3E23A

Crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
QAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGRPVRTMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLHVSVRKPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the RPA2492 protein in complex with SAM from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR299
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein RPA2492
total genus 66
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e23A00
4HSGA 1EIZA 5B1SA 2LD4A 1RJGA 3BKXA 4GOND 4E70A 3LHDA 3F4KA 2GPYA 1RJEA 3FRIA 4FGZA 4X41A 4HTFA 2IDJA 3FPFA 1N2XA 1L3IA 4MWZA 4DKJA 4PYMA 1X1BA 2BR3A 3ELYA 4B17A 1SQGA 3HCFA 2G1PA 3BXOA 3DXYA 3FPJA 4C08A 1I1NA 2AN5A 5LQAA 1KIAA 1XDSA 2PWYA 3DR5A 3CCFA 3EGEA 1JG3A 2PKWA 3HCEA 3TRKA 3MHTA 1VL5A 1NW5A 1RJDA 5GIOE 4GC5A 4ER3A 5FHQA 1SUSA 2NXNA 4ZTBA 3VC1A 5K0JA 3P97A 2AOUA 4HGZA 3NW9A 3FZGA 4OQDA 4GC9A 4E30A 3GU3A 2ZSUA 1RJFA 3IHTA 2ZCJA 2VZ9A 1R6AA 1BHJA 5CVDA 1FJXA 1VBFA 5DM1A 1G38A 2PVCA 3KQSA 4HGYA 4IWNA 4AX8A 4RTJA 5KQRA 2UYQA 2AOUB 3E23A 4RVDA 3DLIA 5LQCA 4E2YA 1WY7A 2CKDA 3C0KA 4KVZA 5E2BA 5FWAA 3EVEA 5HZMA 2V7EA 5LQRA 1FP2A 3HVJA 2C7QA 3UA3A 4C06A 5DTMA 2AVNA 4KRGA 1L9KA 1AV6A 4FSXA 3C3PA 5BP7A 8MHTA 2CWWA 4E32A 2VDUE 1JQ3A 1QAMA 2AVDA 4RV9A 5K0GA 1I4WA 2DULA 2GA9A 4HTFB 3UJ7A 4EKIA 1BC5A 3OU6A 5E9WA 2V74B 3A25A 5CD1A 1D2CA 2P1DA 2AS0A 5T6BA 1DUSA 2OB1A 2ZZKA 2ZIGA 3OE4A 3G2OA 3JWGA 1QAOA 4YUXA 5BW4A 3NVKI 3P9NA 5EGSA 5GINE 1ZHFA 2PY6A 1JR4A 3JWHA 2P40A 3P2EA 4X61A 4AZWA 5K8VA 3Q7EA 4RTLA 1YFJA 2YTZA 4FT2A 7MHTA 2ESRA 1RI4A 3HCDA 4E2XA 5CVUA 2PV0A 1O54A 3FUTA 4EKGA 1PRYA 2FYTA 3KPUA 1ZGAA 5EEHA 1TW3A 4FSDA 3AJDA 2ERCA 3UA4A 3G5TA 4RTMA 2GLUA 4EK9A 3FUVA 4LWPA 3UZUA 3M6WA 3QV2A 3KKZA 2JHPA 2QE6A 3G2MA 4OA8A 3P9KA 2IP2A 4IV8A 3P9IA 5E1OA 1NW3A 3LBYA 1NV8A 2ZWVA 4P7KA 1P1BA 2PX4A 3M6XA 4LWOA 5EHGA 5FQOA 3SR4A 5HIIA 3KR2A 4C07A 3TFWA 4RTPA 1JTFA 4POOA 2CMGA 4C04A 1X1AA 2GAFA 3A7EA 4GOMD 3SMQA 4PNEA 1YZ3A 2FK8A 5E9QA 3V8VA 2CMHA 3DH0A 3LGAA 5CVJA 1X1CA 2OY0A 3LDFA 1H1DA 2GS9A 3LSTA 2XVMA 1QAQA 2Y1XA 2VP3A 5IH3A 1KYZA 5EMMA 4Z2YA 4DCGA 5F2NA 1YUBA 2WK1A 2ZWAA 3DLCA 4V0RA 1JG4A 1YZHA 4R6XA 1KXZA 3HNRA 5DX0A 4PGGA 2B2CA 2H00A 4BLWA 3O31A 3PS9A 3E7PA 5CCXA 4OQEA 2Y1WA 2ZW9A 3BZBA 5GOZA 3DMGA 5CVVA 3OE5A 4QTUB 3P9CA 3G2PA 3MB5A 3HP7A 3P2IA 1XCJA 4V0QA 5HIMA 4R05A 2P7IA 4CTKA 3BT7A 1G55A 3LKDA 1WS6A 3KPVA 1WZNA 3FUUA 4PCAA 4ER6A 3GRVA 4M7RA 4H0NA 3T7SA 5C1IA 3T7TA 1G60A 2NXCA 3M33A 2H11A 3AXTA 3CC8A 3NDJA 4PWYA 3B3GA 2JJQA 3ELWA 5HIJA 1JTEA 1KPIA 2PGXA 2G70A 3PB3A 5DX8A 2JHCA 3LCVB 3KQPA 1ZGJA 3O7WA 1U2ZA 2EJUA 5K03A 2JG3A 2JH8A 4RTQA 2FHPA 3KQVA 3OU2A 3I53A 1NBHA 3NJRA 3I58A 2IFTA 2P41A 4QPNA 2B25A 4E2ZA 1O9HA 3EMDA 1EQAA 4EQZA 2ZTHA 1PJZA 3S68A 1SVUA 5DWQA 5D1NA 2IIPA 3OU7A 2BZGA 4QPPA 3ER8A 2YVLA 1R18A 3MERA 5E1DA 5DSXA 5FCDA 4YV0A 2NP6A 1B42A 3PTAA 5ICCA 3HVIA 1VE3A 2NP7A 2WA2A 3BGIA 4MQ4A 5DRTA 1YFLA 2Z6AA 3SXJA 2HMYB 1JQDA 2VDWA 4FT4A 4QVGA 3EEOA 3OZRA 1N7JA 1HMYA 5E8RA 1UWVA 5D1HA 3UJ9A 2OXTA 3EVCA 3H2BA 2I62A 3LDUA 5EMJA 4CWAA 5FADA 3FTCA 1L1EA 1NV9A 4MHTA 1TPYA 3ELUA 3IV6A 3OFJA 3KPWA 2C7PA 3B7PA 5E9JA 3G2QA 3SM3A 3R24A 4U7TB 3MTIA 4P7GA 5EOVA 3TM5A 1N7IA 4P7FA 3A26A 3DMHA 1Z3CA 4M36A 2PJDA 3DTNA 4L7VA 3AWIA 10MHA 3SGLA 1V39A 3GDHA 3I9FA 2Z6UA 4GOOD 1RI1A 2N47A 2AZTA 5T67A 4XUCA 1QANA 2BR4A 2KW5A 2EJTA 2ZBQA 3CJQA 3JWJA 4DA4A 1VPTA 2HR1A 1EAMA 2PWPA 3E8SA 3BGDA 5CUQA 2O07A 5FULA 5GM2A 4KW7A 3KR9A 5F2KA 3V97A 4YUYA 3RW9A 1XXLA 1D2GA 3QOXA 5KQSA 2ZIFA 2HV9A 4WVLA 4DMGA 4CKCA 3LL7A 5DTQA 1P39A 1WG8A 1JG2A 1VP3A 1EG2A 3GJYA 3KR1A 5EC8A 1T43A 3K0BA 2EG5A 5LQKA 4LG1A 5DT2A 3AXSA 3LBFA 4PIMA 3B3JA 2OB2A 5M5BA 4RWZA 4PIPA 2GH1A 4DF3A 3Q87B 2K4MA 4E33A 4RX1A 3MGGA 3ME5A 2ZVJA 5LR6A 4RTOA 1ZG3A 4Y2HA 4RYLA 4OX9Y 3MCZA 4A6DA 4OA5A 1KYWA 3CKKA 3BWMA 4ISCA 5K0NA 5K09A 4BLVA 4RTNA 5ICFA 4PCLA 5CCBA 1JG1A 5GWXA 3K6RA 1F38A 2P3OA 3GIWA 3CJTA 1L3CA 9MHTA 5HILA 2H1RA 2OZVA 4R6WA 3M6UA 5EVJA 2AOWA 2XYQA 2ZIEA 4HH4A 2FPOA 1JSXA 2B78A 5DTRA 1IM8A 2ZBRA 5FA5A 5JUWA 3TQSA 3OPNA 2UYHA 3GRYA 1KHHA 4MTLA 2FRXA 3KQOA 3R0QA 2ZZMA 5FHRA 2PX5A 3BUSA 4IKPA 1R8YA 2I6GA 3FTFA 3ORHA 3DUWA 2ZLBA 3GWZA 5EMKA 1R74A 5DX1A 2B3TA 2VDVE 3M6VA 3HEMA 2AOXA 2I7CA 3DMFA 2P35A 3EMBA 4Y30A 5P8WA 1AQJA 2E5WA 1QYRA 3KQWA 4K6MA 2EFJA 2WA1A 1ZKDA 4C4AA 2IGTA 4G56A 3GRRA 3FPHA 1NW6A 4YUWA 4AUKA 2NYUA 3ID6C 3E05A 2UYOA 5BXYA 2OO3A 4RTKA 2UYCA 1SKMA 1NBIA 5KYGA 3HCCA 2O05A 2BM8A 1G6Q1 2AOTB 3FYDA 5HOQA 2IDKA 5CVEA 3FUXA 4CKBA 4CXMA 4CKEA 4LECA 5DM2A 1YB2A 5EZSA 4DQ0A 5T64A 1RI5A 2A14A 4X60A 2AN4A 2YUIA 3G7UA 3TMAA 3MTEA 5EKUA 2UZ4A 1BKYA 3EVZA 4QTTB 4C03A 3L8DA 3P2KA 1X1DA 3G89A 4PYNA 2O0LA 5LQUA 3ER9A 1M0EA 1SG9A 2CL5A 3TPZA 3B89A 3G5LA 2FCAA 3HM2A 3P71T 5H02A 4RTSA 2IBTA 5DSTA 2NNWB 3EGVA 1JSZA 1Q0SA 3NWEA 5KVAA 3RODA 5MHTA 2PXXA 1XJ5A 2FK7A 2QRVA 3DXXA 4M37A 3I5UA 2OYRA 2XYRA 5DXJA 5IKMA 3DOUA 1P91A 2IPXA 5DRYA 5DLYA 3GXOA 3LKZA 5FWDA 1NE2A 5GIPE 4U7PB 3FTDA 3ELDA 5EIFA 5GM1A 1VLMA 5DXAA 3KR0A 3R9XB 3CVOA 5K05A 5DM4A 5FQNA 1UFKA 1VP9A 3DP7A 4XCXA 5E1BA 5K0EA 4P7JA 1XDUA 2Q41A 2HNKA 4PYKA 4QDKA 3PX2A 4OBWA 2OKCA 2QYOA 3HA5A 3HCBA 5K01A 1ORIA 1R8XA 3KU1A 4RSRA 3GGDA 2YX1A 1QZZA 5EPEA 3TKAA 1SUIA 4PYQA 1YF3A 2GB4A 4BP3A 2P3LA 2BM9A 3EGIA 2ONZA 3SSMA 3EVAA 1XDZA 3LX6A 3KHKA 4QQKA 4PYJA 3FPGA 3TOSA 3EVBA 3GRUA 1JQEA 3BWBA 5HIKA 1D2HA 3A27A 1INLA 5K0BA 2QRVB 3UJ8A 2R3SA 5EZQA 4F85A 1VQ1A 2O06A 4YMHA 3LDGA 4AZSA 1DL5A 1IY9A 3SX0A 2PT9A 4FS8A 2G72A 3UJCA 4UOEA 3NTVA 5ICGA 3G8BA 4GUAA 3C6MA 2R6ZA 4BLUA 5EQJB 4QDJA 3LCCA 1XCLA 3TLJA 5C0OE 4F86A 2BH2A 3DXZA 4NECA 3C3YA 3NVMB 5C9ZA 3UFBA 3O4FA 1AF7A 2ZFUA 1DCTA 2P8JA 3IYLW 3BWCA 4KWCA 2YR0A 1XVAA 5EIWA 3CGGA 1M6EX 1L3BA 1O9GA 3GCZA 2YXDA 3MAGA 5HEKA 3TKYA 4FZVA 5DPMA 2C7RA 2AOTA 2F8LA 3BWYA 5ERGB 3T0IA 2JH9A 3R6TA 5FA8A 5JR3A 2HTEA 4ER7A 4KIGA 3G8AA 5LQJA 4E31A 1KPHA 3PFGA 5K0CA 3UJDA 3CJRA 1AQIA 4YUZA 3PLAE 2NXJA 3ANXA 1HNNA 2QM3A 1KR5A 3GO4A 3RIEA 1XTPA 1BOOA 5ICEA 2XYVA 5K0LA 5E8JA 3X0DA 1FPQA 3OCJA 2PBFA 3REOA 2IH5A 3KQTA 4GF5A 5E2AA 3C6KA 3EVFA 4KDCA 5FUBA 3KPJA 3A7DA 3HVHA 1OR8A 1UIRA 3D2LA 5DM0A 4DCMA 3U81A 4PINA 2DPMA 3M70A 2ADMA 1I9GA 3QOWA 3NMUF 4EMSA 1WXWA 4OBXA 3KQQA 3MQ2A 5EHIA 4P58A 3OFKA 5EKXA 4EVIA 3PT9A 1KP9A 4X63A 4ER5A 4HG2A 5E1MA 4KDRA 2AN3A 3FUWA 4X1OA 3EEYA 2EX4A 3FRHA 5F2OA 3UBTA 1EJ0A 2IH2A 2ORED 2YXLA 3I64A 5BW5A 3FTEA 2G71A 1FP1D 1SQFA 3FYCA 4RVGA 3VYWA 1MHTA 3ERCA 5HFJA 2IBSA 2OPBA 3LCUA 1ORHA 3UWPA 4GQBA 5EMLA 2P7HA 5KS2A 3HTXA 3TR6A 1VIDA 3LECA 4FP9A 2YQZA 2NXEA 3THRA 1NT2A 3LPMA 2P3QA 4GOLD 5LQNA 1ZQ9A 3HCAA 2PXAA 4R8SA 4DZRA 3MCTA 5EEGA 3WSTA 4DM3A 1KPGA 1X19A 3EVDA 3JWIA 3SSNA 4QVKA 4R8RA 4RVHA 1NKVA 5CIYA 4RTRA 3CBGA 4YUVA 4O29A 2PSSA 4IV0A 3NWBA 5EG5A 4RVFA 3VC2A 3AY0A 2XBMA 1IXKA 3GRZA 1Y8CA 3FPEA 1G8AA 2QY6A 1TW2A 3HA3A 4AZTA 2B9EA 4ER0A 3NDIA 3HVKA 3THSA 1M6YA 2PX2A 1FBNA 3IEIA 2G8NA 2JHAA 4HC4A 1R00A 2PX8A 4HRAA 3SSOA 2ZBPA 2C7OA 5G02A 3OZTA 1P1CA 3UJ6A 1G8SA 3DULA 3TM4A 4E2WA 1NW8A 3OZSA 2I9KA 1RI2A 3HA7A 4C05A 4YMGA 5U4XA 2AOVA 4FR0A 2HWKA 3EVGA 4PGHA 3T7RA 4PYLA 4XUDA 4ATNA 4BP1A 5FTWA 3VSEA 4JXJA 2PLWA 4CTJA 3KQYA 2PT6A 3M4XA 4WXHA 2ZZNA 4GEKA 3BGVA 3PFHA 2XVAA 2BR5A 2IH4A 4PYIA 4A6EA 1MJFA 5LSAA 1NW7A 3PVCA 3BKWA 4F84A 1Q0TA 3P8ZA 2PXCA 2AR0A 4AZVA 2O57A 4YV2A 4MIKA 3PX3A 5K0FA 4YV1A 2Z6QA 4PYOA 3R3HA 4KIFA 4QQNA 3KPYA 4GBED 1EJ6A 3UJBA 3GNLA 3B3FA 2ONYA 2VS1A 4PONA 3SVZA 5GP1A 2ZULA 1WXXA 2OBFA 3EPPA 2YXEA 1F3LA 3G88A 3A4TA 4XUEA 4BY9E 3B5IA 3UJAA 3KQMA 1RI3A 4M38A 5CM2Z
chains in the Genus database with same CATH superfamily
5FBHA 2GZMA 4MI6A 4Y8VA 1A98A 1K7YA 4Y2YA 4KQWA 4ASUD 1R8SA 2ID7A 2IXBA 3F4KA 4ZU3A 3SPXA 5JTTA 4LXIA 4HTFA 2IDJA 1L3IA 2E89A 1VMDA 1QRSA 4AICA 4EX6A 2ECQA 4PYMA 3DLAA 3WS7A 2WU4A 1RFGE 2R7LA 3A6LA 4JU9A 4DYHA 2Q2WA 1P7WA 1R4ZA 1VC2A 2WVGA 2X2EA 3FF1A 1EWRA 2PLNA 4N3NA 4UMEA 2IWHA 3SIWA 2QZPA 5LQAA 2C8KA 2XW6A 1W85B 4HYEA 5EAIA 3VYRB 3TRKA 1X0XA 3CONA 1F2DA 1JEAA 1TM5E 5TE9A 2QRKA 3G2NA 1J2UA 4GOKA 1UOOA 2CUTA 1DAHA 5CB8A 3L8GA 2D4HA 4OAOA 3VC1A 5KU1A 4KQ2A 3NHRA 1M5TA 4P32A 3AYXB 3BC1A 1MG5A 4KQ6A 1ZINA 2A0FA 1ORVA 3SDSA 5EZYA 2VN8A 1PBTA 1F0KA 1JHAA 2CJYA 3NRJA 3BE4A 1FXSA 4HGYA 1A9QA 5ADHA 2ZJZA 4TLCA 1EGQA 3SOZA 1CU1A 4QEZA 1QVVA 1RQNA 3RS0A 4KE7A 4QNRA 4BLTA 2IHVA 1EGVB 3R7FA 1C0LA 1PD0A 4N5MA 3AR8A 3PDIB 5IJWA 1Y98A 1ISPA 3BWDD 4O5OA 1KEUA 2BUBA 1J5EB 3ESQA 2J3EA 3NRCA 5EP3A 2DBYA 2IIQA 1WO8A 1T0HB 3ND5A 3NGMA 2HDOA 3ENWA 3OZXA 4HI0E 3RUFA 2DCUA 2ILVA 5G41A 5BQPA 1TVCA 4TVOA 3RG8A 3L7BA 3KS9A 3AHDA 3AVVA 2GA9A 4JJZA 4FGLA 3A25A 3I2GA 3JYQA 2F9MA 4FILA 1NSTA 1NW4A 1OX4B 2NZYA 2Q0QA 3O82A 3RSCA 4J2OA 5EFOA 4IAOA 3ZU5A 1GFSA 4A26A 721PA 4FLEA 5JAZA 5EWMA 4YJ3A 2ZAIA 3KOWA 2GVDC 3P9NA 3W8FA 5BMVA 3NVKI 3N8HA 4US0R 3CA8A 1TCVA 2MYPA 4HNAB 5D01A 5LOVB 4X7MA 4MPTA 4KREA 2DHQA 3CS3A 3PC8C 3IVXA 5EP4A 1QYVA 1WCWA 1YFJA 1TZKA 2YWDA 3CLTD 1SQ5A 4HVLA 3FY4A 5ER6A 3WMGA 4IKEA 4OHYA 4CHGA 4KEAA 1YJXA 5HM6A 5C8ZA 3A9WA 3PPVA 4QWWA 5KCZA 3IT0A 3E9YA 4S12A 1B0ZA 4ZWNA 3AZQA 2QJRA 3FG9A 3OESA 4PN3A 5FQOA 3IUNA 4RDIA 4A10A 1CZLA 1W46A 3HKEA 1SZPA 4HH0A 1Z68A 2Q29A 1N2GA 4RMJA 4ZHQB 5HUHA 1MRSA 1NVUQ 4B76A 2C2HA 1QUEA 4J1TC 4G4GA 1YO6A 4DV1B 1M54A 1CD5A 4PXSA 2ZUCA 1JHPA 3LDFA 3OZDA 4PLVA 5FWXA 2HYIC 4ZD6A 4ZT6A 3QLEA 3HXOA 3T0FA 5LL6P 1Z3IX 3D7RA 3OMXA 4LF7B 4G4SO 5KQPA 1BMFD 3IC5A 1DAKA 4OKIA 3LE8A 1QRAA 1UJNA 2J1LA 4R54A 4R6XA 4F8EA 3ZBQA 2W2KA 1PCXA 1D2RA 1FPMA 4BTVA 4NY1A 4Y2VA 1G21A 5HKAA 1PJ3A 2QXYA 5JC1A 1PYOA 1SVOA 4DSTA 2H4ZA 3JQ7B 4C9BA 4R0MA 1FS5A 1YDEA 1VA5A 2B34A 2GZSA 4R05A 3R0IA 5CGQB 1N4AA 1WS6A 2O8FA 4WDQA 1MO2A 1XZEA 3VSAA 2QN6A 5J5AA 3X1WA 4HDMA 3IURA 1CUIA 4IIGA 1HTBA 3W7BA 4EFMA 3F96A 1MEOA 2QMYA 2W83A 3L7KA 1OGYA 4FWIB 2PK3A 4BWYA 4Q3CA 1QDEA 2IYOA 3W5AA 1UBMS 2Y9PB 4ALJA 1U0RA 3TZKA 2EJUA 1VJCA 1NU8A 3L7MA 5K5EA 1SXGA 5LDHA 4CMKA 2GEDA 3HBMA 4IL5A 1KA9H 2XMRA 4E2ZA 4W5TA 1E1CA 1U81A 3HN2A 4OXXA 1Z33A 4EUNA 4UFNA 2QPAA 5DN6A 1T5OA 2BM0A 1VLLA 3ER8A 2YVLA 5BYKA 5JDCA 5IUNC 3S81A 1LBEA 2H7VA 2WIGA 1EJ2A 1O95A 1T1GA 1ZRMA 2A57A 3WLRA 3ZTTA 3G0HA 5ALZA 1AJEA 2HLPA 4MQ4A 1N5DA 3DFIA 1GTZA 1DC6A 1PZGA 3O4HA 3R3WA 2XKAA 3LV8A 3USES 4EGQA 2OAQ1 4I1OA 2Z6AA 3GDWA 4KLRA 2W2TA 1WPQA 2FJPA 2R9VA 3RUPA 4AWAA 1HSZA 1N7JA 2W0MA 3ZLTA 2RB5A 3UJ9A 1MTOA 7REQB 1JMKC 1T2VA 1TYBE 3O73A 3OKFA 3Q3IA 1BVYF 3FNBA 1Y48E 3GX1A 1J90A 5DK6A 5ES3A 5G0VA 5JIBA 4TTRA 4W63A 7GPBA 3RLIA 3GRKA 2ZJBA 4Q4HB 5SYNA 1C1YA 1M7GA 3PUKA 3PYXA 1N7IA 3B8HA 4FYJA 1EIWA 2JI7A 3BH7A 3DMHA 1OI7A 4G5QA 1I2CA 1PR0A 1J1UA 3KB6A 3EMKA 5CB4F 4XD7A 3SF8A 1PUIA 3ZWOA 3STHA 2IPNA 3I9KA 2QVBA 4UHKA 1FUKA 2BE9A 2IODA 3I28A 2NZVG 2RGGA 5KJEA 5E3IA 2COUA 1Y80A 2PCJA 4ZPXA 1ZN8A 3TQIA 1FDVA 1CZOA 3BGDA 5LBUA 1CZNA 3FBTA 2Q5CA 3ZE6A 1VE5A 4MW7A 4WVLA 1EVEA 5HW0A 2IYLD 1V2GA 4PS1A 5IABA 1YHZA 2A0KA 1JU4A 1UMBB 1V3QE 2V4ZA 5DTQA 2DUJA 5I8PA 2B82A 4FEEA 1YRQA 4G8BA 2DEUA 4BDTA 1GQ2A 1T43A 1RTTA 4ZOAA 1AS2A 1X9HA 3VR2D 3NVAA 3D5EA 3KD2A 2F3RA 4PHFA 1S2NA 3RVNA 1BWQA 4EI2A 4D02A 3HU1A 1UZUA 4BN4A 1XQVA 4W1SA 2CVOA 1B8UA 4ABTA 1TYAE 3IR7A 4HVAA 3RUDA 2ZWIA 2YFYA 2QL6A 1ZJ5A 1G20E 1Q57A 2RMKA 1GGJA 3GLIA 3MWLA 3TKLA 2HK8A 4U2KA 3PENA 1EM8A 1IK6A 5K0NA 2FFJA 5KWIA 3G5AA 1TQ8A 5IX8A 5GVRA 1MTZA 2VTEA 2O7SA 2XCIA 1WWKA 4CQJA 3HXKA 3K4HA 4L9SA 4WCFA 4UD6A 3F8WA 4I6GA 2BFMA 2QNIA 4NAHA 4QSHA 4NS1A 4KQEA 3WOVA 1R64A 2XADA 1GN9A 1EUYA 3K6SA 5JMWA 4FXPA 1KI7A 2V5AA 4BBJA 4TMWA 2EG9A 3LP5A 2WAOA 5ITZA 4U7FA 2MYUA 2BKUA 2H4FA 4Q21A 1YIDA 1F06A 2CSUA 3GFGA 4G9EA 1OWMA 4WOPA 4JUBA 1T0PA 3LC7O 3HK2A 4R1TA 4L2IA 1R74A 2ZYIA 3Q7SA 4OSPA 5ELMA 4QG3A 3K8YA 3I1YA 4P4UA 3KCNA 4WGFA 1Z63A 2F7SA 5ALXA 1QGUA 2C2MA 1C9EA 3DQQA 2Y0BA 4RETA 2KMLA 3UMCA 1NVFA 1D04A 2Y76A 4BOYA 1PJ8A 3HY4A 3MJVA 2KWIA 2ZYUX 3MWJA 4EFKA 1ZNWA 2W2PA 5BXYA 4YJ2A 3HG7A 3WJ2A 1Q21A 2PVPA 2R7AA 1PJ2A 2WT9A 2BFDB 1HKUA 1V35A 2A0XA 4V38A 4CKEA 3LCMA 1C3OB 1M34B 5TT1A 4E3WA 3DL2A 3KZ1E 3LC2O 5CYPA 4ZCRA 3UGKA 2MIIA 2QLLA 1IXRC 3ACCA 4N7JA 4CDMA 4HRVA 2PS9A 1T0JB 2RHJA 3KKKA 3OQNA 3MTEA 4OK5A 2VP0A 3GBVA 5FFNA 3SF8B 5KNBH 5H80A 1XB2A 1WBBA 4IINA 2JCGA 1NYRA 4F04A 1L4BA 1JYFA 2I3GA 5K3CA 4C4SA 5IT4A 1UC9A 2ODBA 2AJTA 4K1XA 2XTMA 3KYIB 1P5JA 2CZGA 4PQRA 1SQ6A 4KAJA 2XLBA 2IELA 2J6HA 3ET4A 1TDJA 3WGTA 4DV5B 2AFHB 4U7PB 3DC2A 4YACA 4C0BA 3FETA 2PN1A 1R7RA 1JRLA 1SG6A 3VPCA 5EY5B 2ZRIA 2J5KA 1B4DA 4O4LA 4B9AA 2QYSA 3W5VA 3OQHA 1YDFA 1HDZA 2RH4A 4PPFA 5KYWA 4DV6B 3NX4A 4BQNA 2UZ1A 2YWCA 1Z4IA 3Q3VA 4C0AC 3QEKA 5K01A 5EPEA 4LOJA 4PSAA 2KI5A 3L01A 2QX9A 3ABSB 3HE3A 1UIMA 1NUHA 1V7ZA 1P8JA 2AEEA 3EGIA 3TLYA 3N0XA 6LDHA 4W6ZA 4WW0A 3Q3EA 1EA5A 2OV4A 2ERXA 1YT5A 4ENVA 3WE7A 3QFCA 1BH6A 3QPBA 4MW2A 1VRWA 1WHSB 3HJNA 1E3SA 1V16A 1Z4JA 4ZOBA 5D3MA 2B8NA 1UBHS 1W581 3K9GA 1W25A 3NHKA 1AKVA 1Q7EA 1WRBA 2CCGA 4FS8A 1C1DA 4MEJA 1Q0ZA 4JLVA 3CUYA 1ZIOA 2X19A 1IEWA 1KK1A 1AUOA 1ATZA 1FU8A 5FUMA 1W1IA 2EFDB 4IQ0A 4TUYB 3N0VA 3KQHA 1SXQA 3NWJA 3D0KA 4PLPA 4U2CA 1QTRA 2IX9A 3VX4A 4I9GA 1AF7A 2E4UA 2VG8A 2ZFUA 3RCBA 1PTJA 1ZC3A 3NANA 3PPWA 4K9QA 4W7IA 3WNBA 4ZK6A 1M6EX 3FOCA 2X7JA 2GEJA 2FQWA 1MNQA 4DG8A 5B64A 5ERGB 3L8HA 3DMRA 3HUFA 3RFXA 1NUSA 4EZEA 4E5PA 2VZEA 2O8CB 1C3JA 4BLPA 2IU3A 2WPDA 4C7KA 3AUFA 3FZYA 4YEDA 3H8JA 3T3IA 1O94A 1WB4A 1JHQA 3RVMA 2E7ZA 1VXOA 5JVDF 3GPIA 4BKRA 1K3UB 3OLYA 4Q4JB 2X5KO 3PHGA 1M7BA 3K3PA 4KMSA 1Y1KE 5K4GA 1SZDA 5G3ZA 2C5BA 1OROA 1B6RA 4KDCA 1WD7A 1LB1B 1GPH1 1E2NA 4OI0A 3WG9A 3ZLUA 1BCRB 1RKBA 3U81A 1U8AA 3C8DA 3MGCA 2ADMA 4CGYA 2ZTMA 4DCSA 4HUTA 5F7XA 2OE2A 3ZWNA 5L3VA 2W42A 2A59A 3OCWA 1JFFB 2JGNA 1TECE 5EHIA 3GV0A 5AKEA 3GHHA 1SU7A 3IBYA 5FO1A 5J2TF 4BVFA 2W11A 3FA2A 4PRZA 5I6DA 3FUWA 1AK2A 5CB4A 4X44A 4L5BA 4MWEA 2QRJA 5KVCA 1N9GA 3ZYCA 3BIWA 2I66A 1PDVA 5D84A 3E61A 5HFJA 3TX6A 2XDQA 3UWPA 1Q1ZA 4S3MA 1T9CA 1VLZA 2WFMA 3GIDA 4I9FA 1Z47A 3EGOA 2OZLB 3M4NA 4IH1A 4PQGA 3ZV6A 1DEXA 1FRZA 1RKUA 2F3PA 4MS3B 5MN5A 2GDJA 5A3JA 2IQIA 3HCAA 4C6TA 3SG0A 1Z2EA 3MCTA 2WQ7A 3NAMA 1ULBA 3KSRA 5JH7F 1FK8A 3FOFC 4KNVA 4QVKA 3QVJA 3X1KA 3WHLA 1CHDA 5I7HA 1QYCA 2Y0CA 1U80A 2WWFA 4I4TF 4RVFA 4MV7A 3PUHA 3PGKA 4RANA 3MQ4A 1G8AA 4KI0A 1CQXA 1ZU5A 4RULA 1BE0A 1C7QA 2BP7A 3PFNA 4LOLA 2RGXA 2HRZA 2ZYTX 2FSIA 5DMHA 1PVDA 1MB2A 4J0FA 1GLGA 1OVGA 5LA6F 2BGNA 2ES4A 2QROA 3WYNA 1MPXA 1AN0A 4OAPA 5F3DA 2ZE7A 3TLGB 4PAWA 3RRJA 4E2WA 5B3AA 1NBMA 2DTDA 1PGQA 4XX0A 2FR8C 3NBAA 4BP1A 1E1RD 1UEXC 1YE3A 4R2JA 4XUDA 5KC9A 2AMVA 1VLVA 3R6DA 2Q9UA 4QELA 4EW3A 1DI0A 2TMYA 2WHPB 2DT8A 1DKQA 2GESA 3IKJA 4OK6A 4WXHA 5EE0A 2VDNB 2IEGA 1X0VA 2FRDA 3ITKA 1CP2A 3RSZA 5IPFA 1A7KA 1ESDA 4JBGA 4O2BB 4LK2A 4DLKA 4NS4A 1JWAB 4MR8B 3QRWA 1M6VB 1W4RA 3F8TA 4DV4B 3K5WA 2PGLA 1XKTA 3PHCA 4PYOA 1CCWA 2ZIVB 4M8LA 5BOSA 1Q74A 2EFGA 2JDID 1EVLA 3T3EA 1GGMA 4W5NA 3Q0EA 1RE1A 3Q9NA 5KSPA 1T8RA 2W2LA 4GLBA 3LFHA 4YCSA 5H4GA 3RIHA 2V3VA 5IBQA 3TZCA 1BHQ1 4DDMA 1RFLA 4K9MA 2JAHA 4X41A 2OV6A 3TINA 3IHLA 5JZVA 4JJ6A 3DO5A 5AJUA 3ZCQA 3PJDA 3ZJTA 3KJFA 1RZ3A 4KKXB 4MYDA 1KQOA 1UDXA 3DXYA 3FPJA 4KG7A 1DG9A 1DFHA 2ET6A 2IUTA 1E3LA 1JG3A 4X8LA 1V2HE 2QZSA 1XLTA 5L7TA 2UZIR 1NW5A 1RJDA 2YWJA 5KI6A 2Q1TA 4DREA 4F3CA 5FRDA 5BQ5A 1VJDA 1TM4E 2SKEA 3AB8A 4MDEA 2B4KA 4FOSA 1JEQB 2IHTA 4BRUA 2FWBA 5K0JA 4FWTA 2BZ1A 1I3LA 1YE8A 2XDQB 3NAZA 8GPBA 4CNQA 3ZPXA 1YC2A 2LUOA 3GU3A 4IPTA 4DMRA 4DRZA 4DFDA 1JMYA 3OAAD 4QBIA 2DWUA 4WOJA 4Z4IA 1UFRA 2FZVA 2Q7XA 4H3SA 5FPHA 3T15A 1N1DA 3EEBA 3NCHA 2CVFA 1RAFA 4YRLA 4Y3UA 4BNTA 2X5JO 3TOVA 1UT6A 2QL9A 1KEEA 2PSEA 2R6GA 1J5PA 3AFMA 3EF0A 4R1LA 1P2DA 2AZDA 4P6VF 5FWAA 1F6WA 2BHSA 3GJ3A 4RLQA 3WK5A 2NUTB 2P62A 1IN1A 3RYIA 2AWNA 2A4KA 3EB9A 2JARA 3H8VA 4HDNA 4PYRA 1G5RA 3UF0A 4OI4A 8MHTA 1WDWB 3F7MA 1IDOA 2QSZA 1XQ1A 4LDQA 1QAMA 4IUCS 4XE5A 5DIFA 2X6TA 2E3JA 3RFVA 5JRZA 4JC8A 1EXVA 2YYZA 4H1TA 1MJHA 4Q19A 1NYLA 3PZRA 2XGOA 3K70D 4R3WA 2C82A 4COOA 2O2GA 4QXMA 2ZP1A 3KDAA 2MMGA 3RAJA 4YYEA 2ZWMA 5HJ7A 1H23A 4DR3B 3DTVD 3IRUA 2OHVA 4CKWA 2Q2NA 1DLJA 1YHNA 1PGNA 4Y9DA 2AXQA 4YLEA 1XRQA 6Q21A 1O6FA 3AI2A 2BJWA 4Z9AA 5IM4A 1JQKA 2D7CA 2PQ6A 2PBRA 2QJWA 3MA0A 2GHIA 2P40A 3KOOA 4H7DA 4IDOA 4ZOLF 2ODQA 4RTLA 1L7OA 2QAGA 1NVTA 2DHDA 4FMCF 1IBCA 4NENA 1GUFA 2YVKA 4KFTA 4UEKA 5IBCA 1NBMD 4GGMX 3VKGA 2CD9A 1W7AA 1JEEA 4KO1S 4H7HA 5GADl 1SUEA 4OSEA 2O23A 3QFTA 5BV8A 2OOSA 1Z4LA 1N6KA 4RC9A 2A94A 2ZR7A 2NPIA 3OZAA 4HV4A 3FUVA 4JJFA 3WO0A 1SURA 1XLWA 5BOSB 5HZHA 3P9KA 2IP2A 3OD5A 2D2EA 5CXSA 1YZUA 1ELOA 4MV8A 1A8SA 3GFTA 2QX8A 1XVLA 1ZCJA 2B36A 2BMVA 1KDVA 4KK4A 4J7CA 2WWVD 5BQ3A 5I9IA 2BL4A 1E0JA 1TGVA 4XDGA 2P68A 4ARZA 1SU8A 4YCMA 4INJA 1K5GA 1CP3A 4YMIA 3U7FB 3HRKA 3LC0A 1OSNA 1ZNXA 1QH8B 2EV9A 3D3NA 4P92A 3ZGVA 1LUAA 3VTZA 4F60A 1Q7RA 1TO2E 2VK8A 4CM5A 1KS2A 2HRRA 4MVJI 4R4JA 1DSSG 4F9GA 5BWNA 5AVZA 3BBPA 2AYYA 3IXLA 4DCGA 1NKTA 3DLCA 3H2IA 4HDSB 3BJMA 2QNBA 5THKA 3TTXA 1M6NA 4GNRA 2LZ0A 3O83A 1U8UA 4DNOA 1FLDA 2JJYA 4PX3A 3RUEA 4JAVC 1JH8A 2X9QA 5HOEA 1H8HD 3MB5A 3FHCB 1OLUB 1E7RA 1M7HA 5G1OA 1X14A 3KVOA 1Q3HA 4BO8A 1DX9A 1WZNA 4ARIA 1QO0D 2OGUA 4HNQA 3FLBA 6YASA 2BMDA 3NNSA 2EKQA 2JJQA 3DFZA 4YP7A 5KOHA 3TI9A 1I51A 1ZR2A 1OWNA 1NXWA 3O8OB 1J21A 3PQ4A 3VHQA 2JIPA 3OE1A 2VFAA 4NP6A 4HGNA 1TZCA 1JL3A 3EMDA 3NYIA 5F12A 4AKSA 4ZP1A 5JADA 1M6HA 1BYIA 3QKIA 5LNK1 3Q8MA 2QAIA 4FVTA 1G21E 3Q7IA 2GPAA 4MEBA 4UTPA 4FPXA 2I4TA 2D0IA 2QGNA 1DKOA 4FFOA 4NHOA 1K5HA 1W47A 3OE7D 2A1TR 3HVIA 1TUBB 1HFKA 2R79A 1DKRA 2WA2A 4LZAA 3WA6A 4B6EA 4UFPA 2B1IA 4YREA 3WYDA 4CIAA 5TV2A 1ISIA 2FZLA 3PPXA 3WSVA 4R7ZA 4FT4A 4YWJA 4EL5A 2WZDA 3BRCA 4X6XA 3BK2A 2QN1A 2CVZA 3GVPA 3BTVA 1ARZA 1C0PA 1HUQA 2CXPA 3U7IA 3GELA 3A6GA 4GGOA 3T3GA 4UBIA 3VQTA 1TPYA 5TARA 1CJVC 1FS6A 1O5IA 2I5PO 1JPJA 3CNQS 5DYYA 3ABRB 3FE2A 2X9VA 1E4VA 5D6NA 3NDBB 1HBJA 1WULS 2G9ZA 3QSGA 2VA9A 1FLVA 4GPEA 5EE9A 1TQHA 2NWQA 4C1BA 4BEWA 1R10A 2JIBA 2ZE5A 3RVLA 4B4VA 2AEFA 1PHPA 1Z3CA 1IWOA 1X7XB 2I76A 3ISJA 2IHYA 2FFBA 4K05A 2BEWB 3H99A 1CZKA 1CUVA 4HLDA 1JBKA 3UHJA 3JD0A 2E0IA 5LPNA 3NHPA 2YIJA 4XFJA 1OVMA 3VTKA 2QD1A 3ODPA 1TKRA 1RWVA 2PVSA 3B78A 3CRW1 3DKRA 2FNAA 3M8KA 4K46A 4LMRA 3L7OA 5LZ9A 1UODA 3OBIA 5D5HA 4YUYA 3KR9A 5CG1A 2OCPA 1QFXA 4CIWA 1XI2A 4MP6A 4TL9A 1O57A 4ROSA 3SC2B 1JIJA 3GLUA 4XIYA 4F2HA 1JG2A 1OHHA 4JOBA 3AINA 2JFZA 4GI2A 4I19A 1Z26A 4LDNA 1NZFA 4PY2A 1Z07A 1HNXB 2GKSA 1Y6RA 3DUFA 2RHRA 4Y6OA 1BU8A 2LKDA 4FYMA 3H5IA 1LKZA 4P22A 4HS9A 1M76A 2XQFA 2K4MA 1QUFA 3NM5A 5AJVB 3X1JA 4AIIA 4OB7A 3DP9A 2WP0A 3C4QA 1HZZC 3HSKA 4JQZA 5BQFA 2D7JA 1QV6A 1JDBC 2ZUTA 4ZHSA 1KYWA 5AKJA 4BKMA 1CUHA 3GCWA 3IDOA 5K09A 3M5PA 1NJFA 1KDTA 3ONNA 2EJVA 5ICFA 2Q1SA 5GWXA 3U3DA 5ITVA 3CE9A 1ICEA 1K8RA 1BD3A 2EJBA 1L3CA 3ZVLA 1HYQA 3E3NA 1WDMA 1OXTA 3QE4A 5PNTA 1WUKS 1SBHA 4BO1A 3ZDCA 2QXTA 4QPCA 4X20B 3WBFA 2EGHA 2QVGA 3GRCA 1BEEA 2DLDA 3CX4A 3INYA 5JDCC 1Z36A 1S8OA 5FBLB 2JD2A 1J2RA 3R0QA 2NU8B 4ARUA 5PGMA 4BASA 2GEKA 4NJEA 1CUAA 3CUVA 1ZKMA 2BHRA 1FP6A 2ZRHA 1S4MA 3RK1A 4BIMA 5CA1A 1E79A 2JAXA 3HEMA 3LT2A 4KR6A 3L4SO 4U6SA 5CFPA 1E58A 1AQJA 2A92A 3A1DA 2EFJA 2YJ3A 4HDMB 3H1GA 1OPXA 4Q34A 3BQ9A 4AG6A 2IGTA 4REOA 2CV1A 1K5PA 1G2OA 1TNDA 4UNQA 4CKBB 3WGNA 4WOKA 4PLWA 5JLJA 2ZT6A 1KDZA 4RTKA 2A88A 4JLNA 5KYGA 4M9XA 3FYDA 1GNPA 3LZDA 3O74A 1LRKA 2IDKA 4RJIA 1COWA 2FE1A 1IN5A 2OCAA 1DIOB 3FUXA 5CVEA 2HMWA 4LCBA 1Z9BA 5EE3A 3V8EA 2D1QA 3UMBA 3M3HA 2W6OA 4ASUA 1OV6A 5AJZA 4ZYWA 4KQGA 1E8MA 1II8B 1K6EA 1YQDA 2DBVO 2EC5A 5HMMA 1TJNA 1ZRSA 1CW2B 1HFEL 1GSIA 1F8XA 4RELA 5AK5A 3U37A 4QXOA 2Q99A 3WLLA 1VL6A 1CUZA 3JAKB 1N5LA 1T5HX 2OT3B 1FDWA 2V7PA 1LS1A 1VI2A 3FZNA 4CUKA 5K9ZA 2QTGA 2Z4TA 2X5XA 1P75A 2H08A 1LXCA 1Q0SA 1DT5A 1VPDA 3MLBA 5DE3A 3S5UA 3CVVA 1XJ5A 3FIUA 3C3BA 3QMMA 3K9CA 3MUNA 3PVZA 2XYRA 2ZUWA 4Z9XA 1ZH6A 1U0FA 4MEAA 4IIVA 5T3YA 2PFKA 3FTDA 2Q4DA 4ONEA 1LLFA 3KR0A 1FQJA 3LI2A 1OWOA 3UAGA 5K05A 2OK8A 5ILQA 3JW8A 3N87A 5KTSA 4YAOA 1M8JA 1OLXB 3ROPA 1M2KA 3IMCA 4OUKX 5E1BA 2O19A 1XK7A 4MRPA 3EIHA 3H18A 4MGYR 4CLRB 3KKMA 4L6CA 4GNKA 2BFEB 2CLMB 2WD7A 4TWJA 5AJWA 1ZCFA 3I5YA 1LI4A 3ZIAA 3F98A 5A4DA 1CZRA 2IXFA 4JVOA 1T4GA 2VUTA 3KLPX 1Z12A 4NDNE 3W5SA 1GZHB 3EVAA 4X45A 3LX6A 2LIPA 3OQJA 4EKDA 3UK6A 5LP1A 3T1TA 3OCXA 4NNOA 2WM9B 1J0AA 1MC4A 3FPLA 3OA2A 1B0PA 2R3SA 2ZT8A 4JVLA 4ZN6A 4KK3A 1Y1PA 1ZI8A 4BN0A 1S96A 4IV5A 1ZYUA 4MS4A 1A5AB 4QYMA 4MX8A 2C20A 4PHCA 3CVUA 4RZ2A 4TV9B 4N0EA 3CISA 3IILA 4F86A 1XLVA 1B73A 1MOSA 3T7EA 1CT9A 2BM1A 1NC3A 3O8LA 4FKZA 2EFEB 3RC3A 4K2AA 5C9ZA 5AI9A 4BJHB 2G3YA 2WWXA 3D43A 4XVRA 3OVMA 1J8VA 2QD2A 1ZL0A 1TMKA 3QFFA 3IH5A 3EODA 2C2ZA 1U7PA 3B3QA 4JYMA 4OQQA 3R7WA 3UHAA 2JIQA 4AY3A 4F4JA 1UXHA 1Y8ZA 3EIXA 2WTBA 3FVRA 3BWYA 2HC9A 3BA1A 3Q0IA 1T6NA 3K9QO 2QLFA 3Q2IA 2PT7A 1Y0BA 4M1MA 5FA8A 3V8RA 3IKVA 2AWOA 4HWSA 4M8SA 4G8DA 3W8RA 4CM4B 5JNLA 4YRIA 3I3SR 2QIOA 5FBQB 3UJDA 4B44A 5SV2A 3EIEA 1BFDA 1DTWA 3PLAE 4MCJA 4ED9A 3O1IC 4F93B 2P65A 3GYBA 3GO4A 1PUJA 3MIIA 1O7JA 3CINA 1W0CA 3GZNA 4N5NA 4LY3A 2J9FA 4U2BA 1DKMA 1C7EA 2X42A 4D3FA 4DDHA 4EPXA 1X74A 1SHKA 3K05A 1J0BA 3TK1A 4BMPB 4XW2A 4KPGA 4MDHA 3ER9A 3UMVA 3JZMA 5ILOA 3TXYA 3BMOB 5I3CA 1PL6A 3WKEA 3B1JA 2F00A 1UMBA 1Y5IA 3AHGA 4U2DA 2O5RA 3IVCA 4MR7A 4OU5A 1N77A 1CPYA 4KACA 4DLBA 1G2IA 4EMSA 4NONA 4XSGA 3W5HA 5C7IO 4WZBE 3OH8A 4H7KA 1CUDA 4TT3A 1GZ5A 1I6MA 3V2IA 1ND6A 2YV3A 4K7JA 4EJSC 5FI0B 2Q4TA 2DLNA 4RPLA 3UH1A 4ZA2A 1PJAA 4FMDB 5JSUA 1GZ3A 2PMFA 4MDYA 1FP1D 1T3SA 3VYWA 2PIAA 4HFRA 5A62A 1UMDA 2JH3A 4W9NA 2FGKA 4QZVA 1RS0A 3O26A 3IP1A 2VDQB 4E5UA 4IIJB 4PC1A 2IXEA 1PEYA 3LLVA 5JAOA 1P4SA 1T2DA 3SIPA 3RHTA 1EU1A 2C4VA 1H9BA 2WIJA 1WXHA 1XYVA 1KAHA 3K6KA 1KPGA 4M60A 5JALA 1M2VB 2RI6A 5TS3A 2WM2A 1IL0A 4L50A 3JALB 4V0MA 4EB3A 3JYPA 4H3VA 2WZBA 1E5VA 3IIKA 5AM3A 1YWGO 2J6IA 4LW8A 1Z5NA 1Y8CA 2CK3D 2HDHA 4RXUA 1HG1A 3MPUA 1H6DA 3NM6B 7YASA 3DLHA 4AZTA 3MWGA 4IZIA 2MINB 5HA5A 3A58B 4RF2A 1HTTA 3EZ2A 1GGEA 2JHAA 4HKTA 2C5LA 3TQHA 3VBCA 4UCWA 4X3PA 1KL7A 2JLSA 2ANCA 3QVWA 3HC7A 2O8BA 5CJPA 4KL8S 2YHIB 4H16A 1MZPA 4CUJA 2PAFA 1NW8A 2VAWA 3VR3A 3FFWA 1RI2A 1OGJA 3HDHA 5TQ0B 4L5IA 4QNMA 4PGHA 5AW9A 1NJ5A 1HEIA 1HDXA 1OYOA 2X23A 3ZZ1A 4KB5A 5EJGA 4UVDA 4IZHA 3BGVA 3K8ZA 4JR1A 4PYIA 3ZQJA 4EH1A 4UBNA 1T9AA 2A3NA 3LHFA 5CYGA 3QX9A 3G0BA 1N33B 3WKBA 1LDGA 3OSUA 3PJGA 4MKIA 2PDAA 1G9SA 3N59A 2G09A 1NQUA 4JQSA 1P31A 4XZ3A 3P2JA 5ENZA 3RGWS 4BAUA 2VS1A 2XJ4A 3EBPA 2GK4A 3PUXA 4GI5A 3HHEA 1B3BA 3RPEA 4A0FA 2GD6A 3I0MA 4Z0NA 4MR9A 3QENA 2OAGA 4JBWA 3ZI7A 3BSSA 3SKVA 4F56A 2AYZA 4P3XA 4MIEA 5IP5A 4CGZA 5JD3A 3AY3A 4XGKA 1PGOA 3PXDA 4OHCA 3U1BA 4D4MA 2IS2A 3HSYA 3R3SA 4WFJA 3AUAA 3O94A 2SECE 4DAEA 1NNLA 2VRCD 2QUHA 2YJNA 1SBQA 3GCDA 3PXBA 4FGSA 2WDPA 4MR7B 2ZKLA 3N2IA 2JIMA 3H4MA 2RKWA 4FYVA 4PC3A 3VFDA 1HF3A 1W35A 1R4NB 3BSFA 4G07A 4EUEA 2WM8A 3R7DA 5B7GA 3C7TA 4FOLA 3NUZA 1RE0A 1PF7E 1TVKB 4YUAA 2QN3A 4WAUA 2YWHA 1YVRA 4AJ1A 3VAAA 5DNAA 1IAVA 1MV8A 4YAFA 4OFZA 4GC9A 2RB4A 3V3TA 2GBIA 2GZ1A 3BRWD 4I99A 1LC3A 4P31A 4MKXA 1JT2A 2B8JA 3SXUB 3KQSA 3UAOA 4UDOA 2V5VA 4IGAA 4OYLA 5GAJA 5GGXA 4C0JA 3RBVA 1NNI1 2BFOA 5FV7A 3ZD8A 4UDXX 1WY7A 3E3MA 3OKPA 4NG4A 4URHA 4DDWA 1K4MA 2TS1A 4D6YA 1BG6A 1GP2A 2SKDA 1FIUA 3HGQA 1EFRD 4NTZA 3OM0A 4ZRMA 3OECA 4TN1A 2WJJA 1PWZA 4KRGA 4J1TA 1L9KA 2CXSA 3V4VB 4GX5A 4QU5A 3RNOA 3TUJC 3BREA 3CCCA 5EJ5A 3MJCA 4LYFA 2X2FA 4L22A 2ZWOA 1TMOA 3UIEA 4ZFNA 5CITA 5K0GA 1OFGA 2DX7A 4XFKA 2OO5A 2Q6IA 2LR0A 2IC5A 4C7MA 3V4RA 4QM6A 3KSAC 1JSRA 4CV2A 5JS1A 1EE9A 1YQQA 3S2FA 1DS6A 2ZIGA 3ADKA 1K3TA 3G2OA 3QVLA 3B38A 4ER0A 2JGDA 3WDLA 1E1QA 2WJWA 3MTAA 3A9SA 2X1VA 4IXNA 1AO0A 5DCUA 4JHXA 1VGQA 2PY6A 5T3UA 5FOXA 2VK4A 1FFDA 2QJFA 3P2EA 3R8CA 4B4UA 4CEIA 4X61A 2HSZA 3EY9A 3L8CA 3THXB 2CJWB 1P73A 3C5CA 1W0JA 4GT1A 3L7JA 4QUAA 2P2NA 3PXXA 1E9VA 1AGYA 1DG3A 4FT2A 4R8MA 5F78A 4D3SA 4RY8A 13PKA 3RDPA 2W6JA 2R60A 1RDFA 3HFSA 4MUGA 1HKHA 1XMVA 2ERCA 1C7JA 4EK9A 1V5WA 2XNDA 3EPHA 1FUEA 2A84A 4MLZA 3AM1A 4I55A 4EGJA 1RLIA 1NV8A 3QPVA 2J3MA 1P1BA 4G8CA 1FLNA 1FNNA 2Y4NA 1EFKA 5JD6A 2WRZA 2EW8A 2Q4EA 4D80A 1QE3A 4HXGA 2ZSDA 3LG2A 4II3A 3DHEA 1UCFA 5HUJA 5JDIC 2D3WA 4LQDA 4ZO8A 3SF0A 5TLSA 1JWLA 3JYLA 4CCAA 2GAFA 2VF2A 1QHSA 4QTXA 1U1GA 3DAFA 4O8CA 1JNYA 1SKYE 3ZHUA 1RYEA 3IPLA 1U2GC 2P1RA 1C14A 2XMGA 5JCXA 1FEZA 1SCDA 5BR8B 2IIVA 5J4KA 3DG9A 1E3WB 3IAAA 3Q98A 5BWBA 2SHKA 4K86A 2O5CA 2C78A 2VNJA 2A9KA 2FUG6 2V7BA 3E22A 3VV2A 3IELA 5KYNA 1Z0FA 5AJYA 4F46A 4M0PA 2DWCA 4BLWA 2C4KA 2Y1WA 2PANA 4PANA 4P83A 4XVQA 3GH3A 3ML1A 3VISA 1Z2DA 3WO1A 3AVTA 2R6JA 3BIJA 3P9CA 3G2PA 1AZSC 2BSAA 3JAMA 4GMFA 4XXHA 5CA1F 4M9QA 3LQ2A 2PTHA 3Q3HA 2GCEA 4GRDA 1J24A 4WPGA 4OQNA 4PCAA 5BRAA 2BBTA 4GX1A 4DV3B 4LJSA 5E6UB 4AKHA 3HJGA 3CLHA 3PK0A 1QDUA 1P8AA 3WHIA 1YBAA 1HETA 4XYEA 3HXQA 4W5RA 3KAKA 5DI9A 2JHCA 1G59A 3C3AA 2MYNA 4MSUA 1S2DA 4MGZR 3NBMA 5L6LB 4RIHA 4RTQA 1RMTA 3U5ZB 4QU0A 3GMDA 1R0YA 1VA4A 2Q3DA 3K30A 4QPNA 4A1FA 1G3UA 3JRWA 4EITA 2OKGA 4YECA 3S68A 1Z5OA 2OGZA 2FTKE 2IIPA 4KSYA 3V8QA 4MICA 1QG0A 2IP1A 3GZNB 4KQCA 3S2EA 3MK31 4QVIA 2P4HX 5DSXA 2CK3A 4WTOA 5E1DA 2II6A 1C7ZA 5CBPA 1FFBA 2YWBA 3I6YA 1ZMBA 2IA5A 2MSDB 4NMHA 1JH9A 3U6BA 1IBLB 1H66A 5DRTA 2J67A 4C30A 3ZI0A 2ECKA 4KN5A 4CG3A 4PSKA 4QVGA 2HPZA 3FF4A 3WGLA 5CW2A 3LM8A 2KM1A 4BO5A 1M8FA 2P2CA 3OPYA 4UU0A 2Z43A 1G98A 4ZICA 3OTIA 3NEAA 4Q1BA 1P0QA 1HLGA 4GSLA 3IV6A 4J0HA 5JHHB 1S9DA 1X38A 1CUSA 1X1TA 2ZQYA 3PU6A 4MB2A 3C97A 2XT0A 5DKFA 3UM9A 3DAPA 3WAGA 3ONDA 5FV4A 1S4QA 4QPDA 1AX9A 5IFKA 5DNWA 5HKKA 1Z45A 3DC7A 1HH4A 1X7ZB 1C1HA 1F14A 3EZGA 1NP3A 3GLTA 4GICA 4R2XA 4WY8A 3T7JA 1A0OA 3LRPA 3OWXA 1ZS9A 3NT2A 1VLQA 3L7DA 3C7KA 1YRBA 5AI6A 1U4NA 3TE6A 4FI3C 2WIAA 3KM0A 4DZTA 3RTEA 2FFRA 1QHNA 4GOOD 2JFUA 5LQSA 4PZAA 3G49A 1A9TA 1ENYA 3QYPA 1CS4C 1YVEI 5IANA 3SP1A 2BGWA 2ARKA 2L19A 4BWVA 1EFVA 1YRWA 2C94A 5D3MB 2DLCX 3DDCA 4AMVA 1IHDA 3BJEA 1OBFO 3KKLA 3OX2A 5KZMB 5KSZA 2JFHA 4OQLA 4E4RA 3GJYA 1VKRA 1X42A 3ORYA 4Q39A 1QE0A 4UNIA 5KO2A 3SQLA 1JJBA 5FOUA 2FQQA 1Z0UA 2ENWA 5DT2A 4O4JF 3DZHA 3H2KA 1UPUA 2B5OA 2D8AA 4ZODA 5FNZA 4UEJA 3DEYX 3AR2A 3CTMA 2VYVA 1Z15A 3TSCA 2BFPA 3C3MA 4BQFA 2OXEA 4MV1A 1F5SA 2FPRA 2W2VA 2WG2A 4TZKA 4L95C 5C1OA 4BLVA 4IFIA 2A5LA 1RJ9B 3R44A 4BTEA 4BGVA 4JBYA 4GQAA 3SYTA 1EZ4A 3ETEA 1QK3A 1V6SA 3HVRA 4E7OA 3HYSA 1CQWA 4TQAA 1QV9A 2FF5A 4RBNA 3RRNA 2OZVA 3IDQA 3KDPA 1JKFA 3H19A 2AOWA 3UB3A 1ECPA 4EDFA 2MJLA 2RG1A 2WVAA 3QH4A 3VSDA 3QFRA 1HQCA 3PUYA 1JJIA 4MTLA 2YBDA 4N0MA 1B2RA 2P9GA 3FPSA 3MPOA 3H1PA 4GP9A 1WCIB 1VPEA 5FOQA 1B26A 2VT3A 3D6VA 1Q3TA 1RWPA 1GTL1 1T2AA 2BKVA 4FHDA 1S2LA 3NC4A 2V55B 3TQQA 4EHDA 3OCUA 3ND9A 1IQUA 1NJ2A 1XHLA 3RC9A 4HDQB 2VHZA 3ZIDA 4FE4A 4JWTA 4QYIB 3RFTA 3AEXA 2CFOA 1IAQA 4QBFA 1JAHA 1JKXA 2J0UB 4HZUA 2QVLA 2YYYA 3STUA 2YS7A 4IHKA 1BA2A 1W44A 3PI7A 2C00A 1M2HA 3ZE1B 1TMYA 1VRVA 1RT9A 5I01A 2FEXA 1RAIA 2UYOA 1SKMA 3SC3A 1GPAA 3LWDA 1QM5A 3HCCA 2REOA 2UVDA 1EBBA 5LDGA 2YJ4A 5HOQA 2P9CA 4G5OA 2HIGA 2Z08A 1XRMA 5KYYA 1XEAA 3GLHA 4GZ6A 1QSGA 4KAAA 3VVMA 3WBBA 3ZW8A 2V8OA 3CTPA 3S27A 3WDMA 4AF7A 4EA9A 5T64A 2VXOA 3L1IA 3IL2A 2VRBA 2A14A 3NNDA 2ZB7A 1UMCA 1J07A 2L0XA 2BFFB 2O6LA 3PGXA 1Z8HA 5CPBA 4RF3A 3OPQA 3ZHSA 4ZOQI 1E63A 3I42A 3P2KA 3SQDA 5JYEA 1AXEA 4KXMA 3NHZA 4ZGGA 3A6FA 4N8EA 3KYDB 2V7TA 1NNSA 1XALA 3EXHA 1JSZA 4J0DA 5I7AA 2EQ5A 4EGFA 4B7UA 5HK9A 3AHJA 4RPKA 3DXXA 4JJ7A 3I5UA 4G09A 4HDKA 3AONB 1NZDA 2C5FA 5G40A 5KSYA 1E2FA 3I2IA 2C9YA 3E81A 1SBIA 4W4TA 5CDFE 1HDEA 2HLNA 3DFFA 4IYRA 2VTVA 3MUFA 2VT6A 3KOZA 1WMBA 2HXYA 2XYGA 3ANLA 4JOQA 3F49S 1W4CA 4KUEA 1VP9A 2QR2A 2PCLA 3ZHVA 4BQSA 5CDUA 2Q41A 3CUEF 1C80A 3TNLA 4QHYA 3VJKA 4BUJA 3C41J 5I4BA 3NATA 3KWJA 2QWXA 2QX4A 4FHZA 1CQJA 3D3JA 3QPWA 2DWPA 3P0HA 2CD7A 1E79D 1O58A 5H9VA 4F4IA 1F2UB 1JV2B 3H6KA 5BWOA 3I6MA 3IESA 4KAFA 1EI9A 4QOEA 3RIYA 1CIPA 5TGDA 3TIGA 2WAAA 3EZXA 3I76A 2MSKA 2NYVA 2Q0SA 3R20A 1XJ0A 3GDOA 2E4WA 5H8WA 3H2SA 3C45A 3WNDA 6REQA 4N9QA 4YMHA 5FTMA 4XPZA 1N8SA 1K6JA 3V1YA 1NPDA 2GN4A 1RAGA 5DNDA 4F9EA 1FSFA 1E2GA 4ZI7F 1WNTA 4C76A 4CJXA 4L3VA 3TRFA 4GYYA 3DT8A 3JQPA 4A9AA 2PKYX 2CVHA 3E0XA 2FMTA 4NECA 1V6AA 3TL6A 2ID8A 3CSSA 4OQXA 4BQPA 2C9OA 1KFCB 1IQPA 3KJZA 2O7NA 1HE2A 3O4FA 3JARB 4TS1A 4A8JC 4ZYVA 4DADA 5FUQA 1IJBA 3AOEA 5F3WB 3IT3A 3SJ7A 4FS3A 5HFNA 1EX6A 1B8NA 1UPBA 2P0AA 1CV2A 1J23A 3LXUX 5DPMA 1AH2A 2AOTA 2F43A 4IDBA 3OWOA 2O2DA 2YYAA 3TMYA 1ZN2A 121PA 2HIHA 4FZRA 3HDTA 5JVDB 4KIGA 3DFKA 3IR5A 1P1HA 1EGMB 4MAFA 4MRAA 1NVXQ 2ASEA 3OHMA 4TT3D 4Y6SA 1FE8A 1RRMA 2OLKA 4GLOA 5FBRB 4NJOA 4UCQA 4CMEA 3V6MA 3WFJA 2OHXA 3WJ1A 5KQGA 4QG7A 1E9EA 3K72B 4CLOB 2YHSA 3OQVA 3ZCSA 1JQ5A 2ZROA 5K0LA 2Y93A 3B6IA 2HREA 1XAHA 4IICA 1S02A 4KR9A 1E0SA 2G83A 4RPIA 3MBIA 4HQ0A 4Z8YA 1QYIA 3KE8A 2AN1A 4AYTA 4EI7A 4JGGA 5CNKA 1YZFA 3PXEA 3HMQA 3JY6A 2FSGA 4KYVA 2QVYX 4BO3A 3NMUF 2GTHA 5C35A 3ZY4A 2Q45A 2YNMA 4W1QA 1IN4A 3QELA 1R0RE 3BB4A 1CUYA 5FF9A 2BUCA 1D5CA 3SX2A 3ZTWA 1VG8A 4JEHA 4B74A 4QDXA 4MVWA 2I99A 3IIJA 4LOAA 4WD3A 5CLLA 4DLXA 4RKYA 4C14A 5TMEA 1VIDA 2IE0A 2UZ3A 2DY1A 4L3OA 4IP0A 4FE3A 1JYSA 2P3QA 2PH3A 3PYLA 4NK4A 4LNHA 4EG6A 4HF7A 1U99A 1GU0A 3ZQUA 2V45A 1LV8A 4GLFA 4OJNA 1GNLA 3L6RA 1JBEA 1OFIA 4RTRA 1LPAB 1TRKA 3UUEA 2PMCA 3A2LA 1FFCA 2J3LA 1KI3A 3JZDA 1EVZA 5IZCA 2Q6LA 1O87A 3QG1A 4BLQA 2RJNA 1MKYA 2WMYA 2RH9B 1CF2O 1B6TA 4HWTA 4NZPA 3WYAA 5HZKA 3I8SA 1J2YA 2WJVA 1DIRA 4C43A 1TW2A 4PU0A 5JJKA 2HRBA 3U3ZA 5JZMA 4JBHA 3TPFA 3V33A 4OF4A 2YMLA 4KBFA 5IXSA 1E2EA 3LJKA 2CMDA 1T91A 3VHRA 1HEYA 3C7DB 3ZR4B 2VJLA 3E1KA 4FFBA 4E6PA 1EJBA 1OILA 3GFVA 3MN1A 5TGTA 3S44A 3T7IA 4E1BA 4UM9D 2A9FA 4KNYA 5AM2A 4JN6B 4BQEA 3H05A 4WCDA 3OZSA 1JAZA 1Z0SA 4Y98A 3EE6A 5KNCA 2RGNA 4LC0A 5AI4A 3T7RA 2VLIA 3IDAA 4YALA 4X6UA 3WX0A 1IPEA 2RG7A 3CIFA 4NFYA 1DDOA 4ENSA 5HF8A 4ES6A 4TM8A 1E1MA 5BY2A 4EEXA 1RKQA 4KE6A 4X7PA 3UWOA 3FZQA 3L2OB 1RHJA 2RHCA 3P8ZA 3WIOA 1WZIA 3IQZA 1RAAA 4P3YA 4P4LA 3P9PA 1NVWQ 1KK3A 5LA6A 2CCJA 4LDRA 2C8LA 1ZGCA 3KPYA 3LW8A 3R6GA 2YJGA 3EQ7A 4LBVA 2ZRDA 4MA0A 1EPUA 1VHDA 5F9MA 3UJBA 4X1KB 3GAMA 3N74A 2ETVA 1OA1A 2OBFA 1MENA 3FCCA 4JCCA 3G88A 5AVWA 1HE4A 3MRTA 5K6RA 1KOLA 1IXYA 2QPLA 4RCZA 4E5DA 5KQRA 5BSHA 4O25A 4QICA 2LD4A 4C89A 2C5SA 1DEAA 1P60A 2VP6A 3BE8A 3L7YA 1XXHB 2H7CA 3LHDA 3S7ZA 3U62A 3L1VA 3V5NA 2YINC 1N2XA 5AR1A 3TTSA 3UTDA 4MWZA 3RRFA 3VNBA 5C34B 1VE6A 4X8MA 2VHQA 4E22A 3WK6A 2Q3EA 4MW0A 3H2GA 2Z9BA 3UJHA 1SQGA 5TVGA 4C0LA 3GVXA 4LZOA 2HL6A 1N0IA 4NBSA 2ZIXA 4QOFA 4HLUA 3NGXA 1E2JA 4Y2TA 3CCFA 4LTDA 5JMOA 1EP3B 1PBNA 1NVEA 3CIOA 3R3ZA 4RYDA 1F5NA 5DYIA 1M67A 4HTAA 3WGGA 1AF4A 1Q7CA 1FSGA 3MOSA 4N5LA 2I67A 2V6GA 2AXNA 2X0KA 4YDSA 3PPIA 3CKLA 4BKPA 2X22A 4K87A 1C5KA 3EW9A 2JRLA 3OPYI 3Q12A 4FFRA 4OQDA 4QYXA 3RAGA 5C1PA 5TQ2A 5K20A 4G0UA 3AB7A 1UL1X 2A0UA 2YIMA 1EVIA 3NYQA 4TRNA 1BW9A 2Z3ZA 4LHWA 4TSFD 1BHJA 4ZO6A 4AROA 2G0NA 3B1XA 3ITNA 1P62B 2ODPA 3LD9A 4JOSA 3DWFA 4ESVA 3GH1A 1GT91 1M1NA 4NBVA 4OQYA 2OECA 4AQYB 4FBMA 1ZMOA 3I05A 4D6XA 1GV0A 4RADA 2W8BB 1AMNA 5C80A 1RKXA 3CLUC 1MOPA 3VR5D 2CZCA 4MMZB 3Q8XB 5EPOA 2WIDA 4Z4CA 1MW9X 3WGKA 2PUAA 4E32A 2P9FA 4LCEA 4FHGA 2CCKA 1PJQA 4EI8A 4Q3NA 3SHQA 3AVXA 4B1FA 2P6NA 3L92A 3HJUA 5A6SA 4XYBA 5AM5A 3MINB 2X0EA 1U8YA 4JXKA 5DBOA 4CMBA 1DUSA 4RD4A 1TTHA 1A9OA 4L72A 2QMHA 3VR5H 4FMPA 3VR2A 1E3TA 1NP6A 4BRZA 1SCQA 3E9DA 3MTBA 4YJHB 4BMVA 4CQNA 2VUHB 3IUBA 4B87A 3X2EA 1MT0A 1XTQA 1XC7A 3UOWA 4DRXA 1AA6A 3LA6A 4B5KA 2WPNA 2HJRA 1YACA 3HWRA 1DC8A 1JEQA 1RCFA 1DRWA 3RS5A 4B0OA 4F38A 3CHYA 2DHEA 3KPUA 4OD0A 4P34A 4S2UA 4AQ7A 3B20A 3PYMA 1UXJA 3HA2A 1XRPA 1PD1A 2PKQO 1N2OA 3GQVA 2F1OA 3M6WA 1LZKA 4OA8A 5G53C 3G2MA 4UHDA 1SUWA 2RKOA 4LYGA 4MINA 5CPFA 2I6XA 2JI8A 5AVYA 1TA0A 5IEJA 1OA0A 1CR0A 4MJLA 4EO7A 4H60A 1D0VA 3T38A 2GJAA 4EAQA 3WZMA 1FDRA 4G0QA 1WF3A 2ORYA 1US8A 2AF3C 3K09C 1KOFA 1GIAA 3GLFE 1L8QA 2V7XA 1JHDA 5FI3A 3SFZA 1KS9A 3AKYA 4QYWA 4EYGA 5CFNA 2ETXA 4QX6A 4NOJA 5IYZF 1VE9A 1GZUA 4NV1A 3IEKA 3Q3JB 3EWSA 2KLBA 1LSUA 4QASA 2OO5C 2Y2VA 5CH5A 3GJ5A 4IWXA 2HLDD 4M0LA 4DB4A 4WUVA 3A1VA 2C9CA 4V0RA 4ZMSA 1ST3A 4J0EA 2QL7A 1ZGBA 1U9IA 1U63A 1VPVA 1PFYA 4OQEA 3RADC 4MVJG 3GOQA 3ZBTA 1QQAA 4OH1A 3DAOA 2EKBA 1TJ4A 1XCJA 4LRXA 1XD9A 4KPFC 3AKDA 2HV8A 3N8DA 1OC4A 2YNMD 5CCXA 4KFCA 5CYFA 1LF5A 4R68A 3T7TA 1G7TA 3M33A 2WWTA 3NHAA 4F6CA 1UAAA 1U2EA 1V26A 2BN4A 3ORFA 4YBRA 3D1VA 5LZ4A 1UAYA 3FDIA 3IVGA 2H06A 1TK9A 2UUCB 4E2FA 4UAJA 3AGPA 3LXMA 3I2HA 1AUVA 4K6OA 3LYUA 3IOCA 3IEMA 1DEOA 3N2KA 3EY4A 1FVFA 1YRHA 3JAWA 3I58A 3R7BA 3A2NA 2GN9A 4YJ2F 2FEWB 1X3LA 4U63A 1JFSA 1LDNA 1K2WA 2B6HA 5T6MA 3RAFC 4JCOA 1Z5UA 2QRLA 1K4YA 2TMGA 1G4HA 1H1TA 4ILKA 4HYTA 1T1RA 4ZAFA 4CLOA 3UATA 4BO2A 4J3JA 1QYXA 5T41A 2IV7A 4RO0A 3ZU2A 1QP7A 5IAOA 1S3FA 1M1YE 2CNNA 3L93A 3QXCA 1CX9B 1EGHA 2X4LA 1VB5A 5FPPA 3RRYA 2WNIA 5ABPA 5DNEA 5A0VA 1LRLA 4BNMA 5F5LA 1ZSVA 4IXMA 1T6XA 5BRJA 3AQ4A 1FY2A 1CY2A 3R3UA 5GZ3A 2IHNA 3EJ6A 4S35A 4GZLA 4RK5A 5ITSA 3PC7A 2W71A 4MUFA 5EMJA 3V8MA 5J63A 1T2FA 3MUEA 4F7DA 1NV9A 3FWYA 2GD2A 2XA1A 4C4ZA 1YA8A 4AU1A 2C7PA 5ENDA 2CYCA 3JWEA 3NWPA 1Z2NX 3KUDA 3B52X 1JG6A 4WESA 2R7KA 3ZDBA 1X1EA 2QP9X 3QXHA 2IZ6A 1T2CA 4P7FA 4GWGA 4EY4A 4PX5A 2CY0A 5IUJC 4DLSA 3P2MA 1P0CA 1RXVA 2JHGA 5JXIA 2C5AA 3FIJA 3WJ7A 1P81A 4F4UA 3OTOB 4HDOB 2QYTA 1A7JA 2AI2A 3ZK8A 5L9AA 1XTRA 2HF8A 3AF1A 3O93A 4XUCA 4G0YA 1WV0A 1B6SA 3L6UA 3L79A 2VI5A 2ZJ6A 3A6EA 3GNTA 3PXCX 1BE8A 3A14A 3CU5A 4JROA 1TC1A 3QBEA 1QCYA 4PR3A 5EJAA 5GM2A 4BNFA 1NASA 1MT3A 4BNIA 2FKAA 2HV9A 3L1HA 1W5EA 4YI5A 3ZJ5A 1MX1A 5AW5A 2OFFA 2PX3A 1PZMA 1VP3A 3G1UA 4H08A 2JNWA 2BISA 3QVTA 4RNDB 1O0BA 3T8YA 4TMTA 2WJIA 3RR2A 3RROA 3OLWA 1XZ8A 4C78A 4L15A 3E6AA 1RWQA 4II2A 3RKRA 4RDXA 4JJKA 5AH0A 1K9VF 4M2LA 1C41A 3ZVNA 2JLRA 2GILA 3PIIA 5G3YA 3GLGA 1X7YA 2ADOA 2E9SA 3UKJA 3CR3C 4D9KA 4B4OA 2V7VA 4KWHA 1Z7YA 3L82B 1PJSA 4HGOA 4JUAA 1WUHS 4M49A 2ZSFA 4BLRA 4YC7A 5JO0A 4KQ1A 4MKRA 4DCOA 3COZA 3HGTA 4L8GA 3VZPA 1HEUA 1LA2A 3O8QA 4S1NA 2C96A 2OMKA 2R6AA 4RS4A 4R31A 4MUJA 1OAOA 4RSHA 4RVUA 4INAA 2HUPA 5HNKA 4MJ7A 2FPOA 1FYVA 1Z8DA 1IATA 4RA6A 3KOUA 2IU4A 4MPRA 3DBVO 3D3EA 1WKVA 5H4HA 5HS6A 3QUBA 4NMMA 4KUGA 3RU9A 2HIAA 3FTFA 4RZHA 4LJ8A 1UJBA 1Q7GA 1Q12A 1BROA 2XNDD 1WB6A 1IXZA 2C7BA 3DWGA 4OQZA 2VNHA 4L0CA 5K6AC 4ZYTA 3TD9A 4KYTA 2Q6KA 4FHCA 1N8KA 1THGA 2OBBA 3QUCA 4FQ5A 4PVCA 4PZEA 1OZ0A 1U7HA 2I22A 4NMWA 5IAJA 1G0OA 2EP8A 4D9JA 4FKMA 4F3NA 4JXZA 3VC7A 4BEBA 4MRNA 1SEPA 4BX3A 5IDXA 4D0RA 2YRWA 3LC1O 2HA5A 4YUWA 4DIUA 4BJ1A 1SUFA 5A1TA 1DX4A 1L7EA 2AG5A 1NQVA 1W85A 4D8TA 4D9EA 5LB4A 2G06A 2UU9B 4N65A 5FI5A 2OMEA 2JK1A 4DC9A 1DBQA 2XRYA 3PD7A 4CKBA 3WGZA 4D97A 1QORA 3BGOS 4Q7JB 1IJKA 3CXUA 3U09A 3I6ZA 1MG0A 1O8BA 2W9XA 2YUIA 1XNJA 2VZ8A 2BUAA 5C4GB 3V34A 4LSMA 4BFZA 3EVZA 2AC4A 1X1DA 2PGAA 4WSOA 5JBNA 1M0EA 1LBSA 1SG9A 2Q8QA 3QGMA 3AR6A 5H02A 3B13B 1KSHA 2CE7A 2OAEA 3A6ZA 3HB7A 4PO9A 1N0VC 3P27A 3RU7A 3ZDDA 1KZYC 3OIFA 5IKMA 4QM7A 3ONFA 4Z3KA 1MVOA 3A1UA 1MX3A 2MT9A 3CT4A 1NT4A 1V4VA 4IWYA 4O4IA 1UM9B 3RF7A 4DGSA 3PJRA 1Z4KA 5DM4A 5FQNA 4LZPA 5MGNA 4P3PA 4YAIA 4X24A 3K31A 3H11B 4IVPA 4XAQA 3SLGA 3NKFA 3CUSA 5EZ6B 4ZYXA 3FLMA 3HA5A 4CLEA 4E5KA 4A73A 2BSQA 1WD5A 3KU1A 4O0LA 1J9EA 1MH9A 1BRMA 3DCNA 2AJDA 3VDNB 2HY7A 4CF4A 1E1LA 1HURA 2GB4A 4MMYB 4F4HA 2PUCA 4LJRA 4BP3A 4CEHB 4G5HA 5LVAA 2O1XA 3T5BA 5ALGA 3RG2A 3MFQA 3B5EA 3CGWA 5C8YF 1I30A 4KWIA 1KBQA 1ZD1A 5C7OO 1M1XB 2V0NA 5K0BA 2WKQA 4JMPA 2HW8A 2XCRB 4GBJA 2W6CX 1DNPA 3HUTA 1SB9A 4U7JA 3DAYA 4HY3A 4Q1FA 4NXNB 1CS0B 1SH7A 1E5LA 4ZAXA 1Y6FA 2YZ7A 4P81A 1OFHA 2FMXA 4IGKA 4G85A 4KQXA 4POAA 3VR6H 4LNUA 1PT9A 1YV9A 2CNBA 3CE6A 2R6ZA 5P21A 4RKWA 3WQQA 3OOEA 5F2EA 3ZWBA 1K8XB 2AG0A 2AC2A 2Z8XA 1FB5A 1U0SY 2LDBA 3GNQA 2CL7X 1A95A 3PHHA 3NVMB 1MC8A 4CRWB 4O4HB 3NHUA 2O2HA 1ZK0A 2IDMA 4O4JB 1DCTA 2P8JA 3SJAA 2IS4A 1L5OA 4J0GA 1QZ3A 1EFLA 1PX0A 3WWPA 1A2QA 1V43A 2YXDA 2GJKA 3H0EA 4FZVA 3T54A 1GDTA 1NRXA 2BEKA 1KJ9A 2R44A 1EXMA 1Q1GA 3H4TA 3ZE9A 1D3AA 1C7RA 3L6OO 4BCBA 3PJFA 3PGLA 3C1UA 1C3OA 2C31A 2BLNA 1M34A 2E55A 1AV7A 1A2OA 3DOEA 4G37A 4JB0A 4KOEC 3PGJA 3U31A 2I78A 5K0CA 1AQIA 4YUZA 5I7VA 5J43A 1YR6A 1P0MA 4N8DA 3OZCA 2WICA 4M1YA 1LPMA 4JOCA 3URMA 1CEYA 2PUFA 2P4SA 1X7HA 1GHTA 3A6JA 1JILA 2QZZA 3CF4G 4J7XA 2J3DA 4JB2A 5JBQA 3U44B 2V4MA 2WE7A 3RYTC 2VZ0A 2XZPA 3LU1A 1J09A 4R8VA 4ALLA 2H2WA 3EUEA 3HXPA 1KE2A 1CLEA 3JQAD 2PJZA 2PS0A 4J43A 3FBWA 4ZMBA 1CSEE 2AR9A 3OQOA 2P2LA 1QRRA 2DR0A 2Z6VA 5CU7A 4BZQA 1EX9A 1YKSA 1RMYA 3SHTA 3KZXA 5LZ2A 2GRJA 1BYUA 4IUDS 1KP9A 3ZHOA 1AZWA 4HMOA 1U9CA 2FQ1A 2NSHA 4ALIA 3ZQ4A 1GQYA 3NLLA 4G3XA 1QP0A 1NFFA 5INTA 1KTVA 2GK7A 1BKDR 2FZCA 4Q6WA 3K4PA 4AY2A 1QR6A 4UM5A 1UANA 3W2GA 5KYKA 2FH5B 4QYSA 4JB3A 3A11A 1KJNA 3Q1LA 4GPTA 3TOZA 5C32A 3H65A 5NLLA 1TAHA 2YN0A 3MHPA 2RKBA 3BH6A 2PMDA 3IBSA 4R2HA 2EFHB 4PG8A 2A9RA 3AKEA 1IB6A 3HWSA 4X3OA 2M32A 2NO4A 1A7UA 3M6IA 4A2PA 3UEOA 4DN6A 1BXRA 1X19A 2XUKA 3JWIA 4GO1A 1Z83A 3WLSA 5CIYA 2RGCA 5CDFA 1N2IA 2B37A 1JPVA 5FTKA 1Y4SA 2OP0A 3FNEA 3JQ8A 1UDBA 2EP7A 2XNKA 4DCJA 1TTQB 3UAWA 4RH1A 1OIVA 3BMQB 1FDUA 4P38A 3L6EA 4IXWA 4B43A 2OP1A 2XUQA 1YJCA 2I1QA 2VQ6A 1FFAA 5LLSA 4KPEC 4HHEA 1K0UA 1XTBA 2JF0A 3IEIA 4B3BA 3ZXYA 3KAJA 2WEKA 4CVNA 1GLVA 4FCWA 1SA0B 3PWZA 1NXXA 1IZZA 4HDRB 5LMUB 4NEQA 1KQNA 2PUDA 2R00C 3NUGA 4N54A 4MHOA 3NT5A 4Q4AB 4C4RA 4QFMA 4ZVNA 2J0UA 3AW9A 2X86A 2FR8A 3ENZA 4BUZA 2WWHA 5BWCA 2HD4A 1IQ0A 1KGSA 1MB9A 2AOVA 2I2XB 2X3YA 3AHCA 3PQ6A 1V25A 4IIUA 4M8NE 4BUCA 5BRNA 3CB4A 4FHFA 5AHKA 5JZBA 2E49A 1E1CB 2I2AA 3RS7A 4P4SA 4DEVA 4BE4A 1N3BA 1AVTA 1E1QD 4UEQA 3KWLA 3DTVA 1WXGA 1XZKA 4K2HA 4LE0A 4OGGA 4B73A 4F84A 4OGFA 2AR0A 2BONA 3FHLA 2F59A 3H9BA 1P0IA 5FOSA 4CDNA 4DIDA 3LZ6A 4Z6KA 2SBTA 3IQIX 3ZCPA 3EJWA 4M1TA 3PG5A 4GBED 5ALVA 5IASA 3PR2B 1MFZA 2QW1A 2XNHA 3IPAA 3IUQA 5ALIA 5JSKA 3WWOA 1QIKA 1SKAA 1NWHA 1P7PA 3GEIA 3LXXA 3M9LA 2PH7A 2XKKA 5H5JA 1B93A 1RI3A 4FEAA 3T0GA 4COKA 2WT8A 5LKAA 1AT1A 1UZAA 1XZNA 2WF6A 4MV0A 4QREA 2E82A 1DTEA 1E2PA 5IKEA 1YR9A 5I51A 2I7VA 4JLBA 5ALKA 3WA7A 2XPCA 3UO8B 3CUKA 3CZPA 4KGZA 4CM9A 4GKJB 1ZUNA 4M7PA 3RWMB 4YRSA 4V1CI 4KE8A 4TSRA 2C2YA 4K5QA 4OM7A 1I7PA 1XD2B 1AXRA 3D02A 3OJFA 5CEFA 2QLMA 1WIWA 1XKQA 1UADA 3DE1X 3QUSA 5K2OA 2QTZA 4A8JB 5K6TA 1HFWA 1DWQA 1VL5A 4N3AA 3K5IA 1YB7A 1Y9ZA 3LHKA 2WT4A 1XR3A 3GXBA 1KJIA 1Q22A 1H1LB 4S0ZA 3TRJA 1M33A 3WL7A 1H3NA 2AOUA 3NW9A 2FQYA 3AUYA 2GASA 5JWRA 1N34B 2G5CA 3NONA 1UJ5A 1ZOPA 4WNAB 5FLEX 1GAXA 5BN5B 2PYZA 2IL1A 5EWMB 2WTMA 5BMVB 1L5HB 1N5OX 1FFEA 1VJRA 2P9HA 2ZXEA 2P69A 2Z56A 1G8PA 1ZHOA 4OLAA 3E23A 2VAVA 3TG2A 4CI9A 3H9JA 1DV2A 4BMSA 1Q11A 4Z5XA 4PX2A 1IFXA 4R7GA 5A04A 1I4OA 3QYAA 3OQ6A 4RV5A 1DKLA 1Z4OA 1JE0A 1LSOA 3BOSA 5BOVA 4DIMA 5JBIA 2GCOA 1RBYA 3FKSA 4OTZA 4YN3A 4DIKA 2WJ3A 1Z6ZA 4D7AA 1IZ0A 2VYVD 2CMKA 3GMIA 4CQMB 5JR3A 3ZVMA 2I6TA 5CD1A 3MRXA 2NP7A 1WQ3A 3IE0A 1TCUA 3MD9A 3OP4A 1MZVA 3U4QA 4KGDA 4R84A 1NR1A 3GPBA 4YX9A 1V5EA 1R6DA 3CLRC 5L95A 5A0TA 1ISSA 2VYQA 2ZRFA 3NO4A 4FOOA 1BCSA 4B3MB 4QBTA 1E1YA 2MSEB 3MGBA 3W2FA 1MLDA 2F6RA 2HK9A 2XWJI 4AC9A 4JEMA 4TWAA 2F90A 3H9UA 1RI4A 4IVRA 3V7UA 3FUTA 3MWDA 1KNXA 2VEDA 1L5FA 4Q3DA 4LSZA 4Q24A 1TA4A 1Q6YA 2ZRCA 2O2ZA 2CHFA 2OOKA 3C8ZA 3H9GA 4W9NC 4AG5A 3UA4A 2IIBA 1F8FA 4V3BA 4XASA 3KCQA 4HGPA 3G0IA 3FUCA 3KZMA 4ZCMA 5LLTA 3VU0A 4HNHA 2FPXA 2VTBB 3NR2A 3UPUA 4GIBA 2P9BA 1UM9A 1FXUA 1RYFA 3EGXB 3QELB 4LZJA 5AVKA 2Z2ZA 2L69A 1N5JA 2H1SA 5AW7A 4YRKA 4FFPA 5HJ5A 3AUKA 4OBEA 1DIGA 1EK5A 2FFQA 5HIIA 3KR2A 1VSUA 4YYZA 3OJWA 2QV0A 2Y3IA 1CJCA 2GCPA 4ND4A 2ZQZA 1KYIA 4QGHA 3FVVA 2OCBA 2WZCA 4P93A 4IDDA 3HYRA 3DE5X 3OZGA 1XDBA 2Y05A 4I4LA 4KWTA 4OPMA 3G9QA 3U7QB 5EXSA 4D57A 1UP6A 2V7UA 1ONPA 2X8BA 4X71A 5LMCA 2OY0A 3E84A 5JQGF 2ZT5A 1RXWA 3KEQA 4M55A 3UY4A 1ZMRA 2XVMA 1YJAA 4LXUA 1B23P 4Z2YA 2TMKA 3KZOA 5DM70 2PL9A 2QTFA 2SNIE 3DVLA 5DSZA 3VSBA 2PAAA 5F5NA 2BFAA 2B2CA 2FMHA 2JIZD 2VDKB 4AJIA 3O8BA 2EFCB 3MM4A 2HI0A 1G42A 3RS4A 2C42A 1E6MA 5CVVA 3SJBA 4ZT4A 3AUXA 4EHLA 2DQKA 4BB9A 1XUOA 1V95A 2BV3A 4MQBA 3EWIA 2ZI3A 3N5CA 2W22A 5HXAA 3EAQA 5I7EA 2BFBA 2BI4A 5ALMA 3KPVA 3SZRA 3FSJX 1RYBA 4H0NA 5LU9A 1G64A 2GN2A 3M4YA 4LAFA 4JNCA 4OFWA 4XOIA 4ZXFA 1XXHE 4URXR 2H11A 3ACBA 5FFFA 3TVTA 3ELWA 1NQAO 2FUCA 3GAAA 1XPRA 1X1RA 2CEAA 3K94A 3PB3A 3LCVB 2OSBA 2JG3A 1FU4A 4D56A 2YMPA 5CJJA 2O8EB 1OYWA 1DJLA 4NZNA 2BHLA 4HUQA 2IXDA 3BGSA 2O3TA 3FNIA 1PKEA 4C3OB 3EQ8A 1OUMA 1X7WB 1JFLA 3EUWA 1U04A 3QWAA 4UFOA 3TCXB 3JVVA 3N2YA 1Z4PX 1DWPA 1M8GA 3BWVA 3RYFB 1I6WA 1BW9B 1WF6A 3WP0A 4M0FA 4U2EA 1OXBB 2RI0A 2VPPA 3DE0X 3E5HA 3N76A 4DQKA 4WL0A 1UWVA 1GAJA 3DAGA 2CNLA 2DTXA 4ALMA 3OQPA 1AUQA 4R0NA 5IUKC 3VZSA 5LQDA 4CWAA 4N39A 2J9YB 1GM5A 2GKOA 2OGTA 3F4BA 1E4EB 1RRPA