3E23A

Crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
QAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGRPVRTMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLHVSVRKPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein RPA2492
publication title Crystal structure of the RPA2492 protein in complex with SAM from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR299
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 66
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e23A00
4WXHA 5CVEA 3DXZA 1XDZA 1FJXA 1N2XA 4U7PB 4KVZA 2AVNA 1R8XA 2QY6A 3B89A 3ANXA 4RVFA 1L3CA 5HIJA 2O05A 3R0QA 3C3PA 2EJTA 4CTKA 2EX4A 2ZIEA 5FHRA 2P8JA 5DM0A 4GOND 4QTUB 5EMMA 3RW9A 4RSRA 4EKIA 4AZSA 3BGDA 3JWGA 1QANA 2YXLA 3VYWA 5EEGA 4AZTA 1AQIA 4RVGA 3LL7A 3KPVA 3OE4A 1M6EX 3R3HA 4NECA 4KWCA 3THRA 3AXSA 3G8BA 4R8RA 3HEMA 3UJAA 3FUXA 4YV0A 3QV2A 1WXXA 2HTEA 2I7CA 1G8AA 3EVCA 1RI2A 2JG3A 4R05A 5C0OE 3FRIA 4OA5A 5BXYA 5JUWA 4MWZA 2FCAA 3SSNA 4GOLD 3CJQA 2PX5A 4DZRA 4RTSA 4HH4A 5HEKA 1Q0SA 5B1SA 2GA9A 3UA4A 4RTNA 4OA8A 4R8SA 1F3LA 3MCTA 1KXZA 3SSMA 5LQUA 1JTEA 2PT9A 3UBTA 2QYOA 2P3OA 3FZGA 2AOUA 3B3GA 3F4KA 4V0RA 3DMHA 2EFJA 3GGDA 5FQNA 3KPYA 1ZQ9A 4FT2A 3SX0A 4GQBA 3UWPA 2ERCA 4PYNA 1NW5A 1WY7A 1KHHA 3LDUA 2F8LA 1QZZA 1M6YA 5C1IA 5LQJA 3I9FA 4KIFA 3I5UA 4P7GA 3SSOA 5K09A 4E2WA 2GPYA 4KDRA 3EEYA 3P9NA 4PGGA 2O57A 2B25A 3MHTA 5DXJA 2NXNA 3WSTA 2WA2A 4CKCA 1RI1A 3ID6C 2P1DA 3UA3A 1G6Q1 4YV1A 5K0LA 3HCDA 1R18A 3FPHA 4ISCA 3PS9A 1KIAA 3EVBA 3NWEA 3TOSA 3G5LA 4M7RA 5E2AA 4PNEA 4AZWA 1XDUA 4PYLA 2AN3A 2AVDA 1R8YA 3SGLA 9MHTA 5KYGA 3ELYA 3DXYA 4RYLA 5GIOE 2DULA 2OB1A 3GU3A 3R24A 4CKEA 5DRYA 1SKMA 2JHCA 3FPGA 2LD4A 3EVEA 4AZVA 3MTEA 2XYQA 2PY6A 2FK8A 1Q0TA 1NKVA 5D1NA 2GB4A 2BZGA 1JQ3A 5K0GA 5CCXA 3P71T 4P7FA 2BH2A 4E31A 5CM2Z 4C07A 4RTMA 5KQRA 5EMKA 3FUTA 3EEOA 2NXJA 4PIMA 2C7RA 8MHTA 2IDJA 1RI4A 3OCJA 3BXOA 3LECA 5DPMA 2BM8A 3G89A 4PIPA 5K8VA 3FTDA 2IPXA 3TPZA 2QRVA 3FPEA 4C04A 5ICEA 2QM3A 5DX8A 4QPNA 1JG3A 1YB2A 3FUUA 3KKZA 1KPIA 2BR3A 3P2IA 2IIPA 1YZHA 2AOVA 1N7JA 3OE5A 1IY9A 4FS8A 2HMYB 3DUWA 1X1DA 3LCUA 3KQQA 3O7WA 2BR4A 3MB5A 3PX2A 4M38A 4WVLA 3MCZA 5KQSA 1I1NA 3BGIA 4E2XA 2NXEA 4FSXA 4P58A 4F85A 1I9GA 1WS6A 3R9XB 2JHPA 1F38A 2P7HA 3LKDA 3NTVA 2AOUB 1NW3A 2PXCA 3LPMA 2O07A 4BP3A 1L3IA 3CJTA 3FUVA 1G38A 4M37A 3TM4A 3UJ7A 4IKPA 1TW3A 4FT4A 1NT2A 3P2EA 4HG2A 3KU1A 3ELWA 4B17A 4DKJA 1XVAA 2G72A 3EVAA 5ICFA 4PYKA 2ONZA 3IHTA 1D2HA 2PT6A 3AXTA 3CC8A 3JWIA 3A25A 2PSSA 3M6XA 3Q7EA 4OQDA 4C05A 2WA1A 3LKZA 5DM4A 2XVAA 3EVZA 3U81A 4YMHA 5FHQA 10MHA 2KW5A 3KPWA 2A14A 1MJFA 3KQYA 2I9KA 4EK9A 1ZGAA 2AR0A 3FPFA 3FRHA 3E05A 5HZMA 4ER7A 3M6WA 3GRYA 4C03A 4Z2YA 2PXAA 3RODA 4OBXA 4QTTB 1INLA 3DXXA 4C4AA 1SQGA 2IGTA 2ZBRA 1WG8A 5JR3A 5K0EA 4QQNA 1T43A 2O0LA 4HC4A 5E1MA 2R6ZA 3TRKA 3FTCA 3LDGA 5DM2A 3PVCA 3TLJA 3UFBA 4RWZA 1PRYA 2JJQA 3NW9A 4GUAA 4U7TB 4XUDA 5EPEA 3HA7A 4DA4A 3B5IA 4DF3A 3CKKA 2ZIGA 2OZVA 3EVGA 5HIMA 5K0FA 4MIKA 1NW8A 3Q87B 5DTQA 5HILA 3T7SA 3AY0A 3TKYA 3SMQA 1XCJA 2YXEA 5HOQA 1X1AA 4FSDA 4Y30A 3DP7A 3I58A 1BC5A 3M6VA 5T6BA 5LR6A 2VP3A 4PCAA 4ATNA 5CCBA 2ZLBA 1VE3A 7MHTA 5K0JA 3S68A 3P8ZA 3G2PA 2PX8A 4QDJA 4GEKA 3AWIA 3V8VA 3M70A 2FYTA 3EMBA 2JHAA 2PX4A 4E70A 5F2OA 5KS2A 4YV2A 1JSZA 2OXTA 3PFGA 1NBIA 3OZRA 5G02A 3VC2A 2CMHA 1Y8CA 2YVLA 3GJYA 3KQTA 5CVVA 3SVZA 3KQWA 1JSXA 3OU2A 3DLIA 3UJ6A 1UWVA 1XTPA 1EQAA 1IXKA 1ZKDA 3G2QA 1ZHFA 4F86A 5GM2A 1ORHA 2BM9A 2YR0A 4XUEA 1VQ1A 4C06A 4YUYA 3HM2A 5T64A 2B78A 4PYIA 5ICCA 5K0BA 3PTAA 3FPJA 3HTXA 5FUBA 3B7PA 5CUQA 2H11A 2ZFUA 5EIFA 3O31A 3BZBA 4LWPA 1JTFA 1EJ0A 1AQJA 1Z3CA 4OQEA 4PINA 4EKGA 3BWBA 3P9CA 1RI3A 3A7EA 1BHJA 2OKCA 4K6MA 5EC8A 3KPJA 3FYCA 4V0QA 2IH5A 5BW5A 2P35A 1SG9A 5T67A 2YX1A 2HR1A 5E1OA 5U4XA 2VDWA 3LGAA 5E1BA 4E33A 2GH1A 1L9KA 3EVFA 4POOA 2PBFA 5EMLA 3HCFA 1YF3A 2UYQA 3PT9A 1D2GA 2G70A 1VP9A 2ZIFA 4A6DA 5CVUA 5EHGA 4CWAA 2AN4A 2OYRA 3KHKA 2ZZMA 1QAOA 2FHPA 2HWKA 5LQNA 5DTMA 3DOUA 1KPHA 1NW6A 2PWPA 5GOZA 4E2YA 4AUKA 4R6WA 5EOVA 3HA3A 4RTJA 4P7KA 3GDHA 3SXJA 2PGXA 3KR1A 1RJFA 3H2BA 2NYUA 4X63A 5ERGB 1SVUA 2ORED 4LG1A 4PYOA 5DTRA 4E30A 4X41A 4AX8A 3I53A 1ZG3A 3GXOA 3FTFA 1XCLA 1V39A 3HP7A 1RJDA 2PKWA 2YXDA 4R6XA 4ZTBA 1HMYA 5EZQA 5IH3A 3TFWA 2IDKA 2N47A 3OU7A 3E7PA 2IFTA 3LX6A 5EVJA 1BOOA 1VL5A 3G2MA 1TPYA 1WXWA 3MTIA 4GBED 4PCLA 3DH0A 4PGHA 5FCDA 1XDSA 2OPBA 2R3SA 1I4WA 4FP9A 2EG5A 2CKDA 2I6GA 4PYJA 2ZWAA 4YMGA 1VLMA 2NP6A 4DQ0A 4Y2HA 4FGZA 4EMSA 3OFKA 3P97A 1XJ5A 3GRVA 3M6UA 2B9EA 1D2CA 2AOXA 3KQMA 4RTKA 3CVOA 2C7QA 3IEIA 3UJDA 1HNNA 2H1RA 3BUSA 3LSTA 2FRXA 3JWHA 4EQZA 4EVIA 4M36A 2VS1A 1P39A 2HNKA 1OR8A 3BWYA 3CCFA 4IV8A 4XCXA 4RTQA 1SUIA 5CD1A 3HNRA 1VBFA 3KQOA 5FA8A 2YQZA 3VC1A 3O4FA 5F2NA 4RTRA 2V7EA 5P8WA 3GCZA 5EG5A 1MHTA 1L3BA 3IYLW 3THSA 1EJ6A 1TW2A 3IV6A 3A26A 2FPOA 3PX3A 2IBSA 2XVMA 3A7DA 3L8DA 3G5TA 1PJZA 3AJDA 3G8AA 3EGIA 3K0BA 2VDUE 3LDFA 4MTLA 4KIGA 3HCEA 4X1OA 5E1DA 3P2KA 4GC9A 1XXLA 1R74A 2FK7A 4QDKA 2UYCA 1NW7A 2CWWA 4DMGA 3DMFA 1SUSA 2P3QA 3ME5A 4RTOA 2WK1A 5E2BA 2P40A 3BT7A 2VZ9A 5EKXA 5GINE 3M33A 3X0DA 4RTLA 2C7OA 3BWMA 1NBHA 2ZWVA 1ZGJA 3EVDA 3NVKI 2Y1XA 4KRGA 4ER3A 5GIPE 3T0IA 4A6EA 4YUVA 3NDJA 4E32A 5CVDA 1P1BA 3NDIA 3NJRA 4GF5A 4QPPA 4RX1A 4X60A 5EEHA 5GP1A 3GO4A 5H02A 1G8SA 2B3TA 3V97A 2QRVB 5FULA 3B3FA 3RIEA 5EMJA 5FTWA 4QQKA 1RJGA 2AOTA 1N7IA 4BP1A 3E8SA 3GRUA 1YZ3A 5LQAA 2QE6A 4ER5A 4QVKA 1G55A 3A4TA 2ZVJA 5CVJA 1SQFA 3DMGA 1JR4A 3E23A 4RVHA 5C9ZA 5LQCA 3BKXA 5BW4A 1EAMA 3TM5A 1AV6A 3TQSA 1JG4A 3CJRA 1JQDA 5DM1A 3REOA 2ZZKA 2ZTHA 3HCCA 3D2LA 5DXAA 2GAFA 3HVIA 5GWXA 2OB2A 5HFJA 1DL5A 2NXCA 4CXMA 3ER8A 5IKMA 2HV9A 5DX1A 4DM3A 3MAGA 1YFJA 2UZ4A 2PVCA 1P1CA 1IM8A 1NV9A 3PLAE 1VIDA 1KYZA 4RV9A 1QAQA 3NMUF 1VP3A 2NP7A 3UJ9A 1QAMA 5E8RA 4BLUA 1KP9A 2XYVA 4OBWA 5M5BA 2Y1WA 3C6MA 2GS9A 5E9JA 2AZTA 4G56A 1R00A 3UJ8A 4KDCA 4BLVA 1KPGA 4HGZA 1O54A 5DT2A 5LQRA 1KYWA 3PB3A 5E9WA 4OX9Y 2ONYA 4PONA 1EG2A 2YUIA 5K03A 1B42A 3A27A 3OFJA 3DLCA 5E9QA 1RI5A 3CGGA 5ICGA 3T7RA 1NV8A 1JG1A 2ZULA 5EZSA 1WZNA 4PYMA 1P91A 3GNLA 5MHTA 2C7PA 4GOOD 2VDVE 4PWYA 1FP2A 2PLWA 5LSAA 1YUBA 4IV0A 2G71A 4YUZA 3ORHA 2XYRA 5D1HA 3EMDA 2OO3A 3PFHA 2AS0A 3OU6A 3G88A 3UJBA 2ZW9A 5FWDA 1M0EA 2PXXA 3GWZA 3NWBA 2AOTB 5K05A 3DULA 3NVMB 1X1CA 3FYDA 5FA5A 4UOEA 5DWQA 2AOWA 2GLUA 2IP2A 2I62A 2PV0A 4XUCA 4GC5A 4RVDA 4BLWA 1JQEA 2AN5A 2ZBPA 3VSEA 1NE2A 3CBGA 3KPUA 4HSGA 3I64A 4P7JA 1UFKA 5EKUA 4IWNA 2UYHA 1UIRA 3BWCA 2CL5A 3KQVA 3QOWA 2OY0A 5LQKA 5HIIA 2OBFA 1KR5A 4HTFA 4MQ4A 4HGYA 3EGVA 3LBYA 2IBTA 3HVHA 2V74B 2ZCJA 5EIWA 3UJCA 4DCMA 2P41A 5DSTA 2JH8A 2ZZNA 3SM3A 4BY9E 1O9HA 1X19A 2P7IA 4L7VA 3HVKA 5K0NA 1R6AA 3G7UA 1U2ZA 2UYOA 3LHDA 5F2KA 3HCBA 3B3JA 3HA5A 3C6KA 2ADMA 2CMGA 3K6RA 3KQPA 3KR9A 3ELUA 4H0NA 4E2ZA 1L1EA 4JXJA 4DCGA 3R6TA 4O29A 1H1DA 3KQSA 4LWOA 5DSXA 4YUXA 2Q41A 1DUSA 3BKWA 3C0KA 3EPPA 3GRZA 3LBFA 3P9KA 1O9GA 2DPMA 2E5WA 2PX2A 3P9IA 1YFLA 4HRAA 5DRTA 3ER9A 2G1PA 2Z6QA 2NNWB 3DTNA 3G2OA 1RJEA 1FBNA 5EHIA 5K01A 1G60A 2K4MA 2PWYA 2ZBQA 5FQOA 2EJUA 5GM1A 2Z6UA 4F84A 1ORIA 3HVJA 5BP7A 3UZUA 5HIKA 3ELDA 3M4XA 4PYQA 5FWAA 4ER0A 1AF7A 3OZSA 3FUWA 4X61A 5KVAA 3HCAA 4QVGA 4ER6A 1BKYA 3LCVB 4FR0A 3TKAA 4KW7A 4MHTA 2ZSUA 3TR6A 2O06A 2B2CA 2PJDA 3KR0A 4LECA 2YTZA 5EGSA 4CTJA 3MGGA 5CIYA 2XBMA 3FTEA 1FP1D 4GOMD 3MQ2A 2P3LA 3BGVA 3ERCA 3JWJA 5EQJB 5K0CA 3C3YA 4RTPA 3GRRA 4C08A 3T7TA 1DCTA 3OPNA 1EIZA 3GIWA 3LCCA 4HTFB 3EGEA 4FZVA 3SR4A 2IH2A 5E8JA 1X1BA 1QYRA 3QOXA 3DR5A 1FPQA 3OZTA 4YUWA 1JG2A 5FADA 2Z6AA 2BR5A 2IH4A 3MERA 5DLYA 2ESRA 3TMAA 2JH9A 5DX0A 2G8NA 2H00A 3KR2A 1VPTA 4CKBA
chains in the Genus database with same CATH superfamily
5HGJA 1RFGE 3TIXB 2QTFA 4UPEA 4ZCMA 4WHMA 1ACMA 4DR6B 4D4KA 2A9RA 2DG2A 2UZ1A 4EG5A 5IAGA 1ADGA 2JJMA 2ZRQA 1HWYA 4F2DA 4TMVA 2JAQA 2ZYVX 3WLIA 2C9DA 4H3HB 3VR4D 3HUEA 5CX1B 3D8SA 1QFYA 2JLRA 3HXPA 1CUWA 1MGPA 1N6NA 1NPDA 1AQIA 2VPXA 4DSOA 1M2HA 4FZ5A 5CHEA 3W8EA 4X6LA 3A9WA 5KYWB 2ORVA 3U0VA 5KAPA 4LX0A 4J90A 4LBVA 2GMWA 2IUYA 2WFLA 3IT0A 2WZQA 1ZMXA 3LC7O 3HEMA 3I28A 3KS9A 3NT2A 3OJOA 3OZEA 4NC9A 5AO9A 5FPQA 4HS9A 4AIIA 3EVNA 4DYDA 4EYKA 3WZ2A 1A2BA 3VNUA 2N3ZA 3MK31 3RG8A 3BMNA 4DV2B 2FCAA 4DV1B 2DZDA 1YSCA 4NYJQ 3GFQA 5KVCA 4MX8A 5CDYA 3KTDA 4X90A 4IGFA 4WLOA 1D09A 5B1SA 1Q0SA 3BXFA 3HJBA 4HTAA 2Q3EA 3TB4A 4C0SA 1LDNA 2BC9A 3AR3A 1HI9A 4GYWA 3VU0A 4F0JA 2HDWA 2OG2A 4XDGA 1GILA 2G82A 5KVQA 3AFNA 1PQPA 2IHUA 3FYHA 3HXTA 3UWPA 2AV6A 1M6YA 5G2OA 1KMMA 2PNJA 3SSOA 2NYVA 3TR0A 3ZHXA 3JQ8A 2NQTA 2YY5A 4AD8A 4K1XA 1U0HC 4K9SA 1ZCJA 2QK4A 3Q88A 4JR1A 3HDYA 2VK4A 3OWXA 5EL0A 3WSTA 2WA2A 3I0ZA 3ZWVA 2BSAA 2XQGA 4CZ2A 1E60A 3KLBA 4CKCA 5AW6A 1UJ5A 3L0OA 1R18A 3D4PA 1VGVA 1LDGA 3M5DA 3EIOA 3EVBA 4KTTE 4ONEA 2RHHA 3TFOA 1K4YA 1GPJA 1JA9A 3A1UA 5SY6A 2WP8J 5HTOA 3K96A 3T7IA 1MNQA 4A26A 3ZQ4A 1DELA 4CQNA 2A8YA 2I2CA 5DMHA 3FWNA 4YACA 2W8BA 5CA0F 4PSCA 4Q66C 2ZRCA 3WV4A 5FLEX 3GU3A 3R24A 1IY8A 4J0KA 4N0MA 2C8JA 3B51X 3C7DB 3FPGA 3JXEA 1JIVA 4HEQA 3WE7A 4EY6A 1JLLA 2QBYB 4KRXA 3TD6A 3T7JA 2PSHA 2BI8A 3ONEA 4NV1A 2QMHA 4P7FA 1A9OA 2BONA 4RMJA 3TRJA 2NTEA 1JHXA 1TLFA 2CZCA 2CSXA 3FUTA 1J8DA 4G8CA 4FCTA 3OIFA 3NBZC 1RI4A 2BGKA 3I2YX 3VZDA 2MR5A 1RABA 2ROQA 3WV5A 1SBNE 1V7QA 4J7AA 2DUWA 2FR8A 1YMUA 3N2IA 3W7BA 4D44A 1UMDA 3I3SR 1JG3A 3FUUA 4ZVPA 2FQWA 3VR4A 3AJAA 2AOVA 3P9PA 1Q2XA 3UJAA 4YV0A 2I22A 3TPCA 3DUWA 2OCLA 2AR7A 1E9BA 5AKJA 5I4KA 3MCZA 3GLIB 3QF4A 5HKAA 4ZYYA 1Z0ZA 4F9FA 2IXEA 2W2PA 4ZVVA 1I9GA 1R6DA 2IIBA 3WL4A 1PGJA 4L4SA 5JHHB 2P7HA 2DWUA 3PWKA 3U61B 1W2HA 4DYHA 1P0PA 1VJ0A 3LLCA 2IYAA 4H7KA 4R5MA 3P9SA 4NESA 3T5AA 1RPZA 3Q8XB 3S99A 1DWUA 2B21A 3B1FA 2H1SA 4FT4A 4XR4A 5AJWA 3IDFA 2UU9B 1LI4A 2C07A 3EVAA 4Q15A 4M0KA 3QGMA 4PYKA 2C29D 4RFSB 5AOCA 2QM8A 3P1JA 4B4KA 4KREA 3E5HA 2XTMA 3W05A 2QD1A 4IWXA 1YZKA 1YUMA 1H23A 2IEZA 3KSUA 3KYCB 1GPWB 2CT8A 3NC1C 1KFEB 4JQOA 4XJTA 3FRHA 3H4TA 3P9YA 3E05A 2B5OA 5K1ZA 4E7PA 3K2QA 4ER7A 3WIVA 3EIQA 5JD3A 1CNFA 1GGFA 3K0FB 3RODA 2XE8A 1OAOC 3SYMA 1UEXC 5JHGB 4JLMA 2B4TO 4HXYA 1TJ4A 2PQ0A 4CEHB 4B3FX 4RHTA 2BZ1A 4CLOA 1NI3A 4RQUA 3FFXA 3NW9A 4GUAA 3ZHZA 1Q2UA 1AH2A 4I3GA 1DSSG 4WFIA 2FMFA 4H4CA 4W1PA 1J0XO 2AFIE 2ZIWB 4RA9B 3KV1A 1DC4A 2Y93A 3TKYA 2WFZA 3JAWB 4X7RA 4N3BA 4E15A 5B36A 4GLJA 3WGMA 4M46A 1TJNA 1YCDA 4M1YA 2DY1A 4HQFA 5IK2D 2PR2A 1QMPA 3DGEC 4H1HA 1WDKA 2OP1A 1WQ1R 2ZJZA 4E5PA 5KINB 1EP2B 1SU6A 1ZISA 5E7IA 2B4YA 1E6MA 1WF3A 2HCTA 4NV0A 2G0TA 1GG9A 3EPJA 2I2BA 4XWWA 5TRTA 1WW3A 3RLIA 4F93B 2FYTA 3CZ9A 2Z2YA 5IU6A 3USCS 5I7HA 1U0OC 4EI9A 5K8UA 1K4KA 3VC2A 1Y81A 4UM5A 2XEXA 4H16A 1NVXQ 2AWNA 1GNRA 3NAQA 3WLLA 1AC5A 1TCVA 1ZHFA 4ZGWA 1OX4B 1G6HA 5DEIA 5G1NA 3ZBUA 1CDZA 1HDIA 3ZV3A 3BWEA 2FLWA 4MS4A 2IV2X 1FK8A 4ZANA 3X2SA 3ETHA 2H11A 5DLDA 1LPMA 5LA6B 4URHA 4K05A 2PBZA 2WM8A 1RHJA 3OF5A 2W6NA 3G1UA 3H3JA 2DUNA 3P9CA 2B20A 2J4FA 1BHJA 3QMWA 4IFIA 1KI6A 4IFTA 3U17A 3Q4GA 4MW7A 2XKKA 3DEYX 1YB1A 4HQRA 5KSWB 3ANTA 1G4UR 2C99A 1B26A 2J41A 3PNSA 4GLBA 3OZCA 4JA0A 5EMLA 3WWDA 2PRZA 4ZXPA 3KT3A 1NC1A 2MYPA 3PCTA 4K6HA 5KNCD 4PLGA 3EH2A 3CNHA 2X8BA 4H3VA 4KQ6A 3S1AB 4C3VA 1G7CA 1JQ5A 4E2YA 1QIDA 3AUUA 3VHRA 3VQTA 3M5WA 1SUEA 3ZQKA 1E9RA 4D46A 3C3XA 3TVDA 3K5IA 3QTBA 2JLZA 4AN1A 3T9AA 1ORTA 1NVTA 2QQ0A 4YJGA 1ZM7A 4GO1A 3NDBB 1PK8A 1C3LA 5IAAA 5J4HA 4ZREA 1WP4A 1RJDA 2GD0A 2INGX 2DR2A 4MDEA 1WTAA 4K88A 1JFFA 1NMSA 1QNLA 2EFCB 2O2GA 3PYXA 1CUZA 4FZ3A 4TYPA 3NGXA 4GG1A 5IFKA 1RP7A 3AERA 3UB2A 3PRHA 2FSVA 3ZJVA 4BEVA 3F98A 1F6DA 5JSUA 2FR8C 3D8HA 1T26A 4E51A 2GXQA 1AGXA 2R3SA 4XM1A 5TY0A 2D1SA 2I6GA 3QVGB 4RNCA 2DPXA 3ZH9B 1FL9A 4RKEA 2VXBA 2VPZA 4BGEA 4HNRA 4YXWD 1BDJA 3Q0IA 3S2YA 2XBLA 3FNEA 4FVTA 2VUTA 2Z4RA 4ITRC 1KU0A 4J6FA 5T4FA 2H2FA 5C7YA 4JOQA 1Z18A 1FX0B 2FRXA 2Y0CA 3JWHA 4IIEA 1JDZA 5IVPA 5H9VA 1CJSA 1I7SB 1WULS 1VLJA 2GNOA 3FLAA 1IRXA 2HJGA 1YZQA 4WUVA 1OLXA 3OZXA 1YS4A 2YQZA 3CFYA 4H18A 4IIYA 1EBBA 4JJKA 1CFJA 1W52X 3D9QX 4PNZA 3UY4A 1N1DA 3QKUA 4LQCA 3ZHYA 2C3MA 2PZ8A 2W11A 4G37A 4LSMA 4CODB 1YBVA 3FXAA 2C20A 4PICA 4JROA 4C0AC 1J7JA 3F8TA 3FDXA 4QA9A 4CL0A 5B7PA 3WYCA 4ABYA 2F3QA 5EN4A 3W5SA 1MR3F 1HY3A 1LW7A 2MT9A 3K0BA 4CLRB 1WL8A 1APBA 3QMPA 1T15A 1N0UA 5LXTA 1EEHA 2FK7A 2PHZA 3NGLA 4QWMA 4LVCA 1Y89A 3L7OA 4EYGA 2P3QA 3C39A 5E2BA 4HK4A 3QPWA 2DQYA 5KNCA 1I4OA 3HWRA 3NHJA 4GWKA 4TYYA 3HXLA 1ZGJA 5J2TA 1QP0A 1FTNA 1XRLA 4F7WA 1YQUA 4QM7A 3K53A 4G2NA 3R0XA 4NJMB 2EEZA 2Y0EA 4JSTA 2B92A 3AI3A 1P0IA 2R6FA 4QTXA 1QRTA 1YVPA 1SEPA 3NJRA 2ZAMA 2HFJA 1E1CB 3A9TA 3TF5A 2J5KA 2HMUA 4H7EA 2P2GA 2X9QA 1HG1A 4ME6A 2ZDQA 3IX7A 2B8WA 3JW8A 3QU5A 3W06A 3R6WA 1RW4A 2HOQA 4DV7B 5EIEA 1J20A 3LUHA 3PTLA 4XRRA 2JKVA 3A4LA 4MDHA 4QVKA 3GZ4A 3F2IA 1XLTA 5M3BA 3B6MA 5TMPA 1DC7A 1DZ3A 4MV0A 1JG4A 3F49S 3DHYA 3REQA 3HSSA 5A5GA 2IXFA 4NMHA 3MS7A 4OP1A 1JDUA 5BN3B 1RCUA 3V4ZA 4D97A 4JL5A 1L7RA 2G36A 1EBUA 4FJ1A 3UXYA 3AY3A 4X71A 4MUIA 5ECWA 2QAIA 4AG5A 5TGZA 2RK3A 3SJAA 3F5QA 3Q7IA 4G0YA 1SIWA 1B23P 2BEWA 2Q3LA 2XYVA 4P8RA 1M33A 2EGGA 3HBLA 1BYIA 3Q3HA 2X41A 1BX3A 4NZMA 4JI1B 1DRUA 4HN2A 3KOMA 3CRW1 3HPRA 5F35A 3D7MA 1FFCA 1JKFA 3ND6A 3RUDA 1PR1A 2ONYA 1WVIA 2YUIA 1UCFA 5HKLA 3Q8LA 5JO0A 1LJLA 3MHPA 2IHKA 2IIQA 4EJSB 3KK0A 1SCUA 2OORA 2YHAA 3E84A 4YO8A 1N2SA 5SYNA 5FBVB 4TKLA 4W5HA 3WB2A 2UXDB 1QS0A 1V1RA 2JKZA 1K6MA 4PWYA 5JOQA 2WMDA 1CEQA 2AC2A 2QP4A 5AMXA 1OA1A 1OT3A 4G0QA 5BVGB 4FXPA 3QBVA 5I7OA 1JWLA 5BWNA 2IEYA 4ECEA 4BFZA 4W5WA 4JSRA 3CLSD 3IP3A 4PZDA 3ZY4A 3GWZA 3CH6A 5EPUA 3RAGA 3V3TA 3A1EA 1N36B 2PMWB 2GNPA 2A5LA 3ZCQA 4DJ5X 4F12A 2JFYA 1WHTB 3N2GB 4HNGA 3NIWA 1F9EA 1JDSA 2EKPA 2ZM6B 1DQYA 2FSVC 3GRAA 4K2AA 4LVUA 1DUVG 1OI3A 1NVKA 2AN5A 4ALJA 2QN7A 4G86A 4YCBA 2XDYA 1BRMA 1LNQA 1YTUA 4A9AA 3FPKA 1Z5NA 1FFDA 1RRMA 4P3YA 3RBXA 5T7BA 1PV2A 1X8XA 3EGVA 4XM2A 5EIWA 2GRAA 3GGSA 3EQ2A 1G8PA 2E55A 3O74A 1QV6A 2AF4C 2FW8A 3Q5EA 3WOHA 1ZR4A 2QTCA 2P41A 2WWXA 1FFXB 5LZ9A 1K75A 1X19A 3ZU6A 1MPXA 1PNOA 2H2AA 1A50B 2IF2A 3D5QA 4J16A 3R41A 1Y33E 4BVEA 3LHDA 2VJLA 4GDMA 3IQZA 4TKVB 4AVYA 1CQJB 3HA5A 1H4VB 2RC6A 5EFOA 5H81A 3I5AA 5JBQA 3OQPA 4H0NA 3HWSA 5ANRB 4M0LA 4UBKA 3UK7A 1ZAYA 5FV4A 4QWWA 3OFND 1SOAA 1CY0A 4M0EA 2M98A 3P9KA 4TLMB 1UOEA 1O9GA 1H93A 3JCZA 5FFNA 2PX2A 1XL0A 2IYYA 2A59A 3F3SA 4TMKA 3DDZX 2P6UA 1VMEA 3H5IA 3O8OB 4U2CA 3KTAB 4W6QA 4HYEA 1VPEA 5CGQB 3EZ2A 4BN5A 5GV8A 1XFDA 2WU4A 4OJQA 1PS9A 2CGEA 1V5FA 3OT4A 2B1QA 4P3XA 5IAKA 2VBGA 2JGFA 3JVDA 3ZU2A 1PDOA 4AECA 4G65A 1ORDA 1X6VA 1W19A 1J5PA 3IBGA 3M4XA 4TQ9A 2FPGA 3T5MA 4CM6A 3MWYW 1HE4A 4WI1A 5CDHA 1OTXA 3FZNA 4WXPA 3EA0A 4JBNA 4ER6A 2P65A 4LGCA 5F7OA 3AUXA 4MHTA 1V16A 3PUHA 4WN9B 2EW2A 3RYIA 4GU5A 3E7WA 1TZ2A 2O06A 3VISA 1KJWA 1S96A 4IIDA 5HK8A 4B6RA 1TQHA 4QU9A 1JIKA 4JB8A 4ZV9A 1U2PA 4RKWA 4CUJA 2PAAA 4IDQA 2AZXA 2AG1A 1N7HA 3AT1A 3LT5A 2YYSA 2IUSA 4EY7A 2ZJFA 2FN7A 2PO5A 3QVXA 1E9AA 3WP0A 1ST2A 1ZK0A 1E89A 2IUUA 3PIIA 4Q82A 5KMGB 1EXVA 1U7PA 1CRZA 1X1BA 4ZD6A 1NN1A 1NXSA 4W1SA 3H9BA 2RDMA 5FADA 1Z5ZA 4QGBA 1RPAA 4L9RA 1XLTC 1O9BA 3KJZA 2GPSA 1JH9A 1DIRA 5DX0A 2G8NA 4LE0A 1G5FA 4CM8A 4YMGA 2V7XA 1OFVA 3DXZA 1QHNA 3L7AA 1FJXA 1XWIA 1U90A 2GN2A 4RJKA 3VJLA 3H11A 3HDVA 3V55A 1COWD 1R8XA 4FOTA 4B7CA 2QY6A 2WOJA 5DGHA 1V9SA 1JH8A 1F4PA 3CG4A 3A1NA 3R0QA 1DEAA 2HLPA 2EX4A 5DFAA 5G0SA 4B6PA 4MGZR 4YJ2A 4MRRA 1X7WA 4EP1A 3BC1A 4H7IA 4YP7A 3KM0A 1WUHS 3ZGVA 5T3YA 2YWBA 5JPDA 1ZH8A 2YIDA 3C6XA 3DVAB 3FOEC 2Y67A 9LDBA 3ET4A 1U04A 2OD2A 3VNRA 4LY6A 4QOSA 1TMGE 3N2LA 2RCYA 3BXXA 4KWCA 3VSBA 4TS4A 4F1JA 5CLQA 3RK4A 4NICA 2HMSA 1REQB 2E6UX 1G16A 2FB9A 3QV2A 4TTQA 3T06B 1IQPA 1RI2A 2Z6VA 2XKBA 3OI7A 3QUTA 5TGDA 2FZGA 3OFNA 3SSNA 5C5DA 2OORC 3COJA 2OC4A 3TIFA 1D6NA 1ZIDA 4UTZA 3ZX4A 3ZYCA 4B5LA 4D9CA 1OTHA 1WOMA 4M0DA 3VYRB 4F96A 4OPMA 4EB6A 1PR2A 2ID9A 3O4JA 1V35A 1C2TA 1KK1A 4QHSA 3WGJA 2P3OA 1KETA 4JI8B 1PUJA 3STVA 4ZA2A 4HDNA 3FYUB 3SYRA 4R1UA 3UG7A 2AFHE 1EQUA 3T4EA 1NW5A 5LQJA 1G8FA 3A4VA 3PNYA 5C1IA 4MUGA 1JL3A 1FX1A 2R60A 2WI8A 5DMXA 5CDGA 1T3ZA 1V96A 1WCIA 4Q21A 1UOPA 3M0EA 3UAXA 3ZHUA 2IYTA 1N1GA 1UDRA 5BN5B 3IXMA 5HFAA 4MQ5A 2MSKA 4RPLA 1AE1A 3RWOA 2P9BA 1DOHA 3DB2A 3KB8A 3L3BA 4R98A 1H8ED 3G2HA 1EXNA 4RK6A 2WYVA 3K2EA 4C6SA 3R5TA 4YJDA 3STUA 1P5ZB 3QE3A 4DY6A 2EERA 3DDUA 5CDTA 4LQ4A 3SHFA 4HFJA 5CXUA 1UPAA 1VCMA 2OECA 5GZ6A 1KRWA 3BEOA 4FIDA 5F33A 5BWBA 2XMZA 3GT7A 1NNUA 4J16C 4LDJA 4NCKA 3U13A 3I42A 1AMUA 3FYSA 2J8ZA 1NRXA 3ENZA 2E4YA 3GHHA 3JYQA 4AAYA 4CIXA 5KOJA 3DT8A 3HQ4O 4QAJA 4B3MB 1X7XA 1SZPA 1DKQA 1SU4A 2YUTA 3HLTA 3S8MA 4G5GA 4ZMRA 2GHIA 4HNAB 3PI7A 1COWA 4WMLA 1IM5A 3BB4A 5K8VA 4C22A 1NVGA 4HX5A 5HTKA 4C04A 3EXAA 2QM3A 4B1FA 5EGNA 1PWZA 3N2EA 4CF5A 1S02A 1Y9AA 2RGDA 4ML3A 3ASVA 5CU7A 1FNMA 3ZD7A 1P5JA 2WWVD 4DLTA 3WLKX 3WWEA 2XXAA 4AMBA 3II6X 4DR2B 4QDUA 4PSUA 4XKJA 4MWBA 3W2HA 1BE6A 3NPAA 4ESOA 4J4HA 4U0JA 1N2OA 2OP0A 1L3IA 2QX7A 1NNEA 1XT6A 1OYOA 1AOXA 2NUPB 3A4YA 1EFTA 4ZCQA 1FP4B 3TM4A 1DXOA 2YWRA 4IEEA 1IZ0A 3E53A 1M2VA 4KO2S 4UXIA 4TLCA 3LQYA 5ICFA 4YCNA 1MW9X 4P4SA 5LYJB 4FKBA 5G0UA 1YZGA 4MYRA 3QHAA 3AJEA 5D85A 2AFIB 3A6LA 3I9JA 4YT5A 5GJBA 1CUYA 1DRKA 4YIHA 5LYJF 3Q8MA 3T61A 3U26A 2XKJE 2PRJA 4OQPA 1I3CA 4DA9A 4MRMA 3HNOA 2FE1A 3CLSC 3RK0A 4N5DA 1E0JA 4QJ3A 3QFRA 4P4NA 1RU3A 3W8DA 5FPKA 4MSUA 1CS0B 1RRKA 4C03A 4EEXA 4W99A 2QRNA 3KEOA 2OUIA 4ALMA 1ZJWA 2PM8A 3V4FA 3LPLA 4WNIA 5CT8A 2Y1DA 3TO5A 1OU0A 4RTRA 1HO3A 1FRVA 3KWFA 1AJEA 1UBHS 2G8LA 1E20A 1PJBA 2CBXA 3I4LA 4WINA 4BVBA 4J07A 2XMDA 5CNKA 1RBYA 5DTQA 1LBQA 1TM1E 1YOVB 2Q6LA 5I9IA 4LCBA 4FCVA 4DW8A 4MVYA 1S9DA 1YCGA 2CXRA 2G9ZA 1WCYA 2QPLA 2ZYTX 1ESMA 2FEPA 2IRWA 3DP7A 3A2NA 1WHSA 2XTAA 4DB4A 4AYTA 1TT5B 1XTKA 1T4BA 1QGUA 1U3FA 4YJ3F 1LDEA 2G4VA 2ZVDA 4FHCA 1FDWA 4YQEA 1NU8A 2QENA 5LZ5A 1E1RD 2VRCD 3BGWA 1VDMA 2Z2IA 2D54A 2JLAA 1XK7A 3AKCA 2ACVA 3FF4A 3H2HA 3D59A 3Q41A 4UTXA 5DCYA 5CA0B 2PX4A 1VZ3A 1SBZA 1QTIA 1JSZA 2ZJ2A 3KVYA 3H1BA 1J9ZA 3EXFB 3O3OB 4JLJA 1Y8CA 3KQTA 4Y6QA 3K9CA 4GZ5A 5IVHA 1LUAA 3DFZA 2A5GA 2COEA 1CIVA 4MWOA 4DLUA 4Q16A 3TIVA 4F91B 2YXBA 1RZ3A 5J1TB 1KOGA 5KUTA 1KQFA 3QYFA 3ZXUB 2V0GA 3AU9A 5T64A 4AMYA 3ZVLA 1K8ZB 4MCAA 1D6MA 3FPJA 1JTFA 1CE8B 2XQJA 3D0RA 3RAEC 4AKIA 1Q7RA 1FFGA 4G5XA 4E08A 5MGNA 1OYWA 1X77A 1EU1A 1W5TA 2NOAA 2PZBA 2Z3ZA 4EHDA 4PEVA 1YJCA 4MKRA 4BL5A 2P35A 2YX1A 4JFRA 4R8KA 1P9WA 3ZJYA 2JPDA 2FFRA 2Q5IA 1CY2A 3FW1A 2XGMA 2BWJA 4N54A 4P92A 1DARA 1WPXA 4Q24A 1NBEA 3DBRB 4B3DA 3DDWA 1TNDA 2E5FA 1F3OA 4A6DA 1HF3A 2AE2A 1BWSA 2CLFB 3MILA 3TSWA 2CC2A 3GJZA 2NVOA 5FWXA 5AUOB 5EZYF 2B7LA 4YCAA 1YRBA 2Q6VA 4XDZA 5CNJA 1P1KA 1PYGA 3PWSA 2HF8A 3GGJA 3U5ZB 2WP0A 3G9TA 3O73A 1E9SA 1EFRA 1KO4A 2PLNA 4CM4A 2PMFA 2D06A 2W4MA 2COKA 2VHWA 4MJXA 1OJLA 1L8XA 3EGOA 4X63A 5JY1A 1NVWQ 2A0YA 1SOMA 1XHFA 1SU7A 1K5GA 1M9NA 1YHZA 3MCWA 5F77A 3RWBA 3TFWA 5BRAA 2FN8A 5MFZA 3QE4A 4OHBA 5TQ0A 2JASA 3R7DA 4N7BA 4Q93A 5AT1A 1KJYA 5H7XA 3I52A 3T3OA 3FAZA 1BOOA 3GGGA 1BWRA 2IQIA 1GCAA 4OJKA 2HBYA 4ZYWA 5ILOA 4PCLA 4TV8F 1J8FA 1PTKA 4PGHA 4BKUA 2CHVA 3B7WA 3Q11A 5E4TA 3ANMA 4L75A 1AS0A 4WN3A 4AZ3B 5I9MA 4QO8A 2EQAA 5I3CA 4M1EA 4S3MA 4TSKA 2CB0A 3LRTA 4QFCA 4PYRA 1NUQA 3A14A 4QXOA 3KNZA 5HRCA 1UUFA 2TMGA 2C7QA 2F3PA 4O8ZA 2GEKA 2RGBA 3TBFA 3BRQA 1MEJA 2Z5FA 5A3RA 4ZOLA 1NFQA 3VSDA 4YJKA 3RS4A 3WK5A 3SQLA 4X00A 2HLHA 1N2CA 5AKEA 1KAGA 4YCSA 2YL2A 3GRFA 4XPZA 4L8LA 2A58A 4MEBA 2ODTX 2ZTMA 1IZZA 1RR6A 4KR7A 4F21A 5FL7D 1ISIA 4QYMA 4K28A 4ALIA 5E6SB 3KXLA 3K8ZA 5F4BA 2LNDA 3I9V6 1ZO8A 2HAEA 2IP4A 4HAIA 2GK4A 4D56A 4FFVA 3MS2A 4TSFD 1HTTA 3OOHA 1G5RA 4KR9A 4BNHA 4DNFA 2UVPB 3HXQA 1PZGA 3A04A 2O6LA 3EGIA 2HJ9A 3IAS1 4Q0MA 2F1HA 5DCLA 4N47A 4ZDIA 3GP5A 1RKQA 2CLMB 3IEKA 4MQ6A 5E1DA 3T99A 1ZMBA 2JBWA 2FRDA 4DC9A 2XUOA 3BF8A 4H7JA 8AT1A 2WYUA 1G5QA 3L06A 1FVFA 3DFUA 3KZKA 1VB3A 3FNGA 1RPNA 2NTYC 3PHJA 3ZUPA 4AJLA 5EKXA 2R1UA 4BFLA 2Q0QA 3AL2A 4Q34A 4RENA 3MC1A 5D5HA 2VSQA 4RPJA 4DANA 5IM4F 1QIEA 4JP3A 4MV1A 2GPTA 2QW8A 1D2NA 3M6MD 4RIHA 1WB9A 4YRJA 2BEKA 1L6IA 3CWCA 1TEVA 5BUCA 1NYQA 1TK2A 2IOQA 4JXXA 1ZSVA 3AVUA 2HX1A 3GFSA 4RX1A 1EP1B 3GYBA 3DQZA 4RGVA 2Q9CA 1VHLA 1XD9A 1YQTA 4ZO7A 2X4LA 5BQPA 2DPHA 3SWWA 3EXHA 1N7IA 4MA5A 4HAUA 2NUTB 3RYCB 3E8SA 4OHPA 4XYMA 1YZ3A 3Q40A 1H1LB 5L3ZA 1UJ2A 4EZEA 5TLSA 3I73A 2X1LA 5HNKA 1XROA 1XRNA 1KY2A 4UDXX 2Y2VA 4ER5A 1BX0A 1EVIA 1QFSA 3G0CA 4Y8VA 3U3XA 3FHOA 4AU1A 4KC0A 4E07A 1LQTA 1PLJA 3A6EA 2NSJA 5JC1A 1FF9A 4FOLA 3CJRA 4JS0A 1TZKA 1U1FA 2NZUG 3TUJC 1NF3A 5LBTA 1ZONA 2ZTHA 3HCCA 3KDSE 2VZ8A 3JQPA 2YMMA 2J31A 5EJIA 3A3PA 2CNNA 1DVRA 4QPZA 2G06A 4PFJA 2XCLA 5IKMA 3WJ2A 4BKOA 2D7CA 3M83A 3QVSA 5KTTA 1QGED 3G2LA 4JVOA 1BMDA 4NPAA 1O8BA 4NOMA 1MABB 3JV7A 3S2ZA 2EG9A 1M2NA 5KDLA 4BLUA 1XZNA 1XVVA 4RV5A 1J8VA 4FEAA 2ZU0C 2JGDB 4IYRA 4KAFA 4ILEA 4ZP1A 1IUKA 4NENA 4EX6A 2AH5A 3QKRB 2AI2A 4JBYA 2O0MA 3N8IA 4Z3DA 2QTRA 1I3NA 2NACA 3UMBA 2CV1A 4TWBA 1ZNZA 2FPLA 5FL7A 4ES6A 2Z1NA 1RWMA 1KFKB 1VCIA 4FMCF 3CF6R 4D99A 5MDHA 4HGNA 4F2WA 1RXVA 1ABBA 2FA9A 1BGXT 1GGNA 3JS5A 2FXVA 3KLPX 5D86A 2EATA 3TLGA 4YRZA 2YOGA 4TSFA 5M29A 1YUBA 5AXDA 4BFSA 2LXNA 4WX2B 3R9KA 3OVMA 1N5DA 3FNFA 1J21A 2AS0A 4ZU3A 3G88A 2O8FA 5K7SA 1ZM3A 5A5VA 5AJYA 3I9MA 4IMJB 1Z88A 3MBOA 5EJ5A 5HE8A 3HUFA 3NWBA 4ZPXA 2AR9A 1Y5LA 4QOJA 4RMNA 4N8SA 3RRYA 2W6JD 1C7RA 1S1CA 2DFLA 1EESA 3V8RA 5DWQA 2WQZA 1XN1A 2XCQA 4KVFA 3IB6A 1VBNA 2NO0A 4ZVQA 1HURA 3GLTA 2AX4A 3BD6A 3LP5A 4ZO6A 3V80A 4OYYA 1MT0A 5CT4A 1QPGA 4HSGA 2D4HA 4Y0VA 1JS1X 4WKCA 2QPTA 1JMKC 1IBLB 1N57A 2GCGA 4XIGS 1W5SA 3WMFA 1DG1G 5KYYB 4HGYA 2JGEA 2IPLA 2D0PB 2VVTA 2CJFA 1C9MA 3BD7A 1QC5B 1PYDA 1CG6A 4PW0A 1O4VA 3EXG2 3EFHA 4YJHA 3SYKA 4DILA 4LRQA 1GQSA 4JVNA 3E3LA 1RBMA 4IIVA 1LS6A 4B0PA 2ZE8A 5IW8A 4A27A 3PUYA 1PT5A 1JQLB 3HCBA 3AUFA 5F12A 5JCPA 3LVBA 4FHGA 3ZHBA 1IEXA 2NWQA 2Q29A 3J7TA 2JDIA 2GXSA 4O2RA 5B57C 4WKNA 1DS6A 2VT6A 3C3BA 2I91A 4FBGA 2HLDA 3LT0A 3H9GA 3IPXA 4HWOA 1RXUA 2EP8A 4N39A 1U3VA 1N1MA 2KM1A 3C0KA 1SD2A 1YI1A 1XL1A 4RZUA 4EX7A 1WB4A 1B14A 2GBLA 2D00A 1N9GB 4E0BA 5HCIA 1I7NA 1MQSA 1AY0A 1ZNYA 3ESDA 4RY8A 2WIKA 4U0KA 1QG4A 1L5YA 4NQRA 2FQ1A 1VA5A 3EIWA 3LTEA 2PH7A 4LYEA 4MV7A 1XQXA 2W9XA 3MOSA 2G5GX 4EHNA 1KQ3A 2DF8A 2ZYAA 1G60A 1KXJA 2QGFA 4GPTA 5GM1A 1S5PA 3N0RA 2Z6UA 1L2TA 4YCJA 1ZN2A 1AU9A 2FRDC 1Y63A 4BAZA 1I2BA 1T5HX 1Z8FA 1ZU5A 3MUOA 4FFMA 2G4CA 5LOVA 2PU7A 2TMDA 2R97A 3TKAA 2C98A 1EFVB 5JJCA 3D5TA 3NNSA 4IRXA 1PQ4A 2YTZA 1H0SA 4HATA 4PV7A 4QUEA 1IK4A 2AEEA 1EFLA 3SC2A 4N48A 4WOBA 1FW8A 3ZTTA 2JFFA 4X1KA 3SM9A 3QFFA 1Q7EA 3RIGA 2VHYA 3KU4A 1GDDA 1VHTA 2OD7A 4LGMA 1RBZA 3G0BA 1I2MA 3Q3CA 1ABFA 3RSFA 3L2OB 3SX2A 4E5SA 3EXHC 3GLQA 2ZYDA 1QIJA 1QO9A 4KYIB 1AV7A 1DKOA 4HGQA 4Z0PA 3O4RA 3X1JA 2VATA 2XOXA 4EJ0A 9ATCA 2XUDA 1QOPB 2K87A 4BUZA 4EPWA 2YN2A 2IH4A 4QUBA 5C1BA 1NBME 1WDMA 2VDQB 4AULA 1MJGA 4CF6A 3H6HA 3KCQA 4I9HA 4IIHA 2G3YA 4P4UA 4XVHA 5CVEA 5B4UA 4DBLC 2H65A 4EY5A 1U11A 1XTIA 3E2MA 4OHWA 2H4ZA 2HU7A 5FTLA 1XZPA 2XNJA 1EGAA 3PLNA 2JJ1D 4PZLA 5JMPA 3ROEA 1L3CA 4ZIRA 1JHDA 3JQRA 4BO0A 4IJ6A 4AX4A 3HXOA 1DT5A 5JWRA 1TZCA 3LCJA 4PR0A 4OATA 3PYMA 4KR0A 4CMIB 4EGJA 4F2GA 4AMUA 2JRLA 3E2PA 2NN3C 1O6ZA 4HGOA 4HMOA 4KRYA 4YA6A 4N0QA 2BHNA 4A73A 1G9XA 2AFHB 3JD0A 4GRDA 1SCDA 5L4SA 2ORYA 2H8GA 4DNQA 1F2UB 4QQ8A 3O1JC 1KDZA 3A9SA 4D9KA 1Y8ZA 2H4JA 1JLHA 2O2EA 1GRVA 3HYTA 4TXMA 1CY1A 3UO8B 4D5EA 2ZTSA 4Z7OB 4DR5B 4R05A 3VX4A 2ZBVA 4N82A 5JARA 1D8AA 3DHNA 1T6YA 3I8SA 4R1MA 1RFLA 4B40A 3A1CA 3CH4B 5A4MS 4DZRA 5HEKA 3V2HA 3HFRA 2RGAA 3K4QA 1N3YA 2ZUWA 4J49A 4X1IB 5BNIA 5GQSA 4AKHA 4HNHA 2Q2VA 3IEXA 1ZVVA 4ZYXA 4DLRA 5EWMB 4W82A 3MWJA 4RMGA 4J4BA 3L04A 3ODPA 2WM3A 4RXMA 4ZCIA 2F8LA 3K32A 4N9QA 1GZ3A 2JKYA 3TIIA 3O0DA 1PE0A 2QR5A 3DEKA 3EEYA 3P9NA 2VJCA 4G8JA 4ZQIA 3PEWA 1R9MA 2B25A 2I3DA 4IIJA 2R96A 3HKCB 3E1KA 2WSIA 1FFBA 4NU6A 3A6KA 5ARCA 3ZJ5A 2XF2A 7REQB 3CLRC 2RCNA 1K3FA 1OUMA 1CLEA 2QJFA 3EZ9A 3AF2A 3K8YA 1YJAA 5K0LA 4BO8A 1TZMA 5BOSB 2O8DB 1XZBA 4E5MA 5K8JB 3CWQA 1L4KA 3RU7A 3VJKA 4N8DA 2L17A 1XYGA 2ZSHA 5K8LA 1VKNA 1U5CA 3LQQA 3TG2A 2I0FA 3KJFA 3IT2A 1NXPA 1IEVA 4PSVA 4EMTA 3B70A 4MXDA 1JYFA 2XAAA 3ABSB 3I1JA 2IOFK 4ZDJA 4DCVA 3AR8A 1IQRA 1XRSB 4FNAA 4GM4A 4DPMA 3C87A 3OY7A 3ROZA 4E5UA 4HVAA 2HSEA 3MTEA 1Y1KE 1PJTA 2A9OA 2X4GA 1AIPA 1CYDA 1P4GA 3MWLA 5K0GA 2W42A 4EOGA 3TZHA 3PA6A 1RHKA 4K86A 4KGZA 4D3DA 4CMJA 3EEOA 1RAGA 3TJMA 3FMPB 5NLLA 3VPCA 1Y1PA 2BMDA 1SC6A 3IUQA 1BYUA 3IDOA 1BVUA 3MFYA 1KJIA 1Q7GA 2BGRA 1IWOA 2IPXA 2RI1A 3R5SA 4YECA 1TPZA 4RQTA 4ZPJA 5BT9A 5JXJA 4E5NA 3LPAA 4PF1A 2Z5LA 4QXRA 2X0DA 4FT2A 2E0IA 3D81A 4IZOA 4AUMA 3K6SA 1QH9A 1FSZA 2GBLC 4JT8A 1E69A 4M38A 2WHPB 3PX2A 1DWQA 1Q1QA 4OEHA 1B6TA 3JPYA 5EERA 5U9CA 5K3SA 5BSRA 3AUAA 5IUKC 1A72A 3RR2A 2D59A 2QRZA 4B46A 1U2GA 3ZBTA 4ZQFA 1FLVA 2XVYA 3AB8A 2EL7A 4B71A 2X2EA 4EY4A 2BTQB 1QF9A 1WNFA 4LNAA 3AR9A 2QYHA 5TPZD 2X5NA 4CU5A 1CSEE 4M37A 1U7WA 2WJHA 3PJFA 1OHHD 4HG2A 4EG8A 1D03A 1NT2A 4D0GA 2UVQA 3O8QA 2QX8A 3L18A 3QBTA 4BX8A 4G41A 2VHXA 2C1XA 3NVAA 4F6RA 5JNRA 2GTIA 2PT6A 3K4HA 3KAKA 5LKAA 1NRJB 2Y1GA 1XA4A 4RS3A 1ESNA 4OK5A 4TTIA 1HFWA 1T3LA 3RKRA 4BFWA 1NLUA 2V1XA 4G97A 3L1HA 4OB7A 4V39A 10MHA 3N8GA 5T4BA 2Q2WA 1FYFA 2GCPA 1CUEA 1U1IA 3PXXA 3RNOA 2P0EA 3FPFA 4S05A 2HHHB 2J33A 1LW6E 1N32B 3ZKWA 3CYFA 1CB7A 1GZ4A 5EJ4A 3K5WA 4Z2YA 4C7XA 1GFSA 3VR0A 4HDKA 1FU7A 3H83A 4C4AA 2IPAB 1H69A 3P2YA 3EEIA 3WLFA 3KYBA 4EQ6B 4KNWA 5IUNC 1D07A 3DS8A 4D81A 1K3UB 3P96A 3UHFA 2QT1A 3HDTA 4BNYA 3MWDA 4KDEA 3T7KA 4D4JA 4I5EA 3RASA 1RACA 1XXHA 1A5AB 1X7ZB 3AHJA 1EDDA 4K40A 3A6ZA 5CIQA 1HYBA 1E5LA 1EM8A 2BGLA 1JQAA 1TUGA 2OBLA 2ZB3A 4REMA 1RQXA 3MPOA 5ILGA 4J3NA 4E21A 4A23A 2P5TB 1A2QA 3QBJA 2QAGA 1QHHA 1W87A 1BC5A 2X7HA 4PCAA 5SY9A 2TSYB 2WJZB 3A9UA 3QYAA 5LDHA 4UULA 3V2GA 1P2GA 3MCUA 3TCKA 2PJUA 1ZOOA 3GGPA 3Q6IA 4GBGA 1C9NA 5A6SA 4ALKA 3AWIA 3MF4A 3HPQA 2POQX 4O5AA 5KYVA 5JBNA 4W5RA 1W36D 2Y77A 2D0DA 2YVLA 2NSHA 2VTBA 4NL4H 3AFIA 1TRKA 1TLTA 2LPMA 2Y9MB 4A6PA 3IPRA 4UBIA 1Z7GA 6Q21A 2DFNA 3CNQS 3DBIA 3DOOA 4GNRA 4RZHA 3QHPA 3RVNA 3UBMA 3O1LA 1TM7E 3AHHA 1KBQA 4BGUA 1KC1A 1T0JB 4BLOA 1KZ9A 5FUMA 4IOLA 1JDVA 2J67A 3G23A 4MUJA 3V46A 4BLTA 1XYYA 2P4HX 4LWPA 4P5DA 2FG5A 1KF0A 1CDDA 4QEDA 4I1VA 1LBSA 5BNZA 3DO8A 4OYRA 5IDXA 3TPFA 2PQMA 5TPZA 3KRTA 4CQMD 2CMDA 2AKYA 2XDQB 1XTRA 3WJ7A 2VDWA 3IFSA 3TRHA 4TTAA 1FSGA 1BEZA 1JVBA 1BS2A 3U3OA 4HX9A 3HCFA 2C4KA 4A4DA 1KEKA 2OYRA 2BGGA 4U1RA 2XECA 4ZFNA 1ZAKA 2OQVA 3CIOA 1QKIA 2IKSA 4ND2A 3KUCA 1WMDA 2YCLA 2HK6A 4EKYA 3VHXA 3H1TA 1EIWA 3ZV4A 4MPPA 4B83A 4R6WA 2HSJA 1GU7A 3QEKA 3NBXX 4QJ4A 4L2IA 2GZMA 2IY7A 1MV8A 4B79A 1T3HA 3DW3X 3JPWA 3IR5A 3VVCA 4EY3A 2HLNA 5REQA 3MT8A 1DO2A 3H2GA 4C6TA 2ORED 1QIFA 1IATA 3AETA 3FYTA 4IJQA 3HJRA 3Q8WA 3USZA 3PSHA 1QIHA 1U0FA 2WF6A 3OQHA 4DR1B 4EMUA 2H9IA 4UTVA 1US8B 2VAXA 3QVWA 4C89A 4AXBA 1YZNA 1M2EA 4QXMA 2C9BA 2CUZA 1MQ9A 1ZY2A 4JOCA 4KVGA 1CY6A 1AF4A 2Y3IA 3NAMA 1MU0A 1W8DA 3CE9A 2EWMA 3I92A 3LYUA 4Z9FA 1G8MA 4B8YA 3HUDA 1OBFO 4UU7A 4D5GA 4DJFC 4FP9A 4I55F 4KJZA 3JZMA 5C1PA 4FKZA 1CJUC 1FYVA 2FPMA 3QLVA 4GMXA 5JH7F 2PIAA 2W2MA 2CBGA 3C5VA 3CNLA 1N3BA 4W9NA 4HQNA 4FMDF 1CZRA 5EKDA 1DUIA 4UHEA 5HMMA 1VI5A 4HSEA 3OPYI 4TMTA 1A96A 1U2GC 1IXSB 1VYUA 3ASUA 3QJGA 4N5NA 1CUCA 3RTGA 3Q3VA 2IZ0A 5FBQB 3CN7A 3HO6A 3NALA 4AJEA 2OGWA 2VS1A 4P31A 4YJ3B 4LTDA 5IWAB 1T36B 1AHIA 5SV2A 2YICA 4MVXA 3SOZA 3TTSA 5LYYA 5JVDA 1RQRA 4MGHA 5T5QA 4F4HA 3ZOZA 2NUAA 4E4RA 2VHUA 2ZR7A 3RBZA 4CT0A 4FTWA 4Y18A 4EHAA 3D64A 3AZPA 4HB2A 2ECQA 1QQ6A 3E5NA 4PG4A 3SQMA 3S2UA 1I13A 1U31A 2BJWA 3SY8A 1Y82A 2XDAA 1KY4A 5KC9A 3PEYA 2I3ZA 1T2DA 1SKAA 4RFLA 3VNBA 1SOUA 2LE0A 4D8YA 3B5EA 3K0CA 1RYYA 5JECA 1PHPA 2XVMA 4HOYA 2QQ5A 4CQMA 4XQGA 3AJDA 5DHPA 4CMAA 4MP3A 1LF5A 2QRHA 2VH2A 2DPGA 2DQ4A 2XUZA 4KPUB 2N46A 1AS3A 2A94A 3DAFA 3DMFA 3K9WA 4WK2B 4JBHA 2GTPA 3ME5A 5L53A 3GLVA 4CFZA 1C9EA 2K7ZA 5KB3A 3RVKA 4CLHA 4JMPA 4Y2VA 5EIAA 2HMTA 3EQ9A 2ZRGA 1IJEA 5JBIA 5DLQC 3V8NA 2CDNA 2CLEB 3BE8A 1W4RA 4ASUA 4Z4CA 2OV3A 3A1VA 2J08A 2Z56A 1U9CA 4JYCA 3TZQA 2O7NA 1EEXB 3ABQB 3FN4A 2ARKA 5EKSA 2QAGC 3TD9A 4J7XA 3V97A 3GO4A 1WF6A 3ZD9A 5EZYB 5FULA 1E3IA 2R7KA 1DFIA 1JQKA 4D0NA 2M9MA 3CA8A 4ZAFA 2QN6A 2RSLA 3F6PA 3OTOB 2EAUA 1TF5A 4RY9A 1DFHA 5DYIA 3LJKA 4YP9A 2QUKA 4XCQA 1GGVA 1Q3TA 3OCUA 1MGOA 2X6RA 4GX1A 4J75A 1U7TA 3NXSA 5CM9C 1XZGA 1L7EA 2FEKA 2R8EA 3SNKA 3Q1LA 3S8EA 3RABA 4DV3B 1Z5WA 1QRUA 4I8IA 2WFAA 4LXHA 4OAQA 1GZSA 2W43A 3EH1A 3HBAA 3SF8B 1A97A 4E46A 4IOJA 1B7GO 2G0NA 4TV8B 3PLAE 1CU1A 2H2GA 1QAQA 1E5TA 4P9NA 4QUJA 4DUZB 3PWTA 2VBCA 3N7TA 4U2FA 1KSGA 4JI4B 1H5NA 2ORIA 2SKEA 3OM9A 4FEEA 1R7RA 2AZTA 4EYEA 3UJ8A 1HZZA 4IX9A 1LLUA 1TCBA 1WU8A 3ESBA 1SBCA 1M73E 1VXOA 5DSZA 1CRPA 4B48A 3C3JA 1KYVA 4DNOA 2ZXEA 1ZUWA 1JHMA 2Y76A 1A88A 4BLQA 1T5OA 3DAPA 1U8YA 5KOHB 1JG1A 3FWKA 2DE0X 3BA1A 1AXRA 1QQTA 2O7RA 3NRCA 4V38A 1C7QA 4UU8A 4AKGA 2OFFA 4ZARA 3DKPA 4JLNA 4ZVLA 3A3NA 5CURA 1L8LA 5KBYA 2FEMA 1MC5A 3N9IA 3PJDA 3HGTA 5EE5B 4IKOA 3OTIA 4O3FA 1GUFA 2A2ZA 4RD6A 2EJVA 3ZBPA 4OJYA 5A0TA 5EP1A 4FOOA 4CIWA 3TW6A 2B4AA 4WJZA 4RIGA 5AKLA 4S35A 7MDHA 1WXGA 4FJ2A 5A5EA 1E0AA 1OSNA 5DYWA 2ZIAA 4ZVRA 4KTVE 3G8DA 3UN1A 1NN0A 3D2BA 1YMVA 1B8NA 2VRWA 2F1OA 2RAPA 4L15A 1M7HA 1XZLA 2HO5A 2NXWA 1RKUA 2RIRA 1K2WA 1TLLA 3HSYA 3KPUA 121PA 3X1WA 1OB2A 1NZFA 1RQ7A 2AX3A 1UBCA 2CFTA 4IWNA 3PPVA 2QI9C 3B6JA 3MLAA 3WBFA 3ZWBA 2BZSA 2IGBA 4O4JF 4RLHA 1ZXXA 2G7MC 3NYIA 4FE3A 4QSHA 5B58T 3RYHA 2ZCJA 1SC1A 4MQEA 3O9VA 3QLVC 1M5UA 5AQ1A 1DRVA 4W9NC 3GG2A 4KG7A 3R3WA 4RM3A 4DLBA 1XU4A 3D7KA 4B84A 4DCUA 4JLPA 3O8NA 4UDOA 2ZJYA 1F06A 3F78A 5CLGA 4GLOA 1DX9A 1G59A 3E22A 1X8LA 3B3JA 3O2QB 1UBSB 4BCBA 3I72A 6ADHA 2NSLA 5AOVA 1K6IA 4HDRB 4EA7A 4A7PA 1L5OA 5FAXA 1ZVJA 2IWRA 4TWZA 1T2NA 4MKHA 2XIQA 4ND7A 5AVWA 3AVWA 1WB6A 2Q41A 2XOEA 4QOEA 3DD5A 4RF3A 5LD2C 1C3EA 3PHBE 2FMUA 3T5DA 2OHGA 4BO9A 1GPKA 2BHRA 2JHFA 1NVUQ 2PMCA 4R81A 1GCUA 1VHJA 1WUIS 3AQ4A 3DTNA 3K0CC 4QNMA 2XTZA 4U2BA 3FFBA 1RJEA 2QN8A 4DREA 5CR9A 4WUTA 1T9KA 4C7KA 5C5CA 1M8FA 2VDMB 4F84A 5CNIA 4MIEA 3ON5A 4RK5A 4Q9LA 2V03A 2FP4A 3AILA 2FLVA 5GV7A 1EPUA 1YV9A 3ILXA 5AHKA 2DVMA 4GAEA 3HO8A 1NG9A 3HCAA 4QVGA 3SJZA 2W71A 2VTDA 1ZN8A 1DQNA 3EASA 4MMYB 3WGGA 2E4WA 3KR0A 4KXUA 1T0PA 1F48A 3DBOB 3Q2IA 4LECA 1XF1A 1I7PA 3BGVA 2Z08A 1AVTA 2FEXA 3KXKA 6AT1A 3S55A 5FT9A 1QZ3A 4PCVA 1Y3CE 3ABZA 4FMCB 4G5QA 4OOEA 3R7LA 2HTFA 3AOEA 1LWNA 3OO0A 3W8NA 4A16A 4BZWA 3HO1A 1M72A 2KMLA 5TQ2B 4H1UA 3NUZA 5IBCA 4HTFB 3VZSA 3NCHA 5AXCA 3FA2A 4NK5A 4ZYZA 2OCDA 1A9SA 3ZZUA 1II8A 2R79A 3PIRA 1GEGA 1Z6PA 1KRHA 2BMVA 3RFUA 1TF2A 2QD3A 3E9CA 3P9QA 4RD1A 2GEBA 1MNAA 3JQAA 2H00A 2QS9A 1MENA 1QYDA 4WXHA 2WVAA 4DR4B 4AJIA 4X44A 3OKAA 3HYNA 1BU5A 1YC5A 2VTKA 3DG9A 2WYIA 3Q9UA 1PG0A 1WE2A 2R62A 3IDQA 1WMBA 3ANXA 1ZHOA 4JI2B 3PFIA 3C3PA 1J0AA 1B1AA 4NONA 1P45A 2QN3A 5IT4A 1K3TA 4WKGA 4XGNA 1UBTS 3U49A 4RSRA 2NP7A 1H2WA 3BGDA 2YXLA 1KKLA 1NSFA 1Y5NA 2WILA 3V4SA 4AZTA 1EUZA 1VIMA 4ZOBA 4GQIA 1P29A 3SE0A 3KOZA 4A8JA 1Z6ZA 1GNVA 1CF2O 2G07A 3FSGD 1KYIA 3JALA 4OUDA 3Q85A 3IOYA 4XXHA 1HZZC 2FKAA 3KEQA 1TTHA 1MTOA 1N2JA 2QJOA 2R5WA 5FWYB 5TF0A 2DFVA 3N2KA 1BH6A 1IHXA 3ZVKA 2DC1A 3PA8A 4JQCA 1T2EA 1TK9A 2PR7A 3R3ZA 1PS8A 3U7EB 5I5EA 2PZGA 3W5AA 3ZCPA 1FY2A 1E3QA 2AHOA 2ECPA 3R4VA 3A1SA 2XUFA 3PK0A 1DQZA 2P91A 4X8OA 3ABOB 3FDZB 1DC8A 3O4VA 3QRWA 4R8SA 3TTUA 3L4EA 5FDFA 1F3LA 2I1VB 5AI8A 2I34A 4TX1A 3EF3A 1PV1A 1UDBA 2RG1A 2D0IA 3ZDDA 2Q1XA 4LJ4A 1PNRA 1FDSA 5HRUA 3NGMA 5ICSA 3ZK9A 3BMOB 3Q3GE 5ALTA 2CBZA 1B43A 1F8UA 3H65A 5L7YA 1HGXA 2PH1A 3L1VA 5EP3A 1TU3A 1WEKA 5T8KA 4EKDA 2IYQA 1NPYA 3VDRA 5AUQA 5I7UA 4ACBA 4DRYA 3GNTA 2I8LA 4CMKA 2UUOA 2HSDA 1BS1A 1HPLA 3L77A 4S1NA 1F4LA 4X1YB 4UE6A 5CBPB 5DIFA 2PKYX 4NFYA 3UV7A 1AT1A 2W8ZA 3NWEA 3H19A 5EJAA 3BORA 1T3SA 4PNEA 2KJQA 5KJFA 1DBWA 4XVQA 1A98A 4YQZA 5LZ2A 3V4OA 4I14A 4KUHA 3SGLA 2NVUA 2CCJA 1L5FA 3BIJA 4P4TA 4D2IA 1X13A 1QWSA 3QFCA 1Z8DA 2DULA 5HIAA 2LTAA 2R25B 2Y0BA 4O2AA 3OCCA 4U9UA 4M9CA 3ETLA 3PD7A 1A27A 1RQPA 4V0ME 1Q0TA 1DWPA 1GHTA 2PV7A 4CE6A 2QRQA 4L8WB 4JJ6A 5C1OA 1NXVA 2Y68A 1W4CA 2C7RA 3TIGA 3DEAA 3BMQB 1ZLYA 3HABA 3UK2A 3W2IA 2BUCA 3WNDA 5JS7A 1BA2A 2WD7A 1ULAA 4EB8A 1H4QA 4DHEA 3JAKB 4JJGA 3NHUA 2BMWA 1ZFNA 1NY5A 2CLIB 2WFMA 3OT1B 1T34A 4URUR 2VF7A 3CN9A 2OOKA 3I6YA 3U4DA 4FLFA 1XELA 1EHCA 5KX5F 2EZ9A 2JCGA 5ILQA 1T2VA 2MSCB 4QEZA 3KELA 3EPKA 2J9XB 1C1XA 1Q57A 4WEQA 3DMTA 3GARA 5ELLA 3RJZA 3UGKA 4N03A 2O4CA 1KK2A 4P58A 5DGTA 2QVCA 3GW8A 3NHBA 4DCCA 4U02A 5HJ5A 2ZCUA 4IHJA 2JBAB 2GJ9A 3KB6A 1FRQA 2YN4A 1R0XA 4FHZA 4TKMA 3A2KA 3OKPA 2O07A 4ZT4A 1PV4A 1YS9A 4XYLA 1F2TB 3A58B 3K94A 3OQ6A 1O57A 1R37A 2RAFA 4IDHA 5CYOA 3ADDA 1QTQA 3NTLA 2OCYC 2X14A 3PHGA 2GM3A 4PAQA 3E3OA 3CX4A 3IHTA 1NF8A 2AJTA 1Z9BA 4ZAZA 1E3TA 3UUWA 1TU0A 3BMCB 1OXVA 3OLWA 4OHFA 3ZWAA 3U81A 3QSGA 2PMDA 1ZQ1A 2O8EB 4B4UA 3R5JA 3STYA 1T2AA 1I01A 2A14A 2Z5GA 4R40A 5CB4A 4OFXA 3AOEC 5KNDA 4EJFA 3GLGA 2P9JA 4MWDA 2XWBF 3IOMA 1QBGA 1CUDA 1PUIA 1NX6A 1YD7A 3N7UA 3DEIA 4QYSA 3JYNA 1K97A 3TVTA 4EHBA 1JHPA 4ITUA 3PF9A 1WG8A 1N77A 2H7VA 4TMXA 4CKEB 5I8WA 2Z9DA 1IBMB 1NVDA 1POXA 4IS2A 1SD5A 3AP3A 4R5HA 4Y0NA 2QLMA 4I1YA 2ZWMA 4WNAB 1L5SA 3U48A 4DF3A 3VHLB 3S1SA 2AK3A 4WESB 2QTZA 1Z82A 2C8KA 3AJ8A 3EZXA 4EYQA 3F8SA 2A3NA 1RAIA 2CL6X 3E0QA 3NVDA 1EK5A 2G9UA 3G0OA 2GAIA 2NZ8A 8ATCA 1G66A 4PQYA 2WNHA 4MV4A 5J47A 4AY2A 4B33A 5DULA 4PR3A 3RFTA 4RE6A 4B6SA 1X0VA 2CXOA 5FI0B 5KCMA 4DEVA 7MHTA 3S68A 2PEZA 2Z8ZA 1QP4A 3V8VA 1IIRA 2R6AA 2WM2A 2YVKA 2P6NA 2ZSJA 3N3AC 3DFIA 3SBXA 4MUHA 3R7WB 2JHAA 1U9ZA 1Z25A 1R6TA 3G68A 4P0TA 1Y34E 3Q72A 2OXTA 2FRVA 5CG2A 4UAUA 4UOZA 2P9FA 4Q7QA 4LCJA 4QGFA 3DLIA 2D1QA 3CY6A 4D25A 1I3MA 1PJ2A 3EDOA 4KCGA 1IXKA 3TEMA 3ZI0A 1VOTA 5DLEA 2IPMA 3U7QA 4TUYF 2HA5A 2G67A 3WK4A 3P4XA 4F86A 1NKTA 5JCXA 1VPDA 4HX2A 1Y4UA 2DTDA 2C1EA 1SCAA 4DIBA 4BU0A 1KMHB 4KE9A 3RB8A 4UBOA 1AQJA 1X3LA 5K8TA 2WMYA 2E2WA 1CQIB 1KO8A 1Z4QA 1IOZA 4YRMA 2JIZD 2VQ6A 3HJGA 5T8KC 1E3JA 1T5SA 2HT6A 1T9BA 3GYGA 5IT0A 3IBSA 2C31A 1P2DA 1TYZA 1FMLA 3B36A 3CB2A 4FI3C 3UFXA 2GEFA 3BJRA 3SC4A 4ZZ1A 4LZJA 4GHWA 4JN6B 1R50A 5KX5B 3MGCA 3EUEA 4F1KA 4OLJA 3ZVMA 5CVUA 4TVOA 5TPWB 4RZ3A 4HNVA 1Y5IA 2R86A 4M86A 4M9ZA 1G8YA 1TA0A 4W8GA 3TWOA 1JF8A 5IYZA 2P67A 1L4LA 2BL4A 3MYRA 5FRDA 5C34B 4HEA1 1Y8AA 2NU8B 5AVXA 5JU6A 3TS1A 2PSDA 3HA3A 3TX2A 4TWJA 1RPJA 2ZPUA 4BRUA 4M0CA 3QU2A 3ZDEA 4JOBA 4W8OA 3U4HA 1ZEMA 1E7QA 2ZUUA 4UVEA 4R1QA 3WGQA 3KXIA 2DHCA 5ER6A 4Z99A 2BRUA 4DPLA 4U3JA 1V8FA 2CDBA 3HLYA 2LBPA 3I53A 5CXSA 1QYCA 5DYYA 4O5OA 5TGTA 3BL6A 5D3ZA 2BKEA 2RB5A 1BE1A 1FMTA 5FTJA 4C78A 5D3MB 5A9TA 3ROXA 4NRDA 3MJDA 2R2AA 3W4IA 2NVBA 3ISVA 3HADA 2PUJA 3Q0TA 2RGGA 2GEVA 4LTNA 1LSUA 2VCEA 4U7JA 4WCFA 2CEKA 5H3CA 5BYBA 4LF6B 3CUKA 1E3WA 1OH5A 1YC2A 2EG5A 2XWSA 3LUFA 2QZ9A 4PYJA 1YL6A 3NDPA 3AUSA 3WMWA 2V6BA 1ZGCA 3ICPA 4FHDA 1KJNA 2EW8A 4HQKA 1SHZA 4L74A 4Q00A 3DMTC 3OOEA 3FSEA 4IGKA 4N76A 1KOJA 4X93A 4WT7A 2EBWA 5EJ7A 2PT5A 5BSGA 1GFIA 5BMVB 5K3EA 1U0BB 3NTRA 5BYAA 1RLOA 1O7JA 4A36A 2C96A 4YDHB 3SVLA 1JKXA 1YIAA 2R85A 3C1TA 4ZJPA 4L5BA 1PEYA 2G88A 2TMYA 3OX4A 4XI9A 4ISBA 2UDPA 5CT6A 4BO1A 1XKQA 3CNNA 2W5UA 4ZVKA 3CB4A 4DV4B 1A4UA 3E18A 3ZWWA 4F4CA 3TX6A 4Z1MD 1RRGA 3IV6A 2ZSIA 1N92A 1JE0A 1TUEA 2JIZA 2OHIA 1IQUA 3LC1O 4NE9A 2PX0A 5ESXA 4DMCA 1JP7A 3PVZA 4QUDA 3H05A 3ND9A 5HJEA 3G8AA 1Y3IA 3IBFA 1G98A 5FOVA 3IJEB 4C76A 1I2CA 3EF0A 1NUSA 1IYZA 1MRZA 2JA2A 1XXLA 5E4FA 5J59A 2HRZA 2K5UA 4KI7A 1C7ZA 1NW7A 4ALNA 4CDMA 4EHJA 5ICMA 5AJTA 5H83A 4BV2A 1O0CA 1QE5A 2PGNA 2C9MA 2G5PA 4BCDA 3LBIA 3ZCTA 4GI1A 4H3SA 2Q07A 4DXHA 1CJBA 2AT1A 1FXSA 4WBNF 1NBHA 4DJJA 1N2HA 1NJSA 3UGTA 4P32A 5AW2A 3PTZA 2FEOA 4KRGA 3EJWA 2PX6A 1GVNB 1V8BA 3L8EA 4JOSA 1ZMOA 5FUYA 1WCXA 4JT9A 3P45A 1S2DA 3CKLA 1BMFD 2OE2A 2R751 5GP1A 4DIEA 4F5ZA 5CB6A 2F90A 1A0OA 1R6UA 2AF3C 3D3JA 1G18A 5EMJA 1VMDA 1LRJA 4MYHA 5FTWA 4WNCA 1E2UA 4B2PA 3EWSA 2BBOA 2IBMA 2XVXA 4GVLA 4TXNA 4E14A 3OQIB 5BQ3A 3U6KA 2YHSA 3W78A 4DM7A 5CXXA 2PS9A 1V1MA 3E23A 5J63A 3Q7SA 2W93A 1W5FA 3ZJTA 3ZDQA 3N87A 4NMXB 2ZUSA 4DSZA 1FU4A 3REOA 1Z2DA 1IOVA 2GLTA 4A2CA 4BN0A 4EI7A 1S2IA 3X2EA 4BMPB 5BYJA 4P2GA 1UT8A 4Y2SA 3RFFA 1XU7A 3GJXC 2ZS7A 3LHSA 1KKUA 2DFTA 2AMJA 3BCSA 1QVWA 5KKCA 4TYWA 3K70B 3GEEA 1FW6A 4EUEA 4DM3A 2WVJA 1IM8A 1G2QA 1ZW6A 1KARA 2C5BA 3IP6A 4U8HA 2EVWX 4RV9A 5CPBA 4TLDA 3G5MA 3SZGA 2J9FA 2X76A 9ABPA 5BW6B 5JAUA 2GN9A 4K9KA 4E4TA 1NTOA 1ADCA 3L1KA 2Y1WA 2IV3A 3PL1A 5HJ2A 3K2IA 2I1QA 1I4TD 3MWEA 5JH7B 3MSXA 3BK2A 3BDIA 1IUPA 1UKCA 1RC8A 4FMDB 3WI7A 1DT3A 3DMYA 5G3ZA 1LPAB 1QQ5A 4OX9Y 1VLQA 2WKPA 2GR9A 1CZNA 2DJIA 2Q5FA 4JB2A 4OAPA 3OMLA 2ZRFA 1RI5A 1NV8A 2ZI6A 3SXUB 3ZV7A 2WE7A 1KP2A 1F6BA 3HJUA 3SHQA 4WEOA 4JV5B 1N25A 3N53A 3J80A 1E2IA 2Z98A 4WZBA 1E7MA 3F5SA 3JTEA 3R23A 4IV0A 4TZTA 4EG6A 4R69A 2WRZA 1KFBB 2COUA 3PFHA 2CHGA 1E3DA 3D3EA 2CMFA 5EINA 5TMEA 3U44B 3PQCA 1ZJZA 2IXDA 2BRUC 3H2ZA 4I50F 4D8WA 1F5NA 2PO7A 2W70A 3KSRA 4D3YA 4RZ2A 2EU8A 2YIJA 3H42B 1J2JA 3RU9A 3ZS9A 1X1CA 2NYRA 5AK3A 2AJLI 1QJ4A 4AZ0B 4FWTA 2I62A 1JEYB 4I66A 2WIAA 1G0NA 3LUBA 3OQ1A 4JD5A 4ERNA 4AJPA 3JARB 4ARVA 2AG6A 3SJCA 4XB1A 1K6EA 4WCFC 3WSWA 1UZNA 3I01A 2QIPA 3MN1A 1UFKA 4TWRA 1GU0A 1W5AA 2BHSA 2V59A 4JR2A 5EKUA 1JAHA 4KX5A 4LC9A 5AK4A 3AESB 3HCPA 3TZBA 3ZDXB 5EHNA 1IMJA 4KKVA 3ZGOA 3O84A 2DOKA 1O6BA 2A0KA 2VF8A 5FX2A 1AD2A 3DT6A 4KACA 2X3FA 2WV9A 4X5OA 5HBRA 3VZCA 4A10A 4OLBA 1O9HA 3IPYA 2I4MA 2OZLB 4RLFA 3KYDB 3L7LA 4BVHA 4X8MA 3QVTA 2GXUA 5F2KA 1U2EA 1WQ4A 4KSYA 1S9HA 3VR6D 1Z8NA 3FMGA 2J5BA 5C52B 4D6YA 2OBYA 3EXIA 3PHIA 4E2ZA 4DCGA 2GWHA 1DCMA 1HTBA 3F5FA 2ZBUA 4ENQA 1XTSA 5DSXA 1X9HA 2XA2A 3SR3A 1GZHB 1RWNA 1HYQA 3PSAA 4IGAA 4R4JA 3IMGA 1KZGB 3RUEA 3GPIA 5KYWA 1W75A 1JLRA 1T29A 3VJMA 4PXYA 5A02A 1B16A 1CR4A 1CZKA 1Q0QA 4FR5A 1I4LD 5G1OA 1FBNA 1QVRA 3D6FA 4FUTA 3U1BA 1TECE 3DBHB 2ET6A 3OCYA 1LQUA 5FQOA 3DKVA 2HXGA 1XTBA 2QYTA 3PNMA 3SU8A 2A33A 3AHGA 1JFRA 1C9YA 3NZEA 1L1FA 1AF7A 3IODA 5KWJA 4EATA 3LX4A 4QOHA 3RLFA 3VZQA 2H52A 4YCMA 2FTKE 1MZPA 4LWQA 1YQ9A 1KZ4A 4IH9A 4FWBA 3O2JA 3SSAA 4F8YA 4E5DA 1BD4A 4R68A 1MRNA 4G85A 4KOEC 3UF0A 1NQOA 5LFAA 2AC7A 3BZWA 4IY1A 5FLKA 4RW0A 2DY0A 5HG0A 2QUJA 2HIGA 1G3MA 1Z38A 2J85A 1N5MA 4ARAA 4KE8A 4TT8A 4I36A 4LK2A 1QG2A 2PTGA 3Q7PA 3IL2A 5F23A 3QOXA 4QBKA 3DR5A 3MLBA 2N42A 4R9SA 2QG6A 2EXXA 4IIFA 1NBMD 1Q83A 3AM1A 5LWHA 3JZIA 4W5QA 2C61A 4OLFA 3KVOA 2GK3A 5HCUA 4O2BA 3GBSA 3NUGA 2PU5A 2W7TA 4MUEA 4IDEA 4AKEA 3P0RA 1DOAA 3RVSA 2H07A 3F90A 1R0CA 1JPJA 3N70A 4NEGA 2A4MA 4NWIA 4O25A 2IHJA 5AI5A 3RYFA 2C8VA 4FDUA 2R87A 2PMKA 2JCXA 2RHJA 1QYIA 4G89A 4KAAA 2WHRA 4L9SA 4OOFA 2V6IA 5BSUA 4GPEA 3AFOA 4JC8A 5DM0A 3TW8B 1AM4D 2A9JA 2PFSA 3GT3A 5JASA 3PYLA 1UMBB 2VXCA 1NR5A 2R8BA 2ZB8A 4RS4A 4RVUA 3T9FA 1GN8A 4PX9A 3W90A 3LL7A 4O4JB 2G9QA 3RAJA 1PFYA 3OEWA 6REQB 5GONF 1QQ7A 1A8IA 1YNSA 1VFPA 3BIOA 4NJOA 2ZK7A 4LA4A 4OCZA 2X8AA 3M9XA 1M0TA 2FEAA 1AQYA 3DE5X 5AVQA 1F4VA 1A5SB 1GITA 4MS1B 2F2TA 4GQAA 5AHWA 1BA3A 5F5LA 1JDJA 5BXYA 3TE7A 1V7CA 5FOXA 3HZZA 4WGGA 2V98A 4AJNA 5BSMA 1JWBB 3E4CA 3GLIA 4QYTA 4KUGA 4RTNA 2ZI7A 1B6RA 1GJRA 4I4IA 1IVSA 2CXQA 3VHQA 4DPKA 3NYQA 4YP1A 3UOGA 5BWCA 4KFTA 1WKCA 1E2HA 1JEJA 3K0EA 3ORFA 5HP4A 4PYNA 2FFAA 1E9FA 2J6CA 4HDSA 4JGIA 2A1TR 3PQ7A 3ZNPA 3M6LA 2VNAA 4M2LA 2UKDA 1E1LA 3Q9NA 3QPVA 3OEYA 3GI1A 2C2YA 2ZU6A 4B74A 3ZDAA 3UTCA 4RFSA 4HUJA 3V4VB 3ZDRA 3X3HA 3IUPA 4GPIB 2XWJI 1F1JA 3JYLA 1WJGA 1XVIA 2IXTA 2Q6KA 1EDBA 2CDAA 1V6SA 4INJA 1WEHA 1HK7A 4BVKA 1G5IA 2R6HA 4KQMA 4NY1A 5DHUA 4V0NA 5IJ9B 2FHSA 4PC3A 1QF6A 3K0FA 1CB0A 2OQ2A 4LQLA 4GT1A 4G0OA 3ELYA 5LZ8A 2R7MA 1LV8A 1K68A 2DWOA 3OP1A 3QKSA 4CEHA 3OCVA 4F72A 4QT4A 1LF0A 3N8NA 1TEXA 2ADFA 2NV6A 4C0WA 3RQSA 5HQTA 3LX5A 1AG9A 1Q92A 5KQRA 1VJDA 5EMKA 1GGHA 4BMVA 2YBDA 1YRAA 4UOQA 3JAWA 1FFYA 1Q22A 2JGJA 1M0WA 1GRQA 1XDGA 1GLNA 4HPJB 4HPXB 1ILWA 4RDCA 3H3FA 3H1AA 1Y8RB 3AIIA 3FPEA 2H08A 4JC4A 3THYB 1JEEA 4K3VA 5E6RA 4FQ5A 3AP1A 5D1NA 2WSBA 2RHTA 4K6KA 3RSCA 2V6MA 3U62A 2V7QA 5EWLB 3W2TA 1L5WA 3BULA 2RHOA 4OXXA 1X74A 1Z39A 1NATA 1P2TA 3WAJA 4M99A 1MP0A 1V2HE 1ZNWA 1WS6A 2ZRMA 5LN1A 3FJOA 3VOSA 5FP0A 5IEJA 2OHFA 1PR4A 2HNAA 3ABIA 3RYTC 1Q7CA 1FTSA 1BVRA 2ES4A 2IX9A 3GOHA 3L0YA 4X91A 4E3ZA 1JHOA 4JI0B 5I7SA 4OUKX 3U37A 4GMDA 3DV2A 4QFMA 2NO5A 3TOXA 1EFAA 1PVOA 3OH8A 5A05A 4RUKA 2ETXA 4MI1A 4WASA 4OQDA 2A6PA 3NG1A 2FNAA 3DA8A 3EDYA 1CC1S 2PQ6A 3HJHA 1V3UA 4IDOA 1XMPA 4EFKA 3PWZA 4ICIA 4DYVA 2A0WA 2BCJQ 2PGIA 5ETJA 5HQ3B 2IWHA 3ASZA 3LY5A 1MJFA 4GSLA 3UJPA 2G4LA 1VMIA 2ILVA 1P72A 2HCJB 3RROA 3PE6A 1YR1A 4MWCA 3M6WA 3QMMA 4UNQA 4CM5A 5A4JA 1B4DA 1TGYA 4DA7A 2Q1TA 3FB1A 4QTTB 5JNSA 1SQGA 1KBZA 1N75A 2HU5A 1BW9B 1DBQA 2O0LA 4AWAA 3RUPA 3MT0A 3TRKA 1YR7A 4YAEA 3FTCA 4F06A 3PVCA 3LCMA 4BEBA 2NM0A</