2K4MA

Solution nmr structure of m. thermoautotrophicum protein mth_1000, northeast structural genomics consortium target tr8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of M. thermoautotrophicum protein MTH_1000, Northeast Structural Genomics Consortium Target TR8
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
molecule keywords UPF0146 protein MTH_1000
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03686 UPF0146 Uncharacterised protein family (UPF0146)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2k4mA00
3A25A 3EPPA 1D2GA 2R3SA 2V74B 2ZBQA 3KR9A 1MJFA 2C7PA 3TFWA 1AF7A 1U2ZA 3GRZA 3A4TA 2ZCJA 1QANA 1F38A 2A14A 1NV9A 3Q87B 4O29A 1DUSA 3FUVA 3FYCA 4P7FA 4P58A 5CVEA 3LCUA 5DPMA 5FTWA 1ZHFA 4KVZA 1P1CA 3TLJA 3FUXA 4RVFA 1JG3A 1XVAA 4HGZA 3EMBA 5EEHA 4EQZA 3ERCA 3EVDA 3P9KA 4FT2A 4B17A 2E5WA 5DRYA 3DH0A 1SVUA 2P3OA 1L3CA 2GPYA 3T7RA 1R00A 4YUZA 5DX0A 4ATNA 3MCZA 1VBFA 3JWHA 5DRTA 2GA9A 4M37A 3KQTA 3NVMB 2B78A 3LBFA 3LKDA 3A27A 3X0DA 2PX5A 4X41A 4AZWA 4GBED 3NDJA 3IHTA 4E2WA 4YUYA 3R3HA 5C0OE 1SUSA 4DMGA 4PNEA 3BGDA 5P8WA 7MHTA 3B3GA 3M6XA 3MERA 2OPBA 1UFKA 3HP7A 5DX1A 5EMMA 1JG2A 2OBFA 1JQ3A 3R6TA 5DWQA 4XUCA 1EQAA 1NW7A 4PCLA 3DMFA 3P9IA 3B5IA 3GRVA 5LQRA 3OZSA 3UA3A 2UYCA 3D2LA 3GWZA 4ER0A 1XCJA 3CC8A 3OFKA 2BZGA 1VQ1A 5ICEA 3KPVA 2AZTA 2HNKA 3DP7A 5GWXA 2B3TA 3RW9A 1TW2A 3LBYA 4MWZA 4DZRA 2HMYB 1ZKDA 2ZWAA 3MTIA 2Q41A 4R05A 3SXJA 3S68A 3CJRA 5FHRA 2HTEA 4FGZA 3BWCA 1BHJA 4C07A 4RYLA 2BH2A 5K09A 2AOUB 2P3LA 4PIPA 5CVUA 2O06A 3KR0A 1KPIA 2ZSUA 4EKGA 3FTEA 2P7IA 2PSSA 5E9QA 5FWDA 4YV2A 5K0CA 2YR0A 2JH8A 3IEIA 5KYGA 3MHTA 3WSTA 3FUTA 1H1DA 3HVJA 3JWIA 1VPTA 3KR1A 3FRHA 3BZBA 1VP9A 3KU1A 1WS6A 2AN4A 5EC8A 2OXTA 2ESRA 4U7TB 2PBFA 4PGGA 3SGLA 1TPYA 1RI3A 3CGGA 2NXEA 4YUVA 1JSZA 3ELDA 4IKPA 1Q0SA 4BP1A 4FR0A 5C1IA 1SG9A 3PFHA 4WVLA 5B1SA 4QQKA 4QPNA 1YFJA 1R8YA 1X1AA 3HCCA 2EFJA 3OCJA 5GM2A 4HG2A 3A7EA 2NXJA 3KQPA 2O57A 3R24A 4GOND 2XVAA 3KR2A 5T67A 4YMGA 1RI1A 10MHA 3THSA 1YF3A 4RTSA 5CCBA 4ER3A 3G2OA 4MTLA 3BXOA 2Z6UA 2K4MA 3O31A 3QV2A 4RV9A 4U7PB 4F85A 4RSRA 1VE3A 3M6UA 5KVAA 3P2EA 3PFGA 4PYNA 3ER9A 3C6MA 3QOXA 5CIYA 1KYWA 2UYOA 2B25A 3MGGA 3UJ8A 2IIPA 4PYQA 4P7KA 5FCDA 2IH5A 4Z2YA 3UZUA 2O05A 3KQMA 1YZHA 3NDIA 2JH9A 3LHDA 5KQRA 2GB4A 3G8AA 5EMLA 2Y1WA 3FTDA 3PB3A 2I62A 3TQSA 4C4AA 1HMYA 4GC9A 3SSOA 1JQDA 3TM4A 1Y8CA 3NWBA 4BLWA 4OQEA 4RTQA 4HRAA 4QTTB 1SKMA 1OR8A 4AZTA 1G8AA 3PX2A 3IYLW 3BWBA 4M36A 4E33A 5E8RA 4QTUB 1RI5A 3HA7A 2FK7A 4P7GA 4PYOA 4C03A 3HA3A 4Y2HA 2BM9A 5F2OA 4QPPA 1NBIA 5EKUA 1NW8A 4RVDA 4CKBA 3DULA 5HIKA 5GIOE 3BT7A 2PWYA 2Y1XA 3BWYA 2OKCA 3HCDA 4PYKA 5HILA 5BW4A 1NE2A 5E1OA 4P7JA 5K0NA 3IV6A 3LGAA 4OA8A 3TM5A 3OZRA 5U4XA 2JG3A 1R18A 4CWAA 2AVDA 2QE6A 4DCMA 4MHTA 2P41A 5FQOA 5FQNA 5FADA 4R6WA 5CUQA 1EJ6A 4EVIA 1WY7A 5K0GA 5T6BA 1WXXA 4UOEA 1O9GA 2NNWB 3PS9A 3EVZA 3UJBA 2IDJA 2EX4A 1RJEA 5LQUA 2PGXA 1XTPA 4F86A 3HCBA 4KW7A 1VIDA 3HVIA 2GLUA 5BW5A 4RX1A 1N7JA 5KQSA 2G72A 5E9WA 2FPOA 5E1DA 3HVKA 2AOWA 4PGHA 4Y30A 2YQZA 3REOA 5C9ZA 4OBXA 3BKWA 2JJQA 5LR6A 2ZIGA 3ELYA 3BGVA 5ICCA 2ZZMA 2LD4A 2XYRA 3BKXA 1T43A 3DXZA 2ZULA 4E32A 3UWPA 5EZSA 3C3PA 4X60A 1R74A 5EQJB 1JR4A 4R6XA 3UJ9A 1RJGA 2B2CA 3RIEA 3NTVA 5K05A 4HH4A 4E2ZA 3OFJA 1JTFA 3DXYA 5DM2A 1JG4A 3TKYA 4GOOD 1FBNA 2JHPA 3EVGA 4FZVA 5LQNA 3PVCA 3TRKA 5LQJA 3G2QA 3ME5A 1IY9A 1EAMA 2VS1A 3PX3A 3UJDA 4FS8A 3EVFA 5EEGA 3THRA 3GXOA 4OQDA 2F8LA 3CJQA 3F4KA 4HGYA 1P91A 1YFLA 3MB5A 3M6WA 3Q7EA 1KR5A 4POOA 4ER5A 1I4WA 1M6YA 3CKKA 3FUUA 2GAFA 1YB2A 4PIMA 3B3FA 2OYRA 3UJCA 5BP7A 2I9KA 3CJTA 1JSXA 2AVNA 2PV0A 4MQ4A 3EEYA 4PYIA 4A6EA 2R6ZA 4GOMD 3G5TA 4KIFA 4M7RA 4ZTBA 3O7WA 1PJZA 3GU3A 2KW5A 3T0IA 2YTZA 4GQBA 1F3LA 2AS0A 3SVZA 3HCFA 4C04A 1NT2A 1YZ3A 2QY6A 3MQ2A 5DM4A 3ORHA 1D2CA 1AQIA 3ID6C 4KWCA 4PYJA 2V7EA 3OU2A 3PLAE 3G2MA 4FT4A 2O07A 3I53A 4A6DA 4BLVA 5HOQA 3LDGA 4IV8A 4V0QA 3FPHA 3ELUA 5EMJA 3SSNA 5K03A 4RTOA 2YXDA 4OX9Y 1NBHA 2XBMA 1XCLA 1VP3A 2AOUA 2AOVA 2FK8A 3DLIA 1KP9A 5IKMA 5CD1A 5HFJA 2QM3A 5E2AA 2UYQA 2PVCA 3T7TA 4LWPA 5G02A 2P7HA 2OY0A 2OZVA 4V0RA 5EMKA 3SR4A 5DM1A 3G88A 4KIGA 5T64A 2PJDA 3FUWA 2XVMA 3EVEA 2PXCA 5CM2Z 1KXZA 1XDZA 4GOLD 2XYQA 1UWVA 4PYLA 5K0BA 2ZZKA 3LSTA 4NECA 3C3YA 2ZW9A 1INLA 3NJRA 3GRYA 2PWPA 4AX8A 3E05A 1TW3A 2VDUE 2JHAA 3LL7A 1FP1D 1QAQA 4CKEA 2VDWA 1VLMA 5FWAA 2CMHA 3G8BA 3KQSA 2UZ4A 2YXEA 1DCTA 3P2IA 3B89A 3P71T 3NW9A 3H2BA 2YXLA 4BLUA 4ISCA 1XDSA 3EEOA 3ANXA 5DXAA 5GM1A 4K6MA 5E9JA 2H11A 2OB1A 5BXYA 3AY0A 5CCXA 2BR5A 5LQAA 3FPEA 3TMAA 4GEKA 2IFTA 4FP9A 4GC5A 1M0EA 3DOUA 3E23A 2PXAA 1EJ0A 2YVLA 4E31A 3KPYA 3MAGA 4C06A 2CMGA 3PT9A 3I64A 2AR0A 1B42A 2N47A 4ER6A 2IP2A 4CTJA 1FP2A 1G6Q1 1WZNA 4KDRA 3G2PA 1L3BA 3KPJA 4OBWA 1M6EX 3AXTA 3FRIA 3TKAA 1NW3A 1EG2A 1P39A 3C0KA 4RVHA 2IBTA 3KQWA 2O0LA 2PT6A 5E1BA 4KDCA 4X1OA 5EIWA 5EIFA 1G38A 4DA4A 2ZBRA 1JQEA 3KQYA 5E1MA 3LX6A 4HSGA 3K6RA 2ORED 4QDJA 5K0EA 4GUAA 4RWZA 2IBSA 4AZSA 2IDKA 4XUEA 2BM8A 5E8JA 1BC5A 3SMQA 4LWOA 1O54A 5D1NA 5ICGA 1D2HA 2EJUA 2G8NA 4LECA 1AQJA 2FCAA 3HCEA 2Z6QA 2FHPA 3R0QA 2ONZA 3KPUA 2PT9A 1KYZA 2VDVE 3A7DA 3SM3A 2P1DA 3CBGA 1NV8A 2H1RA 1QAMA 2WA2A 1L1EA 3B7PA 3FPFA 1XDUA 3GGDA 3M6VA 4R8RA 5HZMA 1FPQA 3KHKA 5K0FA 3VC1A 3BGIA 2DPMA 1MHTA 1AV6A 2QRVA 1HNNA 5M5BA 5KS2A 3LDUA 3TR6A 4YUXA 3E8SA 2XYVA 1KPGA 4AZVA 3VSEA 2OO3A 3GIWA 5HIIA 5JR3A 3LDFA 5MHTA 3DXXA 1L9KA 2P8JA 2VP3A 2I6GA 2AN5A 4QDKA 5EHIA 3KPWA 3HNRA 4EKIA 2CKDA 4M38A 4CTKA 3MTEA 4YV1A 5LSAA 1SQGA 1QAOA 5GP1A 4DF3A 3AXSA 3C6KA 1G55A 4MIKA 2EJTA 2UYHA 3I9FA 1IM8A 3L8DA 5D1HA 2ZLBA 2IH2A 1RJDA 3FTFA 2PLWA 3FPGA 3GJYA 1R8XA 3P2KA 5CVVA 3SSMA 4E70A 4L7VA 2WA1A 4QQNA 2HWKA 4PONA 4LG1A 5EHGA 2YUIA 3O4FA 1BOOA 1YUBA 3DR5A 3NVKI 4PCAA 3GDHA 2I7CA 1XXLA 3GRUA 5EZQA 2ZZNA 4RVGA 5H02A 4H0NA 5HEKA 2C7QA 1X1DA 3OU6A 3OZTA 1NW5A 3VC2A 4EMSA 5DT2A 3JWJA 4HTFB 4QVGA 5JUWA 2P40A 4RTMA 3KKZA 4FSDA 2AN3A 3LECA 1RI4A 2ERCA 3OE4A 5ERGB 4F84A 3BWMA 2ZIEA 2BR3A 2NYUA 2CWWA 3UJ6A 5K0JA 1RJFA 3ELWA 5GINE 3I58A 4AUKA 1JTEA 2NXCA 1WG8A 5IH3A 4RTPA 2PX2A 5DLYA 2YX1A 3LCCA 3DUWA 2AOXA 3TOSA 5DM0A 2OB2A 5DTQA 3RODA 1SQFA 1ZGJA 2QYOA 3G5LA 3JWGA 3OE5A 4QVKA 4YUWA 4G56A 5LQKA 5GIPE 2C7OA 3LKZA 2IGTA 4XCXA 5DSTA 1NW6A 5EG5A 5EKXA 2HR1A 4ER7A 2AOTA 3GO4A 4JXJA 2Z6AA 3R9XB 2GS9A 5FUBA 4RTNA 1N2XA 1Z3CA 5EGSA 5FA5A 1G8SA 2NP7A 4X63A 3EVCA 3QOWA 3UJ7A 3LPMA 1QYRA 3HVHA 5F2NA 3M70A 5CVJA 5ICFA 4E2YA 1RI2A 4IV0A 3FTCA 1DL5A 3EVAA 3P97A 9MHTA 2H00A 4YMHA 3I5UA 1L3IA 4EK9A 4RTKA 3AWIA 5K01A 3UJAA 1X1CA 3HCAA 1KPHA 1ORIA 3GRRA 3KQQA 3V8VA 2PX4A 3P9NA 4CXMA 2ZTHA 5EOVA 5K8VA 2ONYA 8MHTA 2G71A 5F2KA 2GH1A 2FRXA 1X1BA 3EMDA 5DTMA 1ORHA 3KQOA 5CVDA 5DXJA 2G70A 3P8ZA 4E30A 5DSXA 5GOZA 3E7PA 1G60A 3LCVB 4DM3A 1I9GA 3OU7A 2ZVJA 1NKVA 3NWEA 2IH4A 1BKYA 4DCGA 3HTXA 2DULA 2ZBPA 5DX8A 3SX0A 2P3QA 2NXNA 4IWNA 4C08A 4RTLA 3KQVA 1SUIA 2P35A 3CCFA 3MCTA 3FYDA 2CL5A 5EVJA 5FHQA 5HIMA 3UA4A 1O9HA 3FPJA 3EGIA 3GCZA 4HTFA 3B3JA 4E2XA 2ZIFA 5DTRA 2ZFUA 4DQ0A 1N7IA 4OA5A 3M33A 4WXHA 5E2BA 3EGEA 2BR4A 2PKWA 3K0BA 3FZGA 2C7RA 1XJ5A 4RTRA 4CKCA 4RTJA 4DKJA 3A26A 3DMHA 3HEMA 4PWYA 5HIJA 1P1BA 5FULA 3DLCA 1JG1A 3PTAA 4FSXA 4BP3A 1Q0TA 1KHHA 1PRYA 1V39A 3AJDA 3M4XA 5EPEA 3T7SA 2B9EA 2HV9A 4XUDA 1X19A 2ADMA 4YV0A 3DMGA 4X61A 4PINA 2WK1A 4BY9E 1KIAA 3G7UA 2JHCA 3DTNA 4HC4A 4GF5A 1VL5A 3TPZA 1EIZA 3EVBA 1FJXA 3NMUF 2IPXA 1UIRA 2PX8A 1R6AA 1ZQ9A 3VYWA 2FYTA 5FA8A 5K0LA 3G89A 3U81A 4C05A 2NP6A 2AOTB 5LQCA 3UFBA 1QZZA 1WXWA 2PY6A 2QRVB 1I1NA 4PYMA 3P9CA 4KRGA 3ER8A 3CVOA 3BUSA 1IXKA 1ZGAA 4R8SA 2G1PA 3HA5A 3EGVA 3GNLA 2VZ9A 2ZWVA 3OPNA 1ZG3A 2PXXA 3V97A 2EG5A 3HM2A 3UBTA
chains in the Genus database with same CATH superfamily
2P9FA 3BEOA 3USZA 4BGVA 4JVOA 2KE5A 4Q9HA 5I9IA 1GQOA 2JI6A 3ZK7A 2O59A 4HEJA 1I4DD 3A4TA 2O2XA 3FKSA 5HJ5A 1Y6GA 4J2HA 2IYSA 2QB5A 2WTXA 4TXMA 1QTRA 4Y0AA 3WDLA 4MWDA 1FF9A 3STUA 1Q92A 5M3BA 1BMQA 5AP9A 3EX7C 2B7BA 4CNQA 4MYCA 4OL9A 1HQDA 3L0OA 1RHKA 1KH2A 3COWA 2ZT5A 3QTLA 4HVLA 3KEOA 3QPUA 1DZ3A 1NQTA 1W49A 2CXOA 2VHEA 4US1R 5CW2A 5HA5A 4XEHA 3FMVA 3CZ4A 4XSHA 4AQYB 3EXHA 5E4YA 4ECEA 1O4VA 3FOCA 1O95D 1U2DC 4UXJA 4HV4A 5CFMA 1T9DA 2HW8A 5C0OE 3BFJA 4QASA 5BOSA 2GZAA 2Q9BA 1P5JA 2PRSA 3CR3C 5P8WA 1IXRC 1QUFA 3F7TA 1YVRA 1NM5C 2C3UA 3L41A 2CMKA 1YIOA 4JH0A 3VNSA 4BEWA 4I99A 1Z0SA 2ZUBA 4PPNA 3VJKA 3P2YA 3VPCA 2VOJA 4HYTA 1IZZA 2V54A 2GLTA 2VO1A 4QJ4A 4I6EA 1OXKB 1R5NA 1R9MA 3GWZA 1K1EA 4Q4HB 1Q22A 1C7EA 1YVUA 4QUBA 5AKYA 2DFDA 1ZLXA 4Q7JB 3PJRA 3KZXA 1IQPA 1U1GA 5FX2A 4IWXA 4UE6A 3S55A 3I0NA 4YP6A 4JYPA 2B3TA 1E98A 4MWZA 4R1QA 5TB5A 3WJ7A 2ZJOA 2V4UA 4DSTA 2Z0MA 5DLEA 3ZWBA 1P9NA 2ZRNA 1NDQA 5JNRA 2QLFA 2ZBFA 4C0XA 2O5EA 2YN2A 2VBFA 3P9PA 2ZUEA 1K86A 2FPXA 3HZRA 1E3QA 4YMVA 3E35A 2AJLI 2MMCA 1Q16A 3JAMA 3Q7PA 4LRYA 1Z16A 2PMFA 4QX6A 3TQRA 2C2OA 3TMKA 3NWPA 4NVRA 1T6XA 3PIDA 3AMVA 1FTYA 1QR6A 2OBMA 2QK4A 3ZZUA 4AROA 5BRAA 3AVVA 1SHLA 1HRDA 1KEUA 4YQFA 4KNYA 2QTRA 4YALA 3VKGA 2W2MA 4JFRA 2BBWA 4XYEA 3DM5A 1P33A 3QY9A 4XJSA 4BMCA 1CJBA 1J5PA 1V48A 1KETA 2YN0A 3ITDA 3LOUA 2I6QA 1HA3A 3N76A 4FYJA 5EWMB 4YUVA 1IN6A 5IWCA 1N3IA 3SYLA 1I1QB 2FSGA 2ZDQA 4FR0A 4GICA 3LCJA 2HADA 4CMEA 4N82A 2NACA 3FHLA 2ZRDA 4KKVA 1A8QA 4I9HA 3V4VB 3FJ1A 4IDFA 4L22A 3DCJA 1FDOA 1C9DB 1XCOA 1DO2A 1F2UA 3IQXA 5LDDC 3PE3A 5HG0A 3E7FA 3JTMA 2AZ4A 2GDZA 3T52A 3OT5A 1J33A 5EE5B 1F6BA 3ZV6A 3NC4A 4OJKA 1RI1A 3JX9A 3EZFA 4UOZA 2OHVA 2VDJA 3W05A 4F96A 5DLQC 2ODNA 3O31A 3QMMA 4B6RA 1P75A 5F3RA 5KUTA 3VPXA 3OLYA 2AR7A 5C52B 4RGVA 4MCIA 2AUMA 2CXQA 1AN0A 2DC1A 2HMSA 2AG1A 5BNWA 3KQMA 4XI9A 2BFCA 3FCOA 2HRCA 4C29A 1TVCA 3OZBA 4H16A 3G8AA 3UT5B 4DW8A 1UPCA 2Y1WA 4GECA 4U3JA 3IHLA 5BWLA 1P2VA 2IY9A 4GC9A 3CXRA 4EW3A 1PNOA 3AFIA 2Y9PB 2Q50A 5REQA 4DARA 2IU6A 4QTTB 3GLGA 1LY1A 2RKWA 3K70C 5LQKA 1JR3A 1LUAA 4ZEMA 1LPSA 4RNCA 3DQQA 2O3TA 2JFVA 5AXBA 4BO1A 2Q6LA 4M2LA 3RPEA 2ZYIA 3UKOA 3TSOA 4F92B 1V11B 1B0ZA 1QO0A 1N6KA 4YRPA 3U9SA 1QRSA 1OZ0A 1QFJA 5CB0A 3GJTA 5J4HA 1LBHA 1V4NA 2WWXA 4D4GA 4MS1A 1TYAE 3QA9A 1XI2A 2FVXA 3P5BA 2V97A 5SZJA 2Y3IA 2YOFA 5K45A 3W8FA 3EWIA 3HJHA 3R7AA 4TKVB 1OX4B 2HIMA 3WOHA 4DCMA 4LJ5A 4Z53A 2QRZA 4LHEA 1XA3A 4JOBA 3DEAA 3MEQA 4RWEA 3TD2A 1WY7A 2P9EA 4FWIB 1PUJA 3NTXA 3SHWA 1GTSA 2XD9A 3KZVA 4NBNA 5AW7A 3AU8A 1N5KA 2YFQA 3CKMA 1P0IA 1QZUA 4QSMA 2MINA 4FOSA 5A4AA 1LFDB 2HXSA 2K6GA 4H59A 3FNGA 4R9UC 3R76A 1UP6A 2XKJE 1QWSA 5H81A 5CCEA 2PL5A 5DNEA 3RC3A 1MB4A 4RGYA 5A5EA 2NUTB 4K6GA 2OO5A 2VZ0A 3DBHB 2F3QA 5AKIA 1J8VA 5H3CA 3W9SA 1TU4A 4QDTA 1GWNA 2HU5A 2PBZA 3O03A 3UWPA 2Z30A 2WIAA 1KI4A 3O8NA 1WL8A 3PI6A 4G5XA 7ADHA 9LDBA 3SNKA 4YRDA 3NTVA 1AN9A 4N5IX 4DV6B 1BS1A 4IHAA 1UANA 4G4SP 4U6SA 4E07A 1WLYA 3KBBA 3PIIA 3T3GA 2XCSB 2EBHX 3ME5A 3OCZA 4I5FA 1MO3A 5ENDA 3ZXSA 3I61A 3U3RA 3EVFA 3M83A 5F5NA 4BNUA 5D2CA 2F90A 1T8SA 2QORA 2XB9A 3N87A 2OVFA 4YMUA 4JX9A 1REQB 2BI4A 3AUFA 5JZMA 4ID3A 4CMKA 1IMOA 3HBNA 3LDHA 4RMGA 4UVHA 2OYRA 2WSIA 2OP1A 1HUQA 4RUKA 3D2CA 3WIEA 2ETVA 2ZUVA 4GOMD 3QVGB 1PJZA 2IP4A 1H9AA 3DTVB 1P6UA 5F7JA 5A06A 1NBEA 2XF2A 2AG6A 3DYBA 1TGYA 5DP1A 3OWHA 1JDPA 3RS8A 4IDGA 3IPYA 2HK9A 4MW7A 3ORHA 4D9FA 2LPMA 5L3SA 1AQIA 4I55A 3WLMA 5F64A 3D3NA 2AMVA 3PFCA 4QARA 3E2IA 1OBOA 2Z6VA 4FT4A 3TUZC 2YHAA 1OPRA 3I23A 4GI5A 1UPBA 2VDLB 3TLMA 4ZEOA 3VYTB 5A5DA 4EFLA 4RTOA 4BTEA 2NVBA 1EUDB 2QTTA 4ARZA 5IFKA 1VP3A 5HIAA 4M1TA 4K6OA 3S2ZA 4GKBA 2HRZA 2QM3A 4HH3C 4IR7A 2MYNA 2WVGA 4O1IA 4PEVA 3ZGLA 5J4LA 1B0AA 4O5AA 4CE6A 1ISRA 4I9GA 2YICA 3S44A 3UK2A 3VU3A 1SG0A 2DPHA 4FCVA 3JQAA 1WUYA 5CM8B 1G21B 2OAGA 4HWTA 1NBAA 4E5SA 2V65A 3A1CA 3CW9A 3CWZA 3OAAD 5CM2Z 4ALIA 4MJ3A 1LD3A 3RS4A 4FFWA 5F7XA 1IOLA 1DHTA 4K88A 3V5NA 5FUQA 3BL5A 1A8SA 1ULUA 3SYKA 4D96A 3CRRA 2QTMA 6REQA 4QFMA 4D4HA 4YMTA 1ABFA 1WV0A 1FFWA 2QZJA 3W9BA 5JEEA 3ON5A 4DDHA 3A6FA 2NXWA 5DHSA 3SF0A 1YJXA 1XE3A 1ZP6A 1WP4A 1RXIA 4KRXA 3NT4A 4WN3A 1T13A 4B3GA 3GMDA 1JE0A 4BO0A 2YXLA 4QODA 1A5ZA 2C4VA 2H4JA 3LH5A 3E15A 3WBFA 1LWOA 4PLHA 1GG2A 3OZVA 1ZJ5A 4MLCA 4OKSA 4G0OA 1IUKA 3ED5A 3NATA 3VOSA 3ZI4A 2X8AA 3QW4B 3TGLA 4G4IA 3FPEA 4GEKA 1L7MA 2JGFA 1A4XA 4GO1A 2QDXA 3IERA 2J5KA 5A7FA 2ACEA 2P27A 1E8NA 3D54D 5E0KB 4RFVA 1SXJC 4UZEA 1DAKA 1MGOA 2D8AA 2VQSA 2DOKA 4OMDA 2IZ7A 4G5QA 3ZV7A 4ENTA 4QFDA 4OM8A 4DLZA 3R6LA 1SIOA 4YDRA 2XGMA 3IPRA 2G9QA 4LZPA 3UO8B 3AXTA 3RUPA 3MCVA 2ERXA 3JYHA 3DNFA 1YV9A 3AUKA 3MLAA 1I2AA 4F45A 1VKZA 1CYEA 4F9FA 2HA0A 2JHGA 2O7NA 2OGUA 2WVAA 3F6EX 2XTZA 3GCGA 4GR9A 4IINA 4KX5A 2J87A 4KXWA 5TC4A 2ID9A 2QTHA 1UKVY 1R5BA 4LF5B 1M5RA 1CU1A 2EERA 1MQAA 3P96A 4Q9DA 1XKXA 5J4KA 2FW8A 2W2PA 4TT8A 3KKQA 4KSYA 3ZWCA 1C8VB 2EHDA 3PNBA 1JT9A 3ENVA 3E61A 1QAMA 1L5VA 2CL6X 2GNAA 3FOFC 1IVNA 2NGRA 3INGA 3KHKA 2H2GA 1G1AA 2VG8A 2XWBF 4NYIR 1H4QA 3W3ZB 4YP5A 2C82A 2RHWA 2C95A 2Y67A 1XEFA 3EODA 1I9CA 4AZVA 2TMYA 3PIRA 4BDTA 3VSEA 3I30X 3IAM6 3EFOB 2FW1A 3OTHA 4ZYLA 1G2PA 1KVUA 2D2VA 2HXYA 2PSHA 3TEFA 1F2DA 1HE1C 2PH7A 3ONEA 3KALA 5BSKA 4REQA 2M6RA 1EX1A 3PGVA 3USES 2VJLA 4F2HA 2XNSA 3UHPA 1NXSA 2ES4A 1RAAA 4LY6A 1TIBA 2JGEA 2DWUA 2P77A 3UG6A 5JVDA 3K1ZA 2J0SA 3DYVA 3WK4A 1ZJZA 3ETHA 3RBVA 5J43A 1RRPA 1G5IA 1J2EA 4C0AC 3H86A 4O4IA 5LQMA 4HX9A 5JLAA 3BXZA 1MTOA 1FJGB 1E1CA 5EHGA 1KRWA 1IBSA 4NBKA 4GWGA 1T0PA 4P2BA 4L78A 1ESEA 1YUBA 2GYYA 1LNQA 3ESXA 4FBLA 4PC7A 2IE8A 2DTDA 2Z1NA 4BDSA 4WOJA 3FYUC 5DNAA 4DV2B 1ZU4A 4B71A 1E2GA 4B7UA 4HYQA 3S28A 4YRAA 3OZTA 2ZXUA 1YS7A 4DG8A 2DF8A 5EIXA 1L5SA 2CJXA 3U40A 4J0FA 4RTMA 2YY5A 2VHUA 1CNMA 2PUBA 1FX0B 5I4BA 5BWOA 3U6KA 3RCBA 1JPJA 2IS6A 4UARA 1PJSA 1WU7A 1NWHA 2ZB8A 4HQFA 4EHAA 1FTNA 5EQFA 2BONA 4XM0A 5BQ5A 4LY9A 3PYLA 1PJ3A 4HWGA 4C87A 3SZ3A 5CA1A 1C9MA 3DUWA 1XZ8A 2R7AA 1OVMA 4JL8A 1KHTA 1KFCB 4ZQBA 4D0SA 4RETA 1NVXQ 2OQ2A 1ORWA 3AKEA 4YV7A 2K7ZA 4Q3OA 2PV7A 4KQ9A 5CFRA 2WFLA 2HUPA 5EG5A 4B6EA 1X70A 1L5WA 5LXTA 3QG1A 2JIMA 3KUUA 1BH2A 4BWGA 2HMAA 1RXEA 1SIUA 3N74A 1KKUA 1IZ0A 2JAXA 2QT0A 3CLRD 1OUMA 4CM4A 1OYYA 5LOVB 1JAYA 2WINI 4PNHA 5HE9A 3EWAA 4AD8A 4MYUA 1P0CA 2FFJA 4N5LA 2A6PA 4Q4JB 4RVNA 3A05A 2WOOA 1JSLA 5JQGF 3M70A 5DWDA 4JLMA 4E2YA 1RHUA 1RS0A 3ECSA 4GGMX 3ZTYA 1PEYA 1I51A 1KFBB 4XVHA 3EASA 4LDPA 3NHAA 1GPJA 3Q3VA 2R65A 4ZZIA 3UPUA 3P4UA 1JHYA 1TZ2A 2X2OA 3AHDA 3MILA 3UJAA 5AYVA 4L02A 5K01A 1ZR4A 2GN2A 4AKSA 2R86A 1DVRA 3AGPA 4M0PA 1LK0A 1PWXA 3FBWA 4HGQA 5JNLA 3Q9NA 4KZKA 1QG0A 1WM1A 3P9NA 4Y9RA 4EUNA 2CC2A 1X1SA 4OL0A 4UTVA 4JS0A 1K6MA 4KZPA 5FH9A 1EG7A 4WK4B 2R7MA 2OQRA 4EFKA 4KC0A 1SOWA 2YQ5A 2ZBDA 4UCFA 3ZDRA 3U09A 4LDQA 4O8CA 5DN6D 1O6ZA 5KOHB 5JPIA 3OQNA 4KBFA 1W2GA 4DCPA 1S6YA 1DRJA 2FEPA 1QH1B 3H11A 5ADVA 5C8YB 3D6UA 1J20A 1NJ6A 1SA0B 1ZJJA 4NZ9A 1WD7A 3HN6A 3VNQA 1MW9X 4MYDA 1ACMA 1YRAA 2RK4A 3I04A 4D44A 1NMYA 5H9VA 4AP6A 3IAEA 1LNZA 3FFXA 2OUKA 4Z2AA 3A26A 2IKQA 3GVCA 5EZYA 1FNMA 2VWGA 1QF7A 5EE3A 4RPHA 3N6XA 1RHJA 3OBIA 3M4XA 4B1FA 3LJKA 4K1LA 5EJ8A 1HBJA 1JIVA 5HKAA 2H1LA 3CVXA 5DCYA 4HLDA 2JLWA 1SCDA 5ER6A 2JI7A 5LPNA 2ASEA 4ITUA 3V4OA 3ESQA 3KETA 3QVJA 4TYMA 1EIZA 3ONWA 3EVBA 4EG7A 3KV3O 1J5EB 1MA3A 3GP8A 3RS3A 1UIRA 1B4DA 1TO6A 2QNIA 1YNSA 1TVKB 1D1PA 4GKAA 4AF6A 4C05A 3EPKA 2JCXA 2NO4A 4REOA 4CI9A 4QZVA 1U0NA 2ZI6A 4ZJYA 4OIFA 1WXWA 5TSDA 3S8MA 3V1TC 5IC4A 1JUDA 5AXCA 2HHJA 3CVOA 3M6LA 2WLTA 3COPA 5U4QA 5A9SB 5KVVA 4PQFA 2OBBA 1IN8A 1RLIA 2Q3CA 1AS0A 1FU4A 2W7TA 4YT4A 2LKDA 5KNDD 1VHTA 2C3OA 3QUBA 5A4DA 3I04M 3TFWA 2JAOA 5JAZA 4K87A 5DF1A 1COWA 1U2ZA 4G2NA 4WLOA 5BRNA 1TA9A 2ZCJA 3Q87B 3EVTA 1JPVA 3ZNOA 1OKKD 1OLXA 1OA0A 3DTTA 2K2WA 3UOWA 3WWYA 3PFIA 3NWJA 5AW8A 3W2EA 1VG1A 3Q12A 3ND7A 4X62B 1X39A 1OVGA 2O8CB 4UM7A 4O5OA 1IU9A 4QUAA 2ACVA 2H54A 5AJHA 1C0LA 2R48A 1C3VA 3DFMA 3T7RA 4C7XA 1I7LA 3SLGA 4PZ0A 1GRRA 1XFDA 1VBFA 3HKEB 1P5HA 1X14A 5E2IA 4FKMA 1Y0BA 2DH5A 3LQ2A 1KC1A 1T8WA 3ZE9A 3X0DA 3GH3A 6Q21A 3ROMA 4A8JC 5FPHA 5CNMA 3GRAA 3D5EA 2EL9A 1FNBA 2IDMA 3O94A 3COSA 2SHKA 3F46A 3ANLA 1V1RA 4LBVA 3VNUA 1TZKA 1YU6A 3R6TA 8GPBA 2P5UA 1E5TA 2NUPA 3DMFA 3QWFA 2PUVA 3JD4A 3KL4A 3NTLA 1ID1A 3D3WB 13PKA 1J23A 1OJLA 1KOJA 1P4RA 3HKBA 4JJEA 4PBSA 3TEJA 2VK1A 1BU8A 1M8KA 2YC2C 4CEJA 3UVEA 1EI9A 3VUEA 2BFDA 4HDMA 1OFUA 2WD7A 4IJQA 4TT3D 2ZWAA 4LF7B 3T41A 3MTIA 3FETA 3K9GA 3S68A 3ZHRA 1LPAB 3M9LA 1U5CA 4WRRA 5L40A 3AF6A 4IX1A 2FX3A 1Z0KA 1MRZA 4KMRA 4RBNA 4AMUA 4D81A 5I51A 4DFDA 1FSFA 1TOAA 2XIJA 3KR0A 5CVUA 3N5KA 3QEJA 5G1OA 2R7LA 3IIKA 1B76A 2WKSA 4G0VA 1RKBA 3O2QB 5CH3A 4ZANA 2CUZA 1CY0A 2AF4C 4N54A 3VHXB 1N8TA 1UKAA 2GKOA 1QGZA 4CCYA 1FDUA 2O23A 3HLKA 1QPBA 3U0VA 2AFRA 1ZD8A 1WJGA 4CEHB 1Y9DA 1N57A 1MLDA 3RV3A 3ZZ1A 5K8TA 5B7NA 3E9EA 3PX7A 1W9HA 4B7XA 2EC5A 1FUUA 4YDSA 3I72A 3LI2A 3QP9A 4KO2S 5HZGA 1O77A 4ARIA 4TQAA 4ROTA 3JRXA 1DAIA 2Q5CA 2AWNA 4G4SO 4K9OA 1HL3A 4WVLA 4EECA 4R84A 3S70A 1RC1A 3TXAA 1R8YA 3DFFA 3N3BC 4WUVA 2BFWA 4B8WA 2NXJA 3R24A 3V6MA 4C7KA 3O75A 3GUHA 3KXDA 4K1XA 2KS6A 1BEUB 3AR9A 3LK7A 1CP3A 4QFCA 4FJ0A 3LOQA 1ZOOA 1A5BB 4Y6RA 3TZCA 1AKYA 2OAQ1 2VJNA 5K4HA 2Y68A 4RANA 4I19A 1HKHA 3CB2A 4X8LA 2PUTA 2PS0A 4DNPA 2H0QA 1HL7A 5DGHA 1OIWA 3AFHA 4NMWA 4C0QC 2IEBA 3F4LA 2CJWB 2IIPA 3HYNA 2IZ5A 4P7KA 1VL1A 4R3UC 4RS4A 5FCDA 5KKCA 1WW2A 2AFHE 1LX6A 3AR4A 1W0KA 1WUTA 4P5PA 2QAGA 4KR2A 3I9V1 1R16A 1OX5A 4RCZA 5D3KA 2ANBA 3OZIA 3Q0TA 4O4JA 5SYAA 3B1JA 1ZD9A 3QJGA 1T4CA 3QLUC 3LLUA 2J3KA 3NWBA 1FMJA 4YS6A 2J31A 4ZMSA 3GFGA 1MPXA 2NUPB 4FYPA 2BKXA 1KQPA 3P9RA 2EATA 1QKIA 1UJ2A 4L51A 5LLSA 1KJ9A 1JZTA 1GCGA 2W4MA 3JQPA 4P38A 4DJJA 1NW8A 1KSGA 4EG5A 1RJWA 4EYSA 1A3CA 1U9IA 2H0RA 5CFZA 2PM8A 2RH8A 4XH9B 2BTQA 5CT8A 3KXPA 4L8VA 4LYHA 1IN5A 1E3IA 4GH5A 4O4LA 4TUYA 1Q3HA 2MSKA 1NLFA 4M55A 1RXCA 5C8XA 1NXXA 3GVHA 1G9XA 1ZCAA 4HLQB 1ZNQO 1Z22A 1U6KA 2QE6A 4ZQHA 1JPUA 2FVYA 1E2QA 3OEYA 4MHOA 4H3VA 1G63A 1SUDA 1T2CA 2QRJA 1X1TA 3JQ8A 4MVCA 4NFSA 3OQMA 1KNQA 2P2GA 4HI0E 4EY6A 3AIMA 1Z3IX 2FEWB 1OGIA 2E9SA 3EVZA 5M7EA 3I1JA 1YRHA 1Z6QA 4L8LA 3QLVC 5HUHA 2HSJA 1EPUA 1PR1A 3BRQA 5I4CA 2RHGB 4EYOA 4B87A 5G0SA 3UGJA 4MKZA 3B6EA 5IKOA 5BW5A 1ZUNB 1TT7A 2OENG 4O2RA 2HU8A 1T24A 2HQSA 1R10A 2FX5A 1O5IA 3AM5A 4L5IA 3RGWS 4BMZA 5JC1A 2R79A 1S2GA 1U7PA 2HRBA 3REOA 1QIDA 3DE3X 1YJAA 3MRXA 4MW1A 3W90A 3WJAA 5IBPA 3FF1A 3KJQA 2GKGA 3RC2A 4Z4CA 4M9CA 3T9DA 5G53C 4N7RA 4S0ZA 1MFPA 3EVNA 4YCNA 2P5YA 4HH4A 1MH9A 1ZK2A 4RAQA 4D8WA 1KIMA 1YMVA 3T5DA 4QXAA 2IKSA 1FBNA 3BA6A 5LQNA 3ESRA 5PGMA 4Y8VA 3SF8B 3GQVA 3EA5A 4TS3A 4TTTS 4R83A 5IKEA 2X7HA 5BXQC 1GYRA 1ZL2A 4JLDA 4EGCB 2NQ2C 4PZEA 1J8YF 4Q48A 4RACA 3AJRA 2EQBA 3F4KA 4ZAZA 5GVSA 3P27A 1CV2A 2PWBA 4H6PA 2C88A 5ILQA 3L7IA 2K87A 3PL5A 1QHEA 3B52X 4ER5A 2NO7A 4RHTA 3G8DA 5DCLA 4C22A 3A14A 1KI6B 1A2OA 2DLDA 4IIHA 3ZHCA 1TA0A 3HJTA 4EIWA 4NXNB 3B7GA 4O4JB 4FX5A 4TM7A 3WGHA 1B8PA 3L4KA 3UM9A 4C04A 3RUDA 4KE7A 4BMSA 1EBBA 1DKMA 3H8JA 1ZWLA 1MV5A 1XO1A 4XKJA 5HWSA 3I92A 5GY7A 3C8DA 3PLAE 3RU9A 2WG2A 2GPSA 1SQ6A 3I32A 4YJKA 2C2GA 3E2PA 3Q41A 4IEEA 1UDAA 4V0QA 2EJBA 5BUZA 5JXGA 4UD6A 1JDUA 1XCLA 3E8XA 3PHIA 5L4LA 1ECJA 3P52A 1GIAA 5EIOA 4ZXFA 1PL7A 3UWDA 1KY4A 3ENQA 3EXHC 3H75A 4ZT6A 2WYWA 3JQBA 3TECE 3RFFA 3DFUA 3QU4A 2RHCA 4B3DA 4CMIB 4RL4A 4WFQA 4V0RA 4ZAWA 1AB6A 1U0HC 2ECQA 2HF8A 3G8YA 4PPFA 3VX4A 1BQ4A 4Q4AB 1FTWA 4RVCA 4TV8B 3GEHA 5A6SA 5KYYA 3LQ4A 4PS1A 4IILA 5DULA 1M74A 3IVXA 5J1SB 4A03A 2I2WA 3Q8MA 1PHRA 3JQ6A 4AMZA 1VJ5A 3OG9A 1EQUA 1UMBB 3CUTA 3ZWDA 4W9RA 3EHEA 1FNSA 1C8KA 2RHRA 1QHHB 3E05A 1ADYA 3RF7A 2B0JA 4JLKA 4MHSA 3U4IA 3IP7A 1GITA 1AUPA 1ZD4A 3K30A 3OPXA 4EG1A 4FHDA 1YZUA 5I8WA 1IRIA 1IH8A 1JXAA 2B0CA 2C99A 1UFOA 4X44A 1Z75A 2JF0A 4OQ4A 3SQDA 4URHA 5CYGA 2NPIA 2NLOA 2O5CA 3A06A 2EFCB 3AF4A 3C8ZA 4WW0A 3TKLA 5IKXA 4NK4A 1BO6A 2G28A 1JDJA 3NEYA 1QB7A 1EJ2A 2WWYA 1W1UA 2PE5A 2UUAB 1U8AA 4P8RA 3EXEA 2YVLA 4E31A 2VQFB 1RMQA 3K1JA 2ODAA 2H8KA 1TEVA 1IHOA 4B2PA 3EGCA 4K6HA 1WR8A 4NYJQ 2B20A 3EYWA 3GBSA 2LNDA 1N6LA 4LOHA 1ST3A 1MABA 3KPJA 3AOEA 1E2IA 1OLUB 3UUWA 2W6MA 4QYTA 3C0KA 1ISFA 4WXMA 4AP9A 2FMTA 3LUDA 1ATIA 3HB4X 4LJ6A 4WCDA 5K51A 4MR8A 5LQDA 2ZSKA 3VSDA 4Y6PA 3JYOA 2VDOB 3KQYA 1WPGA 4JU9A 3ZY2A 1GFWA 4WLNA 4QDJA 4FFSA 4GUAA 2FOLA 5E6RA 5BUQA 5K0EA 2IBSA 3Q0IA 3RHFA 1AZTA 1BC5A 2OQIA 4DL9A 2OWEA 2PYZA 3BIFA 4L2IB 1DFGA 4ZTUB 3IOYA 2RE8A 4M9RA 4YNBA 1ULSA 1Y1PA 2ZSFA 3QFRA 4KDEA 5ALKA 4CMIA 1OIXA 4ZDJA 1TD1A 2VK8A 4IJ6A 1F3OA 3KNZA 4W9MC 3DE6X 3CG4A 4V38A 1YJBA 4TV8A 4W1SA 3TW6A 1U0BB 2KLHA 3VZQA 4TLCA 4JP3A 1QYWA 2OG2A 2PJUA 1RZRA 1IOWA 3AKZA 3BORA 5D3MB 2QNRA 1AJEA 1OKKA 1RWOA 4NZZA 5DP2A 4XEUA 3GP5A 3DBHA 3NHMA 2VXOA 3NOOA 3QZUA 5IDVA 4WMLA 3F6SA 4CIXA 2A1IA 1Z2EA 5BYJA 5JNSA 3RFXA 5IZCA 4I46A 2IOFK 2SBTA 4TQGA 4CKEB 1GUAA 3K20A 1B0PA 3H2HA 1K8YB 4TWBA 1W5TA 4EGFA 2GZ3A 1Q17A 3D5QA 4KQXA 4D9HA 2IWRA 1MU0A 2RH5A 3FTFA 2VP2A 3LYAA 4QQNA 3RU3A 1GA6A 3DGEC 3S8EA 3ICWA 1NI4A 5KC8A 4B3MB 2ZE8A 4WBSA 4KR9A 1KZ6A 1UC4B 2G40A 1AKEA 3TXXA 3TQFA 4OI2A 5CB4B 1YDWA 2I7CA 2GETA 4S1PA 1ETUA 2BKUA 4GVPA 1JP7A 1YDHA 2NUBA 3KLBA 4WLUA 3ZBQA 1DJNA 4BLTA 2IV7A 3EXEB 1DXQA 3I9V6 4GYKA 4EKDA 2L2QA 3G2HA 3QLVA 4WK0B 5HXAA 1CC1S 3UAGA 4H1WA 5JAIA 2KQUA 1OWLA 2BFEA 3SBOA 1A82A 1XTJA 2Q4DA 1UKYA 4P83A 2VJMB 4RK0A 5K0JA 4V3CA 3EOZA 3RG2A 4ZAFA 3K2BA 3OJXA 1AZSC 3WGIA 5AKZA 1GG8A 5DYWA 3UN1A 721PA 1WHSB 2F8SA 1B0UA 5DLYA 4NI5A 2DLCX 1FS6A 1EFRA 1VL8A 1N0WA 2P2DA 3LCCA 3OP1A 3SBDA 3R5FA 5IH7A 1EUDA 4R8LA 4DLAA 3F2VA 2XTNA 3ZBPA 3GGGA 1ND5A 1II8B 2F6RA 1NR1A 2QGFA 3K8QA 3OPYB 4JC5A 1U9IC 2PPLA 4WD3A 4D9GA 2ONCA 5AVRA 4KJXA 4H6XA 4UZFA 4WBXC 3RTGA 4YGYA 2GS9A 4L2IA 1KI3A 3WWCA 4JYZA 3E9MA 3ASZA 1N2XA 3K32A 2R68A 5L6LB 2VBIA 2ZDHA 3B9RA 3V8BA 8ADHA 4O2AB 1ZCZA 1WX1A 1VM6A 1Y6JA 4ND1A 1JZQA 1SK9A 4PYRA 3UJ7A 2FW9A 3GQBA 4C14A 4NCNA 1YZTA 3GLFB 3IP1A 2IYNA 4AZ0A 3I28A 3LPNA 1AKWA 2MCFA 1Q14A 4DBLC 4AUEA 2YRXA 4JIGA 1YIDA 3FTCA 1UODA 1UC9A 3PP8A 4PHFA 4E14A 5CA0A 1P1JA 3E7XA 4B82A 5JCXA 1TVEA 1M2FA 1U3UA 1CEQA 1XTKA 2GF9A 2GERA 5DEOA 1N6OA 3HKDB 4PFQA 3DF9A 3SU8A 1E2MA 1X1CA 2WSYB 2FSSA 3MJHA 3VO1A 2SICE 3SYTA 1K7XB 4D9NA 1OJ7A 5IVPA 5DOZA 3AVQA 1L5QA 3DP9A 3V8VA 4B80A 4IJKA 1SCBA 1FMTA 2IQ5A 2I55A 3CLKA 5JBNA 3F71A 3QFTA 4YT5A 2HI0A 3H5OA 3QHAA 3SZMA 2G9UA 2Q2NA 1JLMA 1H6CA 2OECA 1Z4LA 4G1CA 4D5EA 4PNPA 1PQUA 1L7BA 5AW4A 1M33A 1W35A 3W9YA 3H0EA 1PJ8A 4RHYA 2AK3A 3A6LA 1UMDB 3V7FA 3Q9SA 5K3DA 2YDYA 3VZDA 5ALEA 8AT1A 5IZ4A 2I4IA 3OTGA 4XRRA 5T3UA 3UA4A 2VPYA 2HREA 4DN6A 2RAPA 2Z4TA 4BO2A 1XXHE 3KLNA 3L6RA 1J0EA 3OECA 2XRZA 5IAEA 3UT5A 4B2YA 2RBKA 2ZEJA 1K0UA 2WJHA 1V8PA 2Q1TA 1IG0A 3HJCA 3ZWAA 1C7RA 1KJJA 2PKWA 2ZVQX 3FHOA 4HDRA 4EYEA 4A0FA 2QSZA 1VHDA 1Y6FA 1XRMA 4PWYA 3I1IA 5FBVB 1PG0A 2N1MA 4LRTB 3WK6A 2Q3LA 4LOLA 4ARVA 4IMRA 4EDHA 1V39A 2ZOSA 2R1VB 1EGHA 1M1YB 3JPWA 3KFLA 5LZ2A 1M3SA 3T7DA 1RVV1 2HV9A 5BMVA 4IJVA 5C1PA 2ST1A 4FB4A 5C81A 2O0MA 4YT2A 3GMTA 2FW0A 1OILA 4HAYA 4DDUA 2XF8A 3NKLA 1E7SA 2VHWA 2CDNA 3TPZA 4WCFA 1XD2B 4F91B 3CVUA 1HORA 5IBCA 5TLSA 5J59A 4TSKA 4KK3A 3NMUF 1DARA 3TIFA 3H2KA 4N47A 3BX1A 1M67A 1TLTA 1YZKA 2G5GX 2HBZA 3IPCA 3N2KA 4LHZA 4LYJA 4Q7EA 3UFBA 4RPIA 5JADA 5GJVC 1L5NA 1OC2A 3QXCA 1EESA 3LZDA 4PE5B 4M8IA 2ZSIA 1HFWA 4QGAA 1BN7A 3SVLA 3IKMB 3CO0S 2W0SA 4ADSG 3LT2A 1RQGA 2HMTA 2MINB 1PLKA 2EG5A 2FFRA 4M49A 5E9JA 4ZT2A 4F72A 4K9PA 1IWBB 1QG4A 2ZIZA 1M8PA 1USWA 1EE9A 1D2GA 2JFQA 3M1YA 4GQIA 4HB4A 4HCJA 4RHFA 4C0WA 4RULA 2C7PA 1AK2A 1GFIA 1TFRA 4RKEA 2G4VA 3ASUA 2I8AA 4MUHA 1DFIA 1NRXA 4KQMA 4P7FA 4RZXA 4QDUA 5FTWA 3M4JA 3DF7A 1C3OA 1TM3E 2FWBA 2Q5HA 3FUXA 1A2BA 1OWNA 4R51A 3IP3A 3ERCA 3VA7A 1ODSA 5B6PA 2H29A 3DH0A 2NZ2A 2CHVA 2XTMA 1X74A 1JEQB 1NP7A 3KZ1E 4G07A 1M0SA 5AJZA 3TTWA 1DXHA 1YBFA 4MQFB 4OQXA 2OXFA 1RQNA 4OQYA 3WL6A 4HMPA 3DT9A 3TZEA 1FTGA 4UUAA 2MYUA 1JEYA 4DILA 3X1WA 4DWOA 1GAJA 4HGNA 5A62A 2XY4A 3GNQA 2X5OA 2VJOA 4GZ3A 3M6XA 4N0PA 2Y0DA 4S1VA 3OJEA 3TTYA 1IXZA 2F9LA 2C3MA 4F7WA 1PF7E 4FFVA 3LNCA 1YC5A 2A4KA 1GGEA 3DMYA 1WVIA 2O0HA 4JEIA 4O4HF 5K6AC 3OZSA 1BXRB 3WL8A 4K9SA 4OYYA 3MN1A 4P0QB 4LC0A 4KV7A 1TCVA 2P6UA 2WD9A 1U7XA 2PYIA 4RK6A 4YECA 1WXEA 1OFHA 2HNKA 3LT5A 1SOMA 3FCCA 1AV7A 1TKAA 3UK7A 5KHLB 4J6EA 3C6ZA 4TN1A 2NNLD 3SHTA 1W5EA 3PNPA 3CJRA 1N1GA 1HYQA 2JKVA 3C4QA 1AZLA 1NMSA 4Y1GA 3AW9A 4YJHB 2PBRA 4I1OA 4ZGBA 5BMVB 4G97A 4FZJA 4LC9A 3KG2A 4ARZB 2WT8A 2ZRHA 3EXIB 1NVEA 1VE9A 3NR2A 1OAAA 4NCAA 4LW8A 2C9BA 2OK8A 3R4CA 3E84A 4Y6SA 2AG0A 4JC4A 4JLUA 4OJNA 3AVWA 1SPBS 3OC0A 4NU5A 1RRGA 3X1YA 2QMHA 3PUXA 3L07A 1ZK0A 3FRHA 1IBKB 1EWTA 3BZBA 2PNFA 3IUNA 5FLXA 1OAOA 2ZBUA 3BRCA 5B12A 3A9TA 2PBFA 4QGHA 3STYA 5ERXA 3LUCA 3S2EA 2L0XA 3FLMA 1MEEA 1VBKA 1LEHA 2NO1A 3TOZA 2VTDA 2ZU0C 2VYVA 3RIMA 4BP1A 5C1IA 3WFIA 2A0WA 1BFDA 1A71A 3KD2A 4C0LA 2AR9A 1CS4C 3TQIA 3HCCA 1SRQA 4Z1MA 4PTLA 3LY8A 4UVGA 5LZ5A 3A7EA 3KQPA 4HYEA 2OCAA 4OP3A 4BVEA 3FFAA 2A0UA 4V0ME 2WMOB 5EJEA 1F2TB 2C9ZA 3G2OA 4Q05A 3O4HA 1I6LA 3R8CA 4RDCA 2IHTA 3ZTTA 2HLDD 2Y0EA 3F4BA 1DPGA 2IZ6A 2AJ8A 3ZWQA 5A5VA 2RGUA 3B12A 4LMPA 4HT3B 3N05A 3M5WA 1R4ZA 4A36A 4UHFA 2A5GA 4TLAA 3NPMA 4AJ4A 1F48A 3FIJA 3PJEA 2YIMA 1ZJWA 4LC1A 4ZI3A 1Z33A 3THYA 5JQWA 4DQXA 4O8ZA 3V3KA 4RZUA 4QWMA 4JI7B 1F0KA 1RYBA 4MYTA 1U63A 1S8OA 3HK2A 4H4CA 3GJ0A 2X42A 3TAUA 2I76A 2KJQA 3MS4A 1Q44A 3QU9A 2ZYDA 2QTGA 3PEWA 5CM9C 5M29A 2R00C 3C1UA 1A5AB 4KN5A 4B6SA 2ENWA 4EKNB 3F97A 3HJRA 5ISMA 3SXUB 4K6CA 3S0JA 4HH0A 3QRWA 4QPPA 3UC5A 3BE5A 3WIVA 4UULA 3WNQA 5LYJA 3WWZA 2DKNA 4CGYA 2H59A 3HCDA 4KQ2A 2F1RA 2RHHA 3C14C 3NDBB 4RA9B 4ENPA 5EJ9A 1ILWA 1D09A 2CLIB 4PAMA 5TPZD 4N7BA 4J43A 3IELA 1XJ0A 2JBAA 2PGIA 4PXYA 4I1PA 2RHOA 2B4AA 2Q3DA 1JTVA 2WT9A 3PV0A 4NPHA 1PSDA 4EVIA 1M76A 1XZKA 2OHIA 1YKSA 1XMIA 5A9SA 3DBVO 3NORA 1GGMA 1X8JA 3DZBA 3E8MA 4NAVA 4UAUA 4BWFB 4RIIA 5JJCA 1JEAA 1RP1A 2RIPA 4LPSA 5AK5A 1VIDA 4DLSA 1EFPA 4M83A 4B3IA 2KBEA 1EVZA 4BQIA 5JH7B 2RJ3A 2VNKA 1V8BA 2CYBA 1UDBA 4J7CA 4PGHA 5SYMA 5D7BA 1DC8A 1UEXC 2CNDA 3FTNA 2JFZA 1NYTA 1UQTA 3U4HA 3C8MA 4RY2A 3W8EA 4FMDB 3FPLA 2VYCA 2QUHA 4KACA 5IJ0B 2C7VA 3KSMA 1N5MA 2F9MA 4UU1A 5LB2A 3NYIA 4ILEA 3AJAA 3U7JA 2P11A 2OSVA 2GCEA 5DGCA 3RIEA 5I7VA 4GMFA 1VZ3A 2HHHB 4RCYA 5A4KA 4BKPA 1FC0A 3EVGA 3EFHA 1UM9B 1XG5A 4MXDA 4O4IB 2EFYA 4CMJA 1NBOA 4WJZA 1DS6A 3K16A 2X9LA 1X7ZA 4NJEA 4NOLA 2E89A 1I8TA 3THRA 4A0SA 3SYRA 1XROA 4E5MA 2VPXA 4OV6B 1GNTA 2FZGA 1BZYA 1S2NA 3LHFA 2XIQA 3GA7A 5BN5B 1S3GA 4GPAA 4JNKA 3UJCA 2C92A 1NUHA 5CFQA 4BRUA 3A6KA 4IIVA 1QE3A 4IJ5A 4HAIA 1R6TA 2WNIA 2AJTA 3EY4A 3HKBB 3EBLA 2KW5A 4GDMA 1F3LA 3LPLA 2EBFX 3EA0A 4JUFA 5JG7A 4MWOA 1NURA 1T8TA 5HCUA 1ES9A 2AG5A 3IIIA 4HDMB 2VTKA 2VPIA 3CTMA 3R3SA 3OA0A 4XGKA 4FHZA 3ZGYA 4ZVRA 1HFKA 4FGJA 3OOJA 2QMZA 4HQ6A 4O4HA 1H0KA 2O0JA 4E1AA 1L7PA 1JFLA 3QKUA 2H1OA 2PMWB 1C1YA 3DBOB 3I0ZA 4BNJA 1UBOS 4DPKA 4J49A 4JOSA 4EFNA 4YPOA 2BW0A 3DLIA 1H94A 1YONA 2YFKA 2RBGA 1EFHA 3L7OA 5F5LA 4HWSA 4YAJA 5FR1A 2WFLB 2GBGA 2QLTA 2EKDA 3A6DA 4N3AA 4HQ0A 3B1XA 1XR3A 4L3OA 4PS0A 4GXRA 3M49A 3L18A 2WJAA 4JJFA 4CM4B 1E1NA 1QIIA 4LJ9A 4O25A 3TFQA 4QT4A 2HSZA 1QX4A 3D8HA 3V7NA 1DO0A 4J0EA 1ZD1A 3T0GA 1KXZA 2QRNA 5HK8A 2XMRA 1UBEA 4JI2B 1IEVA 3C3YA 2D4AA 4BVKA 4LJKA 4WKOA 4X00A 5HKBA 2BFMA 3GRYA 4QYSA 1MOSA 3TRIA 5AM3A 1I7SB 1DB3A 1DT3A 1E1RD 1DMRA 3HXLA 3IMKA 3K4QA 1C9JA 4UCXA 1PX0A 2WZCA 3CUYA 3TLYA 4HZIA 4MB6A 3LU1A 2EF1A 1W4CA 1OAKA 4QYIA 5AW2A 2JGIA 3UWKA 2G82A 3B89A 3R41A 4WXYB 3LOPA 4TN5A 4ML3A 1CUYA 4DEXA 4NV3A 1AHHA 2NSLA 5CEFA 1HK7A 4G8BA 3BM5A 2X3YA 1ECFA 2QX4A 1YBVA 2PZFA 3PPVA 4H08A 1NAHA 3WXBA 5JXWA 5LD2C 5C8DA 4NJEB 1Z12A 1Y8ZA 2NU8A 1A0OA 3FZEA 1BAPA 4LOIA 1QBGA 3DOUA 1NX9A 5AI6A 4DAOA 1SHJA 1BVUA 2PMBA 4DLRA 3JAKB 2PT5A 3DEYX 2Z5LA 4LQ4A 4P3PA 3ABQB 4G0UA 3UFXA 3AV0B 2GZRA 2WMDA 1JI0A 1Q83A 3E9ZA 2WDPA 4I8DA 2P4UA 5FUXA 5IXSA 4DB4A 3KD3A 4EJ2A 5I9SA 1Y42X 4U6NA 2J0UB 3EMVA 3DWFA 3AVTA 1DKPA 1HYHA 1UWKA 3DS8A 4EF5A 2C5AA 4UHDA 4UQOA 1ZBQA 5H70A 2PU7A 1OXBB 3KQWA 4NH4A 3IR5A 3RS9A 4EW2A 1Z2DA 3PHCA 3MOSA 3NM4A 5AXAA 4XWAA 4BCDA 2PLRA 3A1WA 1KZHA 1CDEA 1EB8A 3GWGA 3ORYA 3RJTA 4ZZ1A 3K6RA 2JD2A 4O4LB 4TUYB 1U2RA 2EWMA 1KU6A 4G5FA 3M3PA 1J39A 2BM8A 4W7IA 4A1FA 4B9EA 2GT1A 3GLGE 4ESEA 1CS0B 2DWPA 1T8YA 2NX2A 4F4DA 5CEJA 2W6IA 4R1OA 3RTAA 1E6CA 1C80A 2PT9A 1E0JA 1G2OA 3CX8A 3FPFA 3UT6A 1AQ6A 4LZAA 5AI4A 3GEIA 4B46A 3VC1A 2VC2B 3ELBA 1Z6TA 4MP8A 1AV6A 2PEYA 5LYJF 1NXQA 1LI4A 1G16A 1Q1ZA 4AULA 2C1ZA 3WNVA 2WSBA 2J4DA 4P4TA 3IXQA 3DUFA 3TZQA 2GJKA 1VRCA 4PF1A 3BMNA 3HP4A 4MA0A 4WN9A 1MZVA 3EAFA 5JR3A 3DXXA 4J16A 3IEPA 5JDIC 3OESA 4FUTA 4GSYA 3V1YA 4LXXA 3I45A 2HEIA 4O1HA 1Z0IA 1JBKA 1JHXA 2J5XA 5COQA 5FF9A 3VR2A 3ORRA 3ZK9A 5LKRA 5MFZA 4MIKA 4H7KA 1OLXB 3D1JA 1T8UA 1MC1A 4LWZA 3VVCA 2QPAA 4NMMA 1U8CB 3C41J 1NTOA 2BTEA 2LW7A 5CVVA 5ADWA 2ZSDA 2D7JA 4PONA 2VJPA 5JYBA 2G7MC 2FR1A 4M7PA 4YI3A 3ZWXA 1AGYA 1W581 4P92A 2P69A 1UJBA 2J7PD 2ZBEA 3CN7A 3GK3A 3HKEA 4M9SA 2ZT8A 5EZQA 5FPSA 2A0KA 4RVGA 1I7PA 2H65A 1SD1A 5GV8A 4LJ7A 4RENA 4WNIA 4A7PA 4CM6A 2BC9A 1H2YA 5JUWA 3BB4A 2CDCA 2G9RA 3C6XA 2WG1A 3AR2A 2HAEA 2B21A 4AQDA 2AWOA 3BT7A 4XM1A 3UFXB 4WQMA 2NYUA 2FSVC 5K0SA 5A4IS 4DIOA 1Y81A 3MBIA 4WECA 4Y2TA 1HQCA 1XV5A 4RSGA 1CLEA 1PI3A 1YZNA 3OZFA 5DM1A 4K6FA 5IH3A 2GF0A 2YKGA 1JIJA 2YX1A 4QTXA 2J9FB 4HNQA 1HLFA 3KKMA 4RA6A 1YA8A 4MKRA 1QV9A 2WD7B 2FI1A 1VPWA 3E9CA 2IW1A 2QYOA 1Z8DA 2GD6A 2G63A 1Z2OX 3VDQA 5GIPE 1V6SA 2UAGA 4B4DA 4EEZA 2RFLA 3EIFA 4HB0A 5J2UB 4Y2XA 4MVJM 4H3KB 5T4BA 3HABA 1CS0A 4RTNA 5K3CA 4LJYA 2GBIA 2CJFA 1XLWA 2KLBA 2NP7A 2PWZA 1IY8A 2VR1A 4LBWA 2EKLA 1XLTA 1AKQA 3RVKA 1ISMA 5BSUA 1ONOA 4Y2JA 4HPJB 5ICFA 1RI2A 2F8TA 2JI9A 3AVOA 1S2MA 1GZVA 3NASA 1GNRA 3P97A 3PC8C 5IAKA 4AY2A 3CPSA 4YH1A 2G5PA 1FSZA 2GZ1A 1C9NA 2C7GA 4ZD6A 4TTAA 1L4BA 2FPRA 1T4BA 4BQFA 2BMVA 1YAHA 5J4YA 5GVRA 2HCJB 4TMYA 4OLBA 1USUA 1NN0A 4G23A 4EMTA 4DV3B 4NFYA 3B53X 3A4VA 4CKYA 3L82B 1GPDG 1U0LA 4P82A 2UXCB 1P60A 4IY1A 2R4UA 2OORA 3EMDA 4D9JA 4R2HA 4YP1A 3KQOA 5KMGB 3BXEA 5LA6F 4F5DA 5GOZA 1FRVA 1WCV1 2DXIA 4MUMA 1HNWB 3I9JA 5C1BA 5G4KA 5DJ5A 3EXHB 4NJOA 4IGIA 1Y9ZA 2J0EA 4YAUA 1UCFA 1LV7A 4XD7A 3LUJA 2B1IA 1L5HB 2P3QA 2ZROA 5ANRB 1Y3BE 2HLPA 2GNPA 3VDNB 4RD2A 1Z7WA 4KXMA 5CDSA 1Z9BA 2JVIA 1NLMA 1O9HA 1AE1A 1YR3A 3KJEA 5E95A 2WIKA 3SDSA 521PA 5LFAA 1A8PA 2IEGA 3ACDA 2TECE 4BE7B 3HACA 2PX0A 3FMIA 2BR4A 1JV2B 4MV1A 1TM4E 1BS9A 1TADA 3U4CA 4FC6A 1T5BA 3W04A 4OVKA 3FCAA 3MHPA 4FSXA 2WUDA 1NLYA 4MVWA 5E6SA 4AZ3A 4S35A 3EWNA 4AJHA 5E6RB 3QKTA 1TKCA 2H1FA 4BFCA 1FX1A 4WHMA 1Z4KA 3COYA 2A84A 4GRAA 4PW0A 5FOWA 4BY9E 1GQFA 2IXDA 1UOOA 4HC4A 4KSCA 3LO8A 2WOJA 3HY4A 4LYDA 3GUCA 4ZPJA 5DCUA 1D4FA 4S2UA 5L45A 3AH8A 4D5GA 1YO6A 2R6R1 4A3SA 5J2UA 4HVCA 3ZDAA 2SCUB 3TNJA 2F3RA 1O6BA 4OMFG 4ZP1A 3CRVA 1RXWA 2FG5A 1TQ6A 3P9CA 1PTJA 5C31A 2HPVA 4YDHB 2DJIA 3OCXA 4JQCA 3IEMA 4N6GA 3O83A 3IUPA 3HN7A 4E3WA 5HMMA 5FB3A 1GZHB 1MOQA 1Q84A 2RHBA 1AQNA 1NXTA 1LS6A 3TF5A 4M1EA 1H5QA 2R3SA 4I1VA 3Q4GA 3VMFA 2G4CA 1YR6A 1DDOA 3ZNQA 1GUFA 4DR5B 2A14A 4L8WB 3GZNA 2QL9A 1M2EA 4IZ6A 3TLJA 4KVZA 3GOHA 4OGWA 2P62A 2HHCA 2Q8NA 1KK2A 5ALLA 4A6XA 4EABA 1IEXA 4PG8A 4YX9A 4WZAA 5HQTA 4X65B 1EINA 3U3JA 2X41A 4RHUA 4EG4A 1DLJA 3WMXA 5DX0A 1YVEI 5DRTA 4M37A 3FHJA 1KORA 4OQZA 5IKPA 2OM2A 4MQ5A 3CWCA 3U17A 3GT4A 4EATA 3ZCTA 2AQHA 1Z73A 4GGPA 3E9NA 2WHPB 3F98A 4IBOA 1UIMA 1IFXA 821PA 5CX1B 1GZ3A 1ZW1A 1KS2A 1HZJA 1STOA 3PA6A 3GOQA 1UBRS 2JEZA 4IH4A 1YRYE 5EMMA 3LC0A 4G0PA 3D7RA 3TO5A 1CZOA 4BNWA 3MJCA 1RD4A 4P22A 1I1HA 4ZHQF 5LQRA 3C3XA 1IN7A 2C0QA 4UNIA 2O8NA 4RJJA 1TTHA 1V11A 1Z4IA 1KJZA 3GX1A 4RK7A 3GFFA 5FPTA 4ND2A 1SXIA 3BFKA 1XU4A 3THXA 1C0PA 2Z2ZA 2VRCD 3ZS8A 2NU7B 5AKKA 4LSWA 5E6SB 1SOUA 3TGPA 2VIIA 1NC1A 4KLCA 4FDAA 1BHJA 2CE7A 4HQRA 4PQYA 3WYDA 4DLXA 2R9VA 4JBYA 3RRFA 4OKNA 1KNXA 2QRHA 3RIXA 2BH2A 2EP7A 2X13A 3H5WA 2WRZA 2C58A 3IMFA 1FYEA 4YVFA 3BHMA 4GOXA 5IXYA 4PVCA 3C7AA 2YIJA 1XTVA 2D5LA 3BIOA 4MRPA 3R7LA 4K3UA 1ZICA 1ZPDA 4AZ0B 2AFIB 2HOQA 5C32A 2QD3A 1N2CA 1ZINA 2NN3C 5K6RA 5DGXA 2ESRA 4H0CA 4N03A 1QYXA 3RRMA 4V1CA 1MR3F 3GPDG 1Z2PX 4NF2A 5CP8A 1SC3A 3CH4B 3ZIDA 1ZZGA 2KX7A 3D8BA 3ECCA 1EA5A 3COVA 4LDNA 4RIFA 3SHFA 3WVNA 4CFYA 4H4DA 2VAXA 4I6JA 2V9CA 4PZZA 2Z5GA 6NULA 5B1SA 2GPAA 2C59A 5FV4A 3GR6A 3WWOA 4U9UA 3MGCA 7MHTA 3UC9A 4HRXA 1XYVA 2I1VB 3FFWA 4HRYA 4CIWA 2YJTD 2J08A 1W36B 2JGMA 3A1SA 1SEVA 3FVTA 2C5SA 3IUEA 3IS3A 1L4GA 2JBHA 4HR7A 3QV2A 3HU5A 4LDRA 2QL7A 4MTLA 4NKRA 1HY3A 4I3HA 4F85A 5AD1A 2D5IA 5FP0A 3ER9A 1ZUHA 4X24A 2V98A 4IAOA 2EGHA 5KYXB 3PGKA 3T1HB 3A28A 3I8XA 2IH5A 1JNYA 4RQAA 2HWYA 4E4RA 5JSYA 4UHCA 4MEBA 2V5VA 4PTYA 1JIQA 3NTOA 4XQ0A 3RJZA 3RV4A 1ZXXA 2CMFA 3LHDA 5KQRA 1SEPA 2ZBVA 4IGEA 1EXDA 3ED1A 8ATCA 3OJLA 3VR3D 1CQXA 3CYFA 3IP9A 1HYGA 3KXIA 3N2GB 1ZBDA 2I2DA 4RTQA 1SKMA 3HJUA 1K98A 1G8AA 4Y9TA 3GLVA 3QITA 1ABBA 4IXNA 1RI5A 2XXAB 4DLYA 3M3HA 5L3SB 3RKUA 3MINA 3R8XA 1U2GA 2R1VA 5FBHA 2WIDA 4D3DA 1JLSA 1N5IA 2HNBA 3DMTA 1H8ED 1PYOA 4KXUA 4G26A 3AUUA 4MR8B 5EP3A 4HZUB 1CVIA 5BYBA 4CKBA 4F4IA 2HF9A 4M86A 3BWYA 3AHJA 4TL8A 5HILA 4PYKA 1XK6A 2EZUA 5ITVA 4HS4A 5K0NA 4P7JA 4BMXA 4C2AA 4CNBA 5JH7F 4FB5A 3R6DA 1Z68A 3WYEA 2OCBA 4CDRA 4IJUA 3Q5GA 4HY3A 1BX3A 1SVNA 1SH7A 2C07A 2XVZA 2WE7A 4JQYA 4UUQA 4XLLA 3QLEA 1GPBA 4K6KA 1XC7A 1ACLA 4G37A 1NC3A 3IQGX 5T6BA 4W82A 1E62A 3I2GA 1SU4A 2PSDA 4HBGA 2POCA 4JVLA 2PCLA 1RJEA 2AFIA 2L69A 3KDAA 2VSFA 1UJ6A 3WYFA 4TGLA 4D8XA 3OHMA 1FE8A 5BPFA 5ABPA 2WG0A 3PDWA 3OTQA 2R96A 4AWBA 3I73A 5EWMA 4JGBA 1DBPA 1B8VA 3F8SA 4UUNA 1T43A 3PPXA 4ZV9A 3LF1A 1Y34E 3AEQB 2NUAB 4R6XA 4XVQA 1V8OA 2IT1A 3AYXB 1H2RS 3UJ9A 1WUHS 2V5AA 5T41A 3ZJ4A 4JUBA 2EIHA 1HT0A 2PZEA 4LF6B 1JL3A 2R6CA 3A6EA 4TXJA 4PLGA 4F38A 2PMDA 4HDNB 2I29A 5G40A 1ULBA 2F64A 2RHJA 2XRMA 3VO8A 4ENVA 3ZZNA 5KSYA 2EYUA 4BECA 1TTTA 3OO0A 4P80A 2WJPA 1QGYA 3WO0A 5EJMA 1NUAA 3TLBA 3FJYA 4HGYA 5AI0A 2C2XA 1SCKA 3I12A 4O3FA 3RAEC 1TB4A 1TZCA 1AKTA 1DWUA 3L8CA 2XMPA 3CKKA 5LIPA 3VV3A 2RGXA 5BP7A 3JSAA 1DUIA 1YQWA 3ACBA 4UEKA 1KDTA 1BE0A 1U1IA 1Z6XA 4YP7A 4MP3A 5AUPB 1GQQA 4IOKA 1ZM3A 3O7WA 3O4VA 3I8SA 3KV1A 1ZS9A 2ATVA 4JT2A 3G0HA 2AZXA 2VH5R 2WQ6A 1O6CA 1UP7A 4Q1EA 1AX9A 1PT9A 5ITWA 1QIEA 2XNJA 5JBQA 2QVZX 1BDIA 4HWPA 3MMZA 3JARA 5TT1A 2EZTA 2NU6B 4OX9Y 4Y9DA 1CQZA 1Z5OA 4JKIA 5IKMA 4OU5A 3ZUPA 4UM9D 1WMDA 2VTBA 3H19A 2MSNA 4KVFA 1V5WA 4NBUA 3DWEX 2O52A 1RADA 3R3JA 1BRMA 4YQYA 5F3WB 3K0KA 1U9CA 1ZISA 4KEAA 4D8YA 1Z62A 3I1FA 4C0HA 5B1YA 2J9ZB 4JI5B 5I5GA 2VXYA 1NDUA 1Q7BA 4QICA 1QVRA 4XX1A 1K8RA 2BGNA 2QBYA 1S01A 2CCKA 4IO1A 1LF5A 4EEKA 3QFSA 4FMCB 1M2HA 3IB6A 1QHYA 4MUXA 4UD2A 4XFJA 4LV5B 1XEXA 1J0BA 3FLBA 1NMXA 3F7OA 3FNQA 5CK4A 3UG7A 2C2HA 2GPJA 4XVCA 2B30A 1HR0B 3GVXA 1IJBA 3QMPA 3TR0A 4B3RB 4FYKA 2RGCA 3VKWA 2IS1A 5ESWA 5TQ0A 1TW3A 5EWJA 1JFFB 1AVTA 1DTEA 1H0HA 1NVMB 1T1SA 2AXEA 2W90A 3A31A 2ZSEA 3AG5A 2PVSA 2NUTA 1KTIA 1M72A 3G8BA 2ZVDA 2GCNA 1RHQA 2A33A 1USGA 2ID4A 3DC7A 1DQNA 4EPRA 3K2EA 1DPFA 4D97A 1I2BA 3ZKWA 1ZZEA 1RLTA 3P71T 4QT0A 3E3MA 3QYJA 4FHCA 4B7CA 1AS2A 3INYA 1XMPA 4DR2B 3CPHA 3WAGA 1FXUA 1JDBC 5DYIA 1P18A 2H11A 3SCZA 1LSSA 2QG4A 4UVIA 3BFXA 4OPMA 5BQPA 1ZM9A 2BR5A 3MJSA 2M2IA 1HX7A 1J22A 2ZYAA 1YQTA 4GC5A 3T4UA 1DBVO 1ONBA 3PL1A 3K53A 5IJZA 2AR0A 3I6YA 1G3IA 1RJ9A 3AEZA 4AMVA 2WV7A 2QG6A 3BK1A 1G59A 1N6IA 3AR3A 2I1QA 4G5GA 2EFGA 4N4AA 4H4EA 2C9YA 1NT4A 1JEEA 5F1YA 3TKAA 5A0FA 5JXIA 1EG2A 1RQ7A 1GARA 1AUVA 3I09A 2A1UA 2PT6A 2WUVA 2HJSA 1CUCA 4W9NC 1W75A 2RB5A 3GH1A 3OJCA 4PZCA 4X8HA 2ONKA 2AFVA 1DIGA 1VLZA 2X0NA 4ZK6A 4ALMA 4JSRA 5P21A 1LI5A 3BCHA 4KNVA 2Q5LA 1EWVA 1DQRA 3BB3A 1M1YA 2BE7A 3LHIA 1BCRB 5JECA 2V6JA 5CPFA 4NDNE 1VI2A 4JHLA 3EHDA 4XW2A 2JBAB 3F7NA 2H7XA 4IDBA 3R0QA 4Y2PA 2D4HA 1B15A 1JI3A 2VYND 5AHKA 2XD4A 2QV7A 3QELA 3QWHA 1WV1A 2DBQA 4JUDX 4EHHA 5B2EA 1MHTA 1KERA 4TYPA 1JDBB 3DZJA 3D8RA 3RTBA 4ALJA 3WNBA 4GKVA 4LX8A 3ANMA 5JS1A 4B4UA 1P7VA 3N39C 4G5SA 4QRIA 1HLDA 2AT1A 4X8MA 3BF7A 1QORA 2Z2KA 2VCEA 4U2DA 2O2EA 2P1ZA 4EVRA 5JH7A 3ZQUA 4E5UA 3VZBA 3GCDA 1AUQA 3GJRA 2SECE 4WY8A 5FTMA 2VP3A 5J5AA 2QUZA 1H5UA 3ENZA 1N2SA 3DZFA 3OPVA 4TRJA 2QX6A 5AXDA 5KOIA 1TMKA 4AAYA 3W8NA 2NAPA 1TLLA 4FN4A 2XQKA 4X92A 3UMJA 3OPQA 3Q2IA 2H57A 2QIPA 2GDJA 4FNAA 4GRIA 4B4OA 4TVOA 2C03A 3K5WA 2WYOA 3ZLTA 5EXEA 2VF2A 2YWFA 3P4XA 1P19A 2X1HA 1LLCA 3WYCA 1BKDR 3LLVA 1CQPA 2ZR8A 5IHXA 1ZMXA 4NEHB 5TQ2B 3CUKA 3ETEA 1W8DA 5I7EA 3HZHA 1PR5A 4G84A 2ZKIA 3VC2A 3SZUA 2HSDA 2Z4SA 4RS3A 4FE3A 1WHTB 2GWRA 4KNWA 5LLTA 4JBLA 1DELA 5KTKA 1UC8A 1D9XA 2ZRPA 3HB9A 4AUMA 3AB3A 2BR3A 4V39A 3NDRA 3A3NA 1W93A 4QHSA 5LXTF 3GLIE 3KJGA 4H7DA 1B43A 1FSSA 1TIPA 4ZMRA 1TYEB 3BQNB 4MH0R 2RI0A 2ODEA 4I1RA 2XYGA 3B5EA 4I8XA 5AESA 4EKEA 1WD5A 4XTRA 2B98A 2OAP1 2K5UA 2X5NA 1IVSA 2AOXA 4ZYWA 4OM7A 2UXDB 3ROXA 1YKFA 3HG7A 3II6X 3TQCA 2V7QD 1SQFA 4YI5A 1PYGA 2FP4A 2HA5A 3OE5A 1KQNA 4JR2A 4YJHA 2UZ1A 3HU2A 2C5LA 5FOQA 4JXJA 2IEZA 1ZRNA 5FUBA 1FTQA 4DA9A 1LBIA 4G1UC 3I52A 7ABPA 2QUIA 3EZ9A 3LSYA 2XX3A 3L9WA 1P9WA 3HDYA 4AS3A 1I4EB 3EVCA 2PEZA 1F8XA 3H2IA 1KMHB 3PUKA 4Y2VA 1IY0A 4UEWA 1N9KA 3OQOA 2W48A 4W7SA 3QW2A 1TJ3A 4IV0A 3U61B 4M1WA 3D8TA 1S5PA 1TCUA 2PSFA 3CLUC 3PXXA 4GM0A 3JAWA 4QUEA 5IZCC 1KJWA 4K9QA 4LMRA 1ZVVA 1DBIA 3OIDA 3COJA 2JFWA 5CAEA 3HMKA 1JMYA 1H2XA 1YS1X 3PA8A 5I7AA 2GJ4A 1S2IA 1VB5A 2OZLB 4REQB 1H5NA 5T8KC 1O4WA 4BWVA 4GG1A 3Q5DA 4G4JA 1NSTA 1Q77A 1PL6A 1H42A 5FKJA 3RRNA 1P7ZA 2OFPA 5AJVB 3VKVA 1QRDA 2B2NA 1NBWB 2XT0A 3KE8A 4XQ9A 2G70A 1PR6A 1JAIA 5AI8A 1OWMA 2QLNA 1MAUA 1TC2A 1ZLYA 4FEGA 4DM3A 2WSSD 1E1CB 3HUDA 2RH9B 3JQDA 3NWEA 2JZOA 5JSUA 1PJCA 1J24A 1FFXA 4X1YA 1ZJ6A 1SVMA 5JDCC 2P35A 2BHNA 3CM0A 2WAAA 3MCTA 5DNVA 5EHQA 2IYLD 2Q4TA 1XX6A 2EHJA 4ZTZB 3ZGZA 3HGQA 3P0HA 2XB6A 3F6RA 4LFCB 1THGA 3AIOA 3FXAA 1ZOIA 3OM0A 1SBZA 4HLNA 4L5JA 3Q1LA 2JJ1A 2G04A 4KH0A 1ILEA 3DWIA 5BV7A 1WDMA 1LDBA 2X2PA 4X1IA 2X9NA 3HSYA 5EKTA 4NMHA 3STVA 2C2MA 2EXXA 1Y4ZA 2OBXA 3ZY3A 3CLUD 1KHHA 4KX3A 4Y0VA 3IE1A 5BSTA 2EW8A 1YFZA 4I5GA 5ALDA 1WF3A 1A4IA 1KRHA 4YXFA 3PQFA 3TQQA 4KR6A 2ZI3A 1L7EA 3W1WA 4MI9A 1QIGA 3RTCA 1Y1TA 2JHCA 3TSZA 3WQQA 4H77A 1J00A 1DJMA 3SQNA 1EFRD 3AVYA 1XAJA 1GT91 1V9SA 3C1OA 2C00A 1T9AA 3DOHA 3IBGA 2C2ZA 1SD2A 2ODBA 4PLZA 3M5CA 2VP4A 1SBHA 2FYTA 4O4LF 4TUYF 2BDEA 3OY2A 5D3QA 5G0VA 2OLEA 3VHXA 2AEJA 1RTKA 2FUG1 1W7AA 3P1JA 5DU2A 2V8OA 3TW8B 1BOFA 2GPBA 4YJ2A 2FQ1A 4B31A 4X0EA 4JZKA 2C9OA 4RPKA 2XNDD 4R8SA 4CEHA 1KMHA 1YGYA 1PR9A 4TRNA 4X1KA 2QM7A 2ZJ7A 1ULHA 3UBTA 4C3ZA 3A25A 4GR4A 4FDVA 1JIKA 3INNA 4DJFC 2UVPA 2ZS8A 5C37A 5IPFA 2V3VA 1X7DA 5BSHA 1G7RA 3TDNA 4BNVA 3SDBA 4KBYA 2MOKA 2I65A 2XGOA 3BXPA 3D59A 3BJEA 3EZ7A 4HWRA 5FA6A 5JAQA 4MV0A 1C14A 4U7PB 5B4VA 2XDAA 2PTHA 3SC2A 3UMRA 2ZJFA 1KOLA 1LLDA 4RVFA 3NNNA 2O7SA 5EEHA 3MGBA 3CZCA 1XWFA 2WUEA 3WMEA 4U9IS 2E5WA 4CG3A 2G1AA 5KYTA 3PPWA 1RXUA 3CFYA 3F3YA 4OP1A 4NPAA 3V55A 4DLTA 4XJXA 4JI8B 2B78A 4N7MA 3RBAA 4CMBA 3NZEA 1YHZA 3H05A 4M0FA 6ABPA 1ODIA 3IHTA 4E2WA 4OI1A 4K9RA 2LCFA 5JSHA 3ZI7A 5CLJA 1H8HA 3GAMA 4Q34A 3SX4A 1KMNA 5IUNC 1UFKA 5IXJA 4R3WA 5EAIA 2OHOA 1LKZA 1ATZA 1P2BA 4GX5A 1KKMA 4UZSA 4UTXA 1NW7A 3AP2A 1T0JB 2J3IA 3SKVA 1Y7HA 4OJQA 1MQ8B 1U1FA 3WLHA 4P4SB 3WLTA 3YASA 4AJ2A 2HT6A 5JI2E 1DEAA 2QN1A 2QVCA 1XCJA 4NBSA 3GLHE 4YRTA 5K3AA 4MRMA 2CVHA 1R6BX 1RTTA 1NUPA 3CGWA 4RK1A 4GMDA 4P36A 1RCTE 4NV1A 4NS1A 5EZYB 3VI4B 3W8RA 3ZX4A 2JZCA 1JEJA 3OMWA 3EH1A 3FW1A 4RKQA 3RFUA 4QHYA 3DFIA 1D2EA 3W5HA 3ZHVA 1K5DA 4DB2A 2CGEA 4ZVOA 1P62B 2WHQA 3O38A 1N4DA 2P3LA 4MWSA 4PIPA 2O06A 3EZLA 4P3YA 1FP4B 4W99A 4YV2A 4XVRA 3RAGA 3AM1A 4C0BA 1HKUA 2XT9A 1KH1A 3E5HA 4LE2A 2IPMA 3PGJA 3F8TA 1ZGBA 2NTNA 2RGYA 3WRXC 2VDQB 3BHIA 1VPTA 3HVJA 4IDEA 2PNJA 4YJ2B 2BFBA 4EY3A 1DWQA 1FVFA 4IKOA 2HHLA 1NAIA 5FEUA 2Y0CA 4IHJB 5EC8A 3NVAA 4EJ0A 2WV9A 3NONA 4EITA 3B2EA 3T7JA 4CF5A 4EBFA 2J4CA 4Q3CA 1E3TA 1Z2AA 1JLHA 2P5SA 1OOEA 4JJZA 1NVWQ 2PZ8A 4KO3S 4MROA 3K5PA 5FI5A 1RLJA 4JC0A 4TS9A 1CRZA 1D1QA 1UXOA 1V26A 4BFVA 2E18A 5BRJA 1RXVA 1NYLA 4GOND 2YFHA 3RS2A 1U8TA 2Q29A 4KWTA 2FP3A 2FHSA 4LXIA 3PQ6A 4WZAE 4XQEA 3SF8A 4AJ9A 3O0TA 5KSOA 3NEAA 2OO7A 2FFHA 1CIVA 4PFSA 1EXMA 2HIHA 3PC2A 4EHFA 5KVAA 1I80A 4ZZ3A 3GFVA 4F5YA 5BNTA 1TGVA 2NM0A 4L73A 1QK5A 1AKNA 2RB4A 1Z08A 1KAMA 3FDZB 2BEWB 4Z2YA 2CBXA 2VXBA 1EFTA 1POXA 2CVFA 2LV8A 2SKDA 1ZXBA 1K3FA 5JE8A 3TK1A 1J25A 1HLGA 1QTIA 1YQ9A 2WPNA 1LDEA 2ACWA 2O2GA 2ZYSA 1Y3HA 3ORSA 3PRKE 4PFKA 4QOHA 5D6NA 3V8QA 1GUBA 4U2EA 2CT8A 3NHPA 3PNLA 4DDKA 4Q93A 1GTZA 1ST2A 4PG7A 3CNOA 4GX0A 2CFOA 2MWMA 3GRFA 2YCBA 4UPVA 1P7CA 3TTSA 4G3XA 3ZVMA 4YBRA 1Q0RA 1SNYA 2FMHA 3D3WA 3FH0A 3PE4A 4QBIA 2BM9A 2G1KA 4YAOA 3V8RA 1BG6A 1P3DA 5CTAA 2E82A 4BZPA 1KO8A 1D6NA 1P4HA 1Q0QA 5IDYA 3G17A 4ZI2A 1V96A 2UXBB 2F1IA 3UXHA 1VHQA 3VMMA 2AX4A 3GRCA 3JALB 1EK5A 4OFBA 5AVQA 2OMKA 3I3OA 3QPAA 5IEJA 5TS2A 3ESAA 1JQJC 2Q07A 3Q72A 1F9AA 2XRFA 3A3YA 1ZSNA 4DC0A 2IEDA 5TQJA 1L7QA 1SHTX 2SCUA 3IJ5A 4W6QA 3ZBUA 3C97A 2PDAA 4TSFA 4DCOA