2K4MA

Solution nmr structure of m. thermoautotrophicum protein mth_1000, northeast structural genomics consortium target tr8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0146 protein MTH_1000
publication title Solution NMR Structure of M. thermoautotrophicum protein MTH_1000, Northeast Structural Genomics Consortium Target TR8
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03686 UPF0146 Uncharacterised protein family (UPF0146)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2k4mA00
1T43A 2BR4A 3RIEA 4C04A 3NW9A 3ER8A 3FTCA 1D2GA 3G2PA 3G88A 1JSXA 4OBWA 3E23A 3GDHA 5C1IA 2AOTB 2WA1A 3B3FA 4PINA 1R00A 3R24A 5GM2A 4UOEA 1BKYA 2YVLA 3KQVA 3B89A 4U7TB 1R8YA 3HP7A 3KPUA 4XCXA 1Z3CA 1NW5A 2B3TA 5HOQA 1NBHA 1JG2A 3BGDA 3L8DA 3OU6A 5GP1A 3R0QA 5BXYA 2AN5A 2QRVA 1XJ5A 5CCXA 3CGGA 2I9KA 2JHPA 3FUWA 1X19A 2ZBPA 3G2OA 3G2MA 3UJ8A 2XVMA 4R6XA 4V0RA 5GWXA 4EVIA 4EKIA 3UJCA 1UWVA 2VZ9A 5KVAA 2EX4A 3SVZA 2H00A 1KYZA 4POOA 1RJFA 2LD4A 5IH3A 4AX8A 3E7PA 2PSSA 3HNRA 2K4MA 4ER0A 1AQIA 3DOUA 2ZIGA 2C7OA 4ER6A 2I62A 3P71T 5K09A 3GRZA 3FUUA 5B1SA 5LQNA 3S68A 3KQYA 2UYQA 5DM2A 5FULA 4E2ZA 2NXNA 2YQZA 1FP1D 2EFJA 3EMBA 1RJDA 3EVAA 4X61A 2IBSA 3GCZA 5HIIA 3NMUF 1Q0SA 3OFJA 4CTJA 3NTVA 1N7IA 2FPOA 2QY6A 3BWMA 1EAMA 3PFGA 2OB1A 4G56A 2E5WA 5EZSA 3REOA 3CVOA 4A6EA 3ORHA 2VDUE 3M70A 2AR0A 2ZSUA 3EVBA 3TKYA 4AZSA 4XUEA 3OU7A 3B7PA 4MQ4A 4RV9A 3HTXA 1M0EA 3MERA 5HIJA 4EK9A 1P39A 3G2QA 3ELWA 4MHTA 4AZVA 2V7EA 1KXZA 1P1BA 2FCAA 3LECA 4RTMA 4RTKA 5E8JA 4M37A 4HTFA 4PNEA 2JJQA 3TLJA 1X1AA 2HV9A 2C7RA 2YUIA 3C3PA 4H0NA 4ZTBA 3HCAA 3P97A 1H1DA 4JXJA 1I9GA 2BZGA 2B78A 3VYWA 2P7IA 3HVHA 3AXTA 7MHTA 1KPHA 2PV0A 1RJGA 2PXCA 5FHQA 3MQ2A 4QVGA 3UJ6A 3SX0A 4YV0A 2ESRA 5EKXA 3EVZA 4QQKA 4OBXA 5E8RA 3PT9A 2PT9A 3THRA 5FQNA 1D2CA 4BLWA 4YV1A 1ORIA 5LQKA 1G60A 3I9FA 3A27A 3FYDA 4PYIA 4RTOA 1Q0TA 5EIFA 2EJTA 1KYWA 2H1RA 3SR4A 1YF3A 2Z6UA 5K01A 5HZMA 5CD1A 2FK7A 1JSZA 3T7SA 4M36A 1QZZA 1SQGA 2YR0A 3LCVB 3ELUA 4AUKA 3EPPA 4K6MA 2O06A 2V74B 2Y1XA 4QTUB 2QYOA 4KIFA 5T67A 4GF5A 5DX1A 4C05A 4CKEA 3T7TA 4E70A 9MHTA 1JQ3A 1NW3A 2GS9A 4BP1A 5E2BA 5ICGA 5LQRA 1B42A 3FYCA 5G02A 4FR0A 2ONZA 4DCGA 2PX8A 3HEMA 1YZHA 5GIPE 2PXXA 3GRVA 1NKVA 1VP9A 2P40A 3AWIA 1MHTA 2JHCA 3C0KA 3OZRA 5FTWA 3PLAE 2ONYA 2Z6QA 3CJTA 3GO4A 3TPZA 4AZWA 3DXXA 3MTIA 3LX6A 4LG1A 5FWDA 10MHA 2BH2A 3OU2A 2AZTA 3FPHA 4FSXA 3EGEA 3Q7EA 1V39A 3KQMA 3B5IA 3LDGA 3ER9A 3FTFA 3VC1A 4V0QA 1KR5A 3TM4A 4BLUA 5DWQA 3SXJA 3EVGA 1M6EX 4U7PB 4GQBA 2PVCA 2VDWA 5CVEA 2NNWB 4PYMA 3M6WA 2XYRA 1JG4A 2G70A 2ZLBA 3A7DA 4QPPA 2AOUA 1N7JA 2OB2A 1P91A 2P1DA 4RVFA 4X41A 3TOSA 2O0LA 4DQ0A 3EVEA 2PWPA 2B2CA 1BHJA 4RTJA 3BZBA 3TFWA 3B3GA 5M5BA 2R3SA 3LPMA 5EMJA 3DMGA 4PONA 1WY7A 3O7WA 2QM3A 3UA4A 1WZNA 5E1MA 3QV2A 3UJDA 3PX3A 3LCCA 4A6DA 2EG5A 2PX4A 3CKKA 2HWKA 5HIKA 4HGYA 5DSXA 1SG9A 2NXCA 1R8XA 4X1OA 5K0NA 1XDUA 2OZVA 5MHTA 3X0DA 4HSGA 4F85A 3IHTA 4YUVA 5P8WA 5C0OE 4PYQA 4Y2HA 4C03A 3AY0A 2FRXA 2ORED 4QDKA 2ZWAA 4E31A 3NJRA 5BP7A 4QQNA 3AXSA 3F4KA 4FP9A 4CTKA 3DR5A 3G8AA 5GINE 2KW5A 4KVZA 4HC4A 4PIMA 5CVJA 4LWOA 2OPBA 3TR6A 8MHTA 1HMYA 2Q41A 1SVUA 1BOOA 3A26A 3DXZA 5DM1A 1XDSA 3O4FA 1OR8A 3D2LA 4PWYA 1L3IA 1NE2A 2P3LA 3JWGA 5DX8A 1WS6A 1BC5A 3MAGA 3P9KA 2Y1WA 4YMHA 2PXAA 3SSMA 3IEIA 5LQCA 4OQEA 4CKBA 1RJEA 2WK1A 1QYRA 4QTTB 2AOUB 1XTPA 5H02A 1UFKA 5DM0A 3KQTA 4IV0A 2CWWA 1YFJA 1XXLA 4HG2A 4WVLA 2OYRA 1QAMA 5DRYA 5E9JA 3LSTA 3GXOA 4RSRA 2BR3A 5EMLA 5FCDA 3A4TA 2ZW9A 4OQDA 3UA3A 3M6VA 3A7EA 2UYOA 1IXKA 2PLWA 1FJXA 4PYOA 5K05A 4MWZA 4FSDA 1RI5A 2QE6A 1HNNA 3DLIA 4KDCA 4GEKA 5EVJA 4YUZA 1UIRA 3JWHA 4DF3A 1TPYA 4E2WA 3BT7A 3DULA 3FTEA 2G71A 1O9GA 5EHGA 4BLVA 4EMSA 3AJDA 1L3CA 2GA9A 1L3BA 1JQEA 1KPGA 2O05A 4YMGA 4ISCA 1ZGAA 1XDZA 4Y30A 2AOXA 3SGLA 3UBTA 2QRVB 4GUAA 4LWPA 5DT2A 5LQJA 4PGHA 1VBFA 2HNKA 5DLYA 3TRKA 1KHHA 4C4AA 4M38A 4M7RA 3GRUA 5FHRA 3DH0A 2HR1A 2Z6AA 5D1HA 3RW9A 3HCCA 3SSOA 1SUIA 2NXEA 3GRYA 1WXWA 5CVDA 4RX1A 5EKUA 4DCMA 5DTRA 3Q87B 4GC9A 5EG5A 3VSEA 3CJRA 4PYJA 3KQOA 3MCTA 4PCLA 1VPTA 1F3LA 2GB4A 5HEKA 5U4XA 1EIZA 3GIWA 5K0EA 3EEOA 2IPXA 3DLCA 3HCBA 3OE5A 3TM5A 1G38A 3FZGA 4R05A 4E2YA 1U2ZA 5DXJA 5HFJA 2UZ4A 4PGGA 2WA2A 2OO3A 2PX5A 4DKJA 3ERCA 3G7UA 3DTNA 3HA3A 3PS9A 1VL5A 3CJQA 1EQAA 4DM3A 3LBFA 3EGIA 5EC8A 2IP2A 5E9WA 2ZZMA 3P2KA 2OY0A 3EVFA 4PIPA 4BY9E 2VP3A 3ANXA 3OZTA 5K0GA 5KYGA 3WSTA 3FRHA 1AQJA 3PTAA 2AVNA 5BW4A 3EVDA 1NV9A 3GRRA 3LCUA 5FWAA 2IFTA 5C9ZA 4HTFB 1R74A 2C7QA 2P3QA 3ELYA 3SMQA 2YXLA 3B3JA 5LQUA 2XBMA 5FADA 1WXXA 2ZBQA 5EEGA 2IDJA 3CC8A 1N2XA 1O9HA 3BKWA 3FPFA 4E32A 2IDKA 3NVKI 4E33A 3P8ZA 1INLA 4B17A 1DCTA 1ZGJA 4OA5A 2AN4A 3M33A 3EGVA 4KDRA 1NV8A 2BM8A 2ZZKA 4PYKA 5IKMA 1NW7A 1RI4A 4L7VA 3OPNA 3PFHA 3I5UA 5E9QA 2IH4A 4GC5A 3UZUA 3KHKA 5E1OA 3I64A 5CIYA 4CXMA 5F2KA 2AOTA 3DMFA 4RYLA 3TQSA 5CVVA 2UYHA 2ZWVA 4P58A 3HCEA 5K8VA 3C6MA 3FRIA 3MB5A 1XCJA 1EG2A 4LECA 3BWCA 1TW3A 3E05A 3H2BA 2IIPA 2VDVE 2ZVJA 3G89A 4PYNA 4PYLA 3P9NA 4R6WA 5EOVA 4F86A 5CCBA 1G55A 2AOWA 5E1BA 2ERCA 3I58A 2CL5A 4IV8A 1ZG3A 2H11A 3KPWA 4HGZA 4F84A 5E1DA 3HCFA 3P9CA 3T0IA 2IBTA 2ZIFA 3PB3A 3M6XA 2I7CA 1DL5A 2I6GA 1G6Q1 1IM8A 3KR2A 3LKDA 5EGSA 4ATNA 4ER5A 3R9XB 3K6RA 2VS1A 5DX0A 4DMGA 5T64A 1G8SA 3T7RA 3V97A 2YXDA 3G5LA 1G8AA 3BUSA 4YUYA 2GH1A 2ZFUA 3UJAA 5JR3A 5K03A 2B9EA 1SKMA 3MHTA 5GOZA 4C06A 3G5TA 4FT4A 3EMDA 1X1BA 1NW8A 1QAQA 3DP7A 3ID6C 2ZCJA 1O54A 1EJ6A 3IV6A 4RWZA 5K0CA 2PT6A 2N47A 3P2EA 3BGIA 2GAFA 2HMYB 4RVHA 1ZHFA 3THSA 3MCZA 4HH4A 3U81A 5FA5A 5K0LA 1AV6A 5FUBA 2CMHA 2ZULA 3LGAA 3BWBA 5D1NA 1YB2A 2OBFA 3UFBA 3LDFA 1L1EA 3LL7A 3NDIA 4YUWA 5BW5A 5LR6A 1JR4A 5CM2Z 1PRYA 1ZQ9A 2P7HA 5ICCA 2YXEA 1F38A 1WG8A 3SM3A 1Y8CA 3KR1A 5EHIA 4R8RA 2PGXA 2CMGA 4YV2A 3FTDA 2AN3A 3HA5A 4QVKA 5F2OA 1KIAA 3P2IA 4E30A 1JG3A 3OCJA 4E2XA 5EQJB 1D2HA 2JH9A 2PY6A 2FHPA 2XYVA 3HVKA 3MTEA 1XCLA 3GWZA 4HRAA 1JTFA 3KPJA 3KQWA 1RI3A 2NYUA 4FS8A 4CKCA 5K0BA 2ZTHA 3KPYA 3PX2A 4FT2A 4IKPA 1FPQA 1QANA 3HVJA 2ADMA 3EEYA 2IGTA 2PKWA 5HIMA 5KQSA 5FA8A 2PWYA 2P35A 1X1CA 4XUDA 3A25A 1KP9A 1FBNA 2OXTA 1KPIA 3K0BA 1L9KA 5GIOE 3CBGA 3ME5A 3R3HA 3FPEA 3KR9A 4KW7A 5EIWA 3C6KA 5GM1A 4ER7A 4P7GA 5LQAA 1IY9A 2GPYA 2EJUA 3FUTA 4GOOD 4P7KA 3JWJA 4RVGA 5DRTA 1JTEA 3NWEA 3TMAA 3FPGA 1YFLA 1VP3A 2NXJA 1YUBA 3KKZA 3NDJA 4IWNA 2C7PA 3GNLA 1VQ1A 2IH2A 3I53A 5CUQA 1VIDA 1M6YA 3BXOA 2BM9A 3UJBA 3DUWA 4AZTA 1EJ0A 3HCDA 5E2AA 4RTSA 5DM4A 2OKCA 2BR5A 2XVAA 3EVCA 4OX9Y 4P7JA 5KS2A 2AS0A 2NP6A 2AVDA 2ZIEA 1DUSA 2ZBRA 4XUCA 3KQQA 3V8VA 1NT2A 4GOND 3VC2A 2P41A 1JG1A 5EMKA 4RTNA 3BKXA 2PJDA 1TW2A 2B25A 3GGDA 3HM2A 2JG3A 2ZZNA 4O29A 5ICEA 5JUWA 5DXAA 1XVAA 1R18A 2UYCA 1MJFA 3DMHA 3OE4A 4X63A 1YZ3A 2YTZA 3M6UA 4GOLD 2P8JA 4KIGA 1SQFA 3E8SA 4NECA 5DPMA 1I4WA 2O07A 1JQDA 5EEHA 3KPVA 4BP3A 4R8SA 4Z2YA 4MIKA 3P9IA 4GBED 2XYQA 3DXYA 4RTLA 3TKAA 4CWAA 2YX1A 3OFKA 3OZSA 1X1DA 2CKDA 3KR0A 3MGGA 3QOWA 3UWPA 2DPMA 3KQSA 2O57A 5EPEA 3FUVA 2A14A 4WXHA 4QDJA 4EKGA 4RTPA 3GU3A 5K0JA 1I1NA 1ORHA 3BGVA 3UJ9A 2G1PA 2AOVA 2G72A 1VLMA 4FZVA 1RI2A 4P7FA 5F2NA 5K0FA 1P1CA 1NBIA 4DA4A 4ER3A 2JHAA 4YUXA 3HVIA 5LSAA 3LHDA 2PX2A 3KU1A 3KQPA 3IYLW 1RI1A 5DSTA 2IH5A 5KQRA 5DTMA 3SSNA 3LBYA 3GJYA 4RTQA 3R6TA 2G8NA 1VE3A 4GOMD 5ERGB 3M4XA 4MTLA 5FQOA 5DTQA 4KRGA 2R6ZA 3QOXA 3RODA 2GLUA 1SUSA 3FPJA 4QPNA 5EZQA 3JWIA 3CCFA 3HA7A 1AF7A 5HILA 1R6AA 4X60A 4PCAA 3BWYA 2NP7A 3LDUA 2FK8A 3NWBA 3FUXA 1NW6A 5ICFA 3NVMB 4FGZA 4RVDA 4DZRA 1FP2A 2HTEA 3G8BA 4KWCA 2JH8A 4EQZA 3ELDA 3C3YA 4OA8A 5CVUA 2DULA 1PJZA 3O31A 2PBFA 4RTRA 1QAOA 2FYTA 3UJ7A 5EMMA 3LKZA 2P3OA 5T6BA 3PVCA 2F8LA 1ZKDA 4C08A 4C07A
chains in the Genus database with same CATH superfamily
3TW6A 2I7XA 3WIBA 3E61A 2W48A 2VXBA 1ZD3A 4I9FA 1D4FA 4BQNA 2CDBA 1R1DA 2IZ6A 4G09A 3VKFA 4ZT5A 3K8QA 4LY6A 2ZI4A 1KZ1A 3OPQA 2AX3A 3VYTB 3GFGA 3DOHA 1D9ZA 3RRNA 4ZHSA 5HMMA 3F3SA 5GZ3A 3ORFA 1A5TA 3RUPA 4MTCA 1PFWA 3A8TA 2IEAA 4N03A 4X1IB 4G24A 3LY7A 4WCFC 3IE2A 2QLJA 4AG3A 4CR8A 2GPBA 1SIBE 4XVQA 3UK2A 3F46A 1Y6FA 4HLCA 4DARA 1R9GA 2WM8A 1PZNA 1FMJA 1NQTA 1NQVA 3AETB 5CNJA 2C77A 2E4WA 4DR6B 3W4KA 2W11A 3O8NA 2XKJE 5CNMA 2XQJA 4O4LB 3TVYA 1RE0A 1X0XA 2V45A 1D1TA 4OYRA 1OFVA 4I3HA 5IT4A 1J0CA 2PE5A 2H2GA 1IK6A 3W2GA 5CAEA 1O97D 3NNDA 3O93A 4ZKDA 4QHYA 2XKKA 2P69A 2QMZA 1TJPB 5EP4A 3GRZA 3RS7A 4KSBA 2NUPB 2TYSB 3FYSA 1WZIA 1F2UB 3UMMA 1AXGA 3WYEA 1A9RA 5KNCH 4YRBA 4MINA 3WQSB 1F6WA 4KDFA 3G68A 4QPZA 3O8CA 4Y0AA 4K9QA 1DC4A 5FPPA 1TPZA 2CLKB 4C0KA 3BWMA 3L7BA 5AFSA 5BN1A 4BKOA 1MB3A 3OFVA 4HPWA 3TKYA 3EPRA 6LDHA 2OGSA 3VR5A 4OXQA 1EM8A 1OT3A 2UZ1B 3AIKA 3G2QA 3EZGA 2X0RA 1VC2A 1NFRA 3CZ5A 4TS4A 2OM6A 5AI6A 4PG5A 5F35A 2A92A 1NF3A 3ZU3A 2PKQP 2BGWA 4QOGA 5TQ2A 5HKBA 4LJRA 1RZ3A 2JJQA 2IJGX 4GYJA 2HV9A 4MCJA 4D9NA 3REQA 1DAKA 1JLLB 4R7ZA 3C3JA 2VJYA 5HFNA 1GCGA 1IDOA 3O73A 1UKEA 3IBFA 2RAUA 1LPMA 4QQFA 4JBNA 4WVFA 2ZCVA 3GP3A 4QATA 1ECBA 4ID9A 2YWCA 5HZHA 1UPFA 1N25A 4BQFA 1U0BB 3CF4A 4TTJA 2EAUA 4RUKA 1IY8A 3EIXA 3D7LA 1XRJA 4BLWA 4NJEA 4HZUA 2Q1UA 2GYUA 2BBTA 4NV1A 1LPPA 1MT3A 1DIHA 1JBEA 4M36A 1C8LA 3AWDA 2I6UA 3TBFA 1T8PA 2P11A 3KM0A 3DBHB 4OM8A 4PZYA 1WW3A 4Q18A 1M54A 3IQGX 3EZ6A 3GUVA 3QQ5A 4WL0A 3RJZA 1VPLA 3AGPA 1DFHA 1RQ2A 2CNOA 3U44A 4R84A 3NFYA 2FSHA 3EXHC 4UHKA 5A7GA 3RT1A 1M6NA 3EFOA 4FGJA 3HE3A 1V6AA 2PX8A 3ZX4A 2CJFA 3HMKA 4BN5A 3BH0A 4KO2S 4UVHA 3GFTA 1NYRA 4PZUA 3MWFA 4DHWA 4GOKA 3WL5A 1HNXB 3SZOA 4V0LA 5IDVA 2LGJA 3NKFA 2BFCA 3LOQA 4NONA 1ZNQO 1BE1A 3KQHA 1O94D 2ZRJA 5I9BA 3RK0A 2OUIA 2R7AA 2TMKA 2C58A 3BREA 2WYWA 3NCHA 4Q1CA 2HMSA 4X3OA 2CV1A 3RQIA 1EQUA 2FSIA 2CLEB 5GQSA 1ZONA 3L07A 1RWWA 4YO8A 1XLVA 4I55F 1R27A 4TYWA 5B4UA 1QG6A 2JLAA 5ES3A 2VWPA 4GE0A 1K2WA 2YJ5A 4MI9A 2O0LA 2P67A 1SKQA 1G6HA 3UTCA 3LFTA 1NMQA 4BLTA 4IIFA 5FR2A 5M5BA 3I30X 4H6VA 1LUAA 3OEEA 3O8OA 3QELB 1JFFA 2OV8A 4MI1A 1WUKS 4U7JA 1VB3A 2OOKA 2WSBA 2DBQA 5CB4A 4AKIA 3CRW1 2OZVA 4HOYA 4ZZ0A 5KJCA 3DCJA 1G63A 3CB4A 1SU8A 4OAPA 4PYQA 4R01A 5AUPB 5JSHA 3AY0A 3ELBA 3T4UA 1BQ4A 1DAEA 5TQJA 1CYEA 2PX0A 3NQ41 3DDOA 4TWAA 1P3JA 1ZIDA 2I91A 2QE7A 2O2XA 5TSDA 2KI5A 1UT6A 2FFRA 3ESYA 3F3KA 4ZGBA 1FK8A 3T7KA 1P2SA 2FPXA 1COWD 1E20A 2UAGA 3DBIA 4Z4CA 3AVWA 2AI1A 1XCGB 4JMLA 2WMYA 3SSMA 5AOCA 4ZCSA 5J2TA 2IDZA 1LRLA 3IXLA 3NGXA 1IJEA 3Q5GA 5ALLA 1H93A 1N9GB 4CNBA 4BIIA 2NYVA 1LLCA 4Z86A 3TLMA 4C7JA 1GARA 1JEDA 3DW3X 1LSUA 1XI2A 1GNPA 4LYFA 5D85A 1PJLA 2P27A 3E22A 3IQDB 1PIWA 2IK8A 4GM1A 3M6VA 1A2KC 1UJNA 3MBOA 2UYOA 3W8RA 3AF3A 1SG6A 4ZOEA 2A1TR 4AFNA 4X95A 4ZMRA 1YB7A 1ZXBA 1W30A 1XEXB 5FFNA 1VLZA 1PVVA 4YRSA 5JQGB 3QKUA 2J3QA 3IQWA 1CRWG 1CB7A 2CT8A 4OLBA 2F55A 1YU6A 1FTYA 3LE8A 1KO1A 2O4UX 1Q7CA 2BM1A 3BDIA 2C9DA 3QNUA 1GPH1 4TOIA 3D4BA 2GN6A 5LA6B 2G28A 3EGOA 5EXTA 1U3GA 4KR9A 4RIHA 2XCLA 3RVPA 2Y1DA 5T8KC 3FVVA 4W7SA 4BEJA 5C1DA 3STTA 1CEQA 4TYNA 3WFIA 2VJNA 1E6UA 2HGSA 2V6BA 2VYQA 3CKMA 3B6EA 3F5MA 2IPOA 5FTMA 3WR5A 4EW1A 4CEHA 4NFYA 1MABB 3PHCA 2A30A 4BCBA 1UJMA 3R7SA 3AF6A 2W0SA 1QGAA 1PJ3A 5KB3A 4O3MA 1EBFA 2WTMA 4N82A 2PUAA 2EGGA 2JBAA 3IUYA 3EH2A 1MX9A 3CJRA 1H05A 4P4SA 4WCVA 3TLZA 4ENRA 2A5DA 3F1KA 4OHPA 3A4IA 2QP9X 1D7AA 3QYJA 4ZICA 3PWKA 3B70A 4DFDA 2NPOA 2BDUA 1SD5A 1GPJA 3TB4A 5E3HA 1TQ8A 2IUEA 2QSUA 1AO3A 1UEXC 1N8NA 1YC2A 3ZCRA 1U8ZA 4D92A 4CIBA 2IWHA 1HO3A 2WIBA 1NI3A 2OHFA 3IERA 2Y9MB 4ZDJA 3WZMA 2ZZMA 3P2KA 4EGJA 3UMSA 2VP3A 2DGDA 3S29A 1VMDA 4FQ5A 2EKPA 3DL0A 1TM3E 4B3HA 3GRRA 3PRJA 1G7SA 4RA9B 4Y1RB 3SS7X 1R74A 4G0XA 1MIHA 3Q2IA 4GQAA 3STHA 1D6MA 3VYVA 1GADO 3PEYA 2PH5A 4OQXA 4E14A 1WXXA 3HXKA 4UM7A 4P5DA 4MUAA 4LGVA 3GDGA 4ZT2A 3NVKI 1UZNA 3CPEA 1RLJA 1FX0B 3HDJA 2CNLA 4Y6QA 3MUEA 4FYIA 4BTEA 1QK4A 1ZH0A 4NKRA 3H9JA 4HVLA 1B8NA 4NZOA 1A8HA 1EX9A 1MR3F 4NYJQ 2VAVA 3LT1A 4HAXA 1GPNA 2I80A 1N5OX 2ZRBA 5HZKA 1WMFA 3L0ZA 2ZWVA 4P58A 4YCDA 3BL6A 3I2GA 2J9XB 3RVBA 3IAS1 4WGGA 4IJ6A 1U9JA 5A4MS 4XJXA 1P4RA 3WGGA 1QGED 5HKKA 3NBMA 4O1IA 1PT5A 1QORA 2BSAA 3AP3A 3IKJA 5KYXA 1BVRA 3IQFA 5CCBA 2ZJBA 1IB6A 1V47A 3KKKA 1MJHA 4EM6A 1CUEA 1SC3A 2VP2A 5AJYA 4BNFA 1G2PA 1RPAA 3L49A 2DFKB 1IJFA 4OI4A 5HA5A 3E3MA 3UFXB 4D9HA 2ZS8A 5BORA 2VO1A 1OZAA 4RK5A 3RIGA 4X1YA 2D5BA 2IBTA 3RO7A 1FA9A 4IFEA 1B00A 3AF4A 2I6GA 3ZCXA 2ZRPA 2ZSAA 3CX8A 3Q9NA 2EDAA 3OIFA 4FOSA 3ZLBA 3BFPA 1G8SA 4ETMA 3LF1A 5LQDA 2I71A 1EA5A 3G5LA 4YUYA 4L4RA 2YFYA 2DM6A 3AEZA 3K2BA 4KQJA 4WNYA 5F4ZA 4QUEA 5HS4A 4V0ME 1JVBA 3UKOA 1C50A 1OAKA 4M21A 5K9ZA 2HM7A 2GXUA 4I9NA 1RMYA 3B53X 3HSKA 3JD1A 1T9ZA 3FIJA 3TOXA 3GLUA 2QYTA 3NTUA 3WL8A 5GMOA 1N2CA 2DB3A 4N49A 1S3IA 2NU9A 2R87A 3IO5A 1A8SA 2HU7A 2NTVA 3GRPA 3JWPA 3BGIA 1KC3A 4OEHA 4TN5A 5KTSA 1BXRA 2OQRA 2H85A 2R84A 5IK2A 5KOYA 3PU6A 4MKGA 1MIOA 3LW7A 3MJVA 3VV2A 4R31A 4YR7A 1T3GA 1FZQA 2P6MA 2QMHA 1J42A 4X1KB 2HA6A 4ZN6A 1KSJA 1UT8A 2LCFA 3GLKA 4HRYA 4JSTA 3U2QA 1VE6A 1Y8CA 1BH6A 2RBGA 5EHIA 5KMGB 1GDTA 2DR2A 1R0XA 3SBOA 1Z3IX 1I7LA 1V9SA 4R9NA 4D9FA 4JGIA 4HO1X 3QLUC 4F9TA 4YXWD 3ETLA 4FLFA 4ZI7A 1RZRA 4OQ4A 5EQJB 2XYVA 2FHPA 4IS2A 1JTFA 2FV8A 4RGYA 2Q5EA 4LVNA 4DBVO 4OXYA 4MJ3A 2QTWB 4X20A 3KP1A 3ZGXA 1GM5A 3BE6A 1O5IA 3SHFA 2KLBA 3ZY2A 4KC0A 3JV7A 4FYYA 4JASB 2DCUA 1NR5A 1JECA 3Q6NA 4CQJA 4KN5A 4BVBA 3C1OA 3D7SA 3K9HA 4PO3X 4X6LA 1NF9A 2OZLA 4WERA 1FUIA 4JJGA 3STYA 5DN6D 1CSEE 4TXNA 2WRZA 3E84A 5JH7F 1CRPA 2IT1A 5C1OA 1HNZB 4P7KA 3IHLA 3WISA 2V7PA 1PN3A 2C2KA 1SG0A 3HSYA 2P9BA 2IZ1A 4GMGA 3V32A 3F1LA 4XEHA 5G0UA 1QQ7A 1JHMA 2BTOA 2D3WA 3FH0A 3I3OA 5DP1A 2QLFA 4TZKA 1JG7A 2IEBA 4PVDA 1BEEA 1CUHA 2VAXA 1P62B 3KKZA 2F1RA 4JI6B 3E3NA 3R3UA 3GLIE 3DVSX 1NASA 4IIXA 3I53A 2J4CA 5JZMA 1AV7A 2BM9A 4N7JA 4AMYA 4CCYB 4V3BA 3DUWA 3DUFA 4QFCA 1THTA 1OYYA 3NWJA 1AU9A 1J24A 4GMKA 3VPFA 2OKCA 3C7AA 3QYAA 3MTJA 5TGZA 4K28A 1TMYA 1J0BA 3ZI0A 3PEFA 4S2UA 1K8ZB 1YJXA 4RF2A 2ZBRA 4ZEXA 4HXYA 4RORA 2G82A 3VO1A 2O2SA 2N3ZA 1IVNA 1GL7A 3VC2A 4FKBA 1V35A 5EMKA 2C5LA 1HKHA 2HBZA 2BRUA 1CDDA 1Y3IA 2VYVD 3MS2A 3A3NA 4ZVLA 1E1CB 2SNIE 1TOAA 5CX4A 1Z75A 2ODTX 5H82A 3AK4A 5LXTF 2LP4Y 2I65A 1LQ2A 1BMQA 4OH1A 1IHDA 2A0XA 3DS8A 3H1TA 4IOLA 4NECA 1J06A 3HBNA 5D7BA 4HH0A 1EFUA 2WQ6A 3TUZC 2FFBA 4K9MA 5EL0A 3P9IA 2J0EA 4JBGA 2ZIZA 2HXYA 4H35A 4RS4A 5K3OA 4GR5A 1D2NA 4P81A 1X1DA 5JO9A 1C8VB 4C0HA 2UZAA 1AJEA 1DEXA 2CVQA 1QYVA 3KQSA 4KWEA 3JS5A 3WWCA 3HSSA 4A5SA 4KVFA 4Y9SA 4QDXA 1XCPA 4KKXB 4NOLA 1PR3A 4TMVA 5FF9A 1NVUQ 3UJ9A 3G8YA 2BL4A 4QU0A 4CQMD 2R5WA 5IHPA 2JHAA 4W5WA 3GT7A 5CDSA 4DQDA 1LI7A 4Q4LA 5FOSA 2WE7A 4BGUA 1T9KA 1Z74A 1QO0D 2C04A 5JECA 1DB3A 3QFSA 1XR3A 5FBLB 3IALA 3LHFA 1TUBB 1JFRA 2WKPA 2ZYTX 4LZZA 1H23A 4ZOQI 4MTLA 1PR5A 5FQOA 5AVVA 4KRGA 3KYIB 4WXMA 4O4HF 3V3KA 2P1RA 3U19A 4CIDA 3NCTA 2CW5A 5TARA 2C5EA 3WO1A 2XSZD 2MTBA 3R7FA 4RVDA 4ZYWA 1YZQA 2JL1A 4NBSA 4PRKA 1QKJA 3HCPA 2JFPA 4PLVA 3UG7A 2PUBA 4OA8A 5AJVB 4LMRA 2A3RA 3IXQA 4O63O 2GWHA 3WAKA 1EX6A 2JAHA 4OBEA 3A9RA 1C30B 2P3OA 4CF6A 3LLCA 4CPDA 1QPBA 4RTPA 2RGNC 3A3KA 2FWMX 2PL1A 2VQDA 3JQEA 2NU8B 3QYFA 2GHRA 3NW9A 3T0FA 5I8PA 4ARCA 1A4XA 4DJEC 3GJ3A 4XX1A 4P84A 3G2PA 5IX8A 1JSXA 2GHIA 4C7BA 2O0KA 4QDZA 2ZYRA 4Q15A 2QN2A 2AOTB 3LCRA 3ZPXA 3B3FA 4HSEA 4ZAGA 3KE8A 3WGLA 4ZZ2A 1E32A 4CKWA 1PGQA 2PYIA 4P2GA 5G1NA 3ZU6A 1JIXA 3WDLA 3JPWA 3OJEA 3KPUA 1YI0A 3HY6A 4BAZA 4AQYB 1ZJWA 4DV6B 1X8KA 2B7CA 1VSTA 5GP1A 2DLCX 3AVTA 1ZKMA 4LHYA 4JT8A 1SN7A 1K8RA 3CEPB 3G2HA 1QJ4A 1VJGA 2JZCA 2JCGA 3K0CA 2VBCA 4MV8A 2Y71A 3OJXA 3G2OA 4PXSA 3LQFA 4YCBA 3EFHA 1PNVA 2MSNA 1NONA 2RSLA 4YCLA 3RYHB 4KLAA 4P86A 2V0NA 3NXKA 3R3SA 3UG6A 1FFBA 3P94A 3X1XA 4I46A 1FC0A 1DWUA 1E3LA 4FUQA 4AKTA 4I1PA 4MQFA 2A58A 3HNRA 4FJ1A 4LNAA 3JD0A 2FA9A 3I2FA 2EGUA 2QP3A 3KKEA 2HDOA 1EE9A 4MPRA 5EERA 3ZLVA 5ICMA 4ARUA 1RMQA 3IBTA 2Q21A 3HGQA 1HH4A 1NM5C 3CZMA 4A6PA 2QJTA 1U5BA 1QHHA 4Z2AA 1YKFA 3DZGA 1H9AA 3E9RA 2ZKIA 1PZXA 5IUKC 2OC4A 3QYPA 3UHOA 5KNCD 5F9FA 3IULA 4L0MA 1OHHD 4JP2A 1VDZA 4FM9A 2VH5R 2JVKA 5HW0A 3OFJA 3S1SA 2ZDGA 4MHOA 4FEEA 1NLFA 3S8EA 1MB9A 4YJ2F 1WABA 1US8B 1JHQA 2JGEA 1N2IA 2ZJYA 3PD0A 3QBDA 3QMVA 6NULA 4X54A 3HN2A 3AB7A 5FV4A 1LBEA 3FOBA 3HN7A 2F3QA 1D1PA 2OBLA 4YV7A 4RDXA 1F06A 3UWMA 4ZJUA 2FQXA 3GHYA 2RMKA 2EP5A 3AZQA 3FMVA 5T41A 1BQEA 2X3FA 5BYJA 3WQQA 2PUCA 2WV9A 3TLJA 4KJZA 2CSXA 1W4ZA 4DNPA 4I3FA 3URKA 3I1FA 1VBNA 4GPBA 4Q7KA 5HK9A 4GW3A 1PGNA 1R0LA 1L4FA 1C0PA 5KSZA 5K4AA 1UMBB 3S6JA 1PK8A 2M1XA 1SPXA 2WWFA 3SQOA 3UT6A 1Q3HA 4PHFA 4TLMB 5BNTA 3N8HA 4TTVA 1P7WA 1MRZA 1XYVA 2W4QA 4PG6A 6ADHA 5FQNA 4OMCA 4JDPA 3RUCA 1I6MA 1U2EA 1RU3A 2FMHA 3TXYA 1WVMA 4RYDA 1U1DA 5DWVA 3LBAA 1WCXA 3F2VA 2VJOA 3DVLA 2PA0A 4RZHA 1HR0B 3BCUA 1TQDA 3FXAA 3WMWA 3EAFA 3GRCA 3MUFA 2GCNA 4Q4HA 4YB8A 3WGKA 1AXRA 5HDQA 2P9TA 2BCEA 4D0NA 2C4MA 1WP9A 1YS4A 1T3SA 4RFSA 3BMCB 2GS9A 5B30A 4AUNA 3V8EA 1XTIA 2C4KA 1BVYF 3F47A 1XSEA 1UXGA 2HK8A 1EJBA 2IW3A 5G02A 1AHNA 1NGSA 4G81A 5LZ7A 2K2WA 3I5AA 4P1ZA 5FEMA 2VPYA 4LK3A 4TWJA 2O2DA 3WY9A 3R9XA 4ZJZA 4L85A 4NVRA 4URZR 1EJ2A 3DL7A 4YCCA 5K6AC 3PQ8A 1PTKA 2X86A 4DL9A 2RBKA 3CRZA 3AINA 3Q8LA 2O14A 2Q9AA 1Q50A 2GBCA 1C9KA 3QVTA 3NHWA 3B5IA 1SVLA 1JYFA 2QTNA 3H3JA 4E0BA 1PWHA 1G3QA 2NZXA 2O2EA 1N6LA 2SICE 1BMTA 1G8YA 2JLQA 4GQBA 4X3PA 4PICA 5AIBA 1K75A 1RYMA 1QGOA 2IZOA 1CT9A 1TA9A 3FVTA 5KTRA 2WTXA 4HI0E 4LMAA 3E9CA 3KZ1E 3DC2A 4E12A 1N7JA 5B6JA 2GPSA 1F17A 3VGPA 1C3OA 3HHEA 5DW3A 1BHJA 1I80A 3K0HA 4NV0A 1QBGA 3RD5A 3T5BA 4DAOA 5LBUA 1L2TA 4IIYA 4KIJA 3HZHA 3QPWA 5DN9A 2OZEA 2VSQA 1RRCA 2KX7A 4HFNA 3IBSA 2ZAIA 4I08A 4YTEA 1EXDA 3NKVA 1Y5NA 1AB5A 3G7NA 4FEAA 6Q21A 4UFPA 5LOVA 4I5EA 4K6HA 5T5QA 1Z07A 2PM8A 1YQGA 3NTLA 3D2BA 5JDCC 1EUCA 4F85A 2VHZA 1Z2AA 2A5FA 4QU5A 5P8WA 5C0OE 1PS9A 2H57A 2B82A 4NLLA 3AHGA 3QU4A 3BAFA 3RVQA 1CB0A 4N6OA 4PZCA 2ACWA 1GAWA 4XAQA 3Q5DA 3WK7A 5JNSA 5MFZA 1WMDA 1V2GA 1U28A 3DVAA 4HC4A 3KKQA 2XIQA 3B6IA 1PHPA 2EARA 2OPBA 2HLDA 3HYNA 4LDPA 3LL4A 1G8HA 1PCXA 1LLFA 2TECE 4Q39A 3UC5A 1N32B 3KJNA 1CIPA 2XTJA 2H92A 2NU7A 1LK7A 3D2LA 4PWYA 6ABPA 2FSUA 4AJLA 2AA3A 4A2CA 2H5IA 5HMLA 2A7QA 2BDEA 2DJIA 4O2AB 1M76A 4Q12A 1ZCAA 3IT1A 2YCLA 4ND6A 4O2BA 3WV4A 1K6XA 1UFKA 4D3ZA 1UPCA 4INOA 2QXTA 1OZFA 4YMVA 2RB4A 3R6WA 2YUTA 3NT5A 3V00A 3LSTA 3AW9A 3QHAA 3K32A 4HX9A 3F6BX 4P32A 2ZJ3A 3TZKA 2I4MA 3GLVA 2C5BA 2PSJA 4OLJA 5DEOA 4BNUA 4GGPA 3UA3A 5KHAA 1JJVA 2R85A 1AKNA 2IELA 2ZRNA 1IXKA 1DC6A 4Q93A 4X45A 5EUCA 4TV9A 1VZ3A 3ZZNA 4BKRA 4K2HA 5F52A 1ENPA 1Z9BA 4D7AA 2E9SA 5FUYA 3JWHA 1DELA 1WXQA 4YJFB 1LY1A 4GZLA 4ZAZA 3QVGB 1L5VA 2QGZA 2XUPA 2VF7A 3MAAC 2GZ2A 4IXMA 4Q05A 4CGZA 1G5QA 2QD2A 5GZ1A 5G0VA 3WI7A 1BS9A 3QBEA 1ZGAA 3OSZA 4I2VA 2IHUA 2CXPA 2Y6UA 4R8KA 2QRVB 4RF5A 4YQZA 5ABPA 2B8TA 4CG3A 4YY3B 1GAXA 5DKFA 4J3NA 2Q3DA 2CXQA 4EFKA 3URMA 1SOVA 5JSUA 3PQFA 4IRUB 1OAOA 1JA9A 2J85A 4B33A 3GLIA 8ADHA 4PG7A 3T3IA 3FHLA 3IELA 1OBHA 2EGHA 2CBXA 3ZHRA 2NUAB 4PZEA 3D3NA 4H08A 4O3FA 4TS1A 1M1YB 1T2FA 1E2FA 2BMWA 1NBWB 4YS6A 2XDQA 2X76A 2OWDA 1O95C 2R65A 3RT9A 5EPUA 1N2BA 2ASEA 2HWYA 5FLYA 3KLOA 1KNXA 1JFSA 1U7TA 4IJUA 3BS4A 3LUPA 1OIXA 4N18A 3EEOA 3DLCA 4RPCA 2J48A 3UT0A 5C80A 3FZNA 4PGGA 4DKJA 4JVLA 3PFCA 1E2DA 2CK3D 3PS9A 1DV2A 1NLMA 2VYFA 3R1IA 1Y4SA 4IUYA 1OB5A 3Q0EA 1U2GA 3S2GA 2W6NA 3MD9A 4JB0A 3KSAC 3EVFA 2BAGA 5MN5A 3X1JA 1GCUA 3PTAA 3VPXA 3QWBA 2GCOA 4G0YA 2ZYDA 4KXYA 3GBVA 1SUCA 5AUOB 5K3AA 2YIMA 4F4FA 4KLCA 1KJJA 4RMIA 1UBSB 2ZREA 3PEEA 2CL7X 2C7QA 3LFHA 5K8IA 4Z1MA 1FVHA 3ZN2A 4U9IS 2VQEB 2FDRA 4DE5A 1DBIA 2CGEA 5HF5A 1CRLA 3BXXA 3REGA 3EY9A 5ARDA 1RC8A 2AFIB 4UBMA 3TDNA 2IDKA 3PG5A 1U2SA 3P8ZA 5CK5A 1DCTA 1TC1A 3OZ7A 3TLXA 4OOEA 2ZT7A 3TW4A 2QW0X 2BHRA 2GBFA 4JAVC 1XEAA 5E9QA 3UMJA 2JCXA 1QH8B 1U8YA 3L6EA 2ORIA 4TQUS 3E03A 2PTGA 3BTOA 3KCQA 4Q4JB 3VO2A 4XVHA 1Y1SA 1MQ9A 2O5RA 1CIVA 4A9AA 4WXRA 3SCZA 3GNTA 1KEVA 4WN9B 4C0LA 2IEIA 1W0JD 1IEVA 4GYKA 1EG2A 3BWCA 4YR9A 4ND2A 4QGGA 1KU6A 1R10A 2IXEA 2XX3A 4PQRA 5EE9A 3RTEA 3D6FA 3HB9A 3SLKA 1UBJS 3C4VA 4X7BA 1KDOA 4EEXA 4DOMA 1P4AA 3MN1A 1ZD5A 2LIPA 5LIRA 3FAKA 1CFJA 3QFTA 4KVGA 4D1YA 2PSFA 3IV7A 3N39C 3LBNA 1AF4A 4ZQBA 4DIMA 3RS3A 1UT5A 3D6JA 4YLEA 5ALXA 1M6VA 3DWGA 4NMLA 4YDRA 3NV9A 2HRRA 2NZVG 4PSCA 5GY7A 3B2NA 3OX4A 4OHZA 3VZSA 4DSUA 4WLOA 2ZI7A 1A9XB 1L7NA 2B4TO 1IL0A 1P33A 3SOZA 4BMDA 1K0UA 4FDMA 5LP6A 2HWXA 3HCWA 1V1MA 2AQHA 2BMJA 2Z4TA 3Q8KA 3DDUA 5AXBA 1XU7A 3HPRA 3AUSA 5AW4A 1BOFA 3WQBA 4FT4A 1K9VF 5H83A 3BXHA 1YFKA 4YEDA 4JELA 1WW8A 1CZLA 1WR8A 1TYBE 3N0XA 4YAOA 4Z8XA 3ZHYA 2ZBVA 1OLSA 5B58T 3ZWWA 2FP3A 4EYGA 3LQ2A 3QMPA 2AWOA 3WK5A 3THSA 3L7LA 3BBLA 5TMDA 3RBXA 2IA5A 3RJ9A 1VGVA 1NSYA 4BZZA 4QG3A 3BFXA 3BN3A 4DADA 3QWIA 3GEPA 1L1EA 1J22A 4GSLA 4LOHA 3VBCA 4GXNA 4V3CA 4OTZA 4B40A 4DV5B 4LY0A 2HCFA 4M2LA 3USCS 4JT4A 4A91A 4DIEA 1T5LA 2HY7A 2NVWA 1AS3A 3CZQA 1UOEA 3DSRA 1BH2A 4LE1A 4I55B 1H0RA 4IDPA 3ROPA 3VAZA 1IPHA 5FWYA 1E59A 1OE0A 2AV6A 4FS8A 4W9NC 4F4CA 2C20A 3EBPA 3K73O 2YWEA 3NALA 2ADMA 3PA8A 3UMVA 2RHTA 2XXBA 5HIMA 3YASA 5ILOA 3F8SA 1CY1A 2AFHA 5IAGA 1ZUIA 2Z5GA 1TZKA 3A25A 3U0VA 3OIDA 1VKHA 2BCGY 3N8NA 3DBVO 5TMEA 4F38A 3KBBA 2G06A 1PE0A 1OWLA 4M0LA 3CW9A 4UMEA 2CC2A 3L0IB 2JFZA 4C0JA 1Q74A 3V2UA 4MRSA 1JMKC 1P2UA 3GA7A 2WAMA 3DE1X 4HRVA 5C3MA 5C81A 3RAEC 3GZNB 4PXYA 3CLRD 4GI5A 5HS6A 3MPUA 1SUEA 1XF9A 2E7ZA 3Q9SA 3DAHA 4AT1A 5FWXA 5FR1A 5JLJA 2MWMA 4PZLA 3FPGA 1RWPA 3CH6A 3EQZA 1P6UA 3NDJA 4HUTA 3R8CA 5FRDA 3HBMA 4RADA 1UDCA 2DFVA 4KXNA 1NBMA 1PUIA 1VQ1A 1XOIA 4RFLA 2C1EA 2PJRA 5JWRA 4G84A 3M4YA 4IVQA 1VJ1A 2OYCA 1XXHA 5HK8A 2R97A 4YA6A 2ECOA 4LFBB 2GZRA 2FPWA 1MO4A 1N5LA 2IXFA 5HGXA 1JDJA 2Q3CA 3VH2A 3L4JA 2ZBUA 5FOXA 1O6BA 4I9GA 4CKCB 1JWLA 1YBFA 4D8VA 3BA1A 3FI9A 4RTNA 3A9WA 5FUMA 1PUXA 2YFHA 1CR0A 4LZWA 1TW2A 3GMIA 4FXPA 4JI3B 2JG3A 3FMFA 1EESA 2P9ZA 1GEGA 5L3SA 4MKIA 5GAJA 3HVRA 3MJHA 4XJTA 3A10A 2ZT5A 4C4PA 2R11A 5CYOA 1PYDA 2V8OA 5KBYA 1Z6TA 1JR3D 2PBRA 3DWIA 1E8NA 3EQ8A 4ENUA 5A5VA 4DMLA 4TTSA 3DXYA 4DLAA 2ZR8A 1LX6A 1V1RA 1QVZA 4LBWA 3T5AA 2AGVA 3KR0A 1U2PA 1UK9A 3P9ZA 1GFIA 2GYWA 3FDFA 4A16A 3EIOA 4HGNA 5AD1A 4QRIA 3AOGA 3GUCA 4P33A 1TTPB 3DBRB 3K4PA 2YMQA 3KKNA 1DS6A 2NPIA 3V8PA 5I9IA 3IAXA 1WZ2A 4O4IA 5I7OA 2XECA 2CDRA 5AKEA 4DT1A 2F3SA 5CDGA 6GPBA 1UM8A 1XLTA 2VPWA 4CVNA 1NRIA 3W3ZB 1Y9DA 3GJYA 1CR6A 1YDEA 4NNPA 4QE3A 3R9KA 4YRTA 1YB4A 2XA2A 5BV0A 1FSSA 2Q0HA 3ZE2B 1WCIA 2R6ZA 1E4EA 2ECFA 1HDIA 4M1KA 2RHLA 4FMPA 4XDHA 2ID7A 3HA7A 1DCKA 3MZ0A 3Q40A 4EBFA 2XT0A 5HILA 1AURA 2A5JA 2QXYA 3LDUA 4FMBB 4LRTB 3I73A 2FW0A 3INGA 1QTQA 3OF3A 3L8EA 1A4UA 5CVTA 2C7BA 4F9EA 4L02A 5CB0A 3G8BA 1Q14A 1M34E 2XGSA 2WHPB 4M22A 3FSGA 3G49A 5REQA 1Z17A 5LYJF 3SVLA 1NVFA 1W8IA 2BGUA 2FYTA 1BGVA 4J76A 4LDQA 5HQ3A 5K6RA 2HCRA 1VHWA 3LK7A 2B37A 2NZUG 2QXUA 3T5CA 4ARAA 1DLJA 3G3EA 2X4LA 5ELMA 1KMCA 1V8ZA 3I45A 4KO1S 1RHRA 2MMGA 1KO4A 3DKVA 2SKCA 4HNQA 1AMNA 5ALQA 3T99A 1ZN9A 4YWJA 4EBBA 3W5IA 1XZMA 3HUTA 1Q0LA 4TYMA 3DZFA 3MINB 2QVLA 3GDHA 2ZJAA 5C1IA 4F4UA 1YJAA 2WSSA 3L0CA 3L93A 2OGTA 3U39A 1UBOS 1SOAA 5AHKA 4BVHA 2HSDA 3LKBA 4AYXA 1GFZA 1N2SA 2FEWB 1N33B 3OAAD 2E1PA 2WAOA 4PHTA 5K20A 3MYRA 4D44A 4RGQA 3PDIB 3I0MA 1TC2A 3QTTA 1JG2A 4FDLA 4ESEA 3DV0A 2W2NA 2XUDA 4P92A 3UAZA 2YWBA 1DG1G 1GSIA 2XODA 5C52B 3IOEA 3MWJA 3CO5A 4IGKA 5D01A 1BHO1 1OX6A 3JQAB 4DV0B 1COZA 3OH8A 4IQFA 2P2ZA 1DIBA 1GZ5A 1XC7A 2I6FA 2JF0A 2WHQA 1MW9X 2XHEA 4O2LA 5HSGA 3F0TA 1YOVB 4CR6A 3G79A 1D0SA 1SZDA 3IUPA 2IXTA 4QT4A 4MK4A 5FNVA 1YE3A 3A28A 2XBUA 5M3BA 2PK3A 1CCWA 3T7AA 1E2HA 3THYB 4PLCA 3I9LA 4R2IA 4AJ4A 4QD3A 5K2OA 4AKGA 2DBYA 1J00A 1KH1A 2Y68A 4YJKA 3N2LA 4Y9RA 3N6XA 4DQVA 2YXBA 3V4OA 2HQ1A 1V2HE 2Q4DA 5BSVA 4FI3C 1E6CA 2RAPA 3C5HA 1T36A 1UADA 3NPAA 4A82A 2IBSA 3KD2A 1OI3A 3AF1A 3WWOA 4DLLA 3DT8A 3KOXA 3SF0A 4CF3A 2Q28A 3H75A 3S1LA 1XYYA 2G9VA 2VHXA 4KYVA 2QHXA 5GVRA 4UUBA 4MVJF 4OGGA 2QTHA 1FZTA 4GWLA 3ZE6A 3MERA 3J81A 3B78A 5IAOA 1POWA 3IP5A 4XKJA 4ZVNA 1LKZA 2V7EA 4R9SA 2A0FA 5AI9A 1K2VN 3GQBA 1J0XO 1VJDA 4JS0A 3CO0S 3C6ZA 5E8JA 1A9SA 1Z8NA 1BS1A 4KAJA 1O96A 1XTBA 1X1AA 4RVCA 1ZOOA 3RVOA 5C5DA 2C7RA 1T9GS 3DE6X 4PIVA 3PZBA 1A9TA 1MAVA 1XU4A 4H2DA 2O7NA 4DLUA 2FG5A 2FMUA 4OATA 5IZCA 1E1DA 5HF9A 2QQFA 1WX1A 3FZQA 1F14A 2CNWD 3Q3IA 1SXQA 2PEZA 1W19A 2XDAA 4Y1EA 1GZSA 2EZ8A 3HR4A 3AV3A 3JQGA 3WA6A 4RM2A 1EHIA 1ZOSA 4HH1A 1BXKA 2PU5A 1KY2A 4IXDA 3ZHUA 1T6XA 4RGBA 4YMLA 5IT5A 1E61A 4OJQA 5EIFA 1YGPA 1LD3A 2GF2A 3H5RA 3ZR4B 4DNXA 2E4UA 4WRRA 5KNDA 2H29A 4MEBA 4AY6A 3FVWA 3I01M 3KAKA 2HJVA 2PRYA 3QVXA 2QYOA 2VPIA 4GM0A 1QIEA 3O74A 4GGOA 4C05A 5KYWA 1I10A 3P96A 4WX2B 2OMEA 1C4WA 1ZY2A 1ABFA 4F2WA 1CZRA 2QNRA 1BHQ1 2A5LA 2XAUA 3DGFC 3HEMA 4NP6A 1YI1A 4KQ6A 4AJHA 1NIPA 5AVRA 2WQ7A 3BMNB 1N34B 1VP9A 4NBUA 4B0PA 3TL6A 3PEUA 5LQSA 3F8TA 3ROQA 4ZOAA 4D26A 1Z4QA 3VR6A 2JFUA 1K7EB 4YPFA 2G9RA 4BE4A 3DB1A 1U2QA 1ZLXA 1T5DX 4CCWA 3KYJB 3A31A 4PFJA 4H59A 1NR7A 4HQ0A 3CUUA 6AT1A 3PC3A 4L78A 4E4YA 2IYLD 3CHYA 1PDWA 1Z5ZA 2WEKA 2FRDC 3T3DA 1TYZA 4Q9AA 2XUQA 4DDTA 1C9MA 1Z7EA 2WD9A 3EVGA 1P4HA 4C7VA 3V6MA 3BJZA 4R71A 2NVBA 2CVHA 4RK4A 4UCWA 4U3JA 2Q2QA 1W0KA 3SC2A 4CYMA 4EWLA 4BPRA 3EVEA 2YOHA 3JXEA 2OSBA 2XTNA 3PLNA 1ODCA 4PGMA 2ZRDA 3S2YA 3ZYZA 4YLYA 3B6KA 4MW9A 5EKDA 2B8WA 2OV2A 1IE3A 1J25A 2AMJA 1NJ8A 2HUNA 1H1LB 3C6BA 3D3WB 1MRSA 4KUHA 5LXTB 5LUBA 1QG0A 3KHSA 1FXWF 4D43A 3CKKA 2QLBA 3B1WA 4HGYA 3OEYA 3KYDA 1LBHA 4X1OA 4EAAA 2EEPA 3D7NA 4IMPA 1T8WA 4AU1A 3HFJA 3AFNA 3FPLA 1VI6A 4HCJA 4YRMA 1C9DB 3OHMA 1KJNA 3CVXA 5AI0A 2NAFA 3V46A 2PMKA 3MRVA 3I5YA 4F4DA 5LB2A 1RXWA 3IQEA 3I1IA 2GJ9A 1IK4A 2V65A 3GJRA 2WPNA 3A0UA 1DXQA 4MV3A 5D86A 3IILA 4XWOA 3JQFC 3R3YA 4L51A 1GAEO 1LDYA 1XD2B 3R7WB 3NHSA 1TF7A 4F4HA 3JWGA 1YCGA 3IKMB 3BF8A 1WS6A 1BC5A 1VE1A 4IH9A 1KDRA 3WNZA 1NUUA 5HWSA 3L6BA 3RANA 3GVCA 2AYXA 1WEKA 2GNOA 1KSFX 4QUAA 1WZCA 4NHOA 1NURA 5C18A 1FBTA 3MRXA 4OU5A 5TV2A 2F3TA 3CMMA 4O4HB 3TE6A 1F8FA 5DRYA 3DAFA 2V7TA 2JJ2A 2UVPA 1Z6AA 1Y6GA 3NTQA 4PU0A 2FJ0A 2WSSD 3I6IA 3K5HA 1XRQA 4ZO8A 3WB9A 2ZW9A 4PBRA 4KFCA 1X1RA 2VCHA 1RJ9A 3U7RA 4A4DA 2OCIA 3AL0C 1UXKA 5E7JA 5TIIA 1CJSA 1C29B 3G0OA 4RABA 1LBIA 3LC2O 1QLHA 3QM1A 4YWHA 1WUHS 1TX4B 3N2EA 3O1HB 4ILEA 3T3MB 3U3DA 1RHMA 5HXAA 1RYFA 5PGMA 3V4ZA 4Z7JA 2XY4A 1ULZA 3H11A 4WH0A 4LSWA 1UXOA 3TR5A 2NVUB 3N3AC 1EFKA 4GX5A 1AZSC 5EWMB 3WWDA 4TMWA 4PGHA 1N2HA 4DN6A 2FEMA 1SU7A 1HM5A 1KRHA 1QXSA 1Y3CE 2C2OA 3ZKAA 4QJ3A 4P4TA 1DDIA 4ND8B 4RCVA 1M2HA 1SWWA 1U9YA 5EJ4A 4P0TA 4Y9DA 5EI5A 3C16C 3I2JA 3WKDA 3EZLA 3U31A 1T2EA 5CBPB 4Q6WA 5CVDA 3H18A 3I92A 2B2NA 3AU8A 5EY5B 2X1HA 3MF4A 4FGWA 2DTXA 2QZ4A 4EY8A 4AG5A 4UMDA 2HPHA 3LBHA 4MUNA 1V71A 1ETUA 3EAGA 4E4TA 4H3VA 2R6HA 3D6VA 1J9EA 4P82A 3R7AA 1XL0A 2F1JA 4LNUA 4XIJA 5I48A 1MCZA 1Z0IA 4W8GA 1G38A 4XPIB 3OQIA 5TR9A 4GLBA 1BDJA 1N5KA 1IONA 4HX5A 4WCFB 2WF5A 3CEJA 1JAYA 3U4HA 1PQUA 1X7ZB 2GCPA 1OOEA 3M1LA 1MRNA 1QYDA 3HA3A 4FD3A 1R4ZA 4LXUA 5JMTA 3C3BA 4HDMB 3EIQA 2XUJA 3KJQA 1J99A 3LBFA 5BSMA 3E35A 4J1SA 4DJDC 1R15A 2UDPA 3FNGA 3KZKA 4UHJA 3T12A 3S7TA 3PLRA 1HEIA 5TGTA 4OVKA 3LVFO 4XH9B 2QR2A 4ED9A 4LHSA 3QLJA 4A23A 1BU8A 2GZSA 2IFTA 2XOXA 1KS9A 3AEXA 3H8SA 3KB6A 4BMYA 1C7QA 3H16A 1U0HC 2HRZA 2QENA 1JHOA 5IEJA 1BDIA 1G8KA 4XGNA 3BBPA 3DEYX 4ERXA 4YJ2B 2IDJA 3C8MA 3UB3A 4H27A 2EF1A 4FEYA 1EEXB 1GCIA 2BMFA 1N8TA 4RAQA 4UOQA 1ITZA 2YJGA 2VUUA 4X6UA 1NV8A 2Y0CA 2ZZKA 2WVHA 1NW7A 1RI4A 1X1QA 2YVKA 3KXKA 4RPHA 1HSOA 2QKYA 3BFVA 1SEPA 5ALJA 2HXGA 1B16A 2Z8YM 3GB9A 5THXA 3UZUA 4GD3Q 4C0BA 4CXMA 3FNIA 4C5BA 5C2JB 3GJ5A 3NGLA 5B58C 1KU0A 3LX5A 3EW7A 5I4BA 3UBMA 2DTEA 4D9MA 2GJSA 1YRQA 2PRZA 4L57A 2JW5A 4WLEA 1DO2A 1PR1A 5C8XA 1R0SA 5EWJA 1KIFA 2FKNA 1WB5A 1EVEA 3E05A 1N8KA 4L76A 2Y0DA 4X1IA 3EIEA 1TZMA 3QW4B 4K6FA 4NRDA 4JUBA 2FHSA 2ZUSA 1FFXB 4UPEA 1IOWA 2W43A 2JKZA 2MYPA 4JUDX 5AHRA 4ABYA 1E1KA 5FP0A 1ES9A 2B5WA 4W7IA 3FNRA 1E77A 3V8QA 1DRWA 2HRCA 4O4LA 1BIFA 1H2FA 3OD1A 4ZQIA 4KWHA 1FDWA 4FFBB 1U8UA 4XUGB 3RUEA 4DMGA 4DQLA 2ROQA 3VBEA 3TLBA 1OBCA 2WU0A 3LHKA 2OP1A 2C2BA 4AIRA 2O48X 1VMIA 1ML3A 1UKVY 1GZ4A 2YWDA 3O9MA 4S04A 2Q1TA 3MHTA 1JIJA 2NUPA 2DFLA 3PR2B 4L4SA 1SA0A 1F2UA 5EJGA 4PN7A 2ZVPX 3AR5A 1PFUA 2AIRA 1OYWA 4PE5B 2H48A 1QAQA 3KOZA 3VNVA 1XJ0A 1RLMA 4LJ5A 4CLHA 4C76A 1QHNA 4D5EA 2WOJA 3TG8A 2CD9A 2FZLA 5C8ZA 4MW2A 2NIPA 1SOUA 2OCPA 3WL7A 1EU1A 1AV6A 2O2ZA 1C7EA 2X8JA 2ZULA 2QR5A 4GS5A 4ETNA 4WT7A 1NX9A 1TYDE 2HIHA 3ABRB 3PYLA 2UZ1A 1SHLA 3L7IA 4MO2A 5CM2Z 3RFVA 2Z1NA 4B71A 1F38A 2ACEA 5CDFE 1FRVA 2QJOA 1YB1A 3IUQA 3RBZA 5L4LA 1FSPA 4LGCA 1OB2A 4G6ZA 2EFGA 5F2OA 4TV8B 4E30A 1T8RA 3AR8A 1W88B 3KAPA 1E3JA 4RDCA 4RVOA 3ZK8A 4MUMA 3H6GA 3KKOA 1CBUA 4GRAA 1JLLA 2P1ZA 2F3UA 2Q4BA 4KXVA 4UCXA 1V3UA 2PKCA 1GNTA 4NESA 2JEOA 1RYHA 4LVCA 1TEHA 4M7WA 4EFDA 2D6FA 3O3NB 4XOIA 1QIFA 1RQGA 1Y34E 1F6DA 4TUYB 1D0VA 1JAIA 2XB8A 3DHEA 2XWBF 4HDRB 5C32A 1RYYA 4JWKA 4WKGA 4PWZA 4RJKA 2WF7A 5B2ZA 4ER7A 2O8EA 1GU1A 3DLAA 2F4VB 1RQLA 2EJUA 2LIVA 2XNDA 1BDHA 2A84A 1LDEA 1VL6A 2I2WA 2WJIA 3DDHA 2B4QA 3DBHA 3PKJA 4G2NA 1DIAA 2ZI3A 3Q1KA 4JJ6A 4OM7A 2Z9DA 3TZCA 4XM2A 4BAUA 4ZK6A 4JXZA 4LYEA 3AEUA 3W1VA 2W6QA 3IKVA 2DLDA 2W2LD 4IIEA 4BRWA 5EFOA 4B3SB 2BVNA 3N07A 3RKRA 1SNYA 4ZD6A 2A7XA 4RIIA 1P7VA 2B61A 1OXUA 5FLKA 3W6UA 4ZCTA 5KCZA 1OQAA 4B47A 3CU5A 2IOFA 1H5NA 4LW8A 4P7JA 4HF7A 3KWJA 4P83A 2QMEA 1HQDA 2W6MA 3ETDA 1T25A 4R0NA 1BEZA 3TDKA 5JNUA 2GHQA 3OOEA 3KE9A 5TQ0B 3INYA 4ZVKA 2ZSIA 5EINA 1DEAA 4PVCA 4AWXA 2HUPA 4O4JF 3NRJA 3I8XA 2VF5X 4AF7A 3IDZA 4M53A 3V5NA 1CF9A 1NATA 3S5JA 1XVAA 1R18A 2IS1A 2H4HA 4LPSA 4UUPA 2VHQA 1Z7BA 4AYWA 1SC9A 1YS6A 2E4AA 3H2IA 4Q7QA 5M04A 2O07A 3OO0A 1ADCA 2E4ZA 1CY2A 2BEUB 1Z25A 2FETA 3ADKA 2D2EA 3DEHA 3FF1A 2OAEA 1WBDA 3IP1A 1NXVA 1ZRSA 2FUEA 1KEEB 3MJTA 3OFKA 3PKIA 1QNFA 4JA0A 5DBFA 3AJAA 3QOWA 5JYDA 5KSYA 2Z83A 4B4OA 4NICA 1ZWKA 4JNKA 3CKLA 3UIEA 4AXBA 5BQFA 2HQBA 3QELA 4M0FA 3VH3A 4QDJA 4OSPA 4EKGA 2CUKA 3G2LA 1SY7A 3ZJ4A 2JIPA 4J6EA 2WSMA 3NBAA 3ZOKA 1P1CA 4G8JA 3UQZA 4L1KA 3ZWCA 3PPIA 5L53A 1IXZA 3ODGA 1JE0A 3OOYA 2VPTA 4TVBA 2ERYA 5FA6A 1C8KA 5BN5B 4Z4HA 1K6JA 5LQMA 2V55B 3LBYA 3U3OA 5JJCA 4HXEB 2Q4TA 4L8YA 4WZBE 3RB8A 3L8YA 3O5AA 3VU9B 3QPUA 4G1MB 1H2RS 3KEMA 4IHQA 3DZBA 3CCFA 3DDZX 4WTOA 4C7XA 4BFTA 1YJ5A 3BWYA 2NP7A 5E0KB 3PC6A 1IJBA 1Y8RB 2RKWA 4JT9A 1ADFA 5HPYB 4UU8A 5ICSA 1J5XA 3ZWAA 5CB4F 5L51A 4HS9A 4TMYA 2ZUEA 2OBMA 3TZQA 1MQ8B 1UBLS 2DULA 2HA0A 1USGA 4Q3AA 5JSZB 3IP3A 1RAEA 1N9GA 4DA6A 2VAWA 3TD9A 2Y1KA 2IC5A 4XA8A 3IRVA 3UT5A 4DJAA 4BMSA 4A0SA 3VHXB 1V11B 4P7BA 3VZQA 2D2IA 4C08A 2RGCA 5BOSB 4ZEMA 4YONB 1MAHA 1FW8A 3OVMA 4DMCA 3ER8A 1X77A 2PUGA 4LHZA 3RTBA 4DNFA 3KALA 2BFFB 3PQ5A 5JQGA 1XEXA 3G88A 3H65A 1GLGA 1R0CA 4RSGA 121PA 3OESA 4ZV7A 4JI5B 5BWNA 3H2KA 5TS2A 4DDWA 5J2TF 1OH5A 5DISB 2ZXFA 1N6HA 1PFYA 3DHVA 1W4AA 4V03A 4AJ2A 2C57A 4M88A 1UEIA 3VNUA 3UXHA 3GW8A 3C3CA 4G63A 3RHFA 5LA6A 3IUNA 3VU1A 3EW9A 1WO8A 1Y89A 1NE7A 3MWGA 1FNBA 3NWPA 4CMIB 3ACCA 3CY6A 2CLFB 3GXBA 2E85A 2VF8A 3FUWA 2ONJA 2OV3A 1V0JA 4XX0A 1AQ6A 4BJ5A 2EZ9A 5JAIA 2VT2A 1MB2A 1PSWA 4M1QA 4D6PA 2QUJA 1SAYA 2CHQA 2IKSA 4OU4A 4PC2A 3U7GA 3Q3HA 4N7MA 1NNI1 2LD4A 3LA6A 3E7PA 1W93A 3W6PA 4NBLA 3GAFA 5DGXA 4E5VA 1I7NA 2ONCA 1L5MA 1BEUB 1ZD1A 5DE3A 1O8CA 2WHRA 1OX5A 3X1ZA 4D3YA 3QVMA 3VDMA 4B3XA 1A2BA 3QV1A 4K9LA 1Q12A 1L5HB 2GPTA 5B1SA 2A88A 2PGAA 3UPDA 1E7SA 3JQBA 2EQBA 4Y7DA 2I2FA 2O3UA 5CMLA 3S55A 4CIVA 2FQYA 1N57A 3WYFA 2O6HA 4MVJM 2FMFA 1L1RA 1BDMA 3HN6A 2GXSA 2G08A 1NQUA 1XELA 1PEDA 4NBTA 4RSMA 1DAFA 3PFGA 2QAIA 3TW8B 4FI3F 4HV4A 4G5GA 1MX3A 4AZSA 2ZGVA 3LLSA 2I1QA 3ESDA 2VNAA 3JZFA 4BFZA 2A0YA 5A9SA 1U9IA 2YY6A 1JSRA 1NRXA 3GLSA 1QFSA 3QVJA 4JU8A 4O33A 1NXWA 4PYRA 4AYTA 4KXWA 5CT4A 1QH9A 1V8DA 2X0FA 2ZUTA 1P1BA 4FXOA 2FCAA 2P6OA 4KV7A 1Y8QB 2PUWA 3WB1A 1ODSA 3WBFA 3AM3A 2PPLA 4RA9A 4WZZA 4Y1RA 5HBRA 4YPVA 1A0OA 1AKYA 1KYYA 1J0EA 3MMXA 4R2WA 1P6XA 5BRNA 3DQZA 3I52A 2H54A 1H6CA 1GL9B 3C3PA 1KI7A 2DY1A 2UVDA 3HCAA 3QPBA 3P27A 2VI5A 1VI5A 3ICWA 2FX5A 3BHMA 4GP6A 5EYPB 4JYPA 2PV0A 1R0KA 4N47A 1RVDA 1SRRA 4GH5A 2VEDA 1TI7A 3H0EA 4US0R 4BX2A 4GM4A 4JQYA 3K15A 3AQ4A 3IUEA 3GDOA 3MT0A 1GUDA 4Q02A 3OTWA 3VHQA 4W5OA 4G9EA 1G19A 3RHSA 4CHTA 4BYGA 2JD0A 3HQ4O 3MUOA 4MCIA 3R76A 4FMCF 4GZ3A 3MJFA 4HNGA 1RABA 4YP6A 1MGPA 4UQPA 5KSPA 4F91B 3SYRA 1P2FA 3S2SA 4IBOA 1FW6A 1CUZA 3IPRA 4UTPA 3E6AA 1WB6A 4AN0A 4KE6A 4U2DA 5H4HA 2FZ5A 2W6OA 3OFSA 5E0OA 2PNJA 1W46A 4URFA 2VDRB 2ZTSA 1G5FA 1AQYA 1YZHA 1P75A 1BHSA 3SC3A 5LP1A 1EVZA 3E4CA 3UFXA 3T1HB 3UUFA 4DV3B 3IVXA 3OZRA 1OGJA 2F9MA 4NE7A 1B43A 1EFRA 3FPAA 4DYDA 1I4TD 1MORA 1V4NA 5AJXA 4LDNA 5CFOA 3U61B 3IB6A 5FWDA 3W06A 5DNDA 5E4FA 2F3RA 1ZMXA 4MMZB 1U0FA 3JR3A 3UUEA 4EUNA 4UM9B 1CDEA 1E5XA 2V54A 4LCEA 2GLXA 2YL2A 3KQMA 3CLTC 5DHUA 3LDGA 3BC1A 1T8SA 4P98A 2VAMA 4P3NA 3VC1A 4DLNA 4JQOA 3W5BA 2VQFB 4OFBA 5ILQA 1V3VA 2XOKD 3ZWVA 1FOEB 1MB0A 3M6WA 2BSXA 1HLGA 5CIQA 4OYYA 1V25A 1EVYA 1LLUA 2HFJA 2E4XA 4OFWA 1Z8FA 3E0XA 4QM7A 2EFHB 4BEVA 1H69A 2IS6A 2OK8A 3DJFA 3EGWA 5C1BA 4AP6A 4W6QA 3WB0A 3D1VA 3LCMA 4BZPA 4X1KA 1UIMA 5LKAA 4FINA 2UZIR 2VZ8A 3PIRA 1R12A 4NCKA 5JZBA 2DTDA 5KMGA 2BBWA 3IP7A 4N4AA 1KMIY 4LXTA 5JAMA 4Q00A 3L77A 5FORA 3Q88A 5EUMA 1KVQA 2BJVA 1HEYA 3N70A 1XDUA 1BMDA 2O3SA 2DQSA 1NVVQ 3DFZA 5DHFA 3WGOA 1HOXA 4OI0A 3ET5A 3DEAA 4LF5B 1L5ZA 2AXNA 1DFIA 3F9IA 1TZJA 3OC0A 4K3VA 4BO4A 1E3SA 3DR5A 1K8XB 5KYKA 5GINE 3VR4A 5A6VA 2GD0A 1EGMB 3AOEC 1Q7EA 4D3FA 3QY0A 4Q01A 1OXSC 4ZOCA 2XUIA 5DM1A 3O4FA 3BCHA 4ARZB 3HYRA 5EQFA 3LYHA 4B7AA 4CTOA 3TYXA 2PVPA 1HKUA 2AG5A 4FIZA 1Z2NX 1EA7A 1WQ4A 1HZZA 1RWKA 4MH0R 5GJWC 4YQEA 3AEKB 3I12A 5TXGA 1HG0A 5IVDA 4EPRA 1RP1A 3I42A 4BFVA 4J0FA 3HGTA 5BQ5A 1M2VB 2FOIA 5HRCA 3WOVA 3O4RA 4XYLA 5F2EA 3PX7A 4JQZA 1Y63A 2HIGA 4CCYA 3WIVA 2OLJA 3R3VA 3ZCUA 5IMSA 1SXJA 2GAOA 1BDBA 3KIPA 3V8NA 3QGMA 1O8BA 2O8CB 3ILHA 2CYBA 4B7UA 5I9LA 5LYJB 4R3NA 4XTRA 2RK6A 3RABA 1KEKA 5KTYA 1ZGHA 4EF5A 3WJAA 3JPYA 2YHBA 1D1QA 2NU6B 3WICA 3T35A 2PJUA 1L3BA 1VMKA 2ECPA 2O05A 4WK6A 3VI4B 3N6RA 1KMHA 2I22A 4Y0VA 4CUZA 3HJUA 4OSOA 5CLLA 2BGRA 3V1LA 4B3IA 4C7KA 4DR1B 1V8PA 2CNBA 3QKRA 1KHHA 3M2PA 1JR3E 3RSHA 4LKRA 4XEUA 1O87A 2QORA 2HU8A 2F64A 1VE7A 2PGNA 4NL4H 1I7DA 1DJLA 3NI2A 2D59A 2X5OA 2J3JA 3P1JA 3BSFA 1S2DA 3WRWA 1MVLA 5BXQC 2Q3FA 3N2IA 1USKA 5ALNA 3TPCA 1XTRA 4AJEA 4DCMA 5H81A 4GC9A 4Y1GA 3RRMA 1MENA 1GTVA 3DNFA 3GRFA 4WNIA 2KB0A 2KM1A 5DYIA 3C87A 3OM1A 3UGQA 1U7OA 3GIWA 2J0QA 3AHDA 3I2KA 3P4YA 2QN1A 5FO1A 3Q85A 3BB1A 4OCZA 1ID1A 1U2ZA 1HYGA 1ULUA 3R5TA 2ST1A 4YAKA 3CNHA 2AUTA 4IDAA 3DTNA 3FNEA 2WFAA 1W36B 4CDMA 3W5UA 1MAAA 4Q16A 3MD0A 2X1LA 1YJ8A 5AVKA 4N39A 4EHIA 5FYQA 4XFJA 3Q8MA 3PNSA 4N5LA 3KSBC 3DOIA 5ERYA 2OLEA 3ORQA 4LSGA 3K6SA 1XQXA 4YP0A 2D00A 5K0GA 1FNMA 3ZNOA 2XMSA 3NHLA 5BNZA 2VP5A 2ZDHA 5ITZB 1QH1B 3K4HA 2AQIA 5P21A 3NJ8A 3EXG2 3C24A 4K3UA 1HG1A 2EVWX 2M32A 4H1WA 4QREA 4QJIA 3AR6A 4O2RA 5AM5A 3U1VA 2E82A 3U16A 2OA0A 1QOQB 2EX0A 1RRKA 2HO4A 3RU3A 1N0WA 1N2XA 2CLOB 5DULA 1C30A 1KAGA 2DF8A 3D8TA 3PXDA 2X5NA 4GZ6A 2PRSA 3FFAA 2NU8A 5CGZA 1E62A 4MYSA 1KOLA 4RNDB 3OPNA 5E9AA 3DFIA 1EZZA 2V0CA 4K2AA 4PO8A 3SZLA 3NM4A 4INPA 2AOTA 4Z4IA 4KMSA 5K8VA 3RS5A 3OLCX 3ABIA 1RACA 4BB9A 2A9OA 4MUGA 1DQSA 1N3BA 3PGVA 3R6GA 4ZP1A 2MCFA 3VDNB 3W4JA 2JGLA 3H2BA 5K99A 1BG6A 2ZVJA 4JB8A 3U48A 3B1KA 3HC7A 3AUJB 2VJPA 3K7EA 4YGYA 4RELA 4EYSA 4YPOA 3DAYA 2AOWA 2VNIA 2QMYA 4IV8A 2QG9A 3Q0IA 3NHPA 3F73A 2ENUA 3RYHA 1YZGA 1Q1QA 2FUG6 4D4HA 3RIXA 1XCMA 3VPDA 4BU0A 2Y4NA 4WKNA 4DSZA 3UGJA 3GMTA 1HT3A 2NSJA 2VHEA 5EGSA 3E5MA 3OO1A 1WCYA 3W7VA 3DLHA 5LLDA 3ZHCA 4NDZA 2VDKB 3EGXA 4Q3OA 3W34A 4ES6A 1U0RA 4IINA 4TS3A 4RPJA 1VYVA 3FTQA 1TL7C 5EP3A 1IQPA 4G8DA 3JR7A 3RU2A 5G53C 3C4JA 2ID8A 2IXAA 4EYOA 1FU7A 3AYZB 3SX2A 2XNKA 3UN1A 3CG0A 4BV8A 3T8YA 2VBIA 1DINA 1KAQA 4UTZA 2BGMA 1T91A 3LTEA 3SP1A 2J32A 2W93A 3A1WA 1HDGO 1US8A 4H7EA 3QXCA 4LV5B 1S0UA 1Y1TA 1Y6JA 4KREA 1JYSA 3KV1A 5J4YA 4DUYB 4IHAA 1ZN8A 3GVPA 4WDRA 3ZNPA 3AVPA 1EXMA 4B6QA 1Y3DE 2I0FA 3QFRA 3T3HA 4FYKA 4CDGA 3D3JA 3DKPA 4QVKA 4R83A 4Q1FA 4QXRA 5FTJA 2GQ0A 2ZE5A 1IHUA 3AHIA 3CIFA 1N2EA 5CYFA 3VR4D 5L6MB 3OCVA 5DASA 4DJ5X 3SG0A 5IF3A 1GG8A 2Q6KA 3EYWA 3AW8A 4WFQA 4XFKA 5EUBA 2J3HA 5H70A 3CW2A 4BBAA 1UMBA 4BS9A 5KJEA 2Z08A 1NKSA 1QE0A 2AQKA 2R79A 2WAXA 4YRPA 4BQIA 1SOMA 1NSFA 4RW0A 4OQYA 1R66A 1UXIA 4EG4A 3VAAA 1JB1A 2XUGA 3ISTA 1QB7A 4A8HA 2ZI6A 3ZY4A 1XWFA 1TO1E 3DA8A 1U3DA 4HS4A 3R3HA 4K9KA 2VOEA 2IUFA 3WK4A 1AKTA 3BTUA 1ADBA 1BGXT 3O0DA 2JJMA 5KOIA 3GCXA 3A6FA 4K1LA 1QOZA 3SEFA 1KIMA 4GIBA 2O8VA 3C3KA 1U7HA 2PDAA 3I05A 3KL4A 3BIWA 1YFLA 1PLJA 2NMVA 4F93B 4MP8A 4D8XA 3TNDA 4R1SA 2C7PA 2J08A 4JK3A 1ZITA 3PGJA 4DMKA 2HHCA 5ALMA 1PGPA 4B09A 4GRIA 4A26A 4MKXA 4G37A 3PPYA 3LUJA 2JLXA 3GLHB 5JRZA 2L82A 3TTTA 2BR5A 1P0PA 2B21A 2PGLA 4IICA 1WD5A 1HYBA 2NP6A 2GAIA 3RREA 1DC7A 1B0PA 3A32A 2C61A 4HZIA 4V1CI 1OH7A 3FNFA 4ZT4A 3DAOA 3W3AA 5DGIA 5EZ5A 1E2NA 3SI7A 4YRQA 2PT7A 2OCDA 1KQPA 2ZQZA 5JUWA 1F0NA 3OEHD 3ETEA 2UYCA 3U7FB 5TLSA 3DMHA 4TMZA 1JR6A 2KMLA 2Q7XA 1I32A 3FCYA 3F6EX 1SQFA 1PJ4A 2VDJA 4KVAA 4R1MA 4ZI2A 5KJFA 2X1MA 1W5BA 2PFSA 4O08A 2N1BA 3RROA 2YCBA 4EL5A 1PWYE 4LAFA 1SQSA 2XV1A 4G0UA 1SIUA 1WWKA 1F9AA 3RC1A 5LWHA 1WLSA 4KH0A 2ICAA 2AR9A 2YNMA 4NK5A 1T0BA 3L02A 4NOMA 3HB5X 4BJ6A 5BSEA 2EQ5A 5ED4A 3FF4A 3W8NA 1L7RA 3KXPA 2R66A 1N5JA 1HL3A 2VWGA 1W2HA 1XTVA 2XB9A 1XZLA 1NBIA 1NXTA 1VJ0A 1JX6A 2UUOA 2XCIA 3LY9A 3HVIA 1NZFA 1C4XA 4NZ9A 2O2IA 3ENQA 5D87A 4WA7A 4B79A 4UNRA 5IM4A 4YYZA 1LV7A 4HFRA 1YBAA 3SSNA 4YACA 1PS8A 5CP8A 3R6TA 3FLMA 4ARVA 3H13A 3PUHA 3PITA 2R9VA 2H2HA 4S24A 2ZATA 2X0EA 3EQ2A 1O97C 1VMEA 1Z6QA 2ZYVX 3OETA 4JC0A 3T7CA 1DXOA 4GPEA 3LGXA 5IW8A 2AQ8A 2OAGA 4J0HA 2J31A 2Z1MA 4F04A 5GTDA 2EIXA 4TQAA 3L4KA 3K0AB 4TKUB 4LV6A 2FX3A 5CITA 4HN9A 5GJCA 1FP2A 2BF7A 2FAXA 2DHDA 2HTEA 2WJPA 3UOAB 4HNUA 1VYTA 4GKVA 1GTSA 5AW1A 3JD3A 3I2YX 1B4DA 3O31A 2ACKA 2PBFA 4KN6A 2CZGA 4H15A 2IOQA 3QOYA 1ONOA 2ZYWX 2OORA 3U4QA 3RK4A 3D1JA 3ZOZA 2ZI9A 4LSZA 2XMQA 1ZGBA 1TIPA 5BT9A 3W04A 3FBTA 3RIEA 5ADWA 4IEIA 4JR0A 2JC3A 4NEGA 3UGTA 3VZRA 1SB8A 5IVKA 4PCUA 1E6KA 5I51A 2EQAA 5E6UA 2QUBA 4GBGA 1DPFA 1GGKA 4DCVA 4YJFA 1N1GA 3PDCA 4DRZA 2RAFA 3QVGA 4GI7A 4X24A 3C48A 3MWLA 2RG1A 4P3KA 4EKDA 1VPWA 3NV7A 3U1TA 5TPWB 4O2BF 4JI8B 2X6QA 4P3XA 2DHQA 4QARA 4RKFA 2FW9A 1P7CA 3CTPA 4YI5A 3L8DA 1MVOA 4P0PB 2AN5A 2QRVA 2NO1A 3LT4A 5CCXA 1KYVA 4HQOA 2ALJA 3EIUA 1NFQA 1Y3FE 2LZ0A 2Z3VA 2ANBA 3BX1A 1QOPB 3E2MA 4ESOA 3GJ4A 3QK7A 1NF8A 4UTXA 4DRYA 4QGSA 1MFZA 1P4SA 1WXFA 4TV9F 3SVZA 3BERA 2YN4A 4QNRA 2O8BB 2OK7A 5L4NA 2NUAA 3OHPA 1OCEA 5M2QA 2YN2A 4ER0A 1T4CB 1AS2A 1AQIA 5AR1A 4YRJA 5SYNA 3VSCA 4XVUA 3KOYA 1EIWA 2NO4A 4F71A 1A88A 4QBGB 2IQIA 1QIGA 4GWKA 1CP2A 4ND7A 4B35A 3L7KA 5KUTA 1Y9AA 4WKBA 4BTVA 4IVNA 2IYOA 3OLWA 1EWVA 2ZKLA 2GN0A 3EVAA 5CU7A 4D80A 4R9UC 3MGCA 2FR8C 1PNQA 1GVNB 4I1VA 5LZ4A 3EZXA 3UF0A 1BXGB 1Z34A 3CVOA 2Z43A 3KZVA 1PJTA 2FZVA 2BI7A 3QE3A 4MKFA 4XQEA 3U09A 1O94C 2BKUA 4CIYA 5J4KA 4KQEA 5DNCA 4AZ3B 1LJUA 3MILA 3R0JA 4DLSA 4WUTA 4AZVA 3M49A 3EC7A 4BMNA 4BE9A 3DWEX 4YP5A 1MC8A 3ISJA 4FDTA 3GPIA 3EFBA 3ML1A 3U3JA 4RV5A 4RKYA 1JLHA 2NSYA 3IAEA 3ND9A 2X19A 2OP0A 3PCXA 5A3QA 1XZ8A 1U94A 1K92A 1GR0A 1X9GA 1AHIA 2AFIA 4U6QA 3QVSA 4JCOA 2XE6A 2Q6IA 4TSFD 3PNBA 4YV0A 3PD7A 5JANA 3MQ2A 4QVGA 4TPKA 1TTHA 2I54A 1YB5A 3P9SA 1MT0A 1GZ6A 3GVIA 5COQA 3T06B 4DQUA 2AL7A 4DJJA 1B0UA 1AGPA 3HDTA 4M8KA 3LX8A 3OOJA 5F64A 5AK0A 1O4WA 1G60A 4JUFA 5B1EA 3QH4A 1J70A 3LP8A 3E1KA 2G1KA 3IAM6 4D4MA 3G9XA 3PWZA 4AJIA 3J7AC 3DZKA 2FB9A 4WN9A 4IJQA 4ALIA 4B3TB 1N6OA 1QZZA 3L0OA 4QC2A 4X92A 3ZLTA 5ESDA 3F7NA 1BFKA 2V74B 5T67A 2YJZA 3UH1A 2EKBA 3GLRA 2NOAA 4N65A 5ICGA 3LQKA 1CYDA 5F21A 2YMLA 2BY4A 3L84A 4NJMA 3SJCA 2C98A 4TYYA 3WB2A 1JDBB 1MKYA 3D6UA 1XG5A 3HJAA 4EGSA 1K4KA 2PXXA 2QN3A 1MBZA 3PLAE 2JHCA 2C9CA 3HZZA 1ZESA 3B85A 1A7JA 2C7GA 1FQOA 4M54A 4NCIA 5IKOA 3LX6A 2GCGA 4DLPA 1A9XA 1XRSB 3D3EA 2AK3A 5HUHA 2AZTA 1EDEA 2E89A 4CIXA 2CLMB 3BD6A 4JX9A 1ACMA 1JV2B 3EOZA 3PRKE 5TT1A 4UTOA 3PC2A 4TT3A 2LR0A 1GPLA 4URUR 3I1JA 4JBWA 4UHFA 3KJEA 2PVCA 2VHCA 3LFUA 4NJEB 4HZUB 1SXPA 4PANA 3EE6A 4KQMA 3EXIB 5BV8A 5DI9A 5HFAA 4LI0A 2AOUA 4I2NA 3TOCA 2J0SA 1BMFD 3RRBA 2ZRAA 1OTYA 3OKFA 1VRWA 3LSYA 1IAVA 1UJBA 1X7XB 4YC7A 3ZHQA 4BWVA 5LP6F 4MCAA 3E1GA 2IPNA 3EUFA 4O4JB 4WY2A 5FIUA 4OLAA 2I4LA 4ZQFA 5JEDA 1L5QA 2CHEA 1UPUA 2O7SA 4ROTA 2W6CX 5LMNB 1KFBB 4EUHA 5C4IA 3D2CA 3EG9B 4A6DA 4BNJA 4EP1A 3EFOB 1CS0A 5EE3A 2EG5A 2HWKA 4DWOA 1U02A 1ZI6A 2IYPA 2R7KA 1H5QA 3NAQA 4AY3A 4FK8A 1FRFS 4ZU1X 3TK1A 4BWYA 2ZUCA 4ZCLA 2BONA 1D7OA 3AR9A 3EYAA 4MP6A 2V5UA 1GZUA 1PJCA 5DJ5A 1ZI9A 1NI4B 2BFCB 2V6IA 3G13A 1JIVA 3AXSA 3KKPA 4LDRA 5FUVA 2W2TA 3QA3E 1RYZA 3B8HA 4GYWA 2DHRA 5IAKA 3OQVA 1XMXA 4HB3A 5J2UA 3KXDA 1OASA 1QCYA 4QXOA 2GD6A 3EHEA 2BP7B 2ATEA 4P4GA 1E64A 1FFHA 1EP3B 3MT7A 3SFTA 2JFNA 1YGYA 3P9KA 1V5FA 2JGNA 2ODWA 3GZNA 4DLZA