4BLWA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylhomocysteine (adohcy) and adenosine monophosphate (amp)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
280
structure length
280
Chain Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blwA00
5DPMA 3C6MA 2PXCA 2BM9A 5BXYA 4QTUB 1KHHA 5LQAA 4PCLA 3NMUF 3I58A 3OPNA 2PX4A 3FUTA 5HEKA 3ELDA 4OQEA 3KQOA 5K01A 4LWPA 3DLIA 4PINA 2AOUB 3LKZA 1UIRA 2ADMA 5DM1A 3DMFA 5E1MA 3ELUA 2E5WA 2FCAA 3C0KA 3P2IA 4FSXA 5EEGA 2P40A 2O57A 4YV1A 3THSA 3CJQA 3NVMB 3NTVA 4C07A 2Y1XA 3LCUA 1VIDA 1SVUA 2ERCA 3FTFA 4PNEA 3X0DA 5DM0A 2NP6A 1F38A 1RJEA 5K0LA 3TOSA 3A7DA 2ZW9A 5JR3A 1EG2A 2DULA 4RSRA 3RW9A 3DH0A 5F2KA 4CWAA 2AOUA 3WSTA 3TRKA 2IH4A 2AN5A 3KHKA 3FTEA 2GS9A 3E7PA 3GIWA 5KS2A 1JG4A 1JTFA 3CC8A 10MHA 2C7QA 2UYCA 5CD1A 3MERA 5LQUA 1KPIA 3PT9A 3C3YA 3EVZA 5CM2Z 2OY0A 4ER7A 5FCDA 5ICGA 5CUQA 3ORHA 4DM3A 2P41A 1QAQA 5CVEA 5K8VA 3R9XB 3SSNA 3KPJA 3GO4A 4DCGA 1NW8A 3EVAA 3EEYA 3Q7EA 5DTQA 3HTXA 3HCBA 1TW2A 4P58A 4QPNA 5EMMA 2BR5A 2ZBQA 1IM8A 3KU1A 3A25A 4FZVA 4X1OA 5E8JA 2JHAA 4CKBA 2JH8A 2XYVA 2LD4A 3C3PA 3HCDA 1O9GA 3UJDA 4A6DA 1I1NA 3DXZA 5LQKA 2OKCA 3BGVA 1RI1A 1P39A 3FPFA 2C7OA 2PBFA 2ONZA 1FJXA 3GRRA 4EKGA 3UBTA 4HRAA 3TM5A 2YTZA 2B9EA 3ELYA 2ZBRA 4LECA 2PX8A 5DSTA 4CKCA 4E2WA 2NP7A 4FS8A 2ONYA 1AF7A 2O05A 3OZRA 3RIEA 3UJAA 3AXSA 3BUSA 3HA7A 4QTTB 3DR5A 3KQMA 2XVMA 5DT2A 5FWAA 3P9KA 5EZQA 5ICEA 4RTLA 1X1DA 1P1CA 1D2HA 3O4FA 4AZTA 2DPMA 3SVZA 2PXXA 4KVZA 4FSDA 4XUCA 2OB1A 3EEOA 1AV6A 4EQZA 2OYRA 3C6KA 1RI3A 2OXTA 2JHCA 4E30A 1AQIA 1ZGJA 4EVIA 5K0GA 2HNKA 3EVFA 1D2GA 2BM8A 4AZVA 1MHTA 1L3IA 2PSSA 4X60A 3FTCA 3LBYA 3BZBA 2QRVB 1NBHA 2IH5A 3CCFA 3QV2A 3FYDA 1R18A 3CGGA 4EMSA 3GRVA 1R00A 5EVJA 5EIWA 3EVEA 3HA5A 3DUWA 3REOA 2NXEA 4KDRA 4U7TB 4QQKA 3IHTA 3FUWA 2GA9A 3EPPA 1VQ1A 3FZGA 1QYRA 1YUBA 1ZGAA 3FPGA 5FTWA 5HILA 3HEMA 5E1BA 4YUXA 4RWZA 1Z3CA 2HMYB 4L7VA 5HFJA 3RODA 1BHJA 4FR0A 5E2BA 2O06A 3JWHA 4Y30A 5DRTA 2I9KA 2EJTA 3BXOA 1KXZA 3TR6A 2CMHA 5HZMA 4ISCA 4GEKA 4IWNA 4PGHA 3VSEA 3KR0A 3A7EA 4YUZA 2QRVA 5EEHA 3SX0A 2CMGA 3I53A 4XUEA 2P35A 4IKPA 4F86A 3CVOA 1NV8A 1AQJA 4JXJA 3FUUA 4FT2A 5FULA 2CKDA 2ZWAA 4PYMA 4PGGA 3QOXA 4RVFA 3EMBA 2PV0A 2AOTB 2AZTA 2OPBA 3MGGA 3SXJA 1HNNA 5EQJB 3THRA 2YQZA 4BP3A 4YMHA 1Y8CA 2AOWA 5IH3A 3HCEA 4C05A 3KQSA 2ZWVA 3LHDA 5DRYA 1EJ0A 1N2XA 2V7EA 1R8YA 4R8SA 3BWYA 3HCFA 2JH9A 2VZ9A 2Q41A 1MJFA 2EFJA 5E1DA 5C0OE 5CCXA 3KPYA 3CJTA 1SQFA 1PRYA 1IXKA 2EJUA 2GB4A 3EVGA 3BKXA 3QOWA 3FPHA 3O31A 5DSXA 3UJ6A 1JR4A 2G72A 1ZG3A 3LBFA 1VPTA 3G2OA 4PYQA 3UZUA 3UJ9A 3GXOA 2PT6A 5DX1A 5K0NA 4C08A 3B3JA 1RI5A 1FP2A 2IPXA 3IYLW 2AOTA 3R24A 4KDCA 5FA5A 4RTPA 4MTLA 4R6XA 5EPEA 4KRGA 1WZNA 4RTNA 8MHTA 2QYOA 2O07A 1VL5A 2IGTA 3I5UA 4UOEA 5BW4A 4NECA 1NW6A 2Z6UA 3P97A 1KIAA 3KPUA 1G38A 4P7KA 2EG5A 4H0NA 5CVVA 3KQWA 3V8VA 4E33A 3SMQA 1JQ3A 2GPYA 4RTJA 3PS9A 2ZZKA 2PX2A 5K03A 4C03A 3NWEA 3T7RA 4FT4A 4DQ0A 1VLMA 1KR5A 5BP7A 3G2QA 2PKWA 4PYIA 4R8RA 4DA4A 1ORHA 4C04A 2YXEA 3PX3A 4OQDA 1H1DA 1QZZA 3ER8A 1WS6A 1XTPA 2ZSUA 3KQYA 3GDHA 1YZ3A 2V74B 3P2KA 3KR1A 1NW7A 2IBTA 1BKYA 1XJ5A 3UJ8A 2G70A 4QDKA 2XVAA 3NJRA 4MWZA 2FYTA 5FUBA 2ZCJA 1JQEA 2NXCA 4FGZA 1YB2A 3T7TA 3BWMA 5GIOE 5DTMA 3SGLA 3GRUA 5KQSA 3ID6C 4EKIA 4GOND 1ZHFA 3G8BA 4RVGA 2JHPA 4MIKA 3LL7A 3MTEA 4GOLD 4P7FA 3V97A 5F2NA 5LQJA 4PWYA 4PYNA 4M38A 4PYLA 1Q0TA 1YFJA 4RTMA 4QVKA 4R6WA 1RJFA 3A4TA 1RJDA 1XVAA 3EVDA 5DLYA 1NT2A 1FP1D 2B2CA 5GM2A 2IDKA 2AN4A 5E9QA 2H11A 5CIYA 3G2MA 4AZWA 3BWCA 2BR3A 4M7RA 2VDWA 2IP2A 2Z6QA 2P3QA 3TFWA 4E2YA 2NXNA 4M37A 4P7JA 1X1CA 3B3FA 4IV8A 4OBXA 3DTNA 4YUVA 3DULA 4AZSA 3KKZA 1INLA 3I9FA 3TMAA 4ER3A 4AX8A 3BGIA 5ERGB 3T7SA 2IIPA 3TKAA 3VC1A 5GP1A 3GU3A 3DLCA 3OU6A 3TLJA 2Y1WA 3ELWA 1SG9A 1RI2A 3MAGA 2AR0A 1UWVA 4GOMD 4RYLA 5LR6A 1M6YA 2P3OA 3M6XA 3FYCA 4B17A 1VP9A 3DP7A 2WA2A 2NXJA 4KW7A 2NNWB 3T0IA 3GWZA 5K0JA 3P9CA 4E2ZA 2QM3A 3DMGA 4WXHA 3OZSA 1JG3A 1X1BA 5FQNA 4RV9A 4M36A 4BLWA 4HC4A 3KQQA 1F3LA 5EHIA 3K6RA 4Z2YA 4BY9E 3GGDA 5DTRA 4GUAA 1TW3A 3EGIA 5FHRA 3FRHA 4HGYA 1QANA 3B7PA 4KWCA 4XCXA 3UJ7A 5K0BA 2K4MA 4QDJA 3P9NA 5EMJA 1EQAA 1FPQA 2P8JA 4FP9A 1I4WA 1JQDA 4C06A 4O29A 5K0FA 5GIPE 5FWDA 3E8SA 2ZZMA 3MHTA 3FUXA 3P71T 3HCAA 4GOOD 3NVKI 3PLAE 1PJZA 5D1HA 4RTRA 1XDSA 5FA8A 4RTQA 1XCLA 4GBED 2PY6A 5HOQA 2OO3A 9MHTA 4U7PB 1SUSA 2FHPA 3B5IA 3OE4A 4EK9A 3HVIA 1YF3A 3GJYA 2OBFA 5EKXA 3GRYA 3OFKA 2PVCA 3ANXA 3BWBA 4CKEA 2UZ4A 4R05A 1G55A 3P2EA 4YUWA 2PX5A 5EG5A 5LQRA 2VS1A 5FADA 1XCJA 4HG2A 5H02A 1EIZA 5D1NA 3KR9A 4LWOA 5KQRA 3A27A 3MCTA 3LECA 3FPEA 1JG1A 3KQTA 3UJCA 3VYWA 2WK1A 2P7IA 2F8LA 3LKDA 1WG8A 4RVDA 3SSOA 4RTSA 2P7HA 3EMDA 3KPWA 4GC5A 2I6GA 4GF5A 4YV2A 5T67A 3ERCA 3OCJA 3LX6A 2P1DA 1B42A 2GAFA 2YVLA 3OU2A 3SSMA 1N7JA 3LSTA 4MQ4A 5GOZA 4DF3A 3PTAA 1U2ZA 1WY7A 2QE6A 4G56A 2IDJA 4RTKA 5K05A 1M0EA 5GM1A 3LPMA 1G8SA 1IY9A 3PVCA 3MQ2A 5K09A 5EC8A 2FK7A 5K0EA 5HIKA 2Z6AA 3TKYA 1OR8A 3PB3A 5EZSA 3GRZA 2ZIGA 1Q0SA 2XBMA 3JWJA 5EKUA 4QPPA 4CTJA 4POOA 4QVGA 2CWWA 1L3BA 1L9KA 1EAMA 4GC9A 3UA4A 4ER5A 5IKMA 1M6EX 3HP7A 5G02A 3U81A 4PYJA 2AOVA 1QAMA 2AVDA 3UFBA 1HMYA 3NW9A 1DUSA 3AXTA 1RI4A 3HVJA 5DXJA 3MB5A 4BLUA 1VP3A 1XDUA 2R3SA 4YV0A 4ER0A 2YXLA 4OX9Y 2C7RA 3GNLA 5GINE 1SUIA 3EGEA 4F84A 5E8RA 1NBIA 2IH2A 5DX8A 3B3GA 5DX0A 2ZZNA 5DM4A 3UWPA 5EIFA 5CVJA 3HVKA 5DXAA 1L1EA 4V0QA 5CVUA 3G89A 4PONA 5E1OA 5C1IA 3BGDA 1SQGA 1RJGA 2VDUE 3LGAA 2NYUA 3VC2A 5LQCA 1YZHA 3MTIA 2ESRA 5E9WA 4RVHA 2VDVE 3OE5A 2PWYA 3G8AA 2HR1A 2YX1A 3NWBA 5T6BA 5P8WA 2C7PA 3G88A 4OA5A 3G2PA 2PWPA 3F4KA 3R6TA 4HGZA 3S68A 2P3LA 1QAOA 3UJBA 1NW3A 5LSAA 1VBFA 2YXDA 3JWGA 3R0QA 5T64A 2FK8A 3ER9A 2B3TA 5KVAA 3LDGA 4BP1A 1NW5A 5E9JA 4GQBA 4ZTBA 5FHQA 5EMKA 2O0LA 1R6AA 2G71A 1O54A 2ZTHA 2XYQA 3E05A 3K0BA 2HTEA 3OFJA 3I64A 5U4XA 5CVDA 1KP9A 1BOOA 5EOVA 3D2LA 4F85A 4YUYA 2G1PA 5ICCA 3P9IA 4KIFA 3R3HA 5JUWA 3M6VA 2HWKA 4RTOA 4MHTA 3O7WA 3TQSA 3LDFA 3NDJA 4DMGA 3KQPA 2N47A 1KYZA 2ZIFA 1YFLA 2G8NA 3DMHA 1XXLA 1D2CA 3NDIA 4PYKA 2EX4A 4KIGA 1NV9A 3G5LA 2JJQA 3UA3A 4P7GA 4X41A 1G60A 2PT9A 3A26A 3HA3A 3CKKA 1G6Q1 3M4XA 4XUDA 5MHTA 3CJRA 5CCBA 7MHTA 2A14A 3FRIA 4ER6A 3M70A 4E32A 2IBSA 5DWQA 4LG1A 2BH2A 2BZGA 3CBGA 2XYRA 3EVCA 5GWXA 2VP3A 2PJDA 3TM4A 3Q87B 1JSZA 1P91A 3L8DA 1JTEA 2ZBPA 3HM2A 5LQNA 2ZULA 1P1BA 3LDUA 1ZQ9A 3GCZA 4HTFB 3SM3A 3E23A 1UFKA 4PCAA 2BR4A 1DL5A 4DZRA 2QY6A 3PFHA 1WXXA 3PX2A 5HIMA 1VE3A 1T43A 3ME5A 4BLVA 4E31A 1X1AA 4QQNA 3OU7A 2FPOA 3DXXA 2OB2A 3AJDA 2YR0A 5EHGA 4CTKA 2H00A 5K0CA 5C9ZA 1KPHA 3M6UA 3IEIA 3PFGA 4Y2HA 5HIJA 4YMGA 2WA1A 2ZFUA 5KYGA 4E70A 2GLUA 3BT7A 1KPGA 4HH4A 4HTFA 3M33A 2ORED 5B1SA 1ORIA 2HV9A 3FTDA 3HVHA 1ZKDA 2UYOA 3G7UA 4X61A 4OA8A 1NKVA 2I7CA 3JWIA 4E2XA 2R6ZA 2AVNA 1I9GA 5DM2A 4C4AA 3EGVA 3KR2A 3OZTA 4PIPA 3BKWA 4DCMA 3B89A 2ZVJA 4AUKA 1NE2A 4IV0A 2PXAA 1KYWA 4PIMA 1EJ6A 5M5BA 1JSXA 2UYHA 3KPVA 3TPZA 4WVLA 2KW5A 3H2BA 4X63A 5F2OA 1XDZA 1O9HA 2YUIA 4RX1A 2B78A 5EMLA 1DCTA 1BC5A 3AY0A 3LCCA 2ZIEA 3AWIA 4K6MA 4OBWA 2PLWA 3IV6A 3HCCA 1WXWA 3P8ZA 2ZLBA 3KQVA 1FBNA 5E2AA 1N7IA 5ICFA 4PYOA 2AN3A 2I62A 2AOXA 3FPJA 4V0RA 2H1RA 5HIIA 5EGSA 5BW5A 2FRXA 1R74A 3MCZA 3EVBA 3HNRA 2IFTA 1JG2A 4HSGA 3DXYA 4A6EA 3DOUA 2B25A 2GH1A 4CXMA 1TPYA 2PGXA 4DKJA 3M6WA 1G8AA 3SR4A 2JG3A 2AS0A 2CL5A 2OZVA 3G5TA 3FUVA 1SKMA 3LCVB 1L3CA 1R8XA 4ATNA 1V39A 1X19A 5FQOA 2UYQA
chains in the Genus database with same CATH superfamily
4EP1A 1NTRA 5DLEA 1HE1C 4D96A 3N39C 3PXDA 2ZRPA 5E6UB 5EY5B 2ZJOA 1X8LA 2HN9A 4MUJA 3GEBA 2MT9A 1I2CA 2RHCA 2FQQA 2I03A 3VJLA 5HEKA 1Z6GA 1SA0A 2FEAA 2OWEA 4ZHQF 2CLCX 3CISA 3QLJA 3DDNA 3DLIA 1SCNE 3SQNA 3JYOA 1I2BA 2BONA 4WK4B 2V0CA 2I1WA 4B75A 2IL1A 3IOYA 5F5NA 4A92A 1GZ7A 3OSZA 4UOZA 1TC2A 3P2IA 1HWYA 3LW8A 4Q82A 1Y5IA 4WK6A 4Z9AA 4WXEA 4R31A 2O6HA 3ZWMA 1HEIA 1MO6A 2QW8A 1P7VA 4NMMA 4QFMA 3LCUA 5KNCA 1ZBQA 2JLZA 2B4YA 3KFVA 3L6BA 1Z2AA 4MYDA 1W46A 2IIQA 1TK2A 1JFSA 3T7JA 3M4YA 4CN9A 3H4MA 2RAUA 1OFGA 1XEAA 3I4CA 4X44A 4E11A 3LDAA 2JLCA 5A9SA 1CNFA 2E0IA 2WU0A 3VTZA 1MCZA 2J9ZB 1NQTA 3UXEA 4TQUS 1O77A 3S3TA 1FSZA 4DW8A 2H2WA 2B20A 1EXWA 1HOTA 2JFVA 5ICGA 1WB5A 4EHHA 1YWGO 1EXNA 5CVEA 5IXJA 3RV3A 4ZO8A 1T9ZA 3KPJA 4Y1RB 5MN5A 3ZWYA 5LNK6 4LEIA 3CN7A 4JK3A 4MWCA 1SCAA 3AI3A 5KNCH 3KKNA 3DTVD 4P9NA 2I2DA 1E2HA 1KAOA 2P1RA 4AY4A 3BSYA 1MABB 2OECA 2GJKA 1QQ5A 3I83A 5E8JA 3H87A 3UJDA 4YJ3A 1NVGA 4E7OA 3HGMA 3DXZA 4D0SA 1WMSA 3IAXA 4XWTA 3R8XA 3NGXA 3NHRA 3D3WA 1IZYA 1M34E 1XUOA 2D5AA 3CEMA 1PI3A 3V5NA 4E1VA 1E18A 1MB4A 3KLPX 4R7ZA 1DO2A 2PPLA 1MH9A 1UPTA 4BNXA 5IBCA 2ZBRA 2J6BA 3UFXB 3N07A 5BNFA 4W1RA 1XZMA 2AW3A 1EFPB 3AXSA 4M1WA 3G2JA 4E07A 1EUZA 2FQ1A 2D13A 2FZ4A 3IFSA 5JSHA 1D9ZA 2IS4A 3D6TB 2CYAA 1KK2A 1UZAA 1U8FO 2QG6A 5ED0A 1I36A 2PXXA 5CHYA 2H0QA 4XUCA 5JE8A 4BGDA 4GPTA 1JA9A 2NU9A 4AJJA 1OXKB 1ZW1A 1MQ9A 1T9DA 3QPDA 3WHLA 3G2NA 4OSPA 4Q9NA 1GY8A 4F2HA 3Q72A 3CGWA 3L4SO 3PXBA 5ALZA 2HD4A 3UGJA 1NKTA 3NIDB 1RRKA 2CGEA 4IOJA 4DB4A 3ZLTA 4Q4JB 3FROA 3T3HA 1U90A 1Z0DA 4NJEB 4ESVA 3DUWA 2ZGVA 1CUEA 1Q1GA 1C41A 4FJ2A 1AV7A 1K7YA 1X14A 2IZ6A 3MOGA 1MAWA 3FZGA 4PLPA 3SJCA 1YUBA 3VR2D 3ZW9A 2R7KA 1MIOB 1Z5UA 3NEYA 1MLDA 2Q45A 5HFJA 3I01A 3BRWD 3OZCA 3TR6A 1TMGE 3ONEA 5BWBA 2J0UA 2PZBA 3GVIA 4ISCA 4YHHB 2NG1A 2XDYA 2YV4A 4R98A 3HZHA 4YH1A 2O8DA 3RUPA 3H9QA 1EVYA 5EEHA 2QVYX 2RDMA 9LDTA 5J43A 5KX5F 1T24A 1WOYA 2YOGA 1S3GA 3EZ2A 3Q7TA 4G0MA 4UUMA 4OUDB 1U9CA 3D3NA 4HB2A 3PI7A 1ZM3A 4FT2A 4PYMA 2QUZA 2BM1A 1MFPA 3WB0A 3ICQB 3QSYA 1E2UA 1ZOIA 2P5SA 2R1ZA 3MGGA 1FLAA 4Z8YA 2CE7A 2JEZA 1NWCA 5C4GB 1JR3D 2ZDQA 2BDEA 3BMOA 3EK2A 3PCRB 1JW9B 1ZM9A 2CF6A 4K40A 1IJKA 2MSEB 3FMGA 1ZWLA 3EEBA 4YO8A 4F9FA 1QVRA 4RU1A 3FWHA 2VZ9A 4AVYA 3D2BA 3EAFA 3GEPA 4RZSA 1CWUA 3DO5A 2Y68A 2C9OA 2ZSEA 3L43A 3R0IA 4O1MA 4KPUA 5FEMA 2XJ4A 2TYSB 2CJFA 3CG0A 1P2FA 4C5AA 3BIJA 3MELA 3UC5A 4GX1A 5TEVA 4NG5A 1B3RA 3OKFA 4WXMA 1ZKMA 3OICA 3B7WA 4G24A 1VL6A 4P80A 1OLOA 2D8AA 2P2YA 1GQRA 5EP4A 1GAEO 2D1FA 4Y2VA 3FFWA 5JYBA 3C2QA 3HHEA 3PUZA 3C16C 3U4QA 3UUEA 1M2VA 1Y5NA 4ZMBA 1KI6A 1PL6A 4RJJA 4CQNA 1L2TA 2H17A 3KUDA 4BV2A 2EG5A 2C59A 4XRGA 1OH7A 4FFPA 3RAGA 2H5JA 4G0PA 3GLFE 1MH1A 2YJTD 1M66A 4Q3OA 1QFMA 2BY4A 3PG5A 5BUSA 2RCYA 1JNYA 2I87A 4PGFA 5TNXA 5BT8A 3GLSA 4RENA 3ELBA 2J7PA 4ZXFA 3TLMA 2WP0A 4BASA 1MUUA 1SBZA 3LVFO 3MWYW 3I37X 2A7QA 3ZJUA 2ZSUA 4JQZA 1X87A 3ZXIA 4UZSA 2V74B 4KZPA 1ZK2A 5K99A 4BO2A 4DC1A 2C0QA 3RQSA 3NLLA 2W6JD 4I1VA 3O26A 5LMZA 1SVLA 4XB1A 4QUHA 3QKIA 2P30A 4BZPA 3GT3A 2BMJA 3UKOA 5FBZA 5A62A 4UQOA 3ICCA 3D2AA 1C7ZA 5GJCA 1YUMA 3WGZA 1Q7CA 5G0VA 3KX2A 1Y7HA 1S02A 3MRVA 2AUMA 2QNIA 2QMOA 2VWQA 3C85A 4H2DA 1J2RA 4U00A 2OBNA 4Z8XA 4O2BA 4XGKA 1Q0ZA 4IOKA 4A0FA 1T8UA 1CY0A 3A4TA 3P0HA 5A04A 1ZNWA 4MCHA 1SU7A 4ENVA 4Z0PA 3G2MA 1RCTE 2HBRA 4FXPA 1A1SA 3H19A 2X40A 2WM8A 1GU1A 4JI3B 3HMQA 3I9V6 5HK8A 2WSSA 2ZJBA 2ODAA 3H1PA 3TW8A 3B12A 3QA9A 3STHA 4DLXA 4OBXA 3BFPA 3TS1A 1KSHA 2CZQA 4H1TA 4ER3A 2G06A 2DPHA 2XMZA 3SF8A 3KIPA 1N34B 1WBBA 1JSLA 2X8JB 4Y2YA 4X45A 1QGZA 1A3CA 3PUHA 1O94C 1S2NA 2YV2A 3VNRA 1FYEA 2Z5LA 3AOEA 1P3JA 5TR9A 2HW8A 1A0OA 4G5HA 2ISQA 2C5AA 4XSGA 2HSEA 5EHIA 5JMOA 4ZVQA 4BAGA 3ZNOA 1PVDA 2FSSA 4JX9A 5JEDA 2K4MA 1DBSA 2NV0A 2PBZA 3P27A 3ZJ4A 2MMGA 2GJ9A 4HWOA 2YICA 1GPJA 2QMZA 3WIUA 5DHQA 5K0FA 2DFPA 4R2MA 1D03A 2IXTA 3PQ5A 2QT0A 3HCAA 4EDHA 3L4KA 4WY2A 2BGWA 1BGWA 1XDSA 3JQBA 3RFTA 3BB3A 1MDFA 5HOQA 4RULA 4FXOA 3C6XA 2Z1NA 4MP8A 1U4OA 4EK9A 3M3DA 4RGYA 4WI1A 3HYNA 1I30A 3KEGA 3EFHA 3GZTB 1Z3IX 2C4UA 3NEPX 4RGBA 5EKXA 3VISA 5J47A 2LNDA 3I9NA 3RHFA 1Z0SA 4MYCA 4NZOA 3IQEA 1NOIA 3K1TA 4AMVA 1USKA 4JLNA 3HUTA 1PJSA 3LO8A 4OI4A 4GBMA 4HLNA 4Y2PA 5JMTA 3G0HA 3RUEA 4OKSA 5JPIA 1M67A 1HQDA 4FKBA 4H35A 1F8UA 5BNWA 5KVSA 3EE6A 3HABA 5K8CA 4L0DA 1DDOA 2VZEA 2OK7A 4XXHA 4PLWA 5ECDA 4FFNA 1AX9A 1QRUA 2PYDA 4FI3F 3F6YA 1QHNA 4LZZA 3Q88A 4WBSA 5I4BA 1F7VA 1CVLA 1C30A 2XTMA 3BCUA 4E88A 3GLUA 1VIYA 3OCJA 5JSUA 3D1JA 1P4JA 4ZT4A 1BCRA 5J23A 4QUEA 4DZTA 2OBBA 3UXHA 1ZNXA 2XCLA 1GM5A 5GOZA 1Y9ZA 4V1CA 5JEEA 1C7EA 3HR8A 2CXUA 2IDJA 3OKAA 1WB6A 2J3KA 3OVMA 4RHCA 3O75A 5FR2A 2WZDA 3HPQA 3AHFA 4C7JA 1UPXA 3F97A 5TJ9A 3FZQA 5DEOA 1QH0A 4WACA 5EZSA 1K0FA 3MZ0A 5K20A 3KCQA 2NZJA 1QV6A 3IAAA 3PNBA 3EW7A 3PNLA 2BP7A 4M87A 3A28A 4NY1A 1UJ4A 2QVBA 4G1UC 4NI5A 4R9SA 3G59A 4FFRA 4DV4B 2Q6LA 1I1QB 4OUKX 3ZIAA 1AA9A 3HP7A 2CEKA 3PYMA 4IZOA 4J0IA 3AESA 3DOEA 1QE0A 3PIDA 1WZ2A 2NTEA 1KRHA 1PZMA 2YHUA 2QP9X 3PXEA 3HVJA 1KVRA 1H3EA 3DHVA 5KSPA 1JQKA 1PGPA 4OX9Y 3CW9A 1GQQA 1C4XA 2OD9A 3CZMA 5AESA 3EZ6A 4RUKA 5BPHA 4J91A 1I6KA 2LW7A 4LZNA 3COPA 2FMHA 1T8TA 5EIFA 2YXPX 3B2NA 3L46A 2XQIA 4MB2A 4GVLA 4MPPA 1KZGB 4TKVA 3HLYA 3KOZA 1MDBA 3OY2A 2XB2A 2DQYA 1SHJA 2H5EA 3DNFA 4CIWA 3LNCA 5GONF 2OORC 3AUJB 3FGZA 4LXGA 4UFOA 1U0LA 5J63A 1XU9A 2Q8QA 5TRTA 2PFKA 5I7UA 3LLSA 5T3UA 2J0SA 1SKAA 3T4EA 2XHZA 1T36A 2YS7A 4IHJA 5LSAA 1C80A 1MP0A 1SELA 2Q4EA 2QL6A 4PQRA 5CT4A 1C0LA 4ZHSA 2B94A 1P29A 3PR3A 4BFCA 3E48A 4V38A 1U0FA 5L8VA 1R6AA 1C7FA 1HURA 2Q6VA 2XYQA 3P1JA 2C95A 4OGFA 3ZC3A 3JD2A 4L8FA 3TYXA 1A9TA 5J2TB 1UK9A 3M83A 4J0CA 1GTMA 1KEEB 2HMUA 1P6QA 4RHTA 2WU4A 1XQXA 4IGFA 4MHTA 5F3WB 1CIPA 3NDJA 4BIIA 3KALA 3KQPA 3EXEA 1UFVA 4R41A 4S3MA 5HA5A 2GLTA 1M8PA 2VDQB 2XTJA 1WEHA 1Y7LA 2CHFA 1DKLA 3BSSA 3DMHA 3NBZC 1FNMA 3OAAA 1G9XA 4HZIA 5BOSB 2PTHA 4AO6A 5DK4A 2GBIA 5BMOA 3VH1A 2FLKA 2CUNA 1QRSA 3S29A 3LQFA 5KTYA 5AVKA 3WIOA 2F3QA 1KC1A 2AEMA 2QVCA 1PG2A 4DJTA 5SYAA 2FR8A 4JQOA 4Y2JA 2GAAA 5LBUA 3I9JA 2A9FA 5MGNA 5ALRA 3PEEA 5FYQA 2YWHA 3K6JA 2P62A 2BH2A 1ENYA 4RY2A 5HUQA 3F7MA 1PR1A 3W8NA 4DQXA 4G9BA 2ETVA 1VSUA 3LTEA 4MUXA 2FMTA 2XGOA 1QHIA 4RAQA 4KGZA 3GCZA 4OVKA 5EIHA 3RV4A 2G1JA 1H85A 2VRCA 2X5JO 2GETA 3W9YA 5ISMA 1V1MA 1F3OA 3GGSA 3PFHA 1M2WA 4Q9LA 1GT91 3L0SA 5BN5B 4CV2A 4ZO6A 2V3WA 1GITA 1RQNA 1X1AA 4DWOA 2Q49A 4MWGA 3F96A 1KMQA 5EP1A 2O48X 5IASA 3WJ1A 1AXGA 5TPZA 4CZ2A 1AG9A 1JDNA 1Y6QA 2HZ7A 5EHGA 3P26A 4BWFB 1I33A 4UJ5A 1DT3A 4R9NA 3UHPA 4M1MA 5L3VA 1QQAA 5MDHA 1TGVA 5KHLB 4G09A 3N7AA 5FI3A 2ORED 1UM8A 4Y3UA 4B48A 3NHAA 4YAFA 3TKLA 1NZJA 4CM6A 5EHNA 2UKDA 5KTSA 2X0NA 5E3HA 1MEEA 2ALJA 1E1RA 1ZUWA 2W8BB 1DWOA 3B89A 3BE5A 1T5DX 3G0BA 3D6NB 3R23A 2W98A 2ZSFA 1Z4MA 4B31A 4LY9A 2QDXA 4NS4A 3KB6A 3MVEA 2FF5A 3I34X 5SZKB 3TPZA 1T34A 5FNZA 4X64B 1O9HA 5AJYA 1T1GA 1EWVA 1G41A 4RX1A 4F3NA 2XXJA 1AOXA 5B6IA 5DYWA 1YCHA 4EECA 3HFGA 5A5VA 2OYCA 1SPBS 2A9VA 2WF5A 1MAVA 3NQ41 1EVJA 2JIQA 5G4LA 3W8EA 5HK9A 1U3FA 3MTGA 1CHNA 3B38A 1E60A 4PLTA 4WJZA 4RPJA 4DR5B 5A1JA 1KU0A 4HNGA 3D5EA 4DLNA 2KI5A 1EX9A 1V9SA 1YQGA 4LZOA 4NBLA 1CS4C 5KHOC 3HNRA 2F3RA 4HOYA 3IRUA 4HXEB 5IKOA 4DV0B 1EFVA 2J3JA 4OLHA 4M1OA 3EZFA 1YJCA 3ZQ6A 2Y2VA 5G2OA 4JL6A 2FGJA 3FUVA 4NBKA 2H1CA 2FFRA 5EXDA 2X6TA 1P0IA 2DC1A 1XELA 2EC5A 2EW1A 3EEIA 4RVOA 1XQWA 1EINA 2WV7A 3ROPA 4MR8A 3G6WA 3TGPA 4MW1A 2WWFA 4ZCSA 2XCSB 1DAFA 2XWQA 3H9BA 4QYIA 2FFJA 1YRLA 4WXYB 2JVIA 3I58A 3FOWA 1GSAA 5FUYA 2F3TA 3CLRD 3UYKA 1AH2A 2YH2A 3L0IB 4C0XA 2Y6VA 1NKSA 1FY2A 1ZVJA 1FYFA 2H2AA 3QG5A 1CUDA 4GDMA 4H6VA 4PBTA 5CLQA 4DDKA 1H0KA 1PFUA 1GQSA 4MRNA 5TF4A 4L74A 2AIRA 1BH6A 3HCPA 2LDBA 1DP4A 4FOLA 1YZQA 2DFVA 3UIEA 4JT2A 1DRKA 1RC8A 1QDUA 1C8BA 1VPEA 1Q12A 2DWQA 2ERCA 3CNLA 2VDKB 2OGSA 3VR4D 3KKEA 4GQIA 4M0DA 4CCAA 5BSFA 2GZ3A 4W1QA 4J4HA 1V96A 2FFBA 3HB0A 5HNKA 2EKZA 2OHJA 1Q6YA 5JR3A 3FNBA 4YRBA 1GNRA 2QPOA 4MQ6A 4BWVA 1DBIA 4C4YA 4Q9KA 4EG8A 5KS2A 5CA0F 1U0GA 1JTFA 5C4IA 3OE7D 2VUUA 4MIYA 1AUOA 1PT9A 1XG5A 1RVDA 5DLPA 1OXTA 3BS4A 3W5AA 1KPIA 1USUA 4N4AA 1PQUA 3PT9A 5AJZA 4DCVA 3KHTA 3VKWA 1DG1G 5FPTA 3RFVA 2UU9B 5G1PA 3VPSA 1RSZA 5EIEA 3W2GA 1FA9A 2PL3A 4JQCA 4QPJC 3K53A 1SQSA 4RFLA 3KV1A 4XD7A 2LZ0A 5F33A 3UHFA 3JALB 4F1WA 3T41A 1K4MA 4Q1DA 1JVBA 2PSJA 3M1AA 3PE3A 5I9NA 1MPTA 3HCBA 4C4PA 3BORA 4M9ZA 4UBMA 1YDGA 2JEYA 1E1CA 1UKYA 2FUG1 3MRXA 3IQIX 1CUYA 3Q10A 4IWYA 4PZPA 1ML3A 3AZQA 2GBLA 2F43B 2GCPA 3OFVA 3NUGA 3IKVA 2XUJA 4FE4A 3HBJA 2REQA 3P7MA 1I1NA 3MF4A 1L5OA 5C7IO 5I47A 1GRQA 1XEXB 2PD4A 1FK8A 2FV8A 3BRSA 3OSUA 4IJUA 4LQ4A 4RJLA 2GCOA 5ILOA 1YJBA 5JAOA 4JB3A 5KX5A 4K87A 2ZDHA 2PBFA 4XEUA 4MDYA 4HRAA 1W9MA 2VHWA 2PYIA 2CV1A 2XUHA 3B13B 1L8QA 3EARA 3HL4A 3WMEA 3NAMA 4OGGA 1ZGZA 4DARA 4CIAA 2ZROA 2I2FA 3H5VA 3EGWA 3OQHA 4OQZA 2NTNA 3L1UA 1NI4A 4V02A 1W85B 3W2IA 1B8VA 1JECA 1OAKA 2YMQA 4FGJA 2NYAA 3S7TA 4N39A 2QR3A 2XVMA 3V1LA 3KSMA 3VZPA 1F4PA 4RTLA 1WW3A 1Z8NA 3P9SA 4BO7A 1YBMA 1FXSA 1GYQA 4YO7A 6Q21A 3E5MA 2WF9A 1TU4A 3HLTA 2HSWA 1LH0A 2K5UA 3ACBA 3DW3X 2V5UA 5F9HA 1JF8A 2IELA 3ZDDA 1GZ4A 1S9HA 1XN1A 3FWPA 4X7MA 3IDFA 4QDTA 3K70D 2Z8XA 3CE6A 3CWZA 3GA5A 1P9NA 3LWZA 4RANA 1M2GA 1E3IA 1N78A 3KEQA 5KDOA 2WTMA 2HLDD 1R9GA 1BN6A 3AHJA 4QQKA 4TYMA 4CG2A 4J0JA 2XRFA 1MA3A 4ZOQI 1JGTA 1JV2B 2QLMA 3UO8B 3PCTA 4PC3A 2IYFA 4WCDA 1DOAA 2A9RA 3W90A 4Y30A 2VHUA 5BSEA 3UMYA 4E21A 1SB8A 2PM8A 1QH9A 2IYXA 1MRNA 3KR0A 4TQAA 3ZVNA 3ZU6A 2WYUA 2Q5IA 2XADA 3FTNA 3H5OA 4HRXA 3V48A 1MN6A 3H6GA 5FJIA 4JXJA 5AMXA 2QUJA 2BDTA 3E18A 2FEKA 2KMLA 1NOKA 2FAXA 2HX1A 1BDBA 3ZDXB 3OM8A 5KWSA 2W8ZA 2D00A 2NN3C 4EY3A 5IDWA 1T6XA 2YMMA 3A06A 3A70A 1E69A 4PSUA 1Y8CA 3LBAA 3A6HA 1CUJA 1SU8A 4OIMA 5EYPB 1UBNA 4WKCA 4LF5B 3DE7X 4M1YA 4KR2A 1NAIA 1N2ZA 3GUZA 1F8GA 1DIAA 1X7YB 3ANLA 4TS1A 3RVDA 3K71B 4MRRA 2X6QA 4TLEA 4BP8A 3GLGB 4F3TA 4GR5A 2P1ZA 1QYVA 3H8WA 4PYQA 4K8RB 1ECCA 2OR3A 3AEZA 5G1OA 1IWBB 4CLRB 2AOTA 1H2FA 1YC5A 1RJ9B 2LCFA 2QD4A 2OG2A 3H1GA 1PZGA 4V0OA 3ABOB 5HDBB 1WZNA 3RWMB 1I7SB 1TYEB 2DH5A 1RZ3A 3THXB 1Z45A 3K70B 5ADWA 1TTHA 2WLTA 3R8CA 1W4ZA 3SOPA 4FWTA 1IN7A 1KIAA 1SHKA 3KSRA 3HGQA 3NB0A 3WGHA 2EF0A 2L0XA 2OILA 1P1IA 4JB0A 4MR7B 2A88A 4HDMB 2FXIA 5I4IA 1IY8A 3NGLA 5C8ZA 2WD7B 5FWYA 4FT4A 1FU4A 4V0SA 2Y1KA 4RDXA 1S2LA 4JP1A 4JGGA 4YRMA 3VM6A 2ZI7A 4TKMA 4CCYA 2FRVA 3KQYA 4KAAA 2AC7A 1I0LA 2PD3A 3DD1A 2PWAA 2E87A 3DEYX 4UHCA 1VLJA 5TQ2A 1XJ5A 1EWKA 2DJIA 4NE7A 3ZCSA 2IZZA 5CFPA 4LHVA 3A1CA 4ZT2A 1TC1A 2EKPA 2WT8A 1SD5A 2Y1LA 4TMTA 4LRSB 2R5FA 4ZZ0A 1DQZA 5M2QA 1KH2A 1G2OA 4PAWA 6YASA 2CVZA 4FGZA 3GEMA 3SGLA 5JTUA 3CZ5A 4P86A 3UT6A 3RT7A 3N2LA 1JWBB 3L82B 1E5TA 1L4YA 1VL1A 2NUTA 5L4LA 3U09A 1A7UA 4XDZA 3RS9A 1NT4A 4HGOA 3FOCA 4Q3EA 4X8LA 5LKRA 2GJ8A 1N7HA 4M38A 2OG1A 3GGOA 3V7YA 3PNOA 4IIEA 1TF2A 2JF0A 3Q0EA 4DIFA 3WDSA 2C2MA 1BMFD 4WK0B 3BCRA 4WOPA 3R9XA 2SHKA 2PL9A 2BKUA 3I0NA 4D6XA 2IDKA 2VT6A 5DB4A 1UXJA 3WGUA 2PUCA 2QG4A 2QSYA 3HWRA 1ULTA 2OGZA 3B5EA 3P2MA 5AUQA 3NFYA 3F8WA 2VHXA 1ZPDA 4MZDA 3GGJA 4FNGA 1GARA 2R25B 2ZT7A 3ZXXA 2CHQA 3EY4A 1X1CA 3W06A 4QFBA 1GTZA 3O2SB 2Y1OA 4H7DA 5AHWA 4S24A 3TD6A 5IEJA 3LXRA 2G7ZA 4GI1A 1ZP6A 2FOLA 1EVZA 1PVVA 3GU3A 3OU6A 3UM9A 4B6RA 4RYLA 5C81A 1DEOA 1QJCA 1RRMA 1J8YF 3CRMA 4G0WA 4JR2A 1FJ2A 4NAUA 1P9RA 5JMPA 3OMLA 3R6DA 1ML4A 1XLWA 2NNWB 1BKSB 4DLVA 2OESA 5HCUA 4UATA 4IMIB 4R01A 3DFZA 4J76A 3RHZA 4MVJP 2XWJI 2VQ6A 1XD2B 3TNLA 1LDEA 1N75A 3RM3A 1J9ZA 1OKKA 2VC2B 1ZITA 3OQ1A 3QF4B 2NVUB 1Z4JA 3H9EO 4BBZA 3QXHA 1C9KA 4YC7A 4BE9A 3T8YA 2HEGA 3GFFA 3ZE0B 1I4WA 4QULA 4F7WA 2J45A 2BFPA 5TVKA 4FNAA 4GOOD 1N3YA 1WHTB 5K8LA 2TMKA 2P2CA 1T3ZA 3I6MA 5DHFA 5BR1A 2FPGB 5HBGA 1N2GA 3ER6A 9MHTA 2HPAA 3ND6A 1NDQA 2HLPA 3KJHA 2PZLA 4PTZA 4YGYA 4HS4A 4KQMA 1IY2A 1R5OA 3F2VA 2IPLA 3MG9A 1GU7A 1V25A 2I55A 2J33A 3PNKA 4MW4A 4B32A 1A7AA 3SEZA 4XWOA 4H1UA 5JT1A 2UV8A 4TXLA 5DCLA 4LE0A 3TBHA 1P2TA 2OSVA 3WX0A 3PZRA 1CZNA 2PX6A 3OIWA 1SXJC 3PQ4A 5DHPA 4NU6A 4L73A 4EY4A 5JXJA 3TLYA 4DRXB 1U2RA 2C61A 5K3AA 1QH8A 4KACA 2JI4A 1N2CB 4MVJM 5E7QA 3X2SA 1IWPB 5ALTA 1Q0QA 2WM9B 4HYEA 1LTHR 1OTXA 2O0MA 2JI9A 2PL5A 3GA7A 5GONA 3E84A 2G9VA 1OLUA 1II8A 2ZYIA 1H4TA 3ZJVA 1KMHA 2EQBA 1XTBA 3LX6A 3MFQA 3U1TA 3A2KA 3IP1A 5EHZA 5K8TA 4BIMA 3H7IA 3BMXA 3LSTA 4BMDA 1P1RA 4MQ4A 3IPAA 3BREA 4PAOA 1B8OA 2QE6A 1XVLA 1VBNA 3EUFA 3RGWS 5C46F 4BVHA 1NAHA 4XGRA 5AK6A 2FK7A 5U9CA 4BAUA 2DR0A 2QXUA 5LZ2A 3S40A 3RC1A 3IL2A 3WE7A 2BBTA 3H84A 2JFWA 4H3HB 3MJTA 5CT8A 2XBMA 1Z0JA 2ZJ0A 1Z5GA 4UXHA 2QRKA 3BTVA 3JATA 2WKWA 1X9IA 1QTIA 3C3AA 4GWLA 4HX5A 3SJBA 2ZAOA 3JR3A 3THWB 1YU9A 3ABIA 1U8ZA 1W5BA 2JATA 2JRCA 2NYVA 3D4OA 3FLEA 4Q24A 4TMVA 1DBVO 1U7PA 1ZNZA 2W2XA 4EZIA 2RHDA 1UBHS 1DT5A 3RD5A 1FDTA 5EJ8A 3GJQA 3X44A 2DF8A 2ZUEA 1TU3A 3ENNA 2ECFA 1DHTA 1MC5A 4ROTA 2B1GA 3TAXA 3ZZTA 1Y1PA 2HYDA 3ZLUA 5GTDA 3ZHXA 1XCOA 1ONBA 2P4QA 4J6EA 2WLSA 2XKAA 1J33A 2X77A 4HEHA 2LKDA 5EE9A 2JBAB 3E3NA 2LDXA 2D2XA 2VDUE 3LGAA 2R1VB 3HCNA 4UTOA 5HUJA 1YZHA 1Z4KA 2WWGA 3TCXB 2IS1A 3BMQA 1QP0A 4YJDA 1X92A 3NAZA 2FP4A 2Q1XA 3ZV6A 5FOSA 2ZUFA 1KE1A 2XGSA 2PR7A 4HYQA 4R1MA 3K9WA 4ZAZA 1Y7TA 3NDPA 4EFDA 3N2ZB 4YLEA 1E2DA 1WIWA 1GZUA 4AMGA 3ER9A 1SUCA 4UZFA 2RHRA 4Q16A 4RC9A 3ADOA 2QLJA 2D1RA 4BNWA 3TPFA 3R0XA 3N5KA 2RH9B 1UT8A 2VTDA 2ZRMA 3V4LA 2JAQA 3A6PC 2HTEA 2XKKA 3OFND 5JSZB 3OT4A 4B6GA 2XA1A 4AIRA 4XM1A 3C6BA 1G98A 1EA5A 3M6VA 1IB0A 4U5QA 3UCEA 4BV8A 4URYR 1YQDA 2R96A 4FMCB 3STWA 2WF8A 1RHUA 2YQ4A 1G2PA 1YE8A 4A0RA 1MHPA 2VF8A 3PRYA 2C92A 2ZITA 3L7LA 4ENSA 4P54A 4LZLA 4INJA 1ZEJA 2CF5A 2B30A 4P7GA 5K2OA 2WPDA 4HPXB 5GY7A 1CD5A 4FC6A 3NPMA 4KGDA 2PS3A 3KJFA 2B4RO 1N8SA 5FPYA 1Y6ZA 4PWZA 2J5KA 4G1BA 4OQQA 4EO9A 2EFGA 5KO2A 1IDN1 3NHBA 5KWJA 2VEOA 1DMSA 4ENPA 4TTRA 1S2GA 3EG5A 3TM4A 3PGVA 1S3SA 4QUAA 5HSGA 2OQIA 2BRUC 2M2IA 3M34A 4M86A 1P1BA 1Z6QA 4MI6A 4IXTA 1E8DA 2PANA 3FYSA 4MUNA 4AYWA 2LTAA 3H1BA 4B34A 2W2OA 4BLVA 4CN8A 4MWTA 3A10A 3WGYA 5BWOA 2FPOA 3TDMA 5KQMA 4KQHA 2XQJA 2PA3A 5TSDA 3X1YA 4BMPB 2YR0A 1RRVA 5LB2A 1BJRE 1U8AA 3PFGA 4MCIA 1G7SA 2IV2X 2YZKA 3OC0A 2UXCB 1A8HA 2EBFX 3JASA 4LCBA 4RS3A 4TYPA 1LBHA 4UMEA 2GBFA 4URHA 3THYB 1E1QA 1NGSA 3WZMA 1JIUA 4PZYA 3L18A 1ZUIA 2AT1A 3G2KA 3PHHA 2G08A 3ZDYB 3KZNA 1XVTA 1Z0IA 3D6VA 3ZY4A 2P11A 2WE8A 2H9YA 2HPHA 3B1XA 4A27A 5AW8A 2VJCA 3L1JA 3UTDA 1N1MA 5CDFE 4N01A 3OI7A 2BPOA 4QJBA 2ZI6A 2H65A 2P91A 4IV0A 1Y8RB 4X54A 4DLLA 1MFZA 4Z0TA 1C7IA 1U0TA 3IP7A 1WETA 3E81A 2PZGA 4MAFA 3EZXA 4GXRA 4QOFA 3H2BA 3WLOA 2FI1A 2YWGA 4R8MA 3R5KA 1GUZA 1P4RA 4EPYA 1D3AA 5DNWA 3DE6X 2ZRGA 3WRXA 2PUBA 2IX3A 1JR3E 4I1UA 2IEYA 1EDDA 1FBNA 2XD4A 1N7IA 2OBMA 1GPLA 3AO0B 1DTWA 3N8GA 4QU0A 3O4JA 3AFHA 4GT1A 4MSUA 2QTVA 4Q4JA 4EFMA 5BW5A 1NN5A 3M2TA 3ORRA 1LPOA 1TCBA 4LDQA 2VH2A 3AWDA 3UOAB 4HPJB 1PX2A 3P2JA 3PPVA 4KE6A 4MMXB 1LU9A 2BV3A 2B25A 2P9CA 3EOBI 5ARDA 5F5LA 3RQIA 4KXXA 1K9VF 4D7AA 1CHDA 2CMFA 2IPOA 1TAUA 3DTVA 3SP1A 3QXGA 4FW9A 4EJ6A 4YLYA 4AKIA 4BFXA 3SYRA 4D4IA 4CEHB 5DP2A 3VU0A 5HS6A 5K3BA 3ASYA 2O7SA 1R64A 2FVYA 2X0KA 5E2IA 4JV5B 1XTJA 1VC2A 1PFYA 2E4ZA 4MUMA 1ZA2A 1K4YA 2ACWA 1DC5A 4IQFA 3OPNA 3IP3A 2GEFA 2G9NA 3WY9A 2OYSA 2CNDA 1PGOA 3SZ3A 4KMRA 2AOUB 2HB6A 3E3LA 1XTIA 4NOMA 4JUFA 3OPMA 1W581 4LUCA 3JZMA 2FPIB 5DDIP 3RBZA 4FYVA 3QWFA 3W05A 1PJLA 4Q7QA 4JN6B 3OESA 1XE3A 3V8BA 1E6KA 4M0LA 4ZMRA 3ZX5A 3B6IA 4AI6A 2HAEA 4V0KA 4NSNA 1VIDA 2VXBA 4U2DA 4WOCA 2Q7OE 5CR9A 1JPVA 2BD0A 3OLCX 2WVGA 4FN4A 1RJEA 1TLLA 4B40A 4DG8A 3ZE7A 4E5YA 4BNYA 1Z6AA 5H4GA 4YBRA 5WRFA 4UTVA 2REBA 1EG2A 4I1OA 4TLCA 3PEYA 1ZZGA 4DLTA 4M4SA 4QTYA 4BQRA 2KX7A 2QTGA 4I19A 1GKYA 1L4HA 2C7GA 4MWBA 5DNCA 2W0MA 5JQGB 4G5OA 5EESA 3DD5A 4ND3A 3HU3A 2G4VA 3TDKA 1COWD 2R7MA 1A2KC 2OO5C 3DR3A 2QL9A 3KYIB 3WK5A 3BDIA 4GOKA 4AULA 1SXPA 3OQNA 2XUKA 2JFUA 5IT5A 4QOHA 1AKNA 3AJRA 5C7OO 1UBLS 1J6UA 1KMIY 2HK9A 1AQLA 1XJ0A 1JU4A 1NATA 4TS4A 2OCPA 2CVHA 3AY3A 3I0MA 4DCGA 2EG9A 5K4HA 3AKYA 3BMNB 3BMCB 4HMPA 4ZARA 6ABPA 4JI0B 2BFFA 3KZCA 4FFVA 1S1CA 5TQJA 1YDFA 2KJQA 2BISA 1IM8A 2ZBQA 4Q3KA 4HR7A 4ARBA 2XZLA 1KRWA 3V6MA 4MV6A 1G8MA 2CL0X 1SC6A 3N58A 3R5TA 1ZL2A 5GJWC 3WLHA 3IJRA 1SAYA 4F8YA 5I7EA 2JAWA 1GEEA 3D0KA 4LX8A 4TX1A 1K7EB 2YWCA 4HXYA 4UHDA 5A0FA 4DPLA 1L0BA 1M2FA 1Z28A 2YFYA 4N0MA 4UOQA 1NMQA 3EG9A 2ZYDA 3HKEA 4KXFB 6AT1A 2XUOA 4UCFA 4KIUA 4E2WA 4FS8A 3C97A 3E6AA 3LHFA 3NBYC 2PZMA 4IJQA 4EHLA 1X0VA 1W49A 4KXYA 4CLOA 1MEJA 3V3TA 2IHVA 4QXRA 5CEEA 4DJEC 3LP6A 1X1DA 5G1NA 1C7RA 1AE1A 5IJZA 3OO1A 3PJEA 2C5EA 5H0IA 1W5TA 1VGRA 3ZE9A 5K0GA 2AG0A 2QSZA 1KDZA 7REQA 4Z7JA 1LLCA 4X60A 2DYKA 4XDHA 3QELA 2ECQA 5IZCA 4MUYA 4J0QA 3OT1B 5BQPA 2B35A 5EJIA 2PEZA 1IUNA 3LFUA 3JVEA 4IIXA 3MCWA 4IL5A 2G77B 2X19A 1TADA 4BLRA 4NULA 4FJ0A 2C42A 4UE6A 4WNIA 3T1VA 3RB8A 1RPZA 1QFXA 2FG7C 1UBFA 2XSZD 1ONPA 3KXIA 4O4HF 1T3SA 4DA9A 5I51A 1QHHB 3B70A 2WNIA 3JQFC 1P7ZA 2BUCA 2QORA 1YIAA 1DEXA 2BDUA 1K89A 3D7LA 3D5QA 2GRAA 3LUPA 3PLRA 1LDNA 3H13A 3Q9UA 1K7CA 4IZHA 4FSHA 2QSUA 2H4HA 3CLUD 3PNQA 2PGOA 5AM1A 3ZGOA 3ZWQA 1Q1EA 5FD8A 3VYUB 4AM8A 2G83A 2AWNA 1VCHA 2FVXA 4YUZA 2WSYB 1EFLA 3SX0A 4CF3A 3MK31 4P3NA 1AXRA 1X7DA 2QN8A 3U60B 1JPNA 2DSTA 2OL4A 3D8BA 3NOOA 4N12A 2O9JA 5DBFA 4OOFA 3V2IA 3PHGA 1HSZA 4QNMA 3ZK8A 2P6PA 2FN9A 2JFZA 2P9BA 3IBYA 1NSFA 4FGWA 4TVBA 2NX2A 2EJVA 2DHDA 2OPBA 3OQBA 4KJZA 5EQJB 3A6GA 3OCZA 4BNDA 2EZ4A 4FYKA 1VMAA 2QX6A 4FIZA 3KQSA 3P5SA 2P6OA 3UAWA 1A88A 2RGAA 4KQKA 2PUEA 3E15A 1FCJA 4PCUA 3DZ8A 3EISA 3DG9A 1YJQA 4FKZA 1VIAA 4L85A 3ZKWA 3TB6A 3FOFC 3LW7A 3H8JA 3GNSA 3QOWA 2O1WA 2R7LA 4PHGA 4FX2A 3FPBA 4MLZA 4UUQA 3OE1A 1FVHA 4LJYA 5DX1A 3HV0A 5K3DA 4ARVA 2HR1A 3B3JA 5AVYA 4G07A 3DMYA 4C22A 1H94A 2R66A 1V16B 3EUWA 4JLBA 4R6XA 4YA6A 5TPWA 1Z15A 2BIFA 1B15A 1MJGM 1I3OA 2IGTA 2O07A 3KTAB 3NEAA 2JCYA 3SQDA 4D3ZA 1K7SN 3KPUA 5TARA 3HZRA 3RI3A 2C78A 2VPQA 3VDQA 3UBMA 2OLJA 4WFQA 4E33A 1NURA 2CLLB 4OFXA 4W5RA 2E4XA 2GN4A 2PKXA 3L6UA 1YVRA 4KQ1A 2A78A 4YI5A 1LDYA 3ENQA 3T06B 3MXTA 4EGCB 1RRFA 3TQIA 1Y3DE 1JDBC 3NGMA 3DE0X 5B3AA 5DHTA 4OO3A 4LYJA 2CJXA 3E27A 4RL6A 5FUBA 4CCSA 2FYTA 5KSZA 1YB5A 4X1YB 1YZKA 3K05A 3R3XA 4PYRA 1BDMA 1PX0A 4JGIA 3UHJA 4C21A 3ZEAA 5ITSA 3BA6A 3BWMA 1RC1A 1LX7A 4PFJA 4EKIA 3D8UA 2WI8A 4JP3A 2XDWA 4O25A 1U98A 1BS2A 4GOND 5JROA 1Q7TA 3TO5A 2PR2A 2XZOA 2WTUA 1A8QA 5DYYA 1DKMA 4A8JA 1KJ8A 2ZSIA 3DLAA 4BYMA 1H2XA 3FGNA 4A4DA 3QEAZ 1HT1E 2BMEA 3E1KA 4QVKA 2XUDA 4Z1MD 3KFXA 2IZOA 2EFDB 5KU7A 2IEGA 4MW6A 5DLYA 3LY9A 1ZRNA 3K31A 5CTJA 3L2OB 4A36A 2JLVA 1J97A 1YMVA 3KOOA 2E4WA 9LDBA 1OIVA 3ICWA 2H11A 4GL2A 1OI3A 3IAHA 4PQFA 1DGQA 1CCWA 1X2EA 1R5JA 2AZMA 2ORVA 3NS7A 3OT5A 3QWIA 4JB2A 4UU1A 4NCBA 4RW0A 4OB6A 4J07A 4U4AA 3DO8A 4YJ2F 2JHGA 3GMIA 3T12A 1MD9A 3HUDA 4DSZA 2QZZA 2Z04A 4NG4A 4QNNA 4F06A 3RYFB 4D97A 4B3FX 4FX5A 1GV1A 1OGYA 2Y1WA 3NYWA 4O0LA 3VC7A 3BD7A 4PRLA 1JEAA 2V6JA 1CPYA 3V1TC 4BEWA 5HR5A 1DC3A 1JKJA 2QAGB 4KKVA 4R1OA 1E96A 3OEED 4PZLA 2JLXA 1YAJA 3GWZA 2OFWA 1F0NA 1O96A 2QM3A 1AO0A 1APBA 3T0GA 1P8JA 4AZ0A 2I6SA 2RJNA 3GRCA 1JAHA 3PC7A 4R1UA 4UQPA 2F9FA 2D5IA 2ZYAA 3GJ3A 4EJSC 1HQCA 2H52A 5EL0A 3AG5A 4DT1B 3RYHB 3K2EA 4MWEA 3VGJA 4RFSA 1UJ6A 3OFSA 4FE3A 5TQ0B 1HDCA 2VP6A 4O29A 2ZUVA 1C81A 1Y89A 1B43A 4RTRA 2BFDB 3D6AA 5FA8A 4RTQA 1HBJA 1T25A 3DNPA 5IYZF 1OU4A 4NE2A 1E9AA 2QTHA 1UC9A 1XTUA 3AU9A 3IV7A 4FR2A 5AKKA 3VKUA 1N8TA 1GZ3A 2PSFA 4FZ3A 1UDWA 4IYJA 3DBIA 1UOOA 3GRYA 4K2AA 3D8HA 1L4FA 2W6NA 4RMJA 3ZHSA 5JNLA 3OFKA 4DJFC 2NU6B 1Y8AA 1P0FA 2PH1A 2W2TA 4HKTA 4KE9A 4XQ0A 1LJUA 1FC0A 1XCJA 3PBKA 5COQA 2W6ID 3DVAB 3LHKA 4RQTA 2BUBA 4IX1A 4LHSA 3P0JA 1H4QA 1E9VA 1X1RA 3KKQA 4HADA 4RVDA 2XCTB 1Y1RA 4HDCA 5C3MA 3OKCA 4EJ0A 2P7HA 1P2VA 1KARA 5LXTB 3O4HA 4EPRA 4DBZA 2GT1A 4GF5A 2CYCA 5KJCA 5DASA 2QRHA 1QZTA 4TXJA 5H82A 1CZHA 5YASA 4N5HX 3DE2X 1K6MA 2GAFA 5JJKA 2P90A 5JAMA 4DFDA 2CLIB 4BEBA 1Z34A 2PIAA 1ETUA 1WDKA 3OJXA 3W3AA 3SLRA 3TG2A 1G5IA 2Z8YA 3IUPA 3PHJA 4X91A 2FZEA 3EAQA 3VTKA 2C98A 2CEAA 5B7GA 4J7UA 4L7QA 3WKDA 5LIRA 3EPLA 4OHYA 4ID3A 3FFAA 3RFCA 4EI9A 2X8WA 1WD7A 4U6SA 1NVAA 3DEJA 3SF0A 4LIPD 3V32A 1TVEA 2H51A 1PU2A 3WLQA 2Y76A 5JHGB 3TBKA 2V98A 3EXHA 5AK3A 3Q7SA 4E12A 1WXFA 1XHLA 3KK0A 2KWIA 4FQ7A 1J1ZA 2IE8A 4QT0A 3W5BA 3EQ9A 2MR6A 3AL0C 2EHDA 2QX7A 4M1TA 4OXNA 5TS2A 4F6RA 4YV0A 4DHEA 2A0WA 1GCGA 5CDUA 4PBSA 2LR0A 2C7RA 1QS0B 4L8WB 4OAPA 3F6SA 5IABA 1I6WA 2FUCA 4XFKA 4WJLA 4G41A 2QTNA 2Z2IA 5IARA 1X7XB 1JH8A 3HEAA 3N05A 2ZUUA 5I7HA 3IQFA 2O8DB 3V2HA 2IYUA 4HB0A 3UJAA 3M89A 1HYEA 1Z33A 4LY0A 1DSSG 1FVXA 1J09A 2G67A 4HEJA 1ENPA 1ISPA 4B43A 5K45A 1BX3A 3QEMA 1PWXA 4D98A 3I05A 4Q48A 3ZHYA 5IJ0A 2AG5A 3KDAA 5DNDA 3P32A 4JC0A 4X7PA 5A71A 2PWPA 1P62B 4KPGA 3UJBA 3HSSA 2QYHA 2ZSAA 3L93A 5TT0A 3IA7A 1EJBA 3R0QA 4JUIA 1V8OA 1V1JA 3O21A 3UPTA 4IUBS 3DCNA 4NENB 1DKUA 4MX8A 5KTRA 5JHHB 1NYRA 1RPTA 3L02A 1AY0A 1OZAA 3E05A 1VJCA 2Y1EA 5LP6B 2EYQA 3CW8X 5T8KA 5U4XA 1WU7A 3GN1A 2IP4A 2ZB4A 2WDPA 3VSDA 2NSJA 1NRIA 2R6GA 4OK5A 3WWEA 2XUFA 4NCAA 1G3UA 3CT6A 1Q2XA 3FYUC 3NOVA 2YJ6A 4IUDS 4RA6B 2CN1A 4YRFA 2UDPA 2HDOA 5EE3A 3E2PA 4WN3A 3FZNA 5DK6A 4WERA 2PG3A 5IANA 2ODEA 4ZKEA 1PQYA 5B55A 4ROSA 1H8ED 3ESRA 2OCLA 4M9XA 3EW9A 2GESA 1S7GA 2PT9A 2M32A 2X9NA 4HWKA 5H3HA 5EXEA 1FB5A 1G8YA 5AJVB 4D8WA 4NOJA 2PZEA 4XVRA 3AVWA 4XUDA 1E3WA 4Y0VA 4RJTA 4MKFA 2A14A 2A1TR 3NAQA 1TAGA 1QONA 3H5WA 3M70A 3NR2A 3HY6A 1IU9A 5CJ2A 4BNUA 5KYYA 4LMRA 1TQ6A 3HBNA 1J1UA 2FJ0A 4HF7A 3ESZA 3Q87B 3UV6A 2QBYA 4CIXA 1E9SA 2VDPB 1B73A 3CMCO 5AJHA 5EFZA 4CTMA 3IVGA 3FBTA 3JALA 2O20A 4Q7JB 4LVNA 4U0JA 2IZ0A 2MOKA 1UFKA 1EB8A 3TI7A 1DUVG 3ZHVA 2QMYA 3QM1A 3GLGE 1OUMA 5IKXA 2VPTA 3OQPA 2O14A 1Y9AA 2DTDA 3LX8A 3R20A 5LJLA 2WIFA 3YASA 2IA5A 2B4QA 3FSGA 4IMPA 5AO9A 1G2IA 2H00A 3AMVA 1OX4B 5F35A 2XT6A 1NG1A 4CT0A 1TM1E 4F4IA 3GQBB 4OMUA 4OJMX 4JA2A 4PLGA 3AX6A 3D7KA 2OBXA 3T1OA 1FNBA 4CR6A 3BT7A 1KPGA 3QIAA 2NUPB 4W5WA 2EERA 1GUBA 5E0OA 3WQSB 4KO3S 3OPXA 4ZREA 1MEOA 2HRBA 4Q4AA 1XLTC 2FQXA 4K1XA 5AJXA 4OA8A 3CRVA 3VU9A 3OLZA 4EW1A 1IZ9A 1EJ2A 3BIOA 5BQXA 2Q5EA 4Y2SA 1RVV1 4BKQA 3AY6A 1FSPA 2AZDA 1QOPB 2AB0A 3C1AA 2D2FA 2JIZA 1W88A 4RJ2A 5C32A 1G64A 4W5NA 1E1KA 1KOFA 2ZE5A 3P45A 1PK7A 1XDZA 4JH0A 3TRHA 3I52A 4NH4A 4QJIA 1NR1A 1S3IA 3QEJA 3GV0A 5LYYA 1O0CA 2A9QA 2HMSA 3AY0A 3OH8A 2OXRA 1QGYA 1WXWA 1CLEA 2ZLBA 2Y92A 5EQTA 5BY2A 3RRYA 1MT0A 3IODA 3J7TA 4CKZA 4OG2A 1WP4A 1MO2A 2ZTSA 2GBGA 3NX4A 4MQFA 1USGA 4YQYA 4GUDA 2RGRA 2MINB 1HYBA 4G0XA 1T3TA 4R7TA 2YZGA 2DY0A 3HKCA 4ND4A 2G1KA 3AIMA 4NWIA 1K6IA 4ZOLF 1W4LA 2IZ1A 4HSGA 1RXWA 4XQ9A 1W35A 1N9KA 2P9QA 3DOUA 2AQKA 3II6X 1OXXK 5KNBA 2CK3A 2PGJA 4JITA 4KMOA 1NUSA 4AQYB 3DT9A 3N28A 3A1EA 3FVWA 1O8BA 3ORYA 1EWQA 1Z0UA 1Z6ZA 4U2KA 4AJNA 5ADHA 5DYNA 5CAEA 1Y8ZA 3LG2A 4DSNA 5IVPA 4L57A 1LX6A 3QE0A 5C18A 2W2NA 4PR3A 3Q9NA 3SDZA 4FB4A 5BXYA 3BGOS 5LQAA 2XRMA 2PX4A 1JT9A 3IUQA 4MW5A 5TLSA 1UZLA 4BMVA 5EERA 4HZUB 1ZK0A 4KO2S 1Z6XA 5AM0A 3ZI0A 5I3CA 1GUDA 1J5XA 4JZYA 2DTEA 3CVUA 4ZV9A 1KEWA 1U8XX 1PZFA 4I66A 3B53X 1Z62A 5EHQA 4MUIA 4NXNB 1E9RA 4FBGA 4GZLA 3GCXA 3Q9LA 1VTKA 3JD0A 1N9GA 4TT3A 3NVMB 4HUQA 4WCFA 1RRPA 1UAYA 2QVXX 1JEYB 5EP3A 5DGHA 3PPXA 2EARA 1I4DD 1PWEA 3GDOA 4OP2A 2PUGA 3IX7A 2VYVD 1R0CA 3ZVRA 4I1YA 4DM4A 4AYXA 1DVRA 2CWDA 1EM8A 5A1TA 4L07A 2AXNA 2IYEA 5FWXB 5AUOB 5DHAA 4N3CA 4RXMA 1YR8A 3CX4A 5AM5A 3D8RA 4KXVA 4PO8A 3IPRA 3PC3A 1JDPA 2X2PA 3ZK9A 3CXUA 4IHQA 1V8BA 4ALIA 3ZV7A 3FTPA 3WMFA 4X90A 3MGBA 4C88A 4YRPA 4B71A 4XGNA 1R50A 3V1NA 3K6KA 4NBWA 1D2NA 2WJ3A 1TPZA 4IIUA 1EUCB 1DCFA 3PRHA 1HZJA 3UXMA 3SMVA 2AZXA 1ODSA 1E7QA 1PWHA 2B8TA 3SBXA 1Z4IA 3EEYA 5JBQA 3KAQA 4O4HA 1I6MA 3VU8A 4EWLA 1F06A 1DG9A 3R9KA 1N2CE 4OHUA 4MYUA 3T4UA 4D9BA 2SECE 4BPBA 4X1OA 1Y8QB 2Q7DA 3HZZA 1L5VA 3HCDA 2XITA 1PQPA 2PZJA 1D7AA 1X9GA 2B61A 5ENZA 3ZWXA 4CKWB 4BVKA 5CXQA 5IH7A 4HVLA 3HWWA 4LFCB 1PHRA 2IYSA 3EFOB 3E5HA 4W82A 1G5TA 1T1EA 1U9YA 4LZPA 1K86A 2V9ZA 3T3NA 2GM4A 4ND1A 4UPEA 2P79A 4PSVA 3U4MA 4X84A 3ANMA 3K94A 4L6CA 4PX5A 3QWAA 2A57A 4LECA 1FW8A 1CUBA 3R3WA 4N5DA 1AO3A 2BTQB 1TUBB 1F60A 1UK7A 2D1QA 5K6RA 4TYNA 3HM9A 3CR7A 3K1YA 3OZRA 5ALNA 3ZHCA 3M5WA 4P7BA 3BUSA 5DT2A 2C77A 2QI9C 1JKFA 1YULA 3COVA 4V03A 2Q3CA 2VF5X 3QEKA 5AVSA 5JNWA 1PD1A 3HUEA 1SC3A 4E4YA 4EQZA 2HUPA 1Z0ZA 3N2GA 4JBLA 1UJNA 2JANA 2WFLB 4LJ8A 1U2DA 1XQVA 4QYWA 2IV7A 2HA2A 2FW6A 2J3HA 4H7FA 1U99A 4EMSA 1XF1A 1E7MA 1XQ1A 1GNVA 2IZ7A 2A58A 3NWJA 4CBVA 4CL3A 5A5GA 2EF1A 2NYRA 3PHIA 4ABYA 2BCJQ 4U7TB 1UPBA 4XQEA 1WSAA 4V2UA 5IN4A 1LZKA 1OXSC 2BMDA 2GPJA 3TEFA 3WQHA 3ZLBA 5JDIA 2VSYA 4DDTA 1QZUA 1W2WB 3X1DA 4HTAA 1Z7YA 4P82A 1YVUA 4UXIA 3H11B 4R2KA 4LV5B 2YVUA 1YK1A 3LXUX 3HJFA 3M6AA 3O8DA 4BBPA 2JBHA 1SCBA 3IUEA 1ZN2A 1NLZA 3QF4A 3QVGB 3X2EA 3O4RA 5ENDA 2SNIE 4DS3A 4WECA 2CNWD 1PUIA 4CIYA 1RZRD 4ERNA 2GPTA 2VNJA 4IICA 4DQDA 3V00A 2ZQZA 1DE0A 4NYMR 5DTJA 3NBXX 4KDFA 5DKFA 3T3GA 2IBTA 2D4AA 1KDTA 4RVFA 2D1TA 2AZTA 1LJLA 2ZAIA 3BJMA 3NZEA 1HNNA 1NN1A 3QFFA 4N48A 3H2KA 4P22A 3A1DA 4BP3A 4J16A 1QX3A 4BN5A 4EB6A 5A2QA 4QM6A 4MROA 2RB4A 3B9BA 4LX0A 4RKQA 1JLMA 1SCKA 2X4GA 5CLGA 3T7AA 3BWYA 3SPXA 2JH9A 4D4KA 9GPBA 1BMFA 5BR8B 2UUCB 4MV7A 4UD6A 4UD2A 2QLLA 2VSXA 1ECFA 4UJ3A 3CCBA 3LI2A 2BL4A 4HEA6 2BI8A 3UUWA 2IW1A 2X42A 4XA8A 1YR7A 2IXDA 2QR2A 1ZG3A 4R3WA 2NPIA 4EGFA 3UZUA 4C08A 5AVXA 4W5JA 2VK1A 3AIOA 2L42A 2NNLD 1IQPA 1G20B 1NL3A 3EC2A 3M1IA 4G65A 4Z51A 1W4BA 2G80A 3F2IA 3CPJB 3UHOA 3NC4A 1AIPA 3HLKA 5CXUA 5EXTA 1CJBA 1HMPA 1UP7A 3OLQA 2M6RA 4Q6WA 1H22A 1XHFA 2PK3A 3PIRA 5P21A 4MDHA 2HXYA 4I8DA 1RTKA 4YJ2A 4H0NA 3PUIA 3DQZA 5F1YA 1WUKS 4NU5A 1GDDA 3CWCA 3WBJA 4I46A 2I91A 3OPVA 2PKWA 2BFCA 3U7QA 2D1SA 4PYIA 5H83A 3DL7A 3PC4A 3QLEA 1UAGA 3QGMA 2PUHA 4COOA 4DLPA 1DAIA 2NPFA 3ECSA 3GDHA 4IS2A 3EPHA 4U8GA 3GFTA 4AMZA 3L07A 2OLEA 4KYTA 4QDKA 4S2EA 4B3CA 3R6GA 3I4FA 1JB1A 3I04M 5CDGA 2ENUA 2D5LA 2EFYA 4Q37A 2PDAA 2CXXA 4HQKA 4J2OA 1XXHB 4RH1A 1TIPA 1T1IA 3HFRA 4YXWA 2V97A 1X80A 1FRVA 1YSCA 3C8HA 4I6GA 5EZ6B 5F4BA 2VPPA 5T3YA 1E64A 2MSLA 2VSQA 5A2GA 1JLHA 2F4NA 3PKZA 3TRIA 4I99A 4WESB 2B5OA 4PWYA 2ORIA 4FOOA 1PSZA 5L3ZA 2JBWA 3M6LA 1W94A 2NSHA 4R6WA 1ZOPA 3CPSA 1DOHA 4WNCA 1RJDA 4JOQA 2WAAA 1RLOA 3D7MA 1YDHA 5IBRA 5D6NA 3AEKA 3W0LB 4EENA 4G8JA 5F51A 5IAGA 3CEHA 5DNAA 1T26A 3V2UA 3OCWA 2P5YA 2D54A 4ZQBA 4OLAA 2Z6QA 2JFQA 4GGOA 4BGUA 3MCVA 1HT2E 1W5AA 4HLDA 4X6UA 2H16A 2MDTA 2A3RA 1BNCA 4R1LA 2XUPA 5KYUB 2OWDA 1MRSA 3QVLA 4IKOA 3UF0A 1QO9A 1TZBA 2BGRA 1QV7A 4CWAA 4BO8A 5IFLA 3DEIA 1JHOA 5GP1A 3C6QA 3SYTA 3CRNA 5H7XA 2DMRA 1SZPA 4AZ3A 5BMVB 2JA1A 2OAQ1 4V1CI 4N8SA 2OGUA 3FYCA 1IK4A 3I76A 4L9RA 5F7XA 1L5LA 2DEUA 5K0JA 4L5JA 3AEYA 1E2IA 4QUGA 3S5UA 4D8TA 3WGIA 2YS6A 3PGKA 1I01A 2XH8A 4H4CA 3F9CA 1U9IA 3WLAA 4F3RA 5A4KA 5HMLA 5K0BA 2W6PA 2F64A 4QHTA 1YQTA 2JD1A 1OV6A 3DV9A 4Y18A 3TZLA 1LJ8A 2EDCA 5FI0B 1ISMA 1V26A 2B2XA 3RK4A 5I9LA 5KOIA 3TEJA 1CJTC 1F8XA 3V2GA 4NBUA 5ALVA 1WMBA 2IHNA 2P8JA 1L7AA 4Q3BA 4D0NA 4EPTA 4CNBA 2IIVA 1I3NA 4HDKA 5KOJB 5KYXB 3TLBA 4YK7A 4A5OA 4RESA 4X92A 2OGWA 2W48A 4EHNA 1CJKC 1T35A 4H1VA 4KSCA 2E82A 3OF5A 1D4OA 2Z1MA 4KWTA 3I6YA 3ND9A 2Q3FA 3RWBA 3UGTA 4DG9A 4MQLA 5FPKA 1REQA 1M6NA 3EIUA 4JDUA 1G7RA 4IIDA 2AN1A 1E6CA 2CD7A 4P3PA 1ZCFA 3CUTA 3M49A 1V8DA 4AJIA 2QUHA 1CE8A 1Z4OA 4AJ9A 4R2IA 2IITA 5PNTA 4EG0A 3IEMA 3VH3A 3D3EA 5E9AA 1PSWA 3KSZO 4IGEA 4LOHA 4DR1B 1WMDA 3LECA 2WPNA 3K0KA 4R0MA 1D1QA 1YUNA 1NBOA 3O4VA 4JSRA 2Q4RA 2VT3A 2BFWA 4LFAB 2C88A 4KXMA 3UMBA 3TAHA 4EATA 2HBYA 4GE3A 1AUQA 3HR7A 5DFAA 2Z2XA 2XPCA 3DKVA 2ACEA 3FI0A 3SSMA 3OFNA 1I3MA 3USZA 3ZZUA 4E51A 3B6MA 5FBKA 1F0YA 4NZMA 2AN9A 3PC2A 1CY6A 4I36A 4Q4HA 2QX4A 5B2EA 2Q3LA 1NDUA 1MNAA 3PDIB 3PUWA 1WABA 2UAGA 2J87A 4QX6A 4Y6PA 3RSFA 5D01A 2DP4E 2NUAA 1BW9A 4JT9A 1SEVA 1SURA 3RJ5A 3TIIA 1HG1A 4XVQA 1U7HA 2WUFA 4UTNA 5K3OA 3IO5A 2O2XA 3UA4A 5IKMA 1ZAYA 2WKRA 1GNSA 1F4VA 4BFYA 1POXA 3WGGA 5JFTA 2Q5LA 4O33A 2ZAYA 4N9WA 4GKKB 4ZK2A 4IH9A 4U8HA 1UOQA 3NW9A 1NBAA 5ITWA 1DUSA 2Y66A 1UZNA 3NETA 5C2JB 5M34A 5CURA 1U1CA 1KE2A 3HCOA 3KKLA 2IVFA 1T29A 1VIMA 5TGTA 3QTTA 4FZ5A 4ND8B 3S99A 2HEIA 4KR9A 1ECJA 1ZRHA 1WSBA 3FCYA 2FWMX 2P6UA 4H6PA 3WHPA 5BV7A 2BJWA 3K8ZA 4O4JB 1XRPA 1PG0A 2BFBA 5DXAA 5B1EA 5JD6A 2CCGA 5C1IA 5JZ9A 3WIVA 5EJAA 1O5OA 1SY7A 5DYIA 5LNK1 1E59A 1ZVKA 2ZJZA 3DCJA 4CQJA 3ZWBA 2UXDB 3EXFB 3G88A 1JJ7A 3F4KA 3S68A 3B1VA 1FZTA 3DHNA 2H4WA 1NW3A 1DZ3A 1HLGA 2VBFA 2IKQA 4TV8B 1KS2A 2X9QA 3RC7A 3X43A 1SBQA 3OJ0A 4FILA 3ZLVA 2EW2A 2MSCB 1TVMA 1VSVA 3CRW1 3KE8A 1NW5A 5KAPA 2C9YA 1PNTA 3RSZA 4XVCA 2I7VA 4FYWA 3ST7A 5C8DA 2G71A 4HLUA 1VG8A 5IUNC 3S28A 1L1RA 4Y2XA 4YY3B 4LTNA 4WSOA 4J1TA 1I3CA 1K7XB 3KBBA 3R3HA 3HJTA 3KXPA 3UUFA 4B3BA 3WP1B 4DMGA 1Q14A 3O8QA 1NVWQ 1XNJA 4G8CA 1C1DA 3PA8A 4J49A 1GHTA 1CY7A 1TQ2A 3K2BA 3H0KA 4R2XA 1XU7A 1PKXA 4KVFA 1TNDA 3G5LA 5DHRA 3UJHA 3B6KA 4LI3X 2J59A 2V6GA 1XJWA 4JVSB 4TS3A 2HLNA 3U4CA 3NYQA 3QW4B 4DCSA 2XIQA 2OPHA 1B6RA 4LYDA 3NG1A 2V7QD 3CVYA 2BEUB 2MCFA 5JXHA 4FYMA 3RSQA 2G5TA 3D1VA 3IC5A 3HN2A 3LF1A 5HQTA 1NQAO 2XYRA 3NBQA 4U7FA 2VH5R 2VP3A 3RRFA 1Q77A 3F5DA 4OJQA 2GNAA 3IE1A 1I2MA 1O03A 2JD0A 2WMOB 3RVPA 4ZODA 4H0FA 2EWMA 4L4UA 3SQMA 1SOUA 1ZQ1A 4ZOLA 1KJJA 2QRJA 4PG8A 1T8RA 3MWDB 1T3HA 3QPWA 4LOKA 4MS1A 4M8LA 4ASUA 4C0LA 3GVPA 4TTAA 2Z30A 3NC0C 1R9JA 4A73A 1U1IA 3P0RA 1EVKA 4X1IA 1VG9B 2ZI5A 5AVVA 1EXVA 2WAYA 4U9IS 4XX0A 1NJ1A 1DXYA 1NPYA 4OB8A 4B5KA 4EGSA 1UMKA 2BVNA 1A9RA 3ESYA 3FLMA 2VQFB 3OQMA 1QO0A 2JS7A 4BO4A 1E5DA 1ZY2A 5CBPA 1QK3A 4FHDA 4GX5A 4DC0A 4PPNA 3GLIA 2VQSA 3INGA 2O8NA 1VG1A 2RH4A 1ESMA 4WN9B 1ZD3A 2C0PA 4Y1EA 4J03A 2GEUA 1PE0A 3DHEA 3TSCA 1ORRA 3FAKA 2NVBA 1GZHB 3SKVA 2R00A 3KDSE 4EY6A 2ZJ4A 1NONA 4S04A 1ZH0A 3KT3A 1ZC4A 1T0HB 1Z13A 4W7SA 2IHYA 1ZU5A 2WJ4A 4TWZA 3RVSA 4OTZA 1M1NA 2KBEA 3CEPB 2UYHA 1SQ5A 1A2OA 1SUEA 3R5FA 3TCKA 4X63A 3QH4A 2QN2A 3UT5B 3WMRA 1BE8A 4DMHA 1KKUA 2PGNA 3KSBC 4YCSA 3VR6A 1JQLB 1LPBB 3JYPA 1J24A 1GVNB 1BC5A 2WAOA 1QIJA 3AIIA 1AU9A 1UKBA 3MTBA 1PBNA 3F5SA 1Y6FA 3GJTA 5DTEA 4WFIA 1VJ1A 5ICFA 3DAGA 4EJ2A 5KC8A 2FKNA 3ZCRA 5BNZA 3L84A 1CB7A 1CW2B 2ONKA 4B5LA 5F9FA 3E7FA 1PS8A 5ALIA 3V8RA 1PLLA 4P3YA 2Z95A 3SXUA 2DBVO 5K6AC 2E1RA 1C9DB 1SM4A 1BXRA 3Q7IA 1N5LA 2BGJA 2WIKA 2GF0A 3W2HA 1S1MA 1AUVA 5T4EA 1R6UA 5CBPB 4ATNA 5G0UA 1MQSA 1K9SA 1X19A 2CFTA 1KY3A 1C1XB 4ER7A 3E53A 3QYJA 4KRXA 5B1HA 821PA 1C2YA 4L2IA 3CIFA 4HYYA 4EA6A 3HYRA 3DHWC 4OI1A 3TH5A 2II6A 3AR8A 3NMUF 4J4TA 3ANYB 1CRQA 4WV3A 4N82A 5EJGA 3U1VA 1GLGA 3EH2A 3MC1A 1YC2A 4C6HA 2ADMA 5DM1A 4JWTA 3TZHA 1TD9A 4DEYA 5BSVA 3KSAC 4FCVA 3G49A 3HJAA 4RE6A 1UMDB 2C9DA 3EEQA 4JCCA 2P40A 5FDFA 2WZQA 4QA9A 4ZANA 4WW0A 3QI7A 4HNAA 4IJ6A 3EGXA 2HK8A 4G0QA 3AHGA 5BVGA 2B8JA 3X0DA 3ROGA 1F38A 5HKLA 2AYZA 1DS6A 2J4FA 2WICA 2H7CA 2O0KA 2F1KA 1PNOA 2DULA 1SD2A 2YL2A 4EW2A 1MXHA 3HU5A 2ISCA 2IH4A 1MG5A 3PC6A 2B8EA 4FUTA 4EYEA 1OIXA 2A7XA 3ODGA 4RL4A 4CU2A 2YRWA 3I9V1 4QOIA 3TAUA 1OLXB 2JFBA 2P9ZA 1P2SA 3AK4A 2HQOA 2NO4A 3FMOB 1Y3AA 4HEQA 4AFNA 3K8QA 2H57A 4KK3A 4BEJA 3N2KB 3IAUA 2BJHA 1DKOA 3TTVA 3ADBA 1G5QA 5KKCA 3UXYA 1R0YA 4E03A 1J2YA 4TOIA 1Z7GA 5JXGA 5LQSA 3M3PA 4KUHA 4Y98A 2G5PA 3R7WA 1ZH2A 2FOIA 3DOIA 3KOWA 1MZPA 4Q1VA 4CMCA 4GD3Q 5HBRA 1QYIA 3EXG1 2IOYA 2NZYA 4FZVA 4GLOA 1EZ4A 3C3PA 2HRZA 1IEQA 1G5FA 5M04A 3UUGA 3HK2A 3MMSA 3F1LA 4P83A 3ECAA 4HNTA 2WSIA 1QG2A 3KBOA 1QH1A 3VFDA 1PV4A 2CXQA 2COKA 2VYCA 3ZNPA 3PRJA 4MR9A 4NMWA 1ADFA 1E0JA 2ILTA 3I9KA 4BQQA 2YTZA 3QRWA 3ELYA 4EVQA 5H9WA 3B1KA 2IS2A 1XK7A 2FSVC 2OAP1 1YTLA 1PR2A 3R4CA 4IIHA 4Z6KA 5K6TA 2D6FA 4ZPJA 2Q3JA 1EWRA 1RT9A 3C3JA 1CZKA 1EFHA 3AB8A 1T0IA 3GRKA 3IOEA 3HA7A 3DR5A 1G21A 4QODA 1HDRA 4ERXA 2Q99A 1N3IA 4NZYA 1KVUA 3SXPA 3CX7A 1D2HA 4PO9A 3SVZA 4G0VA 1TZMA 3AUUA 2ZYGA 1YDWA 5LB4A 1E8MA 2O3TA 3PUKA 2D0OB 2O2YA 4GECA 5IUKC 4E30A 1HFKA 5GQSA 4OLFA 1SIUA 1I5RA 3P4UA 3BX1A 1L7DA 2OXEA 4FFWA 4G0YA 4HI0E 3HO1A 1RCUA 2RHGB 4YJFB 4DIUA 4FFSA 2D5CA 2F00A 3QV2A 3FYDA 5A03A 1R18A 3GFGA 1ILEA 3JVVA 4GBJA 4CYMA 2CFSA 5K3FB 3F8SA 2NXEA 3F67A 3RC9A 5KNDA 2RGBA 2ATVA 1VQ1A 4MKRA 1ZGAA 1MVLA 2VH1A 3SC3A 5J2UB 4DTIA 4BB0A 4KOEC 4ZU1X 4C6TA 1EZZA 5EZYB 2GD0A 4M2LA 3DQPA 2QLFA 2C5HA 4LK3A 1TJ3A 1CF9A 3KKKA 1N0VC 1I2AA 3PP8A 1I10A 3GJ7A 2VPYA 2UZ3A 1ZSYA 4HO1X 4IKPA 1JEQA 2PEYA 4Q12A 2DR2A 2RGWA 2CKDA 1P4SA 2I7DA 2Q4TA 1VIVA 3JD1A 3FMPB 3HJUA 4YI3A 5A4JA 3OOSA 5SYMA 1JHZA 1P0PA 3BYZA 3AINA 3Q11A 4Z86A 4F3CA 2QN6A 2D7CA 3S2GA 4PTLA 1EJ0A 2RBGA 2A94A 3BWVA 4K9MA 4MWSA 4P4UA 1OPRA 4ZZIA 4A15A 2FRDA 1GQYA 1CQWA 1NVMB 3C4VA 2I22A 1LLFA 1XIVA 2GB4A 1QIHA 4QYXA 5ALPA 1CK4A 1QKJA 3FPHA 4JLWA 1IXZA 3VYTB 3LBFA 3VC3A 1SO8A 4R2HA 5K0NA 4WZAB 3WGTA 2B34A 3COZA 4REQB 4ZMSA 3FNIA 1TA0A 4KFRA 3O0DA 4KRGA 4CF4A 4MMYB 3P96A 4RPHA 3GPLA 4OJYA 3UK7A 5IWAB 2I3GA 3OQ6A 5E7IA 1GPH1 4ZAFA 4ETIA 1XEFA 4IIJB 4IFIA 3NT2A 2H54A 2ZSDA 4GSYA 4LGCA 1NM5C 3OEEA 4QOJA 3DZFA 4XE5A 1A97A 2I80A 1ICEA 5JZMA 5IJXA 1NG9A 1I4OA 5DM60 5KDLA 4DKXA 4F9TA 2XBLA 1KQFA 5HGXA 4C04A 2W2MA 3BWEA 3FUCA 3C3DA 2CUZA 3C43A 1WBJB 1XFAA 3H0C