3E23A

Crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
QAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGRPVRTMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLHVSVRKPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein RPA2492
publication title Crystal structure of the RPA2492 protein in complex with SAM from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR299
rcsb
source organism Rhodopseudomonas palustris
total genus 66
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e23A00
2YXDA 3PFGA 3UJ6A 3UJ7A 4F86A 2UZ4A 1M0EA 4IV8A 4ATNA 1AV6A 3E7PA 3P9NA 4M37A 5DSXA 4QVGA 3PFHA 4RVFA 4RX1A 4RTKA 2BR4A 5U4XA 5DTQA 2QM3A 1VPTA 2PT9A 1X1CA 2ZIGA 3EGIA 4PGGA 2OYRA 3P9CA 3KQWA 3KPJA 2AN3A 3AXTA 4EVIA 1YUBA 4GOLD 3A27A 1P91A 4R05A 2IDKA 4JXJA 1KPGA 5C9ZA 3QOXA 3UJ9A 5F2NA 3PLAE 5HZMA 5CVJA 4QDKA 1JQ3A 3DTNA 3OE5A 3TM4A 2ZZNA 4MWZA 3PX3A 3G5TA 4C05A 2EG5A 1RI2A 3B3GA 5FA8A 4FZVA 5C0OE 8MHTA 3FRHA 4PYKA 3TKAA 4U7TB 1WY7A 1FPQA 4HSGA 3HM2A 1BOOA 3HTXA 1XXLA 1Q0SA 3FZGA 1FBNA 1UIRA 3SR4A 4M38A 3I58A 2AOUA 3DXXA 1UWVA 2IDJA 4MQ4A 3MCTA 5FQOA 2WA1A 2Z6QA 2E5WA 4BLVA 2G70A 3G2OA 2NNWB 2R6ZA 3G2MA 1NW7A 5CVVA 4E2YA 1G8AA 2EJUA 2FYTA 3P71T 5GM2A 4Y30A 5GWXA 2BH2A 5LQCA 1ZG3A 1F3LA 2HR1A 3B3FA 3NDJA 2JHAA 2OB1A 3FPGA 3O31A 3OZSA 3GGDA 1D2CA 2IH5A 4OX9Y 1QAMA 5HEKA 1YFLA 3BKXA 1JTEA 2AOVA 2QRVA 3DOUA 4WXHA 4B17A 3NWBA 1I4WA 4PYNA 2QYOA 4A6EA 1NKVA 2P40A 5K0GA 4GBED 4GC9A 3ER9A 2P1DA 3BWCA 4IWNA 5T6BA 2PX5A 1G6Q1 5LQJA 10MHA 2O57A 4OBWA 1P1BA 2N47A 3FTEA 2YX1A 4QPNA 3MQ2A 3CJRA 2P3QA 1PRYA 3HEMA 4KDRA 5KVAA 1AQIA 1WXWA 3C0KA 4EK9A 1BKYA 1O9HA 3BUSA 3BXOA 5FWDA 2HTEA 4AZTA 2V7EA 4PYQA 4AZWA 1DCTA 3V8VA 2YXEA 3RODA 3TFWA 3KPUA 2AZTA 3EMDA 3EVZA 3PVCA 2KW5A 5CVEA 2C7PA 4OQEA 1JTFA 5EQJB 3IV6A 1OR8A 2I62A 2QRVB 2OBFA 2YUIA 2ZULA 1XVAA 3M33A 2IH2A 2GA9A 2BZGA 4C4AA 1NE2A 1NW8A 2ZZMA 4YUYA 3OFKA 3UJDA 2OY0A 3GRYA 3KR9A 4DKJA 2AOWA 5EZSA 2UYHA 2G8NA 4XUDA 1BC5A 3DP7A 2ZWAA 1NW6A 5B1SA 1P1CA 1Y8CA 3OZRA 3M6VA 1NV9A 2AOTA 2B25A 4PCLA 4QPPA 2XYQA 4AZVA 3KR2A 2P35A 2ZFUA 3Q7EA 3FPHA 2K4MA 1X1DA 2PX8A 4RSRA 1ZHFA 5HIMA 3S68A 3GXOA 1I1NA 3SM3A 1VIDA 3I53A 4OA5A 4R8RA 4KRGA 4R6WA 1SG9A 2YQZA 5EMKA 1PJZA 3M70A 2YTZA 3ME5A 2B2CA 3V97A 4X1OA 2ZZKA 4L7VA 5EGSA 2DPMA 2AS0A 3LDGA 2A14A 3L8DA 3K6RA 1VQ1A 5EKXA 3DXYA 3LGAA 4M36A 5H02A 4CKEA 1RI4A 3G5LA 1QAQA 2FHPA 2CKDA 3EVDA 2PV0A 4HRAA 2C7QA 2AOTB 1QYRA 4KWCA 1G60A 2ESRA 2LD4A 2ZBPA 1N7IA 2BR5A 3LKZA 3OU7A 3P2KA 4RYLA 2JG3A 5EPEA 5EC8A 4YUWA 4DCGA 2C7RA 2G1PA 4MHTA 4KIFA 3A4TA 2XYRA 4HGZA 2PBFA 5FWAA 4P7FA 2PLWA 1MJFA 1O54A 3SSOA 4POOA 1AQJA 2PY6A 5K0JA 3GO4A 1M6EX 4HC4A 1JG2A 3KU1A 3KKZA 5FHQA 5CM2Z 1YF3A 3FPEA 4P7JA 5D1HA 3CGGA 2NXJA 1ORIA 5HIJA 3VC1A 3FUWA 2B9EA 3SSNA 1DUSA 1TW3A 1T43A 2ONYA 3ORHA 4IKPA 5T64A 4CWAA 4DA4A 5CUQA 5EG5A 5DM0A 4FT2A 3G2PA 2PJDA 3KR1A 3KR0A 1NT2A 3UJCA 4C06A 2GPYA 2JH8A 3CKKA 2GH1A 5DLYA 4F85A 3C3PA 4FSXA 3KPYA 1YB2A 3A26A 1JQEA 4OA8A 2PT6A 3FPJA 1ZGJA 3KQVA 4GF5A 3TOSA 3U81A 3KQTA 5LQUA 1WG8A 3T7RA 3A25A 3TKYA 4RTPA 5FHRA 4RTLA 3AXSA 3FTFA 5D1NA 3LKDA 4P58A 1RJEA 3MERA 3REOA 4BP1A 3HCEA 5KS2A 4DMGA 3NVKI 5GINE 1EIZA 5FQNA 3GDHA 5EMJA 4FSDA 4YUVA 4CXMA 1BHJA 2PX2A 2BR3A 4R6XA 1QAOA 3C3YA 2BM9A 1NW3A 5HILA 4PWYA 2AOXA 3AJDA 5DX1A 2NXEA 4CKCA 2Q41A 3R0QA 1UFKA 5BW5A 3NMUF 7MHTA 4QTTB 1ZQ9A 1KIAA 1SVUA 3GRZA 2AN4A 3HCFA 3LBYA 4U7PB 1KP9A 1FJXA 3A7DA 3PB3A 2FK8A 3AWIA 5E9QA 2PSSA 2ZIEA 4X60A 3O4FA 2PXCA 4LWPA 1B42A 3SXJA 1RI1A 1YZ3A 3NDIA 1XCLA 3UJBA 2ONZA 3LX6A 3DUWA 3FUTA 3I64A 3IHTA 3KQPA 3UJ8A 5EHGA 2P8JA 2XVMA 2ZIFA 1L9KA 3JWIA 3TMAA 3FUXA 2ZSUA 4V0QA 3P8ZA 5K8VA 4RVDA 4E33A 2NP7A 3EMBA 2FK7A 5E1BA 1JG4A 3G2QA 3JWJA 5T67A 1KYZA 3HA5A 3JWGA 4GOND 5DX0A 2VDVE 5E9WA 5EIWA 5ERGB 4BP3A 2I6GA 2AOUB 2JH9A 3EVEA 1WXXA 3KQYA 4E70A 3MTIA 5K0CA 2V74B 3HCAA 3DULA 1R6AA 4PCAA 5LSAA 1O9GA 5DT2A 4FGZA 5EOVA 3UBTA 2Z6UA 1WS6A 3FRIA 5ICFA 3LHDA 3ER8A 3G89A 3C6MA 5LQRA 2VDUE 2JHCA 2EJTA 4E2XA 4XUEA 3HCDA 2NXNA 1NBHA 3OPNA 3EEOA 2BM8A 4YUXA 1WZNA 3EEYA 2UYOA 2ZLBA 3KPVA 4G56A 2IH4A 3TRKA 4PIMA 4GEKA 3BZBA 1EG2A 3THRA 3FTDA 1JG3A 1G8SA 1R00A 1RJDA 3GRVA 4DF3A 4YV0A 3DR5A 5IKMA 4BLUA 4LECA 1SQFA 2GB4A 2G71A 1RI5A 4HH4A 4PYOA 2P7IA 3TR6A 2CMGA 3CJTA 5DXJA 4EKGA 3GJYA 1XJ5A 2O07A 3M4XA 4GOMD 4MTLA 3TQSA 2WA2A 3BGVA 3DMGA 5EMMA 4CTKA 3EVAA 4E32A 3NTVA 5LQNA 3GU3A 5FADA 4LG1A 4A6DA 3EVGA 3KQOA 3FUUA 2ZW9A 4RVHA 1ORHA 3TPZA 5ICCA 2ERCA 3THSA 2OZVA 4X61A 5BW4A 1XDZA 3HCBA 1G38A 3DMHA 3KQMA 2NP6A 4PGHA 3R24A 2PX4A 2B3TA 3K0BA 3LCVB 5K05A 5LQKA 1MHTA 5K0NA 4BLWA 4QDJA 3FYDA 1Z3CA 3JWHA 3BGIA 2JJQA 3E23A 3MCZA 3OFJA 1VL5A 3B3JA 4HTFA 4LWOA 3EVBA 5GIOE 3O7WA 3SMQA 4CTJA 5K0EA 4V0RA 3P2EA 2P3OA 2O05A 3NVMB 3HCCA 3UA3A 4AX8A 4Y2HA 3PTAA 1IM8A 4R8SA 4F84A 2HV9A 1ZGAA 4GQBA 4ISCA 5HIIA 2P41A 2PXAA 1RI3A 3F4KA 1R8XA 3VSEA 5CVDA 1VLMA 3D2LA 3LDFA 3NW9A 1I9GA 5E8JA 2C7OA 2ZCJA 5KQRA 3LSTA 2OO3A 3BKWA 4FS8A 5DWQA 2HWKA 4M7RA 5HFJA 1F38A 2VDWA 4AUKA 4KIGA 3PX2A 3DXZA 1P39A 5DTRA 3B7PA 4XCXA 2UYQA 1KPIA 4ER6A 5LR6A 5EZQA 4ER7A 3Q87B 4HTFB 4PIPA 3MHTA 3VYWA 2EFJA 2FPOA 2YXLA 3TM5A 3GRUA 2Y1WA 5CIYA 1NV8A 2PGXA 1R18A 5K01A 4DQ0A 2PKWA 4RV9A 4YUZA 4Z2YA 5EVJA 4YV1A 1H1DA 3G8BA 4ER3A 3EVFA 1SKMA 3BWYA 5HOQA 3ANXA 2VZ9A 1YZHA 1RJFA 1N2XA 3HVJA 1M6YA 2G72A 4FR0A 3HVHA 4UOEA 4KW7A 1VP9A 5KYGA 3SSMA 1R74A 5K0BA 5F2OA 1FP1D 1KR5A 3HA7A 4DZRA 2XBMA 2ORED 4C07A 5EEGA 1ZKDA 4KVZA 4E30A 2XYVA 3HP7A 1KYWA 3C6KA 5ICEA 5K09A 3WSTA 4DCMA 4MIKA 1X1AA 5BXYA 3FUVA 5E9JA 5P8WA 5DRYA 3B89A 4QVKA 4HG2A 4P7GA 3QOWA 3A7EA 3P97A 1L3IA 4PYMA 4X63A 5DM4A 2H11A 5DTMA 3KHKA 5KQSA 3ID6C 1EQAA 3ELYA 1D2HA 3OZTA 5F2KA 2ZBQA 3LCCA 4WVLA 1TW2A 3FPFA 3MB5A 3MGGA 3OU2A 4E2WA 4AZSA 3RIEA 5K0LA 1EJ6A 1VBFA 2IBTA 3H2BA 3OU6A 3MAGA 3UJAA 4YV2A 4C04A 2IPXA 1JSXA 3CCFA 3IYLW 3KQSA 3DLCA 4H0NA 2ADMA 1X19A 2IP2A 4QTUB 4BY9E 5FCDA 2F8LA 2PWYA 3P9IA 4E31A 3HVKA 3P9KA 2R3SA 2CWWA 3CVOA 1EAMA 5IH3A 1D2GA 3PT9A 5GIPE 5EIFA 2IBSA 1G55A 1SUIA 2OKCA 2WK1A 5ICGA 5C1IA 1JG1A 4O29A 3UZUA 2AR0A 5EMLA 4PYJA 5CD1A 2ZWVA 4EKIA 3I9FA 2EX4A 4K6MA 3GRRA 5DM2A 3SVZA 3NJRA 3T7SA 5DRTA 5MHTA 5GM1A 4YMHA 3HA3A 3HNRA 1JR4A 5E2BA 3R6TA 3T7TA 5JR3A 2YR0A 3BT7A 4RTRA 2GAFA 3LBFA 2PWPA 3QV2A 4KDCA 5JUWA 5CVUA 1L3CA 2ZBRA 2P7HA 4EQZA 4RTQA 3FTCA 1DL5A 5GOZA 1JQDA 5DM1A 4RVGA 5E2AA 2H1RA 4QQKA 1KXZA 2XVAA 1N7JA 3CJQA 3CBGA 3GIWA 2P3LA 2NXCA 3ELUA 2OXTA 3LECA 3EVCA 3G8AA 3SGLA 1U2ZA 3M6XA 2ZTHA 4OQDA 1TPYA 3BGDA 1EJ0A 1HMYA 1RJGA 4GC5A 1YFJA 2AN5A 3DH0A 4GOOD 4QQNA 3DLIA 5DSTA 1XDSA 2OPBA 5LQAA 3KQQA 2VP3A 4PYIA 3BWMA 4HGYA 2HMYB 4C08A 3BWBA 5E1MA 3T0IA 1IY9A 2O06A 4GUAA 2ZVJA 3NWEA 1VP3A 4ZTBA 4RTSA 3ELDA 2GS9A 4OBXA 3PS9A 4RTJA 9MHTA 3G7UA 1QZZA 3M6UA 5E1DA 1KHHA 3CC8A 2NYUA 5FUBA 3B5IA 5CCBA 2I9KA 2OB2A 1L1EA 2JHPA 3LL7A 4PINA 4C03A 3UWPA 4PONA 1X1BA 5EEHA 4NECA 3X0DA 3SX0A 1NBIA 2B78A 1VE3A 2IFTA 3M6WA 4ER5A 3RW9A 3OE4A 5CCXA 3DMFA 3E8SA 1XTPA 2CL5A 5DXAA 2AVNA 3UA4A 1SQGA 5DX8A 1XDUA 3UFBA 2HNKA 1NW5A 2H00A 2QY6A 3TLJA 4ER0A 4FT4A 4IV0A 5EKUA 2GLUA 5BP7A 3OCJA 2YVLA 3LCUA 4YMGA 4P7KA 4CKBA 5HIKA 5K03A 1V39A 4RWZA 2UYCA 2QE6A 3KPWA 2AVDA 3HVIA 4PNEA 4EMSA 3EGEA 1XCJA 2CMHA 3AY0A 3G88A 2PXXA 5FULA 2Z6AA 4X41A 3MTEA 2I7CA 3GWZA 1INLA 4RTOA 4PYLA 4RTMA 1QANA 3EPPA 1L3BA 5E8RA 1FP2A 1SUSA 4FP9A 4E2ZA 1IXKA 3I5UA 4XUCA 5DPMA 3R3HA 5EHIA 3GNLA 3E05A 3P2IA 3IEIA 3ELWA 2IGTA 1Q0TA 2PVCA 3VC2A 2O0LA 3EGVA 5FTWA 5G02A 1AF7A 5M5BA 2FCAA 3LDUA 2DULA 2VS1A 1HNNA 3LPMA 4RTNA 3FYCA 3ERCA 1KPHA 2FRXA 4DM3A 3GCZA 1JSZA 1R8YA 5FA5A 5GP1A 5K0FA 5E1OA 2IIPA 3R9XB 2Y1XA
chains in the Genus database with same CATH superfamily
3PFGA 2IYOA 2D7JA 5DKFA 4MAAA 5FORA 5CFPA 1P4AA 1PNTA 3ONFA 1NNI1 5IJWA 1GNTA 1XLVA 3CF4A 4UZEA 4IXTA 2I2FA 2QG6A 5K4HA 1OH5A 2R5WA 1Z4PX 1OC4A 1WDLA 2JLVA 4H3HB 4ZYVA 3ISJA 4E0BA 4Y1RA 1GDTA 3WLHA 1IQRA 5CFQA 3UJ9A 4B2LA 1HBJA 5L3SB 2O8FA 2I1WA 4Z5XA 1MXFA 4OK6A 1E2MA 3OMLA 3WK8A 1GFWA 2W2TA 2XSZA 3RF7A 3Q0IA 1AKWA 1L5SA 2OQ2A 3VHQA 1DAOA 3AHGA 3T3DA 1OU0A 1JMKC 4X7RA 3L46A 4AF7A 4AF6A 5GGXA 5KWJA 4JJAA 4OHCA 2OA0A 1KSHA 1W1IA 2FQYA 3OM8A 1SKUA 1K6EA 4LK2A 3D31A 1L4YA 2D1RA 1NJ6A 1FYDA 1Z6GA 3PA8A 2XTAA 5ULLA 2X1HA 1XK6A 2R6JA 3G2HA 3T5CA 4BBPA 4BLVA 1OBFO 4DA7A 4E2YA 5GY7A 1ZQ1A 2EJUA 2OD7A 2VAMA 4LOIA 1ZUIA 2QU8A 3DMPA 3ROEA 4DMUB 3JARA 1RVDA 4ZQBA 1M0WA 3DOJA 2VXBA 5IK2D 4Z0NA 5IFLA 1LBEA 4FOOA 4ND1A 5KWSA 4HZGA 5FF9A 2PQ6A 1T3SA 2Q5OA 3C3JA 4B0PA 1RAFA 3DOUA 3FN4A 3NXSA 1LZLA 4LY0A 3ZIUA 1Y6QA 2PWBA 2HLNA 4PX2A 4FX5A 4PYNA 5FPSA 4PLHA 5CT4A 1KYIA 2QLLA 1ZOLA 2X2PA 3BCHA 4CM8B 3WRYA 3ABOB 1JFFA 2BP7B 3BWCA 4IJQA 4PLYA 4D4LA 3O74A 1U4NA 5LQJA 4G85A 4IHKA 10MHA 3LVRE 1ORVA 3QVSA 2Y1CA 3BH7A 2I2BA 4H77A 4RWEA 5K4GA 2H7YA 4KZKA 4KNVA 4MRMA 1N6LA 3ECCA 1JEJA 3HJBA 4RGVA 2HA7A 3O93A 1KEUA 4P93A 4TM8A 2I3GA 3CEHA 5GONF 2OOKA 1TIPA 3SBOA 2FFBA 4O4HA 1QOZA 3OJWA 4H1VA 4HDNA 4BQQA 4RXTA 4IO1A 3ZWXA 1OR8A 1P2DA 4O25A 1WZUA 2W2PA 3T9DA 3SY8A 1YMUA 1VG9B 2OBLA 4OK5A 4FN5A 4JJEA 5ESDA 3N0XA 1ZOOA 4UQOA 3KR9A 4NENB 4DGSA 2AOWA 2H52A 1IMOA 2A67A 4PZDA 3T3HA 4UEKA 3TUIC 4N5MA 2YWCA 3RI3A 2AV6A 1ZO8A 3T1QA 3OZEA 3DBHA 4KXUA 4MHOA 5WRFA 4IV5A 4XVCA 4XOIA 2PSHA 5HIMA 1GQYA 5FIUA 3QBDA 3U3RA 3H5AA 4CMHA 3BFPA 1G8KA 5DIZA 4WZAE 2P6MA 1XZQA 2HEGA 2WR8A 3P7MA 5HKBA 1BXRB 2G80A 5KWIA 2HSGA 1SQ5A 4MQ6A 4YJDA 4BNZA 5JJ5A 2AI1A 3QSGA 4BMNA 4RFLA 1Q1NA 1A3CA 1QIEA 3NOXA 1T4GA 4GP7A 4NESA 4X1OA 3SXUA 4E2FA 2OYCA 3MWDA 3NDRA 1WV1A 1LXCA 3ONDA 5JRZA 1EWQA 2DPMA 4N1AA 3E7WA 3DQPA 4JP2A 4QXPA 5ALJA 5H02A 4O4JA 1B6SA 1NKSA 2DYKA 2I8CA 5DGXA 3AVYA 3HLYA 3A04A 3PKIA 4G84A 4GNKA 4MGIR 3U3MA 2WWXA 4DV0B 4H7HA 3CLUD 4PLWA 2RGNA 1G20B 4YPFA 1WXFA 5TVGA 3UHAA 1FFHA 1QIMA 1HPLA 4UASA 4C7MA 5KYXA 1KI6A 4RGQA 4R0VA 1THTA 1YZUA 3H1FA 3F2VA 4CKYA 3AL3A 4DUGA 3K6SB 1NHGA 5DK4A 5T5QA 1H9CA 2PMDA 4Z99A 4E6PA 1UBEA 3QBJA 3GBPA 3D8RA 1O54A 5DM70 5K0JA 1RIFA 2WI8A 2VDQB 4MV0A 4LCJA 4ZHQA 2UUBB 3QBTA 2FFQA 3U3OA 2IEIA 1CCWA 1OGYA 1Z4JA 4EPVA 1E4VA 3R4VA 4H3SA 5BYJA 2O5EA 4CG2A 1M2GA 2FMKA 4MV1A 3DBRA 2Q9AA 4MV6A 1P45A 2QW0X 3WGGA 1XZKA 2QROA 2ZRHA 1ISMA 1EFTA 2J1LA 5CUQA 1SCNE 1ZNWA 5K8JB 5EG5A 4KVGA 2I67A 2PJDA 2ZI5A 3IIKA 2BTOA 2O14A 1AB6A 1Y6JA 3OX2A 1VLZA 3U0VA 3I9JA 1YQTA 2JH8A 3EG9A 4PZ9A 4D45A 3C3MA 1L4BA 2HQRA 2NVOA 4EZBA 3CXUA 1E7WA 1TU4A 2GAOA 5L3ZA 4D9JA 2I71A 4MPPA 1N0UA 3EXIB 3Q5EA 3CX7A 4ZOAA 3V55A 1Z33A 3U81A 1WPRA 3ZPXA 5KX5A 3VTFA 3I0MA 1DJOA 4I08A 1TPZA 4M8NE 1IG3A 1Q7GA 5GONB 1L1FA 3WISA 2JJ2D 1PGNA 2Y0DA 3LU1A 5LIPA 1ML4A 3HCEA 3NVKI 3M9XA 3R5TA 4HH0A 4M88A 2HX1A 1ABEA 4Q4HB 2FLKA 4BGEA 4NCAA 2BM9A 1GVHA 1U28C 5EE9A 4EG3A 3L1VA 3IPRA 1Z5ZA 2J85A 3PUHA 2W48A 2JI6A 2Q41A 4FR5A 4WLVA 1XO1A 7MHTA 3M82A 2GYUA 4IDBA 2G04A 4K6CA 1WZCA 3HCRA 4FFOA 3RFUA 5JHGB 5CA1F 1HM5A 1EGAA 3LUDA 1DOHA 1YFZA 1QYDA 1XU7A 5REQA 1DJMA 1XN4A 2HB6A 4JLWA 3SLGA 3AFMA 5I4KA 3KT0A 4HAUA 4AU1A 2FVYA 2QLJA 4NH4A 3C5HA 4U7DA 3EE6A 3LX6A 3BMOA 1QU3A 4PCUA 1XZHA 3H13A 5A5EA 3GUHA 6REQB 1YXMA 3HZZA 4A91A 2MSCB 4KIWA 1NVUQ 3WLAA 3IMEA 4XI9A 2ZIFA 1RQRA 1BA2A 1M2OA 3MBOA 4BFXA 3FMOB 4GMXA 4RQBA 4LHEA 1KBZA 1YONA 1M10A 3ILVA 4ENVA 5TEVA 2YIVX 4NOLA 2QZJA 4H7FA 2DM6A 1DCMA 2PGOA 5L3VA 3ZWKA 5HCNA 3TR0A 4AMZA 1RXCA 4TROA 1E7MA 3SG0A 1FNSA 1RFGE 3TIFA 4HXFB 2W11A 5KNDD 3IBGA 4DBLC 4Y1FA 4BO6A 2AR7A 3UUWA 4K6OA 3HJAA 4DMHA 2IUUA 2YVUA 3B6ZA 5HMLA 3R0ZA 4UU7A 1WF6A 3INRA 1RMTA 4QO8A 5AXBA 1X92A 4YROA 1IPHA 1IJKA 2W6JA 3FNQA 4GQIA 3O8BA 1Y8QB 3VPBA 4YUXA 4CIVA 1OAAA 1QIDA 2MR6A 3D7SA 4FFLA 2ZLBA 3N76A 1GTZA 4U1RA 4XQ9A 1ZM7A 4HWGA 4RANA 3SS7X 5KYUA 3WJ1A 4G36A 3N05A 4UC0A 4MPJA 4D5EA 3DR5A 2BEJA 2QZPA 4NYMR 3Q2IA 1WSBA 3F9IA 1RXUA 5DOZA 3TR6A 3IE1A 3OKPA 1YV9A 2VG8A 4XDGA 4KJXA 3D3QA 1G41A 2JD1A 4D25A 4EUNA 1R15A 2XBLA 3KEOA 3ZLJA 1HQYE 2V7VA 1EVLA 2HUNA 3L2OB 3BGVA 2DSNA 1HA3A 1CUXA 1KIFA 4QYWA 4GMDA 3T61A 1H2FA 1KEEA 2AF3C 5CU7A 3V2GA 1TGVA 3NIGB 3OOEA 4OGKA 1CVRA 1O4WA 4BV3A 3OQVA 1M33A 4ZOBA 3HCBA 4HJXA 2WWTA 4QD3A 4C4SA 2VHQA 1PLJA 3DWGA 4S3MA 2HZBA 2PKXA 3DOEA 3MT7A 1KKLA 3IE2A 2BCEA 3LWBA 2XGMA 3ZYZA 4CMGA 5C1DA 5KTMA 4CL2A 1GQQA 1NQAO 1VM6A 2QTBA 3FB4A 3A1SA 3VUEA 5HQJA 3IELA 3O7WA 4M53A 4XYLA 4Q1FA 3WZ2A 4MWBA 3GD7A 4PPQA 4UBOA 5IN5A 3UWSA 3W3AA 3GEEA 4WADA 3RFXA 2UXDB 5HVNA 5CA1B 1H2WA 3MIIA 1W0KA 5TJHA 2ZEJA 3D4IA 3QNWA 3GLHB 1FYFA 4DLUA 2XMRA 5I4BA 4JHLA 3VHXA 1RI3A 1XPJA 1ZCJA 2OSBA 2NX2A 4X9XA 3TDKA 3ZCSA 3QE9Y 3SF8A 2Q4OA 3D2LA 3ZQKA 5HUQA 1QHFA 3BXZA 3FYUA 4G1EB 5C1PA 5ITVA 4FS8A 5CURA 2HWKA 5DHFA 1N9GA 3H0EA 3NC1C 4UOZA 4NMWA 1RWMA 4XCXA 1O97C 2ZJFA 1L4NA 4JYPA 5AKKA 5EZQA 5TQ2A 4HTFB 3WNZA 2PIAA 1BKSB 4TWAA 2QE7D 4PM4A 4X7MA 1AHNA 2Y1WA 3P4XA 4IG9A 4X1KA 1R18A 4C6SA 2I6FA 2Z83A 4ECEA 4Z7OB 3ANTA 1X9IA 2JIZD 5F78A 3RLFA 3LT1A 1MXHA 4ZV4A 4A3SA 4CIAA 1T35A 1YK0A 1E5XA 1Z6XA 1J7KA 1JHVA 1YZHA 1RJFA 4BO7A 3T9FA 1YT5A 5BUZA 4DLZA 5KDOA 1J0CA 3I9LA 5EXPA 3ZW8A 3VI3B 5IZCA 2CFCA 3GP8A 4AJLA 4H0FA 1CQJB 2CFRA 3G49A 4MICA 3G3EA 1EFRD 2X0KA 3LD9A 4F6LA 2WHRA 2B6HA 4N49A 5KCMA 2M2IA 5KKCA 3JATA 5TQ0A 1AB5A 1JAYA 5FPYA 1MTZA 1T8PA 4K9LA 3SFZA 1XWFA 3CUEF 1PS8A 2RGBA 4NK5A 1MJHA 3JQCA 3K9CA 4L51A 3UENA 5BR7A 1GAJA 1RAEA 1G16A 4WLEA 2EX1A 1WB6A 2V8OA 4GUDA 4EVSA 5ESXA 5CDUA 1D2HA 2AJTA 2B7LA 1WMFA 2H7XA 5K0TA 1UT6A 2Y6UA 4ZCLA 2QTRA 4DCUA 1R16A 2FW9A 2GNAA 4EFMA 4LYJA 2XCTB 1FVHA 2J0UA 1NVXQ 1NOIA 2CXTA 4Y2RA 4ZVKA 3H16A 3WQQA 3W1EA 4UXHA 3V33A 3DLCA 3NAZA 3EPLA 5FV4A 3IIIA 4NYIR 4YJHA 1H1LB 3QRWA 5FCDA 4PQYA 5CK4A 3EW9A 3SQMA 2X4IA 2CL7X 3BHIA 3HI4A 3E5RA 3EZLA 3P9KA 4IDPA 1SBYA 1GL6A 3PT9A 1Y3CE 5EIFA 2Q2OA 5IH7A 1JQLB 2ZJ5A 2HHCA 4QGGA 3K0KA 1XTKA 2AR0A 3GDOA 4B45A 4NJMA 4BRSA 1KKUA 2EX4A 1PDVA 1GGHA 2G17A 4CI0B 1C9NA 1SURA 1SU4A 4FFDA 2O8BA 2WFLB 1E60A 2NV2B 1XGKA 3BL8A 4JELA 4EQZA 2WIKA 2WM3A 1T3HA 3RYTC 3U7HB 4FFVA 4HGNA 1TCCA 4HQRA 3T7JA 3AETA 1KXZA 2AR9A 2ATEA 3THWB 1DS6A 4R8VA 1DFHA 1IONA 2P78A 3E0QA 4TSRA 2W2LD 4HWRA 2GD2A 2ZJBA 1S7CA 2WSSA 3GK3A 1SHUX 3JALA 4O2RA 1ISSA 2F6RA 3OOWA 5I5GA 4B4UA 2HIAA 4RH3A 3BSWA 3DH0A 4W8HA 1T1GA 3EXHC 1DEXA 1QZXA 1CP3A 1KZGB 1YASA 2OGWA 1Q1ZA 1WMBA 2BFWA 2I66A 2JS7A 2P5UA 4LCEA 3LY9A 4O2BA 4RZ3A 1E3SA 4Q1VA 5CDSA 3D0QA 3DW3X 1CETA 4RDXA 1H4SA 1JPJA 2JZOA 1JR3D 4RTSA 4LJ7A 1HLPA 2G77B 4IXNA 2GS9A 4OBXA 3S2GA 1OB5A 3HKEB 1IATA 2IYLD 2YZKA 3KAPA 3QHAA 5IAKA 3U48A 4DLTA 4OQPA 3QUCA 1UXGA 1WXEA 3F49S 3FCEA 5CPFA 1X1BA 4AWXA 3GF4A 2AG6A 4YGXB 1V3TA 4RDHA 3SX0A 3ZW7A 4E4TA 3FLMA 3NYRA 4G0OA 3U0BA 2PA0A 2YMPA 1PF7E 3W6UA 4C0BA 3TG8A 1DQRA 2D1TA 3K1AB 2A0YA 1R4NB 4BGIA 1YB4A 1D5WA 1MKYA 3P5SA 2H00A 1X13A 4OFWA 4DUPA 1DKOA 1E77A 2GTHA 3FMGA 1RQGA 3ABIA 3ZVLA 4B32A 4MVJD 4CKBA 4HLUC 2HWUA 3QG1A 2QAJA 1TGYA 2PMWB 3N0RA 1TVKB 2IXDA 1HDRA 4CM6A 3GGPA 1R50A 3ZI0A 5IDWA 3CLVA 3MTEA 1DWQA 1USIA 3GFGA 3X44A 2O0KA 1KJQA 3DDOA 3FBWA 5G4KA 1Q19A 4DR4B 4HWSA 5AM1A 3CN9A 5HKAA 1RYYA 1FP2A 1XJWA 1P0CA 2XADA 3N7AA 2ZJYA 3NHKA 5DPMA 5EHIA 5EWJA 5LBTA 4E2ZA 5CFNA 3VR3A 1UDCA 4EIWA 5ALHA 5KSYA 2FMUA 4JODA 1AUQA 4RMNA 1SHKA 5EVCA 3V6LA 2BF4A 3KELA 3GLGA 1T4DA 1PEDA 2ATVA 4LE1A 1OYYA 3A0UA 4NOKA 5ESWA 1GNQA 4PWZA 1AHPA 5K1ZA 3H5VA 4D2IA 4L5YA 1BMQA 3LYAA 2ZE7A 4JKYA 3HCOA 3UJ6A 2C61A 1CC1S 2TMYA 2VRCA 5TMBA 4LJ9A 2QN7A 5DSXA 1CUHA 2FKNA 3H9JA 5KUTA 1CIPA 1A8PA 1EFHA 1QO7A 4JP8A 1XEWY 2D1SA 2PT9A 3G0IA 1FDRA 2WJWA 4K9KA 3PCTA 5AP9A 3TNFA 2VZ0A 2WWIA 1SCQA 2Z2YA 2OYRA 3SC3A 3O84A 2GZRA 1WRBA 4KAFA 3F71A 4JXJA 2RI0A 4NR0A 1WNFA 3N8IA 1NM5C 3HGMA 2AG5A 3OTHA 3FJ1A 5CVJA 4QDKA 1JKIA 1ZIOA 1GCGA 3ESCA 4M60A 5KYKA 4JFRA 1Y1QA 1UT5A 5C4IA 4M1MA 5B3AA 2YFKA 3DE3X 4TX1A 3IERA 1I4DD 4HWTA 4RD4A 3QK7A 1P60A 3EDRA 1JDVA 2BY4A 1DLIA 2R8PA 2YNMA 3MSCA 2QQ0A 4DZTA 1E6LA 1GZVA 1ZJZA 3KSRA 2Q7DA 1PX2A 4F4JA 3PQFA 4R71A 1EEHA 1ZY2A 3T6KA 5E6UA 1XRLA 2I4TA 4YWJA 4N0MA 4R1NA 3RSLA 1E2KA 4R8MA 3WRXA 5B1YA 1G8AA 3P71T 5CNKA 2O1EA 5JSZB 2FG7C 4HQFA 4NZYA 2PYZA 4BB9A 5BT8A 2XA9A 1LPPA 4CTMA 3KEMA 4WRRA 5CFOA 4IILA 5JXHA 4Z4QA 2FUKA 4IVPA 4KMOA 3RSQA 4J16C 1F12A 2WUVA 1DUIA 3IQFA 3CNBA 4JUDX 4XYBA 3S28A 1VJDA 3UAYA 3WKAA 4R2MA 4C43A 4R1LA 3GRCA 1PL0A 2QRVA 3N0WA 1VPLA 3T4UA 2V45A 1HKHA 4JT2A 2AZMA 2JCBA 3RO7A 4DLYA 5AJYA 3ZNOA 3W8RA 4DAEA 3EF1A 5AW2A 4L5AA 1XZJA 2Q2WA 4O08A 3C2QA 1WPXA 3I9KA 2CUTA 2PGDA 5D7BA 1UMBA 4RH1A 4ROTA 2YX1A 2JA2A 1WXDA 3HXTA 4FFBB 3TTUA 2VATA 4ZPXA 5IJ0A 1K7EB 4HFMA 3S8EA 5EFOA 4EK9A 3VVCA 3DVAB 4G4JA 4HADA 4HK4A 5FWDA 3KB1A 3RVJA 2GPJA 5CYFA 4YRTA 1T3LA 3Q2KA 4ARZB 1UINA 4HAYA 1ORDA 1R9GA 2BMDA 2C04A 3RVBA 4YRFA 2QD4A 1PFVA 2C7PA 3P2JA 3RVLA 4J4BA 3LBAA 4HAIA 4NLLA 4K0RA 6LDHA 4M6WB 2NU7A 1QFJA 2ZXFA 3RT9A 3EARA 1KWGA 5D6NA 4K9QA 3VI4B 2FGKA 2EFCB 3I6ZA 3F6EX 5TY0A 1EAYA 2CD7A 3TOCA 4FS3A 1KDRA 1D6MA 2MSWA 1G18A 4PHTA 5ENVA 4PCLA 1AKEA 1PD0A 1SXJC 2GHTA 4F2DA 4TKUA 3BG5A 3JCZA 1QFZA 4AUMA 3I6YA 3QKRA 3WSWA 4MV7A 2E1PA 2R2GA 5LU9A 3KRTA 3CRNA 4M0MA 3T9EA 1C8BA 2DRIA 4ZO6A 4H6VA 3AHHA 4PX3A 3RADC 1TCAA 2VYFA 1PLKA 2BFBA 5JFTA 2AZ4A 1CUJA 4QGHA 1G5IA 1ZMBA 4R6WA 3TKLA 3P0HA 1BH2A 1P8AA 3RTEA 3C6YA 1NR1A 3RRMA 3WYDA 5I01A 3IBFA 3INGA 1IJFA 1AQYA 2PZGA 3FETA 3AVXA 1OX6A 3DKRA 4S0XA 4EFNA 2NQ8A 1TM3E 2BJHA 2VT2A 3F90A 3M5DA 4CIYA 2C2BA 1GGKA 2C7QA 5DHAA 3HUDA 1J4AA 4UJ3A 2CDNA 1M8JA 1CYDA 3KBBA 5EP1A 3U2QA 4DLLA 4HATA 1G17A 3V1TC 2FG6C 1JX6A 1VTKA 4CR7A 5KU7A 4YUWA 3VV2A 1MGPA 5KVQA 1QHEA 3CLTC 4IDEA 4RNDB 3CURA 2PSJA 2V4UA 2XOKA 1R1DA 1F8XA 3DWEX 3IP3A 3ENNA 4FYMA 5K8UA 4N5IX 1EINA 2POQX 4I46A 4TXNA 5COBA 4BZZA 3GO4A 4ABYA 4J43A 2JDID 1KJIA 2GKGA 3Q3CA 4HC4A 4YO7A 1AKVA 3OT5A 4TTQA 1N75A 2EU8A 3CVVA 2RBKA 3K53A 1W44A 3KM0A 2XNDA 1XDDA 1BMTA 1K9SA 4N01A 4OFXA 5D1HA 3N5CA 5H83A 3WICA 2EBWA 4CR6A 4HV4A 5BNWA 1GPDG 2FAXA 2A1UB 3ORHA 1C3JA 1AHHA 2BGUA 4CF7A 1JZQA 3NBAA 3G1TA 4MQUA 4B44A 1X77A 3G2PA 3AIIA 3PGXA 4FLMA 3TEFA 1UZLA 3TMYA 4FWIB 4WECA 1ZD2P 3MTDA 1BAPA 1LPAB 4X71A 3K92A 2JLSA 2X40A 3R3SA 3X1ZA 4CN8A 1B0PA 3N74A 3KQVA 5C80A 4KN6A 5TPZD 2EP8A 4QYMA 1T91A 4DQKA 3RYHB 2CFIA 3V7UA 4N8EA 4PE5B 2QXTA 1RJEA 1DBQA 3QX3A 3PRJA 1U8EA 3MJRA 5FQNA 1SBCA 4I7EA 2K2QB 3ETHA 4RV5A 1MX9A 2FEAA 4TTJA 1IN7A 3AMVA 3QVTA 1L5RA 5ABPA 1E6UA 1OSNA 3A6EA 3KEFA 3MMSA 4NNOA 4OXIA 1UDWA 1DBSA 1V1JA 3K8OE 5DX1A 1PJ2A 1UFKA 1UJCA 2WVAA 4LNUA 5LP6F 1Q95A 4MQLA 2H2WA 2YDXA 5JNVA 3VRHA 3PB3A 3KO8A 4IIJA 1XC7A 1KF0A 1KOJA 3ANSA 3IBYA 3ESYA 4L5JA 4WCFC 2ACVA 2WZDA 5AW5A 4DBVO 4R51A 2FPWA 3JYPA 4ANFA 4E22A 4ZICA 2RHTA 4UNNA 2NUBA 5FFNA 1ECLA 2FPUA 2FSUA 2I03A 2R8RA 3JPYA 3MMZA 5EA2A 4DCVA 3ZH2A 3ZHOA 3S2FA 4MQFB 5HZKA 1E8DA 3GJXC 4MQEB 4XRRA 1R0YA 3TMAA 1NLMA 1CQZA 3LHKA 2Z8YM 2UU9B 3V00A 3ZD8A 3GFVA 1P5JA 1X1EA 4OUDA 2M6KA 4BEVA 1YRAA 3H6KA 1P1KA 3GBVA 3ONNA 3UMMA 4U8GA 2EKDA 4RHXA 1EE1A 2PK3A 5M04A 1LEHA 3PNQA 4DIEA 4OQ4A 3PQ8A 4RAQA 2Z6UA 4V0NA 1K66A 1WS6A 2QSYA 1EUYA 4P8RA 3ZE1B 3E5HA 4DUZB 4KR3A 3Q3GE 4NCBA 4YB8A 3TQQA 1YSCA 3OUTA 4REQB 4MUYA 4AT1A 4C5AA 4YHHB 3EEOA 3ITNA 4FYPA 2WUEA 4CEIB 1WZNA 4IKOA 1A9TA 1C5KA 4FHEA 3HABA 2G5PA 4IX9A 1MPTA 4MVCA 4OSEA 5EJIA 3R20A 1GPYA 1KJYA 5SY9A 4BNHA 4BWVA 3DT8A 4R4JA 1ORTA 1R00A 1RJDA 2CLCX 2FFRA 1EBFA 2A1IA 1BA3A 1CY4A 2PH1A 3DDHA 4OEHA 4TWZA 4YO8A 3PZBA 3UICA 3ACBA 1RI5A 2UDPA 1TO1E 3B13B 5BYAA 1BWQA 3EF3A 5C8YA 3RC2A 3WIBA 4OV6B 2DU8A 2QTAA 3F5FA 3FVWA 4S1NA 4KGXA 4XGKA 4MUJA 3D4BA 3C8UA 4G37A 1B1CA 2V7UA 3SS8A 4IGEA 5M2QA 4KBGA 4CTKA 2FY8A 4IHQA 1JLHA 1U3CA 4B7XA 3B5EA 1ATZA 2Q0XA 4R68A 4B4DA 2RARA 3F3KA 3AR3A 1FUKA 1ZINA 5FOWA 5JSKA 1WD7A 3AUSA 3L92A 1OLUB 4QUHA 3MWGA 4JDPA 1LV7A 4MYSA 3NP7A 2G0AA 4JYCA 3WWDA 5H9VA 3BHNA 3MTJA 4TTTS 4C5BA 3ZEIA 3NYWA 3HJCA 3HRIA 5I5EA 1US8B 5EHZA 1NDUA 4XR4A 3UT5A 3D43A 5FX2A 2G8LA 4QDJA 1E4YA 2G9UA 1LY1A 2WINI 4Y1EA 1VMDA 1VL5A 2GAJA 4GLFA 2X9NA 4B8YA 4F8YA 2ZDHA 2CW5A 1D4FA 1SBTA 5DULA 3LXUX 3UA3A 5TB5A 3DEHA 3HCCA 3VTAA 3ZE9A 2V6GA 5LP6B 1GPJA 1H3NA 3VBEA 3K0AA 1YIDA 1C30B 2H7VA 5DHPA 2VXYA 2QI9F 3KFLA 3CKLA 4R8SA 3WNVA 4JXZA 2HV9A 1SVWA 3D1LA 4NNPA 4BVHA 3GN1A 2H4WA 2R6GA 2RGAA 3JASA 4QOSA 3GJ7A 3N3AC 1KETA 1R8XA 4GBMA 2IIBA 3BREA 5TJ9A 1ISIA 3H1BA 3VR5A 1PYDA 1Y9AA 2RCYA 3NATA 3W8EA 3GV0A 1U28A 3BKWA 4J9VA 4P92A 4U5XA 3H9CA 2NZUG 4FD2A 1UKAA 3M0EA 3CNHA 2UYQA 4RF5A 5DK6A 3TNYA 4ER6A 2OZEA 1MQAA 3Q87B 4RIIA 2EFJA 4JB3A 3WHLA 5I7HA 5EHNA 1ISJA 4B33A 2Q2NA 4HAVA 1YWGO 1CZUA 1F2VA 4DQ0A 3ZWYA 4OXYA 3MT8A 2BE7A 2NOAA 2FSSA 1KYXA 2XQIA 3VO2A 3QU5A 1VMAA 3HRHA 3MS4A 3IIEA 5ECGC 5L40A 4KR7A 1SAYA 3WP1B 4N4AA 5BV2P 4TN1A 4Q9LA 1E18A 5KYYA 4U7JA 2A9FA 3CRMA 2Q3LA 1V96A 4UATA 5KYWA 4V38A 3H2HA 4YRAA 5CITA 4QVIA 5EUBA 2ZT7A 3A1FA 3I1FA 1JLLB 3GEHA 5EEGA 4B5KA 4W63A 1N4AA 2HBQA 3HP7A 5EESA 1IXRC 2AJBA 2OOSA 2ZIXB 3C8DA 5LLTA 4Y7DA 4L57A 1IXSB 5E9JA 1JMYA 1XZIA 4PPYA 3TZBA 2AA3A 3RODA 3NG1A 3LC1O 1SQ6A 4EWLA 2G4LA 4Z9FA 3TVYA 5AMXA 2NSDA 4AO8A 2Q21A 2X9LA 2OVFA 1E7RA 1XD2A 5F2KA 4CFZA 1FFEA 5IVIA 2J87A 1LPMA 2B3DA 1UPCA 4EH1A 4EPRA 3SJCA 3KB2A 4IICA 2H1CA 4TWJA 2XJ9A 4OJNA 5K0LA 5ELLA 1W19A 4B4WA 4KLRA 5J2UF 1C8VB 4AJEA 2FSPA 1K7FB 4BL5A 3KZCA 1I5OA 2YMQA 3MMPA 2P27A 3ESZA 2B1IA 1W36D 4FFNA 4N8DA 3U56A 3UXYA 4Y0NA 4ZALA 2PWYA 3FVVA 3DVLA 1XPOA 2NZVG 3IGFA 2O1WA 1JLMA 1G6KA 2R3SA 4J3NA 3U26A 4ZJZA 2I9PA 4UVHA 1XTRA 4XGNA 3WAJA 2D2EA 1O8BA 4Q3DA 3C98A 4DVGA 4U7FA 1JG1A 3CZRA 2OFWA 4MQMA 4F7WA 4NRDA 1SB8A 3NALA 3M8KA 2Q5JA 4B3CA 5BYKA 4FIDA 3UJPA 2FPPA 5EE0A 4KPUB 4II3A 2X8WA 3P4YA 4EVRA 4JENA 3LT5A 4OJMX 5AYVA 5U4QA 2RD2A 2WUFA 3F78A 2YV4A 4CMIB 4HDAA 2G6TA 1UPUA 3ZG6A 4RCYA 2VCYA 5KDDA 5DWVA 2NTVA 2JLUA 4RVGA 2P90A 1A71A 1YRHA 2WIBA 3KZMA 3SLRA 2Z5VA 5FUVA 3UYLA 2QL6A 3QYAA 3CCBA 3JD2A 3SSAA 3Q3VA 3GIWA 1GNLA 3PI7A 2OXTA 1H94A 1T5BA 2R1ZA 2ZSAA 1U2ZA 3C6BA 1F14A 1IHDA 1FS5A 2JI9A 3QTTA 2Q28A 4ME6A 3C1TA 4OQDA 3ZCPA 1BE8A 5C7LO 4AWAA 1YFJA 4R0NA 2ZT5A 2OPBA 4ZIRA 3RUDA 2QJWA 1QQ7A 4ZK2A 3GG2A 4ZDJA 5BVGB 3PRHA 2ECPA 4C6TB 2FZ5A 3W2EA 1EDDA 2B4KA 5TGZA 1I7DA 2ZVJA 4EYSA 1J70A 1ILWA 1MT0A 4WGGA 9MHTA 1QP8A 1QZZA 3KP1A 4E5DA 1E5QA 2OB2A 5DNCA 3O8CA 1PW7A 3SQOA 2HFKA 3N58A 3F7OA 5TR9A 5DBOA 3WGOA 1JHQA 1QE0A 3AF4A 3BXHA 2AVNA 1TADA 3BGWA 5F3RA 3LYUA 1NUAA 1SQGA 3UA4A 3MLEA 1UZMA 3BCUA 5CB6A 2EFEB 2C0CA 1GSHA 1TTHA 3KOYA 16PKA 1BVRA 1CT9A 1DINA 3HDTA 1R6XA 4RL6A 2ZB8A 5LQSA 1CE8A 3KETA 4P4GA 4ZRNA 3WB1A 4EW6A 3U4QB 2WTUA 4CU2A 2D0IA 5AJWA 1E2BA 3C43A 2DPXA 2EAUA 3FPSA 3SEFA 3SNHA 2AN9A 4FGJA 5J2UB 1MC5A 3EPPA 4I4CA 3KXPA 4XUCA 1QTQA 1NLYA 1RW4A 1NL3A 1UC8A 3BE6A 4NCKA 1Z5OA 1URPA 4Z4CA 2O3JA 3VC2A 1Q0TA 2MU1A 1OA1A 3VPDA 4CDGA 1T0JB 4D44A 2BMAA 2CF6A 4LY6A 4RVOA 4WOPA 4ZC1A 3WYAA 4C76A 1M7HA 2I7XA 4HLDA 5HYVA 2PUFA 2Z56A 1HH4A 3UOAB 1VLJA 2Q3JA 3Q3JB 1QV7A 3O8DA 2QLMA 1M0EA 4W7HA 9LDTA 2ZIWB 4IV8A 1DTWB 4OUKX 3E7PA 2HLDD 2WAOA 4RHFA 4ZARA 3S44A 2WOOA 3PFHA 4MJ3A 4AJIA 2BR4A 1AHIA 4B6OA 3CB2A 4C5CA 1E1LA 1JR3E 1KTVA 1VPTA 4KRYA 3SBEA 3GC6A 3HL4A 1EDZA 1NN3A 4WJLA 1J2YA 1CJUC 3KQWA 4O4HF 1RJ9B 3IUSA 1O94C 4XVRA 1MV8A 3FRJA 5FA6A 4XGIA 4BBZA 5BV0A 1HFWA 1JA1A 2NAFA 2L18A 5HZMA 1QLJA 3QJGA 1S0UA 3D64A 1QDEA 4ZODA 5JJKA 2AC4A 5I9MA 2RH4A 4HEHA 1O1YA 2DOKA 4NV3A 1Q57A 1WR8A 1XTUA 3BOSA 1IHPA 1NU8A 3CPJB 1G98A 2YW2A 3GNTA 3Q15C 4XIJA 3UANA 1NYQA 4FGLA 4FUQA 1O57A 4HSGA 1BOOA 3N2GA 3AKEA 5AM5A 3LYLA 1AMOA 3D02A 1K63A 3MOIA 1RYEA 3I58A 4JYZA 2AOUA 3DXXA 3I4LA 2FP4A 3ZZNA 4N82A 3MWFA 2HJWA 3CO0S 3DWFA 3IJPA 1GU7A 3SZLA 1KJNA 1NW7A 3R7NA 3T3MB 3ICVA 5L4LA 2PN1A 4ND7A 2VUIB 2B37A 5DBEX 1E4EA 3PF8A 3ZWVA 5JZOA 3U60B 1OX4B 2BFMA 3CRVA 2C5AA 2WIDA 3O31A 2PAAA 3EEQA 4RK0A 4GMKA 4F72A 5JXGA 1FXUA 1PLLA 4J29A 3EXHA 1D2CA 1M34A 4OX9Y 4A0RA 2PH3A 4HRXA 4BJ1A 4EPWA 4ZEXA 4IDDA 1XTBA 3SBXA 4B17A 2REBA 2RH8A 1AMNA 4DMCA 2OCIA 2CDAA 2Z4RA 1KK0A 4B4OA 2WZQA 4A8JC 5HFNA 4JP3A 3NC0C 3SP1A 2YS6A 1VIYA 5CGZA 3AVWA 3IQXA 2O57A 3UB2A 3FTEA 3BA6A 4ZGGA 2RC5A 3BUSA 1MEOA 3JARB 3VAAA 1TIKA 1ZVJA 1LI5A 1KQ3A 1R4MA 2OK8A 3HR4A 3DOCA 4BFZA 3GYBA 4B74A 4ZHQF 1UKBA 3KPUA 4FYVA 5IHXA 4RD3A 3TMKA 5FBKA 4CCSA 4CDRA 2PBZA 2Y77A 4AN1A 4HLUA 3SEAA 3WOVA 3TK1A 1L7OA 4I5DA 3BH0A 5TV2A 4YRPA 4I9GA 3M33A 4R83A 1AH2A 4I3GA 5B6PA 1ZD8A 4C4AA 1R37A 3P5BA 4LTDA 1BDJA 1AO3A 4RQTA 1DT5A 1JFFB 1UXOA 2J0SA 3KT8A 3MT0A 4H7PA 3ZE0B 2F59A 3AM3A 3E58A 5C1BA 4TMTA 3NWOA 3IEPA 3U3JA 3L7JA 1L7EA 4KBFA 4KQGA 3FOAA 4MRMB 3T06B 3DZHA 3AG5A 3GAZA 3A1WA 4IZOA 3ZHQA 2B4QA 5KX5F 1KGDA 3F8SA 4O02B 4XJXA 4AZVA 3A6FA 2RHBA 5K3AA 4RHUA 3UF0A 1J99A 1LFAA 4IEEA 3VDNB 4WUVA 1TVMA 2UZ3A 4D4IA 2CT8A 2XCSB 4O4HB 4YQZA 4HDNB 3U9LA 4W8GA 3CNNA 3V2UA 5DNUA 1LBIA 1NNSA 2QOEA 4HAXA 2C7VA 3DFIA 4AC9A 3SYRA 1AGXA 2ODPA 4Q15A 2CWDA 3UAGA 1IM2A 1A2OA 1FDIA 3I2JA 1JLKA 1IQ0A 2FP3A 2Q4EA 3PR1A 5A9SA 5JS1A 1I2BA 4C89A 4GOXA 3A9RA 3E9QA 3H5OA 4UHCA 1JIXA 5A62A 5C5EA 1HURA 4KB5A 1J49A 2UVDA 4EYGA 1XZEA 3B5JA 4EEXA 1A8SA 1LVUA 1OVMA 5EZYA 3OECA 1NM5A 3OCUA 3DV0A 3FE2A 4UE2A 3ZV4A 3K70B 4HGZA 1KMNA 2FWIA 5AUOB 4P7FA 4AJOA 4QEKA 1G7CA 1T9CA 2VT3A 3QVUA 1WP9A 3K32A 4MEJA 5J23A 3M1LA 3SXUB 3ROGA 3MWDB 2BKAA 1CJTC 4G1MB 4BVJA 5SYMA 1KEKA 3ZD7A 3FYSA 3BJEA 1NATA 3SEQA 2BJWA 2A9PA 4PG7A 2UYGA 1NHWA 4L9WA 4LISA 4IWXA 1L5MA 2DF8A 4ZOEA 2MSNA 2C1XA 1T6YA 5EJ9A 2JLBA 3KR0A 5KYXB 1KI6B 1XNJA 3JV7A 1KEVA 3L8MA 3WGIA 3UJCA 3OJ0A 3FOFC 1E1RA 3V7YA 2R1UA 4J0GA 2GH1A 4UOQA 5DLYA 3H42B 4N5HX 4J16A 3DKKA 1TD9A 3DMNA 5D86A 1ZGJA 1QHNA 3Q6MA 1IAVA 3KQTA 1WG8A 1HDOA 4HNVA 3AEKA 2BEKA 4PHHA 4BGDA 3EOAI 2YJ3A 2H1VA 4ZHQB 5KTOA 4PZYA 1V3VA 3GLVA 2PUJA 4WE3A 4DWOA 3DP9A 2Q5IA 2LV8A 4KUEA 3RV4A 1CF9A 4CV1A 5JYEA 3DBRB 1JEQA 4G1BA 3L0IB 3QEOA 1RDFA 4M21A 1A0OA 3B78A 4B6PA 3MRTA 2GK6A 4EAQA 3NMUF 2J67A 2QG4A 2MYTA 3FPBA 1UBSB 2B5VA 4MAMA 3UG6A 5E9QA 3WLRA 5FTLA 2VJBA 1Z74A 2GI4A 4JQCA 4TLEA 3H2GA 3E7FA 3EG9B 3HXOA 1G2QA 1PJCA 3HDGA 2ILTA 2IV3A 3O21A 4BFCA 1UM8A 3RE1A 3F5QA 1CJBA 4CETA 2VJYA 3ANYB 2PJUA 4UHHA 1USVA 3JZAA 4BE4A 5KX5B 1XPRA 1JU4A 4E3ZA 4HXGA 1G21A 3WB9A 1XELA 3KWFA 2K5UA 2W2NA 4PX9A 1HFEL 1ZGGA 4PG8A 4ZO7A 1JPNA 3OQJA 1NMEA 2GFHA 4NBLA 1LZKA 2X23A 4JEIA 4H1WA 4R5HA 4ZZ2A 3UQZA 3THXA 1PBTA 4MYCA 2VAWA 1WXXA 2QSJA 3GWGA 1SXJA 3GA7A 2VO1A 5A1JA 3H5RA 4ECAA 1U7ZA 4F1JA 3NWPA 5LSAA 2F67A 5REQB 4Q1AA 3RSCA 2QRGA 4GXQA 2DPLA 4X24A 5ICFA 1VCOA 3ZQJA 3VA7A 2ZI4A 2JHCA 2GD1O 2XWQA 3BMOB 4NV0A 2BMJA 3PLNA 1OXXK 3TSZA 1PWZA 3AVPA 4A92A 3LO8A 4DY4A 4U2CA 2M9MA 1R5OA 1C8KA 3FSGA 1TCVA 4EECA 5BSGA 4RHTA 1PU2A 3EC1A 2GM4A 1FCJA 2WAMA 1M2OB 3DFUA 5LJIA 3W8FA 3ZD9A 9GPBA 2PU5A 3CZMA 3BZBA 2CE7A 2JK0A 1WHSB 3DC2A 4UHEA 4X84A 3GB9A 1OXVA 2KJQA 4LI0A 2IS2A 2UXCB 5CAEA 1GNSA 2P7IA 1Z4MA 3FFXA 4M1YA 5F1PA 5K0EA 2YBEA 1XJ5A 4GXRA 1KZYC 5CHEA 1MQ9A 5KNCH 5TLSA 1OFUX 5ER6A 2OM2A 1LA2A 1IN8A 4PBTA 5F3DA 3WWYA 4E32A 1UBGA 1FX1A 3GU3A 5BNTA 2UZ1A 5FADA 1MOZA 2PLRA 2VUSA 1HTBA 4G24A 1JHYA 4BMVA 5KYUB 3SWWA 1IG0A 1ZK2A 3B7WA 1FB5A 2O8EA 3K0BA 1X42A 2R44A 3AC0A 2VNJA 3OZUA 3EXEB 4YIKA 4DIOA 2OD2A 2D0DA 4ZVQA 5K0NA 5JARA 1UBTS 1CW2B 1VLVA 4N6GA 3S2ZA 4H9GA 5JXIA 2AEEA 2C88A 1QJCA 3M3PA 3Q9UA 1P4SA 1PUIA 2QW8A 1PJ4A 1T9HA 1CR6A 2VXOA 2XF2A 2YZGA 5I7OA 1VYTA 2QZZA 1IZZA 4Y2HA 1RS0A 3BIFA 4K9SA 1KEEB 3WA6A 1F9AA 3UHOA 3BZUA 1QH9A 4X94A 3PGVA 1SZDA 1TYBE 5I6DA 1ZUNA 3OCWA 1CHNA 1QGDA 4LDRA 4A5SA 3S81A 2FPRA 1GUFA 3DTVA 3GQBA 3LQKA 1KEWA 1Y5NA 3IXQA 1AUVA 4ZO9A 4A27A 3H2SA 2ZYAA 3CVWA 2OENG 1E20A 1WZEA 4DR3B 4EB3A 5K6RA 3T5TA 2IZ0A 3DEJA 2XUAA 1YR7A 3NB0A 4UBMA 5GZ6A 2QVBA 5JMOA 5T57A 4LC9A 4WCFA 1W48A 3COYA 4FJ2A 3GRUA 1Y8ZA 2IHJA 1MG5A 1BQ3A 4NJOA 5L7YA 3WGMA 1S2MA 2PGXA 4BATA 4DXAA 2PAFA 3LHSA 2X58A 1D1QA 2E89A 2XGOA 2XUZA 3N2KB 3OKFA 3PEEA 4L8GA 4Z2YA 1OQAA 3QXJA 2RE8A 1KAHA 3A6KA 4OSPA 1Z7YA 3VHXB 1G1AA 5AR1A 1ZN7A 1KEPA 3IKJA 3SF8B 5E4YA 5DOVA 3VPXA 3FYUB 4EDFA 3CVJA 3MLAA 3W90A 3AUAA 5IC4A 1K3FA 3CLUC 4XVHA 3HZOA 4A8PA 4EPTA 1JSCA 4YMUA 3W5SA 1Q2XA 2XIJA 3CLHA 3WK5A 4F8JA 5IT0A 5TQ2B 2NSHA 4NZNA 3EUAA 5ICEA 3C97A 1NBMD 1XHEA 5F4ZA 3RNLA 4X1KB 1IBKB 5P8WA 2ZWOA 4OATA 3HR7A 4IH1A 3DHWC 1H22A 2QXUA 4O2BF 1M6WA 2HK9A 3FM9A 3QE3A 2IPOA 3QM1A 3QLJA 1O6CA 2CBGA 4JI1B 2EHDA 5KAPA 3MUFA 5CVCA 3O4IA 4P2GA 4N8SA 1R6TA 1GFZA 3W2HA 4IQ0A 3OP1A 3HY3A 4UFOA 4N0EA 1KDYA 3L7KA 4AZSA 2LKDA 4WLFA 4P86A 3JD3A 3JVIA 1N9KA 3MB8A 3H2BA 3IKLA 4WZAA 4YI5A 4Y2JA 4MYDA 1V5IA 3UIEA 1Y8RA 4UHJA 4UTPA 4HLCA 1K97A 4OSOA 2B35A 2C8KA 4EJ0A 3KK0A 1UBUS 1RC0A 2R4TA 4EB6A 1NE7A 4QTUB 2GA8A 3JATB 4L9AA 5TQ0B 2PKYX 3L7CA 4OHZA 3VFDA 2G88A 2IXGA 3L0DA 4K1LA 4F4DA 3R40A 1F06A 2ZRFA 3BE5A 2FB9A 2UKDA 3OM1A 5FWXA 4ZEWA 1QNFA 4HPWA 3H99A 2NZYA 1SUIA 3I73A 4URZR 4XZ3A 1RP1A 1XWWA 2XDWA 3VDXA 4TUYF 1VIMA 2HHAA 2QUAA 4O6VA 5AI9A 4B9AA 1PWYE 5DMXA 2P9BA 1Y6RA 4MI6A 2J0UB 4MA4A 4D46A 4JQYA 5E2BA 4Q02A 5JSQA 4EJMA 2QIPA 2B8WA 3LBFA 3PSHA 5EJ5A 4QOGA 1ZGCA 1U8TA 4F5ZA 3GDFA 3LOUA 4YJHB 1WSAA 3AHEA 1ML3A 1SIBE 3R2JA 2NU8A 2QMQA 4BJ6A 1C3VA 2VYQA 3GT0A 2C4WA 3KHSA 4EJ6A 2VJOA 1BMDA 1IPEA 1FSGA 3ILYA 3H0KA 4CMBA 2Y1GA 5DGDA 1EJ0A 1DV2A 1X94A 2NXWA 4R40A 3VZSA 1LI7A 4NJMB 1C9DB 1E2QA 1X0VA 2JATA 1RU3A 1HDIA 1QHYA 2ZG6A 4EMUA 4X8MA 2A88A 2CXQA 4WNCA 4RPKA 2O8BB 2PWAA 3PWKA 4LN1A 2XMGA 1ZJWA 4LX8A 1XE3A 1F4LA 3IR6A 5IWAB 4GXNA 3A06A 2F9LA 1GG2A 5B37A 5NULA 4BCBA 4MO2A 1P1HA 4RHCA 4KGZA 4RDIA 1N1MA 2G1JA 1Y1LA 2H2HA 3DMYA 2LZ0A 2ETVA 2JLYA 1LNQA 1HYQA 1JP7A 2WNSA 2QPOA 2GXSA 3E8SA 1HOTA 4L15A 3RK1A 3RYIA 3JALB 1JJAA 1XAJA 2ZS7A 3PXGA 3IAUA 1OGIA 4X8HA 2WY2D 1VHDA 1CUBA 3ETEA 4H7DA 5A4FS 3GN2A 4YRIA 1V7CA 4J6EA 4WNAB 4YRJA 1D4AA 3DL2A 3HVUA 4O2BB 5JCPA 2YC2C 1QZ3A 2ZYVX 4Y6PA 5HBRA 5J9FA 3H9GA 3IAM1 2DZDA 2AVDA 1JIUA 3WNCA 5E0OA 4DYDA 1UP6A 3KTDA 3EGEA 3R9XA 4X7PA 1UEIA 2BONA 1LBQA 4FK8A 1LD3A 1EGVB 1CXZA 3X1WA 5IFKA 3F3YA 2V0GA 1E3DA 2ODQA 5CX1A 3RJ9A 2V7GA 4KX3A 1J8FA 1NUPA 3F9RA 3C7TA 1A5BB 2RJ3A 4D4JA 1FVFA 2B6NA 1Z26A 2O3SA 3PJFA 5F76A 2PSDA 3DYBA 4FYXA 4IQ8A 4RFSA 2BI4A 2OGTA 2VS1A 1TLTA 4WI1A 5AKJA 1EP3B 2HN9A 2VP9A 4FE7A 2AMYA 4CKBB 2VPPA 3JX9A 3K8ZA 5L51A 1P2GA 2IY7A 3CEPB 4ZANA 4A6PA 1YKSA 3K15A 5FWYB 4EDHA 2ILVA 1JNXX 2EIXA 3D6UA 3L6RA 1W6RA 4PVCA 3AHCA 5G4KB 3TTTA 4JI8B 5DTQA 2A9KA 2O4CA 1EK2A 1F8FA 2GBLC 5EWJB 4C6RA 2P6NA 1QGYA 1F1JA 2YVAA 3AQIA 4Q34A 3A27A 1P91A 2XNJA 4DJEC 4R05A 2C20A 5FXMA 4Z2AA 5B55A 2UVQA 1LLFA 4X3OA 2QN8A 5SV2A 4ZGWA 3R3XA 4URXR 3PJGA 3GLGB 3ITKA 3O4GA 3LA8A 5LIRA 4B3SB 2CV2A 3NEAA 1FRNA 3E0XA 2YQ4A 1RPAA 4Q5IA 4FZVA 3LK7A 5FUYA 2PUDA 2O2CA 3ESBA 2ZBUA 4HEA1 4B6FA 4AJKA 3DO5A 5ALEA 3MYYA 5LMCA 1BIFA 2AB0A 2H1HA 1CV2A 1U0HC 2VP5A 3PNPA 4JMPA 4JL8A 4D0GA 4X8OA 1IL0A 2A9JA 3HU5A 5ER9A 5AVQA 3VVLA 2XQKA 1L5GB 3SFVA 3MCTA 2H1SA 3AONB 2WWVD 1GWNA 2Z6QA 4HPJB 1OWPA 3PNLA 5BW6B 4J2HA 5D3KA 4AY3A 2GCNA 5BSKA 2ON6A 2IV7A 2E5FA 4A16A 1Q74A 3JD4A 3FLEA 1YVUA 4CCAA 4D97A 3G2KA 1WUHS 2WZBA 5A7HA 5CDFE 4FE4A 2XA2A 4II2A 4G86A 4Q3AA 1I3MA 1ZVMA 1PSZA 4NE9A 4CDMA 2WJIA 3EWNA 5B30A 1CB0A 4UUQA 2C82A 1L7VC 1DUVG 2WT4A 2AEFA 2BW0A 1EX7A 4HQKA 2ANCA 4J2OA 4QIHA 1U0LA 2DQZA 3VMMA 3F5DA 2JVJA 2BSQA 2JW5A 2OV3A 5FI3A 4BKRA 3A1NA 2N47A 1P5FA 3WIOA 1IZ0A 3OOSA 3AM5A 3P94A 2QGNA 1L7NA 1PGPA 2AIRA 2X4GA 5E6UB 3TJRA 3ZJTA 3PC8C 2H7CA 5K6TA 5JAPA 3M9WA 1U9CA 2LIPA 3AJ8A 4KDRA 4ADSG 4H35A 3VMFA 3S7TA 1UQTA 1SZJG 1KZ7B 1JFVA 2DFLA 1VKNA 2Q3MA 4MGEA 4AZWA 4TM7A 1T0UA 2AZTA 3PLRA 3TPCA 4XUGB 2RGCA 3HY4A 3K2EA 1K5GA 1T4MA 1U8XX 2AXEA 1DMSA 2WWFA 3U39A 4HT3B 2QRVB 1AY0A 4QECA 3LFHA 5F21A 4K0KB 2H3HA 3RU7A 2G9RA 5GPBA 3O9MA 3BBLA 4QUIA 2JLRA 4P31A 4XM2A 3IAS6 1GT6A 4U2EA 2WHQA 1AS0A 3N1UA 1NF3A 4XD7A 3ZTTA 1UMBB 2Q5CA 4GKVA 1YBHA 3BEOA 5PGMA 4Z1MD 1NP6A 1Y8CA 3RQIA 3WHKA 1N3YA 3E3NA 1TYDE 2DJ5A 5CR9A 4JWKA 2VZLA 5IJ0B 1KR2A 1PZXA 5IXSA 5K8TA 1SVKA 2DLCX 3KSMA 4F1KA 1LRKA 1LBSA 1LH0A 2WJAA 4JUCA 2PKCA 1M6VB 2XIQA 4OA5A 1WWKA 3IUNA 4Q4JA 3QTBA 4YALA 4FFMA 1KZ1A 4PRZA 3WMFA 1O77A 4KRGA 4UXIA 4W6ZA 4EB0A 4GYJA 4QTXA 1LJ8A 4REMA 1WV0A 2F1HA 2NU7B 4DA9A 4QAQA 4KQEA 2I8LA 4PQFA 2O7RA 1ULUA 3HR8A 5L3QA 3LDGA 3ZWWA 4IIJF 2QKYA 3LGAA 4EJSC 2WNHA 1RRCA 3VR4A 2VR1A 2ZRIA 4NFYA 4LIPD 2I2AA 4TKUB 1JZTA 3KYJB 1O94A 4JT8A 4Q9AA 1I0IA 4N7MA 4NQRA 3QKRB 2MSEB 1GZHB 4WZZA 2WJJA 3AUXA 1BO6A 1QO0D 4P3PA 4B7ZA 4BKOA 4DCGA 3U31A 3OI7A 3CSSA 4JSTA 3ZKAA 2BFBB 1AX9A 2FJ0A 2ORVA 3LHFA 1RMQA 3KVRA 4GD3Q 4POOA 5ECWA 4ZHSA 3SVTA 2FN3A 2QYSA 2PM8A 3BFVA 4FI3C 5EUMA 3VH2A 1F2TB 2VNIA 1QMGA 2ECOA 3K09C 4I6EA 1C3OA 5EN4A 3RIMA 1WUIS 4P54A 4KIJA 5G1OA 2WG0A 4F4FA 1GZ6A 1SOVA 1TFRA 1XK7A 3T3GA 4BO1A 1I9CA 1QG6A 2JJMA 2XYGA 3SQNA 3PICA 4IMJB 5FEMA 5ALOA 4DA4A 1E79A 2IEAA 3KQLA 1E2DA 5BNZA 3GPCA 2HPHA 1L1QA 3PGKA 4QBGB 1XJQA 3UWOA 4FT2A 2XMBA 1J8VA 5U9CA 3L18A 1Y3DE 3E35A 1ZK3A 3WLPA 3O2NA 3SR3A 3JQ7A 5KZMB 5FWNA 3RABA 1WO8A 3GUZA 3AI7A 4R84A 3L8EA 4YAJA 3U9SA 3VKHA 2J09A 1LGYA 4PZ0A 4HO1X 3TOSA 4Z4EA 4H6PA 1SWVA 2GPNA 1OH6A 2Y1KA 3R9WA 4E11A 5GOTA 5FHRA 2YJTD 3ZY4A 5IVKA 4CQLA 3H9UA 3D8UA 3U7RA 5A0TA 3NV7A 3WGQA 5CDGA 4YUVA 1R88A 4A8JA 1XA3A 1BHJA 2NYRA 1QRUA 1NUUA 5HILA 1ZGHA 2HJSA 1JGTA 3D3EA 4EOGA 3AJDA 1TM4E 1U7PA 3AH8A 1YIOA 4NI5A 2WC1A 3SI7A 2WWYA 4EUFA 2WWHA 2C4TA 1DIBA 1E9EA 1A9SA 1SVUA 1Z39A 2AN4A 3GRZA 3H87A 3R6DA 2WILA 3A7DA 2CJFA 3C3XA 4GVXA 3WLIA 2Q0HA 4AJ1A 3AVUA 1PJAA 4QWWA 4OFZA 1RSZA 2GN4A 1FW8A 2XB2A 4ZWNA 4L2IA 2GWRA 1BRMA 3DUWA 3KOOA 1PYOA 4S1VA 2R6HA 4ZCTA 2HQBA 2P8JA 2XVMA 3PK0A 5IULC 1XD8A 2XTMA 2JI7A 4NMXB 2FMFA 2P91A 5ALWA 2XWSA 4MKZA 1YDGA 3OC6A 4RVDA 2J08A 3PPWA 4BKPA 5K8VA 1OGJA 1AZLA 5I51A 3JWJA 3M4YA 5DB4A 1M7GA 1JB1A 2WJ3A 4L1KA 5H59A 5UKDA 4CUJA 5J58A 5K4AA 2I6GA 1CY8A 2JAUA 4LNUB 4XEUA 1DTEA 4NCIA 1Y3IA 1VC2A 1H2AS 1QB8A 1KMQA 1RWKA 1G5QA 2C3YA 1R6AA 2D54A 3QEJA 4JHXA 4IIJB 1NBOA 1W35A 1WXHA 2HJVA 3O3CA 4AJJA 1IXYA 2BGNA 4AJPA 4MLZA 2HMVA 3I32A 1U3UA 2XT0A 5IWCA 4I8IA 3OQNA 4EI8A 1SHZA 1GL9B 1QS0A 2C2WA 3T34A 3T52A 3Q8LA 2JBHA 2H17A 5F1YA 2OVBA 4CGZA 2AYYA 2CNBA 4PC1A 1AA9A 2D2FA 4QBIA 3V8BA 1B0ZA 3VNVA 3VR1A 2ZRKA 1Z45A 1YZGA 2DFTA 3KPVA 2OECA 2XVYA 4JUIA 5JAHA 4R9VA 4HKTA 1H4TA 4JOQA 4JKIA 3VR6A 4OUDB 2FUEA 1G3RA 1G8SA 3FTDA 1EHYA 1F8GA 1TJPB 3IQEA 1K6JA 2OGUA 3EISA 1XCBA 5LB2A 5FUMA 1EB8A 5JNLA 1WUKS 2I7DA 2IKSA 1ZNZA 1D2EA 5K3FA 2H4HA 4KO8A 3TZCA 3CRZA 4EKGA 3LWNA 1KRWA 4PVDA 2A5DA 1GRVA 4TLCA 3V1MA 2FETA 4GOMD 2BTEA 2KE5A 3DMGA 2JGEA 2X1LA 4WLUA 1PJTA 1E9FA 4A9AA 2ZKLA 4C2BA 4X20B 2AT1A 4NVRA 2GPSA 2ZW9A 1DLJA 1H0RA 1RYDA 1Y37A 3TPZA 2WFMA 3BRWA 4IPTA 3L0ZA 2BGWA 1TAGA 2O7NA 1XVVA 1L9XA 2P6OA 4V2IA 4W5HA 3BM5A 4D8UA 3HCPA 3FWZA 4MRNA 3A3KA 3ZGLA 2GWHA 3FIUA 4XD2A 1JW9B 5G0TA 1KRXA 4XGRA 1H23A 4A2CA 3FDZA 3BWDD 4ZU3A 3AF1A 3B3JA 4ZU6X 1YQWA 2Y2UA 3BA1A 1KAOA 3O8LA 2HRDA 2WV9A 1M72A 1SIOA 2I54A 1ORWA 4QO7A 2RC6A 1V26A 4LK3A 2BHNA 5DH9A 4MPRA 1VFNA 3WFIA 3ZHXA 4BJ5A 3N3BC 2PQMA 3QPBA 5B4UA 3G0GA 4Q7EA 2G1KA 4GRIA 5EHQA 1QVVA 5KTTA 2JFXA 3DW1X 1YRWA 2BKUA 5JBNA 2TMGA 3A14A 4A26A 4NULA 1RLMA 1Z18A 3ICPA 5EYPA 1IB6A 4M7RA 3UPDA 4LRXA 2NN3C 2QTMA 4FYHA 3QUQA 4Z9YA 3EODA 3DXZA 3PKJA 3UT5B 2P5SA 2GGSA 5AK4A 3HEAA 3I42A 2OAGA 3IQGX 2PGNA 2EQBA 3OY7A 3PENA 1I7SB 1E3LA 2PPVA 2JB9A 4D6XA 2NVUB 5HIKA 3A36A 3DVSX 4HBGA 4OOEA 4QNRA 4BB5A 4XLLA 1Q91A 1EZZA 3CUSA 4I4IA 5FL7D 5CIYA 4CBVA 3K0AB 2H1OA 1IRXA 4R9UC 2C0PA 2WVGA 4R2LA 3J7TA 5HE9A 2J3JA 1O96A 2QRMA 1QNLA 3WR5A 4ER3A 5B1SA 3FDIA 3JASB 4RESA 4B84A 5B4VA 1SCJA 1VPWA 3IJRA 4AKTA 3UY4A 3S8YA 1SBNE 1RRKA 2EJVA 3CY6A 1ESNA 4OK3A 2HYIC 4V03A 1HFKA 4U5QA 3X2FA 1AZWA 3VSAA 5DJ5A 1SEPA 2WSLA 1RCTE 2QA5A 2B2NA 2ADFA 3E53A 1RE0A 2BYTA 4G1VA 5TNXA 3TG2A 4B8ZA 1Z25A 5EJGA 2WYWA 1KR5A 3QX8A 1RLTA 5EQFA 3UW3A 2E55A 4M9QA 3N7UA 4J4HA 3EWAA 4P3XA 4TSFD 2QRKA 3GEPA 4CT0A 2CGEA 3C6KA 4P1ZA 4Q37A 4V0KA 4UU8A 1XZAA 2YDYA 4I4NA 2W43A 1OI7A 1QH1A 1CYEA 1CY0A 5A5FA 1ZS9A 3C48A 2A5LA 3HSSA 2H11A 4JITA 1SH7A 4LZLA 3KHKA 1AD2A 4CLDA 3I12A 3ID6C 3M2TA 3ZHRA 1HDGO 5F3WB 2BSAA 4YRKA 2OV8A 3W06A 2PSFA 4R9RA 3MCWA 4E4RA 3KSUA 3NORA 4HUQA 5CRIA 5FOTA 3OIFA 5KYYB 1DFGA 3FOWA 3OWOA 4WXEA 4F2PA 5KYWB 4M46A 1EJ2A 1V8FA 3TVTA 1SRRA 5F33A 1H9BA 4MWOA 4NPHA 3PD0A 2QBYA 2JFQA 2VWGA 1PR2A 5IK2A 3TRHA 3CT6A 4CPDA 4KL8S 2Z9BA 4L8FA 4CKCB 4NX2A 5LFAA 1GZ7A 3WXBA 4XB6B 1N34B 3V34A 2BFNA 2W0MA 5B4TA 1ZNXA 2NZWA 3LI2A 4IO0A 1LKZA 2WU3A 5GIPE 4WBNA 3DB1A 5ILQA 1G5TA 1ONPA 1DIAA 3OIWA 1H2HA 4DWVA 5CD1A 4PTYA 4BIMA 3RVMA 2CVHA 1NVDA 1XD2B 3KEQA 4L22A 1E89A 2CMDA 2KLBA 1I3LA 5A05A 1NZFA 3BAZA 2E4WA 2WPNA 3HLKA 3NTQA 5IC5A 1B76A 5E3HA 1JVBA 2AFHE 4UVGA 1W4ZA 8AT1A 3L40A 3SIPA 4ZKDA 1UQRA 5ALPA 1A4IA 2A0FA 1JQDA 1U65A 1YR8A 1UFVA 1PCXA 1QM5A 2HNAA 3P4UA 2ZR8A 3B85A 3VGPA 5ALKA 3ISVA 5CLQA 3VU1A 4LZZA 1F7VA 2WHYA 4KMMA 4V2UA 2RONA 2H85A 2HC9A 3N2LA 5DYTA 2GHRA 4OP3A 3W5VA 1ACMA 4QC2A 1NBME 1OFIA 1TJ4A 3NCTA 4GVLA 2W6NA 2WF9A 3ZCVA 4IOMA 3GZNA 5IC6A 3INTA 3LQ4A 4JB8A 3KHTA 4XAQA 4JNCA 4PGAA 2FPPB 2RCNA 2GXUA 3QHQA 3GCGA 4JH0A 3NHWA 2BZ1A 4M1EA 2CNOA 4GMFA 2JGMA 5G0UA 2XVZA 1J56A 1OWOA 2HJ9A 3VHRA 4U0KA 1PT6A 4UNPA 1NXOA 2XEDA 4R1MA 1MIOA 4E1BA 2IXEA 4AURA 3R0VA 4DG8A 2OHOA 2B78A 4HS9A 5JCXA 1WY5A 4MO9A 5FOVA 3OE4A 5ALRA 5EQDA 5J5AA 5KJFA 3IAAA 4ZVPA 2JI4A 1E3EA 4IFEA 1WW2A 1A9ZA 1NX6A 2CDCA 2OXEA 1G3UA 3GFSA 4M1SA 1IE3A 3FPAA 1JDNA 3L43A 3TSWA 3VZPA 3TLJA 4ZDIA 1GG5A 3CLRD 4G5YA 3TCXB 3ZIDA 5AW0A 1Q17A 2PFSA 3PEVA 4TS3A 5BSFA 1KBQA 1XZMA 1EFKA 1OA0A 2CCKA 5IRCD 5JWHA 1P9NA 3AG6A 4EGQA 3PUIA 4O1HA 4I0WB 1BE0A 3H8WA 2H9YA 5J4HA 4WLNA 3A9WA 3OTQA 5G4LA 3UGQA 2QW1A 3QPWA 4U0JA 4U63A 3HNOA 2PLNA 3O94A 2AQHA 2EOAA 2OLJA 4PS0A 3R3HA 4QUKA 1K08A 2XHEA 5BQOA 2BEWB 3MGKA 1GV0A 2OKGA 3ELWA 3CLSD 4TT8A 4MMZB 2O0LA 4OO3A 2WWRA 3NTOA 5FOUA 2FWPA 4TWBA 4H1TA 2EW2A 3GD5A 5ADVA 1V0JA 2P0EA 1PL7A 7REQA 2P69A 1CE8B 3GGJA 3KTFA 3PEYA 1UJ5A 1Y7TA 1ISHA 4PLVA 3UOWA 4CLOA 4Z7NB 1QO9A 3D6HA 1TZCA 3N2NA 4BMDA 1PV4A 3NUQA 1AV6A 1N92A 2YKGA 4EB8A 4RVFA 4RA9B 5C8XA 1IMJA 3H86A 1FMFA 1XKXA 3I2HA 1FF9A 3ZE8A 2DWCA 4O3MA 4YCNA 1KIMA 2IZOA 3MUEA 4HYQA 4PGGA 2PMFA 3GVCA 1H2ZA 1T8YA 2C4KA 4EVIA 5BQ3A 2JJ2A 5DCWA 3ZXIA 5LD2C 1KQOA 3NFRA 4KGVA 1J8MF 3GELA 3LFUA 3PLAE 3TIGA 1H0SA 4KO3S 2QN2A 3DAOA 3OPYA 5BQ5A 3UK7A 1ZMRA 4CHGA 1T8RA 2VVTA 4WD3A 5IBCA 3IDZA 4J91A 3OLCX 1RQ7A 4E46A 1TMGE 4PZEA 4WFJA 4HYEA 3KKNA 3FDFA 3FDJA 4G8CA 1QXSA 4RPLA 2NPFA 3KCNA 1UBLS 5A6SB 3A6HA 3A9TA 1JLSA 1LPBB 2V7QD 4GSYA 4OQLA 3T0GA 4BO0A 2WA1A 3G7NA 2Z98A 3RKSA 4F04A 1JVNA 3WMGA 5F51A 2E5WA 3IODA 4EYQA 1OZ0A 1ES9A 1RADA 3DTTA 3G2MA 4LRUA 2BFPA 1GYPA 2VP4A 4EYOA 5JJCA 3I8SA 2BRUC 3K9GA 1UBJS 3T5GA 1SCKA 1A69A 3MINB 4F11A 3AUUA 2RHMA 3OESA 5ERYA 2WD7A 3NDPA 2GSDA 4FCWA 3GGDA 3SOZA 5BSVA 1UBFA 1EFVB 3MD9A 3ZCUA 3O8RA 2GAIA 3ENZA 4E5MA 4BO8A 3PDWA 1PS9A 4QYTA 3RNOA 4C0SA 4FT4A 4Q7LA 2MDTA 3LP6A 5KNDA 1JDTA 4HWOA 1N1EA 2WU1A 4O5OA 5EAIA 1KNXA 2YFQA 4KYVA 5KYTA 3N2GB 1M2JA 1D8AA 2I4NA 2OCAA 3F6BX 4GBED 4LBVA 1BDMA 3FR7A 2GT1A 3G23A 2I3BA 3O8QA 4JBNA 4BECA 2X5XA 4QUBA 3RG2A 4ZVTA 2JI8A 2FP4B 3PD7A 3FIJA 5EZYF 2CB9A 3KB6A 4G26A 1OI3A 4FE3A 4X6XA 5BRAA 2EG9A 4JI0B 5F7OA 4JROA 4LOAA 3RVNA 1IUPA 3AVQA 3IAXA 3IEMA 1E4EB 4BMCA 2BI7A 4J94A 3JVEA 3ETDA 2IYTA 3EY9A 3SDZA 4L8YA 2C5HA 3EXHB 2HI0A 2BBWA 4JLJA 3BX1A 4EF4A 1ZBDA 2AUMA 3RF6A 4HNUA 4FINA 4H18A 4QG7A 3ADBA 3JZMA 4RH0A 4YCAA 3TB4A 3DE5X 2OO5C 1XVAA 3K5WA 3LDAA 3HXPA 4Q82A 2ISQA 4S12A 4TL6A 4ZOLA 3WP0A 2IP1A 1XCOA 4EKEA 2ZK7A 4I55A 1NXXA 2CJXA 4YP0A 1NX9A 1XAGA 3O8OB 1UPXA 1BC5A 4D9FA 2UYHA 1COZA 1SCUA 5FBWB 4JOCA 5MN6A 1W8DA 2D6FA 4MV9A 2NNLD 2GARA 3PQ3A 4P82A 2IOHA 2VJDA 2B25A 4I5GA 1QBKC 2D3WA 3F97A 4N40A 4PO9A 4DQUA 2HT1A 5CM9C 4JOBA 3RBZA 2ZFUA 4EY6A 1WM1A 5IASA 4ZCPA 1RM4A 2ZAYA 2WHPA 4RMGA 2W90A 2XB8A 3SE0A 2EV9A 4YCSA 2HHLA 3DE7X 3VYVA 3WE7A 1YFKA 3ZY2A 1SBZA 1CLUA 2JGIA 3EMVA 1DIGA 4KMRA 4YFVA 5EERA 4F0JA 1E94E 5LUBA 1YCDA 5F2EA 4ZP1A 4MW0A 4YRNA 1HT2E 3RC3A 2YQZA 3HGTA 5BNFA 3ME5A 5A9RA 5GAJA 2MMCA 4UULA 4QE3A 5EKDA 5IUKC 4M22A 3IURA 3Q8XB 4NE2A 3V5NA 2E1RA 3HXLA 1OOEA 2A14A 3RJZA 3K6RA 3NHAA 4YYEA 2P2DA 4CKEA 5HSGA 4Q18A 2GBLA 2XKJE 1KDPA 1F6WA 1Y1SA 4M3NA 4EITA 3TLCA 2DH5A 1ADCA 2KB0A 1NAHA 4LYDA 4MS1B 1KTIA 2XGGA 2LD4A 3ZGXA 4LJ4A 5JPIA 3GUVA 4DAOA 2CUKA 3LNTA 4FWTA 2VCHA 4MA5A 2VQFB 4MWCA 4U2KA 4MINA 3G13A 4BNMA 3ESAA 4S2EA 3REQA 1G8GA 4POAA 3IMGA 5TRTA 1Z12A 3FXAA 3ZNPA 1H4VB 3A70A 1ECJA 3CYFA 3GJ5A 2GEUA 1FRFS 1GCAA 2CLKB 2QE7A 3KKZA 2E0IA 2AKYA 2YXNA 1U2DC 3TLEA 2DGDA 4UEOA 1U3WA 2O5RA 5A9SB 3FUWA 3HWSA 4IQGA 4V0SA 2ONYA 1T43A 4IKPA 4LWZA 1V5EA 3RUEA 3QLUC 3V8MA 1Q21A 1JB9A 3BB1A 3LZDA 1DC3A 5CW2A 2HMAA 3BRQA 1H42A 2C92A 2I1QA 1WCIA 5EZYB 3CKKA 4E13A 3DV0B 3CLKA 2H08A 4QFMA 4R1QA 8ABPA 1IY1A 1LF0A 1EWYA 1U02A 2PT6A 3ZJ5A 3RG8A 3Q8WA 1FNCA 3IHWA 1DTSA 4KMSA 2D1FA 1PIWA 4PIVA 5EE1A 1QGZA 2GJ9A 2PS3A 3HLTA 2DBRA 2I6XA 3FAKA 3C3YA 4G5OA 2TS1A 5K7SA 2O2YA 3MVEA 2JLAA 3O3O