2QXYA

Crystal structure of a response regulator from thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
LTPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDVFEGEESLNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a response regulator from Thermotoga maritima.
rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response regulator
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxyA00
3H5IA 2IPLA 3ROFA 5KQGA 2Q5CA 4XASA 3ILYA 5FWXA 4XARA 3UK0A 3H5WA 3H6GA 1K66A 5FBKA 2L18A 4NCAA 1A2OA 3EGCA 1W25A 1SRRA 2E4XA 4IMJB 4EVRA 2PUGA 3RVSA 3IP9A 4FE4A 5FBHA 3OQOA 3N53A 4WUTA 5IUNC 1H9CA 2R4QA 5IC5A 4D6XA 1EWKA 1JHZA 1KGSA 4EVQA 4MQEB 1JL3A 4Z4HA 3H1GA 1JF8A 1E6LA 3CG4A 1RXEA 3SM9A 4JAVC 4N76A 3HXMA 4L85A 4FB4A 1VKRA 4KQ9A 4MR9A 5EWMB 4TLLB 1TM2A 4JB2A 4XFKA 3GT7A 4OBBA 1XHFA 4L4UA 3KCNA 4MGEA 3A3KA 2MYTA 4QYMA 1DBQA 3C3WA 1ZITA 4UHJA 3W9SA 1AB5A 2QV0A 3Q7SA 1D1QA 2JCGA 3OLVA 4RV5A 2V0NA 1DRJA 3IP6A 4P1ZA 3KHTA 3QLVC 2VUIB 5HSGA 4YV7A 1TLFA 3OO0A 3RH0A 1WETA 5TE9A 4MLCA 1MB0A 4H3HB 3QEKA 2PUEA 3D02A 4D74A 3M9WA 2IPAB 2FEKA 5ABPA 3DGEC 2FMIA 2QU7A 4F12A 1OXBB 1NXTA 3E3MA 4LZLA 1U2QA 4N47A 3OM1A 1L5ZA 3O21A 4QYWA 3CZ5A 2B4AA 3Q7TA 2YHBA 4RXUA 5EWJB 1Z18A 1XHEA 1E6MA 2NZVG 4H3KB 3H5VA 3F7NA 3QEMA 5IUKC 1BDHA 3F6CA 4OLAA 1YMUA 4Q6WA 5IULC 1PEYA 4Z0NA 2RJOA 2WJAA 2IOYA 5EWLB 1AB6A 3FFWA 4LE2A 4Z4EA 1JFVA 4KK3A 3LFTA 4OLBA 1JBEA 4G0ZA 1DCMA 1P2FA 4ETIA 2PUFA 4Z9AA 1P6QA 3F73A 1Z26A 2NZUG 3IPAA 5FWYB 4CBVA 1EAYA 5KWSA 4NICA 3S99A 3HZHA 2FTKE 4EGSA 6CHYA 5TQ2A 4W5OA 4G0XA 1D1PA 1QMPA 1Z2EA 1QQBA 4RS3A 3BRQA 4W5QA 1USGA 3HUTA 1ZN2A 5BR1A 4NCBA 2WMYA 1NXWA 4EYOA 3A10A 1U2PA 2L19A 4MAAA 4F8JA 1M5UA 3FFXA 2FXIA 2FQWA 2FMHA 3MA0A 3MIZA 4QICA 4WXEA 4PEVA 1PHRA 1Z17A 2P4UA 3QELB 5TQ2B 2R48A 4MS3A 4Z4CA 3QX9A 1D4ZA 4G86A 3SQNA 2GKGA 1ZVVA 1SXIA 2QXYA 4KFCA 1DCFA 2LPMA 3HO1A 3EJWA 3LUJA 5EWJA 4JOQA 4YP9A 1YS6A 4D6YA 1JFSA 2FVYA 4G0MA 4RY8A 5DGCA 5HKOA 1ZAYA 4H60A 3HK2A 1EFAA 3HDVA 4ML3A 1E2BA 3I45A 1GUBA 2VYCA 2QR3A 1TMYA 2FQYA 5KC8A 1QQAA 4WWHA 1FFWA 4KV7A 3QX8A 3HUUA 4PYRA 2WJWA 1PEAA 2TMYA 3K4HA 4HYEA 2JVJA 3FDFA 2HSGA 5E3JA 1C4WA 2LP4Y 4WZZA 4IILA 3NHMA 2FMKA 2OENG 3TMYA 3CTPA 5B3JC 3QLTA 4N41A 1T34A 4WT7A 4Z4IA 4W5NA 5KI6A 1ISSA 4LX8A 4YLEA 5B3JA 3SAJA 3RQIA 5IEBA 3URMA 1NXOA 3LTEA 4GPAA 1NY5A 1PNRA 3O75A 1JLKA 4TLMB 5CNJA 4YO7A 4ZPJA 3BRSA 4RK1A 4XXHA 3RVMA 2RJNA 3C3MA 4G0YA 4IF4A 1QP4A 3BREA 3NBMA 4Y9TA 4N0QA 4ZMRA 1M2FA 5EWLA 1TJYA 3DGFC 4ZJPA 3FFTA 1YMVA 2IDMA 4MQFA 3OLWA 5IX8A 1GCGA 2E4UA 2IPMA 3HV2A 3EQZA 4PE5B 4JA2A 4IMIB 3Q41A 4NQRA 3JY6A 3KYIB 1NXXA 2PUCA 1USIA 2RGYA 1EWVA 3L49A 1EHCA 3QLVA 3GRCA 4LRQA 3KLNA 1SD5A 1EWTA 1MB3A 3C6QA 4MS4B 4RDCA 1SXGA 2E4VA 3CKMA 3CHYA 5CNIA 3HM9A 2QVCA 4ZMSA 5KQLA 1ZGGA 5CHYA 4YR7A 5T7BA 3HCWA 3H1EA 4EUKA 2M1ZA 2DRIA 3KS9A 5IBQA 2LIVA 3IP7A 1BVHA 1ZDMA 3RVRA 3CNBA 1DC7A 2A9QA 5HM6A 2KYRA 3QELA 2ID7A 1RXIA 1E6KA 2PJUA 1LJUA 3C3KA 1KRWA 4RY0A 3VNBA 1BDJA 2R47A 2PL9A 2JBAB 4PZ0A 4B09A 1NTRA 1PUXA 4F11A 4M88A 3CG0A 1P8AA 5C5CA 4MLDA 3O2SB 1LBHA 3EODA 5DTEA 4KREA 4LE1A 2JVKA 8ABPA 2IPNA 4OG2A 1VLZA 2NT4A 3LOPA 4RKQA 2W42A 3TD9A 2PUAA 1QNLA 2MSLA 2GI4A 3SNKA 4RSMA 4RY9A 2PE5A 3O2QB 3B2NA 4Z9BA 5JNSA 1PNTA 3UUGA 5JNWA 2GX6A 2PMCA 2CHEA 3KG2A 1YS7A 3A0UA 3OO1A 1BAPA 3IDOA 3O1JC 3RVKA 1ABFA 3BBLA 3GYBA 2A9PA 1Z25A 3RVLA 2CD7A 3H6HA 3NNSA 4WXMA 1M2EA 3Q9SA 1BA2A 1I3CA 4E7PA 2FN9A 1F51E 5DKFA 1DC8A 1FFGA 3EDCA 3LUHA 2QZJA 2FLKA 1JYFA 3KJXA 3EAFA 1ZESA 3MF4A 2MSKA 3O1HB 1JDNA 2HPHA 1DCKA 3D8UA 4O1IA 4EYQA 4EVSA 3EULA 5JS2A 4YGXB 2QVGA 1NXSA 2JK1A 1QP0A 2PLNA 4PICA 3RVOA 1YIOA 2GBPA 4MR7A 2BGGA 1FSPA 2PAFA 6ABPA 1W9HA 1MIHA 1YK0A 3CS3A 1J56A 3K9CA 3N6VA 1QP7A 1FFSA 3VNAA 4KNYA 2J48A 3H5TA 4XLTA 3KTOA 2HJ9A 3NNNA 4O1HA 4Q6BA 1U0SY 3M9XA 2FQXA 2P9HA 2FEPA 2ZWMA 3I42A 3JPWA 4MRMB 4RK7A 2MYNA 1VRVA 2OQRA 3DZDA 3HEBA 4MRMA 4NV3A 5IEJA 1HEYA 2WWVD 3F6PA 4XAQA 2JRLA 5JNRA 1DBPA 1K68A 5JNVA 3DBIA 1APBA 1KRXA 5I4CA 3OLXA 4G0QA 3I09A 1CHNA 4RU1A 5KC9A 3LKVA 3NHZA 1JH9A 3M6MD 1TVMA 3O1IC 3GBVA 5ED4A 1RZRD 4P98A 4Z99A 5TPZA 2E4ZA 4DQDA 3R0JA 1Z16A 3Q15C 3FMVA 4MS3B 2FLWA 1QPZA 1LBIA 2FSPA 1P6UA 3BILA 1DJMA 2YHAA 2O20A 5BRJA 4MR8A 2NT3A 2JBAA 4TMYA 2LBPA 3KYJB 3HSYA 3OMXA 1JYEA 4LE0A 1L5YA 4RK5A 4EYKA 1C0EA 2HQBA 3RVPA 4LDZA 4F3TA 4DN6A 2B1JA 5TQ0B 1GLGA 4MR8B 4MYRA 1RNLA 3UKJA 3LKBA 3OLZA 2L2QA 5F64A 3RVJA 3SY8A 1LK0A 1NXVA 4EYGA 3MYYA 4JB0A 1VPWA 1DZ3A 4F06A 3KSMA 2FN8A 1KMIY 3LUCA 1ZGZA 4IRXA 4OATA 5CNMA 3LUAA 4RK6A 3JPYA 4EY3A 4MR7B 2F8TA 2E4WA 4N03A 2QW1A 2VK2A 3SG0A 2FKAA 1D2AA 3FGZA 3KLOA 4RXTA 5HQJA 4GNRA 5T3YA 5TPWB 4KRFA 1M5TA 3CLKA 3RVNA 1URPA 3A0RB 3L6UA 3G85A 3JTEA 5DLEA 5BQ3A 4RKRA 1R8JA 3ROTA 1RPJA 5BRAA 1FQWA 2A9RA 2HQRA 2PKXA 4RZSA 2GWRA 1ABEA 1LJLA 1QO0D 3GV0A 4OTZA 4Q7EA 5JS1A 3LUDA 3GL9A 2AYXA 1CEYA 1DBWA 3OQMA 3T95A 4Z4FA 4MQEA 2FEWB 4LDAA 1Z13A 1ZY2A 3C97A 2MYPA 3OMWA 3IPCA 4W5RA 2HQOA 5GQSA 4YRZA 3QK7A 3CZCA 1MVOA 2ID9A 2CHFA 2JB9A 2CWDA 4G97A 4MS4A 4JP1A 2N9UA 5JNTA 4G0PA 4S04A 4MQFB 2JVIA 4TN5A 3MMNA 5TQ0A 4W5TA 4O5AA 2NUBA 3H5LA 2QSJA 1Z15A 2H3HA 1ZH4A 2M98A 1U04A 1DRKA 2PUDA 3ILHA 3T8YA 2L17A 1YK1A 3GWGA 4ZYLA 4KPYA 1XWWA 3P9YA 3Q7RA 3G1WA 2WB4A 1F4VA 3TX6A 2VUHB 3QLUC 1JFTA 4KK4A 1ISRA 4QPJC 1GUDA 5DCLA 5KQMA 3DLBA 4KVFA 4MPTA 4DADA 3JVDA 3LUFA 2E4YA 1BDIA 3KKEA 2IYNA 7ABPA 5GOTA 4RK0A 4Z4GA 2FMFA 3QEMB 3EQ2A 1UDRA 2ZAYA 3JS5A 3MM4A 1NATA 1NXPA 4MS1A 4S05A 3N8IA 3GBPA 1QO0A 2AYZA 3N0WA 5JNUA 2H0AA 2MYUA 3N0RA 4HNRA 1USKA 4HNSA 1OXKB 4N0PA 4KMRA 1S8NA 3CRNA 1IIBA 3OQNA 1YTUA 4FE7A 2WY2D 3OLYA 1CYEA 3GA5A 3H75A 3HJFA 3LMKA 2I6FA 3O2JA 3QLUA 4YCSA 2PUBA 4KZKA 2F8SA 5KQPA 3MQ4A 4ETMA 5FWYA 1Z2DA 3T38A 4MR9B 5EWMA 5PNTA 5TPZD 1ZH2A 3RVQA 4G0OA 1DP4A 1B00A 2MSWA 2LUOA 4RK4A 4RWEA 3HVRA 4HNQA 1Z12A 1A0OA 3OM0A 3TO5A 3N75A 5TPWA 5TQJA 4IGAA 5D2CA 3LUGA 2R25B 2FW0A 9ABPA 4YS6A 3CU5A 3NNDA 2RDMA 2XDYA 3H5OA 4E7OA 1JWLA 3LUKA 4MS1B 3HS3A 3IP5A 1SXHA 1A04A 1MAVA 1DG9A 1ZHHA 3T6KA 1D5WA 2X7XA 4RXMA 3TB6A 3H1FA 3E61A 3I5AA 4UHKA 4YWHA 5FWXB 4ETNA 3JVIA 2IKSA 1Y1LA 5IUJC 3N0XA 5CNKA 1RZRA 1JDPA 3O74A 3DLHA 1YVUA 1JX6A 1U8TA 4KQCA 2PL1A 2WRZA 3HDGA 1GCAA 3CFYA 4JASB 2A9OA 1QKKA 5C5EA
chains in the Genus database with same CATH superfamily
2BJHA 1IBKB 1VCHA 1L6IA 2VHXA 4WA7A 4NESA 4B48A 4G26A 1FNNA 1F4LA 4UXIA 2PL5A 3EZLA 3GYGA 5JC1A 3GQBA 1BDBA 2Z1NA 3QM1A 2C4HA 1SRRA 3FGOA 4TXHA 3V1NA 4DT1B 4Q3KA 2TMKA 4QIHA 4FQ7A 3KQPA 3I6IA 1TZKA 4RFSA 2CCJA 5I9LA 3BD8A 3PXEA 4GLBA 5AJTA 1IBLB 2HYDA 4IHJB 1G3MA 2CK3A 1KGSA 3CURA 3VR3A 1DFGA 5FLXA 4JI4B 2CXUA 1Q0SA 1DIAA 3PGXA 3CG4A 1UKVY 3VAAA 5JQGA 1ZI6A 2ACWA 2JFGA 3CM0A 4Y0NA 4PLFA 2WZDA 5JD5A 2A5DA 5ALKA 3FOZA 4JBYA 2VXCA 2A0XA 2QX6A 3PBKA 1IBRA 2CUZA 2P9CA 2Q9AA 1U1DA 4AQ7A 3EOZA 4F72A 2YUIA 4TMVA 5JCOA 2MSNA 4AP9A 5F23A 1YB7A 1GFIA 5A5GA 1P8JA 4AMYA 3G7NA 2VP5A 3RQSA 5B7QA 2VDRB 4OQMA 3RDPA 2FY8A 5JBQA 4BDSA 3PXGA 1ZH8A 2J6CA 2JHGA 3AR4A 3D4PA 1G5PA 5A4IS 1LSUA 5A9SB 3H8WA 3RS4A 3OHMA 1NYTA 3HDJA 4ARUA 1KAMA 3L4BC 5CCBA 1TCCA 2X7JA 1ZWKA 1BX0A 4OHFA 5EUBA 1BN7A 2VA8A 1J8YF 5JU6A 2JFFA 4LXIA 2C84A 3UUWA 2COUA 1GUAA 4KYVA 2ERCA 2X2FA 4JUDX 4K87A 2YYAA 1KIMA 2Z4RA 4XJXA 2E49A 3N6XA 5HIKA 3O47A 1KK3A 2H31A 1P4AA 3PT9A 4K9MA 4LZLA 2PQ6A 2WJHA 5B1HA 3WLJA 1UM8A 2AEFA 2XB9A 3A31A 2Q3HA 3I23A 5T64A 3N07A 5G40A 3WYBA 3ZW9A 5K6TA 1OWMA 3K9FC 3I6YA 3ZWXA 4NMMA 1XVVA 3ICVA 3U4HA 3ZV5A 2BP7A 4QQNA 5F3DA 4DSAA 5GJBA 2D6FA 4CKZA 1TJPB 3MUFA 4X20B 4BO1A 1N3LA 1PDOA 4V1CI 1A9RA 1OASA 3IH5A 5CIYA 4ENQA 1KHTA 3D8RA 2WJAA 3L93A 3H19A 4Z4EA 3C4VA 4KFSA 3I37X 1JSCA 1NLFA 1YVDA 2D13A 3HFJA 2ISSD 1L5NA 5HRCA 1ZL2A 1GL3A 3BMXA 3FI9A 3T9EA 1PFQA 1ZK4A 5I9SA 1AMOA 2PUFA 2X40A 4PGAA 4UPVA 3ZBQA 621PA 2PMBA 4D46A 4WGFA 4CBVA 2WTBA 1EAYA 4ECEA 4HWTA 5D7BA 3ZKAA 2CXQA 4ZI7F 1P9WA 1EU1A 2ZBQA 3U5ZB 3QE2A 2WJ6A 4DLBA 3ESRA 1MORA 1RWWA 1NUPA 1IUOA 2B25A 3I32A 1N4AA 1E2HA 1QUEA 3H2GA 3R6LA 1U0EA 3ZCXA 1J0BA 2WU1A 1F20A 2O2JA 3UMGA 2D1YA 1HDCA 1DWUA 1SHJA 3D7LA 3EPLA 4CV0A 4O02B 3KZXA 1M5UA 3D4NA 3KR2A 5EXTA 2Q5FA 5E6UA 3AF4A 4NECA 5F5LA 3ACCA 1D2NA 3WB9A 1C30B 2VH1A 2NLOA 2BFPA 4KOAA 3I6QA 4BMSA 5B6JA 3L4EA 2HJGA 2P5TB 1P3JA 5EJ4A 2IHZA 1YVRA 3V8BA 1L1RA 1DOHA 1D1SA 4ZJZA 1JQDA 2ZANA 1E2MA 1AZLA 1MA3A 1ZN7A 1PUIA 2GRUA 4PWYA 1ZIPA 3LWZA 4UCQA 2ZIGA 3ZJYA 5B64A 4GM4A 5JBIA 3OX4A 1RKQA 2BEJA 3OY2A 2GERA 3S0JA 3O8RA 2QVYX 3SR3A 3U6BA 2F1HA 1VQ1A 2C3UA 3NWOA 3B9QA 4RPIA 1KEVA 2FSSA 2DP4E 2HJHA 2XEDA 4Q3DA 3HJRA 4QO8A 4WZZA 3RS7A 1WMBA 4BQPA 3RODA 3K0CA 4GPEA 3B9PA 1H2HA 2BSXA 2XXAA 4YLEA 4EFLA 1BDMA 3OPYB 3FJOA 4HAUA 2Y77A 1QYDA 5AHOA 3FB4A 2ZQZA 6YASA 4FXPA 4DLTA 1RCUA 3JZDA 5HA5A 4L5CA 5SZJA 5HE8A 1QGOA 1CX9B 4K9DA 3BRSA 4DV4B 2UZIR 1K92A 3LFUA 2B3DA 1QG0A 1W4BA 3X1KA 1FFHA 1W1WA 5JJCA 5EHQA 2AFVA 3EA4A 1EXWA 2XWPA 5FPHA 3PGLA 3NEPX 3QY0A 4ZOBA 3FYUC 1SUPA 1T4MA 4H17A 5ALQA 1H5NA 4LA4A 4ZAFA 2FWBA 2WA1A 4HVAA 5B1YA 3SBOA 1JV2B 1LNZA 2VYVA 2JGMA 3FH0A 4IUBS 4JROA 4OIMA 2AVNA 1GG2A 3K0EA 5JSHA 2W83A 3S40A 2JLWA 1VKNA 4RF4A 1AZWA 3I0ZA 3KYDA 4K8RB 1B41A 5TNXA 2D0IA 4JT2A 3RT1A 3DFMA 1DI0A 1PJ3A 1PR5A 2X8AA 4QGGA 2QI9F 4Y2VA 5CX1A 3DONA 4RDCA 2QM8A 1OXMA 1NVBA 2BGTA 4CWAA 3V1TC 4GPTA 4P82A 1JKIA 3NTVA 4EB8A 4QNNA 2PZGA 1KDPA 5CTAA 1AQIA 3OJLA 1D7OA 3B36A 4W7SA 4UTRA 4E1AA 1BJTA 3OE4A 2AFHA 1AZSC 3DAHA 1SZPA 3SOPA 1R0RE 1VDZA 2A9QA 2RHCA 5JADA 2XX3A 2DTXA 1E6KA 1H1LB 2PJUA 1NN0A 2QM3A 3BHIA 3PHHA 5E9JA 3TMKA 3Q9NA 4AD8A 5FBWB 3NH6A 4LBZA 1I33A 3OPXA 4ZOLF 5AVKA 3PX2A 1J90A 1FRFS 3U37A 4BO7A 4IDCA 1KKUA 5T8KC 4KUEA 2JFVA 3V32A 5KWEA 1XL0A 1YHZA 2QLJA 2WVHA 2DE0X 3PL1A 5DM70 1W2HA 4OJQA 2NACA 3BULA 2XRFA 2KSQA 3MILA 5DH9A 3QBTA 3RJMA 4OB6A 4M49A 1QVVA 1RM4A 3GMIA 3BDIA 3RSLA 2PMCA 3IQIX 4X1YB 1XL1A 2GEUA 5JSUA 1ZJ4A 1TI7A 1HQYE 1T6NA 1ZK0A 2F3TA 2ZT6A 1SHUX 3GYBA 2QMYA 1DT5A 2VZ8A 4EL5A 2PIDA 4JCOA 1LX6A 4C3OB 2CD7A 3WNDA 1HI9A 5LPNA 3PEWA 5L3RA 2AZTA 4PLZA 2IY8A 1ECCA 4PG7A 3VTKA 5LKAA 3FUUA 4TTQA 3TNYA 1ZM2A 2XE7A 5A03A 1ECPA 3KPVA 3O3CA 4EPWA 3LO8A 3AUAA 1XYGA 3PQ3A 1Z5PA 3WNVA 2YQ5A 1UJBA 1O94C 3MF4A 3MGGA 4C21A 1F6BA 1NRJB 2YZ7A 1CERA 4FJ2A 1MJFA 4UAVA 3H2BA 5DP2A 4LF5B 4XDHA 2WTNA 1BE1A 2RHLA 1DRVA 4KOEC 2ONJA 1WSAA 3NM5A 3PNLA 4O4HF 1UP6A 3AYXB 4MR7A 1Y8RB 4B4DA 3ASYA 4U2GA 4KLCA 2IE8A 4Y0VA 3OM8A 1EHYA 1HEUA 2YW9A 4M1EA 3M6FA 3WA6A 3R3HA 3H5TA 1IWBB 3OT4A 2HJ9A 2BWJA 2VTDA 4URZR 4NX2A 5FFMA 3WQBA 2PT9A 5FO0A 1T13A 4AIRA 5KJ6A 1U3UA 2ZSEA 4D43A 5CDGA 3PU6A 2JIMA 4FNOA 2EV9A 4XPIA 5IJ9B 1HNZB 5I47A 4LNUB 1SOUA 4BAZA 4A03A 2NU8A 4B44A 5B1DA 1APBA 2MMGA 4JU8A 5AM0A 1A1SA 3V4SA 1SU4A 1NPTO 1U8EA 2XNDD 1CHNA 5I4IA 3ZDBA 1T3ZA 3JZAA 4RU1A 1AS0A 2WKQA 3U7QB 4YJ3B 1B6RA 3L92A 2GK4A 2H57A 4RLFA 4I9NA 3A32A 3JQAB 1PGPA 1XPJA 3COYA 1CZRA 3L02A 4Z51A 1JMYA 3ZV3A 1ODIA 4IIJF 3CT4A 4Z1MA 1W30A 4P4NA 2NNLD 5LFAA 3WSVA 3ABIA 3KFXA 2W2PA 4YBZA 1XGKA 3KYJB 3OFKA 4HQ6A 4HYTA 4K9NA 3UPTA 3LIIA 2XNDA 1C9EA 3CIOA 2O8CA 5BURA 2G7MC 3R5JA 5DHAA 3R7WA 4B3GA 5L3SA 4JR1A 2YZNA 4I99A 1V16B 4DDKA 4YRIA 1G4AE 3DQPA 2DQKA 1NBAA 1GPNA 1L5SA 3QG1A 3F7TA 4A2QA 1H0KA 2R751 1HY3A 1RJEA 2DWPA 2CMKA 1R64A 4A6EA 4ZO8A 2HU7A 4EJSB 4C0JA 3WICA 3VRHA 1KARA 4JB0A 2O14A 1Y98A 1RBMA 2ZQYA 5KSOA 1A9PA 2Q29A 4QLBA 2IFTA 5F7OA 3SI7A 2ZI9A 3PDCA 3OIGA 3TBFA 1KEEA 3PNQA 1RJGA 4Y2XA 1AU9A 2P8JA 4E4YA 4E30A 2OPBA 2KI5A 4LNUA 2B1RA 2E1PA 4TSFA 3RBZA 2ZJ2A 1SG0A 4FMPA 4TS4A 3GGDA 2XW6A 1RM5A 3L3BA 4GSKA 2F6RA 5IU6A 1ZNXA 2PLRA 4BMVA 4GX1A 3W77A 1FRVA 3OKAA 3QMVA 3TFOA 1HC7A 4Y6LA 1UK7A 2O2ZA 3N6RA 3VVBA 4QM7A 5J4YA 4K6HA 2QN9A 1V5WA 3EUEA 1DQRA 3OZUA 1AQUA 1D0SA 1K9SA 3MWFA 5DNWA 1TL7C 2Z3VA 2IW1A 4FMDB 1DLJA 1SM4A 1NQVA 2P6UA 4LDAA 1YUBA 1EFVA 3SGLA 2ZU0C 1AC5A 2BFDA 2MDTA 4L74A 1WD5A 1ZMRA 5DTJA 5GQSA 1ZXXA 3IMCA 1KY4A 2GKOA 1RWVA 1K7YA 1NJSA 2BC9A 2K2WA 3DHWC 3O8BA 4Q3AA 2JEYA 4LXXA 1QRRA 4NAHA 1COWD 2O6LA 2VP6A 1Z6XA 3QWBA 5AM1A 3ZWQA 1XMQB 1HYBA 2HI0A 1DADA 2W6CX 3U60B 5C8XA 1IHDA 4YB8A 4QZVA 1YL6A 2GLUA 2IDKA 2Q0XA 1G66A 4NPHA 2VS1A 3RREA 1JJAA 3CR3C 3KFLA 1N5JA 4RZIA 4E94A 2HIAA 1FTQA 2VHUA 3D5EA 2HA3A 4RANA 1V37A 3W8EA 2R86A 1SURA 1XP8A 5AXCA 4DADA 3LUFA 4G36A 2E4YA 4RETA 3ZHYA 2KHZA 2OB2A 4EFMA 3GI1A 1Y1QA 2DJ5A 1RAHA 4GGMX 2GEDA 4I5FA 3KQOA 3ZGZA 4ZGBA 4WVLA 5IVKA 1QZ3A 4FFBA 1PN3A 4WCVA 4AK9A 3QEMB 2CJYA 1R6TA 1BMFA 4LJ4A 4N6OA 5ULLA 5D3MB 2IUEA 1NC3A 4L8GA 2A5GA 4B6PA 5DX1A 1J8VA 4E22A 4CF6A 1WF3A 4I2NA 4Z7OB 1ZMTA 1SBNE 2HZ7A 3V7NA 4A26A 1HNXB 5JSZA 3O7MA 1X1RA 1N6OA 3H3JA 4XR9A 5DSZA 1J2UA 3UW3A 1OXKB 4HN2A 3CRNA 1DMSA 1JHYA 1P2DA 3LHIA 5CXSA 5FV7A 4EZBA 2F9LA 2PUBA 4HDKB 2WHEA 3I04A 4MHOA 5BSVA 5F9HA 3VHLB 5HKAA 3MQ4A 1NUQA 3OQIB 4EEKA 2XUGA 3KV1A 3UJAA 1CEQA 5KOYA 1MJ5A 2P40A 2IBTA 1GNQA 2WYIA 4TVOA 3VO9A 4BNUA 1Y3DE 5HUQA 2VOJA 4FP9A 1G20E 4ZGWA 5TQJA 4IGAA 2C2HA 1GU7A 3CWQA 4I5GA 2ZI4A 5IN4A 1KFKB 5CYGA 1KZ9A 1YAHA 3F4LA 3QU9A 4Y7CA 1JTEA 4P0TA 3DV0B 4D57A 3LL4A 2MR5A 3ZD9A 4AURA 3M1LA 2C5SA 5EI5A 2Q1UA 3AUJB 1P60A 1N4DA 3IB6A 1EFKA 2I33A 5KREA 3B52X 2AN5A 4PFSA 5JWHA 5C7OO 3FDZA 1CZOA 2QMQA 3PI7A 1DWPA 2C03A 2C1ZA 4RIFA 4YJKA 3PJRA 3FM9A 2BFFB 3GLTA 1JDPA 2WYVA 4ESVA 5K7SA 3HFSA 4N12A 4E5KA 2NTNA 4PF1A 2HF9A 3CFYA 1AO0A 1VM6A 5J1TB 2LDBA 3H4MA 3D7NA 2PS0A 1W93A 1IJFA 3DKPA 3A70A 3WL4A 5E38A 2P9YA 2Q5CA 1C7FA 1N2CE 2JGDA 4M55A 3ZJVA 5CB4A 4Q7KA 1UBTS 2MJLA 1A2OA 3SE7A 3ZV6A 1U7TA 3NRJA 4FEEA 3BB3A 1KVQA 1QJ4A 5BWNA 1M5RA 3AWIA 4WAUA 4R98A 4OXRA 3NFRA 1OFIA 3N53A 2MTBA 3IQXA 3H8SA 3IB3A 4IIFA 4LDQA 5IC5A 2ZJAA 1G5HA 1L0BA 2C20A 3IQWA 2UYOA 3OOSA 1WXIA 4MKZA 1FUKA 3LXRA 4LZPA 4MQEB 2JHAA 3H1GA 4HCJA 4PQRA 5NLLA 1FP1D 1NL3A 1RXEA 1XRLA 2CLKB 1I3MA 4JLMA 1BWPA 4FD3A 3V48A 4JP8A 2H9AA 5ALDA 1DAOA 1Z8DA 2H4FA 1VL5A 2VLIA 4U7DA 1VKRA 3OJEA 2RKWA 2XCRB 3QBDA 1FFXA 5CXXA 4P0QB 4JB2A 1EZ1A 1S2OA 1W76A 4D82A 5AVSA 1FJ2A 1U2GC 3A3KA 3HB1A 1J4AA 1MQ9A 2V7UA 2HJWA 2PT7A 3GC6A 3PFIA 4BNFA 4BMZA 3BD9A 3P0FA 1E8MA 4P7JA 4G1UC 2A0UA 4NNPA 4CQLA 4DBZA 2B7BA 3W9SA 4WIAA 4TV9B 3KK0A 4Q18A 2ZSAA 4LCBA 4B47A 5KIAA 5CT5A 3EZ7A 1Z2OX 2P9QA 1E2GA 1AA6A 4WKCA 5DTRA 1EUCA 1HPLA 2D2FA 3FHJA 4P1ZA 5EG5A 1Z0UA 3OF2A 2G77B 3OJFA 4H4EA 1TLFA 2PUJA 1CR1A 3A4IA 4N0EA 3N39C 2FV8A 1O08A 1YR7A 2CYBA 3R6DA 4LSWA 4MGHA 3TOVA 4D2IA 5GONB 1Z2CA 2W9XA 3K05A 4RQAA 1T5HX 1Y5RA 3V4OA 4DARA 4UOEA 4YT2A 1SC6A 4JWTA 4C30A 4LGMA 1OXBB 2AOUB 2WWGA 4F5WA 3UCXA 2O5CA 1ST3A 2RH8A 1GQFA 4X44A 3WJ2A 2A94A 1NUTA 3QXGA 4MUEA 4P7KA 3O21A 1T9AA 3K0SA 4OSEA 2B4AA 1WU8A 1R0LA 1N6LA 3DMFA 2YHBA 5DBFA 5LQNA 2I22A 4CLOA 2AOXA 4RDXA 3LPMA 2PZBA 1AUQA 1SUSA 4R9UC 4TV8A 1Z22A 1QYRA 2VPXA 2NW6A 3LRPA 4OMFG 4FR2A 4MB2A 1YQTA 3GF4A 5LU8A 5DXAA 2ZWIA 3LVQE 4B4UA 4P4TA 1KQPA 2PA3A 1SOMA 4NJEA 1G8HA 4BQRA 2RJOA 4J0KA 2VZEA 2DWQA 1R7RA 3I92A 4OB8A 2V54A 4NE7A 2OV3A 3DMTC 4Y9DA 4ZI5A 1BJKA 1WUJS 1X7WA 2EGHA 3DC7A 2OXEA 3PNOA 4BLRA 2EBUA 5CFNA 1JQEA 1BMTA 4NK4A 1AIPA 4YLGA 4AKGA 4JENA 2H8GA 4HDMA 4M0CA 3KJFA 3WO1A 4KDFA 1EM8A 3BCHA 2F62A 4IIEA 4KSYA 2Q7OE 3FTEA 4K86A 2O2CA 2ZUVA 4JWKA 3S99A 1XUOA 4UTZA 4DMKA 4EGSA 3WNCA 1P4SA 1ZMXA 2PJRA 3MJFA 1U3WA 2CBGA 4CUZA 3LPLA 1PHPA 3K09A 3H4TA 2VT2A 4OHWA 1KU6A 3DJFA 2ECKA 5JJBA 5B37A 1O5TA 4MQBA 2ET6A 3D43A 3M8KA 1R0BA 1QGUA 4C0QC 1RXUA 2O7QA 3OLCX 3ZNPA 2ZJ7A 1M1NA 1YUMA 2XWQA 2FMHA 3QW2A 3D6FA 2IITA 1RI5A 2A7XA 3RSFA 4DR4B 3UMJA 2IPOA 2C58A 2QLBA 3D1JA 3L7AA 4CG2A 3KHKA 4KPGA 3QKIA 4FR0A 4BL5A 5I01A 2PVCA 3SVTA 4CGZA 1VKJA 4IEEA 3EJWA 4H3SA 3BXHA 2VATA 4LCEA 1UWKA 3SKYA 4LJ9A 2EJTA 3GJ3A 1L3CA 5BVGB 1NX6A 3I01A 3L0SA 1UDWA 1TZCA 4RLSA 5DTQA 1B23P 4CHTA 1UJCA 2HN9A 4H1TA 2HIHA 3UMBA 3UBTA 4WWHA 5G0UA 2GAAA 1Z63A 1U5AA 1XEFA 4Y2SA 4WKPA 2OCDA 4R16A 1MIOA 5GZ3A 3BERA 1H3NA 3JWEA 4HWGA 2O8EA 2Z2JA 1CV2A 2WFZA 3EVEA 4Y0AA 2V65A 3B6MA 4WT7A 2DHQA 1LI7A 1ISSA 2ZI5A 3ANXA 3QF4A 4G4GA 4OF4A 4UNPA 2VVTA 5D51S 1PNRA 4Q5IA 2Y1GA 1N8NA 3O75A 3QX7A 5H02A 4BXOB 1RXYA 4YO7A 3NJRA 4LBWA 1DIOB 1JPUA 2ENWA 2WKRA 4ALIA 1NR1A 1GPWB 3JQ7A 2QRVB 2N1BA 3PD7A 4HADA 5EUQB 4IIYA 4F1KA 1TW2A 2Z9CA 3PYMA 4N0QA 4NEGA 1BZYA 1VA5A 3A1SA 3AEXA 4PC1A 5DBIA 3ZCUA 4V1CB 4LAFA 4OHUA 1XCJA 4DIMA 1H0RA 5CA1B 3HVJA 5JAHA 3ANTA 1PYDA 3C5HA 3B1YA 3R3JA 1G6Q1 3WYEA 4DTCA 1A77A 4F93B 3Q41A 2QMEA 3JY6A 1K6IA 3DFUA 1XZ8A 1QCDA 3DV2A 4AS1A 1G1MA 2ENUA 4TT3A 2EYQA 4TXNA 2OV8A 2VDJA 2DUWA 1PWXA 4GDMA 1W49A 2C5GA 1CUJA 5A1JA 3EFOA 4UJ3A 3GJXC 4LNHA 3HYNA 1T0JB 2QYOA 4KQ6A 3KXKA 4J4TA 3RU9A 3AF5A 2X3YA 2R00A 2ZREA 2UZAA 1BHJA 2QAIA 1FFXB 5T7BA 3I34X 3WNQA 2Z2IA 2ZJ1A 2II6A 4WLEA 3ZU3A 5GGYA 3GEHA 2P5YA 3UENA 2E7ZA 3GVXA 2Z8XA 4QRDA 4W8OA 2XUOA 1MEEA 3VR6A 3NAZA 3G13A 4I9UA 4UUBA 4CCYB 2IHBA 5AM3A 1JW9B 2YVQA 1J99A 3DSRA 1ZXBA 2PKWA 3FNEA 5HCNA 4CDRA 3K8QA 4MQ4A 2DLCX 3M34A 4HK4A 4QYXA 1IG3A 2NAFA 3PPIA 2JVKA 2O3JA 2BMAA 2IPNA 1EGAA 2JJ1D 2QRKA 1XTVA 3DXYA 2WYHA 3LCMA 3O92A 4NSNA 4OUDB 3QKRB 5A9RA 3GZNA 3QKSA 5I4KA 1GP2A 1PTKA 2FZCA 1JB9A 2DHRA 2PV7A 2W90A 3B3QA 3PQ6A 2IF0A 4OJKA 4N0DA 1SMKA 1XJQA 2G88A 3CJQA 3KVYA 4FDMA 4QOEA 4XD7D 4TWJA 3UJ6A 3VMMA 2QE7D 4ZV4A 4KNWA 1FDTA 2I4RA 4HGPA 1KH3A 2QRMA 1VL0A 3GJ7A 3O8NA 4QVGA 4Y67A 2JNWA 4WX2B 8MHTA 3LDUA 4LFAB 3BGOS 1H2WA 3NYWA 5C2JB 2W43A 1YRAA 1X87A 1EMDA 2BTOA 2CHGA 2X7HA 3P26A 2BONA 1M6HA 3GUZA 4PLYA 1RM3A 5T8KA 3ZWBA 5GZ1A 4HWRA 1ZVQA 4QUIA 5BMVF 1QCYA 4MWEA 5EOVA 4CKYA 2B30A 4CEHA 1Z4LA 4MQUA 4JK3A 2VNIA 2ZBGA 1DAKA 4HLUC 5CD9A 1MO3A 2HREA 3GRRA 1SQFA 3EULA 2XRZA 5GJWC 1TEXA 1O58A 1UOQA 2PRKA 2Q4OA 5CAEB 5C52B 1QCCA 1F9AA 5LA6F 1PQ4A 1LA2A 4LDRA 5AICA 2VNKA 3IOCA 1QP7A 3PQEA 1TRHA 2YIMA 1NA5A 2ZR8A 2ZBFA 3HYCA 1NULA 2Q5QA 3FWZA 4KNYA 4BB0A 1CZKA 1K7FB 1LRKA 1RQPA 4BO0A 4BOYA 2XB6A 3SQXA 4J8PA 1KZYC 2PS3A 2Z2YA 4J2TA 5J2UB 4BWFB 3Q7QA 4JVNA 4I4IA 5ALIA 3IJRA 2Z98A 1NI4A 1U2GA 1HTTA 1TT5B 4GL4A 4H77A 1VSBA 1O87A 1QG2A 2Q5EA 4YJ3F 5ENVA 4YP6A 3Q0EA 2OYCA 5LVAA 1L1EA 1B76A 3I3SR 3G2PA 1YACA 3EBPA 1JLLA 4M9XA 2PRSA 1NW9B 5AQEA 5LD2C 1I10A 3I09A 2HIGA 4Y2TA 1ORRA 3MLAA 3AVUA 3AF3A 3IVGA 4JL8A 4ZVPA 5IPFA 4MUFA 5ED4A 1XVIA 4LVOA 1KP2A 2IQIA 3AF0A 4HB3A 1PVDA 4NMHA 5IM5A 4C06A 4DQDA 3U7JA 4MS3B 3PRHA 4LJ6A 3GZTB 4RCZA 3LBHA 2N0SA 4FZ3A 1DJMA 5BRJA 3D3QA 4IRMA 4MNTA 2VDOB 2XCTB 2P2ZA 5BSKA 1U8XX 4CM7A 2BFWA 3RTCA 4XVUA 3WOHA 3U3ZA 2JIDA 3H4IA 4GYWA 5P21A 2WC1A 4RLHA 4FZVA 1M2WA 1YONA 2JZCA 1SIUA 3KE9A 2C5LA 2KX7A 4IIGA 1PWYE 4M9QA 4W99A 1T1RA 4AF8A 3G7UA 2WKWA 5EKDA 5EPEA 5H5JA 3ADKA 3HO6A 3ER6A 2AQ8A 4WKGA 3B5EA 5A3VA 2YV1A 3E48A 3TLGA 3W5IA 3RK4A 4CMCA 3LKBA 4O4HA 1AKTA 1N7JA 4R1MA 3IMGA 1N7IA 1MN6A 1JWAB 3EGDA 1X13A 3IKMB 5TDHA 5BPHA 1A4XA 3IQZA 3OPNA 5FAXA 3EAGA 1YHYA 1X80A 3LKZA 1V1JA 5CNMA 1R0WA 5CRIA 2C99A 4RK6A 5E0OA 2YXDA 1FMJA 4JLSA 2O8DB 1LU9A 2WWHA 2AHRA 2W71A 4LJKA 3SJZA 4DCJA 4ENPA 4S3MA 4MIKA 1VFPA 1SOWA 3A1NA 3GXBA 1T9GR 4Z86A 3IO3A 5EZ5A 1G2QA 2YXNA 3WJ7A 2CUNA 4JCCA 3AHEA 4NOMA 5DT2A 1L7NA 1P33A 3ZHOA 5B7NA 5FEUA 3ROTA 4CMBA 4Q1VA 4FXOA 5BSUA 2RHOA 2XUJA 1IXYA 4BFSA 1Y6FA 1Z5UA 3IAFA 4BQEA 4HWOA 3PXDA 2P0AA 4INAA 1SBZA 5K0EA 5CVCA 1YL7A 5DM4A 1PW7A 2DPXA 3HJTA 4MCIA 2G4CA 4CLRB 3FCAA 5C7YA 2JAQA 5ELMA 4NBTA 3TLAA 1MG5A 2OKCA 5AM4A 3MTJA 5GJCA 4AZ0A 5ER9A 1J2RA 1O96B 4XGRA 2OG1A 2CV1A 3AI3A 4OAQA 3IPCA 1RBQA 2W2MA 1B6GA 1UFKA 4QBFA 4CCSA 3VO8A 1KI2A 4YCJA 4G97A 3TIIA 5J2TF 1G5FA 2GZ1A 2JDID 1IB6A 1G19A 1I2DA 2XAUA 1SC3A 4MW9A 4NR0A 3AHCA 4O2RA 4RMGA 3NKFA 4W5TA 4DJEC 1K6JA 1UPTA 2ZPUA 4GLFA 4GFDA 1U04A 2BFCA 4NABA 1I4WA 1T35A 5AWFC 1K5DA 5K09A 3DEKA 4ZYLA 2O0MA 2DCMA 2GR9A 2XYVA 1WHSB 1X42A 1XTBA 3BHNA 4PQGA 2BE9A 5DP1A 3ZZNA 1WBBA 4OLHA 1NM5C 1WZ2A 2Z57A 3U1BA 1IIRA 1GUDA 5G2OA 3T34A 1USUA 1P2VA 1TJ5A 3PF9A 2BEUB 3TM5A 5J47A 1DX6A 1SA0B 2VLBA 4CEHB 4EOGA 3NTOA 3OURA 4FDTA 4OPMA 3AP2A 3L0IB 1EDEA 1TXGA 5JH7B 5GOTA 1CULC 4K9SA 4OVKA 4FX5A 4NY1A 3L4KA 3ZDFA 3SIPA 1XQYA 2NAPA 9MHTA 5KDDA 2ECFA 4NI5A 4AN0A 5ENDA 5L53A 4GUDA 1MX3A 1L8QA 4J76A 5FPYA 4C1NA 1C9MA 4FZ5A 2O8VA 1B8NA 2QXUA 2Q8QA 1OFGA 2B6NA 2C29D 2H0AA 2WDZA 3DA8A 4MRPA 2MYUA 4ZQIA 3RYFB 3UHJA 5JECA 4ZYVA 1P81A 2ABWA 4Z5XA 2W4MA 4LGCA 1P7WA 1L5MA 1I4OA 1RAIA 3B1JA 1CC1S 1TYEB 4FKBA 4DILA 1HLPA 3H75A 3OTIA 2JA2A 2D4AA 1J42A 1MFZA 3L8ZA 4OHYA 1KQ3A 1EVZA 1J7KA 4W82A 1R0XA 4HWPA 1DOZA 2FFBA 3DULA 4E32A 1YKGA 2JCBA 5TX7A 3MFQA 4LXGA 2F1RA 1B00A 5D1NA 4DXDA 2B0CA 2WJIA 4GX5A 4JOSA 2GETA 1O6CA 4Z1MD 2E89A 1POXA 1PE0A 2UKDA 4WFIA 2GO1A 3HCRA 5MN4A 3OA0A 4M76B 4YAGA 4INOA 3FDJA 1BRTA 3IDFA 4MPPA 1P7YA 4KUHA 3WMFA 3H5OA 2POQX 1B0UA 1XTTA 2JI6A 2NU6B 3E0XA 3N2IA 1N36B 3ICQB 1GNLA 1N5KA 1TF2A 1VE5A 1YC2A 2R8RA 2YV4A 3HZRA 3I73A 3O95A 2CNDA 2C57A 3TCNA 2LXNA 1IE3A 1E2NA 4I5EA 5SY6A 2PHZA 2PWYA 3ZH9B 4V0RA 3I5AA 3DO5A 4E2ZA 1KQFA 3D6UA 1QIGA 1JEDA 3WGTA 2YKGA 1TQHA 2XUKA 2YL2A 2ZB8A 3WQSB 2OGSA 5E6SB 2AZ4A 1L1FA 4D3SA 1XLUA 3O90A 3GLFB 4EPTA 5IF9A 1R6VA 4RM3A 3E5RA 3HI4A 5FR2A 5ALOA 1LBTA 2V45A 1NJ2A 2DWCA 1HKHA 4G0VA 4R81A 2IPLA 5LXTB 2QTZA 3F78A 3OPMA 3ANSA 1YRYE 2KLBA 1AV7A 5CR9A 1B8OA 4Q3NA 3K9BA 3PE4A 2C2GA 1W25A 1W5TA 2G82A 1O2DA 3DM9B 1RRFA 1LDMA 3OEYA 2AD1A 3IVCA 3ZD8A 1T91A 1ZOSA 2OWEA 3ETNA 5BYJA 1EEXB 1QV7A 1QZTA 3OM9A 2GM4A 1DV2A 3FYCA 4X1IA 1EWKA 1PT5A 3ONFA 2LR0A 4XQ9A 4YRSA 1HYHA 3CZMA 2XCSB 3HXMA 4PYJA 4BC1A 1I6KA 5L8VA 4PNHA 3AGPA 3OFNA 4M0FA 2XRMA 3EGVA 3SJCA 3H7IA 4FMBB 4G9GA 4D25A 4YJ2B 1DC3A 3AB7A 4DLUA 3KCNA 2QU8A 1F2TA 2BM8A 2WA2A 3PUHA 2ZR0A 1DLIA 2DU8A 5BQOA 3QYJA 5TSDA 3V97A 4F3KA 3C7DB 3HP7A 5ENZA 1KBOA 5IDYA 1RXVA 5L40A 4JLKA 4IGFA 4WW0A 4WLFA 1NRWA 4C2TA 3ZV7A 3V8PA 3MTDA 3W9YA 4EO7A 3ZGVA 4EATA 1G8SA 1QPBA 4LZJA 4YV7A 1A9XB 2H17A 4OHKA 3SCZA 5ERXA 3DWIA 4AVYA 4EHHA 1C7EA 5LQKA 4NLLA 1PBNA 1L8XA 2VN8A 4MW5A 2WJ3A 3QEKA 1VMKA 4WESA 1E63A 5JDCC 1X1BA 3RYHB 1SWWA 2QUHA 5ABPA 1UZAA 3P0RA 5A06A 1E7YA 1CSEE 2C7PA 2F00A 4MA4A 1JQBA 3V1YA 3ZHVA 1U2QA 1FQOA 2GQ0A 1V6SA 4QQRA 3TGPA 3HN7A 5FL7D 2YRXA 5TMDA 5JEDA 5BVGA 2GN2A 2ZW9A 4HDCA 2Z8YA 1FU4A 3JQRA 1YJ5A 2E4AA 1OXUA 4B3BA 1U5BB 1E3WA 1VSVA 3G79A 1PT9A 2HCRA 1G291 1XTPA 1Y9DA 4JA0A 5HYVA 3CJTA 1YZKA 3BA6A 3PRYA 3S44A 2IZOA 2J1LA 3F96A 3T5CA 4KRGA 4KHPB 1QANA 3RNLA 5BORA 2FUCA 2A84A 1M1NB 4Q6WA 3ESZA 1KI8A 3VR6D 4AJIA 4G1EB 3DF9A 1KAHA 4G8CA 1YVPA 3WLSA 1SCUB 4QSHA 5EL0A 4C3UA 4ZYWA 3H83A 1JQAA 2I5PO 2B5OA 3GCXA 3OOEA 3F0TA 3GJ0A 4X41A 1ZD8A 2XNKA 5FNVB 5SY4A 3ZBPA 4FYXA 3D0QA 2P3SA 4F56A 1YS9A 2INGX 4Z49A 1TKBA 5F7ZA 2EQAA 3MWEB 2OAP1 1Z6TA 1GRVA 1AX9A 4QHTA 4M1ZA 2R1VB 3TIXB 5HTOA 2M6SA 2QY6A 4EPVA 3B82A 1P61B 1IY2A 5LN1A 3LA8A 4CFYA 5TQ2A 3BIWA 3FNQA 2Z9DA 3N2NA 3R0QA 1NBME 3C1TA 4US0R 3V8VA 5JQGB 1YIDA 3U7GA 4BLSA 2HSZA 1RXSA 3M6XA 4XIYA 2AG8A 1LLCA 3EXFB 1XVUA 2V7VA 5D6OA 3C14C 2QW0X 1NXWA 2XF2A 2QX7A 3U2QA 2X8WA 3DP9A 3EZ6A 3DQZA 4RWZA 1N57A 2OD9A 2GK3A 3QVLA 4QICA 4UEWA 4WXYB 4X64B 1ONPA 4PIPA 5LZ9A 4O2BB 4DEVA 1LLFA 2AF4C 4EZEA 2P1ZA 1DELA 1RQRA 3KPUA 4IXMA 2QXYA 1B0ZA 2BEVB 4TT8A 4MUHA 2RAFA 4BE7B 4YP9A 2ZEJA 4P4GA 5CA0A 4CLOB 3DXXA 1GUYA 3PSAA 3KOMA 5HKOA 2PKCA 5LDHA 3GELA 3QBVA 2X0KA 3OHPA 2XTZA 3ZY4A 1DCTA 2I71A 4I3FA 3DL2A 2QX9A 4NQZA 1KNXA 5BW4A 2FFJA 2XB8A 1CU1A 3RU3A 4MVJF 3EXIA 4CEJB 2OCXA 4OTZA 1NVTA 4W9NC 4HUJA 3VKVA 2YY6A 1J9GA 3K4HA 3THYB 3AXTA 1F2VA 3G5TA 3I9NA 2ILTA 4LXHA 3NIDB 4PYNA 4QTTB 5E3JA 3WBBA 2OZVA 2DKNA 1G8JA 5LP6A 1NN3A 3ME5A 5DHSA 4S2EA 3WC4A 4B7ZA 1KR5A 4EH1A 5B3JC 3LECA 1KMNA 1T34A 2P8SA 5KI6A 2O7SA 2G9NA 1K7SN 4I3GA 2IY7A 3DLPX 4NV0A 4TKZA 3STXA 2IY9A 1WRBA 2R6R1 1HQDA 4X8HA 1BA3A 5AKIA 2QQ5A 1MOSA 4GPAA 3W7AA 2BUBA 3OC0A 2E5WA 4P3OA 5IC6A 1C29B 3R5HA 4ZPJA 4MPJA 4W7IA 3A1CA 4NZYA 3RVMA 2BKLA 1U1IA 1X86B 2J6HA 4CL3A 3P1JA 4ND7A 4QNRA 2J9GA 5JYBA 2WYUA 4HDQB 1RIFA 1YKFA 3CBQA 2AN3A 3GPDG 5CAEA 5G1NA 3DGFC 2P6PA 2ATVA 1V71A 3FFTA 3IPYA 5E4TA 2YTZA 3RBXA 3DAOA 2DT5A 2MOKA 3BX1A 3WZLA 4RS4A 5JAQA 6REQA 4UU0A 3H0KA 1P0MA 2V7PA 3AETA 3PIIA 1VJCA 3ROZA 4KQ2A 4OFXA 3LQQA 4HAOA 4HNAB 3UWSA 4C0LA 4C2BA 3UMMA 1PD1A 2ZB3A 1IXSB 1D07A 2BMEA 1LNQA 3C6QA 3G82C 3E8XA 4N9QA 4PO1A 4D02A 1GKKA 4M7RA 2BGLA 4LQLA 1KRHA 4UU1A 5ICEA 2VYVD 4HXYA 1SPBS 1V39A 5FQNA 5TS3A 2IHUA 2NYAA 2JGFA 2QS9A 2PGAA 2UYYA 2ZIAA 4NE2A 5U4QA 1QTQA 2GN8A 1E3SA 4FMDF 1OFTA 1VC2A 3DZBA 4QPZA 2P41A 2FR8A 2BZGA 3M4NA 3KVRA 3K5PA 3VNBA 4D9MA 3VC7A 3ZNQA 1RJWA 1N2HA 1HQCA 3LH5A 3NQ41 4PZ0A 3IXQA 3SF0A 3WNBA 4AB1A 1DAEA 1LNSA 1P5RA 3EQ9A 3IR6A 3L7IA 3PUXA 4RHFA 2XSZD 3R7AA 3GHYA 1O8CA 1KTVA 1TZMA 3ZG6A 2O2IA 1OAKA 4OG2A 1PJZA 3LOPA 5ALHA 5EXPA 4DQLA 4DV5B 1SVUA 1PT6A 3F2IA 2FETA 5LZ4A 3B7WA 5A3RA 1VPVA 2VAXA 2PU5A 2IEIA 1KYYA 1ZD2P 1P5FA 3KOWA 3QPCA 2XD9A 5EZYB 4I1OA 4XUGB 3O1JC 2XPCA 1CNMA 4QBTA 3VR5H 3DWFA 1PJCA 4QNMA 5CFMA 1XZLA 4WZBA 2PPLA 1JZTA 3U4IA 3F5QA 3HABA 3VH1A 4BU1A 4YRAA 4JBLA 3SWWA 1JAYA 3KU1A 1OKKA 1RVV1 3P20A 2HTFA 2QA5A 3Q10A 2N1MA 2JDIA 3ESXA 4CODB 1U2DC 4CG0A 2OHOA 1P0QA 1US8A 4Q66C 2GOYA 4U9IS 2B83A 3TRIA 4EM6A 4FYKA 1JR3E 4IDNA 4JJEA 2ZI6A 3DOFA 1DKPA 1MXHA 1PJ4A 3GFSA 3L5OA 3VPAA 2BH9A 5EIOA 4JXZA 4XEUA 1O4WA 3WSWA 1PGNA 1LX7A 2V1XA 3RVOA 4DCGA 1MO2A 1DU4A 1XJ0A 3U3KA 3S8YA 4Z9YA 4AZ3B 5ILGA 2IYPA 5LB2A 1C5KA 3ONEA 2ECPA 1OC4A 2PEYA 4GP6A 2OVFA 3E1GA 4B4WA 3C85A 4GGOA 2BN4A 1B16A 2GVDC 4P7FA 4BGIA 1U0HC 4RA9A 3TXXA 1I6WA 1L8LA 3K0CC 3DO8A 4ZHQB 3RIXA 4JBIA 3W90A 4DMMA 4X00A 5J3JA 3AJAA 3UCEA 4P4UA 2ZXEA 4ZANA 1NGSA 1HEYA 3AX6A 4OXIA 3ECCA 2XBLA 3MWGA 4BVKA 4YUAA 1I1HA 3RRBA 1L4BA 4F9GA 3Q5GA 2ZQ5A 2O05A 4RZXA 4HH3C 5EVJA 2JLSA 4E14A 3KWLA 3V7UA 2ZUBA 4CMAA 2OCAA 4Q21A 2B78A 4I5IA 3T99A 4TVSA 4RGQA 5EJ6A 1A97A 3VKFA 1M0WA 5KYTA 3Q85A 5EGNA 2UDPA 5ADWA 3V46A 1YC5A 4KN6A 5BQ5A 1O6GA 3U0BA 1PUJA 1YQQA 5IZCA 2AFRA 4LYAA 5K2MA 1SCNE 2J41A 2D3TA 2IHVA 2ZJ8A 2A88A 3NVDA 4M0KA 3A1UA 1TZJA 1QHHA 2HUNA 4WNYA 4B0OA 1FYDA 2BFBA 3BD7A 2LCQA 1JYEA 3SX4A 1C0EA 1E3QA 2HQBA 1H1TA 3TE7A 2ZRPA 3A2LA 2IEBA 3VR4A 4CMIB 4DN6A 1COWA 4X1IB 4XUCA 5COBA 3G2IA 4EA9A 2C83A 3M6WA 1LEHA 1YDWA 2CGEA 1B1AA 5ER6A 4UVHA 3RVJA 3K9GA 6REQB 2ZZMA 4TPKA 4YJHB 5K99A 1DKOA 3OFSA 4EYGA 1N2OA 4QPPA 1RRKA 3V7FA 1ZGZA 1M2GA 3LLMA 3TOCA 1CRQA 3PC8C 1EUCB 3K73O 4FHFA 3H9UA 2CJXA 3FVVA 4QHSA 1JP7A 4ND1A 4PZYA 5AI5A 3WMEA 4HNHA 4A8JB 4BNGA 2OUKA 4LW8A 4YO8A 3RVNA 1ACMA 3UFXB 4TZ6A 4PONA 1U5CA 1P2GA 4LY3A 4LHWA 4OCZA 1IBMB 3INNA 4GL2A 1SR8A 2O1WA 3E03A 2QT0A 3D6AA 1GYRA 4PYIA 3U4AA 4X7PA 2BTQA 3F9CA 3SKVA 1A8PA 3B6KA 2DPHA 4CLHA 2HC9A 5ITZB 1ZOPA 3NBAA 2V5AA 3MGCA 1V7QA 3D81A 4JLDA 1MGPA 1QO0D 1P1JA 2NSDA 1F0PA 1ZUNB 3PQ4A 4IJQA 3X2FA 1Y9AA 4X91A 1GWNA 2PKRA 4ILKA 1IJBA 3WADA 3ZCRA 5IJZA 1K63A 3O94A 3THYA 3IIEA 3FUVA 1Z13A 4MV7A 3C97A 4REQA 4POOA 3HI6A 1FVFA 3OH8A 4BZZA 1XO1A 3EDYA 4GSYA 3U4CA 3V2HA 1MKYA 1GFZA 5IJ9A 4QXQA 4ZD6A 1T2NA 3HWRA 3CPEA 4V39A 5FTKA 4ZTUB 3LNTA 1E4EB 4JJ7A 3DUWA 4L4ZA 4PBRA 2NUBA 1Y6ZA 4YFVA 2QSJA 4FGUA 1DRKA 1V9CA 5D3QA 3H1PA 3H4VA 2Z4SA 4QQKA 1ZH6A 4QG7A 1YK1A 4DY4A 2AJTA 2DHEA 1Y8RA 3AVXA 1HX7A 3K3PA 1UC9A 1OFUA 4TL7A 1VPLA 5BQXA 1MCZA 3T4UA 2BF4A 3GY0A 2X1VA 3IHLA 3WLKX 4BBPA 3T1YB 2ADFA 4WSOA 4ZP1A 3V00A 2AC4A 4HOYA 1BKDR 1OHHA 4OREX 3AOEC 2H1SA 4JI1B 1FB5A 1UPCA 2QSZA 3KEFA 3UWOA 3NBUA 4OFZA 5BQPA 2FMFA 4FNGA 2ZAYA 2ZIXA 4EKIA 2HPAA 1V2HE 1NATA 1NXPA 4NU5A 4YRFA 2NZ8A 1CYDA 3DEYX 3N8IA 5KYYB 4S05A 3NP9A 2R7NA 4G84A 1QFJA 4LDJA 1JZSA 1C9DB 2WQZA 2WIGA 4Q01A 4A16A 3N0RA 3TBKA 4X8LA 5EXSA 1ZFNA 2A1UA 2D5IA 2FOLA 2PH7A 2VJAA 4KH1A 4ZO9A 5KPDA 4PAGA 4QM6A 4KMRA 1L7XA 2C7BA 2GJ4A 3TZHA 3ISVA 4A6XA 2QMOA 3EDOA 4O4HB 3QLUA 2I6FA 4DR1B 2AXEA 1JEAA 1F3LA 5LQCA 3OD5A 3CLSC 2Q99A 3W5AA 3E9EA 5DNYB 2VRBA 3DHYA 4F4UA 2G1AA 2IYRA 3LP8A 2MCFA 2X0JA 4DGQA 1D8AA 2R96A 1UCFA 2GJKA 3EMDA 4MVJH 5C8DA 2OHFA 2PH3A 2MSWA 1CW2B 2P68A 2OBXA 3HVRA 1QTNA 4AO8A 3QHPA 1UBLS 3O9MA 2X5KO 1FW8A 5EESA 3L4BA 2IHNA 2HEGA 3CU5A 5IYZB 4A92A 3NNDA 5L51A 3AERB 1CG6A 4BGUA 1HFKA 5BV2P 1NSYA 4P2GA 3LQKA 4AN4A 1G7SA 2IXAA 2WSBA 1K3TA 1MO5A 1RJ9B 3LXUX 3OPQA 3AIKA 3QYPA 2AEMA 4PZUA 1ZIDA 3M6VA 4TZKA 2AK3A 1UK8A 1ECLA 2D7JA 2FUG1 2PSFA 4I1YA 5EFOA 5EP4A 1CTQA 2PD4A 5DGHA 4ZWNA 3OF5A 3DLIA 1VFNA 3GU3A 5J2TA 2FCRA 3NHBA 4PNEA 4ZZ0A 5EQDA 1XYVA 3VOAA 2VDKB 2CY0A 1V3UA 4DLWA 1KMHB 2AKYA 1OW3B 1UMBB 2R7KA 4F2PA 3DMDA 1S01A 1DC5A 3DBLA 4M8SA 4MKRA 3HDGA 3E70C 5ALVA 1DWOA 4D3YA 3LI2A 1L5OA 5BY2A 1T0PA 4HLDA 5JASA 1K2WA 1QHGA 5DX0A 2X42A 5EUCA 2HMVA 3C7TA 3M3PA 1N5IA 3UXEA 4R1TA 1JHVA 1MX1A 1T6ZA 3SEAA 1HBJA 3ZDQA 3ZQ4A 5AW4A 5JQGF 1K66A 2QYHA 1CZUA 3AG6A 4INJA 2WVGA 1WL8A 5AIBA 5KCZA 1QIJA 4MQ5A 5KHLB 3BDAA 4TM7A 5BW8A 2RG1A 4YRNA 5IDWA 1UC4B 1J09A 4F4CA 4KBGA 3WI7A 3FGNA 2CE2X 3G9UA 3ADDA 2VWQA 3L40A 5JZBA 2EEPA 4QWMA 1J9ZA 3RF6A 3LX8A 4AKIA 1DOAA 4JHLA 4D6XA 3IALA 1RFLA 3L6RA 3PUYA 3OETA 4RV9A 3UGTA 3FYDA 3ERCA 4Q3BA 3NDBB 2Y9PB 3EFBA 4KR7A 1YFZA 3KD3A 3PWTA 4IJ6A 3D7MA 1ADGA 2A7QA 4YDSA 3VYUB 3T7CA 3F6SA 9LDBA 4XWWA 3FKSA 3B51X 5C1BA 1XXLA 4I55B 1U7PA 1Y1PA 2O2XA 2YMLA 1SVMA 3CXRA 1C1XB 4HX5A 4OYLA 2XXAB 4QYMA 2J4CA 2WJYA 1PR1A 5DSXA 3WR5A 3K6JA 2BFAA 5CH3A 4DYHA 1W34A 1L4HA 2GCIA 3G0BA 3AEQA 1CQJB 1VHDA 2HQSA 1T4GA 2QUIA 1IEVA 1NW8A 2F4NA 3L7JA 3OUTA 5K8JB 1Z4KA 3F3KA 1F17A 1NP6A 4BQOA 3GRPA 5CIQA 4P58A 2M6KA 1E1YA 4HYYA 3QKRA 1XJWA 3R8CA 3UCFA 2Y0CA 1K6MA 2WP8J 4D9EA 4BP1A 1EA5A 2P2GA 3G88A 4D74A 4N82A 2QBYB 3RHZA 3I5MA 2F59A 1CQIA 2FEKA 2P9TA 1IN7A 1G17A 2GLXA 4E12A 2IOFA 1E59A 4WRRA 5C3MA 3PVCA 2ZB4A 3GLUA 4MJ3A 5HF9A 3BQMB 1SKYB 3R7WB 1II8B 3WHPA 3OM1A 2XTAA 3VUEA 1YQXA 3HY6A 3Q3GE 5JQWA 5B3KA 3ENNA 3VU8A 3ZC3A 4Z3DA 3O8CA 3I39X 3UPDA 2MINB 4EA7A 2GD0A 3VV3A 1U8CB 1UXOA 4XD2A 4RVCA 4ZHQA 3FHTA 1ZQ9A 3LK7A 1JHDA 3DT6A 4QTYA 3USCS 2C8VA 3PIRA 2XNHA 1EVIA 2ORIA 1RYFA 2DXIA 1AQ6A 1S02A 4CUJA 4M0LA 1HE3A 2Q1WA 4E4RA 3CJRA 1HMYA 4IDEA 1PEYA 1FS6A 4LE2A 3GAFA 4O4LF 3BRWA 1F2DA 1M33A 1RYBA 1O03A 3LYLA 4NS1A 5T5QA 4BDTA 4MVJD 1CQJA 3E9MA 5JOQA 5KDOA 2V97A 4PSDA 5ERGB 3NKVA 3A9RA 1JH8A 1E94E 3R0IA 1BXKA 2I65A 3CW2A 3ZI4A 2SBTA 2W5UA 2YV3A 1XELA 1I5OA 5C1IA 1Q2UA 4RBNA 3T3IA 1W0JA 2YNMA 4C4XA 5CFZA 2R0QC 1HE2A 4JQZA 1BKSB 1CK4A 4PAQA 4G0XA 3DEIA 1XR3A 3BRQA 3K6KA 4N1AA 3V3KA 3OZBA 4IXDA 1PJSA 1XD8A 2Z04A 5TMBA 3OQ6A 5I8PA 5LXTF 5CLLA 3HUEA 3ESAA 2Y93A 1KEUA 3A10A 3IBFA 1ZOIA 2DBYA 1GSHA 2RONA 4NMLA 3TLCA 2DUUA 5KCMA 3CZAA 3LXMA 4GNKA 1TLTA 4HH4A 4HL6A 5AJWA 1V16A 3MIZA 4A8HA 3I76A 1EWQA 1RKBA 4WN9B 3AESB 3I61A 4GBGA 2QKYA 4J7XA 1D4ZA 1K8RA 2D1SA 2J33A 4G86A 4DE5A 5C5IA 4AJHA 4HTFA 1GRRA 2E5LB 4NXMB 1LB1B 5J2TB 3IKJA 2OV1A 4LOAA 2G08A 5FADA 1A7AA 2V8BA 4ZEWA 4IH4A 1N9GB 4HO1X 4H18A 1XDZA 5EHGA 3RYCB 1Q0UA 2FVYA 1DB3A 5DGCA 1CB0A 4ND3A 5IS2A 1PVVA 1E9SA 1EFAA 3PNKA 1T9KA 3LNCA 1R0CA 3KZVA 4ROSA 4UD2A 1J8FA 1U63A 3WLMA 4GPD1 3C16C 3CVWA 2O3UA 4K9LA 4Q47A 1CVLA 4KR3A 4U5XA 4RMJA 3B6EA 2O2EA 1XIVA 1GSAA 1SUCA 1OYOA 2FQ1A 4L27A 4ZO6A 3WGVA 5I7EA 1QWSA 1EX6A 3PQFA 1BXRB 5GV8A 1IWPB 2HSGA 3IPLA 5L7YA 3FTDA 1E96A 4NMXB 1CE8A 3ZCVA 1ZK3A 5C7IO 1J1ZA 2VUSA 2P91A 4PCUA 2H4ZA 3PQ7A 4L51A 4US1R 4UZFA 1E2EA 1QGED 4HEA6 1HFJA 5B3JA 1CUDA 4DR6B 4GOKA 4FZRA 4V0ME 2C4UA 4R71A 1GV0A 4PLPA 2AGVA 4LVNA 5K0TA 1KH1A 2GAFA 4C4SA 4AAYA 3JQ7B 3HBLA 5CB6A 2YMQA 3V4FA 4G07A 3DBRB 3U3XA 4EI8A 5KWJA 4RIIA 2QYTA 2AFHB 2R65A 3F5DA 1CT9A 4G0YA 4J9VA 1R5OA 4KI7A 3TJZA 1QP4A 4J0JA 5C8ZA 3EXG2 4GBJA 4YRDA 5DVZA 2RAUA 3G9ZA 3V4RA 2FZLA 2FPOA 3VYWA 1OH6A 1UDCA 4D3DA 3PQCA 3UFXA 5AP9A 2BGUA 3T54A 4DB2A 4GP9A 4AJPA 4DLZA 4ZALA 1E62A 1NSFA 2QIPA 3IDZA 4IMIB 3DEHA 1L5GB 2O8EB 1QZXA 1Y48E 4NOJA 4NPCA 1NLYA 4RKFA 4AECA 1X8JA 5AVJA 4OP2A 4YMHA 1FPQA 3KLNA 4GEGA 2FR0A 1QH8B 2QN6A 4YPVA 5BXQC 4P80A 3GGSA 4MS4B 4WK6A 4DKXA 5BUQA 1NLZA 2AS0A 4LZOA 2E4VA 1KDRA 3BDVA 5G4KA 1S3SA 1ZW1A 4KMMA 4M7OA 1QDUA 1W9MA 3HCWA 1EH5A 3TR5A 2N46A 4JXJA 3BICA 4PGHA 3NBFA 2Y6UA 4C01A 3EC2A 1L7RA 4BE4A 1KYXA 4UTVA 5IXJA 4X60A 3A27A 2XB4A 1UBCA 1EZ4A 1NE2A 3GNTA 5CB8A 2Y0DA 2AXQA 1C1YA 5KAMA 5C5CA 1NTRA 2O4UX 4QGHA 4M88A 4W9NA 4BIMA 4CKBA 1Z6ZA 3MOGA 1OX5A 1ESZA 2C4KA 1Q11A 3GFPA 1VLZA 2BGRA 1USVA 4ZVNA 3TD2A 1HGXA 1VKZA 3MMPA 2H4XA 1XDSA 1SG9A 3T12A 4BX2A 1DAIA 3UJ3X 1U3TA 4N3AA 1YR2A 3QVGB 1SVSA 2CHEA 1YS7A 2X76A 5IC4A 3JCZA 5INTA 3A6PC 4A1OA 1T9BA 2DR0A 3ASZA 3DL4A 3QIVA 1DAGA 3FPCA 4LDPA 2AYYA 4RENA 1KEKA 3CVVA 1NYRA 1O9HA 1YE8A 4C7MA 4IAOA 1YBVA 2VKTA 2L69A 3TQCA 3VR2A 1JIKA 5ALXA 2HU2A 3MW8A 2EGUA 1YZ3A 1DC8A 1YU6A 4KTTE 4WOPA 4DCUA 4UDNA 4IDAA 1LPOA 2I3DA 4A0RA 1AD2A 3WDMA 4B82A 1IXKA 3D8UA 2X77A 3LX5A 2ZETA 4MUIA 1W0KD 1JLMA 1ZPDA 2W7TA 4OI0A 2H4JA 3HU2A 2NGRA 2GH1A 4RGYA 2B4TO 3T61A 4DLKA 1CKEA 1J21A 3TF5A 5K0FA 2QL6A 1QHEA 3FI0A 2CFCA 3PGKA 1DIHA 3CE6A 4WXPA 3FUXA 5IDVA 2W6OA 3EK2A 4DWVA 2H4WA 3OSZA 3M3DA 3KTOA 3TQSA 2C4MA 5CA0B 1Q19A 1GZ4A 1P3Y1 5CFPA 3D2LA 1B2LA 4IGEA 3HJAA 3IXLA 5FUBA 3VR5D 4TX1A 2PS1A 5JNRA 2V0GA 1TOAA 2JLYA 3ETCA 2V9ZA 2PZJA 1BKYA 2J3EA 2WIAA 3L0DA 5F76A 4FFWA 1BXZA 4X97A 5DMXA 3NHZA 1U1FA 2DQSA 5AJZA 4RHUA 5CVTA 1RZRD 1MZPA 1AS3A 2KB0A 3HUDA 5LQAA 4C7JA 1ENPA 3ACBA 3MS2A 4P38A 1FDOA 2K6GA 5J2UF 4I6GA 3BILA 3FCUB 3BGDA 5AJYA 4PGGA 1Z0JA 3E1SA 1EUQA 1OTHA 4DAEA 2JFNA 3FNRA 1RAAA 1T9GS 4TMWA 5JWOA 2BMVA 1AF4A 4QJIA 1ZRHA 3OMXA 3IE0A 3WA7A 3AY3A 1TZBA 1XZIA 2WD7A 3BXZA 4L0MA 5FULA 4DR7B 1V45E 2IUUA 3ZLTA 4M6WA 4ISBA 5ANRB 5LOVA 3WV5A 1ECBA 4HDAA 4UJ5A 5CDFA 2D3WA 1EI9A 1U8ZA 1BFKA 1RYDA 5BMVB 1XLTA 5G0WA 3PITA 3JW8A 4CI0B 4CTOA 3TQHA 3ELYA 2O2SA 4IDPA 4QX6A 1NZDA 1DO2A 1F60A 1SUWA 2GNPA 1FA9A 1G8AA 2E4WA 4MWZA 3WAKA 4BZPA 3H5RA 3NUGA 3GDOA 1ZR2A 1EJ6A 3OE5A 3PA8A 4GNRA 3EWSA 4WZAE 3ZKWA 4DIKA 1QOQB 3MK31 4AP6A 4OYYA 2CNKA 1E9BA 5A2QA 2AB0A 3RYCA 3BB1A 3HDQA 3ILXA 5ECGC 1ORTA 4PCLA 4YT8A 4GMDA 4M83A 4EEZA 1JG3A 3ZDXB 1RWQA 3AINA 3FWPA 3O0TA 1YASA 3TZ6A 5LKRA 4IM7A 4LF7B 5FOVA 3MQFA 1WEKA 1FUUA 2VH2A 1SXJC 3QXSA 3FPLA 4C4ZA 4D9GA 1T2DA 1BS1A 1XZDA 3PRKE 4P4SB 5JHGB 5AM2A 4Z3OA 3P27A 4KR0A 2QW8A 4C3VA 4BQFA 5LZ5A 1ZY2A 3CUVA 1C8LA 1UJ6A 1U3VA 1NFQA 4HATA 4S0XA 3BG5A 1A9OA 3W8RA 4EHNA 4PG8A 3I2IA 3K2EA 2IXGA 3TQFA 4PYOA 1G5QA 3JXEA 1XZJA 2C5FA 2WTUA 3HJGA 3GFOA 4L0CA 2HLNA 3WGKA 1Z4IA 4DSOA 5IRCD 2D1FA 4JXXA 2R8BA 1FFEA 1O7JA 4GZLA 4DDVA 4R2WA 4POAA 1VMIA 1W8DA 2HZBA 2W6QA 2OPHA 3HXQA 3MJRA 3EQ8A 5HZMA 1R1DA 1KU0A 2EG5A 4YMWA 2EDAA 4DNQA 5CGQB 3TPCA 4KPUA 1Z62A 3KJHA 5JDCA 3L4JA 2I76A 1NFFA 1ZN8A 4M7PA 4QPJC 1V2GA 4QTXA 2DSTA 1FPMA 3IBTA 1OTXA 4PX5A 4QSMA 3ZS8A 4WCFB 4ZI2A 1VYHA 2I29A 1J0EA 3A8TA 3SXUA 4F92B 3HPQA 4PPNA 3ZR4B 4TYMA 3RARA 3LC1O 2JLRA 1JDTA 1TK3A 3QOFA 3KPWA 1VYVA 5CIWA 1H42A 2V55B 1YZQA 4IQ8A 3QHAA 2YWCA 3IHTA 2R1UA 3PTZA 4OQQA 1QO0A 4HPXB 1LTQA 4BIIA 3C7KA 2HDWA 2M2IA 3CZPA 4GLLA 2BKUA 4GMHA 3NBKA 3OQVA 1ARZA 3N7TA 3PDWA 4H27A 1HT1E 1GVHA 2WB2A 5ELLA 1GHTA 1T0BA 5FV4A 3MT7A 1QTIA 1MAUA 1ORVA 2HGSA 3CQ9A 4CT4B 1KPIA 3DNPA 1AUXA 1TK2A 4FOOA 1ZP6A 2BVNA 3PTLA 4K6CA 3QMPA 3EG9A 1Z2DA 4HZGA 1OLUA 4JQSA 4Q9JA 3ER9A 5FUMA 3CO5A 3G8YA 1JDZA 2C9MA 2WWXA 4Y30A 3RVQA 3UT0A 2SKDA 1EFLA 1W1IA 1THZA 2ZWOA 1ZO8A 1XLWA 4N54A 4ZZ2A 2CSUA 3UUEA 2XA9A 3NTQA 1JKFA 2Q49A 2AUTA 3LCVB 3VC3A 1XA4A 5JDIC 1IOZA 1UKCA 3ASVA 3BKXA 1KZ6A 4G3XA 2XGMA 4N01A 2M1XA 4WV3A 1OX6A 2IKQA 2QUJA 3KLPX 3GQBB 3T06B 4BB6A 1C0LA 4QEZA 1GG8A 2ZPAA 3L1HA 2QN2A 4MUGA 4UTPA 1FMFA 2ATIA 2JARA 1L7DA 4GWLA 3U39A 4I4CA 2GN1A 4J1TA 2FW8A 5KOIA 2WM8A 1Z7GA 2YZMA 2WDPA 3IP5A 5DASA 3G23A 1ZUWA 1U90A 4IV5A 3NDRA 4FYMA 4DUPA 4J0GA 2QMZA 4NDNE 2ZDGA 3E61A 3R7NA 5CM9C 3P32A 3NT2A 4AZ0B 4CR8A 1OWPA 2B8NA 2QXTA 1L3IA 3G68A 4OGGA 3PR3A 1U7HA 5IKXA 3W2FA 4RTJA 3QVKA 4WUVA 1XROA 3JWIA 2W42A 3PC4A 1KDYA 3VKUA 2Z2ZA 1JXOA 4QXAA 1KJZA 1QH8A 1S8OA 3UAWA 2DBQA 1U0RA 5KSYA 5IG2A 1D0VA 1GEGA 3IDAA 2VBIA 2DY1A 2CLIB 2ONCA 2C31A 1Q92A 1ADBA 3EXFA 3W1VA 5A3JA 2R7LA 4ONEA 1G8GA 2WUWE 5CFLA 1V11B 3AZOA 3C3CA 3PB3A 1SZDA 1HO3A 1FP4B 3DEJA 4L9AA 5T4EA 3ZOKA 2WTXA 5HHTA 2QX4A 5KS2A 2IS4A 4J2HA 2B8EA 2R1VA 3JWJA 4FC6A 1M1YB 1KIFA 4KX3A 2R4QA 3QLEA 1JT9A 4D8VA 1ZD4A 5K3CA 4GOND 2G09A 1FP6A 3C8UA 3CVUA 1S96A 3R77A 1HF3A 1X7YA 4OY3A 2BD0A 1FDRA 1P5JA 3UYLA 4DYVA 4N76A 3NG1A 2GXUA 2C1EA 3MOSA 5DX8A 3S1AB 4HC4A 4LOIA 4DQKA 1XDDA 4D4MA 4HT3B 2CZCA 3PWSA 2R5NA 3OZEA 5AW3A 1DIGA 1GSIA 3GT7A 3EXAA 1EJ0A 1DBQA 1WXGA 1ZW6A 4GQBA 4C14A 3IV7A 4YCAA 4DCMA 3THRA 2HM7A 1ZITA 2TMGA 3FHLA 2BM9A 1IPEA 3FZQA 2EFDB 3K1AB 5FNVA 3SHFA 4EJMA 5AVXA 2AQIA 4Z6KA 3JYHA 4PN3A 3BA1A 3GNQA 2ODPA 4EPXA 3OLVA 8ATCA 3B6IA 1YIAA 4ERXA 4EJ2A 3N8KA 5B55A 1DRJA 1TEHA 1YCFA 4H7HA 3VJRA 1D7AA 1WDLA 2A1TS 1KBZA 1KMQA 2QAJA 4XLZA 1TQDA 2TYSB 3HBNA 5DDIP 4E15A 3RGWS 2GRAA 1NIJA 1GNTA 2FZ5A 3OO0A 4I9HA 3HCCA 3V9AA 4AUKA 4CF3A 5B6IA 4R9VA 3SZGA 1BGVA 3EF0A 1YB2A 3FVRA 2PKEA 3AIIA 4NF2A 3ZNNA 1Y6GA 1I30A 1YSCA 2BIFA 2FWRA 3MUEA 3LPCA 1HK7A 3TX2A 1AK9A 1GLNA 3ZJUA 3BWMA 4GWGA 1D2HA 2Z5FA 3REQA 1O96A 1J8QA 1MAWA 1YZUA 4UU8A 3H99A 2NVOA 3COVA 2XTMA 4F12A 4L76A 1SXPA 3K70B 2ATEA 2AUMA 5KTYA 2NQTA 1F0KA 3NYQA 4U02A 1L4FA 1VYUA 1IJEA 3GJ4A 3MMXA 2AJCA 1TO6A 5L7WA 1Q1QA 4UDOA 3IESA 4G5HA 5FI1B 1YI0A 5JALA 5KHOC 1YNOA 1JIVA 4R2KA 1Z06A 4I1IA 2CYAA 1CY8A 3G0HA 2HWUA 1X7YB 1C3OB 2WZCA 3QNUA 5EIXA 1B6TA 1GTJ1 4LXUA 3UK6A 2DHCA 1LPMA 3VR2D 2FWIA 1D6JA 5DTMA 5JLAA 1JHAA 5KNDA 4BLOA 2Y1FA 1MF7A 2XA1A 3IFSA 3JZMA 3P7MA 3FFWA 4LSMA 3UVEA 3T7IA 3GPLA 1EX1A 4PHHA 1R88A 2AFHE 1XDBA 2A1TR 2BI7A 1RAEA 1VG0B 3G49A 1QF6A 1LVHA 4TRJA 3WGQA 1DCMA 2ODEA 3DBRA 2JJ2D 4FZJA 2NO1A 1LKZA 3EHDA 3H1AA 3WBFA 1L7OA 4XA8A 4BVAA 1E1KA 121PA 3JVVA 3W2GA 1Y81A 2CDBA 1AUOA 1E1CB 3CUYA 4CIDA 2XUIA 1M76A 3FN4A 3L8EA 2WZBA 1YZYA 3NORA 1E5DA 1Y63A 2W4IA 2X19A 3Q3VA 5HKBA 4YCCA 4BGEA 5LLDA 3HUTA 3RC1A 3ES9A 4W5QA 1DDGA 3LT0A 4HUQB 4B83A 1DWQA 1ENZA 3IOMA 4JI8B 1PU2A 2IHTA 3LBNA 4DV7B 1RABA 1I32A 1XC7A 3DCYA 2X5OA 4RTMA 1KEWA 3W79A 3W3ZB 3F9IA 4IVQA 3PT5A 2Z6UA 4OQLA 3W2HA 4PHTA 3PFBA 3KKOA 1II8A 3V9PA 4C7VA 5EY5B 5KDLA 4EHDA 4YLYA 1C0KA 3R3ZA 4MS3A 4KPEC 4ZI3A 1H4SA 5CFQA 1LCIA 2BEUA 4XYMA 1ZVVA 1SXIA 2VQSA 4RJIA 1YU9A 2Q5LA 3N3AC 1JG1A 2XHEA 5IKPA 1UK9A 3OE7A 3JR7A 4RVUA 4XWGA 2GSWA 4YRCA 1IVYA 3AVVA 5KTMA 4LRSB 2GZDA 4L8WB 2WG1A 2QTMA 4WACA 4RF5A 1PZFA 1ZD9A 2Z3ZA 3ZCPA 3HJNA 4CZ2A 4HRAA 3IJPA 1A9SA 2FYTA 3ZDAA 4BJ5A 1TMYA 2J67A 4PLGA 5KC8A 2AZXA 2CNNA 5IFKA 3H9QA 4KV7A 1QE5A 4PLHA 3BFVA 3RLIA 1SD2A 2TMYA 2WUDA 3DDUA 4HTAA 2JVJA 1T5TA 3OTQA 5HBGA 4B74A 2QBYA 2GYVA 1EXMA 3AR5A 4A6PA 4DS3A 1T3TA 4MAFA 5DM60 5AVYA 2AI1A 1M2HA 4Y2GA 1FSFA 1AO3A 5E3IA 4BNLA 1AK1A 4FDLA 2Q9BA 4LCJA 4R2JA 2IZZA 3DPIA 1K75A 2RG7A 3G5LA 3VPXA 3WGOA 2HBZA 4TXMA 3ZHRA 4DLPA 1YRWA 5IEBA 3URMA 4DA7A 4M8NE 3AUXA 4JODA 2NZ2A 3QH4A 2V7GA 2W70A 3EIFA 3HVHA 1RLUA 4E5UA 3HXOA 1K06A 3LGSA 1I01A 4O0LA 4W1QA 1DFIA 1E3TA 1LK7A 2VWPA 4XFDA 1QC5A 1PFYA 2Q3CA 1WWKA 5J58A 1U0LA 2B7CA 3NWPA 5T6BA 3A26A 1TCBA 3AK4A 3S2YA 4BMPB 1M10A 3C6ZA 4D3FA 3TG8A 4YJGA 4JOBA 1BROA 4YDHB 2W48A 2ACEA 1FUEA 1I4LD 3CMMA 1DX4A 5GADl 4JFRA 4BMNA 5BOVA 3ROXA 1PZGA 1R4MB 4B17A 3K0FA 1D6MA 1QM5A 3RTEA 3KEGA 3A7DA 3L49A 2GF0A 1EHCA 1F12A 3C6YA 4G5FA 3P52A 4MUBA 5ESDA 1SD5A 2BFEA 5IDXA 1F0YA 1UQUA 4HAZA 3S5UA 3NXSA 1MBZA 1P0PA 2LZ0A 2FSGA 3HU1A 2DULA 3TLGB 4L6IA 4NBVA 2C3PA 3BL8A 1GXSB 1QGAA 4B71A 3BTSA 3T7AA 3VZQA 2OCPA 4JU9A 5D5PA 1T8WA 2CLMB 3FZNA 4G1FA 5AW8A 5IVHA 1T8TA 3I64A 1VE9A 1PAUA 2OESA 3W4KA 1JDBC 2YS7A 1UXGA 4CCYA 1DC7A 2XOXA 4PZ9A 2B35A 3U49A 5HM6A 3CLUC 1Y0BA 4AW9A 3AF1A 4OI1A 4A4DA 3U31A 1V7CA 2I7DA 1YRHA 4K6GA 4MKXA 4QU8A 2AX3A 4R9SA 4X1YA 3RF7A 4YUYA 2I6UA 3KALA 1HL3A 4A1FA 3O2SB 2VPPA 4L4YA 1HT3A 3HN2A 4TYYA 2MR6A 1PJTA 2KS6A 3EODA 4LE1A 3VHRA 1P9NA 1F0NA 2KE5A 3SHQA 4AC9A 1BS2A 1JQJC 3IEMA 2P9FA 1F6DA 1NVXQ 4M2LA 3UTDA 4XE5A 1IEQA 5I9NA 3FCYA 1OXTA 1PBTA 1QLHA 1JQ5A 1MC4A 4R8VA 4DCNA 2YDXA 3BRCA 1Y1KE 2ZUDA 4I08A 3DE3X 5HXAA 5EMHA 2GNAA 5JS6A 1U1EA 2BELA 1JKJB 4FLFA 5FA5A 4G5RA 1T2FA 1YS2X 3CGWA 3PUJA 4ZCIA 3IDOA 1YQEA 2JJMA 3TI7A 4PTYA 5E1DA 4PRKA 2A9PA 3DM5A 1UOEA 3I8OA 2G6BA 3IULA 3G0IA 1V9SA 3O3OB 4V0LA 4AJ9A 2FJ0A 1CD5A 3NUZA 1OLXB 5AM5A 5AUQA 5KQSA 1UPXA 1U2SA 1JEQB 5FTJA 1NI4B 1A98A 1VBFA 1M2EA 3DAGA 2JLUA 4K88A 2WUFA 3ENVA 2FN9A 3KJEA 2EZUA 2D7CA 2IXBA 4IMRA 4MIYA 3IOBA 3RVDA 1A3CA 3VH4A 4CM3A 1GGEA 3DAYA 4TRNA 4ENUA 3BE5A 5TB5A 3W5HA 2G9UA 3DBOB 2JFBA 5F52A 3WLNA 4AS2A 5BV1A 3PFWO 3DVRX 1SU8A 4EUEA 5GM2A 2PR2A 5C8YF 2RIRA 4P22A 4EKGA 4B3DA 4YY3B 3C74A 2Z83A 3TNJA 1JEOA 1Y4UA 2HPHA 4O1IA 5FL3A 4QVIA 2R8XA 5A6VA 4DR5B 4NJEB 5A02A 1M1YA 3AH8A 1HETA 4J43A 2PKQO 2O8DA 1UP7A 1QSGA 3ZE6A 1DUIA 4KN8A 1LLQA 4EUFA 2EJCA 1A8HA 3MAAC 3OTWA 4PCVA 1KE1A 3RADC 1QG4A 2ZJBA 3DMTA 1J0CA 2EP7A 2WUEA 4GRIA 2VTBB 1MC5A 2ZRAA 4L3OA 3NNNA 4RESA 4YP5A 1AY0A 3FLEA 3I9KA 3IOEA 4RK7A 2J9RA 3K9HA 5ECDA 3TTXA 2EW8A 4MEJA <