2K4MA

Solution nmr structure of m. thermoautotrophicum protein mth_1000, northeast structural genomics consortium target tr8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
b'MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0146 protein MTH_1000
molecule tags Structural genomics, unknown function
source organism Methanothermobacter thermautotrophicus str. delta h
publication title Solution NMR Structure of M. thermoautotrophicum protein MTH_1000, Northeast Structural Genomics Consortium Target TR8
rcsb
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03686 UPF0146 Uncharacterised protein family (UPF0146)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2k4mA00
5EEGA 4OBXA 3M6UA 4RVHA 3TPZA 2P40A 4RTLA 5HIKA 1JG1A 3G8AA 5EQJB 3FPEA 4IKPA 3EPPA 2JHPA 5EHGA 1VBFA 2YXLA 2OB1A 4FT2A 4GOMD 2QM3A 1L1EA 3LX6A 2NNWB 2UYOA 3C3YA 4KDCA 3KR2A 5H02A 3QOXA 4UOEA 2G71A 3VSEA 4RTPA 1ZKDA 3E8SA 1NT2A 5CUQA 2HMYB 3UJ9A 1NW6A 3LDUA 2UYCA 3I64A 1SQFA 2NXNA 3GDHA 3M4XA 4RVGA 3T7RA 2R6ZA 4PCAA 3OZSA 3EEOA 2AN3A 1FBNA 1EIZA 2P3LA 5KYGA 1XTPA 4DKJA 3OU7A 2ZZNA 4GC5A 4QQNA 1NE2A 3GIWA 1JQ3A 1H1DA 4CXMA 4P7GA 3OE4A 3R24A 4HGYA 2ZBPA 3D2LA 1P1CA 3BUSA 4YV2A 1NKVA 5EIWA 3KQVA 1VL5A 3TOSA 2I9KA 3UFBA 4KDRA 3KPYA 4RVDA 5HIMA 4Z2YA 3EVEA 1VP3A 1JQEA 4QVKA 1QANA 2FRXA 2NXJA 5EGSA 3CC8A 2XYRA 2JHAA 2IBTA 3TFWA 5DTQA 1XDUA 1P1BA 3O7WA 5CD1A 2GAFA 3B3JA 2AN5A 4K6MA 2ZZMA 2GPYA 1ZHFA 3G5LA 3WSTA 7MHTA 1OR8A 5BXYA 4PYQA 5DX1A 1L3CA 1D2HA 1KYWA 5EIFA 4EKIA 3NMUF 3MTEA 1NW7A 1JG2A 5FTWA 3KR9A 2ZTHA 3P2IA 5T67A 2PGXA 4M37A 5F2OA 2ADMA 4RTKA 1NW8A 3KQMA 5D1HA 5ERGB 4KIGA 5EKUA 1I1NA 3MCTA 4IWNA 2B25A 3CGGA 3PT9A 1M0EA 3LCUA 3MGGA 3ER8A 1UFKA 3HA7A 3QV2A 2FK7A 5IKMA 3JWGA 2FPOA 1VQ1A 2ZFUA 4G56A 5DM4A 4HC4A 2YXDA 3KPUA 2IH4A 1G8AA 2YX1A 3GRUA 5FHRA 2HTEA 5DT2A 2ZCJA 2ZW9A 4E30A 3TKAA 3UA3A 2P8JA 3V8VA 2PXXA 3B3GA 3NWBA 3Q87B 1FJXA 4X1OA 4PONA 3HVKA 1KPIA 5CM2Z 1IM8A 2C7PA 4QTUB 3TM4A 3UJAA 3EVDA 4A6EA 4RWZA 3HCDA 5KVAA 3ID6C 2P7HA 5K09A 3REOA 4PWYA 5HEKA 4BP3A 2GB4A 4GF5A 1UIRA 3THRA 3CKKA 3JWJA 5ICEA 4DCMA 3M6VA 5E1OA 4DA4A 4MHTA 2ZVJA 2OZVA 1N7IA 1Z3CA 3PLAE 1F3LA 4BY9E 2B2CA 5HZMA 5U4XA 1X1BA 4Y2HA 5K0EA 3G89A 4MWZA 1M6EX 3H2BA 1R6AA 3KQQA 3MCZA 5B1SA 4YV1A 3EVGA 2IDKA 3HM2A 5HFJA 4BLUA 3A4TA 4YMGA 4ER3A 4YUXA 5CVUA 3UJ6A 4E33A 5LQCA 2PX5A 5EMKA 2AS0A 3F4KA 4FR0A 3R9XB 1Q0SA 1ZGJA 3P9CA 5GP1A 5E2AA 1ZQ9A 1VLMA 2ESRA 3MTIA 3FUWA 5FUBA 3BWBA 2G1PA 4RX1A 3LBFA 1SUIA 1DCTA 4M36A 2ZIFA 1RJGA 1RI1A 5DX8A 2HNKA 1NBIA 4PNEA 1YFLA 4MIKA 3BGIA 5DRYA 1JG4A 1L9KA 4QTTB 4R6WA 5E1DA 4OX9Y 1FP1D 3HNRA 2IBSA 3ER9A 1VIDA 2QE6A 3FPFA 3OU2A 3P2EA 5LQUA 2ORED 4IV8A 3PVCA 5EEHA 3TQSA 2YTZA 3P2KA 4O29A 1KPGA 3BKXA 3GXOA 2AOWA 5CVJA 5DRTA 1WZNA 4ER5A 3AWIA 3KR1A 4KVZA 4PGGA 5P8WA 3MAGA 2JH9A 3G5TA 3V97A 4C05A 2EJUA 5E9QA 5F2KA 4XUEA 2O07A 5DLYA 4ISCA 3E7PA 5GWXA 3KQOA 5K0JA 3EGEA 2HV9A 2Y1WA 3FRHA 1Q0TA 2OPBA 1BKYA 2XYVA 4C03A 5K0BA 4DZRA 2OO3A 2WA2A 3FUXA 4KIFA 3C3PA 2B78A 2EG5A 1RI5A 2PY6A 2PV0A 1WXXA 1RI4A 3GRRA 3OZRA 3OPNA 5FCDA 3MERA 1JSZA 3O31A 4CWAA 2ZIGA 3B5IA 1YB2A 2AZTA 2PSSA 4PIPA 3DOUA 4V0QA 3EGIA 3CVOA 3G7UA 3IYLW 4YV0A 2XYQA 3BGVA 4Y30A 3Q7EA 5LQAA 5GIOE 3HCCA 2QYOA 1RJEA 3DLIA 3PB3A 4HG2A 2C7QA 5K0CA 2PXCA 3SXJA 5K01A 4QDKA 5DX0A 3PX3A 4AZWA 4XCXA 1I4WA 3DULA 3KPJA 2IIPA 4GEKA 4QPNA 3KU1A 2QRVA 2ZSUA 3GU3A 3DXXA 2R3SA 4PIMA 3S68A 3NDIA 1M6YA 3VC1A 2LD4A 4E2YA 3HTXA 5JR3A 5KS2A 2G8NA 4P7JA 4E32A 5K0LA 3O4FA 3TM5A 1O9HA 3EEYA 2ONZA 5CIYA 5CVEA 4RYLA 1JQDA 4GOND 1X19A 2JH8A 2XVAA 3GRYA 2DPMA 4F84A 5EMJA 3SX0A 2BR4A 2WA1A 2F8LA 3BWMA 4OBWA 1MHTA 3UZUA 3EGVA 4R6XA 2ZLBA 1G38A 1VPTA 4ATNA 4PYKA 1TW2A 3ELUA 4XUDA 1R8YA 2ONYA 3PX2A 3T0IA 2P3QA 5K0NA 4AZSA 2Z6UA 5LSAA 4X60A 4LECA 5IH3A 1BC5A 4RTOA 4YMHA 5K03A 5DXAA 4H0NA 4R8SA 3SVZA 5EG5A 2AR0A 2CMGA 2P7IA 5C9ZA 2A14A 1KXZA 1R18A 1ORIA 3L8DA 5LR6A 5E9JA 1AV6A 1JSXA 1YUBA 4RSRA 1INLA 1QYRA 2HWKA 2YQZA 4AZTA 3EMDA 2G72A 3FTFA 3DUWA 1NV8A 2DULA 4QPPA 1YFJA 5E1BA 2V74B 3M6WA 2HR1A 5EKXA 1DUSA 3QOWA 3K0BA 5F2NA 3KPVA 1HMYA 2AOTB 3NW9A 4POOA 4YUYA 5K05A 3LDFA 1QAMA 1ZG3A 3KQTA 4QQKA 1B42A 3TMAA 5E8RA 1KHHA 5DSTA 3RW9A 4DCGA 4BP1A 2AOXA 3OZTA 5DXJA 2VDUE 5GM2A 1IY9A 1R74A 4AUKA 5GINE 5E1MA 2ZBRA 2OXTA 2ZULA 3IEIA 1X1CA 4X41A 3UJ7A 4MQ4A 4ER7A 3FUVA 4C06A 2I6GA 4P7FA 3GWZA 3LSTA 3MHTA 3P9NA 4V0RA 1PJZA 3G88A 5CVDA 5BW4A 2PWYA 2Z6AA 2IFTA 5EPEA 5GM1A 2Y1XA 5EHIA 3SM3A 4YUZA 3OE5A 3HCAA 4ER6A 5CCXA 1NW5A 5K8VA 3FPGA 1YZ3A 1WS6A 2UYQA 4PINA 3HEMA 2YXEA 3KR0A 4PGHA 3HP7A 5E9WA 2BZGA 2ZBQA 4FGZA 5EZSA 2EFJA 1L3IA 3BWYA 3FPHA 5HIJA 3LDGA 4DM3A 3EVFA 3M70A 5ICGA 2KW5A 5EOVA 3E23A 2VZ9A 3GRZA 1KP9A 3IV6A 3FYCA 4FSDA 1L3BA 3GJYA 3RIEA 3FTEA 1XCLA 1G55A 4KWCA 3UJ8A 1MJFA 3LCVB 3HCEA 5DSXA 3JWHA 2IP2A 3OU6A 3C0KA 4PYLA 5T64A 3UJDA 5BP7A 3U81A 3AJDA 3P97A 1XDZA 3FUTA 2YR0A 2I62A 3BXOA 3ME5A 5EMMA 5FA5A 3FZGA 3HCFA 3KHKA 3LCCA 3A27A 1P39A 3DXZA 2ZIEA 3LHDA 4KRGA 3NTVA 4U7PB 1TW3A 1FP2A 1G6Q1 5D1NA 5CCBA 2CWWA 5JUWA 4FS8A 3FRIA 4CKBA 2VS1A 3TR6A 3UWPA 1RJFA 3I53A 3ORHA 1QZZA 3BZBA 2PX2A 1RI2A 2OBFA 2PBFA 3BKWA 4P58A 4ER0A 2IH2A 2BH2A 2GLUA 4CTKA 2PX8A 5FADA 4DMGA 3LPMA 3EVZA 5EMLA 4M7RA 1VE3A 3CBGA 3ANXA 4C07A 3LGAA 4WXHA 1SUSA 4HH4A 3HA3A 1ORHA 5LQKA 4C08A 4E31A 3AXSA 1O9GA 4RTRA 5M5BA 2PT9A 1YF3A 1N7JA 3KPWA 2O06A 3GGDA 3G2PA 4ZTBA 2AN4A 1TPYA 3KQWA 4RTQA 3P9IA 2NXCA 2Q41A 5ICFA 3TKYA 1EAMA 3NVMB 4E2ZA 2N47A 3T7TA 1XDSA 3B7PA 1WXWA 1KR5A 2FHPA 1KYZA 4GC9A 3UJBA 5DTMA 2WK1A 4LWOA 3A25A 2O0LA 1NW3A 1WG8A 2CKDA 3A26A 5EC8A 2JG3A 3SSNA 2IGTA 5GOZA 3THSA 3P71T 5CVVA 4EK9A 4IV0A 3CCFA 5K0FA 2GA9A 5MHTA 3G2OA 2VDVE 3EVAA 1EG2A 4PYMA 5GIPE 2AVDA 3A7DA 1R8XA 1XJ5A 3C6KA 3DLCA 3M6XA 2P41A 5EVJA 3UBTA 2OYRA 2FCAA 4CTJA 3UJCA 4M38A 4BLVA 2CL5A 3X0DA 1F38A 2AOUB 3VYWA 4QVGA 4F86A 2V7EA 5E8JA 3GCZA 2JJQA 3T7SA 4EMSA 5LQNA 2Z6QA 4GBED 3GRVA 3CJQA 4YUVA 10MHA 8MHTA 4RVFA 3M33A 3HVIA 2BR5A 2YUIA 3B89A 3C6MA 3NDJA 3NJRA 4GOOD 5DM0A 5FWAA 3DMGA 4PYOA 1KIAA 5FA8A 2BR3A 2EX4A 1WY7A 5KQRA 4CKEA 3DR5A 5FWDA 4HTFA 2E5WA 3FTDA 2H11A 2B9EA 1G8SA 4PYIA 5C0OE 3SMQA 2UZ4A 1HNNA 1JTFA 2EJTA 4GQBA 1ZGAA 1EQAA 1O54A 4OA8A 1X1AA 1X1DA 3EVCA 5G02A 2ZWAA 2NXEA 2UYHA 1AQJA 1D2GA 1YZHA 4GOLD 3PTAA 3FUUA 4R05A 1XCJA 3FTCA 4LWPA 4OQEA 1U2ZA 2OB2A 3GO4A 3KQSA 4E2XA 4YUWA 2CMHA 2NYUA 4AX8A 4HGZA 4X63A 3DH0A 1PRYA 5EZQA 3P8ZA 3R3HA 4KW7A 4EVIA 1NV9A 4CKCA 1BOOA 5LQJA 4EQZA 2OKCA 3SGLA 3DP7A 1DL5A 3LKZA 4NECA 2FYTA 4HRAA 3NVKI 4RTMA 5HILA 1XXLA 1Y8CA 1NBHA 2PKWA 3A7EA 1RJDA 4U7TB 3DXYA 4RTJA 1UWVA 2AOVA 2NP6A 3CJTA 5FULA 1V39A 5LQRA 4A6DA 4WVLA 1SG9A 2PVCA 3ELWA 3HCBA 3HA5A 3P9KA 4RTNA 1KPHA 1JTEA 4FP9A 4LG1A 1SKMA 3DTNA 2NP7A 4JXJA 1P91A 2C7OA 1XVAA 1IXKA 2G70A 4XUCA 2XVMA 1EJ6A 1RI3A 2PX4A 3I9FA 3HVHA 2C7RA 3UA4A 1FPQA 1VP9A 1AF7A 3SR4A 3R6TA 4RV9A 2BM9A 2AOTA 5K0GA 4C04A 3AY0A 3B3FA 1JG3A 3ELYA 2QY6A 2O05A 4PCLA 3TRKA 3RODA 3KQYA 3AXTA 2XBMA 1QAQA 4QDJA 2GH1A 5DM1A 5FQNA 4B17A 5ICCA 3JWIA 4L7VA 2PJDA 3CJRA 4FT4A 1SQGA 2I7CA 3G2MA 5HOQA 4DF3A 2H00A 2IPXA 3OFJA 4AZVA 2P3OA 5DTRA 3BWCA 3K6RA 4FZVA 1EJ0A 3G2QA 3MB5A 2B3TA 2H1RA 3ERCA 3FPJA 2IDJA 4OQDA 5C1IA 5KQSA 3FYDA 3OCJA 5FHQA 3IHTA 3LKDA 3KKZA 4EKGA 4F85A 2AOUA 3LL7A 4E2WA 3OFKA 1I9GA 3SSMA 3PFGA 2P1DA 4OA5A 3SSOA 1JR4A 3R0QA 3PFHA 3KQPA 5FQOA 5E2BA 4E70A 3PS9A 5HIIA 4R8RA 1N2XA 1AQIA 2PXAA 2JHCA 3HVJA 2VDWA 3BGDA 3EMBA 1G60A 3ELDA 4PYNA 5T6BA 3VC2A 2PWPA 3LBYA 2PLWA 3GNLA 2YVLA 3NWEA 2O57A 2BM8A 2K4MA 4P7KA 4C4AA 5BW5A 4PYJA 3BT7A 2VP3A 4X61A 2IH5A 4GUAA 4FSXA 3EVBA 2QRVB 2ZWVA 5DWQA 1SVUA 2OY0A 3TLJA 2FK8A 1D2CA 2AVNA 2P35A 4HTFB 2PT6A 3DMFA 3MQ2A 4BLWA 9MHTA 5DPMA 3I5UA 2GS9A 3LECA 4DQ0A 3DMHA 4MTLA 1BHJA 3G8BA 4HSGA 4RTSA 2ZZKA 5DM2A 1T43A 1QAOA 3E05A 1R00A 3I58A 2ERCA
chains in the Genus database with same CATH superfamily
1DUIA 5JDCC 1N25A 3EA5A 3RPEA 1JHAA 3VAYA 1XU7A 2PT7A 1RHUA 4YAKA 3HUEA 3K71B 2D1QA 3F3SA 3DHEA 2QAGB 4NAUA 3GCXA 1G8YA 5DULA 1RABA 4HDNB 1KVUA 3NUQA 3PR1A 1ZMBA 2I8AA 1B93A 1SUBA 1A5BB 3R76A 1II9A 2JJ8A 1SVMA 2IL1A 1ZI9A 2XYHA 4AX4A 1BQ4A 2HMYB 2BDTA 3DMDA 2BGRA 3ZXSA 1AB6A 4E4RA 4JKIA 2O3SA 4KAFA 1GGHA 5JDIC 3GDHA 2Z5GA 2GO7A 1JDZA 4AY2A 1TAQA 3B8EA 1LSOA 3AJRA 3PJFA 1GCAA 1KY3A 4E6PA 5AUPB 4FGLA 1ADGA 2Q6VA 3IDQA 3LQFA 4J0QA 2XUPA 4CL0A 1QPBA 1DAEA 1TKBA 4M9RA 3BMXA 4HFMA 4M0MA 3MBOA 3VMFA 3V32A 3E53A 1SUCA 2Q7XA 4QUHA 3WWEA 4UW9A 1J22A 1MC8A 1U2GA 3NORA 3GAAA 1XOIA 4MW4A 4YBZA 1L5KA 4F92B 2V7QA 4Z2YA 1MB0A 5DO9A 4BLRA 4GOXA 3WWZA 3WAJA 1IXZA 1M0WA 1EJ2A 4X92A 4ZT5A 5CD1A 2GAFA 1ZR4A 4ZVQA 4XVHA 3T0FA 3DW3X 4ZXFA 1KYWA 2VHZA 3PIDA 1P1FA 3NIFB 4DJFC 1CUAA 4FFBA 5CURA 1L6RA 1V2GA 3QPCA 1U1EA 2ZUBA 2ADMA 2VH5R 4F97A 2QUBA 1X80A 1U5AA 3SZOA 2HPZA 1BJRE 3FMFA 5EA2A 4KIGA 3Q8XB 3JQ7B 5EKUA 4EO4A 2F8MA 3K8QA 4DJAA 3WYAA 4HD8A 4Z8YA 5JYEA 4G26A 4AO7A 1I3KA 3QV2A 3K09A 4G1CA 4QPCA 4MYUA 4B80A 2VYFA 1GL9B 3ET4A 3L8ZA 4IKOA 2VBGA 4ZYYA 1S2LA 1AB5A 2DKNA 5SZIA 3EXEB 2V6GA 3DLBA 4UTZA 4Q1VA 1A9QA 2MDTA 1P1HA 1AGXA 5J4KA 4G1EB 2HEIA 1XYVA 2WM3A 3WLFA 3DD1A 3FGNA 1XMXA 4I19A 3LPLA 1W5EA 3GJ3A 4M87A 1KPIA 1G7RA 2XA2A 4GMHA 3Q1KA 1ZCFA 1AJEA 2ECFA 5FV7A 2J3HA 2ZT6A 3R09A 5HM8A 4DEVA 1CWUA 1VG8A 1GQQA 4OP3A 3AR5A 3SXUA 1KY5A 4FS3A 1SGWA 4JSRA 5HEKA 4WZAA 4HPXB 4TYPA 1NW4A 2EZTA 1AV7A 2AUMA 2OBBA 3MUOA 4FZ5A 2W11A 3QU2A 5FA6A 3EEQA 3SBXA 3U40A 2G36A 4B2YA 4OQNA 4ZK6A 3D0OA 4WQMA 5HZMA 1QHNA 1U2GC 5IT9A 3DYBA 3NWOA 4PQEA 3EGDB 5JJBA 3ZH2A 3WLOA 1CSEE 3BJIC 4D3SA 3PNYA 4NJEA 1JQBA 2W83A 3O0TA 1KI9A 4HEQA 4LVNA 1UJMA 4EKEA 2RAVA 4GI5A 3QPUA 3SMVA 4XIGS 2O2HA 4MPDA 1U1DA 1SUIA 2I2CA 3HGMA 3FVQA 3IHKA 3PFFA 1PU2A 2XMSA 3GN1A 4W82A 5G0SA 1G0OA 3CEAA 4DMHA 1SO8A 2B0JA 2QQGA 3KBBA 4BNTA 5ES4B 4OATA 2E37A 2R44A 3P9ZA 3HNRA 2NGRA 3W1WA 1A76A 2ZJ3A 2ZWOA 2EQBA 2I4OA 1NRXA 2QE6A 4DA6A 4EF4A 4EHDA 2IVFA 4F9GA 5JECA 1W4CA 4PTZA 4FEGA 4TVBA 3SNHA 4QD3A 1LDGA 3ZZNA 1Q17A 4C3UA 4QHSA 4OSPA 5KYWA 5T7BA 3KZCA 5AHOA 1HX7A 4Z9YA 4PGGA 3WNZA 3OCXA 2XQGA 2WB4A 2W6IA 2ZBEA 4K26A 4M8IA 4OD0A 5DLYA 4EHAA 3ELBA 5K0JA 1RD4A 3FRHA 3PRHA 2OENG 3OQVA 3OQ1A 4C03A 4EMBA 3HB4X 1ZOLA 3BREA 1GPYA 4BWYA 4ZEVA 1XNGA 2EOAA 3CLRD 2PY6A 4FDLA 4OJQA 5EWLB 1VC2A 1ZSYA 2JIZD 3S0JA 4ENQA 2ZIGA 4URZR 3ZKWB 4WXPA 4X91A 2FX5A 1GPMA 3FF4A 1TK9A 5IAOA 4YV0A 1RZ3A 2HYDA 3OFVA 4UC0A 5DB4A 1ECBA 1TZKA 2HLNA 4X6XA 2FSVA 3HCCA 5F78A 5IC4A 4XB1A 4ZV9A 4D9CA 1M2OA 5IWCA 3WYCA 4C78A 3MT7A 4NK4A 3WLMA 1DO2A 2FVXA 3HK2A 4JDUA 4LRWA 3HUDA 4BJ5A 1VSUA 4IIEA 4O1HA 3UKDA 3CG4A 4JGIA 3GAFA 3KU1A 1J33A 3GU3A 3VHXB 3CNHA 2ANBA 1Y8AA 5AVZA 3EMVA 1E6KA 3AF0A 4S0XA 2G17A 4QTYA 1GVNB 4PC7A 1S3FA 1J9ZA 4EG7A 3A1DA 3H2JA 3OEED 4P0PB 4BNGA 3EEYA 4JFRA 3VOTA 3K6JA 3FY4A 5C4IA 3D7KA 5DNWA 2EERA 2JI7A 1CNFA 1RYMA 4WY8A 2WILA 3SJAA 4N5IX 5KHAA 2ZJYA 1H0SA 2QMUA 2UVPA 3AUKA 5E4FA 1G59A 4R1MA 4H7FA 3AEKA 2GVDC 1HFEL 1PZFA 2CUZA 1AU9A 2MINB 4HLQB 3QI7A 1UBLS 2G06A 1Z5VA 4Q34A 3RK1A 5CB6A 1VPTA 4E22A 1CP2A 5HS6A 4G67A 5E4JA 1XAIA 3E9MA 3D0KA 4ZO8A 1T8PA 3IS3A 1JU3A 1LNSA 3JQCA 5AUQA 4BO6A 5FTJA 4O2RA 4JI5B 3YASA 1GIAA 2OO5A 2W2VA 2NNLD 1TNDA 4GHWA 3AW8A 1TZCA 1WD7A 5A6SA 4UKDA 4P84A 1MGPA 1JSXA 3QLUA 4D56A 2QTWB 1J00A 2B94A 2Y4OA 3ILVA 4JA0A 4R3NA 3D3EA 3LBAA 3A11A 5GQSA 4UM9B 1IZYA 2G76A 3O94A 3KZNA 4QVIA 2AI1A 3H1AA 3KPVA 3NW9A 2WFLB 3DPUA 5JAUA 1GZ3A 3AEZA 3UATA 2Y05A 4F3RA 5FBVB 3IRUA 1LWOA 6GPBA 5AM0A 4TS1A 4OHPA 5DSTA 3X3HA 2LNDA 3VO2A 4URVR 2KSQA 5BSVA 1UWLA 4TSKA 3I8OA 4LF4B 4AUKA 1T8SA 3H9QA 4AZ0B 1L4UA 1Z2OX 3KOMA 1X1CA 4F04A 2Z95A 3G17A 3LWNA 1CJKC 2GK3A 4KI0A 1A9XB 4QSMA 3W9SA 4D5GA 4S2EA 4GPEA 3STHA 1RAGA 2W70A 2XDWA 3HZRA 1AXRA 2D74A 3HRHA 3P0JA 5AJWA 1Y6QA 3FLAA 5LXTF 3W8EA 3ROMA 5KHOC 2OR3A 4OI0A 1OLXA 1TEVA 3MFYA 4N8SA 1ORWA 3G9QA 1GQ2A 3ETLA 4RK6A 3G0OA 4GPBA 3HP7A 2I1WA 1NP6A 1OILA 2W6JA 1E2HA 1RXSA 2EFJA 3FPHA 3BWYA 4RXTA 1WDMA 1XR3A 5KWIA 1M8PA 2FRVA 3PHGA 2H1VA 4JVLA 1BJTA 3A4NA 4IQ4A 1YQDA 3NV7A 2HQ1A 2XMRA 1K66A 4XQEA 2PRYA 3M5PA 1HRKA 2C94A 1Y3DE 3NAGA 3GGCA 4FUTA 3GBPA 5K3BA 1T36B 4MIOA 3JWHA 1U7HA 3FCXA 1N2ZA 3C0KA 3IFSA 4Y18A 5DLQC 4JD5A 1I1QB 4X65B 2R0QC 5C7OO 2NUBA 1EVIA 3QHAA 3ZXIA 1IXYA 4WOJA 3MSCA 1JHQA 2R11A 1D4OA 3A27A 1P39A 3HY4A 3LCCA 5DOVA 3V42A 3DTVA 5D5HA 2OV6A 1MX9A 4L5AA 2Q3MA 1TQDA 121PA 2F8SA 2OFPA 4FILA 4ZU6X 5CCBA 2O5VA 3KSBC 1JWAB 1PZNA 1QNFA 3G2KA 4YFVA 4ZT7A 1O6CA 2EBWA 4LQDA 1OT3A 2HRDA 4BASA 5IABA 4IMRA 1I13A 1EVLA 4UHKA 1I10A 4PLWA 2QR5A 1A0OA 1O94C 1J2UA 1ATZA 2VEOA 1U9CA 3D6MA 4ITUA 1SBHA 2EFCB 3VGPA 5A05A 4C76A 1E59A 1DRVA 1GGFA 1OY1A 3QEMB 2DT8A 3LX8A 4MQEB 4NV0A 4Z9XA 1E6WA 3ILXA 4UD6A 1IATA 2AZ4A 3KKQA 1AN9A 3KC2A 3LX4A 4I9GA 2BJHA 4N0PA 4WSOA 2PEZA 5BOVA 2OZEA 1U0NA 3TW8B 3URKA 3ZGLA 4IVPA 2AN4A 3D6UA 4MS3A 2WY2D 4WZZA 2WAOA 1RLTA 2JCBA 2A9RA 4LF5B 2QUHA 1GM5A 3LHFA 1H9AA 5D01A 3DEKA 4LOIA 3B7PA 2EEPA 2FKNA 3J81A 1PV1A 2HDHA 2P5TB 5LXTB 2VHWA 3RSZA 4QL3A 3SS9X 2LTAA 1DFGA 3LLCA 4J1TC 2ZUTA 5J2UB 4ETNA 3RUFA 3JWPA 5L3SB 3D3NA 2NTEA 3NX4A 5EJIA 2GEDA 2I54A 4IV0A 3THYB 4Y1FA 1X6VA 1IEQA 4MW2A 4QBFA 5SZHB 5MHTA 2ZYVX 1FXWF 3G2OA 1X1QA 2GN1A 2LCIA 3Q9UA 4JXKA 2SCUB 1RKBA 4JBIA 2RIRA 1THZA 3B3QA 4MS1A 4X1IB 2CF6A 5D00A 1GNVA 3QELA 1XJ5A 4YCSA 4L76A 4WLVA 2BEKA 2R6FA 3Q7PA 1F38A 1T4MA 3T99A 4CL3A 5A3JA 5HS4A 4W7IA 2IKQA 3T3GA 2YYSA 4JJGA 2JFYA 4MLDA 3U56A 3Q3GE 2JDIA 2CLKB 1N8NA 2A2ZA 3T9DA 4GX5A 1EFDN 5D6NA 3B89A 2O8FA 2A58A 4Q9KA 3OO0A 1M5UA 3HN2A 3L0DA 4XW2A 1F5NA 2IEDA 4TKLA 1I4LD 1UM9B 4I5GA 5EMNA 4MAMA 3F47A 3K5PA 4O4IB 1ETHA 1RT9A 2P78A 5KQPA 1QP4A 3RSCA 4RZIA 1R10A 5TQJA 4DFDA 1OZHA 3AF4A 4CIWA 3HKDA 1BVRA 1G8SA 3SMQA 4EI7A 1HDXA 3HJHA 3CNQS 2GLTA 3M6FA 3O4IA 1PW7A 1BXGB 4DIMA 3OQNA 3I6QA 1YZHA 2PO5A 1HQCA 3OUTA 1W34A 4JCCA 3N0TA 2H65A 2OV1A 1YHZA 1YZYA 2NTVA 1U2ZA 3LUBA 4S1OA 4AF8A 4UVEA 5JXIA 2DHQA 3DOEA 3TEMA 1VDZA 3R23A 4LDNA 2ZBFA 3I6MA 4YS6A 3TL2A 1OASA 4RJLA 4MKZA 1FDOA 1AUXA 4YMSA 3SC2A 2FYTA 1E9VA 3DXFA 1CUSA 1H9CA 1X86B 4BEWA 5BMVB 4YP5A 4YT5A 3SKXA 1OH8A 3FI9A 1W8IA 1EK2A 3IDSA 2YQ4A 5LQRA 1QGZA 1VKOA 3JQRA 2FSPA 3EDYA 1REQA 4YP7A 1G3MA 3WWCA 4UEJA 4FMDF 2HBQA 3ZG6A 1HYBA 3K0CA 1SKMA 2ZI5A 3VR2D 1P91A 5AXAA 4UQLA 1WPXA 3KK0A 1H6CA 2XVMA 1RI3A 3K9WA 4ZO6A 3IE2A 3EIFA 3ILSA 2ET6A 1L5FA 3BMCB 3TNJA 4G63A 3C45A 4MPJA 4KREA 1XFAA 1M75A 5D3MB 3OM1A 3S55A 3SX2A 2L42A 1GTZA 3OLYA 4CKXA 2WMDA 4K40A 1JR6A 3SZ3A 2GM9A 3GQBB 5B37A 2QP4A 3HCOA 1DV2A 5DHTA 2XBMA 4LWQA 4O2AF 3SLRA 2BKEA 2OZKA 3E9ZA 4RCVA 4ZVOA 1GZ7A 5JCOA 2AQIA 1A1SA 2A5LA 2FMHA 1K75A 2N42A 2CXHA 2PYDA 2X77A 2RI0A 4UBJA 4O4IF 2HBYA 1PV2A 2YFKA 3OTIA 1C0PA 1NHGA 4N8DA 2OHXA 1GRNA 2GKGA 2VHUA 3FB1A 2XOKD 3UAGA 4ZMRA 1E0JA 2OGZA 7GPBA 3RSFA 5FHQA 3KSMA 3TIIA 1BFUA 2I66A 1YA8A 3JY6A 3HEBA 2XCRB 5HW0A 3EWNA 2GVZC 5JATA 2OXEA 1GR1A 4E70A 3U4QB 1Z28A 1HPLA 3GT7A 4AFNA 1N2XA 1I51A 1V2HE 1MU0A 1QONA 4TKUA 1VCNA 1XLTC 1YBAA 3M4YA 4XD2A 3UN1A 4BGVA 3J80A 3U7FB 1QE3A 3OZ7A 3F73A 1RKVA 2O57A 4WNAB 4W8OA 3F49S 5J2UA 4BEBA 1KZ6A 2ISCA 2WKSA 5EERA 4YDHB 3BH0A 3ECAA 2OCXA 1R16A 1ZM2A 5G3ZA 3VPXA 1G3QA 4WH0A 4B34A 1YZNA 1C9KA 2R97A 4DC9A 3E35A 4DN6A 2BEJA 4EAAA 9MHTA 2XTJA 4OGGA 1UT5A 3OZDA 3UOAB 3NBKA 1EDZA 3H3FA 4DQ0A 5JQWA 3GJ0A 4WD3A 1TJYA 5CXQA 4JI0B 2ID4A 2Q5JA 1MFPA 1OFTA 1KKUA 3E05A 1NBMD 5CGQB 2V96A 2VIIA 1Z4OA 5L9AA 3RVLA 4HLUC 4JBYA 3ZU5A 4TLBA 2BKVA 3HBLA 4RVHA 5J2TF 5HIKA 4HATA 4I1VA 3CVXA 1W8DA 4WFIA 4I9FA 3QSGA 5ARCA 4BRZA 5ADWA 5I3ZA 3ZV3A 1FE8A 2EF1A 3CEMA 1VLHA 1MD9A 1NQUA 4CM7A 2VJOA 5ERXA 1OTYA 2NNWB 2UYOA 2OXCA 2JIRA 1UKVY 1BQ3A 3QOXA 4MJXA 5A3QA 3FWPA 4O4IA 3CLKA 2NV6A 1P7CA 2YIMA 1JB1A 1TZBA 3K16A 3Q12A 3NIDB 2C2ZA 1JT2A 1X9HA 3LDUA 4B82A 1OJLA 1BKSB 1OBVA 3KOZA 5IC6A 1E4EA 2VNSA 3CZQA 3NALA 4ZAXA 3SC4A 3IODA 4PS1A 2E55A 1G4UR 4XWTA 1N36B 1XSEA 2WOOA 4E5YA 2VZ8A 3S8MA 5G1NA 3WNDA 1Y8RB 4CXMA 1JQ3A 1H1DA 2V97A 4MRPA 2WHRA 3R75A 4HNHA 1ML3A 3D2LA 1CLUA 3GPLA 4Q4JB 2YWJA 2CSXA 4OFWA 2ISSD 4RWEA 3MTQA 1UT8A 2YXPX 1Y4UA 2WYWA 3O8QB 3UFBA 3UKOA 4CQJA 3WRXA 5EQDA 4P4LA 2PZ8A 2C4UA 2WKPA 4JJ4A 2VCHA 5HIMA 1DEXA 5I9NA 2J1LA 3CC8A 4NMMA 2OO5C 3NKLA 3WGHA 4FUQA 5DTQA 3O7WA 3IL2A 1CE8B 2XDAA 2ZJ1A 2X2EA 1HLDA 3N6XA 4H1HA 1QH8A 1PS9A 3A1CA 1P5HA 4HAOA 4MV1A 3DVAA 3SN6A 3TBFA 5EN4A 1CQIA 1RACA 4UDYX 1JG2A 4K86A 2P5UA 2C88A 5T8KA 5BYJA 3F3MA 3PF8A 1FY2A 3NKVA 4CTOA 1X7HA 1TKAA 1K7XB 4NNPA 2X5JO 2IJGX 1R6BX 1SEPA 2BEUA 5CG2A 5JVDA 3CWCA 4J4HA 3E9QA 3IUSA 2R6JA 3QEOA 2JIQA 2Z58A 1RWMA 3JWGA 2DQZA 3PWTA 2ZFUA 3CIFA 3O4VA 3KKOA 3QW2A 4JFAA 2J6IA 1KMHA 1C9YA 2VHJA 4PQRA 1H0RA 3K5HA 4BZPA 3TKAA 1OF1A 2FPPB 3OOSA 1X9GA 3QPBA 3JVVA 1QG0A 4P34A 2Y0CA 3F46A 4PONA 3B6IA 4AJ9A 2FPIB 4KWTA 2W2PA 4BAGA 2FSVC 4KEAA 4IFIA 1E9SA 1VG0B 1OTXA 2ZIWB 1M83A 3C74A 1ZD2P 4H6PA 4OMCA 5DT9A 3SKYA 3T7IA 4E94A 1NLYA 2VPTA 1U1FA 3A6FA 2CLIB 2ZYUX 4HYQA 4XOIA 3QWBA 4LNHA 3AHIA 3IUYA 5AFSA 1M72A 1QIDA 4JP1A 1I2CA 3CCBA 3M6VA 4OI4A 5AW4A 3VNVA 2X41A 2Q1UA 3NOVA 5AQEA 2NMVA 3GJZA 1Q19A 2PG3A 1TECE 1OKKD 4QUDA 4EHLA 3G89A 2EAUA 1VYTA 3MGCA 2PSFA 3JARA 4IHKA 3EVGA 4AJNA 1PHRA 4JX9A 4JP5A 3HXMA 5LB4A 1GKLA 2FZKA 4MMYB 2IWHA 2AYZA 3AEKB 1JPJA 1W30A 4YEDA 5GV7A 1BCSA 3G59A 4GLBA 1P7WA 3R9XB 4S1NA 4JN6B 1ZQ9A 4RM2A 3GPBA 3D7SA 4DBLC 3MTIA 2ZTVA 1KEEA 4NXMB 5BNFA 5CLJA 4RIFA 4ZVTA 2IZ5A 1JMKC 1XZEA 2PHZA 3JVEA 3NBFA 3ZJTA 1GVHA 1NBIA 1Q1ZA 5DYIA 4WIAA 1UQRA 1QVWA 2JVJA 3CZMA 3L7BA 4JVNA 5CNMA 2EW8A 5CEEA 4PGMA 5JZVA 3DAOA 4NZ9A 1S3GA 2X7XA 2IA5A 1QH0A 5CX4A 3E2IA 3E0QA 4EJSA 5CB4F 2F1KA 2GPWA 5G4KA 4AICA 4HWTA 1C8VB 3A36A 5ILOA 2HF9A 4NR0A 2RGGA 1ANKA 3PXEA 1SG0A 3VNSA 4M55A 5AXCA 4CLRB 3P4XA 4DLRA 3WJ1A 5ALJA 4A5OA 5LCXA 2PZMA 2GILA 2VPIA 2ZSFA 2WKQA 1OH7A 5EWLA 4DHEA 4JLPA 1T4CA 4YP6A 3Q4GA 5CBPA 2QTHA 4Y2PA 2C3YA 1Q1EA 2B78A 1RI5A 4D9EA 1XX6A 2FETA 3KKEA 4KN8A 2ZJBA 3VR0A 4IHJB 1TQ8A 4BMPB 3FYUB 2FMKA 2JJ2A 4IDGA 3K9GA 1T0PA 3VTZA 3BL6A 4Q4AB 3MVEA 2DPYA 2H1FA 2XRZA 1PJ4A 4G0NA 2J0SA 5CDTA 1KSHA 1R4ZA 1FA9A 3ESCA 3KYIB 1QO0D 3TNYA 3R1IA 4JH0A 2VT2A 3I2YX 1UBRS 3KPJA 3ZE2B 1RQNA 2HF7A 1SHZA 2MR6A 4RKRA 2QX9A 1BCRB 4MKRA 1RPJA 2XDQB 3VPDA 2I29A 3GROA 3QU9A 5LBIA 3ZIDA 1V1RA 3REQB 1DG3A 1XDDA 2R66A 2ID7A 1PSZA 4L15A 4I50B 3ZE8A 5BWMA 1CDOA 1HKHA 3LVFO 5ENDA 2IZZA 3WLIA 3OMLA 4F84A 4K9NA 5EP1A 4AJIA 5BR8B 3KD3A 3L4BC 1MHTA 4RKWA 3R2JA 4US0R 1E79A 2YIJA 2D1FA 2O2GA 3ED5A 4AKEA 5LZ2A 3UUWA 3M6IA 1NG1A 5ALPA 5DW0A 4JLUA 3H3XA 4IFEA 4UHEA 4YBRA 3RVJA 4YMHA 4CF3A 4IW3B 4WEQA 3SVZA 3ZZ0A 4ZZ0A 2PTHA 1IOLA 1JFLA 2H2WA 3TRIA 4EQ6B 2FB9A 1ORIA 4Y2JA 5DF1A 1ZEJA 2WSSD 4DS3A 3GL9A 4O4HA 2QRMA 3DYVA 3KO8A 1H4SA 3FYTA 4QUKA 4H59A 3KBOA 4N49A 3ZU4A 4ZWNA 3DUWA 4HDQB 3HI4A 3RDPA 2VDNB 1N4AA 4H7JA 2KBFA 2C3MA 4Q4CA 2WPNA 2J46A 3NTUA 3ZBTA 4DA7A 5B1YA 4R3WA 1P4SA 2F9MA 1N2JA 1XU9A 4NV3A 5HFAA 4DGSA 1B26A 2QW0X 3GW8A 1YDHA 3OQMA 1T0IA 1W9HA 1NTOA 4TT3A 5DXJA 4PO1A 5JWHA 5KI6A 4E2FA 1FFXB 1W0KD 3O1JC 3NYQA 1XCGB 1SD1A 2VT7A 3JQ7A 2BUAA 4QYXA 4TMYA 3A4MA 3W2HA 3QJYA 5I9LA 1VJ0A 1Z74A 3TK1A 1JNXX 3LUGA 2HHJA 3TEFA 2IFTA 3ETNA 5JEDA 1UL1X 4KXWA 4BATA 3M9LA 1UBGA 3ORRA 3Q3VA 4Y9UA 1Z5NA 1G0NA 2DLDA 2QRJA 2SKEA 3COPA 2ZSAA 1HE1C 3PE4A 5TPWB 4AMZA 4CM4B 4DMMA 5B5SA 1E92A 1YFZA 2A9OA 2GI4A 2HQSA 2R1TB 3IAEA 3M70A 3Q9SA 3ZTYA 4RUKA 5LD2B 2G28A 2GM3A 1MOSA 1TX4B 4D41A 2XWSA 4Q9IA 2WNHA 1DOZA 1JTVA 3L49A 3N53A 4JGBA 4LEIA 1KO1A 2LBPA 4R51A 2EFYA 1CUVA 3HCEA 4XX0B 1ECLA 2IP2A 4YHBA 3VOAA 1N9GA 1A8IA 1YK1A 1CVIA 1X13A 5JD3A 5K5EA 4W63A 1JQJC 5EMMA 3BOSA 4PNPA 2X8WA 3HFGA 1HEUA 3DXZA 4KWEA 1K63A 1F12A 1O6FA 3EBLA 3FYHA 1T35A 2V7VA 2BUCA 3C70A 4WXMA 4ZYLA 1FP2A 2P8SA 4XARA 1DNPA 3ETCA 3KXKA 4OMFG 3PC4A 1MJHA 1TC2A 2DF8A 2AL7A 2OYCA 1FDIA 2Z6VA 1JIVA 1ZM4A 4KYTA 1FP7A 1P2SA 4IHJA 4HQLA 4PZZA 1PQYA 1NBEA 4JLOA 2C4VA 3ENVA 5LNK1 2IH2A 3NHUA 4BCCA 2BH2A 4DMGA 3H2ZA 2FN8A 1MAUA 2AK3A 3LDAA 2VCEA 1O5IA 1VJRA 4NPCA 2IU3A 1CUUA 1GZHB 4FOPA 1NC1A 3EXG2 4FXPA 1HETA 3ESYA 4UAGA 1HE8B 4KIJA 2ZRMA 4M0PA 1VE6A 3NC4A 3PI6A 4MDYA 4C07A 2VJDA 1F4PA 3VI4B 1OOEA 2D5BA 2JPDA 3IQWA 4JJEA 4QDOA 4Y9SA 5H1YA 5HJ2A 3TINA 2EHJA 1KFBB 2PKXA 1Q95A 3F67A 1L4YA 2OQIA 1SC1A 3KPWA 4GXRA 4ADSG 2I4LA 2NXCA 4Y67A 5DVZA 2A33A 2CJPA 2Q41A 1QRRA 4ND1A 2YHIA 3NHBA 1GTMA 4Y9TA 1YJXA 2FTKE 5F7JA 2RJOA 4EG4A 3LT0A 5BN4A 1EFHA 4PY2A 3CZAA 5PGMA 3C1AA 5C7LO 4NMWA 4TTAA 2FPGB 3TJMA 2CJFA 1N5KA 2BEWA 2O0LA 2CKDA 4ZI7F 4Q3DA 3RC1A 4CV1A 2LZ0A 3MK31 3Q15C 4QJ3A 4FHDA 2A4MA 2NN3C 3THSA 4P22A 4E5MA 3F6BX 2VDOB 3P9PA 5EI5A 1Q14A 3ECCA 2UZ3A 3C6KA 2A1UB 4CI0B 4Q0MA 1NJ8A 1UPFA 3OE7D 1KIFA 2EYUA 4TSRA 7ABPA 2CUKA 2LCFA 2PZAA 2AOUB 3S1SA 3B5JA 5TGDA 2PIAA 4J43A 4IOJA 5LA6F 1AUVA 4EMSA 1S8OA 3WLHA 2I4IA 4WFQA 1RLUA 1SC9A 3KUKA 2J4FA 5DIFA 4E11A 1JYEA 1FYDA 3QVKA 1R64A 1M34A 1RAAA 2YUIA 3L7MA 3NC1C 4H27A 1FDTA 2GPNA 3PHJA 4MVCA 4G4GA 4KL8S 4QGHA 3AVVA 2D3WA 1FSGA 3V8MA 1BMQA 1YOBA 4QHYA 4WZBE 1YIAA 3WO1A 5LZ4A 1OH6A 3OD1A 1VJCA 4W5WA 1QF7A 5KHLB 1CYDA 1XO1A 3KEGA 5KB3A 2HSWA 3T95A 5L7WA 2JIZA 1PEAA 1SOVA 2OPHA 1JIUA 2FPPA 4HQRA 4N7MA 5G02A 1NVGA 3ZCTA 4MV9A 2HMUA 3TX2A 2HREA 3M83A 3BPSA 4X45A 4YIHA 3CEJA 1YB5A 1G19A 2WINI 4HZIA 4TZ0A 1N33B 1OBHA 5B4UA 2NYUA 5CLFA 1U7UA 3O2QB 1OX6A 3AG5A 3E27A 4XJTA 1Z5PA 2F3PA 3QFTA 3F78A 4BB9A 2BEUB 4JJAA 2PRKA 1F2VA 4JLDA 1FRFS 3LUAA 1G17A 4D9NA 2NTYC 1SAYA 4RLHA 4HEJA 1B0ZA 1Y7TA 1NP3A 3DNMA 2CL6X 2NYRA 3LT5A 4TV9A 4MEAA 3ITKA 4KXMA 2E5LB 2OORA 1NWHA 2Q46A 5C5EA 1WR8A 2LKCA 1JR3E 1W59A 1Y7PA 3WYDA 4KQHA 4B6EA 1H23A 4HN9A 3F1KA 4ARAA 4G3XA 4J91A 4KXQA 1B8VA 2DJ5A 1QV6A 3QTLA 4YJ3F 5FOWA 3RROA 1AMUA 1WETA 4F9FA 5AICA 1Z4KA 2NO6A 3FM9A 3GAZA 3NVAA 1ISGA 4H9GA 1XTIA 4Y98A 4ALKA 4KV7A 4D9FA 4A2WA 2OECA 5AVQA 4Q4DA 3KJEA 2E4UA 3UA4A 2TECE 1BU5A 4M99A 3C97A 4S12A 1IB0A 2VTDA 1U8FO 1XRRA 1Y8RA 2BIFA 2IEIA 5LKAA 4K9OA 4C0HA 1NI3A 2AD5A 3ZCRA 5KVVA 3X1WA 4YACA 3RU9A 1EP2B 2JIOA 1QH9A 2RDMA 4U00A 3EF1A 1AURA 2J3KA 3OT5A 1M1YA 4KVFA 5HRCA 1D2NA 1QAQA 1C81A 3DKPA 4GOJA 1VZ2A 5P21A 5JCPA 1MC1A 5F52A 1TU4A 2C2HA 3KJHA 4PLZA 2UVDA 4L8GA 4CLXA 1P0CA 3KJNA 1NI4B 1RSZA 4LBWA 1ZGHA 2XOEA 3WBFA 3OZIA 5F77A 2OHVA 2J9FB 3ICEA 2F17A 2OCIA 1H2BA 1SH7A 5T4BA 4FZVA 1BFKA 2WNSA 3FE2A 1E2UA 4MQMA 2G9VA 1BA2A 2H1RA 2VRNA 3SK0A 5IANA 2DUJA 2Y1OA 4WERA 4TQUS 2NU8B 1ACJA 4H31A 3UK7A 3RCBA 3ZJ5A 4E03A 4LHEA 1UDBA 2ZYTX 1WU8A 3CKMA 4EHFA 1XMOB 4ARSA 1T3SA 2HW8A 4ZHQB 2XGOA 1P0FA 3DKKA 4B0OA 3T52A 4ARIA 1XVLA 2OGTA 5HJ7A 3TGPA 1L1RA 2WM2A 1E8MA 1Q0LA 4CW7A 5HIIA 3LX5A 5HQ3A 1E8DA 1FVOA 3R6LA 4BN4A 1QHEA 3BMOA 1WIWA 4G9GA 1U3UA 4M9ZA 5FLYA 3J7AC 1NXSA 2V7WA 4P7KA 5KNDH 4QX6A 4WCFC 3OBIA 1P75A 4FHEA 1I6MA 1Z73A 3CIOA 1BEEA 3VZSA 5E3HA 5FOQA 5C46F 3I42A 1CCWA 5HE9A 1D8AA 3BB3A 3C14C 4BFLA 5B57C 2DFKB 1COZA 1K4YA 1RKQA 1OFVA 1LNZA 2IY7A 1DHRA 2VPPA 4ICIA 2WYIA 2O2JA 2XMQA 3DAYA 3PC7A 5ALQA 3OOYA 1I32A 5ALSA 1XTBA 1DAPA 1XZIA 1Z29A 4WNAA 2MMCA 2Q9AA 1S96A 3P0IA 2P2YA 2JJ1A 4IDAA 3RUIA 1CRLA 2L0XA 3VMMA 1R12A 2XE4A 4O4LA 2WWIA 3CNOA 1KNQA 1R4MB 1Z12A 3AIMA 5REQB 3SZLA 4Z8XA 2VRCA 2ZGVA 3KJQA 3KB8A 2ZZNA 4ENUA 2GN0A 2Z9BA 2EBFX 3FNIA 1M1XB 1G20A 1L6IA 5EUQB 4EFLA 2IQ5A 4A8JB 4KK3A 1OPRA 5JC8A 3LK7A 5H5JA 1CDZA 3ROPA 3CUVA 1HC7A 1SPBS 3OT1A 4JDPA 1S2GA 3ANLA 3AHHA 1IOVA 1US8B 3OJOA 3P1JA 2G4LA 4GP6A 4OAPA 2GHRA 3BF7A 2HDOA 4HCJA 4J1QA 3TDNA 3B78A 3IPAA 2BHTA 4LRQA 1JJIA 3AV0B 5TF4A 2IYQA 1WSDA 2ZSKA 1Q1QA 4Q7QA 3PQ6A 2OC4A 1IXSB 4CNBA 1YE3A 1EWRA 3AZPA 4IIYA 1RHRA 1L7AA 2OILA 3WLKX 1Z0JA 3AHEA 3IUBA 1AA9A 1CUJA 1ENOA 3IIMA 3L8HA 4D4HA 3DKIA 1NE2A 1Z6PA 4R0VA 1E6MA 2V0GA 4GGPA 2ZBPA 4IWYA 4J2TA 2O2CA 4R7TA 3JATA 1U8YA 2GPTA 3CNEA 1U8AA 4TGLA 3SAJA 4KRFA 1OBCA 1BN7A 1WSAA 4GECA 1O6BA 3MLEA 3L40A 1MA3A 1Z06A 5KTSA 4O4LB 4QVKA 1TKCA 2FN7A 2J5BA 2JHAA 4B3HA 3CRVA 1XDWA 4BNXA 1DAHA 5I9MA 2RCNA 2E87A 2D0PB 2C59A 4IJ5A 1ZHFA 4YPFA 3OIUA 3ZX5A 5I9BA 2XMGA 1UIMA 2HA3A 3F3YA 3FWNA 4PFKA 4PYQA 1E2GA 3GRPA 1J1IA 3FVTA 1ZN8A 3JV7A 3QE0A 4G5RA 4MR8B 4H1WA 3LQ1A 4QM7A 1CY6A 1O89A 4NBUA 3N3BC 4LFCB 3U7JA 2Y1FA 3B20A 2W4MA 1RM0A 4HDMB 4JC4A 4KO3S 5K6TA 3MCTA 4AN4A 5CA0A 5BVGA 2NZ8A 3MGGA 1Y5LA 4K88A 4P80A 2H4WA 2RAFA 4MOWA 4XDHA 5JLAA 1VL0A 5HQ3B 3QXJA 1AT1A 1Y5NA 2HJRA 3LC2O 4HI0E 4BUCA 4LJ9A 5LDDC 1RZRA 2A92A 4GKVA 1BXGA 4GPZA 1ID8A 1FLAA 4Q4HB 1WNTA 2G1UA 4TZTA 5H70A 5LFAA 5JY1A 4RA6A 3FKSD 4INOA 3RUPA 1V35A 2EQ5A 3EZLA 6CHYA 1I4EB 4L5YA 1ZXLA 3MTBA 2ZXEA 1VJDA 1T2FA 3GLFB 4I1OA 4HKTA 2AFHE 4A6EA 2FMUA 3D81A 4DV3B 1JAYA 3UCFA 1YI1A 1G8KA 1WABA 2K7ZA 3N05A 4RPLA 2C3UA 2QG9A 4ONEA 4GF5A 3BGWA 3SR0A 3TXAA 1NMSA 3AHJA 2B21A 2HU7A 2RC5A 3K1AA 1F1JA 1M1YB 2AC4A 2QD5A 3QE4A 4JZKA 1RE1A 2ZTMA 4O5AA 2VDLB 2XXJA 2XEXA 4K9LA 2XXAA 1Z7GA 3AKYA 4YX9A 3HYTA 1U1IA 3R0JA 4ZZ3A 5IM4A 5I9IA 4IS3A 5ALVA 2ZRLA 1EQ2A 5THKA 1YGPA 3HO8A 4HEA1 3TL6A 3FYUC 1ZUD1 1RVV1 3PXXA 5KJFA 4N0DA 2FPWA 4HV4A 5DZSA 1BSVA 1KJWA 1XCBA 5DHPA 4C14A 5BUQA 4YROA 4GM4A 4IY1A 3ZWMA 3AJ9A 3CX4A 3V4PB 1W87A 3CA8A 3KOUA 3WYBA 1CY0A 4IGAA 2R5FA 4M2LA 2ID8A 5GZ6A 4EELA 2BGMA 3A4LA 3ANSA 2OCKA 3LBFA 2VF4X 4QBGB 3CEHA 1DCTA 1X7DA 1RJGA 5AI0A 2HHLA 5TPZD 1CUYA 1HT3A 2VNKA 3BK2A 3BGIA 4MIKA 4PNEA 1T0UA 4HXYA 2EP5A 5CU7A 2REBA 2YVAA 3D2AA 1BX1A 3PQ7A 4Q47A 1FW8A 1IHDA 3NJ4A 2H4XA 2ORED 3JD0A 5A02A 5LJIA 1KYVA 1MABB 3H0KA 1NRIA 1P5FA 1BEZA 5CX1A 5JCZA 1WEKA 1FNSA 1RRMA 2Q3LA 3KALA 4YXFA 1HTTA 4X7RA 3IUMA 1RIIA 3I5YA 4RFVA 1UDCA 2ZIUB 4MWDA 4OAOA 5IX8A 1MUUA 5HSGA 3ZU2A 2IF2A 3DM9B 1V8PA 1XD8A 1LFDB 2P9EA 3EGEA 3G9UA 4OK5A 4B47A 4EEKA 4U1RA 3CSDA 3REGA 2F4VB 2BW0A 3QKRB 3ND9A 1QK4A 2PV0A 4DV2B 1WXXA 1RI4A 3MHPA 3O31A 2PZKA 3N8HA 3U4CA 5BN5A 3LL4A 1ZYUA 3ZI4A 2EXXA 4JUIA 1TAHA 3IC5A 3I32A 4UUBA 1QMPA 4D02A 3A6EA 5KYYA 4KU4A 1NRJB 3TOVA 2XOKA 2IVZA 4HG2A 5HKOA 3SXJA 3OF5A 3P4YA 1YR1A 3WL6A 4KGVA 2CHFA 4MP3A 4KYVA 1HE5A 3T4UA 1O97C 3L0OA 2VJMB 1OI7A 1PNVA 2FFRA 3PEUA 4TMKA 3TZ6A 4BQNA 1E98A 2XNDA 1H05A 2XUDA 2LD4A 3BD7A 3E1SA 3IP8A 4ZP1A 3V4VB 4AF7A 1EE9A 2PU5A 4NFHA 5JSYA 2BGIA 2NIPA 5FBKA 3UJNA 4G37A 1NQTA 3HLTA 4NV1A 2HK6A 3MTGA 4JLWA 1RBYA 4D98A 3D6TB 3UMFA 2FSSA 4NVRA 4F4UA 5C1OA 3VR1A 2QGNA 3IH5A 4NEHB 4UEQA 3S70A 3WIVA 2C9MA 3CXUA 3TXYA 1TYCA 1XN1A 1YBFA 2QQEA 4N01A 4C0WA 4PZ9A 3KNZA 4XUDA 3T15A 1BO6A 1NMQA 1XZGA 1FQWA 2H92A 2ZRDA 4KLZA 2IE8A 4ACBA 4AZSA 1OLXB 1Z33A 4ZODA 4FYIA 1RRGA 4G4IA 4P4SA 2QLMA 1J49A 4OL9A 3CN7A 2HRCA 1DAGA 3HCNA 4WOCA 5BN4B 2W71A 3ACBA 4A10A 1YS9A 3KJGA 4AKGA 1K6JA 4BTEA 3GG2A 3OQHA 3O95A 3TIFA 1VJ1A 5KWEA 16PKA 2Z1DA 2FQQA 3JAMA 4C7OB 3I34X 3LXMA 2AZXA 5CFZA 3GHYA 3K6SA 5BORA 2QL5A 4EAQA 1WMEA 5EJGA 1JRLA 2CCKA 4IR7A 5B7PA 3K0CC 4DUYB 2QORA 3AGQA 4R2KA 4KE7A 4CZ2A 2WE8A 2MSCB 1TLTA 5FBWB 3VJLA 3B6MA 2FWJA 1G5RA 1ECCA 1EXWA 2QY9A 621PA 4BFCA 2NU9A 3ETDA 3TZLA 4CJXA 2B8TA 3IAM1 1WB9A 3MXTA 2XI4A 2XQFA 1VHTA 2WHQA 5GM2A 2O8NA 2Q2VA 2ZT5A 4LTDA 4DDMA 3BIOA 3RQIA 3VPGA 4WLFA 2J3LA 4NPHA 5C81A 3GA5A 1VM6A 1W2GA 1RJ9B 1FTGA 2YV3A 3TVYA 4C21A 5LD2C 4MB0A 2XITA 3MHTA 2B2NA 4NDZA 3ZI7A 3AMVA 5TS3A 5EE9A 1EX6A 1SU6A 3NT5A 1JIKA 3OQJA 4DABA 1NQVA 5HZKA 4DANA 4C2TA 4XASA 2DFVA 4F3CA 2XW6A 3PBKA 1P4AA 1Z68A 1N9GB 4YCMA 4RGBA 3H04A 1G7SA 2C4WA 3L0BA 2AN9A 3L7IA 2FN9A 3VH4A 5JO0A 5KYTA 1JECA 3SHQA 2ZBQA 5L6MB 1T3LA 4HGPA 1ZUNB 1TLLA 1KEKA 2DG2A 3EVFA 4RY0A 2QF7A 2HSGA 1BIFA 3AVUA 1T8YA 2E89A 3L9XA 1A9OA 1YBVA 4RF3A 3FTEA 4KTVE 3A9WA 3PFKA 4B76A 4IXWA 3ROKA 1DAFA 3TD6A 1M6HA 2CEAA 2QR2A 2XMZA 1CS0B 4DMCA 5FV4A 1AS3A 5IZ4A 3IUPA 5KREA 2Q5HA 4RZXA 1J20A 1TE2A 2QUZA 3BFJA 3ESBA 3G9XA 2VQ6A 3EW7A 3K31A 3T54A 4KAAA 3EPLA 1SELA 1EDDA 4WBXC 4KQ1A 2V7UA 1SG6A 3O8NA 2VP5A 5TQ0A 3FDIA 4G5HA 1JDNA 3OEEA 3VKHA 1NFFA 3Q0TA 1T24A 3EDRA 3BDIA 1N9ZA 2FAXA 3DBVO 1V8ZA 1YB6A 3T3NA 4BDSA 4KX5A 1ECFA 1KSGA 3UMVA 2XSZA 3CZ5A 1SXGA 1WOYA 5LU8A 4L2IA 2DM6A 4E12A 4KUHA 2FWRA 4N7BA 2PYIA 4ZANA 5FI0B 4DAEA 4PX2A 2P9FA 1DSSG 2NWQA 2W7TA 3CLUC 4K03A 4EDHA 1W36C 1FMCA 2GJ9A 3QBEA 5D3ZA 2AXEA 5LQKA 1L8LA 4IRMA 4LXTA 3AUYA 5BQFA 1NMYA 4DM7A 4FHGA 1KI1A 2ONCA 2R6GA 1TVKA 1UT6A 3KQWA 3RWBA 1FFCA 4LCBA 3U5TA 4F11A 4B6JA 3EAQA 3GXBA 3CLHA 1ONOA 4EB0A 1QQ5A 1SB9A 3A0UA 3R41A 4M1ZA 3TQIA 3QUSA 4GMFA 3K53A 1G6KA 4RAQA 1JHPA 2JJYA 2AFHB 1ZJ5A 3B1ZA 3N74A 2GKOA 1RC8A 3SSNA 1IZ9A 3FKSA 2A0WA 3JQFA 5CEJA 3GLTA 1O8CA 3CCFA 1U0FA 4YRKA 1T1IA 2GPJA 1MVLA 1BVUA 2BDUA 3ESZA 2JZOA 3R5TA 3MN1A 3L8YA 3ET5A 5EVJA 4RH3A 2QPLA 4PRLA 1EFPA 1OGJA 4I50A 4UMEA 5JSKA 5EP3A 2VYVA 3COYA 3CZRA 1T1JA 4ABTA 3N2KB 2QLJA 1P3Y1 2J5XA 3K8YA 4IXMA 4UPDA 5THXA 2XDQA 4I55F 4FR5A 3CJQA 1NVVR 4UNRA 2Q6OA 1XJCA 4PX3A 3D1JA 4UD2A 4GRIA 2PUGA 1U3WA 4JI8B 1CRPA 1W76A 1J0CA 2CFRA 2XZTA 5TJ9A 2PX6A 1JSCA 3HBMA 3UAOA 1NNLA 4PBSA 3GD7A 4EL5A 4XB6B 4RETA 5HP4A 1KH2A 2QSJA 3FTDA 3NXSA 1LZLA 1Z7YA 4QARA 1E4OA 3EIXA 3HACA 5EMHA 2IEBA 4Z6KA 3B6JA 5JH7B 4JIGA 2R47A 5JEEA 4XGIA 2WWRA 1LC0A 3KWFA 4M1OA 1HI9A 2B34A 2YZ2A 3G8DA 3W8FA 4RCZA 3ZOZA 1I33A 1XZKA 4MCJA 5LP1A 1F1BA 4M0KA 4QEDA 1YRBA 3UANA 2HJ9A 1E1LA 5KJ1A 5T41A 3EC1A 3ZBPA 1DX4A 5HRUA 3DTTA 1PRYA 3A3OA 4JMLA 3H9JA 4TQ9A 3A2KA 1KK1A 1WP4A 3EQ7A 2F3QA 2YV1A 3RB8A 4K7JA 3JSAA 4OJMX 1VCMA 3RSHA 4PXYA 4WNCA 1YWGO 3PXBA 3CR3C 1U2DA 4HRAA 4QOFA 4WUTA 4RD0A 1LD3A 3GY0A 4B33A 4DCPA 1H93A 4DT1B 1A04A 2O5CA 1L8OA 1ZIXA 4F2DA 3F6SA 2VOJA 2QM8A 2J67A 4KQKA 3HKCA 1WXIA 2HA0A 4KQFA 3P9KA 2ZETA 1KPHA 3WL8A 4GI1A 4NBKA 1UP7A 3SCZA 2P91A 4LJAA 1QFXA 1QOPB 2MYTA 3RSSA 1TIPA 3THWA 4MWGA 1WBBA 4QAJA 3LLSA 1RCUA 4E5DA 1YJ8A 3AVOA 3ICCA 2DETA 1ZBDA 2PX4A 3O5AA 4IG9A 2IDMA 1B1CA 1BGVA 1VDMA 2BGKA 2QTLA 2VOEA 4FQ5A 4UXIA 4FLMA 1RRPA 4R1TA 2OGUA 5ER9A 3B3FA 1RQLA 3L43A 3VR6D 4C04A 4L85A 5CCDA 3S4YA 1R6DA 1GA1A 2R6HA 3G2LA 3JAKA 1ONPA 1V5EA 3KL2A 4ZVSA 5HTKA 3VDRA 4ACAA 4MUIA 3OOJA 1MW8X 4HDSA 3KLNA 4YREA 1W75A 2W2MA 2Q4EA 3PYLA 4C0QC 3WAGA 3H6KA 2PKCA 3T5GA 2H00A 3DMTC 1N0UA 2GAJA 5D7BA 1O96B 4M0DA 5DTRA 3AI7A 1V11A 1V3QE 3D43A 1AGYA 2QS9A 1U7PA 3MB5A 3KB2A 1YDEA 4KPUA 3U3MA 2QN6A 2G08A 2W48A 4Q9JA 3I6YA 3RFXA 2QAGA 5KQSA 1FFBA 3G2HA 3H19A 3DZFA 1QS0A 5EKDA 4ENWA 3SSMA 2IUEA 1BNCA 5HK8A 3GMTA 4NBNA 3LA6A 1RWNA 2WWXA 4MMXB 3O38A 1ESZA 1QGOA 2W2LA 2YIVX 3A6JA 4FZ3A 3ELDA 5T6BA 2YDYA 1YJBA 1M67A 1FJHA 1PT6A 3OIDA 3WHLA 1FQOA 1R5BA 4KFSA 3A6DA 3JQGA 2R1VA 4MGHA 2QE7A 3TDKA 2Q2OA 3A1NA 3FZQA 4MPPA 5HX7A 2FW0A 4G85A 5KMGA 4KLNA 3GEEA 4Z7JA 3E7WA 4UU1A 1I7SB 3JD2A 3WC4A 2ZRFA 4JC8A 4LX0A 2NV2B 4OBBA 5DPMA 5TQ2B 1JFFB 1T8TA 2X9LA 3B36A 5SY4A 4A8JC 3N5CA 4HSGA 2QR3A 3SQNA 3TTWA 3QEKA 3ZGXA 1TMKA 5ALLA 1T43A 1R5NA 1ZRNA 2RSLA 2IHZA 4RVOA 2RCYA 4E0BA 1JAIA 5CEFA 1LBEA 4BO4A 2KE5A 2EKDA 2BFAA 2J87A 1BWSA 1RYHA 1UEIA 4DMLA 1XNQB 3GJRA 2ZJFA 2B6NA 1XPRA 2ZWMA 4RPKA 1UJ5A 4G2TA 5JHGB 1YZQA 4JR0A 2OC9A 4Y6OA 1LEHA 4FT2A 3RYIB 3WS7A 4FYXA 3ZR4B 4NIMA 1R9JA 4IHAA 3ZE0B 1SFRA 3C3CA 5F9FA 4CKEB 2P6RA 3IO3A 3BMNB 1AKQA 3UJ9A 1J25A 4L5BA 1VB3A 2WD8A 1VSBA 3MLAA 4EY7A 4JYZA 3ZVKA 3TE7A 2Z9DA 3OT4A 2AN3A 2RHRA 1XTPA 2WLTA 4D6PA 4P82A 5DNYB 1LBQA 4GC5A 3ZWBA 3N7AA 3FKQA 1SXJC 1HQYE 1OD6A 2ZR8A 3B1WA 4HB3A 4WESA 4UPEA 4YRNA 1AQ6A 3AG6A 4AMYA 1OI4A 2WIDA 1SU4A 2YRXA 3L0IB 1H0HA 2ZKIA 2QZPA 3JSXA 3R5KA 4KR6A 3EG9A 3MF4A 1JAZA 3TCKA 1YUMA 3ONWA 1P3DA 1ADBA 4YXWA 4RV5A 4E3WA 3ZIAD 3WOHA 2P4SA 3F1LA 5JMWA 2VLBA 3HDVA 3BQNB 1FSPA 2NW6A 1YIOA 1TOAA 3FZYA 4TOIA 3I0ZA 3ZVNA 1FSSA 1VRVA 2EZ9A 2PKRA 3LO5A 4DDVA 4PPYA 3IXMA 1W9MA 5DGTA 5TE9A 4DRXA 1OC2A 1R0CA 2ZTHA 4OQPA 3SY8A 3P2IA 1YDWA 5T67A 2PGXA 4M37A 2FMFA 5F2OA 3OA2A 4JOCA 1CHNA 5SV2A 1RP1A 4WY2A 3TWOA 2RH9B 5B64A 1NYLA 3PT9A 3LCUA 4N3AA 3SBEA 5KYVA 5HR5A 2XTAA 1EUQA 2B6HA 4KQ2A 1EXDA 4EFMA 4GMDA 1DE0A 1I0LA 5DISB 3DAPA 3GJTA 1BDMA 2YX1A 5AJZA 3O8DA 3NP9A 4EW3A 2QTVA 4GMXA 3JW8A 4U0KA 1E2NA 2GGSA 4RELA 5BV2P 5HDQA 3GH1A 3BGOS 4BMOB 2AX3A 3CH4B 1N5DA 1OW3B 1J9EA 1PDWA 1CF9A 4NU8X 3LW7A 5CM2Z 2OEPA 2CD7A 1I3LA 5IUKC 5C3UA 2CJXA 4MYCA 3ROEA 3AP1A 3LQQA 2ZSDA 1KDTA 5BNTA 3EQ8A 2F1HA 4P7BA 4PWYA 4QULA 4X20A 3T1TA 3FVVA 2B30A 2AGVA 1ZW1A 2J45A 3HL4A 4NZYA 3ZNNA 3ADBA 3OOWA 1N2CB 3ZJVA 3ZHYA 1XTKA 2C00A 2QZZA 3R9IA 4MHTA 1K89A 4YJFA 4RC9A 3GGJA 5BRJA 4YCCA 4WZAE 3TQQA 4CFSA 5TGTA 4M7PA 1L9XA 3LLUA 1TA4A 1U9JA 2W2XA 1XEFA 2Y6UA 3A4YA 3PPVA 1EWVA 4RIIA 4Z7OB 1L8XA 4I55A 3MCZA 4L4UA 2FX3A 5BSFA 1EK0A 3A4TA 5CLHA 2BISA 3EXG1 5AXBA 5KX5F 5CT5A 5F12A 1ZD3A 5KTPA 1ZHOA 3HP1A 3WJ2A 3W5VA 1CD5A 3A9UA 1BXRB 2YZKA 4AMBA 5JT1A 1XNHA 1LXCA 2J30A 3KTAB 3V8RA 4RX1A 4JLMA 4AP6A 1RP7A 1WB5A 1Z45A 3H9UA 1NSYA 2W6JD 2PUDA 3RYHA 4JP8A 4QTTB 2F3UA 2VQDA 3DO5A 1SHTX 3W34A 4TYMA 3NDBB 3GFQA 1PV4A 4QT0A 4N4AA 4MR9A 3F5MA 4B3FX 4BGDA 1OAOA 3RYCB 1WKCA 4X9XA 1DQYA 1TM4E 5HZGA 3AESA 3GMIA 1Q22A 2OLJA 3AWIA 4C29A 1JDBC 2FG6C 4EKYA 3G5TA 1HNZB 2KMLA 1YQXA 3A3YA 3T4EA 3PL1A 1H69A 1G4HA 2ZQ5A 3PWZA 3AR9A 5FTKA 3OCUA 3VO8A 5L51A 1I94B 1WXEA 2Y1WA 4OP2A 4BFUA 1YRYE 5BXQC 1R0WA 4HZGA 4CFZA 1KAOA 1NVWQ 3V46A 5TSDA 4DZRA 4DR3B 1QYXA 2QW8A 1XWWA 1NA5A 3CLTD 4LXQA 1SBTA 1UKYA 2J3IA 4IDFA 4WKNA 1F9AA 4KITB 2SHKA 1ADJA 2ALJA 3AB8A 1ML4A 3MERA 3OLQA 4MB2A 4N5HX 2ASEA 4Q3EA 3K4QA 2NVBA 3PTLA 3RVDA 1GG8A 4CWAA 3IOMA 2FWAA 4PIPA 1QCCA 3CVOA 2ID9A 3G7UA 1SUDA 3QJGA 5BSHA 3AVPA 5THQA 3T35A 2ZUUA 3MW8A 2PX3A 1O77A 3WB9A 1HL3A 3V9PA 1Z4LA 2FMXA 1NBAA 3D7RA 3GJXC 3IUEA 2HCJB 4J75A 1M6VA 3HCPA 1SIOA 2GSWA 1UQUA 1E9BA 2WAYA 2X9GA 2NQTA 3B2QA 4OUDA 2ZSUA 2FKAA 3VU0A 3S68A 1QBGA 1C9MA 1Z0IA 1V43A 3EBPA 2HK9A 4RVSA 5LZ5A 4ZYWA 3DFZA 3RGWS 3DWFA 5CIYA 3EHDA 4R9NA 1K8XB 5KX5B 1BGWA 4O8CA 4FWBA 2DPMA 3GNSA 2C96A 5G53C 5LA6A 1II0A 3W2EA 3ZHTA 1R7RA 2XCIA 1NQOA 1WUJS 2QRQA 3BL5A 1Y8QB 1ECGA 3C16C 3DAHA 3GFSA 3GVCA 1JE1A 4WGGA 1P45A 5CYPA 1AS0A 4WZBB 1YCHA 4CYMA 1ISSA 4GR4A 2VBCA 4IIDA 2VYND 1D4ZA 4TL9A 1D3AA 4RLFA 3GELA 2PZGA 4GPAA 5BMVF 3LFUA 3UT0A 4GSYA 1YL7A 4TVKA 1G7CA 7REQA 1IN4A 4CG2A 1U0RA 3DEHA 3UWSA 1DMSA 4CMIA 2PA0A 1Z07A 3C7KA 4EZEA 1SA0B 4QG7A 2YV2A 1A4RA 2HU2A 2RHWA 5FL7D 3SP1A 3DMRA 3NHRA 3KTOA 4BJ3A 2AFIA 2XRMA 3L93A 1SUAA 3QOWA 4EHHA 4IJ6A 3Q0EA 3AFOA 4KPFC 3VU3A 3W5HA 1M8GA 3LDFA 4FONA 1JS1X 2X6QA 2DWQA 3L8EA 3MMZA 4L72A 4UVIA 4CKWA 5HKAA 1V7CA 4W5HA 4XWKA 1G2OA 3GFPA 1S2IA 3JZDA 1SBZA 1Z0ZA 2GXQA 1Q0QA 3I01M 2BFPA 4MARA 4HDKB 1TYAE 1JMVA 2WI8A 1LVUA 3L02A 5FPKA 3RHFA 3PGLA 1E1RA 4P7FA 5K3FB 1U7WA 2B1QA 2V7QD 4BNLA 4O0LA 2IV3A 5JQGF 1E62A 1XKQA 4AYXA 3OFNA 4XE5A 2IYXA 1QGAA 5IXSA 3FUCA 2WIGA 4LOJA 4X85A 3L6OO 1ZZGA 5IAGA 4JX8A 4P4TA 3DUFA 1OBFO 5B55A 4HPWA 4C0SA 1QR6A 2IC5A 1WHTB 1GTL1 4Z7QB 1KP9A 1GWNA 3EBOA 1ZCAA 2X13A 4FFDA 3SX4A 1NJ1A 1EUCB 5I7HA 4N5NA 1Q3TA 1A95A 4IX9A 3S2SA 1FU8A 1I1HA 1P4GA 1FXWA 2B9VA 3HV0A 1K3TA 3I09A 4XPIA 2NU7B 5KQMA 2DUMA 2NO4A 3UWMA 2G80A 4C1NA 4EJFA 2R6AA 1FX0B 3CSUA 1CY8A 4HHEA 4RKYA 3VKUA 4EB6A 1P61B 4L8WB 1OLUA 3ESAA 3FUTA 5FOXA 4HY3A 3AEUA 2PWAA 3GLGB 1OFIA 1QE5A 2KPOA 2GZDA 4LZOA 4OU4A 1KE2A 4F9EA 2GCGA 2L69A 2P2NA 2WUFA 1X1SA 1YKGA 4U7PB 3ZIAA 2KI5A 3C5CA 2FH5B 3W7BA 4OB8A 1QRDA 4C6TB 3KB6A 3JRNA 5IHPA 3TR6A 1W0KA 2GCNA 5AHXA 1RRFA 4MITA 4HWSA 4TSFA 4D80A 2JFOA 1JGTA 1OAKA 1HZZA 2ZDHA 4OJYA 1KAGA 1CQJA 1N2BA 2WWWA 3IP5A 2W2KB 3ABIA 2Q3DA 3M6LA 4Y2UA 3EPRA 3C3BA 2O2ZA 4BO2A 2XUJA 1OB5A 2QMOA 1YCDA 3A3KA 2PL5A 3PC8C 1RAIA 3S27A 4UE2A 4MA5A 3ANXA 5AKHA 1SUSA 3W3ZB 1ORHA 1MZPA 3EQ6A 4ASUD 4JOBA 3OOEA 4WBSA 4KNWA 4HRXA 5IBPA 2WBLC 1CZKA 3P9IA 1NBME 2ZDGA 4MA4A 5JW6A 3R4CA 2P90A 4MXDA 4Q3CA 2C3OA 2Q5CA 2VDMB 2A30A 3N1UA 3A0RB 4Q7KA 2GEBA 4FLFA 4QEKA 2BBTA 4CTMA 2J3DA 2Z0MA 3V4RA 4KH1A 4RK1A 4X95A 5EC8A 4BVAA 1M2HA 4YI3A 2JLAA 1QCYA 4GP7A 4TRRA 3THXA 1PAUA 1H1LA 4G9BA 4XKJA 2Q45A 5CVVA 3RBXA 1EFKA 2I22A 2QROA 5JARA 5JJCA 4YT8A 3LAWA 2HRZA 2I2FA 1VIAA 2R1UA 2F2TA 4K46A 7ADHA 4RZUA 4NBWA 1GG2A 4ITVA 4WTOA 3W04A 1LPOA 1JHUA 3INNA 4M38A 4P1ZA 3X0DA 4B1FA 4MZDA 1T0BA 3BJRA 2COUA 3IOEA 1QIMA 4ND8A 3HVRA 5ALDA 3IKLA 3D6FA 4BMZA 4YLYA 5LQNA 3BGSA 2WQZA 3DMNA 1B4DA 5KIAA 1M66A 2BM1A 4RVFA 5B6PA 1B6SA 3EZ9A 2EG9A 3OH8A 4CODB 2R8EA 1O5TA 2J09A 3JASB 4HQ0A 1QE0A 2BR3A 3RFUA 4I6EA 2QU7A 4KZKA 4DCOA 3ZWKA 2BGNA 3E2PA 4F2PA 3UICA 4DLNA 1P80A 2QTFA 3U44A 4X93A 4ZCSA 2R00C 1FX1A 4RD4A 2F48A 4X54A 1C4OA 1P77A 4KN5A 3QYPA 4YAWA 1OHHD 1NNI1 2FZ5A 3RAGA 4QFDA 3HMKA 2FPUA 4CM6A 1IXRC 2PMDA 1A71A 4H6XA 1WVIA 5JSFA 4MUFA 4LYHA 1KQNA 3NHFA 1JFSA 1QIJA 4R40A 3U4HA 3GO4A 2WJ4A 1GTSA 4YUWA 4QC2A 4G0VA 3IEUA 4Z86A 2BFCA 1I5OA 2MYPA 1DIAA 1W88B 1YONA 3P8ZA 3R3HA 3SHVA 2ZAOA 3EGCA 4G5QA 3COJA 1NVKA 2UZ1B 1OA1A 3G0IA 3K92A 3IVRA 4HS4A 4OHCA 2JGDB 5EJFA 3NTXA 3LNTA 2F9LA 4PXAA 2G9ZA 4AY3A 4ENSA 5KKCA 3WL7A 3ZQ4A 2J4DA 3NJ8A 3PHBE 2QVGA 4U7TB 3I1YA 1C9NA 4U2BA 5HE8A 4AUEA 1R5JA 1N6IA 3D8SA 4P3YA 1QV7A 2GCOB 4RIGA 4RKEA 4RHYA 4G0XA 5F64A 2P0YA 3I6ZA 4Z54A 1X7WB 4HNAA 1JIJA 4LJ4A 5F1OA 2YWXA 4R2MA 4YRZA 4G36A 5ENZA 2IXEA 3GCWA 5J4HA 4Q1BA 4JL6A 3GZNB 2J9YB 3R7BA 1WXGA 1P7VA 4IZOA 4ZAGA 3UT5A 1B43A 2WT8A 4XUCA 1KYYA 4GE3A 1EJ6A 4Z1MD 3BB4A 1UH5A 2C03A 4R1QA 3RJMA 1C3LA 5C52B 2OD9A 2IYPA 1QPZA 3EZYA 1PBTA 4S0ZA 2PS1A 2WYHA 2V9ZA 1DV1A 5DI9A 3HHPA 4D3ZA 2A0KA 1JG3A 1ICEA 5AHKA 3E1KA 1M1YE 3RTBA 3C6YA 4IIJB 1F8YA 4U6SA 5DYYA 1G5HA 5A9TA 3TRKA 2IUTA 1UOEA 3IAUA 4EX6A 4H7IA 4B7AA 3BFVA 5GONA 2W6ZA 3VNRA 1GEGA 3AJ8A 3G0GA 1CT9A 1XLWA 3OC6A 4TWBA 4BV9A 3B9QA 4DF3A 5J23A 4AZVA 2QEQA 2NSJA 2ZCVA 3K6RA 2C8JA 1QLHA 1N6KA 2EJCA 1CNEA 3VDQA 2Z2KA 4IDHA 4LMAA 3KDPA 1Z2DA 3VR3A 5JNWA 1RQ7A 1FZTA 3VPBA 2QE7D 1N8SA 1FDVA 3EXEA 5AP9A 1JP7A 4CKYA 4EG3A 5EZYF 1EIWA 3OMWA 4FD3A 2OBYA 3ZTTA 2VT3A 3C7CB 3NWPA 3HSSA 1JU4A 3C8ZA 2PWPA 3GVPA 1W1IA 3NEAA 1OWOA 3LPDA 4TXJA 1SB8A 4IGFA 1ACLA 3SYMA 4GI7A 2QQ5A 4J2HA 4CIYA 3RAEC 3H6GA 1KF0A 4NZOA 2D1TA 2IEZA 2PUVA 1WMSA 2XWPA 2QRVB 5CPFA 3QBVA 2QBYB 2IT1A 4L9AA 1CR6A 2ZPAA 1MH1A 3ABSB 2P35A 5TC4A 3TLJA 5C32A 2ECOA 8ATCA 3ANYB 3L41A 4UNIA 3OJFA 4AJJA 3RFCA 1S1CA 2C58A 3D9QX 4BL5A 3PQ5A 1KZGB 4HLNA 3UC5A 3BMQA 3KQHA 2P4HX 3IRVA 3NS7A 2CFCA 3ORSA 1V95A 4CM8A 1PUXA 4KQIA 3WGKA 1QFZA 2HT6A 2IF0A 4I3HA 2H08A 1KDYA 5ARDA 1KMMA 5U9CA 1ZJWA 1KJNA 1EFVB 3ZWCA 1ENYA 4PZCA 3P96A 4TMVA 1NJ5A 1ILEA 1P18A 2P9JA 2NAFA 5CPBA 5I4IA 2LW7A 3IIEA 4YH1A 4C87A 5CNJA 5IN4A 1QWSA 2PDAA 1QKJA 1VBKA 2XYPA 2GJKA 3K72B 3H5WA 3PQCA 2PU7A 1GZDA 2D1YA 2A1TR 3Q3JB 3U62A 5JFGA 3DZDA 4RFSB 1FU7A 1QH1B 1VYVA 4IZIA 4YLGA 4RJIA 3K7EA 1YZGA 1NVBA 3T7RA 4YRLA 2EGGA 1HYGA 1J9GA 4V3CA 3GFTA 1TYZA 2HSJA 2YYAA 1AVTA 1BE8A 4HDNA 4OHKA 4UHCA 4I3FA 2NUTA 3B5EA 4XQ0A 3WZMA 5CDGA 1Y4ZA 4TLDA 1C0EA 2F1JA 4TROA 2WJZB 4M21A 1F8GA 2VTEA 2VJLA 3FW1A 2DQKA 4DLWA 1IOWA 1SKAA 2W6MA 1AN0A 4KODA 4YV2A 5KYNA 2HNAA 2XIJA 1BEUB 4MGYR 3S5JA 4PG5A 4D45A 4RVDA 3V6LA 4C4RA 1GP2A 1N1MA 1IN7A 1UMCA 3U09A 2FLWA 3KXPA 1ECPA 3MIZA 1YOVA 2B1GA 1C7ZA 2B4QA 1XDUA 3EZGA 4IMIB 2VO1A 2WW8A 3FOBA 3G5LA 5C1PA 1ID1A 1T9GS 3CWZA 3C6ZA 3IQGX 3PNMA 3FVWA 3NMUF 3JRXA 5AW6A 1RCTE 3KQLA 3IJPA 5FTWA 3WK6A 1UANA 4TL6A 1DEHA 3WOVA 3WMEA 2FUNB 3AF3A 3IEKA 4TV9F 2WU8A 5IXJA 3L7JA 1I9CA 1Q0UA 3II6X 5AM5A 3CGGA 4ERXA 4M9QA 4HYEA 4K6OA 4F3TA 1G5FA 3AKZA 4LZJA 2D8MA 4HLUA 3H9BA 4L4RA 1QQBA 3GUHA 3RIYA 1WZCA 2B37A 4RZHA 4FNOA 1AY0A 3LQ2A 3PDWA 4OY3A 4Q24A 4YGYA 1IJFA 3OA0A 5GOTA 3T8YA 3G85A 2P2DA 3O8CA 4LJ8A 3UA3A 4JQSA 4WN9A 4AKHA 3CPJB 7MDHA 4Q5IA 4A8HA 4R7ZA 5JJIA 1TO1E 4XTCS 1IM8A 1RXEA 2J85A 2V4UA 1EJBA 3WL3A 5CD9A 1YRQA 1CULC 1C9JA 4RLSA 3C2QA 5L53A 2H17A 2PS3A 2JLQA 5JBNA 4J4TA 2QIOA 4HB4A 3MINA 4BP3A 3THRA 1BRMA 2BFFB 3H5LA 4LGVA 1GXSA 5KTOA 3ICVA 2W2NA 2A5GA 3SQWA 4PAWA 3LT4A 4DA4A 3AVXA 2V6JA 2Z8YM 2B8EA 2PGIA 2ZB7A 4JHXA 1VGQA 4TTJA 3B8HA 1W4RA 2D2XA 9ATCA 1NLFA 4B7XA 5DYGA 1MORA 1QGUA 3R5SA 4J0KA 1TCUA 4KRYA 2ZG6A 1Z17A 4KP7A 1E64A 4NZPA 4E33A 4GBGA 4MP6A 3VO1A 3GJ6A 1GEEA 2AS0A 4P83A 4FR0A 2OMKA 2CNKA 1F6DA 3BHNA 1MO3A 4II3A 3Q85A 1ZZEA 2WD7B 1IEVA 4AW9A 1F2UA 1L4GA 4Q1AA 5J5CA 1FP4B 4TS4A 5M04A 1N2SA 2QT9A 1HE2A 4BRUA 1YFLA 1DTWA 5JO9A 5K6AA 4FDTA 1PGQA 3U61B 4PAGA 3FPSA 3PHLA 2AW3A 2RKBA 4WK6A 5K8IA 5IYZB 3QY9A 1IBKB 1BDHA 3AVYA 2R8RA 4RNDB 1MDFA 1AUOA 1OFHA 3BKXA 3DGEC 3K1YA 5DRTA 2ONJA 1WKVA 1ZGCA 2YZMA 2I8LA 2YN2A 3H87A 2CVQA 3KR1A 1HXHA 3M1AA 3MJDA 3IOCA 4RADA 4M1YA 3VH2A 4CMEA 5F2KA 4L5CA 1QCZA 4RY2A 1G5TA 3ZW8A 2HV9A 1HLFA 4S24A 3RUHA 3B2EA 3L79A 3AINA 1MEOA 3T1QA 4F3KA 1ADCA 3OJLA 2G0TA 2V03A 2WA2A 3U7EB 4AT1A 3CVJA 1JB9A 2I8CA 1WHSB 2EG5A 1JT9A 3HKEB 1X0XA 4B6FA 4NXNB 2R6R1 3EXFA 4Z0NA 4JT4A 3T5AA 3MWEA 3TX6A 1IEWA 2WSYB 1GYQA 5I4KA 4DDTA 1N6OA 3DOUA 1PQ4A 3PHCA 4WNYA 1UQTA 4BVGA 2XB6A 4HMOA 2W6QA 3PPIA 4TL7A 1JI0A 1N1DA 2CFOA 2WKWA 3AR3A 5AKKA 1RXCA 3BJEA 3MTDA 3AILA 4F3YA 1UC5B 3HWSA 1SPXA 3K1ZA 4MINA 1OQAA 1XNRB 3GAMA 3TCNA 1KQFA 3JWEA 3LWBA 4LBZA 3GFGA 4OLJA 4X6LA 2VAWA 1HZJA 3FR8A 1N2EA 2ZB2A 3CF4A 4FGWA 1GGKA 3EW9A 3D4IA 4QNRA 2I6FA 3GOHA 3UXYA 2FMTA 3KLMX 5BWCA 5NLLA 1PS0A 4R9RA 2VAXA 3ZIUA 4TLLB 4H7DA 1B8UA 4RYLA 4YYZA 1RXUA 1LB1B 3HZHA 1Z8FA 3N2EA 1RXVA 1JE0A 1B7GO 3F9CA 3PG5A 3X1YA 3EGOA 5H3CA 2WA1A 1JSRA 1Z4PX 3S40A 2QMQA 1WXHA 4U63A 3TTVA