4BLWA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylhomocysteine (adohcy) and adenosine monophosphate (amp)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
280
structure length
280
Chain Sequence
b'MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 97
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blwA00
4QTUB 4YUXA 2ZBPA 5K09A 5CCBA 5HFJA 3LSTA 3KHKA 2WA1A 1L3CA 4FT2A 5CVVA 3BWBA 1H1DA 3FPFA 3LCUA 3GRYA 5EMJA 5D1NA 3LKDA 3R0QA 4GC9A 5GOZA 2GAFA 4PYKA 2PLWA 2NYUA 2ZULA 3GRRA 5LQRA 2OYRA 3B3JA 5DTRA 1WY7A 1L1EA 4POOA 5DSXA 5E1MA 2AR0A 5M5BA 5ERGB 4RTJA 2JG3A 5T67A 1M6YA 1ZG3A 3TQSA 3DLCA 3UJCA 3R3HA 4ER5A 5H02A 3C3PA 2PX5A 5LQAA 2I6GA 4ER6A 1TW3A 3HVKA 4YUWA 3C0KA 3U81A 8MHTA 3SX0A 2CMGA 2XYQA 4QDJA 5ICFA 3T0IA 3Q7EA 4CKCA 3FRIA 3V97A 4E2XA 2C7QA 3VYWA 3B3GA 2FK7A 5EQJB 5BW4A 1L9KA 2H1RA 1JQEA 2LD4A 4DM3A 3P97A 4JXJA 3K6RA 4IWNA 3E23A 3EVGA 3AWIA 2P3OA 1NW3A 4LECA 5LQJA 3R9XB 1ORHA 4KRGA 3MAGA 2NP6A 1G6Q1 2FK8A 2PVCA 4GC5A 5EHGA 4C04A 5LQKA 1KXZA 5GIPE 1YF3A 2ZSUA 5K0BA 1N2XA 1NT2A 1SVUA 2ZZKA 1I1NA 3EVCA 3QV2A 3OU7A 5BXYA 2ZZNA 3B5IA 1B42A 4QDKA 3DXZA 4R6WA 4YUYA 2AN3A 1VE3A 1XDSA 3SXJA 1RI3A 2PX4A 5FADA 2ZVJA 1F3LA 1L3BA 3QOXA 1WXWA 1NW8A 4DZRA 4K6MA 2Z6QA 2CKDA 5EC8A 4RTQA 5KVAA 2ZTHA 4RTNA 2ONYA 2O07A 4FT4A 2BR5A 3TKYA 3HNRA 1XCJA 2ZBQA 5F2KA 2PGXA 3DTNA 2PKWA 3KQQA 2O57A 3NDJA 4ZTBA 3IHTA 5EIFA 3CJRA 2FHPA 4OX9Y 1KYZA 4AZVA 1Q0SA 5DTQA 1VQ1A 3IYLW 3NTVA 4PYLA 4HH4A 3GWZA 3I64A 1UIRA 1ZKDA 3FPHA 3KR9A 3LGAA 1R00A 2JH9A 4RYLA 5DX1A 3TOSA 2YX1A 2IBSA 3E05A 2XBMA 4G56A 2GA9A 4CKEA 4E2YA 3P9NA 1D2GA 2FPOA 2JJQA 2NXEA 5GP1A 3EGVA 4A6EA 4C08A 2GB4A 3G88A 5FCDA 4C03A 3DH0A 2ZFUA 1DCTA 3M6VA 4EKGA 3OFJA 5T64A 3EVBA 4QVKA 3UWPA 4P7JA 3MB5A 5T6BA 3OE4A 3TFWA 4KIGA 5DRYA 1X1BA 4KVZA 2AVNA 3O7WA 2VDVE 3OPNA 4OQDA 1WZNA 3SMQA 3SVZA 3LCVB 10MHA 1O9GA 3R24A 3FYCA 1FP1D 3I58A 4OBWA 4P58A 3GRZA 1Z3CA 5EG5A 2O05A 2PXXA 2XVAA 5K03A 3A7DA 3GCZA 3CVOA 3LDFA 4PWYA 3CGGA 3FUUA 4U7TB 4NECA 3NVMB 3KPUA 1XVAA 2ONZA 4Z2YA 3EEOA 2YTZA 2I9KA 5K0JA 2NXJA 3P2KA 3M33A 4OQEA 5EIWA 2PWPA 2HMYB 4HGYA 1D2CA 1EG2A 2GPYA 3UZUA 3PB3A 2P8JA 5K0GA 4RTRA 1BHJA 3G8AA 1JG1A 3KQMA 2QM3A 3FUXA 3OFKA 4FSXA 3LDGA 4PYOA 1TW2A 4IKPA 1AQIA 3RIEA 4FSDA 4ER3A 3UJDA 4P7GA 5JR3A 4ER7A 3OE5A 5D1HA 1X19A 4R8RA 2EX4A 1P91A 5EKXA 3O4FA 3HCAA 3KPYA 2G71A 3KQWA 3MTIA 4DCGA 3GDHA 3REOA 5DWQA 4P7FA 2XYVA 3BWCA 3P9IA 5CCXA 1JG3A 2ZWVA 4AUKA 2G70A 5LQCA 1KHHA 4FP9A 4E2WA 2CWWA 4CTJA 3IV6A 5KYGA 3LCCA 4YUZA 3UA3A 2HWKA 3MGGA 2CMHA 3JWJA 4DCMA 3G7UA 1ZHFA 3NJRA 3GRVA 5P8WA 2IH2A 2PT6A 1L3IA 1G55A 3GO4A 5FUBA 1BOOA 4WXHA 2OB2A 2A14A 1O9HA 4BP3A 3G5TA 3G8BA 3KQSA 5FA8A 4BLWA 3HVJA 5EMMA 4V0RA 3KPJA 2VDUE 4RTOA 2OB1A 5IH3A 2CL5A 3C6MA 4DA4A 3DXYA 4DMGA 1VP3A 3SR4A 1JSXA 2QE6A 3GIWA 3E8SA 3AXSA 1JQ3A 4XUCA 5EOVA 5EZSA 2NP7A 4RVFA 1XCLA 4GQBA 5EKUA 5DM1A 3MHTA 4PYMA 1M6EX 1NW6A 3EMDA 5K05A 5CVUA 3GRUA 2VS1A 2FRXA 2ZBRA 3HA3A 3HCCA 3OU2A 2Z6AA 2B9EA 3TR6A 3NWEA 2JHCA 3JWHA 5K0FA 2WA2A 3ER8A 3PLAE 2BZGA 4E33A 1G38A 4KIFA 4MTLA 3SSOA 5CVEA 1RI4A 2GS9A 4RX1A 4GOOD 4CTKA 2NXCA 5LQUA 3FTFA 2Y1XA 2P40A 1WS6A 3BKWA 1EIZA 4EMSA 1Q0TA 3HCEA 2G1PA 2EG5A 1R18A 2AN4A 5EEHA 4QQNA 3AY0A 3VC2A 2AOXA 5MHTA 4F85A 3BT7A 2BM9A 4LWPA 5HOQA 1SQGA 1M0EA 3ME5A 2EJTA 1N7JA 3MQ2A 5C1IA 3T7TA 1PRYA 1QYRA 3NMUF 2HR1A 2PJDA 5HEKA 3EVDA 4E2ZA 5C9ZA 1X1AA 1NV8A 1QZZA 3I9FA 4QQKA 3A27A 4H0NA 2BM8A 2B3TA 3EVAA 3HVIA 1I9GA 4GOLD 3X0DA 4RTMA 3CBGA 1V39A 2PY6A 3ELDA 4MIKA 4XUDA 5DPMA 5K0CA 3LDUA 1U2ZA 2C7PA 4IV8A 5FULA 2ADMA 3LECA 3A7EA 2P35A 4R6XA 1JSZA 5DXJA 5FQNA 3P2EA 2IDKA 2R3SA 2VZ9A 2C7OA 4LWOA 2PV0A 3DMHA 1SG9A 2NXNA 9MHTA 1RI2A 4DF3A 2OBFA 3HA5A 2YXDA 3AJDA 2PX2A 1DL5A 2ZW9A 5FTWA 2IH5A 3THSA 5EMLA 1BC5A 3VC1A 3KR2A 3DULA 5DT2A 1XXLA 3PX3A 5FWDA 3T7RA 4M7RA 4RVGA 1ORIA 1KPGA 1RJEA 2BR4A 2UYHA 3DUWA 3TLJA 1QAOA 1QAQA 5E9QA 3TRKA 3NVKI 1R8YA 5HIJA 1N7IA 3DOUA 3FUWA 3Q87B 1VPTA 4FR0A 4QTTB 4RTKA 3EPPA 3ANXA 1EAMA 3SM3A 4DQ0A 5K0NA 5E8RA 2YXLA 4GBED 3EVFA 4PONA 3M4XA 3CC8A 1QANA 3RW9A 4PYQA 2IBTA 4EK9A 3ELYA 3GJYA 2YR0A 3KQYA 4Y30A 5GWXA 2IPXA 3P9CA 1XTPA 3DXXA 3WSTA 1AQJA 1O54A 2AOUA 3FTDA 5FHRA 4PCAA 2OKCA 2ORED 3HEMA 3TM4A 3KU1A 4XUEA 4L7VA 4FS8A 1WXXA 3NDIA 2AOUB 2IIPA 3R6TA 3TPZA 2PWYA 2YXEA 3M6WA 3V8VA 4MQ4A 1BKYA 5BP7A 2AS0A 1VP9A 3OZTA 2HV9A 1KIAA 5HIIA 4PYIA 4PIMA 2PSSA 1RI1A 4Y2HA 1INLA 4RVHA 1YZ3A 3O31A 4ISCA 5GM2A 4R05A 4BP1A 2IH4A 3HTXA 3KPWA 3HM2A 1UWVA 2V74B 3DP7A 1FPQA 1XDZA 2ZIEA 3E7PA 3KQOA 3VSEA 3EEYA 4F84A 1RI5A 2BH2A 1JG2A 4RTPA 5CVJA 4GEKA 2OXTA 3ORHA 1JQDA 2WK1A 1IXKA 2QYOA 3BXOA 3C6KA 2JH8A 3EGIA 4GUAA 3FUVA 4M37A 4OBXA 4M36A 3BWMA 5CIYA 5CM2Z 3PFGA 3G2OA 5FQOA 4HTFA 1T43A 5KQSA 5IKMA 2EJUA 1MHTA 4U7PB 3KKZA 4YUVA 3PS9A 4A6DA 4R8SA 1IY9A 4AZWA 1AV6A 1G8SA 3QOWA 3BWYA 3AXTA 4HTFB 2PX8A 4V0QA 5FWAA 3OZSA 4C4AA 4P7KA 1XJ5A 3FTCA 5K0EA 2ZCJA 4B17A 1OR8A 1X1DA 1RJDA 3LBYA 4E32A 3DMGA 5DRTA 3P9KA 5E1OA 2C7RA 5KS2A 3B7PA 2OO3A 4ATNA 3HA7A 5GIOE 3KR1A 3KQVA 5CD1A 5HILA 3L8DA 2K4MA 2PXAA 4C07A 4E30A 3PFHA 3PTAA 1FP2A 2ZLBA 5DXAA 2KW5A 3FPEA 4RWZA 3JWGA 5GM1A 5F2NA 5LSAA 2GH1A 5E1BA 5EMKA 2OZVA 3TM5A 2UYOA 2E5WA 2ERCA 2I62A 2AOWA 1EJ0A 2FYTA 4MHTA 2YQZA 2QRVB 4HSGA 2UYQA 1EJ6A 1IM8A 4PYNA 1Y8CA 4HC4A 2ZIGA 4GF5A 5K0LA 3THRA 4XCXA 4HRAA 3TKAA 1R74A 5B1SA 5E9JA 4PNEA 4RTSA 2ZZMA 3BUSA 3LBFA 3BGVA 3LHDA 4ER0A 4F86A 1D2HA 3DMFA 3JWIA 3PVCA 4LG1A 4RV9A 4DKJA 2P3LA 4YV2A 1YB2A 1X1CA 3KQPA 3KR0A 1ZQ9A 1JTFA 2AN5A 1VL5A 3GGDA 4RTLA 3ER9A 3UJ6A 2P41A 1VBFA 2PXCA 3G2MA 3I53A 3OU6A 3UJ9A 4X1OA 3RODA 1G8AA 1NV9A 1NBIA 3EVZA 3IEIA 5EZQA 3UA4A 1F38A 3BKXA 3PX2A 3NW9A 4WVLA 5HZMA 5EEGA 5DSTA 1AF7A 3UJ7A 2G72A 3M70A 4C06A 5EVJA 3K0BA 1TPYA 1VIDA 5DX8A 3FPGA 2P1DA 4GOND 1RJFA 4X60A 3KPVA 4EKIA 3GU3A 2Q41A 4QVGA 5E2BA 1FJXA 5EGSA 4PGHA 5FA5A 3TMAA 5BW5A 3EVEA 3MCZA 3D2LA 2R6ZA 4CXMA 3CKKA 3HCDA 2HNKA 4IV0A 4O29A 5EPEA 3SSNA 3EMBA 1HNNA 2XVMA 3B89A 5LR6A 4KDRA 5K01A 3ID6C 3UJBA 4HG2A 4RVDA 4YMHA 5GINE 3UBTA 3G2QA 3P2IA 5E2AA 5ICGA 5HIMA 1G60A 3HCBA 2Y1WA 3GNLA 3BZBA 1P1BA 2P3QA 4FZVA 5DX0A 1KPHA 1SKMA 2YUIA 5DM0A 2JHPA 4KWCA 1I4WA 2EFJA 5DLYA 4GOMD 5EHIA 2NNWB 4AZTA 4PCLA 5K8VA 3ELWA 1YUBA 3UFBA 1JG4A 2IDJA 3LPMA 3DLIA 4KDCA 1SUSA 2DULA 2F8LA 3PT9A 3ELUA 5E1DA 1MJFA 1WG8A 3MTEA 1DUSA 3HVHA 3LKZA 2UZ4A 3G2PA 1P1CA 5JUWA 2IFTA 3I5UA 3C3YA 5ICEA 2AZTA 2V7EA 1EQAA 2BR3A 1KYWA 2G8NA 2FCAA 1KP9A 3OCJA 4PINA 1YFJA 4EVIA 2I7CA 5FHQA 3CJQA 5F2OA 4BY9E 1JTEA 4X41A 5HIKA 1JR4A 5DM2A 4BLUA 3FUTA 5CUQA 5DTMA 2Z6UA 2B78A 3BGDA 2VP3A 3KQTA 2PBFA 3CCFA 3P8ZA 5U4XA 3FPJA 4KW7A 5E8JA 3SSMA 4AX8A 4PYJA 4FGZA 3BGIA 3ERCA 3MERA 2OY0A 3MCTA 4QPPA 3LL7A 2OPBA 1QAMA 1XDUA 1KPIA 3G5LA 1YFLA 3EGEA 3OZRA 2HTEA 4OA8A 2ZWAA 3HCFA 1NW7A 5CVDA 2DPMA 3A25A 1R8XA 3A4TA 4QPNA 4M38A 4UOEA 3H2BA 2PT9A 3FRHA 5ICCA 4RSRA 1P39A 2AVDA 2GLUA 2QY6A 4PGGA 2P7IA 5E9WA 4C05A 2UYCA 2B2CA 3F4KA 2XYRA 1R6AA 1NE2A 3HP7A 2N47A 2AOTA 4X63A 1KR5A 2O06A 3G89A 3SGLA 4BLVA 2B25A 2H00A 3M6XA 1HMYA 1NBHA 4X61A 3B3FA 4YV0A 7MHTA 4AZSA 2IP2A 2AOTB 2O0LA 3T7SA 3UJ8A 3M6UA 4EQZA 1YZHA 4PIPA 1ZGAA 5DM4A 5C0OE 3P71T 3NWBA 4MWZA 2IGTA 4CKBA 3FYDA 3LX6A 1SUIA 1PJZA 1VLMA 3S68A 4YV1A 1FBNA 2QRVA 1NW5A 1UFKA 5KQRA 4HGZA 2JHAA 5G02A 3UJAA 1NKVA 3A26A 2P7HA 4OA5A 2AOVA 2YVLA 3DR5A 1ZGJA 2H11A 4CWAA 5LQNA 3GXOA 3FTEA 2VDWA 3FZGA 3CJTA 1RJGA 4E70A 1SQFA 4E31A 4YMGA 2ESRA 2ZIFA
chains in the Genus database with same CATH superfamily
4C78A 2C5EA 2JIBA 2QP3A 4MQFA 4UM5A 4X8MA 5HFJA 4MS4A 4YYEA 3CX6A 1L3CA 4HMQA 2FEKA 3D1LA 4RKWA 5CAEB 5C4IA 4RZ3A 1K0FA 4G2TA 1S2LA 2AD5A 2VN8A 3V1LA 3E48A 2YDYA 2WM2A 1SKYB 2CJFA 1BWQA 2YMQA 4KBGA 3P1JA 4C01A 4QTZA 4UD2A 5IJZA 4L4UA 1KQFA 1AX9A 4QLOA 5DSXA 5IWAB 2ZCUA 4E7OA 2YHIB 3DEYX 4R9NA 4Y3UA 2AJDA 3S2IA 3VJKA 3GC6A 1SBCA 1KO7A 2M6KA 5CX1A 2DR0A 4K9RA 4MLCA 3G0DA 3R9WA 2BMEA 5IFKA 2F1OA 4Y2SA 4MUFA 3SIPA 4WJZA 4J4HA 1SUDA 3E8XA 5TJHA 4MV1A 2E89A 3ZD9A 1H9CA 1ZS9A 3A3OA 2CMGA 4GXQA 5DEOA 2HF9A 1R0ZA 1SCKA 3PKIA 1AHHA 3B3GA 4AMUA 3U31A 2XE6A 1JDBC 2OQRA 2R1VA 2WWVD 1H3EA 5IAAA 3DT6A 1WV0A 2CNWD 3HUTA 3WGKA 5FI0B 3AVQA 1NTOA 2RI1A 7REQA 1FVOA 5EHGA 1UXOA 4C04A 4PTZA 2FSPA 2G67A 4AIIA 5JJKA 1NTRA 2AHRA 1XE3A 4DWOA 1F5SA 1YKGA 3PHIA 1RZUA 1RP7A 5BR8B 2YCBA 3PD1A 3DBIA 3L92A 2VOEA 1KOLA 4X8HA 1GN9A 1TFRA 2A30A 1H5QA 3ECSA 3VR6A 4HDCA 4AMYA 4BJ6A 4BP9A 3R0JA 4R01A 2MR6A 1T2NA 2YIMA 2ZDQA 1BCRB 4AG6A 1DXOA 5JS1A 1Q3TA 2I22A 2V9CA 2X0IA 1I6LA 2QD4A 1YCHA 3D0QA 1CETA 3HA2A 2IYOA 3FLMA 3I2GA 4BN5A 1TUBB 4I4LA 4UXHA 4CQMD 2GJ9A 2NUAA 1SCDA 1AURA 4FN4A 1SXJB 2BBOA 2VBGA 1NXOA 2EKQA 4LN1A 3ITNA 3I76A 2A1UB 1CVIA 1P7WA 4WINA 3EIOA 3RYHA 3PGMA 1CZLA 4PO8A 3O95A 4YRAA 2IZ0A 3G49A 5TQVA 1KZ6A 2ZYTX 3IUJA 1UK8A 2YX1A 3E1KA 1OKKA 4JAVC 5LYJF 4S1WA 5AI6A 4JLAA 5SYNA 2PJUA 1MG5A 3L06A 2GB4A 1GTRA 3AC0A 2QBYB 4GSLA 3DBRA 3QVSA 3FJ1A 3OPYI 2PBRA 3EVBA 3H04A 5J58A 4BBJA 3UWPA 2VF2A 4DR6B 1BDMA 3I30X 4YMVA 1OZFA 3OPNA 4QGFA 4NH0A 1QHXA 4TT8A 3PTLA 3ZNOA 2W70A 3GLFB 2CSXA 3GYBA 1TM1E 2P6OA 3GOHA 2NMVA 1GFZA 1I8TA 1ADCA 4HGOA 1B74A 1XAGA 3FFWA 1SVWA 2VDOB 2R8OA 1K4KA 2ZT8A 3I1IA 2BJWA 4GP7A 2AYYA 1A5BB 2GCOA 4NOKA 3RD5A 1T8YA 4TV9F 1RLUA 3KYCB 2O2SA 3MWKA 4UQPA 1DQNA 2A2ZA 1XWFA 4NFSA 1JIVA 2JFUA 3ONWA 4EUHA 4RK5A 5IM4F 3OFKA 4L3WA 3E22A 5JR3A 3C5CA 4Z7QB 1FQJA 3KHTA 2JFVA 3ON5A 4R8RA 1KC1A 4HOYA 4JOQA 3DZGA 2D5LA 1I3LA 1YB7A 3WNZA 2YMMA 4R1SA 1B8OA 1VKJA 2BBSA 2PH5A 1KXJA 2X6TA 1B26A 4OO3A 2G70A 2ZJYA 3BC1A 5IW8A 3RYCA 5J4KA 4D8YA 3F7TA 2PUJA 2PAFA 1MNQA 2CXSA 3UA3A 1EWYA 2JBAA 3FSGA 4FFDA 4DLAA 3MGGA 1TF2A 1OKKD 2ZUCA 3S8YA 1G8KA 1BSVA 4UAJA 4BNDB 1FZTA 2GZSA 4AKHA 4XW2A 4LQDA 2WKSA 5AVTA 1M1XB 2AMJA 3L3BA 1SO8A 4MP6A 4MV6A 5EXEA 1Q1NA 3ZXUB 4JKYA 2D0IA 5KWEA 1QHSA 5AW8A 1E69A 2NADA 8ATCA 2BMDA 2YICA 2CFOA 4FKZA 2IYLD 5DHPA 2G7ZA 3R7LA 2NAPA 3KT8A 3AILA 1O08A 5K05A 1JQLB 1PFGA 1NFFA 3FCYA 4G8BA 1I1OA 2H4HA 3IAM6 3RQIA 1NATA 4E12A 4EZEA 5IBCA 4B73A 1R9NA 3NWEA 2QXUA 1SCBA 3FD8A 4QC2A 4DR3B 4K2AA 1G38A 4ARCA 2UAGA 3PQ4A 1OVMA 1XK6A 2GS9A 1X15A 5LJLA 3N75A 5BQ3A 4B80A 2X4IA 1EIZA 2XCIA 3UO8B 1NYQA 1B43A 1A9XB 1R18A 3L7KA 1RRFA 3ZY3A 2ODPA 4YDQA 4HX5A 1H8EA 3E7DA 4LDJA 1YRQA 1C3OB 4EHIA 2ZYHA 2AL7A 4KQFA 1COWA 1PJ4A 3S5JA 4QDUA 4EGQA 1NN5A 4F85A 4N41A 2FCRA 4D7AA 4A3SA 4KPEC 1PFWA 1S8FA 2FEOA 2QD1A 1YI8A 3KXKA 1E9CA 2HSDA 3LW8A 3RRBA 2J9GA 2FN7A 4EO4A 4JYMA 2P4SA 1JF8A 2DTDA 3FSGD 3I9FA 4JJ6A 2O8BB 2ACWA 4C76A 1XP5A 3WX0A 4BOYA 4MMZB 4RTMA 3OKCA 2PY6A 4C9BA 1Y5IA 4MEAA 1WOMA 3TXXA 2ADMA 3CZAA 2MINA 3UOAB 1RWBA 3RU2A 1PL7A 3STHA 3E35A 3LLCA 3SE7A 1SKAA 5KVVA 3WV5A 1ZQ1A 2OBFA 2DE0X 2VP4A 1N6OA 4JY7A 1ZR4A 3ZW7A 1U7XA 4U6NA 1NOIA 2BGRA 4R3WA 3CIOA 1YMVA 3O3CA 5EIEA 2PKQP 4Z9BA 1HBJA 3COPA 1SPBS 4X6XA 5CDSA 3WGGA 4ZJYA 3OLYA 3VO2A 2UYHA 4FIZA 4NAHA 3OJLA 4WKOA 3QV1A 4ZZ1A 3D3EA 3M5DA 4FEAA 5BUCA 3B1YA 2I6SA 3K0HA 4HLNA 4MB6A 4PSDA 4QTTB 3D6AA 4YJGB 3CT4A 5LA6A 4KXQA 1WBDA 1CEQA 4WY5A 1D1QA 4J0GA 4PZLA 4EENA 1DBRA 3MSCA 1NNI1 3N0TA 3DMTC 1G3QA 4JQSA 5IT4A 3HN2A 3LA8A 2OWEA 4HLDA 2IPXA 3CISA 2D62A 3FHTA 1DMSA 1Q7EA 2YS7A 1BU5A 4IO0A 1H8ED 3S2SA 4UVGA 4DYDA 1COWD 3JQ6A 2BM1A 4J2TA 1J25A 1TKCA 5EJ9A 1ZDMA 5JJ5A 5LZ2A 4WFKA 2IYTA 3Q5GA 1GGJA 3RS0A 4EL0A 5KNDH 3ILSA 1FXSA 2WWWA 4GP6A 2W2QA 4JKIA 4F92B 2FUKA 5D3MA 3IMKA 2AC2A 3D4NA 4XLZA 4CMBA 4Y2HA 1RI1A 4LMPA 3LYHA 3LE8A 3QPBA 4L8GA 1CQIB 2L18A 2GNAA 3O31A 4IVPA 3MWLA 4UU7A 4ZRNA 6ADHA 2XKAA 1Q91A 5I7OA 2J0QA 4H1TA 3CRMA 1W52X 4UBLA 2XCLA 1QKKA 1ZJWA 2UYGA 1DG1G 2ZIEA 2M6SA 1MB2A 3G8DA 2BH2A 1YBHA 2XJ4A 3G9XA 4RABA 3BWDD 4ENRA 1MABB 2H9IA 3DQPA 3JVIA 4LC1A 4F71A 1KYXA 4D8WA 2ZANA 1IQUA 2EBUA 2Q1TA 3FR8A 1OFGA 3PNYA 1YNOA 1IN5A 3QJGA 5FQOA 2P68A 3BAFA 3UK1A 4IFIA 1MU0A 1XMSA 4YA6A 2Z9DA 5ARCA 1WB4A 1QH0A 3H6HA 1E79A 4RFSA 4ZQGA 3ZV3A 2I34A 3GVPA 4K9LA 5LZ9A 1AV6A 1P4JA 3K0AB 3DYBA 3O4JA 3N2LA 5M29A 2G63A 2OQ2A 3M4NA 4MITA 3CSSA 1VB3A 1QNLA 1Y7TA 2A0FA 3C98A 5DGXA 5C32A 1AMNA 3ADDA 3ONVA 1CZOA 3D6VA 3CF4G 3F1LA 5AOCA 1GGHA 3C2QA 4H2DA 5K6TA 5JD3A 4E1VA 2P8SA 4LBYA 2BTEA 3KSBC 2ECOA 4URYR 3K09C 5FBQB 1GRCA 1UBFA 9LDBA 3UICA 2DBYA 4C4RA 1FNBA 1CE8B 1H3FA 1ZW1A 2VPPA 2FY8A 5KMGB 2YV1A 4FWBA 3QELA 2ZJ2A 2FKNA 3RYFA 2H1OA 2DXIA 1N0HA 4P34A 3T5TA 1ZVQA 2HL6A 5KHOC 3R3YA 2D7DA 4XH9B 4IYJA 5BN5A 1KOGA 2GHIA 2DCUA 1Z18A 3JZFA 3URKA 1C8BA 1WD7A 3A1EA 4L9SA 5EHNA 3QF7A 1N0UA 3STVA 3VI3B 2J4CA 4MAMA 5DN9A 3RABA 5L8VA 4NP6A 2GM4A 5A02A 4GF5A 2BF7A 2IZ5A 4R2WA 4B6RA 3MWDB 1OFTA 3DE4X 3SNKA 3TX2A 1PSWA 4PBRA 2R48A 2IYSA 1NI5A 4E15A 3A9WA 1WTAA 3DMFA 1NBEA 2Y1FA 3CEAA 4W6ZA 2XB6A 3JW8A 5HA5A 1ZIOA 3FROA 3B7GA 1K89A 1XHEA 4FXPA 2NU8B 1YVRA 2YASA 3MQFA 3WLNA 4CMEA 2O3RA 3D6MA 3SQNA 4JI4B 3KLPX 2SKCA 2FPGB 3HS3A 4WRRA 2CLSA 2O2XA 2ZIXA 3BFKA 3ER9A 5LD2C 3OQMA 5AM2A 1PG5A 3CLRD 4R2IA 3LDHA 1HNZB 1Z7GA 3P5SA 1LBEA 1FYDA 3FJOA 1R4NA 3OQBA 3K9HA 5AJHA 4OXNA 5T4FA 1I10A 1E79D 2C29D 2J9ZB 4FFMA 3T3IA 5INTA 4J8PA 1BQEA 1H2EA 2YWJA 5J4VA 3U6KA 1J6UA 2VT6A 4TSRA 3O90A 3UJ7A 3BULA 4ESEA 4II3A 4C06A 4ZK2A 1C5KA 3EXG2 3H7IA 1OV6A 3O4VA 1J9ZA 1CPYA 3OCUA 2FNAA 3K53A 3ZKWB 3ZY5A 1WDLA 5HUHA 1N5MA 4GLJA 1RJFA 2FEPA 4B7XA 3OZGA 1QE3A 1V9LA 2Q4DA 2EYQA 1G19A 3OOWA 2QTRA 5IUNC 1J24A 1H2FA 1MGOA 4V0ME 3H3FA 1W88B 2BEWA 4O63O 1HNNA 1K6MA 4YCCA 3L7BA 4YJ3B 3RASA 4J7UA 5FLXA 1VZ3A 4F2DA 4J1QA 16PKA 3TK1A 4I8IA 1KAMA 4KXFB 3GLUA 3TF5A 3NKFA 4JSYA 5SY4A 3MC1A 2DR3A 3EZ9A 1UM9B 1Z2CA 1CZNA 3JPYA 4N5DA 1DOAA 1XYVA 4HLQB 2FR8C 3HRHA 4MDYA 3RNLA 5E7QA 1YQWA 1BROA 3TD9A 2NXWA 4ZI5A 1Z37A 1K2VN 4AF8A 3IA2A 4BYGA 1Q6ZA 1ZOSA 3F3SA 4MPTA 5F2EA 2XQGA 3K1AA 1ZHOA 1YS6A 4HT3B 4F91B 1Y1KE 2Y0EA 1HDRA 2F8LA 5DYNA 3GA7A 5LOVA 3IP8A 3JQAA 3HVHA 2PX3A 4ZV7A 5BVHA 3V9AA 5JUWA 1ZN7A 1YXMA 4ZAYA 1PLKA 5HKLA 2OHVA 2HSEA 2BZ1A 1EQAA 1RHRA 3FDIA 2PL5A 3B3QA 5JWHA 3EG9B 3I4FA 1XZNA 4NHEA 3S6JA 3V4OA 3EHEA 4CIBA 4MQLA 3CJQA 2C9DA 5DLEA 1DC7A 2WYHA 4G0PA 4PX5A 4DJFC 2XXAA 2Z6UA 4JXZA 1CYEA 4TZKA 1E0AA 3AZOA 1M9NA 3VV3A 5JQGA 3P0RA 3ZC3A 3C74A 3GFOA 1MJGA 5GGXA 5E8JA 2ZQ5A 4PAGA 1R27A 1XVUA 1BAPA 3PXXA 4ZOAA 3GFPA 1BH6A 3HCWA 2ZZNA 3EGEA 5A9RA 1U2SA 5CPBA 3QEJA 2J5XA 5KOHA 521PA 2PLNA 2VHWA 4HV4A 4JJEA 3GQBB 1Y63A 2F4VB 4JUDX 3QTTA 3SIWA 1IZ7A 2QY6A 3QKTA 3R5KA 5EJAA 1N1MA 3DG9A 3HYLA 1EWKA 3JQFA 3M6AA 3VHXA 2JLUA 4O5AA 4YCMA 2EU8A 3EW9A 3G2LA 3HBJA 3OOHA 1J0DA 2EKBA 1H9AA 2H3HA 3G89A 5GADl 4HEHA 3DFKA 5KYKA 1MQ8B 2Q7XA 1JH9A 2XB4A 3FMOB 3FNGA 3BQNB 3C43A 1LW7A 3QFHA 4CHTA 1ONSA 4BX9A 1MRSA 5AUNB 4QNRA 4OJKA 3FSJX 4HHEA 3JQAD 1R50A 1HL7A 1Y8QB 4G5QA 4DSZA 3NNDA 2IGTA 4OQFA 4PC3A 5HQJA 4CKBA 5FR1A 5DNUA 2FQQA 3RC9A 5IJAA 2ZQYA 1S3IA 3ZQUA 1KS2A 3TLBA 4EZIA 3GGPA 1PFUA 4K0KB 4K81B 2ZSJA 4NDZA 4IOLA 1B73A 4OFZA 1Q16A 4DA9A 4EKDA 3MK31 1XN4A 2IXEA 1VL0A 4Y6RA 3TCNA 1FSGA 3JR7A 5FLEX 3CJTA 1G8PA 4ZOLF 2XNCA 3RUHA 5J2UA 5BQFA 4OF4A 3B60A 1JIXA 2YHUA 3IODA 1XMJA 2ZBPA 3CLUC 1WCIB 3T52A 4KB5A 1WB6A 5EAIA 1IY8A 4FT2A 1BU8A 1JHQA 1Q74A 5E4JA 3K70D 3BVPA 4I1PA 1MG0A 1AZTA 4PXAA 3WDMA 3GLGB 2R6AA 1MLDA 2CZCA 2QYSA 3P32A 2PUHA 3R3ZA 1LPMA 5KDOA 2AR7A 2C95A 4LGMA 3ZWKA 3PPXA 2DM6A 1UBCA 5D8DA 2DKOA 3AR3A 4D99A 4BN4A 1Z0FA 4DB4A 3KT3A 5ECDA 4NEHB 1QXSA 3GJZA 4IJUA 1EDEA 1AB5A 1QS0A 1P80A 2FV8A 3THRA 2XT6A 4DGQA 4DVJA 4ID3A 1GOTA 2C31A 1B14A 1NFRA 3IAHA 4FI3F 1DGQA 2V0NA 3R77A 1Z4KA 1KOFA 5A0TA 4TWRA 3DB1A 4K5QA 1GZVA 1SXJC 3RIHA 3NI2A 4IWXA 3GUZA 2WV7A 5ICFA 1C3VA 1QLJA 3M4ZA 3WGHA 2E87A 1TJPB 4DWVA 4OHCA 3MJRA 3VYWA 1THMA 4KBFA 4REMA 4BO5A 4KFTA 1FQWA 1VCHA 4MRNA 2DQZA 2XSZD 4OHZA 4BX8A 2VK1A 3ZIAA 5LQMA 1Q0ZA 2G82A 4K46A 1EVEA 3JZAA 4PZAA 2REQB 3VX4A 1NVDA 1NDQA 2QRZA 5LYJA 4FN5A 5KB3A 4S1VA 1P4HA 2IHVA 3MAGA 1U2QA 2ZXEA 3FI9A 3PDHA 3GCGA 1POXA 3QPCA 4X45A 3LK6A 4C0BA 1QLWA 4NV3A 4BPRA 2FZKA 1AC5A 2SICE 3KEGA 3ADCA 4QM6A 4EEXA 4JL6A 5D3QA 3L0YA 2XA2A 1YC2A 3F4BA 3MMNA 1DX6A 1DBSA 2GKGA 2PA0A 3H97A 1AS2A 1SZDA 3M1IA 5FT9A 3E4CA 3P0IA 4S35A 2VRNA 3LUCA 4H3HB 2EWMA 1QGAA 3FBTA 2OFFA 1NLMA 5IJWA 1FFAA 5EC8A 2PZKA 1IUNA 1R6VA 1JXMA 5JXGA 4NAVA 2W6MA 2JKYA 5B30A 5F2KA 1MW9X 4DA7A 5J1SB 4MMYB 3AJ9A 2AC7A 1W96A 1C9MA 2W98A 2PKWA 2BKLA 1SUAA 4TV9A 2XI4A 2ZSKA 3OPYA 4NENA 3ZZ0A 1X8KA 1OB5A 3GF4A 3RV3A 2WKWA 1JHYA 1FCJA 1OXTA 1Q0SA 1QP8A 1TLFA 3VYUB 5IM4A 4YI3A 4MUXA 1KZGB 4AYXA 3G6WA 3GBSA 2CL7X 2Q99A 3BFXA 3NDRA 4QBIA 1Z2DA 3O0DA 1D2GA 2B2XA 2Q29A 2BFBA 3CZPA 3P9XA 1DAKA 3IESA 3I37X 1MO2A 2FN4A 4QUGA 1KVSA 1UP6A 4NV0A 2AKEA 5JHGB 4FWIB 1PUIA 2FUEA 2EFYA 4IIUA 4URUR 3COJA 2QMEA 4MUHA 4IMRA 5ES3A 1GT91 1JT2A 2W6IA 1R5BA 3DE2X 2FQXA 5F1YA 4OLAA 1U3TA 2JEOA 1DUIA 3DV9A 3WYNA 4F93B 1K6JA 3TVDA 3D7KA 3PD7A 3TW8A 3NETA 3FYCA 3K0CC 3M9LA 1FTWA 5DU2A 4MKZA 3DEFA 3FTQA 3U44B 1T36A 1X42A 2BAGA 5C18A 3V1TC 1GFSA 4NECA 3KQNA 4NNJA 3WMXA 2BKXA 3DDHA 2WZQA 1UKAA 1IK4A 1NR7A 1TDJA 3OF2A 3P2KA 3A10A 2YXPX 1T15A 2PWPA 4TYYA 1B8PA 3WFZA 4XGKA 4D42A 1F6DA 4B4VA 3PDIA 1GV1A 3ZGYA 4E5YA 4L6IA 3VKGA 2FZLA 4FMCF 3BMXA 2X0KA 2BSXA 2HJGA 3KHSA 2FWBA 4K87A 3W6PA 2PMKA 4ZO4A 1ZUWA 3U4MA 3R6WA 1BH2A 1IQ0A 3THOA 3LG2A 2FJ0A 2LE0A 5KZMB 3C1UA 1CB0A 3C39A 4F56A 1Z9BA 1E3DA 3BCSA 1GTZA 4L76A 4DCGA 4UC0A 1M1NB 3AP2A 3HBAA 1KDTA 1KRHA 3A2LA 3M0EA 3ZK7A 5THKA 3JAWB 2CCJA 4ZC8A 4DKXA 5T57A 2PV7A 2HDHA 1EXVA 1CRPA 2VSXA 1L5GB 2HLHA 3IV6A 2ZI4A 1SC4A 3LCCA 1OWMA 4K6HA 3N58A 4I5EA 1C9DB 4D81A 1XK7A 3TIVA 1KKMA 1T5TA 2XCTB 3UQYS 1MO4A 2PT6A 4R2XA 4DHWA 1OT3A 4WXHA 3W79A 2HCRA 3GZNA 1O9HA 3IH5A 5JYEA 1V7QA 4BRUA 4XAQA 3KELA 4AJ4A 1KEWA 1CDDA 1UPCA 1YE8A 2W6ID 4MV3A 4Y9SA 3QE2A 4LQLA 5GV8A 2JK1A 1OD6A 2ZE6A 3UJ3X 1YTUA 3MW8A 5CGZA 4D9HA 1QDLB 4KR0A 2Y68A 1PL0A 1I7NA 2XE7A 4D5EA 3E5HA 3EMDA 4QREA 1Z47A 3COWA 1NQ5A 1NYRA 1P6XA 1N75A 2HMTA 1U7ZA 4P5EA 1L5HA 5JNRA 3IT1A 3JWHA 4AECA 1HLDA 1YC5A 4W7SA 2BZGA 2MYNA 5JS2A 1QCDA 1J0AA 1UJNA 2VSQA 4HS4A 1AMUA 1FTGA 1RI4A 1F51E 1RWXA 1FNCA 2CLEB 3E9ZA 3TMYA 1TZJA 2DQYA 3KE9A 1LLCA 5LZ5A 2PGNA 3ZBQA 1W29A 2DGDA 2MSEB 2QYHA 1AG9A 3PGJA 4MW1A 4BJ5A 1N34B 3PF8A 3DCYA 1HGXA 4QO7A 5AM3A 4X85A 4AJNA 4H1HA 2VKTA 1QTRA 2ZREA 3ZE8A 1G5QA 1OTHA 2D0DA 5JZMA 4AJIA 2Q7OE 5THQA 2IYXA 1N1EA 8OHMA 1NVEA 5C1IA 3T7TA 3KJQA 3M5WA 3OTHA 3OTWA 4IWYA 1QIGA 5CYOA 3SHVA 3LWDA 4JOCA 2XZTA 1J42A 3RVDA 2R44A 3T41A 2CYCA 2B94A 1E4YA 3LCMA 3WB2A 2ZBGA 3ZHUA 3ZLJA 1KC3A 1E1YA 2BFEA 3CBGA 1ESEA 4IHAA 1RRCA 1U2ZA 1NZDA 5AQEA 3UPTA 3R7WB 2WIAA 1X0VA 2GJ8A 3P2EA 2AQIA 3TZBA 1LTQA 2VZ9A 1CUYA 3S2ZA 2MT9A 4I4IA 4QT4A 4WBNB 3JARB 1J8DA 4WLOA 4XSVA 1YVUA 5AOVA 5I6DA 1Z6PA 2AXEA 2FPUA 4TSFA 4B3RB 3MUEA 3SPXA 1QVWA 1K5DA 2CBZA 3ETGA 2P9HA 1BC5A 1MC5A 3VC1A 4ZMBA 2O48X 5FBHA 1VBKA 2GM3A 4KHPB 1MV8A 3KOMA 4KR6A 4EAQA 4UU1A 1WPGA 1C81A 3E0QA 4R1MA 3DUFA 1N7IA 1N9ZA 1LRKA 4TKVA 2PU7A 5KCZA 5K0NA 1ECCA 5FOSA 4JHLA 3VUEA 3WL6A 3LQ2A 4IDDA 2C4HA 2XH8A 4EK9A 2MDTA 3TOZA 4Y30A 2DEUA 4AJJA 2PUVA 3EPRA 3KXPA 2XCUA 1Z0DA 4NBNA 2Q4BA 4DRYA 2YYSA 2OKCA 3E03A 5CFNA 5KYUB 1TT7A 4PG8A 4CLRB 1OH6A 1EVJA 3O3NB 4FS8A 3F4LA 4KO3S 3VV2A 3T9FA 4EUSA 2YZKA 3ET4A 4B34A 1LPPA 2BF4A 2YFYA 3G85A 3JRWA 3ZV5A 1UR5A 3AJRA 2UXDB 4NMHA 1UDAA 2CCKA 3EFHA 3KTOA 2Q3JA 4NX2A 1M33A 4ISCA 1US8A 3H5AA 2KLHA 4H31A 4HADA 4IP0A 4ZARA 4EJ2A 5IF3A 1LDGA 1LJ8A 4E14A 4BIIA 4QQFA 1WMEA 5B3KA 2VAXA 1GNQA 5DTEA 4BKOA 4WKNA 2HRCA 2VO1A 4AO7A 1O03A 2WTXA 3G82C 2A9KA 1T91A 1YVEI 4KLCA 2RH4A 1NAIA 2WEKA 3BL6A 5FIUA 3ZJYA 5LMCA 4N7BA 2WRZA 2YFQA 3DDSA 2C04A 121PA 2D5BA 4IXDA 4TSFD 1GZDA 2NZUG 1F12A 1V71A 2BRUC 2XDAA 3KKZA 2P4QA 3GJ7A 3LDAA 1Q1ZA 2PH1A 4DIFA 2GAAA 2NPOA 4BUJA 1DTWB 3S81A 5BMVF 1CUGA 2H7XA 2YH2A 3UUEA 4OPMA 3W2EA 3DEZA 3RAPR 1HF3A 4GX1A 1OR8A 4OH7A 3B20A 3F6SA 3I39X 4QO8A 3AF2A 3ZU5A 1C30B 7GPBA 4WERA 3L4EA 3HA7A 1X74A 1IIRA 3KTDA 3TSAA 3C3AA 1EWQA 4DANA 4J6EA 4MKXA 4D4JA 5NULA 2JH3A 4TYQA 5ALYA 2ZSIA 3R7AA 4N48A 5J4HA 4HQLA 4AF7A 1N9GB 2WJ6A 3LUAA 3ZE2B 5DLPA 2J0UA 2OWDA 4HCJA 3R40A 3GFBA 5EZ5A 3CV3A 4EY5A 4YLYA 4UFNA 1P5RA 5CVTA 5AESA 3EZLA 1ZOIA 3A3YA 5KQLA 3EULA 1TFUA 3A3PA 2CJPA 2RGUA 3E9EA 4HUTA 2C9MA 3O4GA 4E03A 3CZ9A 1V8ZA 2NVUA 4OHPA 4LY3A 3NKLA 5EHZA 2DLCX 1PD0A 1I01A 5BN4A 1PV4A 2E37A 2QG4A 3DVAB 2AJCA 4B3MB 4L72A 1HEUA 2VYNA 4UMDA 1KBZA 1X1CA 2W2XA 2X2EA 1PLJA 2A59A 3FHOA 2FEWB 2ID8A 4EOGA 1D2RA 4XXHA 1ORVA 3LYLA 3DBHB 3JATB 4JOBA 4ITVA 4ZVVA 5A05A 4B84A 3GR6A 2A4MA 5K4AA 1VG0B 1VKHA 2GSDA 4ZAZA 3EVZA 3OT5A 1CJSA 2X41A 4Y2YA 1QWSA 4PHCA 1EPUA 1X1RA 4Q4AA 2AE1A 2PK3A 1X7HA 2PZMA 4Y2JA 4BASA 5BPFA 5JJLA 1ZP6A 2Y92A 4DC9A 2C07A 2JI9A 1FUKA 4HDAA 1QO9A 5FD8A 3IBGA 4D4MA 1XMQB 4QJIA 4F4FA 1TPYA 1V9SA 2P2ZA 4O02B 4Z49A 1GITA 5IANA 4CKWB 4RLFA 3OX1A 1J0CA 1I2ZA 1Y5LA 4LYDA 4WD3A 2UU9B 3GJ3A 4QT0A 3TMAA 4TX1A 3MCZA 1M66A 3JQBC 2ODQA 2ZI6A 3NIGB 1PV1A 2NO7A 4TLEA 5IKXA 3CBQA 2VJBA 3EMBA 5DWDA 1G64A 3KYDA 2HXYA 4OKSA 3VSCA 4A4DA 4AX4A 4RH1A 5FFFA 4RA6B 3WGIA 4LF9B 2IHUA 3O4RA 2Q5OA 1VJDA 3BJZA 3P45A 3EC1A 3SYKA 4FKMA 1M1UA 2GK3A 2ZB7A 3G5AA 3ICWA 2XJ9A 5BUZA 1AHPA 4Y2XA 1TM3E 3RGGA 4JEHA 3LM8A 1YUBA 2G1JA 1S89A 4LHWA 3SLGA 3ICQB 2A9VA 2PDAA 3BJMA 4AZVA 2RGGA 4BO3A 4F5DA 1H2AS 3PT9A 2YVKA 2QE7D 3HU1A 1ZU4A 3QLTA 2VYND 1MIOA 1AK2A 1QIHA 3VC7A 2G9QA 1BQ4A 4C7MA 4O0MA 2Y1KA 4RDHA 2C8VA 3THXA 1UT8A 3C8HA 1XLUA 3Q41A 2NUTB 3SQDA 1L5YA 2Q1SA 2QI9C 1WXHA 3FETA 4RPHA 2WQ6A 2DBQA 5JSHA 5LDDC 5TGDA 4BY9E 4X41A 3EARA 3HLTA 4Z7JA 3A3NA 3NGMA 1TVEA 4YRRA 1YNSA 1MAHA 1TCCA 4YMLA 1TAUA 2XT0A 2B78A 5ETJA 3V4PB 4Z3OA 3IJ5A 1OB2A 2CYAA 3BJIC 4N5NA 4G5GA 2JC3A 3ZWCA 1IB6A 1UPAA 2IUTA 2AFIE 2WD7A 4FGZA 2BFFB 2XAUA 4QPPA 1QOZA 1DOHA 3GA5A 4UZFA 3OJOA 4KFRA 1GQRA 3A4YA 5C3MA 3N6XA 2C8JA 4ZOLA 5GMOA 3VO1A 3Q3IA 4Y7CA 3HCFA 3RF7A 1E3MA 4V2IA 4EG0A 1XCGB 3C41J 2GETA 4XZ3A 1QSGA 1JN0A 1QYIA 2P2LA 4QOFA 3HXQA 1FX0A 3G59A 3D31A 4MA0A 5TQ2B 4O4HF 1QV7A 4O6VA 3VTFA 1TGVA 3R7BA 3WNDA 4CIWA 2E21A 3CKMA 2OLKA 2XYRA 4R16A 4XIFA 1E61A 1VLHA 3SBDA 5HMLA 1QFJA 2N47A 2CXTA 5EXTA 1CFJA 5JSQA 2JD1A 2V97A 2A5FA 1HMYA 4MR8B 4YV0A 4FJ2A 1Z0IA 1Y4SA 4CQLB 2GGSA 4AKTA 1VLZA 4BAUA 4LSZA 2IS6A 2DUMA 4GZMA 1MOSA 2DFNA 4R7TA 1L5WA 2VYCA 5ALZA 1RYFA 3X1ZA 3GPDG 1ONOA 3NBUA 3S68A 5JJBA 3MCVA 3QVVA 2FPKA 2WFMA 3FCXA 3RVKA 4HGZA 3EEFA 4H3KB 1NVGA 1IHYA 3F9IA 3UW3A 2YZNA 5JCZA 2P0YA 2AOVA 3F8SA 3IP6A 5JEEA 3Q7SA 4MYRA 3AESA 1G291 2Y99A 3QEAZ 2C7PA 4KNWA 3FZGA 3PRYA 2ATXA 4TWZA 1ACJA 1IL0A 5TB5A 4E70A 3ADOA 2GXQA 3SZMA 3WO0A 4F8JA 1LVHA 2WFZA 4NICA 1M6NA 5KVQA 1GG5A 3GGCA 2GPJA 1ZUHA 2VAVA 3M49A 1CBUA 4D9GA 2IY8A 3M89A 5TE9A 5A6SB 3LTEA 4QPZA 1JR3A 3TPCA 4BZXA 1Y6JA 1IBCA 4B33A 4LTMA 3ZWBA 2CYBA 1N7GA 2RGWA 1ZRHA 3JQDA 1Q19A 1RWQA 3MJCA 3HRKA 2VJKA 1L1EA 4LXGA 4A91A 1JG6A 1JFFA 2F3SA 4ND4A 3SC6A 1M6YA 3H2ZA 3L8HA 1IWBB 3PQ3A 3RFFA 3AHHA 2OCYC 3Q3VA 4RIFA 5L7YA 4DNOA 4H4EA 2A86A 3MIZA 1P77A 2NGRA 3I73A 5A3JA 4L8FA 5LWHA 1H4TA 5FJIA 1HRDA 2RHHA 2J4FA 3C0KA 4DLZA 5IJ9B 3AOEC 4EGJA 3A1VA 4F04A 1U8CB 4D3SA 1KI8A 3OA0A 3Q5EA 1JHAA 5FH9A 4L85A 3WGUA 3RS5A 2CZQA 4HLUA 1C4WA 4O4JB 3RR2A 2B37A 2ZJ0A 4DLTA 3DE5X 2IODA 3IR5A 1N6IA 5JV5A 4JVOA 2AFHA 3RIGA 5JO9A 3B48A 4JUAA 2QT0A 5JC8A 1Y1TA 3GJRA 2FUG1 4P3NA 4EARA 4OK5A 3AGQA 4N8SA 1KJ9A 5DULA 3ZOKA 1KVUA 4C0SA 1LJLA 2VL7A 3I3OA 5JXIA 1E3WA 3ENVA 1CTQA 3UGKA 3DWGA 1FQOA 1BHSA 3TRDA 1ZNWA 3P2JA 4ZWNA 1D1TA 1IDN1 4L3VA 1RXYA 2PTGA 2RAVA 3CEMA 1UWLA 3PNPA 4EHJA 1ZYUA 4DSAA 3QXJA 4G41A 1XLTC 3EWIA 5EN4A 1BXZA 5LNK1 1T8RA 1X0XA 2CKDA 2OCKA 3OCWA 4MS1B 4RTNA 5HZMA 3ZWQA 1DXYA 4DMMA 1JILA 4NU5A 4AULA 1LLQA 1JR3D 4IQGA 1F0NA 4TS3A 2PGXA 3OAAA 4BQNA 4ZEXA 4A6PA 1E3EA 1RHKA 3BF8A 3F46A 1GNTA 3JTMA 2ASEA 1RDFA 2AG6A 2W11A 1AKMA 4L78A 4HEA1 2O2CA 3MD9A 4U0KA 3GWZA 1Y5NA 3CNEA 4QULA 3C5WP 4V0SA 3VU9B 4E6PA 5KVSA 1NXWA 4J4BA 1YR9A 4IDBA 4RCVA 3WY9A 4BRWA 1NUAA 5A5EA 3BHNA 1V11A 2F9LA 1LWNA 2JJMA 1VPLA 4TQUS 1WETA 1HDYA 1UODA 2FPMA 1PDVA 3QXHA 4IRMA 5BQOA 1RZRA 2XIJA 4XA8A 4O2AB 2VATA 1VHTA 4BDSA 2QKYA 4X84A 4OJTA 2WHRA 1E9BA 3NASA 2COKA 3MB5A 5F21A 2PQ0A 3L8MA 5A71A 4AWXA 4E5UA 4MP8A 3LVRE 5AOAA 4ZJPA 4MOWA 3QP9A 1X1BA 1T5DX 3AV3A 5TT0A 5TV2A 1BJTA 3T1NA 3VRHA 1O0CA 3AFMA 1TM5E 2E4UA 5KOIA 4F4UA 1JLLA 1L1RA 3N2NA 3LBHA 2OORC 5K03A 1CJUC 2KX7A 2YN0A 3O1HB 1ENPA 4GM4A 4WZAE 4YAEA 2LDBA 1GCIA 2XMDA 2BFDB 4OHWA 4B3IA 1NPTO 1I80A 1PFQA 1C0EA 1RPNA 1VLLA 2M6RA 3K31A 1QQ6A 5IEBA 3T4PA 1OXKB 2OECA 5GVRA 3GGSA 2RAFA 2FN8A 1M76A 3MYYA 2GPYA 1SHTX 3BZWA 3U7FB 1XZPA 4CM8A 2XMRA 2X2FA 1RHJA 2YMLA 3FUXA 4DM7A 2XXJA 5AFSA 1Z45A 2C4KA 2P5SA 3C16C 4FSDA 4P36A 4U9IS 4BO8A 3ANNA 1JU4A 3CNQS 4NEGA 1UBSB 3QI2A 3A1DA 1X19A 1FFXB 2ZSBA 3B13B 3LNCA 3DP9A 4X3CA 4XYBA 4BLRA 3OAAD 2X5JO 1D6JA 5JOQA 5FUWA 5GJCA 1DWOA 2GAIA 1ABFA 1GRRA 5A4MS 4INJA 1SUEA 4C6SA 1Y8RA 1AM4D 1V41E 2W4QA 5I8ZA 5H4GA 5JHHB 2PSFA 4BX2A 2W48A 1P19A 1RQ7A 4NBTA 4Y6LA 5FX2A 4YUZA 2CUTA 5EPUA 2HWKA 5KNBH 3SJ7A 1Z7YA 4RULA 2CLFB 4Y1FA 4Q12A 1T4CB 3B2QA 3GY0A 2KJQA 3NJRA 1AA9A 3EWNA 3EXAA 1T0PA 3S2EA 5HRUA 1RZRD 1LCIA 3R75A 1KQPA 3JRNA 3ZZTA 1X7WB 4HD8A 3RJTA 3SJAA 5TXGA 3AVTA 3WMWA 3H16A 1RFLA 1T9HA 2JKZA 4FBLA 4CN8A 2ECQA 4EHKA 5CDFE 1PTJC 4JQOA 2QE6A 5KYXA 1X70A 3DFIA 4P98A 3Q2KA 3PUVA 4TQAA 3S2YA 1VPWA 1ZVVA 4Q7QA 2OXRA 3ONNA 2EKPA 4G81A 2CHGA 4XQCA 3JTEA 5M04A 4R1PA 3BJRA 3QKWA 4P4LA 5AKLA 1SURA 5ALVA 3HG7A 2GI4A 2PD4A 4BO6A 3TTSA 2AZ4A 1P4GA 1U2DC 3GFVA 4FHFA 4MQ6A 3T5PA 1SOWA 4CTKA 1H0KA 4KLRA 3T9CA 2PUGA 1ADJA 4G5RA 4MI1A 4EMSA 3MGCA 5CM9C 3HU2A 1J2JA 1XA3A 1XZQA 2Y2VA 3D8NA 3NHZA 3NWOA 2VDNB 4KO1S 5IBPA 4XWYA 3NYWA 3AHEA 3AYZB 3KUCA 4CT0A 3OZUA 1LBQA 2OBYA 3K9BA 4BE4A 1U3WA 4D4KA 3OQIB 2Z5VA 1JJVA 3WWOA 4MS3B 5LB2A 1N25A 4GPZA 2WHPB 2B30A 4NDAA 4E2ZA 3MTGA 1SXGA 5FV4A 3GLIE 3HHPA 1NSTA 2RCNA 3JQEA 1NV8A 3QUQA 1QZZA 3KVNA 1GGVA 4MGIR 1GL3A 5KWSA 1NE7A 2ZVQX 4D4HA 1E2PA 1QFZA 2VT2A 3BCRA 1UIMA 3IULA 2H5JA 3LZ6A 3ORQA 4LV8B 1LSUA 1E5DA 2ZIAA 4IV8A 1E1RA 1Q3KA 1AKWA 1JJBA 4G5HA 2PS1A 3BIXA 2CDNA 5LLSA 2PV0A 4ZV4A 1LSSA 1Z5PA 1FXUA 4AP5A 5JY6A 1H1TA 2X0EA 4YRIA 2IEGA 1TADA 2B98A 3KXIA 3LQ1A 2G04A 4BB9A 4BP8A 3BL8A 1DL5A 3KHUA 1ZM4A 5EWMB 2WF8A 1W85B 4G0OA 4NG4A 4DTIA 1OW3B 4NE7A 2O5RA 5E3JA 2IS1A 5ALEA 1WUKS 4W1PA 3T5CA 2I87A 5EP1A 1A5TA 3I0MA 1WRBA 4QECA 3TRKA 1MV5A 5IKPA 1NBOA 3ZCXA 1C0PA 1D09A 2JIPA 3K5WA 4WA7A 5ALWA 3TR5A 2ZIWB 1VKZA 3G7NA 1TVMA 4X7RA 2ODBA 5F77A 1FZQA 1UBOS 3TO5A 7ADHA 4MGZR 1TRHA 2AJ8A 4NZNA 2IEAA 1QFSA 1VXRA 4EB6A 3FPKA 3PCTA 1HEYA 3OLWA 2MWMA 2CNNA 4R9UC 4MW0A 2BV3A 3WRVA 4YRBA 3LGSA 4KQIA 5FPYA 4NAUA 4W1QA 3HXTA 4PPNA 3DDUA 1VJTA 3DV2A 4DR5B 3TLXA 5CHYA 2Z8YA 1HURA 2CJXA 5DHQA 3ZCSA 1JYSA 3T3HA 4GP9A 1LPNA 5IT0A 3QKRB 4LY6A 2ZSAA 1NQXA 4TWIA 4YAFA 4U8HA 3OZTA 2CVZA 3GG9A 1W4LA 4EITA 3NBZC 2H08A 4DNXA 1F48A 1D5CA 3N70A 4FIDA 3IA7A 3SQLA 2X3FA 4U7GA 1VG9B 5K4HA 3U7HB 2IH4A 2VC2B 1Y4UA 3E7PA 5H82A 3VSEA 3I92A 1E1RD 1DFGA 1JG2A 5AK6A 3V8NA 1PJ8A 1IXKA 4I66A 2GCIA 2J9YB 3B1ZA 1MC8A 5ITZA 3DD5A 3DMTA 3R5TA 4RQUA 1YZUA 3EIEA 4JR2A 4LRWA 3T5BA 1N2IA 2JD0A 1VSBA 4P6VF 2QRNA 4R2KA 5C5IA 1KY3A 1R9JA 1NZJA 2J41A 3MT7A 4E5DA 4GLLA 1WAMA 4WNAA 3R7NA 3EAGA 1U7HA 2VA8A 4GBGA 1WKCA 3N7AA 2XVZA 5J4YA 3A6LA 4PXSA 1XNJA 4IY1A 1YQTA 4GXRA 3ROMA 1TXGA 1LS6A 1XJ5A 4NEQA 5C2JB 2BI7A 4DSTA 1KEZA 3OOYA 2ZCJA 3DONA 1EA7A 1RJDA 3C3XA 3VOAA 1N2HA 1C9KA 2WYOA 3L8YA 3SJCA 3IURA 2C7RA 1XU4A 3IE2A 4XVUA 2FPIA 4NXMB 2QJOA 3ZVRA 3OEEA 5GIOE 3KQVA 2W00A 3LU1A 4B3DA 2DPLA 4KO2S 5CLFA 4KO4S 2EXXA 5JI3E 4GVPA 4BZWA 3KB2A 3UKJA 4NCHA 2JIQA 1W2GA 4ZEOA 2OV3A 1N2JA 4R8SA 1CJCA 1WMDA 3RWMB 1TLTA 2IE0A 5EMKA 1V6AA 3ZDCA 4GQIA 4MRMA 4TL6A 4CEHA 1PR1A 3KZNA 1NBWB 3CUVA 4XYLA 3L1VA 3ORSA 5DH9A 3QLUC 3U7QA 1K86A 2NTVA 3CLHA 3IAXA 4JELA 1IZYA 1X8LA 1WZ2A 4BMYA 3AFIA 1RAAA 5EMNA 4JT4A 2IELA 2W37A 3HCPA 3X1MA 3AFHA 5FO1A 3JD0A 3LBFA 3UMBA 1SCUB 3PVCA 3PEUA 5B6PA 1G21A 1Z0SA 1FFDA 4I5DA 2ZJBA 4NBRA 1Y3AA 2FFRA 4LSGA 3R7DA 3TDKA 4BYMA 3DC7A 4CODB 4F9EA 2AN5A 3H4VA 3WK4A 1D9ZA 1OLXA 4NZYA 5JNUA 5MF6A 2WUDA 3BFVA 3AMVA 1M2GA 4F06A 1HX7A 3KL2A 4G89A 1DEAA 4AC9A 1RR6A 2A0XA 2WWFA 3ELBA 4DLNA 3I01A 2ACVA 3NW9A 4YJHB 4S04A 1DIBA 1MX9A 5JZOA 2FWNA 4WLVA 4M1OA 4ZHQB 2V5UA 2O0KA 3ETNA 4DQLA 2XB9A 4E09A 4TMXA 3ZUGA 3NONA 1JXOA 3DJYA 3FI0A 1A2QA 4FMPA 2ZE7A 4YQFA 3WLPA 4XWAA 5K3CA 3VPSA 2HU7A 2XY4A 3MOIA 4MDEA 4URZR 2NZJA 2Q41A 2P1ZA 2AMVA 3QMVA 3ZHCA 5FA5A 4D3YA 2E4ZA 2G28A 3TX6A 1RC8A 3UJ8A 1ULTA 2IQIA 4FDLA 3TUJC 1SMKA 1B93A 1QGUB 2B8TA 3RF6A 1VLQA 2PWZA 2OBLA 2G7MC 4J0EA 2W7TA 4H27A 1P9WA 1Z7WA 1KJIA 1OX6A 2BGJA 4QU9A 1NQUA 3NNNA 2SKEA 5DGDA 1OIWA 2Z08A 3PHHA 3CVWA 4EB3A 3FOFC 2F3TA 2PSEA 3ZCPA 1IUKA 1JG4A 1UINA 2JAUA 2WW8A 3MAJA 4LMAA 3MXOA 5EIBC 3RTCA 4CTOA 4PNEA 3HMQA 4O4HA 4V3BA 2I67A 2K7ZA 5IH7A 2XWPA 3HGMA 4CM9A 4IOMA 2JRCA 5A0FA 2ZJ4A 4B4WA 1XTZA 3FSEA 2V7EA 2H51A 4JBXA 4ND7A 5FPSA 1NVFA 3ADPA 3P4UA 3ANTA 2WAXA 4BQEA 2AMLA 4EVIA 3IE0A 2E48A 4LCJA 4ENPA 2VUHB 2AZDA 5GAJA 3OTIA 4LCEA 1ULHA 1U9ZA 1GCUA 4EW1A 1GSHA 2ATEA 4NCXA 3BN3A 2NG1A 5TMBA 4BLUA 4PLVA 4XX0A 3Q8KA 1P0MA 5A4AA 4RACA 1UBHS 3KQTA 3L0SA 3MLBA 5TEWA 2VK8A 1TK9A 3K9CA 2WHQA 1A3CA 3DQQA 2PL1A 3SSMA 2RB5A 3B5EA 2HHAA 3MERA 2YYAA 3PI7A 2WMOB 4GZ3A 5KSZA 5L3SB 5IRCD 4DG9A 1KIMA 5DCLA 1DIGA 5MGNA 2GPNA 3LHKA 4N6NA 5SZIA 5AHXA 4L28A 5JWRA 2G80A 1KI3A 3HBLA 1L4KA 4IO1A 1D6MA 1QG0A 1R4AA 1JIUA 5KNCA 4H4CA 3CH6A 2PT9A 1LRJA 3Q1KA 4US0R 4C7JA 2HX1A 1WHTB 2XUOA 1G18A 2D1TA 2I76A 1U8YA 2IDZA 3CZMA 2GZDA 3C6ZA 3IUBA 3OTGA 4DV2B 1M0TA 3L79A 1G59A 5EUQB 4MK4A 3HCNA 4BNWA 4P33A 4BLVA 4EJMA 4U7JA 2F43B 3HH8A 1I24A 3WL3A 3CG4A 4M99A 4JC0A 2PKYX 4YJ2B 1WSBA 4I36A 1YR6A 4R8LA 3SY8A 3ZU4A 2GXAA 4IDAA 4MQEB 1T0BA 4P5DA 1M7BA 4RFVA 4NJMB 1ETHA 4PIPA 4GVLA 4CM9D 3A28A 3EODA 1OUMA 2WQ7A 1LC0A 4M0PA 2Q6VA 1MB0A 4AL4A 2AUTA 1GEGA 2VDJA 3UB2A 2GEFA 1D4ZA 1VE1A 2NVWA 2BMJA 2RIRA 4PZPA 3UPUA 2BGWA 2D8MA 2JHAA 2O0JA 2IVFA 3U3RA 3WJAA 4CIYA 2X1HA 1SHJA 5J63A 1O87A 1A8HA 2C2YA 3C97A 3CPEA 3RQSA 3HM9A 3I5XA 1WB9A 1XTQA 1WXGA 3VDNB 1SAYA 4LOHA 5GZ6A 4DARA 5CAEA 3LT1A 5D7NA 1T3SA 2D4HA 5BSKA 2A7QA 4ZOEA 3U17A 4BEVA 3T99A 1GSOA 3K20A 3ZI7A 1QGED 2C3YA 3HQ4O 2V7GA 3QMWA 3RAJA 4R5HA 2F9MA 4OYRA 5D1NA 4KN5A 3MINA 4I1YA 2HHLA 1EUQA 5BN1A 1T13A 1GZ3A 1UKCA 1ODIA 1OXMA 2QI9F 2PANA 3A6HA 3MT0A 3OFSA 3OWXA 3P2MA 4UHBA 4C7VA 1E3JA 3PKJA 2C5FA 3DOCA 1EUCA 1ID1A 3LQFA 4IDQA 3WYAA 4C2AA 2XRMA 3DW1X 5KNCD 3ADBA 3FPCA 1X86B 2PX5A 4K0RA 3IHWA 4DIMA 3R8XA 1WSAA 2BMAA 2J32A 3BXPA 1RIIA 1SZJG 1JSRA 2WJAA 2QQGA 4ND3A 1KHTA 4G8CA 1IN4A 1ODLA 3U81A 1XVTA 4P4TA 3H17A 3SX0A 3NBYC 3RTBA 4JL5A 2VAPA 4RLSA 3L82B 1SOAA 1RPAA 1Y89A 2SCUB 3JQCA 3OHMA 3PC2A 5DVZA 2OCDA 4YREA 5SV2A 3ZZUA 3QYJA 4DSOA 1NMYA 4MWSA 1V3TA 1R9GA 5BW4A 1ZY2A 1A8SA 4JXJA 1NI4A 3PICA 4L5YA 4U3JB 2W90A 2J87A 2OP0A 4WLNA 1OTXA 3EVGA 2Z95A 1WX1A 3BAZA 3CZQA 1IHUA 2I71A 3WGZA 3DYVA 4BUZA 4PN7A 4KRGA 2GN0A 3MFYA 5IMSA 2ZBEA 5GIPE 3GLKA 2XZOA 1CC1S 5JU6A 3T9AA 1GQQA 1KBOA 3PLRA 1N2XA 4ZZ2A 4DMHA 2FSIA 4MB2A 2I8CA 1OC4A 3DAFA 3ENZA 3FYHA 3U4HA 4KQKA 3RHFA 1AE1A 2AN3A 1E2DA 2GNOA 5EJ4A 2FDXA 3E15A 3L1IA 2ID7A 2VZ0A 4QICA 4ES6A 4OI1A 4P08A 4L8YA 4DZRA 1GPNA 3I32A 3AUSA 3TKLA 1X77A 2XF2A 1SXJA 4ODIA 4QUBA 4M0KA 4C3OB 4DNFA 2ZRJA 2C99A 1S9HA 2Z9CA 4LNUB 4M21A 5F7XA 2NTJA 3WYDA 3DTNA 2QLNA 2QVXX 3IHTA 3AUJB 3TTVA 3SX2A 2WFLB 4PHGA 2WY2D 1LXCA 4QYIB 1HXHA 1NJSA 1RKQA 1V6CA 2BGNA 2MSLA 3KAQA 3BGSA 1FDUA 3QUSA 3CIFA 4YDRA 5K51A 5IAKA 1FP6A 1WXFA 1QHHA 1J97A 1ZKDA 1H93A 1J20A 3B8EA 3ZJTA 2IKQA 1EEXB 2ZTSA 4KGVA 2QBYA 3TOSA 4I0WB 5ALMA 3VYVA 2PH7A 1F14A 4ZA2A 1ULAA 1YO6A 4E2YA 4RJTA 4QVIA 1T8PA 1GYRA 3EGVA 5AKIA 3DDWA 3SYRA 5K3FA 4WXPA 4QZVA 5KYVA 3GPLA 1TYCA 3M3HA 3E2PA 1FFBA 2DTEA 2FWRA 2P4HX 2VPQA 4WNCA 3AB3A 2OA0A 1R0YA 3HJUA 1GGMA 4JYCA 3CLUD 1FS5A 4KIGA 2XYPA 3AF5A 1EX9A 2HV8A 8ABPA 3OZCA 2FI1A 1O9GA 3H5LA 2HQBA 4PIVA 3I58A 1E6LA 3FGZA 3S27A 1OPXA 4LJ9A 4BO2A 1Z5OA 4CLOB 1PDWA 1N1GA 5CLHA 3FNIA 3GJSA 3KYCA 4LDQA 5CFLA 3A4LA 5TS3A 2B20A 4L9WA 4N5LA 1HYBA 2UUBB 5E4FA 4DUYB 1DJMA 3GPIA 4F1KA 2V0GA 2VJAA 5EJGA 4V0NA 3TECE 1P2FA 3DFFA 3KTAB 4LOKA 4MH0R 4CNQA 2YZGA 3QU7A 4KRFA 3U1VA 4MVJG 2BLLA 1JG1A 3H5OA 4FSXA 1F1JA 2MYPA 3LOUA 4UQLA 2QSUA 1SXJD 4PRZA 2JCXA 4PFSA 1WEHA 2FA9A 3LUKA 4OMCA 3UUFA 3IMEA 2QB5A 3DAGA 2GK6A 3O4FA 3K9LA 4QBTA 3REOA 3L8ZA 4KYIB 5ILQA 2EHJA 3D3KA 3IFSA 1NUPA 1WDWB 5CTJA 4P1ZA 4OB6A 5DIFA 1F5NA 4D9IA 3RBZA 3K0CA 3VNUA 4PGAA 1LA2A 2CWWA 2Z1MA 3AM3A 4CF6A 5D86A 3B6JA 2GVDC 2QRUA 1SB8A 1U3DA 3Q11A 4IJMA 2OQVA 5IWCA 3T7EA 2FVXA 1A72A 4GL2A 3EK2A 1Q1GA 2X8WA 4EGAA 1NG9A 1OGJA 2JFBA 3RTEA 2ALJA 2RGAA 1HG1A 3EEIA 2YFKA 1VJ5A 3N8KA 3CPHA 3MM4A 2P9ZA 4HRVA 1EUYA 4MEBA 1ZD3A 2HFKA 3ANLA 4YS6A 3S40A 2CLKB 3SZ3A 4LUCA 5T8KC 4A5SA 2VDUE 1Z5ZA 1LS1A 3KP1A 4QBKA 1TEZA 2OBNA 1C14A 1ZL2A 2HDOA 3LC7O 4CKZA 3DVSX 4LOLA 1Y6GA 2FFAA 3MLEA 4OI4A 3TEJA 5K4GA 4GQBA 2QQ0A 1N5JA 2CE2X 3AZQA 2X22A 3IKVA 4PWZA 1X7YA 5DYTA 4LTDA 1MPTA 4ZVUA 2CMFA 1I4EB 3GRUA 2FRXA 2VQDA 2E49A 2GARA 3HA3A 1CP2A 3AUFA 4G4SO 4BO9A 1XG5A 3WKBA 5AVWA 2BUAA 3U80A 2J8ZA 4YROA 3U61B 4AQDA 2GR9A 4BQSA 4ZAFA 4NSNA 1ZJZA 1A9XA 1GTL1 3T1QA 3EWAA 4QOIA 1OYOA 4ZOCA 5AKYA 3T0GA 5HOEA 4C0JA 4ED9A 5KDLA 2R97A 3AF3A 1PBTA 2GZRA 2RJOA 3MPOA 1EZ1A 3UKOA 2JBHA 2XT9A 3LPLA 3QU5A 1EFHA 1SCNE 3BBLA 5EEHA 1WV1A 3TD2A 4ASUA 4CMAA 2LNDA 2RH5A 5FPTA 5G4LA 1A76A 4GZ5A 3E3MA 2DJIA 4YVFA 3TOVA 2HYDA 4DIBA 3FF4A 4Q9LA 5BXQC 2O8BA 4IJQA 5BWLA 1XZBA 4LHZA 3DPUA 4UDNA 1PRYA 3S70A 1O4WA 3SEZA 1AZSC 3IPLA 1T0UA 1CR4A 3ODGA 3OD5A 4WXYB 5HEKA 3GW8A 2EWVA 1SBQA 1D07A 1E7MA 2F00A 3PFNA 4OYHA 3PITA 1P5JA 4WCFB 2B3TA 4G36A 1NDHA 1Y1SA 2RHBA 4EUKA 3IMFA 1XO1A 4IDOA 4MDHA 1YOVB 2JB9A 3MOSA 2P35A 2VZ8A 1JSZA 1YFKA 4G97A 5FQNA 5TQ0B 1O0SA 3UWOA 3JAMA 4H18A 2RB4A 5HJ2A 3ZCQA 1ISGA 4RHXA 3EUEA 1SA0B 1SG9A 1E5LA 1DO0A 3MHPA 3VZRA 1VSUA 4UDOA 3S1AB 4YPVA 1R64A 4MGYR 4KAXA 5H5JA 2BP7A 2P78A 1EVIA 4YJGA 3OQJA 3RVRA 1PJAA 1DQSA 1HFWA 1OJLA 1ISSA 3R5JA 1YGYA 2UVQA 1PWZA 2XNDD 2YIJA 4QU0A 4BATA 1X3LA 4RD2A 2NU9B 3NVKI 5BNIA 1Q20A 1QE0A 1YT5A 2CNOA 4AJLA 2XNKA 1AHNA 1SQSA 2ZCVA 4HX9A 2FZ5A 4LZWA 4BMSA 1VRVA 2DUJA 3J7TA 4ARZB 3KAJA 5FWYB 4FZ3A 1LPOA 2TMDA 4GI2A 3Q3CA 2A92A 4GM1A 2PZFA 4RVNA 3V4ZA 2XKBA 1EU1A 2C82A 2YQ4A 2YMPA 5GWXA 2IU0A 1KEUA 1CQWA 3EOBI 1AQJA 1A1SA 1I32A 4JC5A 4H7FA 2CNBA 2MSDB 1FLAA 1GHTA 1P9NA 1YQXA 3TM4A 4ASUD 4AYTA 3ENQA 1GKIA 3QM1A 1YK1A 4CMIA 1DDGA 4WBNF 5DNVA 2WOJA 1WXXA 1CQIA 3CGWA 3USES 2C2WA 3V7FA 3AHJA 4EYOA 1TU0A 3ZY2A 3RSGA 4ARBA 2AS0A 5LLDA 3E6AA 4FZJA 4G65A 3KFLA 2AHOA 3ZKAA 2AFIB 1INLA 3KUUA 2QSZA 4I4TF 1TCVA 4QJBA 4TN5A 1FJHA 1MABA 5LQSA 3M83A 2I4TA 1RPZA 1EJBA 3NAMA 4BV8A 4RS3A 4F12A 2V74B 5CJJA 5IG2A 2GRAA 1JQAA 4JENA 4B3FX 3WLEA 4OH1A 4MQ5A 2ZAGA 5HE9A 3TIIA 1CJVC 1E9SA 4XIGS 4LFCB 1ZD5A 5HWSA 1V43A 4WN9A 1GZHB 2A9RA 1UZMA 2JH8A 4OBXA 2J0VA 3FYSA 1VYVA 4EFLA 4M49A 4CT5A 5CDUA 1T2DA 2PYDA 1WM1A 1MCZA 3AM4A 3GK3A 2E4AA 2VH1A 5TIIA 3C3BA 3GLTA 4W1RA 3MWEB 1GRVA 2II6A 1IY9A 2OO5C 1TA9A 3DOIA 3P20A 1C7FA 2YXNA 4KLNA 4OXRA 1ZLYA 5ALJA 1GYPA 3HE3A 1Z68A 3DWEX 3MRSA 3PP8A 4C4AA 1B23P 3KBBA 1SK9A 3NANA 1TO2E 1E9EA 2C2BA 3L6EA 4BNGA 1L7EA 1MC4A 1JBKA 3GRFA 2V9ZA 4V39A 1CE8A 4C5AA 3TZ6A 2H57A 4X7BA 4TTQA 5AJTA 1EFAA 2IS4A 1Q1QA 1UBEA 3RYIA 1BGXT 1NX9A 2K4MA 2FR1A 4Q9JA 3DMYA 1AZWA 1SD1A 3I5YA 3UTDA 1H23A 4RNCA 3FDXA 4G9BA 1GNRA 3EZXA 1IG3A 3ZN2A 2R8XA 5C7LO 5M34A 3GT3A 4G23A 2QMOA 3PIRA 2WD9A 3WWEA 2C94A 4B32A 2Z57A 4URHA 4ZAWA 3HUEA 4RLHA 4Y67A 2BRUA 3DNMA 4LDNA 4UM8B 1TO6A 5WRFA 1RHQA 1LBIA 3AY7A 3Q5DA 4QQ8A 4W5HA 2NU8A 3T7JA 2HA2A 3D1JA 1GG9A 2WD8A 3DEHA 3DKRA 2G4VA 2VRBA 4I2NA 4MJXA 5BSWA 1VDMA 2FPGA 2AG8A 3ETDA 3N2KB 5L3ZA 1Y42X 1ENOA 2ORIA 5AVSA 1YCGA 4ZTUB 1NNSA 1NP3A 4MQFB 1W4BA 1CU1A 4S1NA 2ICAA 4L02A 4MS4B 4X5OA 1ZXBA 3EPJA 1SOVA 1E1NA 2IXAA 3C70A 3GJ5A 2NU7B 1ID8A 4R9SA 1ENZA 3UJ6A 2E6UX 3PDUA 3SZGA 5CIWA 3BERA 3DDNA 2ZSEA 4IL5A 4HNUA 3ESDA 4NDNE 3B1JA 3I12A 4GS5A 1KJQA 4QBFA 4PQYA 3ZKWA 3DHYA 2RH8A 6Q21A 1DINA 5IAEA 5MFPA 4KLZA 1ZRSA 1OTYA 3ZDBA 1QJ4A 1FB5A 1UDRA 2NSHA 3QPWA 2POCA 4FGUA 4YJDA 2VHUA 1W88A 2JIZA 2V8OA 2GKSA 4KQGA 4DPLA 1RADA 1GJRA 1KZ9A 4NFLA 4XVQA 1KJNA 2Y1LA 4QVGA 3ZU2A 2IW1A 4PGHA 4RIGA 4B8YA 1X92A 3EVEA 3D2LA 3N39C 3V2GA 4F8EA 1Z25A 4WUTA 2HNKA 1R9MA 1EVZA 1O5TA 1LUAA 3K1YA 1UM9A 2IZOA 1MA0A 4XWGA 3A1CA 4QL3A 4UU0A 1I14A 3UJBA 1B3RA 1EK1A 1DEKA 3PQ6A 4G63A 1ZH0A 2FMFA 3VNSA 4AN4A 2DH6A 4FZVA 3M5CA 1B0AA 2HDNB 2P5YA 4DFDA 1ZH4A 2HSWA 2XRFA 4CR6A 2Z3WA 5IDXA 4YWHA 3CVJA 3KTFA 4NR0A 1JHMA 4A0HA 2FG6C 4D9EA 4Z53A 4ESOA 2NLOA 1P5FA 2GCNA 4TTJA 4KDCA 1DBVO 2RAPA 3GH3A 3ELUA 1PKXA 4GWLA 4BNKA 3F7MA 3DYIA 4TTSA 2JD2A 1D4AA 1LWOA 3G2PA 3ROEA 3EG9A 3ZLTA 1QX4A 4P4UA 1NN0A 3WZ2A 3OQPA 4IG4A 4BWVA 1FOEB 2MSWA 3QY0A 1B0UA 1YVDA 2RFLA 4HPJB 4UVEA 2W0SA 4GXTA 1CZUA 4O8ZA 3V7UA 3PU6A 4UHCA 3G5MA 1Q2UA 4Q6BA 2J48A 2VZEA 3PQ7A 1TEXA 2CFCA 4ITUA 1WF6A 1U3CA 1K7YA 1NQTA 1P31A 3TTUA 4CM6A 3CLSC 5BSMA 1TJ5A 3C5HA 3ZZ1A 3RYHB 3LH5A 1FP4A 1XLWA 5ARBA 2B5VA 1D04A 3WHLA 2BCJQ 2QX4A 3RFCA 5HS4A 1XEFA 3HWSA 1SXQA 4AJ9A 1YDWA 4CDRA 1LEHA 3IQDB 1NUHA 1Q12A 2E9SA 2JIZD 3BGIA 4GECA 1ESNA 1UAGA 1G41A 2OFXA 1IQRA 1CUZA 1L5FA 2WYWA 3W6ZA 2PL3A 3DJFA 5KOJB 1G20B 2YOHA 4ARUA 1XAHA 4UNNA 4G4SP 3WLHA 3INNA 4WZAB 4EX7A 4BV9A 2RK6A 1BEZA 4JXKA 3N7UA 4PV7A 3UKDA 3W2GA 4UOEA 1NU8A 4J0KA 5K45A 3I2YX 4XLTA 4D26A 1ZD4A 4KH1A 2VTDA 4EY3A 5JD5A 2QLFA 2I91A 2Y93A 2RDMA 2EP5A 4NC9A 5JYBA 5TF0A 4HKTA 2ZIUB 3ABQB 4X63A 1QO7A 1FUEA 2PLRA 1PJSA 5KQRA 3GI1A 2OGZA 3CW2A 5LIRA 1URPA 1W47A 3MJDA 4IUCS 4TV8B 4LF5B 1AKUA 1C7EA 5M2QA 3VOSA 1SC3A 3FVWA 3B6IA 2AOTB 1B15A 1NMZA 4WWHA 3UAZA 2QHXA 5U9CA 1YL7A 3Q0TA 4WESA 5IUJC 4M46A 3EGCA 2YJ3A 5C0OE 1XR3A 4TTVA 4KQXA 2XVYA 4LC0A 1NBMD 4QEZA 4S3MA 1T29A 1TTHA 3SU8A 4AO6A 4CL0A 3E84A 1PJ3A 1EFPA 2QRVA 5B36A 4JZYA 2JIMA 2XECA 1N0IA 1EDZA 2XDYA 3T12A 1XV5A 2FPPA 5AKZA 1ZMTA 3G9QA 4NOMA 3K9FC 5I9TA 5SZHB 2G1KA 3LF1A 2FMTA 1X6VA 2D59A 1IXSB 1SQFA 3GLGA 2GUWA 3CYFA 2ESRA 2K5UA 5DO9A 1KFEB 2AA3A 4YUXA 2OXEA 2HMVA 2JVIA 3X3HA 3KDAA 1YAHA 3D9QX 4DLPA 1W94A 3WAGA 1YB1A 1GPLA 2G76A 2JLQA 1ZGGA 1QDUA 3BE4A 4EQ6A 5I9NA 2M6LA 1GM5A 4JUCA 1W0JA 4YHBA 4ZQFA 4PYKA 3S5UA 4D82A 2I9PA 1FDTA 2CL6X 2VAMA 4MUMA 4QWMA 3NWPA 3ROZA 2PO5A 3RRZA 3UMSA 4B6FA 4LF8B 4NOJA 2O1SA 3PFWO 1DT5A 3UJCA 1XDBA 3QFRA 5CG1A 1RM0A 1Z4JA 3FKJA 4QARA 4RCZA 4PZ0A 1KNQA 1T26A 1VMAA 4HB2A 4F6LA 1YQDA 4YUWA 2W43A 3ESXA 3MIIA 1EE2A 3E3LA 4B74A 1DEOA 2OCGA 1V1RA 5B55A 2AQHA 3M1AA 3Q7EA 3V2IA 5LWQA 2REQA 3N74A 1Z6AA 3NU1A 3D43A 1YZLA 4U7WA 1EX7A 2NN3C 5EQJB 1UJMA 2G9UA 4B2IA 3OOEA 4HXGA 4MA4A 1JQEA 2ZTMA 3ZQ4A 4F4CA 1P1KA 2EGUA 3E23A 4L5AA 1FLVA 1MTZA 1CZKA 3C8UA 5G1OA 1OH7A 1NW3A 2YZ7A 1N4DA 3RAFC 4YV7A 2OTCA 3RWBA 4AJ1A 3GLIB 1XFAA 2LWIA 1FSSA 4H6PA 1CZHA 4KQ9A 2IE8A 3ZU6A 4X94A 4BHTA 2VXYA 3HP1A 1L7RA 3NALA 5ALKA 2QG6A 1XELA 4AY4A 4OLHA 1WPXA 4JLVA 3QYFA 3A1TA 3NO4A 4FHCA 4DR2B 1E89A 2HEGA 3ZW8A 1NA5A 5TMDA 1BZYA 1RMTA 1V8PA 5AM1A 3K92A 2C77A 2Q1YA 3A0RB 3P0HA 4YLGA 3ICEA 2FPLA 4BS9A 3BCHA 1P9RA 5A7GA 1DI0A 3AOEA 2PRJA 4B0PA 2OCBA 4X65B 1GPJA 4U7DA 5DBFA 4P82A 3DOOA 2FPRA 1E4OA 4HFRA 2IITA 4O4JF 4R98A 4UXJA 3W1EA 3VXKA 1Q7RA 5BYAA 2B4YA 4PICA 4Q1VA 2FHPA 5LP1A 3L7IA 5J5CA 4LF7B 1JECA 2G4LA 1GILA 1KY2A 3HPRA 3DNFA 3E3OA 2CVPA 2IT1A 1UIRA 3I64A 2Y66A 1CIJA 1YJQA 2OG1A 3H19A 1XRPA 2HSZA 1II8A 3OZWA 1QOQB 3VVMA 3SE0A 4HVTA 3AKZA 2VJDA 1M8KA 3HB5X 4JP8A 1J21A 4ZVRA 4B3XA 3RG2A 2X1LA 4C08A 2O1WA 1V8BA 4N9WA 4YGYA 4BO7A 2QD3A 2ZFUA 5IABA 1Z28A 4H3VA 3OFJA 3HK2A 3C24A 3O8OB 1CRWG 4N3CA 4CKEB 5T6BA 3BQ9A 3U44A 1PEKE 4HAOA 6GPBA 4Y2PA 1XLTA 4GH5A 5DRYA 3PJEA 2NWQA 4K6FA 3KSAC 2DMRA 1XDWA 2HU5A 3K2IA 3NHSA 2QRLA 4G1UC 5HF5A 1JDZA 5J5VA 4CM3A 3T3OA 1QRSA 1N1DA 2AEMA 1TU3A 4NY1A 2VBCA 3HEBA 5G41A 1NI3A 4M9QA 2YV3A 4RJ2A 3LZDA 2BGTA 4FW9A 4AF6A 3OZBA 5KTNA 3OUZA 2D2VA 2C2KA 3EEOA 3ZY4A 5A4FS 4YRLA 4JEUA 4IXTA 1WB5A 1S8OA 1A98A 1D2CA 2V7VA 4EG7A 3V3KA 1MDBA 1KZ4A 4F0JA 3OOSA 2D0PB 4L9RA 3RIEA 1M1NA 3SF8B 4ER3A 5KAPA 4O2AF 1LNSA 2N1BA 1K7XB 1U4OA 2ZWIA 3JAWA 4DRXB 1RKBA 5D1HA 1E9RA 2R7LA 5ADWA 1THTA 2VG8A 1QV9A 5DNEA 5E4YA 4OXXA 1WQ1R 1SBHA 5FO0A 3P96A 3SD7A 1M7HA 4DXAA 4B7ZA 3FBGA 3JALB 1YA6A 1L5KA 1SQ0A 2O14A 5I3CA 1KHHA 2WYIA 3OPXA 4LNAA 4TRJA 1GZUA 3R3WA 2IUSA 4IHJB 3UXHA 1WCXA 1UJCA 4K8RB 3JWJA 3KBOA 2XZLA 3QQ5A 1J8YF 1BEEA 4KQWA 4PQGA 1IJBA 1NM5C 4CF4A 3SJBA 2I1WA 3RANA 3ZWDA 5KIAA 4OYLA 4D9BA 1KQ3A 4BNIA 1G2PA 3GD7A 3QVOA 4HWPA 4RHYA 4F3KA 1QHGA 1USKA 4KK4A 2JA1A 3KOWA 4GPBA 2OB1A 3S2UA 2C9Z