4BLWA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylhomocysteine (adohcy) and adenosine monophosphate (amp)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
280
structure length
280
Chain Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 97
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blwA00
3P8ZA 2G1PA 5DTMA 4E31A 1QAMA 3GXOA 3ANXA 3PFHA 1KP9A 1BC5A 3F4KA 3M70A 4RSRA 2O05A 5LQJA 4DA4A 1JG4A 2YXDA 3BXOA 2XVAA 3EVGA 3E7PA 3MERA 1WS6A 1R8XA 4LWPA 5GIPE 3SGLA 2ADMA 3FPEA 3PB3A 1XDUA 3DMHA 3TKYA 1ORIA 2ZWVA 1XJ5A 3A25A 1HNNA 3G8BA 5C0OE 2P7HA 4GOND 3THRA 3FYDA 3TPZA 4QQNA 2JG3A 3LHDA 3DLCA 3NJRA 3JWIA 1EIZA 2IFTA 4PINA 2P7IA 3HA5A 1G8AA 3I64A 3HCCA 4QPPA 4A6DA 5K0BA 4OA5A 3A27A 5EMMA 1P39A 5E1OA 4Z2YA 4HGYA 1SKMA 3LBFA 2YXLA 5HEKA 4YMHA 5CCBA 5T64A 1YZ3A 1NBHA 2G8NA 2ZBRA 2WK1A 3G2MA 4GQBA 4MTLA 2PBFA 3EVDA 4CXMA 5LQKA 3DMGA 5T6BA 3M6WA 1RJFA 3EVEA 3CGGA 5GIOE 2ORED 3IHTA 2I9KA 1XTPA 2IDKA 1JG1A 4HTFA 4O29A 2G72A 5FA8A 3OZRA 2A14A 3LBYA 3OU2A 3A26A 5LQUA 3GWZA 2XYRA 2PT9A 4U7TB 2YUIA 1Y8CA 1X1DA 2GH1A 5E2AA 1RI2A 1KR5A 1FP2A 1JQDA 1R6AA 3OU6A 1DL5A 5EKXA 1VIDA 2JHCA 2PWPA 1ZG3A 2Y1XA 2AOUB 2YTZA 2FK8A 1NW7A 3AXTA 2UYQA 3T0IA 2HR1A 2NXJA 3PT9A 2ERCA 2QM3A 1SQGA 2KW5A 3P2EA 3S68A 3DH0A 5GOZA 4RTJA 3DMFA 1Z3CA 4MHTA 3FTFA 4CKCA 1RI1A 5FTWA 1IXKA 3B3JA 1YFLA 3A7DA 3KU1A 3A7EA 3LPMA 4AUKA 2EX4A 3EGEA 3KPYA 3IV6A 3P2IA 2N47A 2PKWA 4IKPA 2H1RA 2I7CA 3FUUA 5D1HA 2E5WA 5EOVA 3CVOA 5CM2Z 2XYQA 3SMQA 5HOQA 5CVVA 2K4MA 3I9FA 2QY6A 1VP3A 2OB1A 4KW7A 5DWQA 4E2WA 4EKIA 4YUZA 5F2NA 5K0GA 1D2HA 3LSTA 1WG8A 2OPBA 3OZTA 1P1BA 4QVGA 3MCZA 4V0RA 3KR0A 2FCAA 5FULA 5K0NA 3UJ8A 5CVDA 4BLWA 5BW5A 3MB5A 3QOWA 5DTQA 4AZWA 2P8JA 2ZZMA 5ERGB 1L9KA 5FUBA 5EQJB 1KYZA 1AF7A 3TMAA 2IH2A 5FHQA 3R0QA 3THSA 4DM3A 2NP6A 3GDHA 1QAQA 2AZTA 2PVCA 3U81A 4ER5A 4FGZA 4DQ0A 3AY0A 3V97A 4C4AA 3DUWA 3KQQA 5DRTA 4PNEA 3GCZA 4HTFB 3ORHA 2UYHA 3Q87B 1MJFA 2EJUA 4P7GA 1FPQA 2IBSA 5E8RA 2G71A 3CJTA 2OYRA 1R8YA 4B17A 1WZNA 3HVKA 1RI3A 1VBFA 2PSSA 3KKZA 4PCAA 4BP3A 3JWJA 5K03A 5EHGA 5LR6A 2R6ZA 4JXJA 3RW9A 4FT2A 3CKKA 1R74A 3SX0A 1EJ0A 3KR1A 2AOXA 3OCJA 4E33A 2HWKA 2B78A 1NV8A 2C7RA 4PIPA 2Z6QA 4HRAA 5DTRA 4EQZA 2VS1A 3VSEA 3SR4A 1PJZA 3FPHA 2VDVE 2VDWA 3VYWA 2AN3A 2IIPA 2CL5A 2NXEA 3ELWA 4X41A 3NWBA 1G60A 5FQOA 3SXJA 3DP7A 3HA3A 3FTEA 1YZHA 1JQ3A 2FRXA 1NW8A 3C6KA 3M33A 4LECA 4AZVA 1AV6A 1X1AA 4R8RA 1UWVA 2QRVA 2AN4A 1RI4A 2XVMA 1VL5A 3DULA 3EMDA 3LL7A 4LWOA 1JQEA 2YXEA 4E70A 1YF3A 2CMHA 3HVHA 1JSXA 2P40A 3FUVA 3L8DA 3ELYA 3KPVA 1ZHFA 2CMGA 3GRYA 3KQSA 4E2XA 1G8SA 2JJQA 2NXCA 3M6XA 5BW4A 3EGIA 3MGGA 3HCEA 3SSNA 2EJTA 3GJYA 4RV9A 4GUAA 4OQDA 2PV0A 2ZW9A 2GS9A 2OBFA 2GA9A 3EVBA 4GOMD 2ONZA 5CCXA 2ZSUA 5LSAA 2O0LA 3UJAA 2P3OA 4U7PB 3KQWA 9MHTA 4RVFA 2JHAA 7MHTA 2GPYA 3PX3A 5U4XA 5HIMA 2Z6UA 3KQOA 2QYOA 1P91A 1F3LA 3HP7A 2PX8A 1Q0SA 2GB4A 1N7JA 3P71T 2YX1A 3SVZA 2EFJA 2V7EA 3LDGA 3NW9A 4ER6A 2H00A 1JTEA 3P9CA 2H11A 1KHHA 4NECA 4PIMA 3GRRA 5HFJA 2NNWB 2ZTHA 4G56A 4HSGA 5FADA 3T7TA 2PX5A 3MTIA 2IP2A 3FUTA 4PYIA 3I53A 3NTVA 3MCTA 3UJ9A 3DLIA 4QDJA 4ER0A 3MTEA 2YR0A 3FTCA 4DMGA 3H2BA 4BLVA 1V39A 4P7KA 4C06A 5K0EA 2AR0A 5ICGA 2Z6AA 3G8AA 3T7SA 3BGVA 4M7RA 3UA3A 4ER7A 1JG2A 1WXXA 1RJDA 3B89A 2GAFA 3M6VA 4F85A 5LQAA 1UIRA 5E8JA 3EPPA 10MHA 3FRHA 4KVZA 4DKJA 3E23A 4R8SA 5KQSA 5D1NA 1DCTA 2ONYA 3HVIA 4PGGA 1YFJA 4OA8A 3DOUA 1N2XA 2R3SA 5GINE 1NBIA 3OPNA 4QTUB 5HIJA 2QRVB 1NW6A 1RJGA 3SSMA 3TM5A 3NMUF 4YV0A 1BKYA 3R6TA 5KS2A 5EIWA 1JSZA 3MHTA 3I5UA 3G2QA 3O31A 3P9IA 2BR4A 3CC8A 5FCDA 1ZGJA 3ER9A 3M6UA 1IY9A 4CTKA 4RTLA 4C03A 1I9GA 3KR9A 1JTFA 5EG5A 5EMLA 3TQSA 1VQ1A 2XBMA 1D2CA 1VPTA 3P2KA 3LECA 4RX1A 5H02A 1VE3A 1NE2A 5GM2A 3D2LA 3JWGA 4QPNA 4F86A 5EMJA 5K0JA 1PRYA 2Q41A 3C6MA 3M4XA 3FRIA 1L1EA 2P3LA 4ISCA 2OO3A 3CJRA 5B1SA 1YUBA 4GC5A 3TM4A 4ATNA 4DCMA 3R9XB 5F2OA 2BH2A 3Q7EA 4R05A 4CTJA 3B5IA 2OB2A 1SQFA 3LGAA 1QYRA 5EVJA 2UYOA 3R3HA 5ICFA 1G6Q1 2B9EA 2FHPA 3BGDA 4RYLA 5HIKA 2I6GA 5K0LA 4RTRA 4BLUA 4OBXA 4P7JA 1KPHA 3NDIA 2EG5A 3FUWA 3ELUA 4WXHA 2JH9A 4HGZA 4PYOA 4XCXA 2CWWA 4M37A 5ICCA 3G88A 2IBTA 2IH5A 3ERCA 4QTTB 2O06A 2AVDA 2DPMA 4MWZA 3VC2A 4RTKA 3PTAA 5DXJA 3R24A 3EVAA 3TLJA 2C7PA 4P58A 2O07A 5T67A 5EPEA 3GO4A 1O54A 1JR4A 3OFKA 3BKXA 4POOA 1TW2A 4OX9Y 1M6EX 2IGTA 2AVNA 4E30A 5FWDA 1DUSA 1BOOA 3GRUA 4GBED 4CWAA 1XVAA 1NW3A 5DM2A 1KYWA 1NT2A 1O9GA 2P3QA 2GLUA 1T43A 1P1CA 3KQMA 3G7UA 4GF5A 4C04A 2G70A 2ZFUA 4KRGA 3KPJA 2YQZA 5DT2A 3B7PA 4EKGA 5K09A 5K0FA 4AZSA 3RIEA 3P97A 4IWNA 2HV9A 4OBWA 5FHRA 3SM3A 4X60A 3O7WA 5K0CA 3VC1A 4MIKA 5DSXA 5DXAA 4ZTBA 4XUCA 3X0DA 4EMSA 2ZWAA 5CVEA 4E2YA 3NDJA 1YB2A 5E9QA 1XDZA 1X19A 1NKVA 4L7VA 1QANA 5FA5A 3DXYA 4CKEA 4RTPA 3EEOA 2FYTA 3UA4A 2IH4A 4QDKA 2PGXA 1KPGA 1N7IA 3BWCA 4HC4A 2JH8A 3PS9A 3GRVA 5EZQA 2IDJA 5DX1A 5G02A 1H1DA 1RI5A 2OKCA 2PXCA 3O4FA 3P9NA 4M38A 5DM1A 3PVCA 1FP1D 3KQTA 1SVUA 1QAOA 1XCLA 4DZRA 1SG9A 4PWYA 3WSTA 1M6YA 5EEHA 2AOTB 3HVJA 5MHTA 5K8VA 2C7QA 4RVGA 2VZ9A 5DRYA 3KQPA 2F8LA 3LCCA 4ER3A 5IH3A 4YV2A 2AOVA 2UYCA 5EGSA 2ESRA 3K0BA 4MQ4A 1I4WA 5GP1A 2P41A 2YVLA 2P1DA 5DM4A 5BP7A 5JR3A 2UZ4A 2DULA 3LDFA 2C7OA 3P9KA 2FPOA 5KYGA 1L3CA 2PX2A 4Y30A 3UJBA 2PT6A 3E8SA 3EVCA 5HIIA 4RTQA 3UJDA 3MAGA 3I58A 2ZLBA 1B42A 3KR2A 2AS0A 1R18A 3GRZA 2QE6A 5EMKA 5IKMA 1QZZA 3HCFA 3LDUA 1EQAA 5DX0A 1AQJA 5FWAA 3HM2A 3EGVA 5GM1A 3PX2A 5HILA 5DM0A 5KVAA 1JG3A 1NW5A 2OXTA 4E2ZA 3DTNA 4IV0A 3KQVA 3IYLW 1I1NA 4XUDA 1EAMA 3UJCA 1X1CA 3LCVB 3C3YA 3G89A 4LG1A 5CIYA 3HEMA 2PJDA 2JHPA 3GU3A 2FK7A 1L3BA 3HCAA 2ZZNA 3HTXA 3PFGA 3AJDA 1U2ZA 5CD1A 3A4TA 1INLA 5EC8A 3V8VA 3TKAA 4FSXA 3BZBA 3BWBA 3HCBA 4RTMA 5C9ZA 1ZGAA 5LQNA 4PGHA 3DXXA 4QVKA 1UFKA 3G5LA 3QV2A 3G2OA 3ID6C 2VDUE 4X1OA 1XXLA 2O57A 2PXAA 4GOLD 3KPWA 4KWCA 4RTSA 2PX4A 3G2PA 5E1BA 4FP9A 3G5TA 3FPJA 3FZGA 5E1DA 2LD4A 4P7FA 3HA7A 3OE5A 4FT4A 4PONA 3UJ6A 3BUSA 4WVLA 4YMGA 1M0EA 5K01A 4RVDA 4PYMA 2ZIFA 2ZBPA 2XYVA 4PCLA 3BT7A 2NYUA 4KDCA 5EKUA 4F84A 4R6XA 5EIFA 1WY7A 5LQRA 5KQRA 1RJEA 1VLMA 2AOTA 4KIGA 3OZSA 1O9HA 2ZBQA 4EVIA 1FJXA 3FPGA 1MHTA 4YUXA 3KHKA 4DF3A 5CVUA 2I62A 4CKBA 1WXWA 1AQIA 4RWZA 3DR5A 4FS8A 4KIFA 4PYQA 2BZGA 1SUSA 1EG2A 1TPYA 1BHJA 2ZULA 1X1BA 3NVMB 4UOEA 1ZQ9A 4YV1A 3CJQA 3LCUA 4KDRA 3DXZA 5EZSA 4EK9A 3PLAE 3ELDA 2AOWA 4M36A 2BR3A 3BWYA 2CKDA 2ZZKA 1KXZA 3E05A 3EMBA 1NV9A 1HMYA 3K6RA 4FZVA 2HMYB 1ZKDA 3BKWA 4R6WA 3TOSA 4C08A 5EEGA 2WA1A 8MHTA 2WA2A 2BM9A 4PYKA 5BXYA 3KPUA 3AWIA 2HTEA 5DLYA 3TFWA 1R00A 2AN5A 2IPXA 2P35A 3BGIA 3FPFA 3UJ7A 3OFJA 2VP3A 3CCFA 5FQNA 4BP1A 3LKDA 3B3GA 1XCJA 2BR5A 3HNRA 5E9WA 3UWPA 5K05A 3RODA 3REOA 3SSOA 1ORHA 2ZIGA 5JUWA 4BY9E 4YUVA 1IM8A 1KPIA 1L3IA 2BM8A 2HNKA 1TW3A 3C0KA 4RVHA 5E2BA 3GNLA 2OZVA 3NWEA 4FSDA 5ICEA 3CBGA 3EEYA 5P8WA 3HCDA 1G38A 3EVFA 5DPMA 4RTNA 4K6MA 4HH4A 5E9JA 3T7RA 4C05A 4PYLA 4X63A 5DSTA 5EHIA 4AX8A 2B25A 5M5BA 3ER8A 4Y2HA 2Y1WA 2PLWA 4V0QA 1FBNA 5CUQA 5E1MA 2PY6A 4HG2A 4A6EA 3EVZA 4RTOA 4DCGA 1VP9A 3QOXA 2NXNA 3UZUA 2OY0A 5HZMA 3IEIA 2B2CA 3OE4A 2ZCJA 3TR6A 1F38A 3FTDA 3FUXA 4GEKA 5CVJA 3UFBA 4YUYA 5LQCA 3B3FA 4OQEA 2V74B 5GWXA 3TRKA 4YUWA 1G55A 1XDSA 3JWHA 3ME5A 1D2GA 4H0NA 4PYNA 2B3TA 4FR0A 2AOUA 3AXSA 5F2KA 3NVKI 3C3PA 1SUIA 1OR8A 5DX8A 1KIAA 4AZTA 2NP7A 5C1IA 3LKZA 1EJ6A 3MQ2A 4X61A 4XUEA 1Q0TA 3OU7A 2ZVJA 4GC9A 4QQKA 2ZIEA 3KQYA 4IV8A 4C07A 3FYCA 3LX6A 4PYJA 3GGDA 4E32A 2PWYA 3BWMA 3GIWA 3UBTA 2PXXA 4GOOD
chains in the Genus database with same CATH superfamily
4U2EA 3H1BA 1QAMA 2ZRDA 3S5JA 1IY1A 4YJHB 1CRPA 5EIHA 4MGHA 5CBKA 3QXGA 3TLBA 4ASUA 4OB8A 3AVWA 5JAZA 1WS6A 1R8XA 3CX3A 2RD2A 1J8DA 3EHDA 3FPEA 5T4BA 4QWWA 3DMHA 4FGKA 1Z5UA 1DHRA 2VHVA 2FVXA 1FMTA 2Q3CA 4FW8A 3TKYA 2J3MA 2QGFA 4TQ9A 2FPKA 5EP1A 3U3OA 4F72A 3GI1A 2G5CA 2BHTA 1GTZA 4IIFA 3DWIA 1GGFA 3E5RA 1FS4A 1BNCA 1RQXA 2I7DA 3B7GA 3FYDA 3PCTA 3THRA 4D1YA 2L82A 3PWSA 3LM8A 1TCVA 3A2LA 4YBRA 1Z5NA 2X0NA 1AMNA 3LYHA 1H0KA 4UJ5A 3DMDA 4A0SA 3HCCA 3A37A 2CV0A 2CXOA 5BSGA 4JV5B 1FFDA 2JFOA 3EF1A 3OOYA 1F8XA 3O2SB 2SKCA 5DSZA 4WERA 1ORVA 1C50A 4BO7A 2XZDA 3B1KA 1LJ8A 1K5PA 4MVCA 1UK8A 3V7FA 3IHTA 1IFXA 4BNZA 4IG9A 2UVQA 3U4QA 4ZCPA 5BT9A 4ZCTA 1W36C 1XTVA 3UQYS 4OI4A 1TKBA 3T0FA 4U7TB 1MJ5A 5EJFA 1W49A 3OQJA 3PE6A 3TMYA 2BRUC 1X1DA 4B3DA 2YJ5A 2YWRA 1IWPB 3GEPA 1NFRA 2RHMA 3N05A 1PGNA 4H7HA 3LRXA 4P0QB 4HNQA 1K75A 1GRRA 3A9CA 4YIHA 5U9CA 2XGJA 1A8PA 2FOXA 2V6FA 4E07A 4MKIA 4TWIA 1E7WA 2C98A 1ZUD1 1A9YA 1NIJA 3T0IA 1T4BA 1B7GO 2IC5A 2IHTA 1AKEA 3WA6A 5B58C 3O8QB 5LP6B 3IUYA 1GQ2A 1PX2A 1NU8A 1JS1X 3AEQA 3FTFA 1RI1A 3E70C 4R8KA 1WUHS 5A1JA 5IM4F 1FYEA 5HIAA 1EXMA 2BFFA 1XVUA 1NBAA 2Z5GA 2RH5A 3IDQA 1PHPA 3RVRA 1CVRA 1NF2A 1BA3A 2WRZA 5D00A 1AKTA 1RKVA 5CDUA 2WTAA 4C7JA 4EZBA 5DYGA 5KNCH 1PHRA 2NQ8A 3I9FA 3LY7A 5A7FA 1YIAA 2E18A 1BU8A 4JB3A 1KYIA 4GZ3A 1D2HA 1EVJA 2K7FA 4CLHA 4UHCA 2IXBA 1G3IA 2LW7A 1YBHA 4DQKA 2WD9A 1KZ6A 3SIRA 2QVZX 4IOKA 4W5HA 2G1AA 3EEIA 1HYHA 3DAFA 4AZWA 1ZIPA 2P8JA 3IKJA 1J25A 3NTLA 4WSOA 3HJBA 3ZWPA 1XPUA 1VHWA 4MUJA 2C57A 2YFKA 4GRDA 2IH2A 2EFDB 4Z4GA 1CHDA 2GRUA 4UJ3A 4KFTA 3WQSB 5GZ1A 4GSKA 1O57A 4M1KA 3MD9A 2IQIA 3D0QA 4Q6WA 4Y6RA 1Q7GA 1VMKA 2OHXA 3R6GA 4YJFA 5GJVC 4PZCA 3W05A 2HEIA 3S44A 4YMLA 3VZPA 3U4QB 3PSAA 1P5JA 4EHBA 3F4LA 3Q3GE 5F52A 1GR0A 1Y34E 4MW1A 3F98A 1P9OA 3JWJA 4OMFG 5I45A 3IBYA 1CR4A 2PUWA 2X3YA 4CMCA 5ALQA 3IQEA 1CU1A 3ITKA 1ZUHA 2EW2A 3OCJA 1QG2A 2B78A 1B2LA 4QASA 4QPZA 2DECA 5EKDA 4CMHA 2GN8A 4OLJA 2Q3HA 3CKLA 3LZ6A 1CJVC 1Z7EA 3HKEA 1T9KA 2QE7A 3NDPA 3R76A 3ZNPA 5F4BA 3PIRA 5JYCA 2GNOA 3AEQB 2VA9A 4W1SA 3THYA 3IMCA 3CE9A 1H2HA 5K2MA 4AZVA 1WMEA 1ETUA 4EB3A 1LRKA 2BFFB 2R8YA 3ZY3A 1Q74A 2XJ4A 2L42A 2OFWA 1LDMA 4IZIA 2EFGA 4BX3A 3AR7A 3CRZA 1I94B 3VKGA 2FJUA 3QBDA 4H3HB 1GV0A 3FUVA 2WHQA 2YCLA 3OCZA 3OZUA 4DV3B 4LIPD 3I9V6 1DRKA 1ZHFA 2VN8A 3KUCA 4X00A 4TMYA 3V4VB 5B64A 5JSUA 2QRNA 3SX4A 4YUAA 3TZBA 2J3LA 1SUCA 1JNYA 3JWPA 3LF1A 1MT3A 1QHXA 1X1SA 4RQBA 2FWRA 3T5MA 2PV0A 2PUJA 2Q3LA 2WVAA 1GTVA 1MORA 2LV8A 1UC8A 1KDYA 1RTTA 4KYUA 1PWXA 4UUQA 4KR9A 3QP9A 1Z6ZA 5B3JC 4NH0A 5CDFA 3LRPA 1P91A 4P08A 1QZ3A 1Z37A 1U4SA 3Q98A 2P75A 2GB4A 1ZMBA 3MK31 1ZGBA 2G40A 4Q1EA 3SVZA 1QGUA 3YASA 1NKSA 3OOJA 5FUYA 3AX6A 1Z39A 4DT1A 1NW4A 4PIMA 2YWBA 2Z58A 4RHYA 3GJ7A 4F3TA 3K71B 2IY8A 4EYSA 3VVCA 4YJFB 4N5NA 1IB0A 3AFIA 3C1UA 2BWJA 1A69A 3ADOA 4YRLA 5DLQC 1IXSB 1E96A 5EE9A 3K70D 2ZSAA 4HB3A 3OLQA 4GO1A 3KJEA 1HDCA 3HEBA 5BNTA 2GJ8A 2YR0A 3FTCA 3IRVA 1QIEA 5BR1A 5IDWA 4CEJA 4R9NA 1DQZA 4NABA 3L7JA 2V03A 4QM6A 3GG9A 2AUNA 1RJDA 3IEKA 1TECE 1YZVA 2A5GA 5AK0A 4IG4A 3IJRA 4G41A 4X71A 3X2SA 2OBXA 4R7ZA 3IT3A 3UQZA 4R8SA 3M34A 4IDFA 3ZW9A 5D1NA 2YQ4A 2XUQA 3THYB 4QU0A 1OFTA 4JJZA 2O2GA 5H0IA 2BYTA 3EZLA 1C3VA 2ZTUA 2LDBA 3NMUF 4H77A 3OY7A 1DAEA 2CMFA 1E6WA 1TCAA 3L9WA 1JQ5A 3R3ZA 1UQTA 4OXRA 2MDTA 1MOPA 5IBQA 1XQWA 4I1OA 2DQZA 1KARA 2EKLA 3DDHA 2J3EA 2ODBA 5JSYA 3OD5A 4K9KA 4NSNA 3FWYA 1GLVA 1C7JA 3B6JA 4FYMA 5EHNA 4ARUA 4E88A 3DPSA 2BFNA 1FTYA 3MWLA 1DDOA 4S3MA 5EG5A 4ZA2A 2EHJA 5LIRA 1IVNA 5EMLA 1MNQA 3OZBA 1TTHA 3P2KA 4IIGA 4UCQA 1WP4A 1OMOA 2PU5A 1C1YA 4LYGA 2VYQA 4LQ4A 3VQTA 2RSLA 3E9YA 3GARA 4HX5A 4PPYA 5B1SA 1UANA 1VHQA 2DPGA 2IUEA 1QTRA 2IWRA 3UTDA 2O2ZA 1E79A 1WNFA 2B94A 3JVUA 1L5NA 1I6LA 1QGUB 3B85A 4RNCA 1DDGA 421PA 2UYOA 3QKRA 4DT1B 2NU6A 3CZAA 2GAAA 1BMFA 1H93A 1ZI6A 1DT3A 3DBHA 2PRSA 4HGZA 4Q02A 3U6BA 3G88A 1XDBA 3W78A 2HPVA 3KBBA 1YR7A 3E22A 3W8RA 5TVGA 1VA5A 1U0JA 3AV0B 3JR3A 1ELOA 3IDZA 1D2AA 1S3IA 2O20A 3C2QA 2B36A 3DZJA 3MNFA 2C7BA 4CEJB 1Z0JA 4E46A 1GEEA 3ANSA 3V5NA 1L4MA 3UJ3X 2NADA 4RZHA 4FFDA 2CT8A 3SLKA 3WQQA 5JEEA 5JT1A 1KY2A 2I1VB 1NW3A 4HYQA 5DM2A 3CLUC 1XZEA 721PA 2H5IA 4HWPA 4QM7A 4P80A 3SKXA 3FPLA 3UGTA 4KQMA 2O0KA 3GFOA 2AL7A 4REMA 1B8NA 3W5VA 1O96A 1V6CA 3GN1A 2GN6A 1IHYA 2I8AA 2Q1XA 1T8SA 3GZJA 4MARA 2WHXA 4RD4A 4LJRA 4MK4A 5DXAA 3IJPA 3NHFA 2O5RA 3N2LA 1Y48E 2B35A 3BH0A 3JRWA 4HDKA 4PSUA 1EWRA 4Q47A 3QE0A 3RSFA 2A9JA 3ZWYA 2JZOA 4E2YA 2WZCA 1UL1X 3TZEA 1QANA 3EA5A 5FA5A 3ZYZA 1V8OA 1G8FA 1X6VA 2II6A 3N7TA 4CF3A 3IQIX 4R2XA 3AR2A 5A4MS 1YHZA 4YC7A 3FJ1A 1TGVA 4WCFA 4TLDA 5CLQA 1XMQB 2XXJA 1LPOA 3SLRA 1WB5A 2RIPA 4Q03A 4I3GA 4ZAWA 3QPVA 1ZS9A 1S1CA 4MW4A 5JEDA 1XKTA 2NTEA 4Q7MB 1C9MA 1M6YA 2VJBA 1C7ZA 3PNVA 3FTNA 2VZ9A 1MOSA 2WIFA 1J49A 1GM5A 4JYMA 3TSZA 2E6KA 2OFOA 3NYWA 4L4ZA 5H80A 3QNWA 5CM8B 3QKRB 3A58B 2K2WA 2NU6B 2P1DA 2Y1DA 3MJEA 4J91A 1UKEA 3A6PC 4JEMA 1C14A 4NBWA 3RTAA 3TZHA 3OJ0A 5BSRA 1E9EA 3JZMA 3T1TA 4GUDA 2C9CA 2J9RA 3HWX1 2AS0A 3VTFA 3GRZA 2X4LA 3U3MA 3MN1A 2ZYDA 1D1QA 3E22B 3QBJA 5TX7A 3SLGA 5DNCA 5AVXA 1TAQA 4TROA 2OKGA 3A1DA 1CJTC 1JG3A 1WHTB 4MJLA 1OKKD 5EMHA 2ERXA 3G5UA 3VJKA 2NU8A 4AURA 3F9CA 2VATA 3KB8A 3I37X 3ETJA 1X1CA 2VK4A 5C32A 5LDDC 4EFKA 1L4FA 3K5HA 1YONA 4US1R 3OPVA 5ENDA 4QAQA 2J3HA 5DLDA 1R4NA 4PLZA 1O96B 1PR1A 2RGCA 4F5YA 4YMUA 2HJGA 2DTDA 2H5LA 2K87A 4DPKA 2H51A 4RCZA 3BK7A 5INTA 2JRLA 1A2OA 3FSGA 5AW6A 4UNRA 3LY5A 4H6WA 3DXXA 3OIFA 4HDKB 1FFAA 1XOIA 1FFGA 3KYIB 2ZQZA 3QV2A 5E7QA 1YHNA 2WF6A 1FB5A 2REQA 4TVBA 1FRNA 2QYSA 1HE1C 1KO5A 5FRDA 1H2BA 4NTZA 4BE7B 5FPPA 4AO6A 1CY7A 4ND7A 1P0PA 4YRFA 4WCFB 1QHFA 2ZSDA 1QCDA 2IPLA 2BUBA 3CO0S 4L50A 4L9AA 4GHWA 3CW2A 3OQPA 3TLCA 3TS1A 3U7RA 4BIMA 5TMPA 2HADA 1J8FA 4Q0MA 5JZMA 1B76A 1PR0A 1VKHA 3FDFA 1RM0A 1L7OA 2IXAA 2NYUA 5LZ5A 4O5AA 5F1PA 1V4VA 5J9FA 2XUZA 2HRBA 5E7JA 3V9PA 1XDWA 1O9HA 3OZSA 3DTYA 1TYZA 2B4AA 3LAWA 3LQQA 4CKBA 2GVNA 2VYVD 1GQOA 2GQ0A 3BJZA 2PPLA 2BZGA 1JR3D 1U8CB 3UN1A 4HOYA 5AOBA 3UMJA 2BGJA 3ND5A 4ZU6X 3NVMB 4V02A 3RSOA 5E0OA 3QU5A 4O25A 3OFND 4QYWA 4YDHB 5DM60 1XKLA 4BNJA 3G02A 2ACWA 1RIIA 3B38A 2BFWA 3N59A 4FYJA 2I4NA 5GAJA 3RGWS 1UT8A 2FX2A 1ZN9A 2H4XA 1NQ5A 5BWCA 5EEGA 3ASVA 2BM9A 2AJDA 1IZZA 5B58T 4FE3A 4GOXA 3M0EA 1GRQA 3IVGA 3NTRA 4INOA 5AM3A 5F64A 2GDJA 3ZWQA 1T2NA 3LUKA 3BGIA 1D04A 3IT1A 4HQNA 2NU8B 3V48A 3B3GA 4PHHA 2HHJA 3TVDA 5KS2A 5L4NA 3B6ZA 1VKRA 3E6AA 3VBCA 4BQSA 2GPWA 4NQRA 1VBNA 4UUBA 1W52X 5B37A 4KXLA 1I2CA 5EP4A 4KMMA 1R4NB 3OIUA 5IH7A 1NC3A 4J16C 4L0DA 5KNCA 2H8GA 2IZZA 3RFTA 3U0BA 1AX9A 5DK6A 1XLTC 3AUXA 1R16A 1ZZEA 1DBPA 4L4RA 1CDZA 5M5BA 3ER8A 1KOFA 3RBAA 1VGRA 3X1XA 1U11A 1H9CA 1C3XA 2A1TS 1ZD9A 3NOQA 3ISTA 1JH8A 2REQB 2IXEA 4AJ4A 4O02B 1PWEA 2HCFA 2LKDA 3D0RA 4CCSA 4DREA 5LIPA 4QIHA 1LQTA 5KVVA 3TR6A 3FUXA 1JKMA 4L8YA 4DBVO 1NJ1A 4KN5A 2A6PA 2V74B 3EYAA 2OQ2A 1OIWA 3AP2A 1D2GA 4HR7A 3BYZA 3DO8A 3HKCA 4XQCA 3UT5B 5F2KA 1B0UA 1Y1RA 4DM7A 3C3PA 2O3TA 5IAJA 3GLIE 4YLEA 1VKZA 2O8VA 1KIFA 4FMCF 2DX7A 4XUEA 4L07A 1G19A 1KI6A 1A5AB 4XPZA 2Q3MA 1UWKA 5J4KA 4J0JA 3PIDA 2I3DA 3MCWA 4JL5A 2LGJA 4CKBB 5I8ZA 1EX6A 2W0MA 3CF0A 2AZMA 3L49A 3ZVKA 2G1JA 5CGZA 3AU8A 5HKKA 5MN5A 3BERA 5LPNA 1L7XA 1QDEA 3BN3A 4KFSA 3LOQA 4TKMA 2ILVA 2YIMA 1M6WA 3FMFA 4WXPA 3EVGA 5CX4A 4GPZA 3H9UA 5H4HA 3BB1A 1U0SY 3PB3A 2IYXA 4JCOA 1IATA 4UARA 3A6ZA 2J3DA 4WKCA 3W5UA 2WEKA 1A8IA 4YHBA 4DVGA 4AP6A 1KI8A 3G8BA 2XDQA 4WA7A 4I99A 1TZCA 2D2FA 4BLSA 1AC5A 4P3XA 1K8YB 1W9HA 2QUBA 3FYHA 4G5RA 2FSFA 3NJ8A 3EB9A 2WAYA 4E1VA 4K5QA 1G7CA 5K0BA 1AS3A 1G8AA 4UE6A 1BX0A 1J8QA 2ATXA 1RZVA 4NYJQ 5IDXA 3BCRA 3TSWA 4Q15A 5CCBA 4JNCA 2Q0SA 4LX8A 2PZFA 3LTEA 4K0RA 1BS1A 3S8YA 2Q9UA 4GQBA 2FVYA 4LWZA 5CHEA 4MRNA 2PBFA 4HYTA 2WC1A 3TSCA 4DOMA 4KN6A 5T7BA 4RPJA 4ZQCB 2W22A 4PZ9A 2J59A 1X2EA 1CLEA 2VP2A 4UEOA 3CS3A 4HTFA 2O1XA 4KUGA 3TI7A 1U5BA 3OZRA 3LBYA 3MJDA 4TMVA 1OI7A 3E8XA 3FDIA 3JVVA 1N5IA 2XYRA 4I2NA 3PGKA 2D6FA 6PFKA 3AKCA 4U7JA 3O75A 3PE4A 2DKFA 5AKGA 2B82A 4M0FA 2CSUA 5JAQA 4MQFA 1L5ZA 2X3UA 4NCJA 4FYWA 1VB5A 3JD4A 2X1MA 1HM5A 1UC4B 1ZC4A 3V8MA 1MU0A 3HKCB 1OWMA 2JHCA 2Y1XA 3PPVA 4L1KA 4X3OA 5JZ9A 5CLFA 4IJVA 2FGJA 3NHLA 5B55A 1KE1A 5JS6A 4N12A 4N9QA 2NSYA 2ZIUB 1KI6B 1E64A 2WHPA 2J5QA 1Y1SA 3RS8A 5A9SA 4PZZA 1ID8A 2VLIA 1HLGA 1Z4OA 1S0UA 5D3MA 1IXKA 4GM1A 4B75A 5E9AA 1EVEA 2V97A 2QL5A 1WLSA 1MX9A 3DVRX 2EX4A 2PT5A 3CZ4A 3R40A 3VKWA 5KOIA 5LM3A 3Q9SA 4LYYA 1M7GA 3NKLA 3UH1A 4LF4B 3MJVA 4Y3UA 2SBTA 3AV3A 4DBLC 3FUUA 4MQMA 3HQ4O 4HBZA 2X0EA 3GT0A 2CHQA 5EOVA 2M1XA 4HUTA 1PNQA 2PCJA 3EF0A 3H86A 1GA1A 1A8QA 3DW1X 1LNQA 2QMZA 1A2KC 3LSTA 4JT4A 4EHKA 1ESZA 4QUIA 3AOEA 2XDQB 2ID8A 4HUJA 3MB5A 4MO2A 1GWNA 3VR1A 2XSZD 3FGPA 4A3SA 2HDNB 4YQFA 3BXGA 3O8OA 3PWZA 2XCTB 5ERGB 5FPKA 5J1TB 2VT6A 2GILA 3Q0TA 1XCBA 3F7OA 2OBYA 2QMUA 1J09A 5BR8B 1TK2A 1QFYA 1V9CA 2EAUA 2PMDA 3GDHA 4U9UA 2OOSA 4G1EB 2KLBA 3AEXA 4V0KA 5KHAA 1FXWA 2OSVA 1ITZA 1JE1A 3FFWA 1KOJA 1X1TA 5K99A 4KPYA 2XD4A 3LIIA 2W83A 4BP9A 3D3WA 5KQGA 3PLNA 4QNNA 3B5EA 4CKWB 2RI1A 4HTFB 2CVHA 2EARA 1U5BB 1L7AA 2X5KO 4FFNA 2DUNA 4J0DA 4N4AA 2C1XA 3VNQA 1EUQA 2G71A 5KTSA 1P18A 4D80A 5C8YA 2PZBA 1F0NA 1ZMTA 1XTQA 3IPCA 2HGSA 1TYDE 2AC4A 3FKQA 1F8FA 4MQFB 3PF8A 1QOQB 2HF9A 4HRXA 4CL3A 1U63A 3CKKA 1CG6A 4L8GA 5KC9A 1RNLA 3GFTA 3H42B 4BAUA 3QTBA 4UTXA 3SZUA 1H8EA 5JAIA 3BDVA 3U4DA 2C7RA 2XB4A 3F6SA 5JD4A 5C8ZA 2CJXA 3SR4A 3EIXA 2VDWA 3IP3A 3HUUA 5ADHA 2NXEA 2PSJA 1MABB 4PO3X 5AJXA 1WCIA 3NWBA 3S99A 1BDIA 1G9XA 5GOTA 2WHPB 2YIVX 4BFYA 4M83A 2PKYX 2YZ2A 5A9SB 3ZG6A 3CZCA 2CDCA 4QXAA 3E3OA 5LMZA 4ARIA 1VJ0A 4R8RA 5CH5A 3AUJB 4FDMA 5D3MB 3VZDA 2D0IA 4Q16A 4WDRA 1Z5VA 1R37A 4A9AA 1CUFA 4KH0A 1WQ4A 1W2WB 3P2JA 4JJGA 3WRXA 1U9CA 2WW8A 4NOKA 5EVCA 9LDBA 1MIOA 4BO1A 1VHJA 4CPDA 5CPBA 3UPTA 1Q0RA 4NEHB 2A7QA 4XIFA 3VSBA 2GBFA 4BJ1A 1CR1A 3MGGA 2G28A 5P21A 2CYAA 1ODFA 3RIHA 3Q10A 4RXMA 3T3DA 4XDZA 4YP0A 3DD1A 2OBFA 3IVMA 1AGPA 1NJGA 2QXUA 4BKQA 1L8XA 3UOGA 4BKUA 1JMVA 3IDSA 2ZDQA 2ZYTX 2ZGVA 4G1MB 2XT0A 4P98A 1FJGB 3O8OB 1QK3A 4IUCS 4DR7B 2VPPA 4EA7A 3WR5A 4DIMA 4EEKA 3X2EA 4OM7A 4LYDA 2FWPA 2OD7A 2XRMA 1Z0SA 3QBVA 4PFSA 3KVYA 1SXJA 4DANA 1QFJA 1UPAA 3AFNA 1Q20A 3JWEA 4IFEA 5M29A 3GRRA 2LIVA 1UPCA 4RM3A 4XVHA 2Z04A 5K4GA 3D3WB 3Q41A 1D4AA 1GSHA 5EIAA 4RHFA 1WL8A 5KNBD 1NMSA 2IP2A 2YMPA 5ILQA 2B5WA 2VRWA 4N7JA 4YAKA 1U02A 1PK7A 4O6VA 3IDFA 3QH4A 3ZDZB 2JLQA 3PNSA 4BKOA 4XB1A 2YC4C 4MLZA 3M82A 1U0FA 3FSEA 3SWWA 2VPZA 6CHYA 2PGLA 4P7KA 5M04A 2JJ1A 3S3TA 5K0EA 1O94D 1YB7A 1L5VA 2MWMA 3SF8A 1JG2A 1XEAA 3G2NA 1NR7A 3B8HA 1TJPB 1JG6A 3NHBA 1E9DA 1ICIA 1XMJA 2VDWB 3FRHA 4MA0A 4R7GA 4CU5A 1WCIB 2M6RA 4B82A 3HVIA 3S2GA 3DOUA 5KX5F 3RAPR 2J3IA 4GRAA 2R3SA 3LA8A 4JUCA 3QKSA 4ILEA 3WK4A 4ENSA 1YBAA 2CJYA 2Y76A 4U39A 5L45A 1CJKC 3HACA 1ZWLA 2J5XA 4YV0A 2ECOA 5JCJA 5FTLA 1TNDA 2PM8A 4NCIA 4CU2A 3G2QA 1T6NA 3GOHA 4MKGA 4FB4A 2YN0A 1GSAA 1MIOB 5ALIA 1DJLA 1IJEA 3NHRA 2O2DA 4DXAA 4EP1A 4S1TA 1IZYA 5KKNB 2O52A 1W0JA 4JU9A 2D2VA 5LBUA 1GQFA 1V47A 3M6FA 3T7EA 4F12A 1GPMA 4R51A 3PHGA 4KAFA 1VE3A 1PYGA 1CY4A 1YR3A 4Y6SA 4BJ5A 2C83A 3NQ41 1YS6A 2FI1A 3BTOA 4KFRA 4OFXA 4X1KA 2K5UA 3KEQA 3OICA 4XOUA 4H7DA 2F3UA 4EBFA 5LJIA 3TLEA 1VGVA 1I01A 3TLAA 4AN4A 2YFHA 1U7OA 3KEOA 1A7KA 1MC5A 1NJ8A 4G36A 4LK2A 4BCCA 1B15A 3B5IA 2GF2A 2WBLC 1SXJB 3D6UA 3R3HA 1T9HA 4UOZA 1NVXQ 2IEGA 1BWRA 5IT9A 4PSAA 4P34A 1TKRA 4JZYA 2O8BA 5HDBB 3N8GA 4WXEA 4OYYA 4OGFA 2X0IA 2MJLA 5HZKA 4EDHA 1EFAA 3QFRA 1L7RA 4E21A 4FR2A 1UJBA 3PTAA 4JI3B 1MA0A 3I5YA 4C22A 3FWHA 1P62B 3INTA 1CZNA 1UBKS 3KSAC 2QF7A 5M2QA 3HI4A 5L4SA 1OV6A 5EPEA 1G2QA 4JC0A 2YBEA 5I4IA 3OFKA 3SF8B 5C31A 3A9WA 1QG6A 3L6EA 1DOHA 4NK4A 4YIKA 4LRWA 1Z7GA 1RAHA 4AQYB 1L5GB 3WMEA 1M7BA 3MMSA 1K8RA 3D3JA 3TGWA 4DNOA 1BEEA 3G9QA 5C7OO 4KV7A 1T43A 3KKPA 4RE5A 4RF3A 1GGEA 2OHIA 4P7BA 4BV3A 2R8EA 1ZQ1A 3HUDA 5FH9A 5L95A 3EXHC 3QKSB 3IP9A 3AF0A 4PFKA 2NACA 3O7WA 4BO0A 2DF8A 3FCEA 1P33A 1NJ5A 5G0WA 4D0RA 4X92A 3R5KA 1OFHA 4MQLA 2RGEA 3RS5A 4DJAA 1DGQA 1YNSA 1ZYUA 2J32A 4UBLA 1OHHA 3PC8A 1Z8HA 4JLJA 3WBKA 3SQWA 1S01A 1YQ9A 3K73O 4MVXA 1AQYA 3BWCA 3L06A 3BMOA 3OO1A 4HC4A 5J5AA 4BMYA 1ZPDA 2WIGA 1H2RS 1RI5A 4Q3EA 4DV5B 4C87A 3P96A 2F3PA 2O8DA 1JN0A 2X2FA 3LLMA 1XCLA 2RGNC 4X1KB 1SG9A 3E2IA 4OHZA 3MC1A 5EEHA 5EWMA 3N87A 4KRYA 2FNAA 2W6JA 1UJNA 2GX6A 2WM8A 3LC1O 5FI5A 1OZ0A 2RGBA 2VSOA 4QLAA 3T5AA 2HUPA 1QWOA 4YV2A 3LZCA 4RSHA 1G3QA 1K1EA 1I8TA 1XD9A 3R7DA 4AS1A 1L8LA 1I4WA 3MT9A 4RS3A 1FUKA 3TO5A 5IABA 5JR3A 1TLTA 2O8BB 4Z9FA 5AI4A 3E8SA 4AKIA 3OETA 1Z47A 4S35A 4RTQA 2F64A 3I58A 2X76A 4IUDS 1W93A 4CMEC 5IKMA 1N0UA 1BD4A 4Q3DA 3FNFA 3GLSA 3GEMA 4QULA 1RKXA 2O6HA 1H8HA 4IH1A 3MUEA 3LFTA 1I24A 2P78A 2CK3A 2O9JA 3LVRE 5GM1A 1LLQA 3SI7A 1K6JA 1P81A 3O84A 5CITA 1HMPA 5IDQA 3OF5A 5HJ2A 3NOVA 4R9UC 4EKEA 2FE4A 4ZK6A 5LZ2A 3LUDA 2VXYA 2AN1A 4KG7A 4AN0A 1N4AA 1PYOA 4QOEA 4CZ2A 1B4DA 4DRXB 1GSOA 1LFDB 4B4OA 4KE6A 1NUQA 4WCDA 4KRFA 3GU3A 3EIHA 2G1UA 4BGDA 2A57A 5TJ9A 1W5SA 2AD1A 3LK6A 2QN2A 1LBHA 2X8LA 5A5VA 2PZMA 4ZHQA 2DUWA 3ETHA 1HA3A 3MRVA 5GJWC 4CM8A 3OCVA 1MRNA 5IG2A 3BWBA 1E6LA 3QOYA 4I3HA 2P9ZA 1FS6A 1WA5A 1EPUA 1IAVA 3UC5A 5JALA 1NDHA 4UHDA 1CKEA 1DIRA 1NNI1 2GNAA 5H9VA 1HY3A 3D64A 3AI7A 4OHBA 4QPJC 1P7CA 4RACA 4ZZ2A 4JITA 4U7HA 4UAGA 2X0FA 2AXNA 1Y4ZA 2PX4A 3A0RB 2NG1A 2RI6A 1PGQA 2ET6A 5E1DA 5DP1A 1V2HE 1H2AS 3BMOB 4PONA 3MWDA 3GRCA 3ZHRA 3KUXA 1K6MA 1QHGA 3GCDA 4L9RA 4OQNA 3ROZA 2BFPA 5ITVA 1I0LA 5AHXA 3RG2A 4EG0A 4E4YA 2O8DB 3I2IA 5EN4A 2V6JA 2XRYA 2O2HA 2ZVQX 3M81A 4LV5B 5EWMB 3ZWVA 4CT4B 4BAZA 3V32A 5BWMA 1SNYA 4KIGA 5DMHA 3KL4A 1UKBA 4IILA 1W87A 4K3VA 1JECA 3WKCA 3IMFA 2I29A 1P7PA 1P4HA 2P62A 1S2NA 4JBYA 3ZJ4A 5JNRA 5JNSA 2B69A 1E69A 2AUTA 4MUIA 1WABA 1EXDA 3TTVA 1LBQA 1O6FA 1N8KA 1UC5B 3DXZA 1C8LA 5EZSA 4ENQA 4FLFA 3IH5A 1JKIA 3ZWMA 4C4RA 2ENWA 1TF2A 3GN2A 1FJ2A 2IXFA 1U98A 4JI6B 2GBLA 3NONA 2RHHA 1PQWA 4L6IA 3P9YA 4BNLA 1QU3A 4C4XA 4LTNA 4EYGA 1XPOA 1LBTA 2HKIA 3ITEA 3MYRA 2RONA 4WZAA 2XMGA 3KSDO 2XODA 3X1WA 4V0NA 4ZRDA 1ZK1A 1I1HA 3WL3A 2D5AA 3V8PA 1JQKA 3UKDA 1EG7A 3LKDA 2Z3WA 4URUR 3VYVA 1JFFA 5AVVA 5E4JA 3REOA 2ISSD 2IK8A 2Q3FA 4AJHA 4BY9E 4BMPB 4MV8A 3VDRA 1PT6A 4O2BF 1KYQA 1PO7A 4L75A 1P5RA 5F7ZA 2IZ5A 3QA3E 4LKOA 2P69A 2P5YA 4QUBA 4R1QA 1ZITA 3MTJA 3ZOZA 4ZHQB 1G38A 4D25A 1ECLA 3GVPA 4CM8B 1Y8AA 4DCVA 2X4IA 4IF6A 4DLSA 1DO2A 3SJBA 4CQJA 1QOPB 2BKLA 3ZBTA 5JNUA 5JW6A 5F73A 3I76A 4Y2HA 2PLWA 3RSHA 5KYXA 1T29A 3ZGNA 5TQ2A 4C20A 3IUEA 3KKQA 4DMLA 3GZNA 3QOXA 2OQIA 4G0WA 2OY0A 2CXXA 1DAFA 4EL5A 2YWGA 3ASZA 2YN4A 2Y1CA 3JQAD 5ABPA 2QENA 1FP4A 2WHYA 3MWDB 3O8LA 4LJLA 3LUJA 1KZGB 4PANA 1ZVMA 1Q1QA 4MYDA 1NGSA 2C4HA 1OR8A 3AHDA 4K2HA 4OJNA 4CQLA 3RC2A 1EWTA 3PNMA 3JTMA 4W8OA 1EJ6A 1EDBA 3ZE2B 4EJ0A 3ZHYA 2ZVJA 1EP9A 4M9RA 4ESHA 3OI7A 5BV8A 3CSSA 1Y5IA 4FKZA 2XTAA 4JH0A 4FYHA 1FRQA 2JHFA 1TLLA 4F21A 1YB6A 3B9RA 2ZUUA 4ML3A 3WKBA 2YMLA 4LZLA 3P8ZA 1AS0A 4E31A 4IDNA 1Z4PX 4EITA 3T7AA 3PFHA 5C4IA 3M70A 2XBUA 4J0GA 1NAIA 2XNSA 3AM1A 1YVRA 1T10A 4DHEA 5CDFE 1DBIA 3VDNB 2XJ9A 1V8BA 5DGHA 1VJDA 3FBGA 4BN4A 3UJNA 1ZGGA 1CUEA 2WU3A 3BA6A 5EZYA 4BBPA 4HNUA 3HS3A 4JT9A 4KCGA 5JH7F 4WZAB 5IZ4A 1TM1E 4YY3B 1EWYA 3L0OA 3ZVLA 2HJRA 4LXTA 5CFOA 1VLLA 4FWTA 1XAJA 2WTXA 1JFFB 1HDEA 1XL1A 1L8OA 2QA5A 3V8RA 1XZNA 4EWLA 3TLXA 1EIZA 3SK0A 3AW9A 1MMFB 1VJ1A 1U3GA 3LY9A 2FRDC 1ESMA 1LKZA 1X3SA 1XZIA 3LK7A 3MMPA 1I2ZA 3WFJA 3QHAA 2WP0A 4EJ6A 4R1PA 3V2IA 4YCNA 3LP6A 3W4JA 3MWJA 4NZPA 1N1MA 1VZ3A 2C54A 3A3OA 4HN2A 1ZGZA 3ADKA 3WXBA 5LQKA 3EVEA 2VCEA 1VL2A 3AF4A 1P0FA 3TI9A 3VH1A 2I9KA 1ZW6A 2IDKA 4ISBA 4CJXA 2H17A 3VJRA 4O29A 5KYXB 3UAYA 1RYZA 1SOAA 2WF7A 1WE2A 2GMWA 5TQ2B 3EX7C 3GZNB 5JSZA 2WIBA 5BPFA 4NOJA 3SHTA 4G5FA 1FDSA 5AJWA 5HMMA 1HPLA 4DMHA 4F5ZA 2NXWA 1OGJA 4K2AA 4M1TA 1UDCA 1FP4B 3QPDA 4UUNA 3TQCA 3O0DA 3OBBA 2PCLA 1LLUA 4MV6A 3F47A 1VIDA 2JGMA 4M53A 4B76A 3U4HA 3W6ZA 2OXFA 3TG8A 4IL5A 3VI3B 5IAEA 1B43A 2FPUA 1ZOSA 2C2MA 4CQLB 5JJKA 1PJSA 3PT9A 2KW5A 3CRMA 3KOXA 3LBIA 1N1GA 4FHCA 3BHMA 2J0UA 2FW6A 4ZVLA 3ZCQA 3ZN2A 3EXEA 3H2SA 2PRKA 1EK0A 3D3NA 1HLDA 1QPGA 3LBHA 1B8VA 1VHTA 2CD7A 3I9V1 4IICA 4QU9A 4UEWA 1E3TA 5ALOA 2J9GA 3WVNA 4CI0B 4ENWA 1NZJA 1OYWA 1WRBA 1JLRA 1T2EA 1WDMA 4LCJA 4BNUA 4Z6KA 4DV4B 3NEAA 1EGVB 2ZR8A 1VIVA 1HURA 2QKYA 3CVOA 4HWOA 2FEWB 3N2IA 4ZODA 1N25A 3B9PA 3LVFO 1V7QA 2XKAA 3IVAA 5I5GA 3UAZA 1IBLB 1RPJA 3LMKA 1SPBS 1H3FA 4XIIA 5EZYB 2HSWA 5FIUA 2F00A 2DHDA 1Y6JA 1VG0B 4RA9A 3KAPA 3TPFA 1FU4A 3IT2A 1Q2UA 4AJIA 4AUNA 5C46F 2VJKA 2BN4A 1RW4A 5C52B 2UXCB 4M1OA 3F5FA 4P4NA 5FHQA 2V7PA 4ZKEA 3MD0A 2VNJA 4OI1A 1SZJG 1JIJA 4ICIA 4LCBA 4N6NA 2HCBA 5TEVA 2GCIA 1G20A 3C16C 1K6IA 2QTGA 4FOTA 1VECA 2PD4A 4MDHA 4OXQA 3O0TA 4P84A 4DR1B 3KLNA 3ESRA 3K2QA 5IBPA 2HSGA 3RB8A 1A5SB 2XBLA 1U1IA 4NP6A 5E4YA 3WBJA 3K15A 5KAPA 5B1YA 5K8LA 1LWNA 3K1ZA 5JSZB 3QX3A 3FSJX 5LFAA 4QXRA 4UVDA 3T5CA 3ZE7A 4WXMA 3HJHA 1NVGA 2J7KA 3AUUA 4FT2A 1KI3A 2VOEA 1FS5A 1OX4A 3ZXXA 1CLUA 3ORRA 4N3CA 1KAEA 3GC6A 4W99A 5DASA 2IYWA 5H3CA 4DJJA 2BPOA 2C4KA 4OV6B 1I9CA 2Q99A 4RD3A 2UXDB 2C7GA 4X3PA 4DMCA 5CG1A 3GLHA 1TF7A 4K8OA 4YS6A 3TW0A 3FCCA 1ATZA 2J0UB 2R4QA 1H6DA 4N0EA 1UMDA 2FZCA 2I80A 3C6KA 3EXEB 4H4CA 4N5LA 1GRNA 1CBUA 2VJYA 3PVZA 3U4CA 5KYKA 3Q8KA 3L18A 1KQFA 3DEIA 3FRJA 4RFLA 1RC8A 1ESEA 1OFUX 3PPWA 1VL5A 1H2XA 4KIJA 4I8IA 2F62A 2WJIA 3QE4A 3I1JA 3ILXA 5J4VA 1TVCA 2HBZA 2QK4A 1NN1A 1POXA 2Y67A 3BWXA 4Q18A 2J87A 5DB4A 2GLTA 2FMUA 6AT1A 3AHFA 5IASA 2JJQA 2RHTA 4CHTA 1NRJB 1N6KA 1XJCA 2I99A 3CT4A 1JFTA 4ZO4A 3PX7A 1F06A 1KJZA 1VOTA 2H6EA 3D7SA 3H2KA 4AWBA 1WOYA 2VWQA 4OSPA 1I5OA 2ZRAA 1UDBA 3H0KA 4K9MA 5TR9A 2O0LA 3DBVO 2P3OA 1HFKA 3NC1C 2GYVA 2ZB4A 2DC1A 4RA9B 4W8GA 5LLDA 4LDAA 3THWA 1O97D 1VXOA 2FZ4A 1ZM7A 1E2PA 2Q8NA 4IX9A 3E03A 5C8VA 1PGPA 3PJEA 5GONA 5GZ3A 3K16A 4Q7JB 3VDXA 2XKKA 2IUUA 2ZBVA 3EBPA 3LT2A 4QRIA 2OILA 4FEGA 3UANA 1EP2B 5I47A 2QMOA 5CYGA 4PQGA 3NCTA 5HFJA 4GOKA 1G20B 3ENNA 1X0XA 4HFJA 4EAAA 3A4IA 1L7NA 1K7EB 4HMQA 4X6XA 5F78A 1Y5RA 4W5QA 2FDCA 3A6GA 5CEJA 3WMRA 3V33A 1KETA 2DG2A 1WPQA 1RD4A 2HFJA 3DLIA 3G2HA 3GR6A 3KKOA 3PTLA 4M54A 4TS9A 3T0GA 2HRZA 3LOPA 3WZMA 2CCKA 2ORYA 4F4JA 3KAJA 4N5DA 1H0HA 1OX4B 1USUA 2Y92A 2R11A 1JH9A 4HN4B 3B89A 1MV8A 2XZPA 2YHBA 1B8UA 2W6IA 3N1UA 3DBOB 3Q9UA 1EB9A 1LB1B 3GLHB 1H2WA 2XMQA 4NWIA 4BN0A 1BMTA 1F1BA 2QHXA 2ONYA 4NPHA 3JRXA 1UMDB 2EZUA 1N2XA 4C0LA 1NLFA 1X7XA 4TYYA 2HCJB 2XE4A 3ZEAA 4D5EA 4WV3A 2BJVA 1H5NA 2B8JA 1EH5A 2Q27A 2C59A 4GI1A 4ITVA 3SSMA 5BURA 2V8OA 1VI6A 5B3AA 3FETA 4DKXA 5CJ2A 5IYZF 3EFBA 1KO4A 3MINA 4RF4A 2JKVA 2GTPA 3IUNA 3PL5A 2QX6A 1JR6A 3E7XA 4BMXA 4RTLA 1YZKA 4BNVA 3BXHA 2GM3A 2GUGA 1ZJZA 1E3SA 1FYWA 1FL9A 2Q0QA 1CUYA 2QL6A 3IOBA 4IJMA 1FUUA 4RX1A 4NV0A 1AMOA 4FZJA 4O8CA 1RWWA 3C7KA 4U2GA 5EMJA 4KQXA 4F71A 1SXIA 4NCHA 4FUQA 2D8MA 2P3LA 3H99A 3SYKA 3IQFA 4ZVKA 1VJGA 3OTIA 3THWB 4F06A 2J7PD 2BI8A 2FEKA 4GPAA 3TM4A 4RGVA 2SCUA 5GONB 1OXSC 2FZGA 4LVNA 1GFZA 1QUFA 5F2OA 4Z4HA 4PW0A 4JOBA 4N8DA 4CLDA 2DHCA 3D6HA 1ABFA 2YV2A 5JCOA 4G4SO 4IH4A 5D3KA 1XWIA 1N6OA 1FQWA 1XHEA 1JT9A 1XE3A 2V4ZA 2JLXA 2CYBA 2OAGA 4XCXA 1KF0A 2EOAA 3AIIA 1CJBA 4M37A 1MXFA 1TTQB 4L5YA 4A16A 5KNDA 2OCIA 4OO3A 4PZEA 2W2LD 3LGXA 4MVJH 4ZPJA 3OJXA 4B74A 4BNHA 3EVAA 2A4MA 5JXIA 4OJKA 3SHWA 1WV1A 2VBGA 3PRJA 1ULSA 1EFHA 3VC7A 5KWEA 2XQFA 4ZZ3A 2YVUA 3RHZA 5AOCA 2HJSA 3SC3A 1PL6A 2VH1A 1E9BA 4I1IA 3FZEA 4ZN6A 3RQIA 5JDIA 2QTVA 1J8MF 2Q1WA 4GM4A 2I3AA 1EXNA 1CQWA 1LVUA 3VZQA 4EMTA 4FDAA 3ANTA 4UZEA 1V6AA 6Q21A 3H5LA 1PW5A 1QS0A 2IKQA 1Z8NA 3BORA 3G2LA 3RIYA 4BHTA 1JEDA 1G21E 1K3TA 4IJUA 5DZSA 4UHBA 3G2KA 2YQZA 1X7XB 3OE7A 1J23A 3A2MA 1ZR4A 5HJEA 2Z2YA 3ORSA 5K0CA 2YWXA 3V6LA 4IR7A 1XEXA 3RLFA 3BXFA 3IUSA 1O95D 1YB2A 3MINB 4WKOA 3ASYA 5I5EA 4DCNA 4C4PA 1FX1A 3PZRA 3ELBA 4JQZA 3G59A 4LVOA 4RBNA 5CNIA 1N2HA 4IUBS 2JH8A 3BVPA 2P1ZA 1ZH0A 1JMKC 2RHGB 4P82A 4ZXPA 4LBWA 4B4VA 4BRSA 5JROA 5DT9A 5KVCA 1ZICA 4IS2A 4JFAA 3P9NA 4OFZA 2HGZA 1R6BX 1N92A 4X6YA 1R9GA 3LE8A 3COZA 3ZI0A 4G89A 4F5DA 1HI9A 4JBWA 1LV8A 3HVJA 1R0ZA 3WLKX 2H4WA 3ACDA 4XRGA 1K97A 1E1KA 2WAAA 2SCUB 2XMBA 3BMXA 3LCCA 1I7LA 3OOHA 3WIUA 3WKDA 2HREA 1R6VA 1BOFA 2JF0A 4R2JA 1MOZA 5EE3A 1LRJA 5TF0A 4JLVA 4G1BA 2AXEA 4KODA 4GOJA 4GXRA 5AIBA 5KYGA 2VHQA 1YZGA 3EPRA 2DWOA 4D4JA 2FR8A 3U4IA 2IJGX 3DFMA 1Q84A 5DULA 2ONJA 4DAEA 4ZHSA 5K0SA 4QHYA 3ZWWA 1JU3A 1RXIA 3QVOA 4QPDA 2LDXA 1NRXA 2WIDA 3QXSA 1MX1A 1N1DA 2MU1A 3NANA 1MB2A 1D07A 2JFXA 2ZYRA 4IXDA 1FOEB 3KJGA 2JD0A 3WLTA 4BMOB 6ADHA 3BRQA 2AQKA 1P9WA 1QLWA 3ZHZA 1I30A 2QTVB 1ST2A 3VYTB 2CNWA 4A03A 4F7DA 3EZ7A 5I4CA 1N78A 4DW8A 1UM8A 2R7KA 1USWA 3EUFA 1QS0B 1ZOLA 1EVYA 5AIAA 2ACVA 4RKFA 4GPD1 5EKTA 4B6QA 2C96A 4L0QA 2Z4TA 2H2WA 3ZVNA 3WIVA 2BMDA 2PRIA 1XPJA 2XTZA 2H3HA 2CLEB 2ZWOA 3ESXA 4NOMA 1CNFA 1XEXB 1LPNA 2WKPA 1UFKA 2WP8J 1MRZA 4FIZA 4BVLA 4B7AA 2ZSEA 4XCQA 4CQMD 2VDUE 1Y7HA 3WMGA 2Z3ZA 1F6DA 3KPWA 2Y0EA 1PKXA 1T2AA 2PJRA 2EW8A 4NEGA 4LOHA 2Q5FA 4P7FA 4K88A 4H7IA 3OE5A 5AW4A 5HCIA 4UAJA 5ALNA 2FZKA 2RC6A 5K6TA 4RVDA 3GNQA 1ECPA 1IOZA 2H4JA 3UT6A 1W36B 5GVSA 1SFRA 1GOTA 2QMQA 4PCLA 2PMBA 3GGJA 1BZYA 4F84A 5I51A 1RXYA 3FM9A 1K8QA 2UZ3A 1JHZA 2QD3A 3ONEA 1P0IA 1KI7A 3JVEA 4YP7A 4JQSA 1W1UA 3T5PA 3TECE 4WEQA 3VXKA 2CEKA 1MVLA 4K86A 3BEDA 1Z0KA 3UFXA 3M9XA 4RWZA 5EQTA 4KIFA 4XQGA 4B6JA 1M2HA 3I04M 3IOCA 2BMAA 1X1BA 5FJJA 4MRAA 4U8GA 2N1MA 2B1IA 3FOEC 1SD2A 2IPAB 2CKDA 1T8PA 4UU8A 2Q5IA 3G82C 1QRDA 2FUKA 2GN1A 3FOWA 3KD2A 4BEWA 3ZGZA 1E8MA 1XD8A 2AEMA 3FTQA 1O95C 2FLKA 3RV4A 4KFCA 4XDHA 1USVA 2OCAA 3PV0A 2JIBA 4CVNA 2ZEJA 3L7LA 2W6PA 1KFKB 4U6SA 5DLEA 1CNEA 2HPHA 3K5PA 5E9WA 4D4HA 5JUWA 5C4GB 3K8QA 3IDOA 2XOKD 3HB4X 1TMKA 2UUAB 1S4QA 4NF2A 1FYDA 2HNKA 4LNUA 1TW3A 1PTKA 3EUAA 1IHUA 4M0CA 2YVQA 2WUFA 4D45A 4QXOA 2YIDA 5ICEA 4KWEA 2BI4A 3EEYA 3IIKA 3QLTA 5AQEA 4HD8A 4KVGA 2JW5A 4XW2A 3F5MA 3C5HA 5BYJA 3QYJA 5DSTA 4QT0A 5F9HA 2F3QA 2YNMD 2IS6A 2WR8A 4PVCA 2UVPA 1XJWA 5CDHA 1BTOA 1E2UA 3KKLA 3QMWA 3GGCA 1OIXA 1P17A 3NHZA 2FPSA 3EWIA 2WM3A 4AC9A 5DNDA 2RJNA 1G55A 3ETLA 1C3OA 2ZE6A 2RHWA 4MTCA 1T6ZA 4CLXA 2ODPA 1T6BY 2QPOA 1A9PA 1E32A 1OPRA 3ORYA 3C3WA 2FFQA 2AR7A 4ZD6A 4Z2AA 1GITA 1PFQA 4ZYYA 2HY7A 1PR3A 3UGQA 2PO7A 1MF7A 3G8DA 3H4VA 4HS4A 4LBVA 1P0QA 1H69A 1Z2PX 2FPMA 1OLSA 3CO5A 2HT1A 3T7KA 1XTSA 4QL3A 4OGWA 1HBJA 4HH1A 4YCBA 1L5YA 3UFXB 2PUDA 4WHMA 3U5ZB 2XX3A 3AO0B 4EJSC 4D42A 4GOOD 5DN6D 2G1PA 3ETGA 2O3SA 1HE2A 2XNCA 3UG6A 3ANXA 3N8KA 4O4JA 2Q29A 4GICA 4KBFA 4PS0A 2C2WA 2O05A 3LUCA 4RSRA 1IY0A 3WSVA 4ZDJA 1M67A 3MTQA 3OIDA 3K0HA 1AN0A 3DNMA 3VU9A 3TYXA 2F6RA 4DB4A 4FHGA 2O3RA 3FMVA 3PUJA 4GGMX 3JVIA 3T3GA 3KQHA 3LP5A 1CY2A 3N0XA 4MAMA 4Z4EA 2B8TA 3CN9A 2G7ZA 2PKQO 3C8ZA 1E1RD 3P4XA 3LHDA 2YL2A 3W2IA 2EZ4A 3GPLA 5C3UA 2HA6A 3I12A 5KYWA 2FZWA 4BYMA 3SQNA 1VC2A 4LOKA 1U2RA 2WSMA 4LNUB 2ECFA 1I6KA 1ND5A 2YXLA 4YK7A 3TBFA 1QXSA 4KN8A 4QOJA 2FOIA 1Y3AA 1YZ3A 2FX3A 3A6DA 3B3QA 2LWIA 1EVZA 3F7MA 2P79A 3J80A 1ODSA 2GFHA 2GCOB 2GEVA 5KOJA 3ICEA 4I9NA 5A3RA 1QJCA 1QWSA 2EKZA 2V3CC 1X77A 3LXXA 1NVVR 5FA8A 3M5PA 2UVPB 4XYGA 3ONNA 1J5PA 2R5WA 2VNSA 3A26A 1QJ4A 1TA4A 2G1KA 2EBFX 2YUIA 1N0VC 1NX9A 3EW9A 3IAS6 4C7MA 1H1TA 4OOEA 2WINI 4UASA 3NHKA 1W76A 1RM3A 1RWXA 2OM2A 3MEQA 2B37A 4J3JA 4KXYA 1C3OB 4BVBA 4PNEA 5AJVB 2DHQA 1J56A 2VP9A 2Y99A 2ZYIA 2NOAA 2WM2A 1YJQA 4I5EA 4RL6A 4YHHB 1XAIA 5K51A 1WKCA 1KA9H 2A67A 5BW6B 1LD3A 2JFFA 5NLLA 1Y3CE 4R2LA 3U7QA 4HLNA 2CXNA 5GOZA 4B33A 2C61A 5DW0A 1OLSB 1O2DA 3JCZA 4AMGA 4AW9A 1H2FA 4B4WA 4HQFA 3AK4A 1AU9A 1R0CA 4UM9D 3EPKA 1IQRA 3ILVA 2C04A 1NVTA 2C2ZA 1J07A 1ACLA 1DLJA 2A58A 3I04A 4JEUA 5IFKA 3MUFA 4ZQIA 2H1RA 3UMVA 5HRAA 4O4JB 1L9XA 1YULA 2CHEA 2VQEB 1CP3A 1OVGA 2V6BA 1VMAA 4OGGA 1A9OA 4IDBA 3BSWA 4XFJA 4B43A 4BX8A 3VU9B 3PQ8A 1JEAA 4EKIA 1WZ2A 5BSMA 4BB9A 5KREA 1E1LA 4PLGA 4K6HA 3WLIA 1YS4A 2VHJA 4EY7A 1OXTA 2IGBA 1FMJA 2OV2A 4FD2A 1TKAA 3FVVA 3FLEA 3I4FA 1JGTA 2VHCA 4DUGD 1AS2A 3F96A 3GLFA 1PG0A 1CWUA 1Z82A 2F3RA 3A4VA 1M72A 4MWCA 4OU4A 2FLVA 4WK6A 1L9KA 4YT5A 5DHRA 5EQJB 4DLZA 1WD7A 4DG5A 5KYWB 4M9XA 5LOVA 2O5CA 4GMHA 3UK6A 3GEGA 4P86A 5DH9A 1R4AA 1LK0A 2B8EA 4HN9A 4LY6A 3ZU3A 1ENOA 1FSSA 2L17A 2OCDA 5KOJB 1TB4A 2W2MA 2B99A 2WYOA 4B71A 4JXZA 1H5UA 3RWBA 3T34A 1GCOA 2FPPA 2YY6A 3H1EA 4HCJA 3QUCA 4YLYA 1MTOA 2FGKA 3B70A 4K40A 4QNRA 1BG6A 4Q9KA 1G9SA 1N8NA 2MYUA 4ARSA 1YZTA 3WQBA 5K4HA 3OQIA 4DDMA 3FCSB 1RXSA 4HLQB 4OAPA 2VPIA 1OTHA 2VT3A 4KMSA 4KXXA 2ECPA 4M1SA 3PQ4A 5EHGA 1GYQA 3TQIA 4X90A 3H1FA 3MM4A 4KPGA 4JYPA 2DFLA 2ZBDA 5HQ3A 1MO6A 1DG3A 3HN6A 2FSGA 4QDXA 5CLLA 5AM0A 4S05A 3F73A 4DNPA 5EPUA 1D03A 4JX8A 1N32B 3LQ1A 2ZT7A 4WADA 4D02A 4DLKA 1OY1A 4PO8A 4TS4A 4AJJA 1V4BA 3NIFB 2ATEA 3QI7A 4OSEA 3U7QB 3EOZA 5BN5A 2R00C 2GZ2A 4ZAGA 1A04A 2CMDA 1DC3A 1UKVY 3FNRA 2ZUFA 3N2ZB 3H5RA 3WOVA 3WLLA 1UWVA 1PNOA 1RKUA 4B44A 2VHXA 2XVMA 1JALA 4UDNA 5LBIA 4BIIA 5FXMA 5IC6A 3SYRA 1SD5A 2CMHA 2ZREA 2JJ2D 2QZZA 4IZ6A 1EK2A 2Y0PA 3PNQA 3A3PA 2O3JA 4JGBA 4Q3NA 1CS4C 4EHIA 1FDRA 3GRYA 5PGMA 3WL7A 4U2DA 4BFZA 4E2XA 4F9TA 2DFDA 2JDID 2VNKA 5HBGA 4D44A 2VTKA 4LBYA 5FBRB 1F3OA 5DO9A 4M0UA 2JBAA 2CYCA 2EJTA 3JAKA 4LDQA 2A1UA 3GFRA 3OMLA 4Z0PA 2RDMA 2HJVA 2QAJA 1H42A 2GS9A 3R5XA 2GA9A 4OQDA 3KWLA 4RK1A 4X84A 5CCXA 1TQDA 3B1VA 2B83A 5IC5A 1J39A 4HPJB 4E4TA 3GG2A 1EB8A 2EZ8A 2WVGA 3LLUA 3CB2A 3GLFB 4MA5A 2GPYA 8LDHA 4JWKA 3G0BA 4JP3A 4L3WA 4Q7QA 1OXUA 5BMOA 4MQUA 5E3IA 3PHHA 2QPTA 5F1OA 3QF7A 4PNZA 5LQSA 4BC1A 5LOVB 4JOSA 3K70B 1AN9A 1ZP6A 2PL5A 2YX1A 1CVIA 2G9QA 1K7CA 1IONA 4HEA6 1GKUB 2IYZA 3M8KA 4X91A 5EGNA 2GERA 4MEAA 4R54A 2B8WA 2JGEA 4W7IA 3RJTA 4G4IA 1M6HA 1XLWA 2JL1A 3BDAA 3ZWAA 2IE8A 2RKWA 1N6PA 1NM5A 2DR3A 2F4NA 2Y1LA 5FADA 1H1LA 2JIQA 4M22A 5IBCA 2C4WA 1OGYA 2FPPB 2VYFA 4E13A 5LP6F 4LF6B 4ZFNA 4IIEA 3TSYA 2G0TA 5AVKA 4EG4A 3AR8A 3EW7A 1H65A 3A06A 2VPQA 3DO6A 1OA1A 4PRLA 3ZHQA 1VPVA 3NBFA 3OQIB 4I4CA 4DWWA 2WMYA 4BNDB 4FCTA 2Q4RA 1WWKA 2Z5FA 4JI2B 4P3KA 1UDWA 5E4TA 3REFA 3FGZA 5IMSA 3RM3A 5HQ3B 4J07A 3WLAA 3EA4A 2ZWMA 1LA2A 2HNBA 4EEXA 1I14A 5E8JA 3WIDA 3HMQA 3L8EA 1SBQA 1F8UA 1KZ9A 1AGXA 4XEHA 2ZWIA 5BN5B 2UYYA 1RBQA 3VR4H 4AMUA 1KFBB 1ZD3A 2VPYA 4HAVA 5BVHA 2BFDA 2ZAYA 7ADHA 4MNTA 2O1EA 3OC0A 5HIJA 1JXMA 2O0JA 2V7BA 4F8JA 4YJKA 2R97A 2IYOA 3PA8A 1Y5MA 2VSYA 1FMLA 3H87A 1J33A 3NRJA 4N49A 4ONEA 3T9BA 2PYIA 3ROGA 3TW6A 4JFRA 1KWKA 1S3GA 1QTIA 4M0PA 4TTPA 3LA6A 3DNPA 3C5WP 3SPXA 4PG4A 4RMIA 4K9QA 3KZNA 1MZVA 2VNIA 3SXPA 3K0CA 1XLTA 3QKIA 1UFVA 3T06B 3RFFA 1PFWA 4AJ2A 4DWOA 1C1DA 4QFCA 4NYMQ 3QXXA 3UW1A 5J4HA 4W5TA 2JBAB 1IZ9A 3JAKB 3TDNA 3TQSA 2A1UB 1MXHA 1JEQA 1TVEA 3LECA 4LDNA 3DHYA 4CKXA 5LMNB 3GFSA 1M8JA 3IHWA 1V71A 5L3SA 3HU5A 2JAXA 4PV7A 2C2HA 4LJ6A 3KXDA 4FINA 3BJMA 1J1ZA 1WD5A 1W6UA 1XZPA 3PDUA 1M9NA 4TRRA 3CTMA 3R5SA 4AM8A 3W04A 3DF9A 5HR5A 3UV6A 5IJ0A 5AXDA 1XZBA 3BXXA 1JXOA 1CX9B 3PD1A 4PAQA 2O4CA 2FLWA 2I6GA 2P9QA 3GAFA 4FLMA 4GPIB 2QUZA 1OKKA 1NQOA 2WZQA 3BPSA 4E14A 3IEVA 1CVLA 1Y6FA 3FUWA 2VXBA 1H1LB 4RENA 4FMBB 1BXZA 3E81A 3AUKA 1D0SA 3E58A 3QVTA 2W2KA 4K9NA 2C07A 1QB8A 3LCRA 2D7CA 2WSBA 2ZS7A 1WSWA 2R96A 4G63A 4W5JA 4YAJA 5ITSA 1T5LA 1NG9A 2W9XA 3DP9A 4WJKB 2BFCA 1WTCA 2J9ZB 3BKXA 4WASA 1FRZA 4YMSA 2QM7A 4RMGA 2XZTA 3GLGA 2WVHA 4KK3A 1L1QA 1SVMA 3DDZX 2FB9A 4ENRA 1UKZA 1DJMA 4MGEA 2DFNA 3K20A 4GRIA 4WVFA 5JAPA 4Q01A 3R8XA 4DWVA 2A94A 1SBHA 3IUMA 5BVHB 2X14A 3DW3X 2BFDB 4HZGA 1V96A 2YWJA 3P97A 2GEFA 4BVKA 1ISPA 4OHWA 3OJLA 2FUNB 4WLFA 521PA 2RK4A 4HGQA 1TFRA 2VDLB 3W79A 5JI3E 5DTIA 1EIWA 1JDZA 2E4YA 2BV3A 4AECA 5CHYA 3L01A 3GJSA 2FEMA 1XCOA 1N7IA 1C1DB 2PBZA 4Y1RA 4TZ0A 4FOLA 2XT6A 5AXCA 2G36A 4LHWA 3QLUA 3W1VA 1E2BA 1JEQB 3QLVA 1XI2A 1JR3A 2A8YA 2DCMA 2XE6A 3TXAA 5AHRA 1U3VA 2J07A 3WSTA 4XSGA 1U4NA 4ZV9A 5MFZA 4XX1A 2Z98A 1LW6E 3H4MA 4G6ZA 1Q3KA 2E4AA 1HO3A 3AM4A 4QOSA 1V5FA 4WLNA 5DBIA 4AULA 1EM6A 2PUVA 4J0IA 4TM8A 4TWRA 4CIXA 1TRHA 1P9LA 4L4XA 3LTNC 2FSVC 3LHSA 4JDPA 4NS1A 2E4ZA 4X8LA 4DV2B 1W94A 4I9UA 2QUJA 2L69A 3HBNA 4LPKA 4UVIA 4YCLA 2IWHA 5KUTA 2NUPA 5DGDA 1MW8X 4JVNA 3ZV3A 3EUEA 3OHMA 4NCBA 3MFQA 1DEHA 2W2KB 1KJIA 5DYWA 2G4CA 5EJ5A 2JEZA 3VR6D 3I0MA 4OP3A 1LVHA 1U8YA 1XZCA 4D6PA 3OCWA 5HCNA 4XLZA 5EHZA 2BFCB 3IV7A 1F9EA 3B1XA 1QHIA 3IYLW 3AF1A 1GLNA 1M6VA 2W6QA 1EAMA 3UJCA 3GLGB 3G89A 4M1MA 2PQ2A 3CFYA 2XKBA 3UO8B 2BEVA 1U1GA 4KEAA 3TBKA 3LLCA 4AD8A 1K6XA 1INLA 3E9CA 4QWMA 5EC8A 4ZVMA 3T3EA 5I4BA 3PYXA 5IC4A 1WM1A 2RFLA 2X1HA 3MTBA 4NE9A 2QU7A 3HY4A 2ETVA 2IYNA 3C3CA 3QEMA 3RI3A 4B3BA 1RU3A 2O7RA 5BSVA 4X1OA 2EP5A 4RDXA 1QP7A 3TTSA 4YQEA 3R3UA 3CYFA 4BFCA 1W29A 1T35A 1Q21A 4IJKA 4F3KA 1KP2A 5EE1A 4Y1RB 2NWQA 2VDQB 4F9GA 1GPLA 3M1AA 4IDGA 5ICSA 2B1GA 3PJRA 1G2IA 3BD9A 3I83A 4OLBA 1RWOA 3DCNA 2OMKA 3OQNA 1SZDA 1AZSC 4IJQA 3UG7A 5HUJA 1Z74A 3IP5A 2QUIA 1ZDMA 4JB2A 3P5BA 4XWKA 1JPUA 1R50A 1PU2A 3ZTYA 1RJEA 3ZI7A 1RM5A 1E63A 2UAGA 3ABIA 4LY3A 2QR3A 4YUXA 1E7QA 1W88A 2X58A 4KR7A 1SKAA 3A04A 3B8EA 3UT0A 4OMDA 1SUSA 1W34A 2J6BA 2WLSA 4MB0A 1KL7A 2CL6X 4JBIA 5DHPA 3BMCA 2F48A 4UOEA 3L41A 1OAOA 3LCUA 4KDRA 3GDFA 2H1WA 5AXBA 3TMKA 1AZTA 2NUPB 4EK9A 4ITUA 3OWHA 1IIRA 4B35A 3AHIA 4Y2TA 5AVSA 4ND3A 3DAGA 2FPXA 1E2FA 1I7PA 4A6EA 2MYTA 1O77A 5ALMA 1D6JA 1ZH6A 1VLHA 1N5KA 1X14A 4H7PA 2UUPA 4HAOA 5H70A 1LXCA 3BF8A 1IE3A 2GZRA 2AN5A 1U2DC 2NSJA 4LHVA 4MRVA 3SYNA 1ODTC 3AWDA 2R25B 1BRMA 3BGOS 1GQQA 3CCFA 4A0FA 4AK9A 1CUAA 5IX8A 2EDCA 3RHSA 4S0ZA 3NM5A 4RSMA 1M6VB 5EIXA 4TUYF 1E3DA 3B1FA 1KPIA 4NE7A 4R5MA 1KK2A 4OQLA 1A9ZA 2BEVB 4NFYA 4FQ5A 4GZMA 3LPDA 2ZKLA 4C4YA 3SQDA 2VNHA 3CBGA 3CBQA 4DR3B 3URMA 4QAJA 2HIGA 4J4BA 5LC1A 3QJYA 3FX2A 3IJ5A 3JAWA 2QXYA 4RHXA 4WN9A 1V3TA 4OFWA 4LSMA 4BASA 1NBMD 1YS9A 2B25A 3QEMB 5KSZA 5KSWB 1YRQA 2J0EA 3BWEA 3EVZA 3MT0A 5IHXA 1M2OA 3VUEA 4CM3A 4FM9A 4BFSA 4L4UA 3WB1A 3H9GA 1ZM2A 2EBWA 2QN1A 3FTDA 5TT0A 4GEKA 1GGJA 3O1JC 3B3FA 1J2EA 2GOYA 1ZK2A 1SIWA 3DE3X 5AW9A 4DR5B 4H6XA 5B57C 5A3JA 1NONA 3K72B 2QD2A 4P32A 1CR0A 4Q4AA 6NULA 4BFWA 4TTTS 4QX6A 1OZGA 2QLMA 3F46A 2Q0XA 1EJ2A 1E62A 4QDOA 2GHQA 3HJAA 1G98A 2HA3A 3A1SA 3TQFA 4C07A 2PUAA 1O5TA 2Z2KA 3LNCA 5ELLA 1W88B 2I33A 2ZSKA 1DIGA 3M4YA 1DIBA 4UTNA 2AIRA 2R60A 2X7JA 3GA7A 1J0EA 4QXQA 3TNJA 1AKUA 3BMCB 4IOLA 4EPYA 4L76A 3SBXA 3ZDXB 1ADFA 1AV7A 1KP9A 1IXZA 2XSZA 2H2FA 4JP1A 4E3ZA 1KDPA 3MERA 4LAFA 3BBPA 4B7UA 1ENYA 2GPSA 2AJCA 3TD9A 4DCSA 3EPLA 4RW0A 4MVWA 1RTKA 3HYTA 2D0DA 1NDUA 3RAFC 2QJWA 2X4GA 1XJ5A 4G1UC 4HQ6A 5C1PA 3OBIA 3KXIA 1FXSA 3JQ8A 3LC0A 1L7BA 2HBYA 2ZYHA 3H83A 4MJXA 5DN9A 3IHLA 4PC2A 3ZE8A 5KTKA 1NYQA 1CF9A 3PRKE 3EZNA 3CWQA 3GGPA 3JZFA 1WSDA 4O59O 5K6AC 2MR5A 4FFSA 5AK5A 2CC2A 2ZJFA 4NBUA 5E3HA 1E0JA 1CW2B 3CSUA 2A88A 3OMXA 2VXCA 4IRUB 1SMKA 1YVDA 3MGBA 4G65A 1M3SA 2H1FA 2VP4A 2DOKA 2WWXA 4XGRA 1Z0DA 5E1OA 5HEKA 1NN3A 4RA6A 3NVDA 5DHTA 1QR6A 4EECA 1GUAA 2ZBRA 3O03A 1U3UA 2BC9A 4OQ4A 3L4KA 5HKOA 1IOVA 1FSFA 3TFOA 3LHKA 1RZ3A 4WN9B 3CGGA 4K26A 3KEMA 5FEUA 4OG2A 4PPGA 4B3MB 4E5NA 1RAEA 1S89A 5BWNA 1U0EA 2BZSA 3EIEA 2Z5LA 4DS3A 1KOGA 2NO1A 3KKKA 3OZXA 1R9NA 3FPBA 3RVKA 4KR2A 2EATA 1M2OB 5G1OA 3AKYA 1LLFA 4MCIA 4WUVA 1OQAA 4XQ9A 5E2IA 3WIEA 1SVNA 4W9NA 2NZ8A 1XF1A 3PFNA 3P52A 3PKJA 4E51A 1A7AA 2WJ6A 5K6AA 2A30A 1RI2A 2P11A 3B82A 1KZHA 4D6YA 1YA6A 2IHBA 4OJMX 3IBFA 3HP1A 5EXEA 1E20A 1DADA 1DRWA 4WLVA 4Q4AB 4BE9A 1A9SA 1OC4A 2BFEA 1QO7A 1JXQA 1W2HA 1TOAA 3D59A 1Q83A 4IHAA 3GUHA 4QGFA 3ZY2A 3PDIA 8ATCA 2ZR7A 4H1HA 4PLFA 1DC8A 3D7KA 1G9TA 3GGSA 2NO0A 1HL3A 1PTJA 1ZC3A 3W9BA 4EMBA 5C1OA 2IXGA 3JYHA 1SELA 3H0CA 4OYRA 5EJ8A 4QG7A 2REBA 4W4TA 2ZYWX 4QO7A 5D3QA 4NC9A 3MLEA 4UNSA 2ENUA 2B8NA 4G84A 4TT8A 4X7BA 1NJFA 5IP5A 4Z99A 2J4FA 1VMEA 3PFCA 3AHCA 4WECA 4H6PA 5TQ0A 1CUCA 2M6LA 3VPHA 3D0OA 1BS9A 1F9AA 3JQ8B 4IDCA 4AKTA 1R8QA 3MCZA 4XJTA 1WZIA 3KR0A 1CQJA 2ZRLA 4OGLA 2QN9A 4P4LA 1MX3A 2JGKA 5H82A 2QRHA 5KNBA 4XM1A 3JXEA 3HB7A 2V58A 2ZZMA 2XD9A 1AA9A 3HCPA 4Z3DA 2ZPTX 4DM3A 3CLRD 3ZJTA 2ORIA 2XCUA 1UUFA 2AZTA 1DOAA 3L4EA 4ILKA 3ZTWA 3SYTA 1VYTA 4RA6B 4EUFA 2UUCB 5I7WA 4Z0HO 4A8JA 2KI5A 2O7VA 4AXBA 4Y2GA 1ABEA 4YJ3F 1O94A 1DMSA 4ZQHA 3G0HA 1XEFA 1TYBE 1ZSVA 1NQVA 2Z8YM 4RLSA 4TLAA 5J2UA 3U60B 2F8TA 1FPQA 4FDUA 3JTEA 2OFXA 1RZRD 2WWGA 4Q24A 4XH9B 2NVWA 2AYYA 4V3CA 4K81B 2WM9B 2H1IA 1D09A 4UMEA 2HXGA 5KYVA 8ADHA 3FIUA 2CNNA 4RVUA 1M5UA 4JIMA 3I34X 4C76A 3G5AA 1A1SA 1SIBE 1YC2A 3C45A 3I9OA 1OI3A 2ZE5A 4CMEA 1C7QA 2ZPUA 3AR4A 1DIHA 1L4UA 3ODPA 3I01M 3WA7A 3TLGA 2G0AA 4QECA 1ZMXA 2BFEB 3OPYI 1MIHA 3ELWA 4OAOA 3T5DA 3PPIA 2F55A 1G60A 2HDHA 3ABOB 2QVLA 2Q2NA 3E9QA 1V8PA 4ID9A 4P36A 4OF4A 1ZNXA 1ULUA 3PDIB 1MEJA 5ER6A 4KQWA 3I61A 2QL7A 3PCXA 1WXHA 4HADA 1RAFA 1TIPA 2EF1A 4LJ5A 2P0EA 1UJ5A 1VSQA 1WSAA 4P54A 1U0TA 1RS0A 2QL9A 1EGQA 4E5VA 4DDTA 3FDXA 1YU6A 3GVIA 1DQNA 1SC9A 1WCWA 4LXHA 4RK6A 3USCS 4EGSA 3KQSA 2YOGA 4MRMA 1Z88A 4IXTA 3V9AA 4CIBA 3PKZA 2F1HA 2IDMA 3EGIA 3NKFA 1NVAA 4LNHA 5TQ0B 3RU7A 4ZI3A 3ZDAA 2QW1A 3ISJA 4NG5A 3AMVA 2JGFA 4LN1A 3GT7A 2IF0A 3ITNA 4HDRA 3WK9A 4IX1A</