3E23A

Crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
b'QAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGRPVRTMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLHVSVRKPEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein RPA2492
publication title Crystal structure of the RPA2492 protein in complex with SAM from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR299
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 66
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e23A00
2FCAA 2P3LA 3KR1A 3FRHA 3SSOA 4C08A 4G56A 1VIDA 2OBFA 3I9FA 3B3FA 1XXLA 2OYRA 2VP3A 5CCXA 4E2WA 2IDJA 4BLUA 3U81A 4KIFA 3GXOA 4CWAA 3EVFA 5G02A 5DWQA 3TKYA 5EHIA 3P9KA 3EVAA 1AF7A 3HCAA 1BC5A 5EIFA 5FUBA 5GM1A 4CTJA 2PX8A 1D2HA 4ER5A 1YF3A 2GPYA 5DM0A 2VZ9A 1M6EX 1Z3CA 3G5LA 2PX4A 5FA8A 2C7RA 1RI2A 3KHKA 3PS9A 5LQKA 4C04A 3TM4A 2AVDA 2FK8A 2VS1A 3JWIA 2PV0A 3HNRA 3HA3A 2I62A 3ID6C 2JHAA 3REOA 2ZSUA 4QPNA 2G71A 2ZCJA 1BKYA 4KWCA 7MHTA 3G2OA 1D2CA 5DSXA 2F8LA 2YXDA 2QM3A 3IEIA 3S68A 5EGSA 5T64A 1EAMA 3G7UA 3TFWA 2H00A 3DUWA 1SKMA 3DXYA 4RTPA 4HSGA 2AZTA 1JTFA 3OZSA 5E9JA 5ICEA 1NW3A 3A26A 3DOUA 2ZULA 2QRVB 4FS8A 3FZGA 4PIPA 3DMFA 1MHTA 5DRTA 1KP9A 1I9GA 2BZGA 1RI5A 2P7HA 1ZGJA 2BR3A 3CBGA 1JR4A 1XDZA 4HRAA 3G89A 4CKEA 2ZWVA 5GINE 5E1BA 3TRKA 1B42A 4RVHA 4XUEA 3TOSA 3EMDA 2H11A 1KR5A 2HTEA 1ZG3A 3PB3A 4EK9A 4HC4A 3B5IA 4E32A 5KQSA 2P7IA 5CVJA 4PCLA 2CMGA 1RJEA 3FUVA 1NE2A 3LDUA 4PYNA 4RTOA 3LL7A 3M33A 3NVKI 2P41A 4RTSA 3KQPA 1U2ZA 1YUBA 1PRYA 3MTEA 3OFJA 4F85A 1VQ1A 2V74B 3MCTA 3PX2A 5BW4A 5K09A 1RI3A 3BWYA 2HR1A 2I7CA 2BR4A 5DM2A 5ICFA 4CTKA 3ELUA 4HTFB 2NXCA 2OB2A 4QPPA 1KPIA 1X1BA 1T43A 1X1DA 5GIPE 3MQ2A 3HP7A 4GOMD 3BUSA 5DTRA 2PXCA 2Y1WA 4DKJA 1P1CA 5FULA 1JG2A 1TPYA 2AVNA 3B89A 3DTNA 3ME5A 3EMBA 5DPMA 2JHPA 5FA5A 3DMGA 3T0IA 1KYZA 4AZSA 1G60A 4E31A 4MHTA 3EEOA 1NW8A 2NXJA 2B2CA 4A6DA 3TMAA 2FYTA 2V7EA 3Q7EA 4DZRA 3HCDA 3DR5A 5GWXA 2JHCA 1JQDA 3GRVA 4EKGA 2AN5A 1VPTA 3C3YA 4ER0A 5BW5A 2ERCA 2PLWA 2VDVE 3CC8A 5DX1A 2JG3A 3G8AA 3B3JA 5K0CA 4JXJA 3KQWA 1NW6A 1WZNA 5EMKA 2Z6QA 1WG8A 4RTQA 4YUXA 3AXSA 5K0GA 5CVDA 2HNKA 5HZMA 3FTCA 4RTLA 3A27A 5BXYA 1SQGA 4MIKA 3KR2A 4WXHA 3P2IA 2OXTA 3KR0A 3G2PA 5EHGA 4U7PB 3CJTA 2GB4A 2YX1A 5FADA 4GC9A 5EPEA 4GBED 1XVAA 2JH8A 4PYQA 2XYQA 4FSDA 4XUDA 5E9WA 4P7FA 2FK7A 1YB2A 1KPHA 4OBXA 5P8WA 1AV6A 2FRXA 2P40A 3FUXA 4QDKA 2NXNA 3LCVB 4BY9E 3HA5A 3MGGA 3BGVA 2YXEA 4IWNA 1VP9A 4CKCA 1N7IA 3ANXA 5KS2A 4RWZA 2ONYA 1RJDA 2XYVA 3AJDA 3O4FA 3OE5A 5DTQA 2PGXA 5F2KA 5H02A 5C0OE 1SUIA 3HCFA 3UJ9A 4LECA 3VSEA 1KPGA 3HM2A 4RX1A 1BOOA 1UIRA 4Y2HA 5ICCA 3MERA 1R18A 2ZBRA 3NDJA 4HG2A 4QQNA 3BKWA 5F2NA 1JSXA 4C05A 3B3GA 9MHTA 2AOTA 3ORHA 1JG3A 3E7PA 1L3CA 3L8DA 3NDIA 3LCCA 8MHTA 2OO3A 4DCMA 2ZVJA 1V39A 2CL5A 3KPJA 3THRA 5E1OA 3UJAA 5LQJA 4L7VA 1M0EA 4RSRA 1O54A 1VL5A 3O7WA 2Z6UA 3HTXA 2GLUA 3NMUF 4KVZA 1P91A 4MQ4A 2FPOA 4PGGA 4PINA 5HIMA 4E2ZA 1Q0SA 2IIPA 1RI1A 1O9HA 1ZKDA 5DT2A 2ONZA 3P8ZA 2ZW9A 1WXXA 1KYWA 3DXZA 3R3HA 5DSTA 4E30A 5C9ZA 2KW5A 3EVGA 2UZ4A 3Q87B 4V0RA 2G70A 4E2XA 3SMQA 4DF3A 3PVCA 5T67A 4PYMA 5HFJA 3TQSA 5IKMA 2BM9A 3E05A 5EQJB 2N47A 3GGDA 4EKIA 4AZTA 1M6YA 2B9EA 1F3LA 1HNNA 2QE6A 3OU7A 4GC5A 3ER8A 3PLAE 10MHA 3FPHA 2ADMA 1RJFA 3GWZA 5E8JA 3KPUA 4YUVA 5JR3A 1YFJA 2EFJA 1EJ6A 3FYCA 3MCZA 3TPZA 3A7DA 2CMHA 5DLYA 5EG5A 4M7RA 2ESRA 4U7TB 3G2MA 4FR0A 1NBHA 4QQKA 5FWAA 4FT2A 4OA8A 3JWJA 5K01A 1QAMA 5ERGB 4X60A 3OE4A 1KXZA 1QAOA 2XVAA 3PT9A 3P9NA 2YXLA 2EJTA 4GF5A 2QY6A 3BWMA 3HVJA 3FUUA 4YV2A 5HILA 3ERCA 2I6GA 4E33A 5K8VA 4KDCA 3GU3A 3UJDA 3VC2A 1IXKA 3UJ6A 3LKZA 4AX8A 1N7JA 5CCBA 1VP3A 2IBTA 2NP6A 5K0FA 3UJ7A 1R6AA 4FP9A 2JJQA 4PYJA 3ELWA 3JWGA 1ORHA 1SVUA 4RTNA 2B25A 2AOWA 3ER9A 3BKXA 3R6TA 3SSNA 3EVDA 2PVCA 3KQOA 4ATNA 3GRRA 3FPGA 2XVMA 1L9KA 2UYCA 2EJUA 5FQOA 3OZTA 3OPNA 3ELDA 4YUYA 2G8NA 3HA7A 4PYIA 3B7PA 3VC1A 2R6ZA 3LECA 3HVIA 4FGZA 2BR5A 1NBIA 5K05A 3LGAA 4PYLA 5FWDA 2YVLA 2NP7A 1WY7A 2XYRA 3DXXA 1AQIA 2GAFA 4O29A 5DTMA 3GRUA 2WA2A 4PONA 5FCDA 2AOUA 2O0LA 5KQRA 5DXAA 1KIAA 1H1DA 4HGYA 2IFTA 4IV8A 3PFHA 1XJ5A 5DX0A 1G8SA 3KR9A 1SQFA 2PJDA 4PWYA 1XTPA 1YZ3A 3UWPA 4IKPA 2YTZA 2GS9A 2WA1A 3EVZA 4AZVA 1WXWA 3TLJA 2PX5A 5LQAA 5E1DA 3UZUA 2NYUA 5K0JA 3FPFA 3FPJA 3FUWA 5C1IA 3RODA 5M5BA 2IH4A 1I1NA 2I9KA 3GRYA 5EOVA 2PSSA 4LWOA 3THSA 5MHTA 2YR0A 1VLMA 3EGIA 3FPEA 1G6Q1 3EGEA 2AOVA 1I4WA 3NJRA 4KRGA 3HEMA 1ORIA 2YQZA 4DQ0A 2CKDA 2OKCA 4EVIA 5BP7A 1TW3A 4RVDA 3KQMA 4ER6A 5B1SA 2ORED 3BWBA 5K0BA 3R9XB 1P1BA 3KU1A 2C7PA 2PT6A 3G5TA 4XUCA 4H0NA 3PTAA 3ELYA 3X0DA 1EIZA 3C6KA 2ZIGA 1R8XA 3EVEA 2AOTB 3KQTA 4LG1A 5E2BA 5EEHA 1OR8A 3F4KA 3OZRA 4RVGA 4QVGA 5E1MA 1EJ0A 2YUIA 4X61A 5F2OA 4PYKA 2QYOA 4PIMA 4XCXA 2ZZMA 1DL5A 3LBYA 3GNLA 5D1NA 5E2AA 5HIIA 4RVFA 1Q0TA 2HV9A 3MHTA 4ISCA 2IH5A 1FPQA 4CXMA 4R05A 2BM8A 2OB1A 3JWHA 1R00A 3QOXA 1XCLA 5KYGA 3E8SA 1QAQA 2UYQA 4Z2YA 4C07A 5FQNA 4FSXA 4DCGA 2P3QA 1EQAA 4P58A 5CVUA 4YV1A 3SX0A 3MB5A 4BP1A 2PKWA 5CIYA 3BGIA 1P39A 5FHQA 2AN3A 3FTDA 2EX4A 3NW9A 4PCAA 5EZQA 5K0LA 2ZWAA 2O06A 4MWZA 1KHHA 3EVBA 2PWYA 1AQJA 3C6MA 2OPBA 4FZVA 3P97A 3DULA 4R8RA 4KIGA 4C4AA 4HH4A 3RIEA 3T7TA 3UFBA 4OX9Y 1XCJA 2E5WA 2HMYB 3LHDA 1ZGAA 3A4TA 1O9GA 3T7RA 4YMHA 3P2EA 3LBFA 4V0QA 2ZZNA 2G72A 2ZIEA 2IGTA 5DXJA 1HMYA 3LDFA 3SGLA 4R6WA 5CD1A 3NWEA 5LQCA 1VE3A 5GP1A 3SR4A 4OQEA 5CM2Z 1ZQ9A 3M6XA 5EKUA 3A25A 2WK1A 5GM2A 4CKBA 4ER7A 5LQUA 3BT7A 3HCEA 1L3IA 2FHPA 4ER3A 3IHTA 2P3OA 2OZVA 4GQBA 3HVKA 3OCJA 3R24A 4OQDA 3IV6A 3HCBA 1JTEA 2P8JA 4AUKA 2IPXA 4B17A 4GOLD 1ZHFA 3M4XA 4RTKA 5T6BA 1D2GA 2GA9A 1IM8A 3BZBA 3P2KA 3FYDA 3CVOA 5LSAA 3TKAA 1QYRA 1R8YA 3KKZA 2Z6AA 4YMGA 1FP1D 1YZHA 4QDJA 5GIOE 4RV9A 2DPMA 4C06A 1L3BA 1UFKA 2ZBQA 3E23A 3LSTA 3P71T 4M37A 1JG4A 1NKVA 3SM3A 1YFLA 2ZLBA 4X41A 5K0NA 3BGDA 5EMLA 2O57A 5DX8A 3EGVA 3LX6A 4P7GA 3AWIA 3O31A 4BLVA 4E70A 2IBSA 1XDSA 4GOOD 5EKXA 2VDUE 3A7EA 4E2YA 4RTJA 4K6MA 4EQZA 3K0BA 1EG2A 3CKKA 1FBNA 3DP7A 3NTVA 5EMMA 2JH9A 3AY0A 1N2XA 2AOXA 2PT9A 3UA4A 2A14A 4BP3A 1RJGA 5HIKA 5JUWA 3I5UA 2AS0A 4R8SA 4C03A 1X19A 1MJFA 2K4MA 4YUWA 5K0EA 3G2QA 3EPPA 2GH1A 2QRVA 2BH2A 2IH2A 3BXOA 5DRYA 2O05A 2AN4A 3M70A 4YUZA 3UA3A 3R0QA 3CJRA 1NW7A 3HVHA 1XDUA 4RYLA 5EZSA 5D1HA 5FHRA 1JQ3A 2PXAA 2AOUB 1NV9A 2B3TA 2H1RA 1JG1A 1UWVA 3KQVA 3T7SA 4A6EA 3H2BA 1G38A 3FTFA 4AZWA 3UJ8A 2C7OA 1X1AA 2ZBPA 1TW2A 3GCZA 3UBTA 2IP2A 1WS6A 3LCUA 3CJQA 4R6XA 4GEKA 2B78A 3I53A 1F38A 5U4XA 2R3SA 5EC8A 1JSZA 1X1CA 4POOA 4F84A 4M38A 2ZTHA 3NWBA 5LR6A 1R74A 2OY0A 3EVCA 3SVZA 3QV2A 2PXXA 4RTMA 1FP2A 4HTFA 2Q41A 3HCCA 3M6WA 4FT4A 5IH3A 3C0KA 5E9QA 1L1EA 5DM4A 1PJZA 3GDHA 3LPMA 4X1OA 2HWKA 1Y8CA 5EMJA 3UJCA 4OA5A 3VYWA 2Y1XA 3GO4A 3GIWA 3EEYA 3C3PA 3DLIA 3FTEA 2UYOA 4EMSA 4MTLA 3I64A 5EIWA 3V97A 1SG9A 3OFKA 2O07A 3D2LA 3MTIA 5ICGA 3P9IA 3QOWA 4PNEA 5LQRA 2C7QA 2G1PA 2ZFUA 4KW7A 4PYOA 4RTRA 3DMHA 2PBFA 3CCFA 2PX2A 3OU2A 3G8BA 4QTUB 4X63A 4DA4A 3CGGA 1QANA 3I58A 3WSTA 4QTTB 4GOND 5E8RA 4DM3A 3KQYA 3TR6A 4HGZA 4WVLA 3G88A 3V8VA 4F86A 1NW5A 4PGHA 5GOZA 1BHJA 4OBWA 2NNWB 2EG5A 3DLCA 4P7KA 5DM1A 3DH0A 5EVJA 5HIJA 3PFGA 1DCTA 3KPYA 2CWWA 3SXJA 3LDGA 5EEGA 4M36A 3LKDA 5HEKA 2XBMA 4LWPA 3KQQA 2VDWA 3GRZA 3M6VA 5LQNA 4NECA 3OU6A 1DUSA 2NXEA 2PWPA 2P35A 3AXTA 3K6RA 4Y30A 2LD4A 1JQEA 1IY9A 3KPWA 1G55A 1NV8A 3KQSA 1INLA 3TM5A 4DMGA 3P9CA 1SUSA 3FUTA 3PX3A 2ZIFA 4UOEA 1G8AA 1VBFA 3FRIA 4GUAA 4P7JA 2IDKA 3RW9A 5K03A 5HOQA 1QZZA 3KPVA 3BWCA 2AR0A 4ZTBA 5FTWA 2P1DA 4BLWA 1FJXA 1RI4A 5CVEA 2UYHA 3NVMB 2DULA 2ZZKA 5KVAA 3MAGA 1NT2A 5CVVA 3UJBA 3GJYA 3IYLW 5CUQA 4QVKA 3SSMA 4KDRA 3M6UA 4IV0A 4YV0A 2PY6A
chains in the Genus database with same CATH superfamily
3PC7A 2Z1DA 2EF1A 2H2GA 3IT3A 4D3YA 4C08A 4G56A 5ALKA 2AK3A 3CLTC 3QVKA 1BFUA 3W1WA 2WAYA 1RPZA 4QRDA 5DH9A 1TCCA 1HDZA 1MO6A 1ZS9A 3BF8A 4B4KA 1Q2UA 5JAPA 3EX7C 2C4MA 3WFJA 4RDIA 3O92A 2HCJB 2XX3A 4UVGA 1NF3A 1A7JA 1OOEA 2C9DA 3AG5A 5KYYA 1E6EA 4ALNA 4UD6A 4EA7A 5LOVB 4QPJC 4FR5A 4GPIB 3E81A 2C2GA 4ER5A 4U7FA 2VA9A 4YO7A 2VOEA 4WNCA 1E3DA 2XADA 5DNEA 3THXA 2P4SA 2C7RA 1J06A 1JZQA 2O7QA 4G1BA 1ULTA 5AVUA 4KQCA 3HABA 3FZYA 4A8JA 4JMLA 1WMEA 1JIKA 2J0UB 2ZSUA 3RVQA 4Y2YA 1CP2A 4DMLA 1I8TA 2ZZNA 2PH3A 1ADYA 3PWSA 2F8LA 2FLWA 3WLAA 3A1FA 4W1QA 3WGGA 4LF8B 4PXAA 1B76A 4CL3A 1XD9A 2SNIE 3OQBA 3IL2A 4YRSA 3SU8A 3BMNA 3TRFA 3LSYA 1NF8A 4YPOA 3LI2A 3Q9UA 1EX7A 1TAQA 3DBRB 4Z4IA 2O2GA 1MF7A 4K6GA 1N6LA 3JAMA 1VCHA 2W2NA 2YV4A 5B1IA 4IUDS 3RS7A 3PC2A 1KY3A 4L8WB 4M88A 1TIBA 4H6XA 1PV1A 2BJWA 4UBOA 4BBAA 1GAXA 1JAZA 4ZARA 4NU8X 3EMDA 2AX3A 2JCXA 4YP7A 1G5RA 4M0PA 1FMJA 1WULS 4S1PA 1AOXA 1C14A 1CUJA 1L7QA 4BQNA 1PT5A 1IN7A 5EVCA 1ZEJA 3RC9A 2ONKA 2WD7B 4FKBA 3MAAC 2W6ZA 3KEMA 4U2DA 3K30A 3W2HA 1Z6GA 1XRMA 2BW0A 1U2ZA 2VN8A 3K31A 5CD1A 2GF0A 5DM60 1DEHA 2XUIA 5LIRA 3G17A 4BZWA 1W35A 1XBTA 3OOSA 4OXYA 1XKLA 4YJ3B 3U3MA 4CGZA 1O97D 2A94A 2IXDA 1IYZA 2PU7A 2DBQA 4DCOA 3WGIA 3PC3A 1T9DA 4YJ3F 1E7YA 3M34A 1NLZA 1HTWA 1SO8A 4WDQA 2VNAA 1XJQA 3DKIA 4B80A 2PYIA 4HWPA 4O5AA 2Q8NA 2GT1A 5FIUA 2DLDA 3UAOA 1P29A 1X3SA 4WK2B 2WSBA 1VPTA 2XT9A 5K20A 1JHAA 3SNHA 1H0KA 4EJSC 3N8NA 5AJXA 2C07A 1AHHA 2LKDA 1NG1A 1YR1A 1H22A 4KX3A 4PF1A 2PDAA 4J0HA 2RCNA 1LY1A 3FTQA 1YBFA 2QOEA 3DVSX 4KPGA 4LDRA 3UCFA 2ZB3A 3RYIA 4DA8A 1DCFA 3CT6A 2GJKA 2CD7A 1Q91A 1S2GA 1UF9A 1U7UA 2OP1A 3TCXB 2HRZA 3TMKA 1POXA 4PZ0A 3SDBA 4D0LB 4BMZA 2O2ZA 1A4RA 3CX7A 3MAJA 4GPZA 1CHDA 2WINI 1LX6A 2DFVA 2VJQA 3OX4A 1AQYA 2J85A 2B0CA 1KEKA 3L0BA 4DDKA 4ERNA 4GBED 2WTAA 3MMSA 3DC2A 4I50A 3CRMA 4Q34A 4C0WA 1KPHA 3IKTA 3LD9A 1WNFA 4ZHQB 4GI5A 1ZCJA 4I5EA 4UE2A 1QQAA 1JE1A 5FO1A 121PA 6ABPA 3DVRX 2YXEA 4GI1A 4KYUA 4JP5A 3QITA 4M83A 2RDMA 4R1LA 1IN4A 4JI1B 3F49S 3UV7A 4D9MA 1M33A 4LZOA 1ZD4A 4UEKA 4DLKA 5BQXA 2DLCX 1RJDA 1W9HA 5F2KA 1PWYE 1SPXA 3R9XA 1CIJA 4G25A 3K9CA 3KVNA 1CUUA 3TQHA 2C5GA 1BOOA 3K71B 4HPJB 4Y18A 1PI3A 3NDJA 4Q7LA 4RD1A 4B4DA 4BECA 4ZO9A 3N5CA 3ZQ6A 4UAJA 2FZ5A 2VJLA 2FFAA 1L1RA 1UOQA 4R1PA 4M0KA 3VZPA 4BO6A 4MPTA 5KDLA 3W8DA 3F73A 3H8WA 3UJAA 4C0KA 3TTXA 1CNEA 4L7VA 3KOYA 3VR4D 3KCNA 1M8FA 4QM7A 1I5OA 4OI4A 4DG8A 5J63A 3QG5A 3ZHSA 3RRJA 5IZ4A 2JLAA 1K9VF 5JD3A 4MLZA 3SICE 1RRFA 2H4ZA 3LDAA 1DBWA 2DPHA 2QTCA 3PQDA 1LSJA 3EYWA 3VR6D 4ZAWA 1P81A 3P27A 4D46A 2UZ4A 4UQOA 1XNRB 1B8UA 1RQRA 1WB4A 3MT9A 3PVCA 4DDUA 4CL2A 2W37A 4CTMA 3TQSA 1RM5A 2YHSA 4BL5A 1UOEA 2Z8ZA 2CYCA 5IJ0B 1F3LA 3RT1A 4MHOA 1OKKD 1N6IA 1PEKE 3I39X 4JKYA 3WOHA 5KSYA 4YVFA 2QSUA 2ZRCA 4EFNA 2NU8B 3ZU4A 1V3VA 1GCGA 1X9HA 4EUKA 2IYQA 4UOQA 4XGNA 2IWHA 1NRIA 3F6EX 3G2MA 1G3UA 2UVPA 5CJPA 2V5UA 1BDJA 2WR8A 5FBLB 3O38A 1U0GA 3EGOA 1U0JA 3I1IA 1TYAE 1OAKA 1QOQB 4TWAA 2H18A 1Q19A 3VISA 4EGCB 2WUEA 1BX0A 2YQ5A 4LY0A 4OHPA 1TB4A 2XITA 4HV4A 1BEUB 3URKA 1AB6A 1CJKC 2GARA 4DV6B 3UHJA 1EBFA 2BFPA 2H4HA 3GFFA 4QNMA 3EIHA 3FOFC 1LLQA 2E4XA 2XIQA 4GD3Q 3I52A 3LY9A 2H2AA 1T36A 2X8JB 3AKCA 3ABIA 2X7HA 2C0CA 3DE3X 5BSFA 2A1UA 4PANA 4XVQA 3T3PB 1E3TA 2AFHA 3ZX5A 5EIXA 2WB2A 1IOVA 3RTBA 4DLPA 5B7GA 4TQAA 1N1EA 2WILA 1NFFA 1XZQA 4MR8A 5F5XA 1RM0A 3BZUA 4AJ1A 1W76A 3V8PA 4MR7B 1GRVA 5KTNA 2ZSBA 1SVOA 2ALJA 3PWTA 2GKGA 1O95D 1C3VA 2D06A 3OPNA 1NURA 1C7RA 3ND7A 1E1QA 3JAWA 1E89A 2GYYA 1X74A 2G0NA 4FGZA 5CMLA 1TAHA 1DUVG 2X2PA 1EFHA 1ZC4A 4WLVA 3TTTA 1K0UA 5A7GA 2VTVA 1LZLA 4I1IA 2H06A 1ZUWA 4M9CA 3AEXA 1ORDA 3RG2A 5FCDA 2JW5A 3TLZA 4BGDA 4F6CA 1B8OA 1KIAA 5BRNA 2NSYA 2IU3A 1TF2A 1TCUA 2A30A 2PR7A 3AF2A 2C8VA 3HRIA 3DFFA 3MTAA 4TLBA 3ZTYA 3ZIAD 5AHRA 1WHTB 2LP4Y 5THXA 3WR5A 3SIRA 4EYEA 3U3JA 3BXXA 5I6DA 4YRQA 2YS6A 4UMDA 2JAPA 4AL4A 4BJ5A 4EG8A 1PYGA 4DMFA 3UB4A 2YR0A 1NL3A 2OL4A 2WE7A 3VZQA 2PE5A 1A2OA 2J4FA 4JI2B 4E7PA 2Y9MB 3TOZA 4IDBA 3VAZA 4CI0B 4KUHA 2QUHA 4X1YA 2XXAB 1WQ1R 1EHCA 4O59O 2YYAA 1SKQA 2HCBA 3H05A 3OLYA 4EJ6A 1WF6A 2HD4A 2SHKA 5AVRA 1JKMA 1QVZA 2DPYA 5JYDA 4WCFA 2BP7B 1EM8A 1QRRA 1SBCA 1XJWA 2IYUA 3H9EO 3V9AA 4CUZA 3FBTA 2QIOA 4D9HA 1R8XA 4YMVA 1X0XA 2OGTA 2XBUA 4BNXA 4FN5A 3KTAB 4FS3A 5K8IA 1UJ4A 3EULA 2HF7A 4QBHA 2WF6A 3KEGA 5DCWA 4BP8A 1UP6A 3Q1KA 4LTDA 2ATXA 2M6RA 2ZUDA 3CZAA 3RUPA 3SS7X 4FZJA 4CKWB 1JPJA 1VSVA 3HR8A 2CVPA 1CUEA 3GUHA 5JDIA 3ET4A 4ISCA 1PL7A 3AIIA 1NT4A 3NCHA 5EMNA 5I7FA 2BONA 1XJCA 4C0LA 1PEAA 3QOXA 3DP9A 2D3TA 3ESDA 1W5EA 3BGSA 4LNHA 3Q8WA 1QAQA 1Y3AA 2FDRA 1Q0HA 1Z8HA 4KI0A 3W5VA 1ONSA 4EUEA 4YV1A 1K5GA 3LT5A 4HOYA 4ND2A 5M2QA 5F35A 4WKGA 2JIPA 4JJ7A 3JVUA 1KHHA 4E1VA 4PE5B 4RS3A 2TECE 2WIJA 3T35A 4EGAA 5CITA 1PVOA 1CUXA 2CL6X 1FIUA 5ECYA 1V1MB 2XJ9A 1UFRA 3FZQA 3ENVA 5E0KB 2E5WA 2OCGA 4QC2A 4L50A 5CHYA 4EYOA 3X1DA 2DERA 4M55A 2JFVA 1UMKA 2YWJA 1I6KA 3OECA 2VSNA 3K9WA 1U0RA 4V0MA 3AHDA 5TMEA 4U4AA 2R00C 1JEAA 2NN3C 5T41A 3NWEA 3WYBA 2X77A 3L0ZA 1S8NA 1TA9A 1DG9A 5KNBA 3E7FA 2ECOA 1T8RA 3OF3A 4JYCA 3ZWQA 1TKBA 3VSAA 1GQFA 3AVOA 3JQQA 2OZVA 3W5DA 1FRQA 2GTPA 2LUOA 4I55B 1U2DC 3UGQA 4NU6A 4B17A 3LOQA 5H80A 1OLXB 3Q41A 4YHBA 1XFAA 3PEVA 4JJ4A 1OH6A 3UM9A 4I55F 5GVRA 5CGZA 3QELA 5IAOA 2ZVDA 4U0KA 3P2KA 1N57A 2JIZA 3CVOA 3ZDEA 1JA1A 1GPYA 5AQEA 4U2FA 2BTOA 4EVQA 3RVNA 1VKNA 1N8SA 1RRMA 4FFOA 5KJCA 3C45A 1FNCA 4DT1A 4KO8A 4M7PA 4RHFA 1NX6A 1J09A 5BQOA 5EXXA 3ZW8A 5ABPA 4U7DA 4YMUA 4UASA 4PV7A 2Q7DA 3HGMA 1IXRC 3LLUA 1PNQA 3BQMB 4NDAA 3REGA 4DMRA 4K6MA 4OJQA 4AG6A 1EG2A 1TQ4A 3KXDA 4HMQA 4BP3A 2D4HA 3IAM6 5EJ9A 2JD2A 1RNLA 1T2VA 3KJZA 2FWRA 1G4AE 1J99A 1TE2A 2VXBA 1HT1E 2EVWX 3BGWA 2IYZA 3A4LA 3L06A 4FCCA 3FNFA 4J6EA 3HKEB 4B3BA 3T41A 1TKRA 4IZ6A 4AULA 5IXSA 1U2SA 4ZGGA 1TAGA 1D6SA 1M34A 3PSHA 3H9JA 4R40A 1TT5B 2AWNA 4RYLA 1KSFX 4BNMA 4Q1EA 5DB4A 4L4UA 4LV5B 5E6RB 5K3AA 5BW6B 2Z83A 2XTAA 2Q4DA 4GKVA 1QFYA 4QGBA 9GPBA 2MOKA 5A5GA 2LIPA 2VTEA 1Q77A 3IP3A 4HCJA 3EDRA 4HR7A 2PEYA 3GFBA 5LD2C 2UVQA 2NUTB 1KVUA 3HUEA 3O8RA 1MC4A 2IITA 3EXG1 5ALSA 3FMOB 5HVNA 3UT5A 3RUDA 4XWOA 4KWHA 1KK2A 4UE3S 4Y2JA 1TJ3A 5IT4A 5IWCA 5A62A 3HLKA 1RKBA 4IH4A 1PBNA 1JFFA 2AZ4A 1MOQA 3VR5A 3QG1A 5KPJA 3MUNA 3BMXA 4MQMA 3QUCA 1H23A 1L5MA 3GDHA 4RY0A 2ZXEA 3E9DA 2HOQA 2Y1XA 4QXRA 1Z08A 3C3PA 1RRGA 1H2XA 2QZPA 4JHLA 4K3UA 4HLDA 1RVV1 4Q7MB 1JJIA 4TVSA 4AJ2A 1PS0A 4UVDA 4IWXA 3K3PA 2IHJA 3C8DA 4IDAA 5FEMA 4BNYA 2PRKA 1NUTA 2ZUUA 4MCAA 4UUPA 2CV2A 5JJLA 1P3Y1 3B6KA 4TL6A 3IKMB 2ZIVB 4V2IA 2II6A 1NW5A 2E7ZA 4IICA 4L2IA 4XI9A 2CD9A 3DDUA 4A8JC 5I7VA 3H0EA 1PJRA 2DHDA 1XJ0A 2GA8A 4GP9A 2XA2A 2QMHA 4IYRA 3ZHOA 1XTVA 4AJNA 4BWYA 4CM4B 3LDGA 1CSEE 2WM3A 1DX9A 3MS7A 5HEKA 1DAHA 3CBQA 4LWPA 1M2GA 4NECA 3W3AD 1EH5A 4J3NA 3TTYA 5MGNA 2D1RA 4MRVA 1H6CA 4Y30A 4ZCLA 3UMVA 2JI4A 3HB9A 1ODFA 2EKBA 1H8HA 4Y8VA 1H4QA 1JEJA 1ZD5A 3ZVMA 4CKYA 2QTLA 2V55B 3L04A 2VDLB 4LJ7A 3AF3A 3SF8B 3PXDA 2NT4A 2CV0A 3GGJA 3W9BA 4BO9A 3IPYA 1NE7A 3N8IA 4MS1B 3OT5A 2FAXA 4K9MA 1HSOA 3AF5A 4BCDA 1SB8A 3OFND 5ESWA 1PJLA 4ZVPA 2VT6A 4M8NE 3PEEA 4DCUA 1UT5A 2QR2A 3C39A 1JR6A 3C3KA 1MU0A 4FHFA 3MGCA 1S02A 3NVMB 3PNKA 4ME6A 4BJ6A 3ZJVA 1YZUA 5EZYF 4TKVA 3MAGA 4INOA 5JS8A 3O3MB 5EZYA 4KDRA 2XKJE 3HKCB 3H3JA 4Y1EA 1W6RA 1K97A 2WG2A 4CU2A 1YCHA 5BN1A 1VC2A 4RWEA 3U5ZB 2C4KA 4RKYA 5BVGA 2XNKA 4OGWA 3THWA 4QOHA 4P38A 4UU1A 2NZXA 1G4UR 4LPKA 5FO0A 1HA3A 2WRZA 3DWIA 5G0VA 4DANA 4W9MC 3ZE8A 3EA5A 5G02A 4DZZA 1ZI8A 2Y05A 3O8QB 9ATCA 3HU1A 4CTJA 1L8OA 1MJGM 1GPLA 1TVEA 2FWMX 2PT5A 2YRFA 1AKWA 2AXEA 2Z4RA 3L8ZA 2Q2VA 2AL7A 7GPBA 3D8RA 2EJVA 4GM0A 1GARA 5LQKA 3E2PA 2G07A 1SG0A 2ARKA 2I62A 3ID6C 3GLGB 1IHOA 1C1XA 2PZGA 3W5JA 4JXXA 3ZLVA 2ZCJA 3QENA 2YHAA 2YMQA 3ER8A 4OO3A 5JROA 4B83A 1KH1A 3DXYA 2IVFA 2C7BA 2GZSA 3OKCA 2AZTA 2FSGA 1TZBA 1ZH0A 1MRZA 3W5HA 5SZKB 1UJ2A 5JJIA 5KAMA 5IJZA 1F8UA 1NW3A 1SUFA 1IOWA 1CNFA 1DBQA 2C5LA 2HADA 2G4LA 2HMUA 3QFRA 3B85A 2PMWB 4U6NA 4UBKA 5ALOA 1ESCA 3VBCA 1CIVA 5J2UB 2WYUA 2IZOA 5CYOA 3JQCA 1XZ8A 2R1TB 3DYVA 3L7YA 2JAXA 4FOPA 5AJZA 5EINA 1RI5A 5F12A 4D9BA 1QGUA 3SQWA 3LYUA 4HRAA 2ZI7A 4EHDA 4DCTA 1MRNA 5IXJA 2KQUA 1B42A 1S3GA 2FMHA 1KR5A 1DC3A 2H11A 5H3CA 2HTEA 3PB3A 1BU8A 4M9SA 4OD0A 2O2IA 3WLTA 4MKGA 1FYVA 3DVAA 4RMIA 2R8BA 1KQ3A 3T4UA 4YAFA 4RTOA 3G0HA 2EFEB 4ND4A 3NPMA 3MCTA 2XUQA 3BFPA 4IBOA 1E1MA 4IQ8A 1KJZA 4BUJA 4DLRA 4H77A 5GZ3A 2F3QA 3PUXA 3IMEA 3QW4B 2ZJ1A 3Q6IA 2BE9A 3E8XA 1SPBS 1RQLA 1QH1B 4Z9XA 2Q46A 1L7MA 1JAXA 1MENA 3AJAA 4NJEB 4F4FA 5IDVA 3W5BA 4A3SA 3GI1A 4TZ0A 3ZHYA 3QE4A 2J3DA 3C6BA 2JK0A 5HUQA 1KJIA 1D09A 1S89A 4WDRA 1HOXA 1UK7A 4MUBA 2P9GA 4DA9A 3NR2A 4CFSA 4Y9SA 3DSRA 2YIMA 2RAVA 5EJAA 2QXTA 3GRVA 4GVLA 2WU8A 3B6ZA 3KUDA 4JJ8A 1ZL0A 1XAIA 3OBBA 3HBFA 3NWPA 3KHUA 2PLWA 4QHSA 2GMWA 5NULA 3O4GA 2E5LB 1E2LA 1OCEA 1XEWX 3A8TA 3DTVB 1PBTA 1USGA 4X6UA 2IPOA 4H7PA 4I14A 4CDNA 2WJPA 3AB3A 2DYKA 3IKLA 3GRCA 4JVNA 1CRLA 4N7BA 3ENQA 4Z4CA 1HT2E 4EB6A 4P6VF 5BV1A 2Z9CA 2ZE7A 3QE2A 3B51X 1RKVA 1DC8A 2LXNA 1JDSA 3KR0A 5DBEX 2HA0A 2NO1A 2DWOA 2FB9A 1RZRD 3ETJA 3OT1A 1XWIA 4ZXFA 2ZRIA 3DE1X 2NU9B 2H59A 1PEDA 3P0RA 2GZHA 1EYZA 1P0QA 2XE8A 5CYFA 2JEYA 5TXGA 5L3QB 1F1JA 1RYMA 5TS2A 5AKEA 3BIOA 1RLMA 4KXYA 3K70C 2N1BA 2WV9A 4IM7A 4IH1A 3TBHA 2P40A 4QDKA 2IHBA 4NE9A 4BY9E 3TLGA 1X7ZA 1Y4SA 2ZJ0A 3MWDB 4HB4A 1T9KA 2HQBA 1L7OA 2GVZC 4QUKA 3PP8A 5K8LA 2CB9A 2D5AA 2NAPA 2J33A 4P53A 3AJDA 5H02A 1S1CA 1ZH8A 1ARZA 4TUYF 2JIRA 3FTPA 3QVGA 4E12A 5BWNA 4TN1A 5HF5A 4TUYA 1NNSA 2O1EA 4RBNA 3HS3A 5TGZA 2J48A 1EUQA 8MHTA 3AKEA 3PLRA 2ODPA 3PQCA 2FETA 2HU7A 1O03A 3W9YA 4IOKA 3UMGA 1VG0B 1WXHA 4L02A 4ZAFA 4DCCA 4HWSA 1RHMA 1N1DA 1NKTA 1UC4B 2I78A 3WGMA 1RRVA 3L6EA 3P4UA 1FOEB 3CPEA 3O4VA 1EA7A 2H52A 3A6JA 3WIVA 1PQUA 1U8TA 3FCXA 1EXMA 4ZN6A 1PWHA 2FSPA 3LY5A 3QVUA 4HDSA 3BXZA 4MUGA 3B52X 4X97A 2B2NA 2CCGA 4YP0A 4DF3A 3N2IA 3E70C 5JU6A 3ZU5A 1H9BA 2BTQB 4RF2A 4Y6GB 5TPZD 4B4WA 2C78A 4Y1RA 2B9EA 4AKEA 1M74A 4AJJA 1FFXB 2EYQA 2B69A 3N6VA 2J46A 4JBWA 5AUNB 5KYVA 3DE6X 4AJLA 2GXAA 3MCZA 1C3LA 5KYTA 1HUQA 1LJ8A 1VLJA 3EIQA 3NH6A 3ICEA 5DLQC 1V5WA 2XQVA 3HEAA 5KX5F 4GIBA 2GD1O 4QXAA 2JI7A 3WQQA 1T1JA 4E2FA 4HSEA 5CD9A 1U7XA 1JU9A 1KY2A 4AZ3B 5KX5A 3Q8MA 2EBWA 3OJXA 4G9GA 3UXEA 1WSBA 3FDJA 5DDIP 2L0XA 2G25A 3RIYA 4KR0A 4NCNA 3UFXA 1KEEA 3LCJA 2VHXA 1VHWA 2BPOA 3G1WA 1PJ2A 1Z0UA 1PGQA 2JVIA 2WMOB 1WXGA 4XOUA 4OHYA 3H19A 3IXLA 1TO2E 2I6UA 4KFUA 2YFHA 1WP9A 1E9CA 1N7JA 2O8CB 2PUEA 4XQ9A 1SOVA 1CEQA 2W6IA 1VCOA 5J4HA 1AS0A 2D54A 1HYGA 2GNOA 3EEBA 4GZ3A 1EFVA 3SM9A 4DLYA 1AHIA 2ZDHA 3K8OE 3NIFB 4H3HB 4RFLA 2JJYA 3NALA 4BNNA 4LHWA 3UNXA 1HLDA 3GRRA 2R84A 3WTBA 4ZT3A 5FXMA 2G1JA 4A6XA 4XLZA 4UHBA 4WZBA 3ST7A 2WMYA 3TXXA 4F2PA 2F43A 2R1VA 4O25A 5IAKA 4A8TA 2VWQA 4MTCA 1F2DA 5JDIC 4QU8A 3SCZA 3VC1A 1GPDG 4LE2A 3VKFA 2XTMA 1UJBA 4Y3UA 3IP7A 4G63A 1HZZA 5CA0A 3Q6MA 4QJIA 5EWMB 4DBVO 5DHAA 2ZWIA 3LY8A 3V2GA 1SBNE 1D4ZA 2GN2A 3RVLA 1HURA 1W47A 4UBIA 2XZPA 2ZT5A 1M8PA 4PPNA 4GM1A 4DRYA 3KS9A 1DAEA 2XMSA 4GNKA 4MPDA 4IV8A 3F5DA 4WZAB 3KBBA 1G8SA 1HL7A 2NYVA 1Z2NX 3PQ5A 4ETWA 2JFHA 5IKOA 2P65A 4D26A 3HCNA 1LNQA 1VGVA 2GS9A 2WA1A 4LRXA 1T13A 4JI6B 4A2QA 4D5GA 1WU7A 3E53A 4RIIA 3F3YA 3MWEA 4DM7A 1ZJZA 2JJ1A 3GROA 1W4CA 5D87A 4MJ7A 1QBGA 4I9HA 3M2PA 5LDDC 5JQGB 3TE6A 1UFOA 2I9KA 3IJPA 1XF1A 1VYHA 2X8AA 1T5DX 4OM7A 1EE1A 2WWRA 2ZJFA 4N5LA 5G4LA 2IZ0A 2P5YA 5CCEA 4U00A 3ZCTA 4YQYA 1RMYA 1IY8A 1XWFA 1Q0LA 4A0HA 4LX0A 4EVIA 4KFSA 1NWHA 2X14A 3KQMA 4IXNA 1JLRA 5DHTA 3RK1A 4Q1VA 4XFJA 4BGVA 3LHKA 3QRWA 3JVDA 4ZRNA 5G0SA 2IHKA 1OMOA 2EP5A 3B5JA 4IJQA 3L7DA 3PFKA 4XGKA 2NNLD 3UAGA 4E11A 3O8CA 3PDUA 3G5TA 3KXPA 4OF4A 4E6PA 3I12A 1KEPA 3NM5A 3SK0A 2C82A 3ELYA 3TGWA 1XDWA 2MYNA 2MIIA 3AR9A 4I36A 4M6WB 1D4FA 3DDCA 1FTSA 3DDOA 5ER6A 3KELA 3S28A 1BMFA 1KZ9A 1T0UA 1UBHS 3LBYA 2ZZMA 1L5YA 3JASA 5F78A 1EQUA 1TRHA 5K3FB 4LE1A 3C5HA 4J29A 4K2HA 1VGRA 1R4NB 1W5FA 2RHJA 4O4HA 4RENA 3VNUA 4R05A 1ABEA 2H1SA 3IB3A 2UUBB 3SQOA 3ZCSA 1ECFA 3ONEA 4MW2A 2R8EA 3HMKA 4AJ9A 2Y4NA 1E3SA 4BJHB 4DIEA 2EP8A 4DJEC 2WM9B 3FHLA 1TMGE 4HH1A 1YU6A 3GQVA 1A72A 2DY0A 2W8BB 5LZ5A 4K1LA 4N5MA 4IVNA 4B8ZA 5TMPA 5KJ6A 4PVDA 2QLLA 3F6CA 2OV8A 3IEXA 5BV7A 3LX5A 3FI9A 3F8WA 2X8WA 4R8RA 1KDVA 4AECA 2R6R1 4KIGA 5KHLB 1EGMB 3KEFA 3FSEA 4MUXA 5HJEA 3HG7A 2HCTA 2OYCA 1XMPA 1TX4B 2C2XA 4F4IA 1E8MA 1CQWA 5HK9A 3ABQB 4FCWA 1O9GA 3PTZA 4L9RA 3JD1A 3IILA 4M8SA 1W4LA 4E46A 4F92B 4AY2A 4M60A 3ORFA 4IIXA 4CDRA 1BHO1 4BZZA 1Z0IA 3BMCA 4FW8A 4PSCA 1H1TA 1SCBA 1GUFA 3IUYA 4XDZA 4OHCA 1G21A 4ZRMA 4AY4A 4D9GA 2VH2A 3R41A 16PKA 3QVOA 2FY8A 5EKUA 2BFOA 3C97A 5DMXA 4F97A 3GZ4A 3KNZA 3T7IA 1FTGA 3L7JA 4GO1A 5LQUA 5JSZA 1APBA 2K87A 3ICQB 1J8QA 3SXUA 4BATA 1JNXX 4AKHA 2JLBA 3I8SA 1KO4A 1UPXA 1U8FO 5DWDA 5KVVA 5AW0A 2QXYA 1UM9A 3M4XA 3K6SA 3M2TA 5BXYA 2IYNA 3IDFA 3OHPA 1NXVA 2CK3A 3FYDA 1LBTA 5FPYA 5EJ7A 1BSVA 2Z6AA 3GPBA 2RJOA 3F6BX 4CIDA 4I5GA 5KOJB 4DUZB 3PXAA 2G17A 2TMGA 4HZUB 2ZTMA 4FONA 4FEGA 4BWFB 3SFVA 3E23A 3EXG2 3WRWA 1HL3A 1NKVA 3G8YA 2RGAA 3BTSA 5K0NA 1JLLB 4H1UA 4H3VA 4RK1A 4AP6A 2EKQA 4Q4AB 1Z15A 4HAYA 4MWOA 4HEJA 5KTMA 4MYTA 3SKYA 1S3FA 2XUJA 2BEUB 4P7BA 1U9YA 2WD8A 4PNZA 3IEMA 3F46A 4AFNA 3NTVA 3UA4A 3QEMA 3GFPA 3FAKA 3UJPA 4O0LA 1IUKA 2H1WA 2J9FB 3Q88A 4RKWA 5BQPA 5INTA 2NLOA 3OAAD 3JVVA 4TWBA 2RIPA 5E4JA 4KODA 3TBFA 2QLTA 3RK4A 4EYGA 2I3GA 2PD3A 2QRVA 5I51A 2I9PA 3ZDBA 3BXOA 1O3YA 4ZREA 1OHHA 1QHIA 2H65A 3AESB 3KB2A 3PRJA 4RW0A 1Y5RA 2P9EA 4C6RA 1K6XA 4LXTA 3U60B 4EHFA 5JJ5A 1GIAA 3NTQA 4UFPA 5F9MA 4HL6A 1EDEA 3DLHA 1RAHA 1TW2A 1K6JA 4X94A 2YNMD 5G0TA 1BZYA 1R9NA 4FQ7A 4GSLA 2A4MA 2CBXA 3OD5A 5JFGA 4HVLA 4JUBA 1U7PA 2NSJA 1KVQA 3RQSA 5LU9A 1GG8A 1MOPA 1UXOA 1OF1A 4JUDX 5L3RA 4EUHA 3B1ZA 4PZEA 1DPFA 2VP6A 4ZVKA 4AM8A 2O0JA 3FZNA 4WCVA 4X6XA 1S5PA 3AEZA 4BBZA 4G5FA 3IJRA 3FHCB 4U5QA 4FX5A 1ZQ1A 3GVPA 4QOIA 3SN6A 1TO1E 2V9PA 2WVHA 2HL6A 4QFCA 4WACA 4Z0TA 5LLSA 4L0DA 1FDIA 1DRKA 4JASB 3SY8A 3CUKA 4XARA 4GXTA 4C6TB 3BMQB 3F3KA 1UKVY 3IXQA 4UBLA 1OPXA 1QORA 2CKMA 1TXGA 2XXBA 4PYOA 1OH5A 1S9HA 1J1ZA 3N1UA 5AXDA 3K2EA 1PW5A 3OU2A 4I1RA 4QTUB 4R0VA 4DA4A 1QANA 3Q2IA 3BBPA 5E8RA 1U7WA 2E2WA 1T10A 3TR6A 3F3MA 2INGX 1TYCA 4WVLA 5T3UA 5FI3A 3RSOA 4PGHA 3UAVA 4IY1A 1T2DA 3FR7A 4B44A 2XHEA 2Z8YA 3T54A 1Q92A 2QLBA 1R0CA 2PLNA 1KWGA 4LBWA 1EVLA 3BGOS 4NH0A 4V3BA 4KNYA 3TEFA 1PZGA 1R0BA 1T91A 2XDAA 3CZ5A 2CXXA 4QO7A 4PO3X 4YEDA 1ZN2A 2JJMA 1DJLA 1VLZA 6YASA 1M73E 4BO5A 1CDDA 2PUGA 1YNOA 1FRZA 3WNQA 1C3OA 4G4GA 4YHHB 2ZXFA 4OSPA 1UZAA 3QYJA 1ISPA 1Y4AE 3MQFA 4JX8A 2G09A 1C9NA 4KI7A 1N2JA 4G0OA 3IQDB 4PLCA 4PW0A 2KB0A 4DMUB 4R9UC 4YLGA 2ZIFA 1P0IA 3FN4A 4IEIA 3ZV7A 1S2DA 4G24A 1KIFA 4UOEA 1MVOA 2RG7A 4KE9A 3UC9A 1NVEA 2I6SA 1VL0A 2DMRA 3CKLA 3DMPA 1ZD9A 4DNOA 1CUYA 5JAZA 2ZSFA 1QZZA 2CXSA 4Q4DA 4RKQA 3OLXA 2OT3B 1GT91 1YR2A 4FB5A 2PX6A 4IMJB 3UHAA 4O02B 5EJIA 3E2MA 1KI4A 3J7AC 2RB5A 1OJ7A 2QQEA 4M1WA 3KU4A 1Z74A 4LOJA 2J09A 1PTKA 2M1ZA 4FYPA 3ULKA 1PTJC 2BBWA 4HEA1 2M1XA 4P0PB 4ZA2A 1TJ5A 3H65A 3N74A 1JSLA 2IKQA 2NVOA 1U4NA 5CJ2A 3D3WB 3RB8A 4OREX 2WY2D 3C70A 4D3DA 4NCJA 1CYEA 2GZ3A 1X6VA 4G1CA 4Q47A 4Q9HA 4QFMA 2NOAA 2P68A 3D0OA 3GPLA 3ZD6A 4Z1OA 5FUMA 1HTTA 3EVAA 4PFSA 3H9QA 4QASA 3CKYA 3L1UA 4TL7A 3F5SA 1NVGA 1X1QA 5ELXA 3Q5GA 5G0WA 4URYR 5LWHA 1R6BX 3OIFA 4F4CA 2VZ9A 1T25A 3AQIA 1G3QA 1ORRA 2ZIZA 3ZD9A 1W6UA 3TM4A 4AW9A 3NWOA 1P1FA 3OFSA 3CU5A 4L27A 4RXTA 3ZWYA 3C4QA 4CVNA 1JHXA 1QKKA 2G9NA 4Z0HO 2QW0X 3H5TA 5D3ZA 3RF7A 3UVEA 2WBLC 5AKIA 4CMBA 4DY6A 1PZMA 4ZI7B 4YRNA 4AAYA 2PAAA 5JAOA 3FSGD 4Q16A 1E6KA 3WP0A 3ZLBA 4XDYA 3C24A 3H7IA 4UNSA 1AQLA 2BFFB 4LMPA 3LFUA 1MABA 3OLWA 1YR8A 4B2YA 5C1DA 1SEVA 1ZD1A 5CW2A 1LSSA 1Q1BA 4WESA 3MT7A 4PG5A 4AMYA 2WFLA 2RONA 5B58C 4LV8B 4CMAA 4FWBA 3QKSA 2WDZA 1AG9A 4LX8A 3UT0A 4MW4A 1A9XA 1Z5GA 5ED4A 1EUZA 4NP6A 1JH8A 3A1TA 5LP6B 1EWYA 4RCZA 3I5AA 4HF7A 1IQUA 1SXPA 4OK5A 5IARA 4KO2S 4CF5A 2CMGA 3PJRA 1ELOA 1FSZA 3F97A 3GJ4A 1W36D 2YJZA 4QUBA 5IW8A 4R0MA 3MIIA 3SC6A 3P9YA 1VA5A 4MWBA 3KEQA 3BWYA 2VJKA 4H7IA 4QXMA 4M0UA 4C0HA 1T8YA 3RU3A 1LI5A 3TPFA 4EGQA 3I61A 1JDBB 3OVMA 4TQGA 3DKPA 2O4CA 3TQOA 5FPKA 1LDGA 3MQ2A 3Q11A 4MV0A 2LCIA 3AIMA 3DTNA 4FSHA 5G1NA 3DFZA 1UDWA 1YAHA 2QS9A 2NTEA 3OCZA 4WLUA 4TLLB 3T7CA 4UTPA 4MUNA 5F73A 3NO4A 1JDVA 2GZRA 4TSFD 1E4EA 4DDVA 5B55A 3IODA 4DZRA 3GLRA 4TRMA 2JHCA 2EAUA 3I0NA 1X2EA 4I46A 1QRTA 4J94A 2PN1A 4BV3A 1OXUA 4ER0A 2EARA 4A4DA 2XSZA 1O6GA 2YL2A 4E51A 3GGCA 2Q0XA 1T2EA 2VK2A 4N12A 4A15A 1TMOA 4JFRA 4NZPA 4X95A 3GJTA 3MB8A 2NO6A 1R7RA 3JQ8B 1WZNA 4G8JA 4UHJA 4XE5A 5JSYA 5BOVA 3RCBA 4C4SA 4CIBA 2R0QC 3V55A 4J16C 1WAMA 5CVDA 2BFDA 2L69A 4H59A 3WC4A 4OGGA 2VRNA 2DKFA 1CR0A 1GV1A 1Y5MA 2E3JA 2P11A 4MEAA 3QF7A 1DKPA 2B7CA 1A97A 3QVTA 4P4GA 4PC6A 4QATA 4WN9B 5EL0A 5B3AA 4CT5A 1QIHA 4D5EA 2YC4C 1PJ4A 3OIWA 3CNOA 2QHXA 1KDOA 1S9DA 5JD6A 2PRJA 3M6IA 3QU9A 1FJHA 5FADA 3ZBPA 3DHNA 5ANRB 2XYQA 3BB3A 2JD0A 5BYKA 5IBCA 1IPFA 4EHJA 3ZCPA 1N3IA 3KUXA 2O3SA 3MGGA 1SXHA 2VNIA 3G6WA 3NXKA 4BFTA 5B64A 5E6SA 4KPYA 3QPVA 3ZY3A 4IWNA 4HTAA 4NYMQ 3I5XA 1DEAA 3KKPA 4O4LA 4NCXA 4NFSA 3IUJA 3O4FA 4NYIQ 2IV2X 5IULC 5FEUA 5KWEA 4QOFA 5DT9A 1RMQA 1SUIA 3I3OA 5E7MA 1REQB 3AONB 2CY0A 3VR0A 1CJCA 3WXBA 2V4MA 1RKQA 5BXQC 1C81A 4NONA 3FETA 2QVBA 2ZBRA 1TF5A 5K4AA 3HZRA 5AJYA 4KRFA 1Z0DA 4HDOB 2BEKA 5I8WA 1AHNA 4V0OA 3RFCA 3TIVA 4NKRA 1PGNA 2A58A 4M0CA 4EF4A 2GFHA 2Q29A 4JS0A 4X65B 2FZVA 2QMZA 4HUJA 2BDTA 2DOKA 2HYIC 3NG1A 3ZK9A 2C5FA 4QZVA 3RS3A 1X8LA 1NUUA 2BEJA 3NKVA 1N4AA 4D8TA 3FYTA 3TSYA 4PICA 2DFPA 2VUSA 1MC5A 3GN1A 3WO1A 3TX6A 1PX0A 1HZZC 1AY0A 1W88A 3E03A 3E7DA 3FH0A 2C7GA 3IXMA 4M9UA 1B16A 5HFJA 3FMGA 3O0TA 4BKRA 1J2EA 1ECGA 2QAGA 4PZ9A 4IJ6A 5ICMA 2I33A 3U4QB 3ACCA 4I9UA 1J8DA 1ZK3A 3IBGA 5KVQA 5KPDA 4M49A 1IZ0A 3PKIA 3J81k 1VRWA 3G9XA 4KXUA 4TTTS 3CB2A 3WMFA 1OROA 4X9XA 2CMHA 2IHYA 1PAUA 3AETA 3QJ5A 4Z54A 1RCFA 3EZ9A 1HQYE 1QP7A 4H6VA 2D2XA 4TYNA 1UMBB 3Q40A 3P9PA 1V4NA 3GJXC 3JWJA 1LZKA 2PSDA 1A88A 1FDTA 1OBHA 2BISA 3OPYB 3QOFA 1H6BA 1T4DA 4FFBA 4M9ZA 5AW9A 4YRZA 4EG7A 1DP4A 1ZCFA 5TQJA 3GLKA 3PT9A 3ROQA 1MQAA 4MS4A 3VO2A 4Z4QA 3AFGA 1EZZA 1EPUA 1ZNWA 2V03A 1H2YA 1EHIA 2C4HA 3H2IA 4YDSA 1ILEA 1H2RS 3RHTA 3A9TA 2MSCB 3F7MA 3VC2A 1NP7A 2WM2A 2RSLA 2ONCA 4DXAA 1UJ6A 3LCMA 2EHJA 2FJ0A 3EOZA 4J0QA 3OKPA 5BNFA 4E3ZA 4BWGA 4B40A 1C1HA 1FQWA 2MMCA 4J90A 4L95C 4NS1A 3O03A 1PQYA 1AKVA 2VPIA 4RULA 1D6MA 3UGJA 4WOKA 3RSHA 3L0CA 1A4UA 2HHAA 4P93A 3UUWA 2NTYC 3D6MA 3QFHA 3ZBQA 2C7VA 3IAXA 2BJHA 4NOLA 4BVBA 4EAAA 1EXDA 3LA6A 5C5CA 4FYVA 5KYUB 3D3NA 4P86A 3BB1A 4AMVA 3AR8A 1H6AA 4OU5A 2NUAB 2ON6A 2O14A 1ONBA 4CU5A 2YWGA 1TI7A 2IODA 2ZXUA 3LV8A 3PQ8A 4TTJA 5H4HA 2YMLA 4NHEA 5IFLA 5H82A 1QFSA 5K05A 5FWDA 2Y9PB 3UCXA 4F6LA 2J0QA 1NDHA 4CIYA 1JDZA 1OXXK 1SXIA 3UKDA 2O8EA 4JOBA 2G36A 2GZ2A 3DXXA 2B99A 5JS6A 1PFQA 2WA2A 1R6VA 3V3TA 4FFLA 2RHMA 4BWVA 3D6FA 1CUBA 2ID4A 1H1DA 3KVVA 1WR8A 4HGYA 1T0HB 1TRKA 4RZIA 1A8SA 4YRRA 2AZXA 3RF6A 3O4RA 4M54A 2C31A 3Q9LA 4NICA 4CLXA 4ZZ2A 1CQJB 2ZAIA 3E22B 5E9AA 1MQ9A 4WJLA 3STWA 1WOYA 2H48A 4Y6OA 5LQAA 1EA5A 2PWZA 2PSFA 1VPDA 1Y5LA 4HWOA 1NR7A 3ON5A 2LDXA 3A3KA 1U8UA 2QTNA 2P67A 4R5HA 5BWOA 1J9EA 4RL6A 1ADGA 2EIXA 4G0YA 4D9KA 1NRXA 1GILA 4G5GA 4YT8A 1T2UA 2BAGA 1DCKA 2CKDA 1YASA 3EDYA 4LQCA 4QTZA 2VT7A 1NBAA 5KWSA 4CEHA 3N86A 3CINA 4NI5A 1GZUA 1DOZA 2AN1A 2CLSA 3DKKA 1N2CA 3ISVA 3PNVA 2ZJOA 4K40A 3T3HA 3U1TA 1RT9A 3SEFA 3H9GA 4HMPA 1XXHA 4RA9A 5A0FA 5LFAA 1UWLA 2FGKA 3ASZA 4G9EA 1LD3A 2NPOA 1LCIA 1GZHB 1VKHA 3H5LA 3HL4A 4ZYWA 1HDOA 3GGSA 5BOSA 2J9RA 2WEKA 3GEDA 3X0DA 4BU1A 5JBIA 4EMTA 5AKKA 5AIAA 4HGOA 3VYSB 4ILKA 4DLSA 4ZZIA 5KREA 3OQMA 3EN0A 3JARB 4C21A 5JG7A 5E3IA 1F4LA 4DQVA 4C89A 3WHIA 5HJ2A 2BEVA 1P61B 1CE8A 3HN6A 4LTNA 4MV7A 5AT1A 4C7BA 4CCYA 4AN1A 2DTDA 1A69A 1OJLA 1JHZA 4G5YA 1LVHA 2Q5LA 3AKYA 3C3XA 1NM5C 1V6SA 1ZNXA 3L5KA 4MAMA 1O0CA 2YS7A 4GR5A 1L4EA 2QE7A 2O3UA 3A6DA 4NZZA 4BFLA 1KK3A 1T4BA 5KYYB 5HQTA 4B82A 3B38A 4JLKA 5CVUA 2QGZA 2XYHA 3V4SA 3SX0A 3CISA 1AJEA 3OEED 1LPPA 2WG0A 1V6CA 1C9EA 3NW9A 3K15A 2G06A 3MMZA 4PSUA 2ST1A 5FV7A 5JHGB 3MF4A 1POWA 3GD7A 3JYOA 2BEWB 3ZIDA 3GA5A 1ZK1A 1XLVA 2HMSA 4XVHA 5A7FA 3DBOB 4PSKA 3OP4A 4RHEA 3T7TA 1XP5A 4QPDA 5G41A 1OUMA 4FXPA 1E7WA 3UFBA 3W1EA 4AXBA 4F3YA 4R2IA 3HDYA 1GG9A 3I9JA 5ESDA 3LXXA 2REXB 1L5NA 4FUQA 3BJEA 4PC1A 5DXJA 3WWDA 3JZAA 3CTPA 3QM1A 4IF6A 1G8JA 1QCYA 1UT6A 2HIAA 4R6WA 4WOBA 2HSEA 4U7WA 2NG1A 2DKOA 1JECA 2IW1A 2P6MA 2ZAYA 3HCEA 3HWWA 3LP5A 4EJMA 4L4RA 1NQTA 4ZMSA 3Q98A 1YKSA 3O8BA 2VYVD 3OMXA 4KAXA 5CAEA 2BGGA 1Y98A 3WYCA 3IEVA 1U7DA 1QRUA 1MG0A 3IJEB 2CLCX 1BWQA 5IDYA 1ZHFA 3EFOB 1L9XA 3MJFA 3GEMA 4KIWA 4R69A 3WO0A 3KK0A 1LBSA 4UPEA 1RXWA 3QE3A 4EUNA 2EIHA 1DRWA 3CH6A 4R41A 3F2VA 1VJRA 2I65A 5GIOE 2A0YA 3FWYA 4MVJF 4UBJA 1U2PA 2VNJA 3QX8A 1JVNA 1T6NA 2EQ5A 3LSTA 4GXNA 2YINC 4M37A 4UUBA 3ZI4A 2NVWA 4L6AA 3EBOA 2OBBA 1NJ8A 4RA6B 3EYAA 1M3SA 3HRHA 2VDUE 4JJIA 4TXLA 1EP9A 1T3SA 5FBWB 2AEEA 3AO0B 1M0TA 2R97A 2A9PA 2VHYA 2XQGA 5EMMA 5CBPB 2Y0PA 4U3JB 3WP1B 5HHTA 1J00A 2GBLA 2HZ7A 3D54D 3IUNA 4R8SA 2KBFA 3BJIC 1K3UB 4BN0A 9LDTA 4CF7A 1E7RA 3JCZA 1I1QB 1U0HC 3DJFA 5I3CA 1OA1A 4OJNA 3LHFA 1BMTA 2PSJA 1CJUC 4RJIA 4KQHA 2Q6KA 1UC9A 2AN4A 1ZM2A 3M70A 4GE3A 1TIPA 1ZY2A 1X7XB 1CZRA 3DOHA 5FHRA 4M1KA 2EG9A 4RHUA 1AK9A 4P98A 3FMFA 2HM7A 4HDQB 4AZWA 3DWFA 3IQEA 5HJ7A 4ZI3A 1X70A 2QJRA 3TBKA 3GCZA 5T6MA 3M3PA 3BK7A 1DARA 2G3YA 3KBOA 1JKFA 3I92A 1WKCA 1I7QB 4TS1A 3RYIB 3AERA 5JZSA 1NNEA 1N75A 1U1FA 2BKLA 3CLRC 5EC8A 1WW2A 1U7ZA 3OE7A 3K4HA 2CXHA 4W63A 4POOA 2OCIA 2FF5A 5AW5A 2P91A 5JYBA 2I55A 1L4KA 2QSYA 1QG4A 1ZIOA 2VP2A 2Y0DA 3M6WA 3RS2A 4DWVA 2YZKA 4DSOA 4PYRA 3ZWXA 4YRTA 3IUPA 1L7DA 4QYMA 2R2AA 1SU4A 2FFJA 1Y8CA 4OA5A 4UTRA 1PD0A 1GZ4A 3R3ZA 1P0CA 1T5LA 3NBMA 1H2AS 4RLSA 5CLHA 4DJDC 3L93A 4FLMA 3W5SA 2VEOA 4EMSA 5I47A 1P0PA 2RARA 3ZV3A 3CVXA 1UCFA 4AXXA 1LK5A 1KU6A 4XPIB 2C7QA 1ZA1A 4ZVTA 2P5TB 2X2OA 4Z7NB 4PZCA 2PBFA 2ID7A 2QJTA 3G8BA 5B2ZA 4EY6A 3CGGA 2W2KB 4LDPA 4MR9A 4NE7A 3TL3A 4QLBA 4W6ZA 2VF8A 2GN4A 3D3JA 3C6XA 4HXYA 2DBRA 4PY2A 4IRMA 1T3GA 1XKQA 3OUZA 5L4SA 2P2LA 1N2HA 5BQFA 2Q1UA 4MVJI 2BI8A 4DCPA 3DE7X 1BD3A 3QUTA 2WKWA 3H1PA 2FRVA 3HJCA 2G82A 2QX7A 4MV3A 2VDWA 5C8DA 1DKNA 3ZG6A 4QPCA 3SIPA 4FOOA 3H5NA 3PL1A 4XWAA 5K7SA 4FGJA 5BSRA 5LZ4A 3GLVA 4AY6A 1RM3A 4ZO8A 4YXFA 5EIBC 5BN5A 2O8BA 4DLLA 3KAJA 4DMGA 3DUFA 1KAMA 3UY4A 2QM7A 3EARA 4UU0A 1WZ2A 3RNOA 2YVKA 4L72A 1VJ5A 5EE9A 5JXWA 4WLFA 5JYCA 4JLAA 3WIBA 3GUVA 2NXWA 1NVVQ 4NX2A 4R8MA 1ZBQA 3D1LA 3K73O 1QKJA 4RF4A 5BURA 2WJ6A 1NPTO 2VCEA 3A58B 4BPBA 4P3YA 2C2WA 2X15A 3C15C 4YMSA 1RYEA 1RPAA 3OETA 2E4WA 2D1YA 1AGXA 3OESA 3TQCA 1GNLA 3P1JA 4ITVA 2X5JO 3A31A 3E5RA 1YJCA 1I4EB 2F90A 3UC5A 3MJVA 3F8TA 2QL6A 4JL8A 4K9LA 2ZTUA 3QY0A 1W0CA 3IQFA 3EISA 2QD2A 3I9OA 1UL1X 3PNOA 4UNPA 4UUAA 3RUIA 4DYVA 2JFYA 4HXGA 2HJRA 1YQGA 3KYCB 3LBAA 5EIFA 4MVWA 3R4VA 2P6NA 2XMCA 1YR9A 4WY2A 1XFDA 1SXJD 1Z3CA 4J91A 3RC8A 2E4ZA 1R8JA 2EEZA 5B57C 5ETJA 4Z8YA 2PV0A 3HNRA 5HMMA 3N2YA 3HFGA 3F9IA 1SMKA 2QQFA 5DNDA 2RGBA 3E9YA 3QQPA 4ZOAA 4F5WA 3EZFA 1R16A 2G9VA 2YYZA 1ZLYA 4QHTA 1LV7A 3OC6A 1XVIA 2C1XA 1RVDA 1JR3D 3WGVA 4JCCA 4Q21A 2Y0CA 1II8A 2D1QA 3FCOA 1NULA 3TL2A 1IUNA 3NM4A 2EQBA 5KKNB 2H2HA 3QXJA 3HGTA 1EQ2A 4WL0A 2VF7A 5KHAA 1XO1A 5EXSA 2PFGA 2VWGA 3ILXA 4IDFA 4MI3A 2NT3A 2P7HA 4K9SA 3VAYA 2VKTA 1RQ7A 1U5AA 3HU2A 4FEEA 1VMIA 3U4DA 5F98A 1SVKA 3FPSA 1EE9A 3QBDA 1O7JA 1W34A 4XUGB 2BVNA 3VOTA 4FYJA 5KYKA 2JLZA 3IP8A 3R7SA 3VMFA 1MC1A 4ZOBA 4KP7A 4TN5A 4B35A 3ZK8A 3AMVA 5EUCA 5I8PA 3GLSA 5K3SA 4FFRA 1QLJA 2IQ5A 2YJGA 3HJAA 4LJ9A 3W6UA 5ICFA 2E87A 4A10A 4E03A 3MINA 1B00A 1DX4A 3BCUA 2IBMA 4ESOA 3GLFE 2AJCA 2I3DA 2P2SA 5ALNA 3V1MA 4WNAA 4D8YA 2KHZA 4D81A 3JQ7A 3V2IA 4G36A 1ECJA 5DPMA 4DRXB 3EMBA 5JFTA 1MQ8B 1EK5A 4TKUA 2MT9A 5G1PA 3WQHA 3OHSX 2A92A 3DE0X 1NW8A 2AQIA 2Z2ZA 4AUNA 4YRGA 1TCAA 2KBEA 5TF0A 1G6HA 1U2GC 2OBMA 2WSLA 1T9AA 1YAJA 1ZSVA 3FJYA 4RDXA 2HQOA 5AW1A 2IXFA 3HKDA 5FOWA 4B85A 4CODB 2JRLA 3GDWA 2CL0X 4JB2A 5A7HA 1VIMA 1ID8A 5HNKA 5JLAA 2HMWA 2WHRA 3FKQA 4MULA 4AQDA 4PG8A 1DBIA 1I3KA 1SCQA 4WCFB 4BYMA 3HNOA 5C3MA 3GDOA 3IOCA 1GKKA 3NJ4A 3ZGOA 1P60A 3R9KA 1DC7A 4F9FA 5AVYA 3L8MA 2MJLA 3FNBA 1E61A 1F06A 1VSUA 2ZSDA 3AXSA 2QAGC 2WJWA 2I2CA 5FPHA 5BSVA 4K7JA 1FPMA 3LM8A 4Q19A 2ASVA 2PL5A 2F1HA 2F9FA 2I4TA 3FPKA 1ACLA 3QPBA 3T7KA 4AKSA 5B6PA 1KTIA 1SAYA 2ZYIA 3H11A 3OM9A 5CFQA 4HAUA 4PO8A 3P2JA 5TJHA 3NETA 4YAIA 4ZQEA 4DYDA 2WIKA 3T3NA 2HRCA 2PBZA 3FDZB 4JN6B 4PYQA 1XVAA 1WQ4A 5C1PA 4D56A 1ODIA 2A5YB 1K3TA 4IHJA 3TCNA 1VJGA 2QNRA 4JENA 2DLNA 1VXOA 4U2BA 5KU1A 3IDAA 1JHUA 1O0BA 1CZNA 4KREA 2PD4A 1ADBA 1X92A 2RHCA 4PTZA 2Y1CA 5C5IA 5K8CA 5F9FA 3HB7A 4IEFB 1NY5A 3B13B 4IZIA 2D0DA 4JUAA 1WVIA 2C98A 1TECE 4MA4A 2NZ2A 5CX1B 4DMHA 5JHHB 5H8WA 1BXRA 1Z7WA 1CX9B 5EKTA 2E5FA 2WIDA 2WD9A 3FBGA 2H54A 3H18A 5BNTA 3FLBA 1QM5A 2F1IA 4RACA 4KCGA 4ARCA 2XV1A 5EJ6A 5AKHA 1L3CA 4R1MA 3NH9A 4K9NA 2P27A 2PH5A 3O3NB 3D43A 3R40A 1AKTA 3L8HA 3HGQA 4KXLA 4ZQGA 4P3XA 1MNQA 3EXHB 2YZ7A 4G8DA 2Z4SA 2B4KA 4N5IX 1SU7A 1VL5A 3GLHE 3AJ8A 4MQ4A 4LNAA 4D79A 2FPOA 4HVAA 5DLPA 4HN4B 3SHFA 4D80A 4WKCA 1Z38A 2AG5A 3HDHA 1QHFA 1DKQA 1J33A 2XE4A 1N2BA 4X20B 4MUKA 3DXZA 1A7KA 1H2ZA 5DSTA 1QQ6A 4N9QA 3EVGA 3JS5A 2G28A 4KQWA 1J8FA 2G70A 2VP4A 3OPXA 3QI2A 4NBTA 5D7BA 3CNQS 4HEA6 4HFNA 3VH3A 5IKMA 3CN7A 3GGDA 1ECLA 1U0NA 1W5TA 1FNNA 3H2SA 4Y7DA 5BPHA 2D3WA 2WF8A 3PE3A 4JVOA 2ZJ6A 1CUHA 5ERXA 3FMIA 2HJVA 4A6PA 3EC7A 3KPUA 3FSJX 1XZLA 2JBAB 4MW9A 1F51E 2ESRA 2GZ1A 2RH4A 4TQ9A 2H2DA 3GRAA 4BVHA 3I2YX 4RMJA 5DNYB 5DYGA 5FWAA 5HGXA 3EFBA 1P5ZB 1R6XA 5ERGB 5LBUA 3IS3A 4GX2A 5IVDA 4EY8A 1KXZA 1T5IA 1QAOA 1Y63A 1M66A 2YXLA 4GF5A 3UAYA 4F5EA 2Q0QA 2NU7A 4I1OA 4JP1A 3BFXA 4IIFA 3K1ZA 2OHOA 4FFNA 3P0FA 1W8IA 3H3FA 4PAMA 2P6PA 2J6IA 1MIOA 3CONA 3ML1A 1G3IA 2FV8A 2XECA 3A6EA 1I51A 5ARDA 3IELA 1EVEA 2IHUA 4ZODA 4DEXA 1YRLA 4C3ZA 3HBMA 1VP3A 3KAKA 3PHBE 4B3IA 3UJ7A 3O4IA 3JQAD 2IJGX 4K9KA 2APJA 4BAGA 5FWYA 1W1UA 1ZCAA 1EGVB 2C04A 4OKNA 4R98A 4RKFA 5ARCA 4ZEVA 3L4JA 2COKA 3DT8A 3A1EA 4D8XA 1QGYA 5BY2A 4GPAA 5KMGA 4D6XA 1SC4A 5CT6A 1CYDA 1T0PA 4IMPA 1CJMA 2GK6A 2JCSA 1LC3A 4I4TA 1N9GA 3HA7A 4PAGA 3L8FA 4B48A 4QEDA 2V7UA 3UWKA 3DVLA 4XTRA 1Z07A 1H2WA 1GADO 5ERYA 3OICA 4INPA 4U8GA 3FBWA 4RELA 3PYLA 1VKJA 3VGPA 4IMIB 4OI1A 3UIEA 5SZJA 3TQTA 4EG1A 4GI2A 1JAYA 1Q0ZA 1J0XO 1PN3A 2CHQA 2HSWA 2VYNA 4JUFA 2L18A 3BEOA 4MLCA 5BWLA 5LU8A 4Y9DA 2O2SA 3JQEA 3IGFA 2D7JA 3GP3A 1ECCA 4EYKA 3GLIB 3VYRB 5FRDA 3ZDRA 2YTZA 4R1NA 4TWRA 3O4JA 2BHNA 1L5HA 4B0OA 1ZI6A 5KYNA 3IE2A 1EWKA 1FYXA 2KI5A 4UATA 3VR3D 4Q39A 3GEIA 3FCAA 1NI3A 1IY2A 2QUJA 2VDNB 2WV7A 2PZ8A 2O6LA 1OILA 1OGIA 1D5CA 3AHFA 4LWOA 5EPUA 4GX5A 4ENUA 5C32A 1CS4C 3HXQA 1QGZA 1Q1ZA 1XTIA 3ANMA 4UBNA 4BGEA 4EMBA 1M2OB 4I6GA 4F7DA 1COWD 3ZC3A 4B3FX 1T9BA 4XAQA 3MCVA 2BYTA 3FB4A 3LC7O 3WLEA 3PNMA 4Q02A 4Z7OB 3LF1A 2ORED 4GQIA 4HFMA 4CKCB 3G1TA 3COSA 5TPWA 2AJBA 3BWBA 1VB3A 4TVBA 3AP1A 1CY4A 1AUOA 3CG4A 3B9BA 2FWIA 4QRIA 4XUCA 4CT4B 3VHLB 3EXEA 4QNNA 3DTVD 4JZKA 4CGYA 3KWJA 4CG1A 2WE8A 3QIAA 2VSXA 1IBCA 1TM1E 3FE2A 4QG3A 5ES4B 1R1DA 5IZCA 4KSBA 4RFSB 5IANA 1OPRA 4B3TB 5E2AA 3NU1A 5EJFA 3EXAA 3PJFA 6Q21A 1KU0A 1QB7A 2FMKA 4I5DA 3FRIA 5DHFA 3CSDA 3TWOA 1A76A 3JYPA 3IESA 4PFKA 2YH2A 1WHSA 1Y6JA 4CXMA 2OB1A 3QMPA 5FOVA 5C8XA 4BB5A 5C7IO 4IFEA 4AROA 4L5YA 4YAWA 3F1LA 2ZWOA 4PPFA 4IDGA 2GBLC 1ZIYA 2P3QA 4U63A 3OI7A 5CLGA 4EKYA 2ZYRA 3DZKA 3Q0TA 5CFNA 4GKAA 4YLYA 1RLIA 2WUDA 2WJ4A 1FUEA 4IIGA 3WLKX 2O06A 1XZBA 1M72A 3G02A 1CR6A 1J8YF 1QYDA 3H2GA 3QBTA 3WYGA 4E88A 3HJTA 3DL0A 1P4SA 1E58A 1SB9A 3PR1A 4OOEA 4R1UA 5CRIA 4RMHA 4YH1A 1C1XB 5AVOA 5G40A 1C7ZA 1P1IA 1B6RA 2ZKIA 1C1DA 4IXTA 1TUBB 4V0SA 1OC4A 1DIBA 1Y3IA 1QK5A 1XL0A 1QHXA 1ONPA 2I1QA 1GQYA 2DTXA 2QT9A 2UZIR 3DV2A 4P31A 3W5IA 4ALLA 1PT7A 1T34A 1V16A 1XL1A 2A1TR 4TXJA 3WAGA 2QSJA 3AH8A 2F3RA 4JLDA 4BQSA 4KQ1A 2OGZA 2J4CA 4LI0A 1ZHHA 2QTAA 2Y93A 3H0KA 4EVRA 5FPPA 3U4HA 1CS0B 1V3UA 3DEZA 4E5PA 5NLLA 3UAXA 3L6RA 4RHTA 1OLSA 1XNGA 4LQDA 5E4YA 3EY9A 5GZ6A 2IUYA 4XWYA 4AKGA 5L8VA 3EGXA 4LF6B 4GW3A 1UDRA 2BMDA 3FPCA 1QYRA 2OFWA 4YMGA 4S12A 4A0FA 4I3GA 4N5DA 4XJXA 1B7GO 5ILGA 5CG1A 5IS2A 3R6WA 3B2QA 3EWAA 4I4CA 4LRUA 3H9CA 1IVNA 1I0IA 3DDNA 3LNTA 4HQFA 2XUOA 5DYIA 3VQTA 2O5VA 3LAWA 1Z34A 3OKFA 2WSSA 3LZCA 4R1QA 3UWDA 5KTRA 1C0PA 1N36B 2X4DA 1NHWA 3ZY6A 2A6PA 1PR6A 4PC3A 1XDSA 1SC1A 1DOAA 5G3YA 4BQRA 1DMSA 1MQSA 1U6KA 4D92A 3I72A 1T5BA 1RADA 4H4CA 4LNUA 1F2TA 4HP8A 1THZA 5E4FA 1RD4A 1THMA 4KH1A 4MIEA 2C7PA 3IQWA 1H9AA 1BG6A 4TPKA 5B2EA 3WA7A 4LF5B 3M9LA 1KSHA 1SOUA 4HRVA 2DUNA 1G5IA 2XT0A 2CEKA 2WSIA 3EAFA 1NJ2A 4BC0A 2OO7A 1NNI1 1DG3A 2O1WA 4A6EA 3OQIB 3Q5EA 4LUCA 1JG1A 4MRAA 4RCYA 3EUWA 4HN9A 3V48A 2WUVA 3ZS8A 2OTCA 4MX8A 4O4JB 5MN4A 3OHMA 4GPD1 2W48A 1B1CA 2FR1A 3BAFA 1NQWA 3JRWA 4MGIR 5AXCA 4B8WA 3D81A 3SX4A 1S4QA 2R96A 1P7VA 3BQNB 2P9TA 2VQDA 4D99A 5ADWA 1CZLA 4JEMA 4Z0NA 3S44A 3RRNA 1FX0B 1KMIY 2EZUA 5TRTA 1Y4UA 1YQ9A 4BC1A 3DXFA 1JYSA 1Z25A 1G63A 3C0KA 3OT1B 1RWXA 4P33A 3I2HA 5DM4A 1SRRA 2HWKA 1QF9A 3U1VA 2ZOSA 4PLGA 2VC2B 3EZGA 4A0GA 4BQFA 4ZIRA 1L4LA 5BYJA 2EFDB 2V7TA 3DL7A 2XQKA 3VO8A 5CA1A 3IAS6 2EDCA 5CK4A 1ML4A 4OV6B 4EZBA 3NONA 2H6EA 4Z4HA 2OFPA 3RRZA 1BW9A 4MQEB 2QG9A 5EHZA 1FLNA 1E2GA 1CRWG 4O0MA 4AX4A 2UYGA 3TR5A 1IIBA 2E21A 4DIUA 3EC2A 1XTQA 1CY2A 5LB4A 2K5UA 5H81A 3SYTA 2ZJ8A 4IGAA 4QG7A 2ILVA 3KM0A 4G2TA 5GOZA 4CF3A 3PQ2A 2CFTA 4G0PA 1MO5A 3CF6R 3VDRA 4JEHA 1BRMA 3IP6A 1Y48E 2WJIA 3FKSA 1K6EA 1CF9A 1QTIA 3IAUA 3NHWA 2F59A 3WNCA 4M36A 3OA0A 3LKDA 4F46A 1VG1A 1XEXB 5HS4A 5LYJF 1HYEA 3M6VA 4QBIA 3HV0A 2JIQA 3SQLA 4B79A 1OH8A 1NQVA 2UZ3A 4TRRA 1GTJ1 1M1NB 1RQ2A 2BL4A 4DUYB 3D0QA 2SKDA 3RFXA 4ZOEA 3DCJA 3NBFA 5F1OA 3IPXA 4TYWA 4MKXA 4F60A 2VQ6A 3WDLA 2AT1A 3ZV5A 3O74A 2Q1XA 5LKAA 1E2JA 1KNXA 2PUDA 1M1YA 2XUGA 2C4WA 4R3UC 3L7OA 1G8AA 4FJ1A 2XUFA 3VU1A 3LQRA 4Y7CA 2ZI5A 1D0VA 1LB1B 3CO5A 3MT8A 1KZ7B 2JGJA 3RW9A 1RLOA 1T5HX 2EP7A 2GTHA 4GYKA 5LLTA 4CM9D 1E8NA 4OIMA 5JNWA 3E0QA 4HB3A 3HY4A 4NU0A 3SEAA 4Y1RB 4ESHA 4GP6A 5FI0B 1NDUA 4F56A 4RMNA 3ZDQA 2ZE5A 2CNLA 4Y1FA 1V8PA 3PFFA 4P3KA 5EFZA 5DSZA 2LRHA 1K63A 4IIJF 5CUQA 2OILA 4HN2A 2X4GA 3M6UA 1JEQB 1DDOA 2AE2A 3EFEA 3Q5DA 4IIJA 4YV0A 4Q1DA 3WNVA 3BA6A 2PL3A 4BNTA 4CKBB 4G6ZA 5I45A 2PA0A 4L75A 4JC0A 4E2WA 2H7XA 4KN8A 2ZUEA 3F71A 1TFRA 1R4MA 3A4YA 1UM8A 4JBLA 3SPXA 1YMUA 4MA0A 2C3MA 3C5CA 3L79A 1AF7A 5JO9A 3VU3A 1XPJA 3W5CA 3L7BA 3SDZA 5L7TA 1V48A 4C4OA 3OEHA 1ZCZA 2Q4EA 2XTJA 4TKMA 1O5TA 2DECA 2RK3A 2B7LA 4RY2A 4I08A 3QX9A 4AU1A 1YOBA 4DFDA 4ZU1X 3AVVA 2O7VA 4B3MB 2Z5GA 4C7OB 7MHTA 3AC0A 4XFKA 4R8VA 3IEIA 2W93A 3M8KA 5LYYA 2AW5A 5T64A 2BC9A 4MUMA 4IRUB 5BSTA 1XQ1A 4J43A 4KE7A 1P74A 1VHTA 4JH0A 2QN2A 3DG9A 4NYJQ 3A26A 4P2GA 1SC3A 2R1VB 1W49A 5IP5A 2AX4A 1II0A 1EK6A 2J7PD 4UEWA 1B14A 3C8HA 4N48A 1JIVA 5CA0B 2X6RA 4EPYA 1AN9A 4OBEA 3AVQA 2KJQA 1LDEA 4GBMA 4B9AA 2BMAA 5JSUA 4PPQA 3FWZA 1JXQA 5KYXB 2JFOA 4IAOA 4E32A 2CCKA 1GZ3A 1N2GA 4GYYA 4TM8A 4BNZA 4P3NA 5FTNA 4IRXA 3C3JA 5B3LA 4EY7A 4Y9TA 1KAOA 1LFDB 4XIGS 3O84A 1MTZA 2XE7A 3DMTA 4XIIA 2NO0A 2QRMA 3O4HA 4LJSA 5BW4A 1EGHA 4LMRA 2O7SA 4Y2VA 1R6UA 3PYXA 3TW0A 3MWEB 1V1RA 2EZ8A 4O63O 3WGJA 1ULZA 2PUJA 4MMXB 2D7DA 3UXHA 4CIXA 2ZR8A 5KAPA 2XLCA 3UK7A 1EDOA 1Z39A 3E1GA 3S81A 2FFQA 4LBYA 4JLJA 4QUDA 4JB0A 1QZUA 3T0IA 4ZCTA 3AWDA 1I6LA 4L0MA 1JN0A 2D0PB 2I8CA 4KNVA 1JWLA 3HL0A 4L4ZA 1QSGA 1JV2B 1THTA 1ODSA 2F1JA 5HZHA 2MSLA 2N46A 5A4FS 2RGNC 3MFQA 3C3YA 1Z8FA 2KM1A 1M54A 5KNDH 3Q10A 3S5JA 4POAA 2HDNB 3W2TA 3HNPA 2N75A 1MRSA 3G8AA 3IIIA 3Q3GE 4I3HA 4QYSA 5K0CA 3WGTA 1K89A 3CH4B 3FAZA 2IEDA 3I6ZA 3HKBB 4KQGA 4MI1A 4MP3A 3SNKA 2R7KA 5I7SA 5ITZA 4BBPA 1NJ6A 5LMZA 4BQOA 1R9JA 3GT4A 3ET5A 3QNWA 3I5YA 2ZDGA 3FNEA 4HQOA 2VIIA 4ICIA 2Z9DA 2WTUA 1NVFA 2ADFA 4OHRA 4UTVA 3JASB 1SQGA 1MOZA 1QHHA 5DIZA 3SLKA 2A3RA 2FWAA 3OT4A 2NVUB 3ZZNA 4YNBA 4O4HB 1PFKA 3QXHA 3QIVA 4OXQA 1RRPA 1T9CA 2OSVA 4NEQA 1ZSNA 3U4AA 1USWA 4BXOA 5EPEA 1JR3E 4G0XA 4HNRA 4NNOA 3KSMA 3GAZA 1HETA 1XRSB 5KSOA 3PLNA 3LCVB 4OQLA 5EFOA 1NUQA 4K6FA 4TMVA 3PTLA 4I0WB 3I45A 5IAJA 3ZKAA 1U7TA 5D8DA 2YW9A 4OL9A 1S6YA 3RODA 3GBPA 5IMBA 1AMNA 1Q2XA 4YCLA 4RX1A 2XDQB 3DBLB 3G68A 3MERA 3WVNA 5K8JB 2AG0A 3OZEA 3VRHA 2P9HA 2QN1A 3HB1A 3OQPA 4M2LA 1JG3A 1N6PA 1Z7YA 2GPSA 1GVNB 2EL9A 5F5NA 3AR7A 1C9DB 2HDWA 2D0IA 4Q3KA 2GHQA 2X0DA 1XHEA 2W70A 3THRA 3R7FA 4E3WA 3U62A 2AG6A 5J1SB 4RZXA 3RVDA 3B7GA 3ZWAA 1EP1B 3AUYA 4P0TA 2V0NA 1H0HA 1UEIA 5HIMA 4FD3A 3SXUB 4BGUA 1RI1A 4O2AA 1RYBA 5CEFA 4XWTA 4EG3A 3K9GA 5BN4B 3BORA 1WXXA 3EZNA 1JHRA 5DWVA 1NSYA 1YZFA 4ZPXA 3ZN2A 5EJ4A 4XVUA 2GBGA 1NXTA 3Q87B 3IQZA 1D9XA 4NAUA 3QLJA 4RJJA 4LJKA 4YJFA 5AHXA 4MS3B 2GK3A 4EPVA 5JD5A 3BRCA 1KI6B 4M4SA 5JOQA 1U11A 4IDDA 4KXMA 3R6DA 2MWMA 4TKZA 4OTZA 2QE6A 1HNNA 3AF4A 4G1EB 4GC5A 2M6SA 2XW6A 4ND3A 3TOVA 1WB9A 5CB6A 3FPHA 1YE8A 3GQBA 2ADMA 3LBNA 4N03A 3AEUA 4OQPA 3VR6H 2EFJA 5A6SA 2QK4A 5G4KA 3X3H