMA 2G71A 2R751 2VDNB 2XVZA 2H3EA 5CGQB 1ABFA 1YB2A 4MWBA 4NQRA 4TN1A 3GQBB 1NY5A 5H9WA 1O95D 2ODTX 5I5GA 3AUYA 4CKXA 2IZZA 3EYAA 3KSBC 2AEFA 1KDVA 1T6YA 2GA9A 2H08A 3C5HA 4EIWA 4BDTA 3T4EA 4ARZA 2HY7A 1MNAA 4JI4B 2GM9A 4NU0A 1N6HA 2B8NA 4GBJA 5K6AC 4MKFA 5EUMA 4A8HA 1QFSA 1IXYA 1NLYA 4LF6B 4YJKA 3A1FA 3OZCA 4AKTA 1YMVA 521PA 4W1QA 3WKAA 4LOHA 1BDHA 1J2TA 1E1CA 1YQDA 1DT3A 2JASA 2RJ3A 2XCQA 4TV9A 3UMRA 5AKYA 3EXEB 1PK9A 3Q5DA 4YI5A 2Z6AA 4R69A 4P4GA 5K01A 2ZRNA 5J5VA 1TADA 2P2ZA 4CLXA 2HM7A 2R8ZA 1GFSA 1PG2A 5TE9A 3CZ9A 1ZJ4A 1I5RA 2XNDD 3VU8A 1RRPA 2C4VA 1A72A 4P1ZA 1YE5A 4INPA 3O6VA 2CCKA 2YASA 4YS6A 2EFDB 5JQWA 4Z4HA 3LP6A 4RD3A 1QYCA 3B9PA 5AD1A 2VT7A 3VR1A 3JYPA 1I14A 4RXMA 1GTMA 1ZM4A 2C78A 2BH9A 3H6KA 3JASB 4DDKA 1L5FA 1MAWA 1J2EA 3O38A 4GBMA 2DJIA 1PT5A 1T0BA 2M6LA 3M81A 4GAEA 1TECE 2PQ6A 3AJ8A 3MBKA 1EPUA 4U4AA 4Y1RB 4B4UA 4XDGA 5EXPA 3ZV5A 3VAAA 1TEHA 1TRHA 4FE7A 3FOCA 1UOPA 4HWSA 3DC2A 1OYWA 4JXKA 5E6SA 4Q1DA 4C22A 2Y1CA 1KMHB 1X7GA 3JQGA 4OBWA 4EUNA 5BT9A 1UMCA 1ZQ9A 2EWVA 2FW8A 1ESCA 3OLZA 2Q8NA 1XUOA 1E6KA 4ALMA 1X13A 1SGWA 3BJIC 4AJJA 4I5EA 3I9NA 4L27A 4YBZA 3RTCA 1JHZA 3LRXA 3S7TA 4S05A 4QXQA 5GJBA 5LA6A 3HTXA 4U7TB 2C96A 1SCUA 4R16A 3V7FA 1AMNA 1Q7RA 1KJ8A 1ZZGA 4EFDA 1Z39A 1J7KA 4JL6A 4LE0A 3T1OA 4HDQB 3ONFA 1UFRA 3KPWA 1QQBA 1KK1A 3T5BA 4LMPA 4RKRA 5AK6A 4A9AA 4N0MA 2EFGA 1PE0A 2NWQA 5CJ2A 4X8OA 2QM8A 3FNFA 4F3CA 1RKQA 3RU3A 3W2GA 5HF8A 1WHTB 3C8ZA 3HI4A 3N2KA 4FUQA 3TL6A 2WAMA 4ZK6A 3DD5A 4CG1A 2CV1A 5B4UA 2FFQA 4IM7A 1TB4A 1YCDA 2OILA 2OBBA 3L2OB 4PC2A 1PR5A 2WWFA 3K1AB 4ZD6A 2L17A 5HE9A 5C8XA 3OPYB 1QRRA 1RVV1 1H0HA 3L1KA 2X8WA 1OW3B 1FDUA 1GTVA 1OU0A 1XPOA 3RRMA 4MROA 4LJ8A 5BQ5A 4TXHA 2MR5A 5AJXA 3DW1X 3ENWA 1P2SA 1M67A 2W0SA 1T4MA 3GHHA 1F2UA 4FJ2A 1RP7A 1KI7A 1AKUA 1YR7A 4EJFA 4KSCA 3FVWA 4JEHA 2ALJA 1V1MA 2QK4A 4KWTA 1ZSNA 2OQRA 1VKRA 4A8JA 1LC3A 1TJNA 2OD2A 3ONVA 3ED1A 3GPDG 4M0PA 3LCMA 5B58C 1Y3IA 1I6MA 1IXKA 1ZGBA 2QL5A 3TLBA 3H2KA 4DV7B 1G20E 1GPJA 4YUVA 4G97A 5E9QA 4XYLA 5J59A 5BR1A 5CCDA 2ZRPA 3ZV7A 3IEIA 3SK0A 1KFEB 2EBWA 4URYR 3AUXA 2HMAA 1VSVA 4RHEA 3H2IA 5C1BA 2VPPA 3FSEA 4EG5A 3RS8A 1H1LA 1OTXA 3LY9A 2X9LA 4MJ3A 5F64A 2GT1A 4JJGA 1E3IA 1G8KA 3DYIA 1II8B 1BWRA 3NDRA 4PIPA 4A16A 1ML4A 1BYUA 1TUEA 3QVGA 2ENWA 1R0SA 3JARB 2V0NA 3MJDA 1ZM2A 4D9HA 1MT0A 1FX0A 3HR8A 4R1TA 2F1IA 1O94D 1CR4A 1UK6A 3GGSA 4KK3A 3F7TA 4XFKA 1NUUA 3KAJA 1Z6XA 4OBBA 3M49A 3T3PB 3FMFA 4YMTA 4OREX 2DM6A 1GP2A 2ZYTX 5ALEA 5KHLB 1XJWA 5KKNB 3O95A 2J0QA 3BGSA 2CNBA 4F5DA 1E7RA 3MXTA 5EJIA 5K3FB 1PWYE 1UT6A 1HWYA 3RLFA 2A5JA 4BWGA 3NWJA 4DA9A 1N2CA 1QTIA 2RGNC 3K92A 4D57A 4AS2A 3BJEA 4WCFA 3VZBA 1NXVA 3WWCA 1ATZA 1EFVB 2DERA 1ZK4A 1KH2A 2E89A 2JS7A 1V9CA 4L1KA 1LLCA 5EIOA 3L7LA 1VI5A 4TV8F 4HZGA 5J4VA 1DQZA 5DEIA 3EGXA 4TTVA 1TF2A 2QN3A 2VATA 4II2A 2C1XA 4G09A 3KHSA 3SX4A 5HFAA 4ZYZA 2BCEA 3ANMA 5AIBA 1UWLA 2PKYX 1Q14A 5JDIA 4MVWA 4B31A 1YVRA 1DRWA 3GA0A 3WFIA 2J0UB 1RI4A 2ZT5A 4B7CA 4D43A 4AT1A 4Q05A 3U7FB 4PGGA 1U0JA 3PBKA 1E5QA 1WEHA 5C4IA 5IXSA 4B40A 3K20A 4PN3A 4A2CA 3VSCA 2UVPA 3COZA 3KOYA 4RORA 3NUGA 4C4TA 2YWJA 1NF2A 3OQJA 3TSAA 5JMWA 3F6YA 2OCAA 4E4TA 4GSKA 2QN8A 4NS4A 2BKLA 3AG6A 4ID3A 4JXXA 1PZNA 4RSGA 1Q1NA 1QKJA 1OLUB 3B7GA 2RGYA 4NBVA 1VPEA 2OYSA 4CM8A 4LF5B 2Z56A 1IBMB 3A9VA 4MS3B 4PC7A 4WKBA 3SFZA 2W2XA 5TX7A 3PRHA 3SQXA 4AJEA 4FKMA 1OXVA 1P29A 5BNIA 2VXBA 1QGUB 1U7XA 3KAPA 4E07A 1OAAA 2O4UX 4XGRA 3T5CA 3Q41A 4LZWA 3KZOA 2EKQA 1OFIA 4J0JA 3VSDA 5IC5A 4RV5A 2TRSB 4RH0A 4J90A 5AM2A 2RARA 1XNRB 3WO0A 3ZDZB 2ODQA 2H59A 3GRZA 3FVQA 2WP0A 3D3EA 2EU8A 2JCVA 4J7CA 1THZA 1P4JA 3JPYA 3LBNA 3MNFA 1Q91A 5F1OA 2JLQA 3I72A 1O96A 2CNDA 3FMIA 2XQJA 3KJNA 4PF1A 4R2IA 4W7HA 3ND8A 4XPIB 1JX6A 2VYFA 2ZYAA 4YPVA 4E4YA 2ZDHA 1C4XA 3ADKA 1U28C 3KOXA 1ICEA 3UFXB 3V8BA 2P0EA 1NF9A 1RDFA 1IBKB 1K8XB 3PE3A 4R8MA 4B34A 5CCBA 4I9NA 4NE9A 5LBUA 4R9RA 2BIFA 3CWQA 3H2GA 4WZ6A 3D8BA 3MJHA 2VHYA 3O4IA 1C1XB 4RPGA 4AB1A 3JD1A 3PHJA 2XBMA 1O1YA 5EJFA 4C4XA 4OYYA 5A4DA 4I4NA 2XNSA 4KHZA 1LH0A 4TYMA 3T7JA 2WLTA 4TYYA 1JFVA 4B6RA 1IHDA 2P6UA 3DV0A 1VPDA 2ZBVA 4RZIA 5K3AA 3AIKA 4E4RA 2G70A 2P5UA 4Q34A 5F23A 1FFAA 1EVIA 3L4BA 3B82A 3I2KA 4X7BA 2IYLD 3KXKA 1PHPA 3UK0A 2IELA 1TT5A 2HDOA 3WGUA 4H6PA 2ZI6A 2Q50A 3DBHA 3F6RA 3KZKA 1JDBC 4F4HA 4KO1S 1OV4A 3D4NA 1HE4A 3VM6A 1QP4A 1T6ZA 1WG8A 2Y99A 4MCIA 3FZNA 3TS1A 1Q17A 4U5QA 4UATA 3L8GA 3U37A 2FPIA 1RXIA 3SLKA 4ETNA 3DL4A 3R74A 3CPHA 3NJ4A 1Q1BA 1U2PA 3L7BA 1H94A 1GAXA 3K16A 3MWEA 3NP7A 4KPFC 4CF6A 4PFJA 1E4OA 2QJFA 1J0CA 3TH5A 4CKWB 4YJ3A 1Y4UA 4KBGA 2BD0A 1H0RA 2E7ZA 2R7NA 2BFEA 1QS0B 1WUYA 1OJLA 3B5JA 4H7HA 4WXYB 2V8OA 1KHTA 1WY5A 3ITKA 4L57A 3SXUA 3WGQA 3GOQA 2AR9A 1IJKA 1Y8RB 2G83A 3V8VA 3FFTA 4FNOA 3P2JA 4EQZA 4QEZA 2P7IA 1DPGA 3KT0A 1SXJE 1P4AA 4X20B 1R8YA 3OM9A 4XIIA 5I7WA 1UMKA 1C7JA 3FWHA 5ALUA 3ZV4A 2GRUA 3D8RA 4C7BA 3CE6A 3MJVA 1J07A 4IH1A 4EGQA 1QQAA 1X77A 1WETA 2XDYA 4ZREA 2YY5A 5L7YA 3OI7A 3FUCA 5DNCA 3ZGZA 1JGTA 2AC2A 4NCIA 4IOKA 5HKKA 2A0XA 2AFHE 2AKAB 2WJHA 4PSUA 2IHBA 1RM3A 2J9ZB 4F96A 5EZ5A 1TZ2A 2EZ4A 1BYIA 1DAIA 4MR9A 3FVVA 3CTMA 2FJ0A 1OZ0A 1KZ9A 5FUYA 4C0JA 3TI9A 1FB5A 2B4RO 1L6RA 1Q0HA 1JPJA 3FTPA 4ZOBA 2JHGA 1R6TA 2ISSD 2JIOA 4U7FA 4FFOA 4EY5A 3EEYA 3EWAA 3LXRA 3OEYA 4Q37A 3W2FA 3ZK7A 3NBAA 2OP0A 4DBVO 3QM1A 5TMPA 3PQ2A 2H1IA 2XVXA 4DCCA 3SMVA 1OBOA 5A1TA 4ISCA 1L7EA 3KR1A 3AX6A 1RYMA 2VTBB 1Y42X 4V2IA 2W48A 4I9FA 3LD9A 5H4HA 4KMSA 5KNDH 3CVUA 3V1UA 2GRJA 4MLCA 1O9BA 1E8NA 3DE3X 2I6SA 1K8ZB 3W6UA 3IURA 5EWJA 2YVKA 1I2AA 4MKIA 3CA8A 1GTJ1 1ODFA 1NMQA 4FXPA 3MYRA 1KQOA 4QOIA 5D5PA 5AUOB 3G7UA 1BC5A 3LPMA 2UVQA 4KUGA 1ZUD1 2WNIA 4MWTA 4BNVA 3WMRA 1XDDA 1O0CA 4Z0TA 1O77A 1J39A 1WULS 4TZ6A 1JE1A 3HYTA 4M98A 4RIIA 3X44A 3FFAA 4NH0A 3HR4A 5DP2A 1MOSA 1MABA 3IR7A 4TX1A 5CXUA 3GI1A 1U0TA 1BVHA 4KSBA 1DZ3A 4U7DA 4RKEA 1LPAB 2ATXA 5ETJA 4F2PA 1JIJA 4R9NA 1JFFA 3ZJTA 3PXUA 1PZEA 1U0NA 4CM6A 3WOVA 3DZFA 5I7HA 4TRJA 1SPBS 1YI0A 3BGWA 3KYCB 2ASVA 3RBXA 1R4AA 2QRNA 2QX9A 2YHSA 4C6HA 5K0TA 1KERA 5KJ1A 3WJ2A 1Y6FA 1U3DA 3EEBA 2ZYDA 4K05A 1D1SA 1TX4B 4R7ZA 1R16A 1BHO1 4MJLA 4YJ3F 4CG2A 1E92A 3FZQA 2V4UA 1M1NB 3H7AA 3SX2A 2AH5A 4TSKA 1P45A 1MV8A 3QVKA 5GOTA 4UCFA 4U2FA 5KI6A 3L8EA 3TEJA 1FYWA 1U1FA 1WAMA 1YL5A 2XOKD 3DWIA 4KGDA 3HP7A 4L0DA 1CNMA 1D4ZA 1H85A 3JWHA 4PZPA 4BN5A 4RJTA 1SHJA 2DPLA 2GPJA 1NRIA 3NU1A 2Q5LA 2ZSAA 4O1HA 3V1TC 1POXA 3IJEB 3PQCA 4O2BF 2RGEA 3VXKA 3EIOA 3TOZA 1NMEA 3FI0A 2BBTA 1XZAA 2YOFA 2IU0A 4E09A 1YJ8A 3B6IA 4GOOD 3WS7A 5IJ0A 3WK8A 1UOQA 3QG1A 3RRJA 3DFZA 4B3GA 4EZIA 1PDWA 2OC9A 3F4BA 4HVAA 2ZIFA 2TMDA 4PZDA 4PZCA 2IYPA 4E22A 1RYFA 4WXMA 4NPHA 4FW8A 4Y6PA 1BS2A 2KW5A 4NOLA 5TQ2B 3UENA 2FWAA 1E2MA 2IQ5A 3BK1A 3HVUA 3MCWA 2PNFA 2YNMA 1K4MA 1NYTA 2Z1MA 3GFPA 2C2MA 4WKCA 5FTWA 4BNLA 1O58A 4YJHB 1XRPA 4JP1A 4HC4A 3E3AA 3RHZA 4KO8A 5HBRA 2H16A 2KQUA 2ACVA 1GPUA 2I66A 1Z8NA 2XKJE 1F8XA 2HK9A 4M7PA 5G4LA 2BZ1A 3RVOA 3H11B 5ALZA 2XGGA 2VDOB 3N39C 3BAFA 5DGDA 1EGMB 3MS2A 1KZYC 2O0KA 2W4QA 1TMGE 4KR0A 1NE7A 1QE3A 5THQA 3LFUA 1T9HA 3U4CA 3WL7A 1JWAB 4GKKB 4GMXA 4WOBA 4AUEA 3GJYA 5EHQA 1SFRA 5IT0A 1DJPA 5FUVA 4UEKA 4X1IB 1CRLA 3S81A 4D3DA 1Y9EA 2DTEA 3NQ41 5CVCA 2W70A 1PFVA 1YZHA 4AZ0B 3NGMA 1EB9A 1NQAO 1W96A 2FJUA 3HK2A 3I6ZA 4BL5A 2PXCA 3O3OB 4F04A 2ZB7A 3BD8A 4AZ3B 1IM8A 4RPLA 1UC4B 3R0VA 2X1HA 4FGUA 4YUYA 5LP6A 1QKIA 1QGOA 3OJOA 1BZYA 4J03A 1DSSG 1QHXA 3N2LA 3N75A 2O0JA 3G7SA 4F6RA 3ES9A 3OJFA 5E6RB 5LLSA 2PY6A 4KW7A 1XZIA 1YQXA 1JVSA 4I8IA 3LY7A 4ZFNA 4ND3A 4N8DA 4WK0B 4PXYA 2Q0HA 3QELB 4XYBA 3TZLA 4CQJA 1LLUA 2EGUA 3JWIA 4GGMX 3T5TA 4NR0A 3U7EB 2X8AA 5C1OA 1RLJA 1BN7A 4NJMB 3QWBA 3HMKA 4R8RA 1KDOA 4A0QA 4L75A 4MUKA 3B9BA 4P3NA 3VV2A 4AQDA 3NIDB 2J0VA 4HK4A 4P84A 3K70B 3G2LA 2ZVQX 2PH5A 2JJ2D 5DGHA 4ATNA 2MINA 3KALA 1U0BB 2GJ9A 1CB0A 2QM3A 2VQSA 3F3MA 3MTIA 3C98A 3WQRA 4G0YA 4KBFA 1FS6A 3OQ6A 3FIJA 1OGJA 4HSEA 1X38A 3OUUA 1ZJYA 3FI9A 2QBYA 3OA0A 4M9QA 3HA2A 4KQMA 3R8XA 5AQEA 4X45A 2IP1A 4HJXA 4NU8X 4TYQA 5TVGA 3L5OA 1TZMA 4RS3A 4DDVA 4K9OA 1HG1A 5L8VA 2N46A 4C7KA 3NBQA 5F35A 4EG8A 1T6XA 4YR7A 2AOVA 1Q44A 3SIRA 1VDZA 2AJTA 3SYMA 4INJA 2RDMA 3B53X 2D7JA 4HT3B 3LKZA 4AFNA 5PNTA 4ENRA 1YA6A 1GADO 3H4IA 3RUHA 3ZDRA 3QWHA 1F12A 1NW9B 4PINA 4CV1A 3VMMA 2BI8A 3U7RA 3NXKA 2XCLA 3PGJA 1DDOA 1OPXA 1XZEA 4L0QA 1ADBA 1DDGA 1V41E 4OU4A 3Q5GA 3ZXYA 1PT8A 3CUEF 4JX9A 1JXQA 4IMRA 4GOXA 2X13A 4N9QA 4B81A 1UP7A 1G20A 2WA1A 3B1FA 1U3VA 1YS2X 3T9BA 4FCVA 3ZUGA 2HU7A 2PO7A 2ZSKA 4KB5A 4X90A 2GJAA 2B7LA 1LNQA 1EK6A 1G0NA 3V48A 1Q1EA 4K87A 4EJ6A 2XWSA 4UNNA 5FUBA 3ZVLA 5K9ZA 3MTJA 1KQGA 4U00A 4I1YA 2ZQ5A 3JAWA 4FI3C 3ENZA 3BREA 3AR3A 3MM4A 1EWRA 4A4DA 2FF7A 1O3YA 1H6AA 2J7PA 1KL7A 3V1MA 3WYEA 3L07A 3FWKA 1IHYA 2I4MA 2GYYA 4BQRA 2H85A 5HZKA 1S3SA 4K2HA 4KXLA 4BKQA 1U7PA 2D4AA 1V71A 3D4LA 5ITSA 3ZVMA 3O8QA 4F06A 7REQA 1GKIA 5LP6F 3QHAA 5FWXB 4BEJA 2WG1A 4UBLA 1NNI1 4EL5A 2W00A 4LRXA 1WDLA 2HV9A 2PBZA 2FCAA 2RONA 3E48A 3VHLB 3W4IA 5JCJD 3A27A 3L4JA 3VVBA 2WPDA 4QUKA 3HFGA 3HWWA 1UM9A 4WDQA 5LC1A 2WHRA 1JIUA 2PL1A 2C42A 2VDUE 1FFGA 2ZYVX 4N49A 3CW9A 5EEHA 4L28A 5CFMA 2P2CA 2R00C 3KEMA 2PZFA 1AKTA 3A37A 1J8MF 1Y3FE 2ENUA 2ZTSA 4MV6A 2YW9A 3BMOA 4R5HA 4EA9A 1XYGA 2HN9A 2HR1A 1U0RA 5D3ZA 4CLDA 5FOQA 5KO2A 1WB6A 3V9PA 3L0PA 2ZE8A 4OOEA 1NNUA 4C1BA 5BWBA 1KETA 4NOKA 5PGMA 3RYIA 3SKXA 2TYSB 1HMYA 2P9EA 3CCCA 4LFCB 1FSGA 3KQMA 4TMVA 4R01A 2AW5A 3F9CA 3MD0A 4CKBB 3O84A 3FTQA 1WX1A 1HO3A 2J9YB 4F91B 3OEWA 3OPQA 3DTVA 4J16A 5AKHA 1R0ZA 4P3YA 4RVFA 1GAWA 3R9KA 1R10A 3H4MA 3I5UA 5LNK6 2HA6A 1JMYA 2JFZA 2NU9B 2Z2YA 1SA0A 3P27A 4CT0A 2PV7A 1Y6JA 3IKTA 3MMNA 1T26A 4I9GA 5TPWA 1M3SA 2YWXA 3KK0A 2PMDA 4V0KA 1FPMA 4JUIA 2QSJA 1YASA 2Y1WA 2JIZA 2P8SA 1OFHA 2YBEA 3H1TA 4RCZA 4JEMA 5KJ6A 5COBA 1KEEB 3A3OA 4JR0A 4CMIB 3DO5A 3L6CA 1NZFA 3DCYA 1V7PC 5T4EA 1EE9A 4MWDA 4DGQA 1P39A 2J6CA 5DWQA 4EW2A 4D44A 3EZXA 1F2TA 3D2LA 4IEIA 4L4UA 3ZHVA 5KMGB 1AG9A 1CUFA 4K6FA 3AU8A 4LSGA 5CEFA 3BTOA 1B8VA 1TZJA 4GP7A 4NCAA 5SY4A 2G63A 4TV8B 4TS1A 1ZBQA 4GYJA 2YZNA 2BONA 4P9NA 2Q9AA 1IN8A 3FNGA 4AG6A 1YAJA 2WTEA 3WK7A 3ZHRA 4LBYA 3QUCA 4FC7A 3MJFA 3ZNNA 4RTLA 2XWBF 1EVJA 2AG5A 3MWLA 3UWOA 1EHCA 3I73A 3EXG1 3T12A 1G1MA 2PUVA 2CF6A 1MO2A 1YZYA 1KP9A 4UBNA 2PMKA 1EUYA 2PYZA 4HRVA 1M75A 2SHKA 4CF7A 4UAVA 5JJBA 4U02A 3FJ1A 3DBOB 1ESNA 4W63A 3BTSA 1ZEJA 4E13A 5JJIA 5EMHA 3OCZA 3QVJA 4LYHA 5LZ2A 4PZ9A 4QHSA 3LUHA 1YJ5A 3WG9A 2NSYA 3H4VA 4HQ6A 3OIVA 3OKCA 3SDSA 1E7MA 1DG1G 3VR6D 3AZOA 4AD8A 2E4XA 2MU1A 5D1NA 4F4DA 1HTTA 4I8XA 2A1TR 3TOVA 2DH5A 2P9JA 1X7XB 2HHHB 1E7WA 3IA7A 2OZPA 2Q2VA 4ESOA 4BNJA 3M6WA 5HEKA 4A73A 1QB8A 4RZQA 4YLEA 1I7DA 4R41A 1CY0A 1NI3A 4D81A 1REQB 3C3JA 1Q1QA 5BWNA 1ZI8A 3TDKA 2G3YA 2ZYGA 3EQ7A 1A5TA 1FQJA 4IGAA 4S0ZA 2P2GA 3FKSA 3HACA 4YMSA 5CK4A 1H6BA 1J2RA 1QIMA 1SVNA 1W5SA 1N2SA 3RHSA 4BNXA 4C4YA 1R6DA 1YS4A 4N1AA 1R66A 1ZH4A 2ID8A 3ECCA 2HK8A 3IR5A 4DMLA 5DIZA 4RHXA 1D9ZA 3QLEA 4QQNA 1QO7A 2GCPA 3BK2A 4RMNA 3RVBA 1XFAA 3M4NA 1KPIA 1A8IA 1ZMBA 3CRQA 4UAJA 1SXJA 2OXCA 5L4SA 1EU1A 2DWOA 4QU9A 1C0IA 2QJRA 4Y7DA 4W8GA 1Z17A 3CGGA 3JASA 1BDBA 4KWCA 1U3UA 1DIRA 1WVGA 3ENQA 4HJRA 4X41A 3CLVA 1L2TA 3QA9A 2ZM5A 3D54D 4IJKA 2R0QC 3NDIA 2EKZA 4MLPA 3KQVA 1GKYA 5I8PA 4YCNA 3KT8A 1JT9A 4G24A 1CP2A 2FRDA 2OGWA 4IPTA 1EFLA 1XTVA 2D2EA 4EKNB 2ZPUA 1L7VC 4GNRA 2AFHA 4QDTA 2XUFA 1CQWA 1TD9A 2GBPA 2J48A 3E82A 4U3JA 1M33A 2ADFA 2DX7A 1NVVQ 2NUAB 4DMGA 4N6GA 3DF9A 2JD1A 4FI3F 1EGHA 1AK2A 1JALA 4QXMA 2CKMA 4KE9A 3TW4A 2A58A 4N3GA 4A5OA 2QUBA 1RJ9A 1BE1A 1KH3A 1VHDA 2NXJA 3IJRA 5A5EA 3JZMA 1UUFA 2OAEA 3WRXC 1QM5A 3KVNA 1J1IA 3MD9A 4DQXA 5C1PA 1CJVC 3Q2IA 4H1HA 5TQJA 3WSTA 1O94C 1QWOA 1NVVR 1W44A 4XGIA 2OFWA 3K0CC 1XTJA 4XRRA 5TPZA 2KB0A 2FG6C 2P3LA 1IXRC 2FMIA 5ALRA 4D9NA 5JANA 5KYTA 1V7CA 5LQCA 2OM6A 2A67A 2YS6A 3CCBA 1DV1A 4JJZA 4EY3A 1A3CA 4U1RA 1E77A 3NHYA 4QJIA 4KYTA 1YJCA 1NJ1A 3MUEA 1ZNQO 1Y81A 2G8LA 4BGUA 5BSKA 2CE7A 4BJ3A 4QYXA 3I76A 1AKVA 5AVZA 2FPWA 2UYYA 2HIMA 5C0OE 4HUTA 1LX6A 3KZCA 3RSLA 4BOYA 1G17A 4O02B 2QSYA 3WB2A 2YL2A 1KPHA 4X3PA 5K51A 1VYUA 2HDWA 1U8ZA 3UEOA 2DBYA 2ABWA 4ZVNA 1U2TA 3KTOA 3F97A 4GQAA 4UBJA 1P0IA 1Y7HA 1MO3A 2ZE5A 1Y5RA 5DLDA 3F71A 1ZLYA 5JAZA 2O3RA 1AKQA 3R5FA 2Z0MA 3N87A 4PTLA 3FPCA 1A5SB 4JOBA 1XD9A 4B2IA 1LDYA 4YBRA 3A6FA 3RF7A 1YR9A 1PX0A 1UJ2A 3EUFA 4DKXA 1T3ZA 4HMPA 1SNYA 4UHKA 4X0EA 3SPXA 3R0XA 3PC8A 1T0IA 2QE7D 1JHYA 5EINA 4N03A 4BZQA 3PQDA 3FOFC 2TMYA 4HTFB 1AX9A 4J0KA 4LNUB 4M1YA 1WMSA 3LBAA 3TMKA 2QOEA 4YO8A 2Q46A 3S8YA 3SYLA 4ENUA 1XTRA 3JARA 1G3QA 2PD3A 2VP9A 2AR7A 3CVOA 2PGIA 4ZQCB 4G5GA 1I9GA 3TDNA 1NBME 1YB7A 4B17A 2RHOA 3NONA 4Q7LA 2QU7A 1LLFA 5DCUA 2J0EA 1DKMA 2DQKA 4DLWA 1M9NA 4KH0A 4PC3A 1UEXC 3KEOA 4WBSA 3D64A 1QAOA 2YFKA 1IVSA 1NMXA 1RJWA 5IHXA 3O4FA 2V7QD 1GU1A 4YUAA 4G5XA 4P0TA 4BV3A 4OQPA 1IBRA 4LMAA 3HV0A 4IQ0A 4XEHA 3JQCA 5KDLA 1MU0A 1WA5A 4EELA 2VL7A 1LB1B 4A36A 1I01A 3VC3A 1V5FA 4L95C 3V4LA 3H6GA 5E9JA 1UF9A 1QGYA 2HNAA 3DUFB 3MJCA 3ROKA 1NWCA 3D0KA 5EHIA 1E69A 5CCEA 3KO8A 2FK7A 2ZXFA 3T1HB 3VRHA 2AD1A 1HI9A 2C7BA 3ZCQA 2UZ0A 2ZIZA 1N1MA 1DMSA 1NJ2A 2FDRA 1HZJA 3MRSA 4KIWA 5EUCA 2J0UA 1WSDA 2GKOA 3DBRB 4B7XA 4JZYA 4MHOA 3M6MD 2QI9C 1N3LA 2K7ZA 1KYXA 1ZYUA 2IPOA 4HFNA 4KE8A 4LHEA 1FFEA 3WTCA 3A6HA 1IVYA 1ZY2A 3DMPA 3PTZA 5K8UA 4FDAA 1HDYA 1M1ZA 1VE1A 2OZKA 2HC9A 3FLMA 3KTDA 4TWBA 4XA8A 3MCTA 1A4XA 4IDDA 4X84A 1KMNA 4AVYA 3ISJA 3AV3A 2PWAA 5JY1A 3VO8A 3IAEA 3II6X 4ISBA 2RCYA 1Y5NA 2O7SA 3GLFB 2YIJA 1UFKA 4BFLA 2DQ4A 4FE4A 1O0SA 3N0VA 1OLUA 1UKCA 1HX7A 2YYSA 1W49A 2Z30A 1YXMA 4NBSA 1BMQA 2NO6A 3P1JA 1HFKA 1KYZA 4Z0NA 4O4IB 4XWTA 1SHUX 1KYQA 2XT0A 4MS3A 4P3OA 5CLFA 1J8VA 1C8KA 3IUBA 1CY6A 2GN4A 4WK2B 2JKYA 5FEMA 5EP4A 4BKPA 4WX2B 4D9IA 1SC1A 4LXXA 3AI2A 3O9ZA 4OQLA 1E1QA 2CNWD 1AMUA 2XVMA 3W3AA 3V3KA 1NSTA 2MMGA 1ODJA 2FF5A 3HCCA 4Q19A 4D46A 3ODPA 5FX2A 1KXJA 5EQJB 2XF2A 1EDOA 1PVVA 5K8TA 2QX6A 2PMCA 2Q5OA 3OUTA 2FFHA 3UG7A 1TZKA 4UM9B 1T3GA 4FR0A 4J9VA 2AXQA 1FP4B 4EZEA 4PO8A 3A4LA 3EQ9A 4H18A 5MFPA 1A69A 5KNDA 3FNRA 3VJMA 1EHIA 1BKSB 1PG0A 2YOHA 1M2NA 3BXZA 2EDCA 3GT7A 2XJ9A 1K0UA 2JIBA 1N9GB 4L8GA 4Y2GA 1NC3A 2GNAA 4HLNA 4XPIA 3RS4A 3VPHA 2CD9A 4DR6B 4P35A 1JHVA 1JG1A 2Y1XA 1L8LA 2Q5FA 2IDMA 2B21A 3H84A 3OP1A 5IDXA 1H42A 3QPWA 4G1VA 5B6IA 1FZQA 4RKQA 2OLEA 3OT1A 3V2GA 1GO2A 3MT9A 1MJFA 1QH8A 4EUHA 3QSYA 4ZHSA 2ZTLA 3KX2A 4EH1A 1DC3A 2CD7A 3Q6IA 1BAPA 1I6LA 4CDGA 1Z8DA 1C1XA 3NVMB 2VYVA 1O5IA 3FBGA 4CMJA 2WUDA 4QX6A 2W2TA 3LHFA 5AJWA 3I2FA 4B4KA 1QANA 2BM9A 2J45A 5ITZB 4HAVA 3TSYA 3EPKA 1TYEB 2EFHB 4LYAA 5E7QA 1Z8FA 3ZK8A 3NIFB 5HCUA 1P81A 4GBGA 3VV3A 1VYTA 1MB9A 4GI3A 1YGPA 2GTHA 1PV4A 1BU8A 1JDBB 2IVZA 1EK5A 1XLVA 3F9RA 3GMDA 3BB1A 4IXTA 2KLBA 4YRBA 5A71A 1GA1A 3SR0A 2NZYA 1FDVA 5JDCA 4KE6A 2WAOA 3RVLA 1PKEA 1U1IA 1WDKA 3WIVA 3OEEA 4G0ZA 3F5QA 2ZJOA 3DHYA 3ZD7A 3NHLA 1L5KA 1SXQA 2COUA 3F7OA 1P73A 3TIIA 5C8ZA 1TM7E 3WMWA 2R6FA 2HSWA 4KVZA 4DA8A 4F60A 2JI9A 4M88A 3EFEA 4ZO8A 2DFKB 1DDIA 1YTUA 1B00A 3VKWA 1YC5A 2WU0A 3CVVA 4K86A 5ALQA 3J7AC 3V42A 1OV6A 3T35A 4J0HA 4WOCA 1ABEA 2X0RA 3FSGD 1Y8RA 3K6KA 1FRQA 3LT0A 3B85A 1N0WA 2IV2X 3ME5A 1RWQA 1DAKA 1P75A 4KFUA 4R8LA 1IN6A 3M3HA 4G37A 3T7CA 4X20A 1I2CA 1KI6B 1SEVA 1T5OA 2GEFA 2JIPA 3FPLA 2FN9A 3I42A 1AVTA 1ZESA 4D6XA 1RAHA 1RQXA 4AJ1A 4NXNB 1MVLA 3WV5A 4POAA 1M7HA 2AUTA 2IT1A 1UBCA 2D4HA 4V0QA 3MC1A 1W581 4AMYA 3WBFA 4DCNA 2QY6A 3A6KA 4ZPJA 1JQLB 2DJ5A 2X5JO 5DNYB 3BXPA 4GQBA 2RIPA 4FFLA 3KYDB 4NSNA 1R9JA 2VNJA 4GMKA 4MKHA 1OZFA 1C1YA 1KEZA 3SSAA 3TRJA 4BAUA 3DBVO 1VFNA 4MQ6A 1U9YA 4GDFA 2IKQA 3UB4A 1KSHA 3M8KA 1OQAA 3HKEA 4MK4A 5JS8A 1JH8A 2PUHA 3I23A 2FX3A 4KXXA 4P8RA 2OA0A 4UU8A 3WNVA 3EVGA 4G0VA 2RHBA 3Q9SA 4FZ5A 1NYRA 4CCWA 3CKYA 2WTXA 4CF5A 1SVOA 2BGIA 4HDMA 3VZRA 2C3OA 3IQFA 4S2EA 4F3NA 1E2JA 1F8FA 2Q6LA 3NAMA 1ENYA 1T24A 3O8NA 3FOAA 3LC1O 5BN4B 3GY0A 1CVIA 1QYDA 4FHFA 5FJJA 3TFWA 7ABPA 5IM5A 3PHHA 1I36A 3KNZA 3Q7SA 1ZUWA 5FL3A 4ASUD 3KR2A 5I4IA 2VTBA 1U0SY 5G02A 4UU0A 2XB2A 4A23A 1OE0A 2Q41A 4LRTB 5DK4A 3GG9A 4ZZ1A 2L2QA 3RC1A 4QPCA 2R8RA 4ETIA 1EVZA 1F60A 3L7MA 2C7PA 4ZCIA 3K9CA 2O05A 4F4UA 2XEXA 1CG6A 4KIFA 3QBEA 1CETA 2EX1A 3RT1A 3ZBQA 4D26A 3EYWA 4QBTA 5ESXA 1GIAA 1TAHA 2I54A 4ER0A 5M2QA 3SVZA 1N6IA 1V3VA 1QUEA 2BGMA 2OQ2A 2VNIA 3EK2A 3EZGA 3KEQA 1JYEA 3CR3C 3HCDA 4TRRA 4JASB 1B2RA 1CE8B 4YRDA 8ATCA 1V1RA 1LI7A 2XR1A 1NQVA 3LBHA 4MICA 1HSZA 2BEWB 1E6LA 3H42B 3CSUA 1CUJA 2IYEA 4KACA 3BF8A 4Y2XA 1S2GA 1RQPA 2QMHA 4RBNA 4K88A 2POCA 4KLZA 3IEVA 1IH8A 1E3SA 1XXHB 3F5DA 2CXSA 3D7KA 5IKPA 1WBDA 1B41A 1E1RD 1B3RA 3MRTA 3QY9A 1GQ2A 2FEAA 2DUWA 2B35A 2EFEB 4KPUB 2G5GX 3SGLA 3R7FA 1BU5A 2XNHA 3IV6A 1N32B 2RHLA 1TM5E 4GH5A 3C8HA 1DX9A 1M1NA 1KYVA 1ST2A 2WKPA 1Y6QA 1L4EA 3GNSA 1G7SA 1RM5A 4TT3D 3KDAA 2CXTA 1VBMA 5JQGF 5A2GA 1K63A 1C7RA 2FOLA 2VOJA 3C7DB 2Z1NA 5IAKA 5J4LA 4DV4B 1YOVB 1FVHA 4GRDA 1E8DA 2ZYHA 1V3QE 1G8PA 3H9BA 3KJGA 1MA3A 4MGZR 1Z2OX 3SP1A 3ZJUA 3WJ1A 4D97A 5C8YB 1WQ4A 1Y3AA 2ZT6A 4X1YB 2G5TA 3ZVRA 1Z0UA 3SY8A 1FDIA 3BQMB 2VAXA 1Y33E 3I04M 3L6EA 1XO1A 2W6ID 4RVNA 5BSGA 4HQ0A 3PJGA 3QX3A 3H5RA 3PJEA 4R0NA 3ZBTA 4H27A 4CI0B 4ZDIA 1V4VA 4NEGA 1PUIA 4JYPA 1R0LA 1I33A 2BUAA 4NYMQ 3KU1A 1K3UB 4MYSA 4TMKA 1A76A 2QTAA 5TQ2A 4NATA 1G1AA 1M2KA 1O87A 2Z5FA 4IYJA 3UT5B 2IIPA 4FGZA 4ZQFA 4YJHA 1XQ6A 2A0WA 3A6EA 3U4DA 4DCJA 2H2HA 4EY6A 1KYYA 1SC9A 2I67A 1UBKS 2Y76A 2FSFA 1SOMA 4WFJA 1SK9A 5ALNA 2QYTA 5EEGA 2PN1A 3COYA 5JD3A 1XCJA 2FWPA 5CYPA 1RFGE 5CHYA 5F77A 4GOND 4NYMR 2FW9A 2C7VA 1NUSA 3KCNA 2H11A 4H31A 4Q6BA 3ZJYA 1WCIB 3GUZA 4WN9B 5H81A 4ZI5A 3VPFA 1BXGB 3L02A 4DLAA 4DHEA 3LUDA 3WLLA 2B69A 2IP2A 1YUNA 2W11A 5LMCA 2CBGA 1FMFA 1DIAA 1EVYA 2VPXA 3B6ZA 3ZD9A 2A88A 3OWHA 3WHIA 3TINA 1JR3E 1KEPA 2B7CA 1KEWA 2GWRA 3CEPB 3ETDA 1N0VC 2GHQA 3I9OA 4PEVA 4RA6B 4BNFA 4AZ0A 121PA 1QIEA 2Y3IA 4U2GA 3QLJA 4DCPA 5IBRA 1XA3A 4OHVA 2Q8PA 3IBFA 3ER9A 3CZ5A 5ENVA 5I7OA 2JLBA 4AZ3A 4QM6A 3G13A 1AN0A 3DPUA 4OPMA 1L1QA 3A1VA 1EUQA 2FEOA 2C83A 3R3HA 3RCBA 4DLZA 4OGLA 4JOCA 1C3OB 3ANNA 4PQFA 2CHEA 1TO2E 2HSDA 4F2DA 2J6BA 1RAAA 5AUNB 4FS3A 4HGYA 1BDJA 3HUDA 1ECGA 1GSOA 3QELA 4H1TA 4ZVLA 2D3TA 5REQB 4ZICA 1AD2A 1KJJA 2PCJA 2WFZA 1QCZA 2DPHA 4R1PA 3V3TA 4O4LF 4NJMA 1N4AA 3V4SA 3C6BA 2GN1A 2ZWPA 1RQLA 2FJPA 1JAXA 3KOMA 5EZ6B 1J00A 5B58T 3E9CA 3RGGA 4F4CA 1HYEA 4RTKA 5BV2P 2OMEA 4AKIA 5CVTA 1NI5A 1E6MA 3A4TA 2ZSEA 1KBOA 3QUTA 5J5AA 1D9XA 5A9RA 1U9JA 4YRIA 5AM1A 5H3CA 2F3TA 3JTEA 4IQ8A 4QUGA 3U1VA 2NUBA 5BOSA 4QYIB 3VR2D 1BWQA 3QVVA 2YMPA 3FCYA 2BY4A 5HJ2A 4F11A 5FTLA 1V9SA 3RIGA 1XDSA 3BHMA 1UC5B 1PW5A 3SKYA 1H3EA 4L0MA 2WIBA 3NOOA 1QHYA 4DKJA 4RD6A 3HO1A 1N6RA 3N0RA 3OQIB 1R00A 5JSKA 3AHDA 3CFYA 1P2BA 2Q5QA 1P1JA 1YRLA 1NVFA 3THSA 5K03A 2CDRA 4HADA 4JODA 4QO8A 1YL7A 1F5SA 2CE2X 3LKVA 1NVBA 4I5IA 3TR0A 3VKUA 3SOPA 3EPHA 3TI7A 1CV2A 4OHYA 4IHAA 2WKWA 2F3UA 4TSFD 1XN1A 2GPTA 1YIAA 1H6CA 4EWLA 3M5CA 4TLBA 3NHPA 2O3UA 2GERA 3SIXA 3FR8A 1YJAA 2CGEA 4A03A 1F06A 1BMFA 2DFLA 4QEKA 3MELA 1HFJA 3ND5A 1FNNA 4INOA 3R77A 4MPDA 5ILQA 1GY8A 3E03A 2XH8A 1SIUA 2N1MA 3L9XA 3AFGA 4HBZA 3FPBA 4QTZA 5DU2A 2LR0A 2I62A 3LQQA 3TGWA 3HBJA 1WP9A 4GC5A 1ZK0A 4QDXA 1TTTA 2ZPAA 3PFKA 1J24A 2BUCA 5TS3A 1RIFA 3TQFA 3ESBA 4OGGA 4B32A 4M0EA 4CMEC 4Q3CA 3S1AA 3WADA 5EJGA 2AE2A 4B3BA 5JQGB 2C31A 4KZPA 4NCJA 4BN0A 2YRWA 3I9MA 4EHHA 1F9EA 2IZ1A 4HB3A 4WUVA 2PL9A 2YJZA 1SHLA 4IIEA 1KWGA 3G0BA 2QMZA 4G6ZA 1IG0A 1T8RA 3FM9A 2RBGA 5FFFA 2AG1A 4IGIA 4DCMA 3FROA 4RVSA 2GPSA 1TF7A 3D6TB 2IYSA 3K8YA 2IEIA 4B4VA 2AK3A 2D00A 2Z4TA 4IO0A 3OPXA 4HXFB 4MVJP 4NG4A 1IQ0A 4R3WA 4XGNA 3FB4A 4ZMBA 3O0DA 3ZBUA 2A9QA 3PZBA 1TUBB 4DV2B 1CEXA 5FD8A 4L4XA 3KYBA 3CRW1 3OPYI 1JU9A 3VU9B 3JWGA 1KI1A 4MULA 3OUZA 4HXYA 5DLEA 4CR6A 3FSRA 4X00A 1BEEA 1QGED 1JQ5A 2HNBA 3QYFA 4IQ4A 2VQFB 4Y2QA 3AXTA 4L9SA 4LDRA 1W48A 3EFOB 1RTTA 4L8WB 3KXIA 3PXAA 1N2ZA 2QHXA 4JLPA 4MRSA 3WA6A 4NAUA 2HQBA 1P2VA 5C5EA 1UT5A 4ZKEA 3SQNA 5JO9A 1X2BA 1ACJA 4PVDA 4QVIA 2FMTA 3C24A 3GT4A 4IZ6A 5TNXA 2XDAA 3CX3A 4HX2A 1V2GA 1CQPA 4V1CB 2CYAA 4YAEA 3KSDO 4RVCA 1T4GA 2OBFA 1M5UA 1FYFA 3F67A 3DDUA 1P5ZB 3BDIA 4Q7JB 5CIWA 4KJXA 2V1UA 4FDLA 2ZJ2A 1Y7LA 4Z9BA 3H87A 1JR6A 2OZEA 3Q88A 4ZMSA 3CZMA 4PBSA 4PYQA 3C7CB 4MR7B 1DGQA 1K7XB 3C5EA 3T3IA 1DEAA 4IZIA 3KQLA 1VB3A 4C01A 3UMGA 3QGMA 1V7ZA 3L0BA 4F5ZA 3IR6A 3KE9A 4LK3A 1I4LD 1KBZA 3HUTA 4Z7OB 2XE6A 3ZPXA 4ZT4A 5IN5A 3HGTA 4DGSA 4YJ2B 3E4DA 3VR5A 1YHNA 3EUWA 4PTYA 3CZQA 1GPBA 3I2YX 1F1BA 2VNHA 1D5CA 4PFSA 3ZDBA 2XITA 3TIGA 2QR5A 3V32A 1ZNYA 2B25A 3P9PA 2RGXA 4MWGA 4B5LA 3OM0A 3R6LA 4KV7A 3UUEA 4PO9A 1XCPA 3LBYA 1DO8A 2CMGA 1PEYA 2KBFA