2QXYA

Crystal structure of a response regulator from thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
LTPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDVFEGEESLNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a response regulator from Thermotoga maritima.
rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response regulator
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxyA00
1M5UA 1QO0D 3CKMA 3A0RB 1GUDA 4YWHA 1URPA 3H6GA 4OBBA 4RV5A 1JYEA 1DCKA 2LPMA 4PZ0A 3F6PA 4XARA 3W9SA 2QXYA 3JPYA 4KVFA 1JFVA 3KCNA 2IPMA 4MR8B 2MYPA 1B00A 5CNIA 1Y1LA 5E3JA 4RK1A 1DCMA 3K4HA 4YV7A 4B09A 1H9CA 1D2AA 1GCGA 1TJYA 3JPWA 4G0OA 3VNBA 1DJMA 2IDMA 1Z12A 1U2PA 4KNYA 1YTUA 1LBIA 3EJWA 5FWYB 1P8AA 3ROTA 4EYQA 4G0MA 4MRMA 5B3JA 4MQEB 5FWXB 3HO1A 4RZSA 2P9HA 4EVRA 1Z25A 4KFCA 4JP1A 4P98A 4GNRA 1YMUA 5KC9A 3F73A 4ML3A 1USKA 1NXWA 5F64A 3MF4A 2P4UA 2WWVD 3RVKA 3TMYA 4ZMSA 4IRXA 3GBPA 1VLZA 2HQRA 3CS3A 4KQ9A 5JS2A 1LJLA 3GT7A 4G0ZA 3E61A 3RVMA 3SAJA 3GYBA 2QW1A 4RK7A 6ABPA 2A9PA 2IPNA 3M9WA 1JBEA 1Z15A 3QEMA 3LMKA 3QLVC 4RK0A 1YK0A 2RDMA 3O74A 3CFYA 2ZWMA 1EWTA 3JVIA 1NXSA 3RH0A 1ZY2A 4MS4B 5IBQA 2PMCA 3EDCA 4HNSA 2LUOA 3QK7A 3RVJA 5BQ3A 5TQJA 1QP7A 3GBVA 3UK0A 1XWWA 3FFWA 4YP9A 5KWSA 2NZVG 2WJAA 1TVMA 1CEYA 1Z26A 3O2SB 3HCWA 1T34A 4D74A 1GLGA 4M88A 2PL9A 1EHCA 1S8NA 2N9UA 3H5OA 3MYYA 4H60A 1BDIA 2FQYA 2WB4A 4Z4EA 5FBKA 1JDNA 4KZKA 4ETIA 3CNBA 1L5ZA 3H5WA 5DCLA 3LUGA 3TX6A 3KTOA 5KQMA 4P1ZA 3SM9A 2AYZA 4MS1B 2JB9A 4MR9B 4OATA 5TE9A 4TLMB 2HQOA 3B2NA 3H5LA 5HSGA 4F3TA 3GWGA 2LP4Y 1J56A 2JVJA 5HM6A 4JB2A 6CHYA 1ZGGA 4MYRA 4Q6BA 4MR9A 1JX6A 1KGSA 3CU5A 4EGSA 5JNTA 4GPAA 4F12A 4RXUA 1FSPA 1SD5A 4N0PA 3OQMA 5KQLA 2IKSA 5CNKA 5B3JC 3MMNA 2L18A 3HDVA 1DP4A 3MM4A 3EQZA 3EQ2A 5TQ0B 3K9CA 1LK0A 1ZN2A 3HUTA 4IMIB 3N6VA 3NHZA 5CNJA 4Z4IA 4LRQA 5DKFA 1EWVA 4G0YA 5TQ2A 5HKOA 3H5VA 4LE2A 3FDFA 1DCFA 2BGGA 3F7NA 5IEJA 4MR7B 1D4ZA 1M2FA 2Q5CA 2VUHB 3FGZA 4H3HB 4MAAA 3Q7RA 4IGAA 2CD7A 3DGEC 1Z2EA 1USGA 2R47A 3IP5A 4JAVC 3SNKA 2GBPA 1M5TA 4D6YA 4MR7A 3QX8A 2OENG 3CG4A 3FFTA 4EVSA 4MLDA 5EWLA 3ROFA 3Q7TA 5I4CA 4N03A 2A9OA 3OLWA 1D1QA 2JRLA 2MYUA 2MSKA 5FBHA 4EYGA 4YCSA 1NTRA 3QELA 4RY0A 2B4AA 1FQWA 3ILHA 4FE4A 1RZRA 5D2CA 3H75A 3BILA 1PEAA 2FLKA 4LZLA 2FEWB 3P9YA 3TB6A 2QV0A 2FMHA 2QSJA 8ABPA 1RXIA 5DLEA 4DN6A 2RGYA 2GKGA 1RNLA 3ILYA 4QYWA 5TPZA 1U8TA 4F11A 4OLAA 5IEBA 3KG2A 5DGCA 4RXTA 1PHRA 1F51E 2NZUG 4ZYLA 4MS3B 1JF8A 2R48A 1JLKA 3M6MD 2IPAB 1A04A 1C4WA 2V0NA 4N41A 4Z99A 2L19A 1ZH4A 3OQOA 4MS1A 1D5WA 1OXBB 3LKVA 4QICA 5BR1A 4F8JA 2VYCA 3KLOA 2JVIA 3N53A 3H1FA 4S05A 3IP6A 2H0AA 3C6QA 2QVCA 5GQSA 4YLEA 4DADA 1DRJA 3D02A 3T38A 5KQGA 1PUXA 4W5RA 4OG2A 2AYXA 1A2OA 2I6FA 3BRSA 3G1WA 2KYRA 3TO5A 2IOYA 3DLBA 2JVKA 2W42A 2M1ZA 1L5YA 1NATA 3DLHA 1NY5A 1SXGA 4TLLB 1ZDMA 3HZHA 3RVPA 4Q7EA 2NT4A 5BRAA 3SQNA 2QVGA 3R0JA 4NCAA 4RY9A 3OLVA 3TD9A 1ISRA 1Z2DA 3HEBA 3LTEA 3LUHA 1RZRD 2LIVA 4RDCA 1F4VA 1JL3A 1Z18A 2JK1A 1MB0A 2CHFA 3D8UA 2ID7A 3BREA 1QMPA 1OXKB 1JYFA 4UHKA 5TPWA 5T7BA 4W5OA 1MVOA 5DTEA 3I42A 3LKBA 3OMXA 1YMVA 4RS3A 2GWRA 1DC7A 3MQ4A 4RK5A 2FW0A 1QNLA 2E4ZA 2ID9A 4QPJC 2E4WA 2JBAB 4KK3A 5IUKC 5JNVA 3Q41A 4XAQA 3BBLA 1CHNA 3OO0A 3LUDA 2FLWA 2XDYA 3HS3A 5JNSA 3I5AA 4IILA 2VK2A 1YK1A 3I45A 4N47A 4RY8A 4HYEA 1YS7A 4XASA 4XLTA 3SY8A 1FFWA 5T3YA 1JH9A 4EUKA 5IULC 1MIHA 4D6XA 4KRFA 4ZJPA 1BDJA 1Z17A 3C97A 1QO0A 3MIZA 4KK4A 9ABPA 4RK4A 2HPHA 4Z9BA 3A3KA 1BDHA 4WWHA 4NCBA 1DZ3A 5EWMA 4YS6A 3DBIA 2TMYA 3FFXA 3H6HA 4WXEA 4S04A 3C3KA 3H1EA 3NNDA 4G0PA 4RU1A 5FWYA 5JS1A 2FQXA 1UDRA 4HNRA 1TMYA 1R8JA 1DBQA 4PEVA 3QX9A 1QP4A 3H5IA 3KS9A 1MAVA 4MR8A 3G85A 1LBHA 1Z16A 3Q15C 2PLNA 1PNRA 4IF4A 1BAPA 2QZJA 4MLCA 2GI4A 1QQAA 3N0WA 1BVHA 4NICA 3OLZA 2J48A 2L17A 3UKJA 1E6KA 3HJFA 4JASB 4RXMA 5TPZD 3L6UA 3JVDA 5ED4A 1NXPA 3NHMA 4W5NA 2R4QA 1JFTA 4MRMB 2FN8A 4LX8A 1VRVA 1TLFA 1RXEA 2JCGA 4ETMA 1VKRA 1XHEA 1VPWA 2NUBA 3KYJB 3N0RA 3O75A 5JNRA 3OLXA 3RVSA 4JOQA 1ISSA 1YIOA 1FFSA 1ZITA 2FMFA 3URMA 1P6UA 4KV7A 3EULA 2WJWA 2WMYA 4MS3A 2MSLA 4EYOA 1QKKA 4LDZA 2E4UA 1FFGA 1C0EA 4O1IA 2FN9A 3CTPA 2PAFA 1ABFA 3C3WA 5CNMA 4W5TA 4G86A 4G0XA 3LOPA 4ZPJA 3T8YA 5EWJA 2NT3A 3QEKA 3EODA 3IDOA 2F8TA 1LJUA 2HJ9A 4QYMA 3T95A 4MQFB 4CBVA 4KQCA 4MS4A 2PUAA 2FEPA 2CHEA 1JWLA 3O1JC 1A0OA 3JY6A 3OLYA 5ABPA 4XFKA 2DRIA 2MYTA 2X7XA 3QLTA 1K66A 4WZZA 4TMYA 2FVYA 4Z9AA 2FMKA 3RVOA 3QLUC 5TPWB 5IUNC 2PJUA 2PUBA 1NXTA 3LUCA 1ZGZA 3NNNA 3GRCA 1ZESA 3N8IA 2R25B 3QEMB 1IIBA 4L85A 3O1IC 4XXHA 4IMJB 2PUFA 4LDAA 4G97A 1MB3A 3H5TA 4YGXB 5EWMB 3M9XA 1XHFA 2B1JA 3LFTA 4Z4FA 5EWJB 2YHAA 5JNWA 1I3CA 1E6MA 2FSPA 3OM0A 1P2FA 5EWLB 3IP7A 4L4UA 1APBA 3I09A 4RK6A 5KI6A 4PYRA 4H3KB 1KRWA 3QLVA 3H1GA 4JA2A 3OQNA 1SXIA 2A9QA 3IP9A 1YS6A 1YVUA 4PICA 5TQ2B 4EYKA 1WETA 3DGFC 2PKXA 1HEYA 1QPZA 4YRZA 1U04A 5GOTA 3O1HB 3SG0A 4RKRA 1JDPA 5JNUA 4Z4CA 4KREA 4LE1A 5TQ0A 3LUKA 4O1HA 3S99A 3NNSA 1NXXA 3RVQA 4WT7A 2E4YA 3O21A 4YR7A 1DC8A 1QQBA 1USIA 2A9RA 1DBWA 2E4XA 2PUGA 2F8SA 5PNTA 4NV3A 3KHTA 3KSMA 3LUFA 1EAYA 3CLKA 3L49A 1W25A 3N0XA 3VNAA 3IPCA 1AB5A 3HXMA 2PE5A 3CRNA 4DQDA 3E3MA 2M98A 2PUEA 4NQRA 1P6QA 1ZH2A 2O20A 1CYEA 1NXVA 3OMWA 4MQFA 2HSGA 3N75A 4Z4GA 3NBMA 4Z0NA 2IYNA 2FEKA 1AB6A 3F6CA 5BRJA 2WRZA 2RJNA 3QLUA 1JFSA 4E7PA 4N76A 1Z13A 4WXMA 2HQBA 3RVLA 5IUJC 3CZCA 1KMIY 2LBPA 4Q6WA 4E7OA 1E2BA 4G0QA 1BA2A 2FTKE 3HUUA 4JB0A 3HM9A 1PEYA 2CWDA 3HK2A 3LUAA 4RWEA 4TN5A 1JHZA 4HNQA 3HVRA 4UHJA 5HQJA 2FMIA 1U0SY 4RSMA 4FE7A 2E4VA 3KLNA 4FB4A 3QELB 3LUJA 3O2JA 2MSWA 1U2QA 5KQPA 2JBAA 2MYNA 3CG0A 3RVNA 1W9HA 2QR3A 3T6KA 3O2QB 3Q7SA 2FKAA 3CHYA 5IC5A 1ABEA 5KC8A 4W5QA 3A0UA 1ZHHA 3IPAA 1GUBA 5C5CA 4KPYA 4EY3A 4MPTA 1ZVVA 4OLBA 1DBPA 3GL9A 3KKEA 4WUTA 3JS5A 1DRKA 1QP0A 4ZMRA 2QU7A 2FXIA 2OQRA 1NXOA 3KYIB 3OM1A 3EGCA 3FMVA 7ABPA 1PNTA 4LE0A 3HDGA 3OO1A 2WY2D 1E6LA 5C5EA 1DG9A 1SRRA 2PUDA 3RVRA 3DZDA 2PUCA 3CZ5A 4Y9TA 4PE5B 3C3MA 2VUIB 4N0QA 2YHBA 1RPJA 4F06A 1EFAA 3A10A 4YO7A 3EAFA 4ETNA 3HV2A 3MA0A 3BRQA 2H3HA 3GV0A 3JTEA 4Z4HA 1D1PA 1EWKA 2FQWA 2GX6A 2ZAYA 4KMRA 3Q9SA 1K68A 4MQEA 5FWXA 2IPLA 1KRXA 2PL1A 3KJXA 4RKQA 3UUGA 4O5AA 1GCAA 1ZAYA 4MGEA 5IX8A 4OTZA 1M2EA 1TM2A 2L2QA 3HSYA 4EVQA 3GA5A 5CHYA 2RJOA 3RQIA 1SXHA
chains in the Genus database with same CATH superfamily
4LBWA 3DHNA 2UAGA 4L8WB 4TUYA 1GUDA 2BKXA 2CDRA 2ZJ7A 3F7TA 3K9QO 5K51A 4LFBB 4DZRA 1U0JA 1SU6A 3T1VA 3SP1A 4QZVA 3ZIAD 4CUZA 2FJPA 1U8YA 1J8YF 4FKMA 3QVMA 4RFVA 3CISA 4AKEA 3U7IA 4UMVA 2QTVA 5KHLB 3EPKA 5HIJA 1O94D 2HGSA 1B2LA 3KB6A 5MN5A 4A27A 1W4RA 1PJLA 4Q9JA 3BE4A 3C7TA 3GJZA 1UIMA 1MZPA 5JTTA 3Q2IA 5SY4A 4V1CI 3G7NA 3HRIA 4NIMA 4MRMA 4QC2A 3LX5A 2IX9A 5ALMA 3KR1A 4YHBA 1X14A 3E3LA 3HGTA 2X1HA 5BYKA 3ADOA 5INTA 3CVWA 4R2WA 1R5BA 3EXHB 1ZVJA 3DEKA 3HI6A 4GNRA 1IPEA 1RXUA 4Q00A 1KO7A 2EEZA 1Y3CE 2QJTA 3I3OA 3AI3A 3IQDB 1M6NA 5BSFA 2VOJA 4YMIA 4F85A 4KR7A 3Q8LA 4UOEA 3CS3A 4C88A 1UAYA 4KBYA 4PNHA 2WTMA 2J5XA 5HZKA 5L9AA 1FUKA 2F4VB 2GCGA 1ID8A 1N5KA 3JQDA 3WX0A 1HK7A 4ENQA 3KFVA 3ZD6A 1JBEA 4YJ3B 3T3EA 3H2GA 3OCVA 1J22A 3VR0A 2AXEA 3CFYA 2GKOA 4PYJA 4I2NA 4PLPA 2ILVA 1SJ9A 2DWUA 3EGOA 4DE5A 3OWOA 1Y37A 2EEPA 4X71A 4BGIA 4BOYA 4AXXA 1T29A 5CLHA 3MS2A 4LZZA 4F71A 3UK0A 1I2AA 1XWWA 5AI9A 3JAKB 4JT9A 3SF8A 5L7TA 5L95A 3L4BA 2ZRBA 3IEUA 2W6JD 1RMQA 3U7HB 2NO9A 2R4UA 2ON6A 1N2BA 4RJLA 4D97A 3QG1A 1JG3A 4EA6A 1M83A 4F9FA 1BA3A 1V8FA 3HN2A 1FTWA 1PYOA 2B4RO 2E1RA 2SKEA 5FPYA 1R4NB 4F4UA 3MCTA 3RSQA 2QSZA 1NUSA 2P78A 3JYHA 3QPVA 4ITRC 4LQDA 3TX6A 1ZHFA 1DLJA 3QU2A 1QHHB 5AOVA 5B2EA 2XBUA 4MB6A 1GTRA 5DDIP 3E7XA 1UH5A 4QYSA 2F1JA 4GXQA 4REMA 3CX7A 4N3NA 3VU3A 4TLMB 2O5CA 1PTJA 2IYUA 2VTDA 3FFBA 5HM6A 4C01A 2ORWA 3LVBA 2AW3A 3OEEA 4FFBA 3D3KA 3H3FA 3RHFA 4PR0A 5JIBA 3K6SA 1ZXLA 7REQB 3PVZA 4KH0A 4LDJA 3M6AA 1VL8A 2RH8A 2ZUDA 1DADA 3IXQA 4RPKA 3WLHA 5IVPA 1DELA 3HDQA 3VGJA 3EC2A 1YVPA 1T1JA 1N6LA 4JJZA 1SXJE 3EQZA 1KI2A 2X23A 1P0CA 4AJKA 5CFMA 2H4ZA 4LYJA 5TQ0B 1RMYA 3EDYA 4IKOA 1Z68A 4MIKA 4HB0A 3DV2A 3MW8A 1E9RA 1A9XA 3R9WA 4FCVA 2VLIA 1QF7A 5KWVA 3T54A 1XMIA 3EAGA 1RQNA 4F7WA 4NBWA 1K5DA 1AG9A 2XYQA 3ZIDA 1HFWA 3A1CA 1A9YA 4KDFA 4TMTA 4JJIA 2TS1A 4LHVA 4MQMA 4JBYA 1WXIA 1XZFA 3OTHA 2W4IA 3QE2A 3B13B 4MW7A 4L6IA 4OX9Y 3N2NA 1PDWA 4LTMA 1Z5ZA 4EVSA 2OENG 2VZLA 5JU6A 3E18A 4OQ4A 1B93A 4KVGA 2QZ4A 1E2HA 1EKXA 1QV7A 3QA3E 2QW0X 3LT1A 3OT5A 9GPBA 2WWFA 2WHPB 1B0PA 3RABA 4YI5A 3K0EA 3QELA 4K5QA 3FAKA 1IHDA 5EYPB 2IYLD 4X66B 4C89A 1RI4A 3FNHA 2C5HA 2E5LB 4AK9A 4EFKA 4MKXA 1NWHA 5BT9A 1Q7GA 7ADHA 5L4NA 3WMXA 2BGKA 5KYNA 1AZTA 1I7NA 1RI2A 4B6PA 3QKRB 4KXWA 3DKKA 2QJRA 1P77A 1KJ8A 1PHRA 3H9BA 1KDOA 2CV2A 4GH5A 2HKIA 2PVSA 3FNBA 1Q92A 3PFWO 4HQOA 2I2BA 4UDNA 2FHPA 5LJIA 1GNQA 3EZXA 3HB4X 4JK3A 3SBEA 2BCJQ 2OV4A 3Q2KA 5HTKA 4YLYA 1Y6ZA 3LKVA 4MV6A 5BSUA 2QUBA 1G8FA 4US0R 3W6ZA 1CF9A 2I65A 2REOA 3U7EB 2PV7A 3UFXA 2VCHA 2AG5A 1V11B 2OBBA 3GGDA 2WF6A 4C4PA 4DCGA 4XIYA 2JCVA 4DLTA 4ZOEA 2AX4A 3FUUA 5CG2A 2WE7A 2BFPA 1PUXA 2X13A 3CB4A 3FCAA 2XCIA 5SZJA 3R7WB 5AW4A 3RYFB 2JIMA 5IK2D 4LWZA 1Z0JA 4FFLA 1QG0A 1WX1A 1T2NA 5FBVB 3DLBA 3FF1A 1SG9A 1TGYA 1SULA 3E27A 2H07A 3LC1O 2JAOA 4E32A 3DLHA 4BNTA 2HCJB 2CNBA 1YBFA 1BC5A 1MB9A 1GUZA 1WHSB 3I4CA 3ZV3A 2IHNA 2OAEA 1T25A 3KAJA 2HPZA 2VTKA 2AOXA 5ER6A 3RRYA 3LRXA 3W8DA 4ZARA 2NZWA 3V8EA 1Z2DA 3R6DA 5G02A 3V9PA 4ACBA 4CKXA 1KSFX 4ZEMA 3C6KA 4U7HA 3WGMA 3MERA 4WZ6A 1UQTA 1HBJA 1E2LA 1JNXX 2DGDA 2ICAA 2W2NA 3BREA 3BXGA 3IKMB 1JG6A 1WVGA 3BXXA 1J2EA 1HOTA 2DUNA 4UHKA 3A4IA 3ZGNA 3ZY6A 1JQAA 2NX2A 1MVOA 4RNCA 4X1KA 3A7EA 1UBMS 4FYIA 4X92A 2QAIA 3M6LA 1GPDG 3F9CA 1DC7A 4ZCSA 1EXDA 4KXVA 4H9GA 4G65A 5BN1A 3QY9A 5B1DA 3TEFA 4MDFA 4E1BA 3BBLA 2H54A 2ACVA 5GAJA 3M1IA 4FJ0A 1C14A 1U8CB 3GUCA 4H31A 5DWVA 3L8MA 3DEYX 3PXGA 3MGBA 2PLRA 1U5AA 3ESQA 1GOTA 4V24A 4IV0A 1F7UA 2WWXA 4G56A 4WCFB 5A05A 3FTFA 4Y2RA 3W5HA 4HZIA 4MUJA 5LFAA 5LXTA 1L6RA 4HDRB 3QV2A 1AS0A 2VZEA 5IS2A 2BH2A 2HT1A 2CLLB 3O4HA 3L7LA 4O4JA 2O8DA 3EPJA 1QGUA 3K0FA 3WKCA 3UAOA 5KDDA 4BO1A 4FB5A 2FPLA 4WN9A 3L06A 4N5NA 5I7VA 4YRLA 4ZRMA 1EX9A 1RYEA 4WFKA 3CPEA 3G0CA 1V1MA 4U6SA 4WESB 3KYCA 1V7QA 2WD7A 4RORA 2Y99A 5AM3A 3ONWA 5LQDA 4AC9A 3QMPA 3EXHA 2LGJA 3WK4A 1JECA 1E4EB 2GZHA 2HMAA 5U4QA 1GRCA 1PNRA 1HE1C 3DPSA 1DG1G 3ET4A 3OLZA 4KTTE 4W7IA 5GZ3A 2EX0A 5TPZD 4TKZA 4RTLA 1M2GA 3PS9A 2X0RA 4LJYA 3H65A 4D56A 4UTRA 4G81A 4TV8B 3W34A 3QNUA 1M1ZA 5LOVF 2XB6A 1UWKA 4DF3A 1VCOA 3I2GA 3OX4A 4EDHA 2GA8A 4EWLA 3A28A 3TTYA 1H1TA 4IDHA 4NFYA 4I66A 2O8CA 1G7TA 2B7LA 1UBGA 4XSHA 1PWEA 3ROMA 4EY5A 1SA0A 3ZU5A 2QTBA 3U4CA 2O8FA 2E4UA 1H8HA 4R2HA 3K8QA 2ZUCA 3CM0A 3EFEA 4W5TA 2G5GX 1KOLA 3O8RA 2B7CA 3N2KB 3Q6MA 4B7XA 4BZZA 1LX6A 3EDQA 4I9UA 4CM4A 2IPXA 1HKUA 2C3MA 3BVPA 1O4WA 4BJ5A 3TZEA 1XROA 1D4OA 2H8KA 1W4BA 3L8YA 1QV6A 3JQ8A 3IDAA 5GIPE 6ADHA 4MQFB 5DLQC 1XG5A 3U3ZA 5GGXA 2WT8A 3EW7A 4BP8A 3KXDA 3U9SA 3TRFA 4E4TA 1D8TA 1LJ8A 3RIHA 3W6UA 2BV3A 1U3WA 1YE8A 2I29A 1W46A 3ETLA 3PUVA 4ZK6A 5EZ5A 3RCBA 5K8CA 3DW1X 1N3BA 2ZXFA 4FI3C 4QPDA 2YXPX 1E9CA 1RYMA 5KNBD 2IBTA 3EF3A 4CQMB 3LPMA 2GN6A 5BSMA 1T9CA 3DLAA 4YJFA 4CQMD 4IDOA 3CBGA 1NPDA 3OETA 1QYVA 2C99A 2PPVA 4HTFB 3ZWCA 1NXTA 1XCGB 3TQFA 3BGOS 5T64A 4UBJA 2O3TA 1I14A 3RTAA 1W36D 1NG1A 4JT4A 3KJQA 3KKKA 5D8DA 3W3AH 4K9KA 3G2NA 5EQJB 3UV7A 1MB3A 4HNUA 4FOLA 5LDDC 3GGGA 4JUAA 2PX6A 3HFGA 3IUEA 4G23A 4U39A 5IP5A 5DBOA 2X41A 4XUCA 4C1NA 4XB6B 2Z8XA 4CLHA 4GICA 4RADA 4UQOA 3V4PB 4PN3A 1CZHA 3RUPA 3H5AA 4DQUA 3FHTA 4V0SA 1Z56C 1TI7A 1M2OB 1X1CA 4LXUA 4NPAA 4GPTA 2G80A 2AG1A 2ZJBA 3CZPA 2IF2A 1PT9A 4LHZA 4B85A 3QHPA 4G0NA 3T1OA 2OCLA 3IP9A 3IUPA 3M33A 1L4YA 4QULA 2ZRIA 3H9JA 5J5VA 1T43A 3L6DA 4XOUA 2VPQA 2OCXA 3DGFC 1Y5IA 3K6KA 5DI9A 4NWIA 1KEPA 3ZY5A 4E5YA 3R3ZA 4HJRA 3PKIA 1LW7A 1RABA 2Z5FA 4ZVLA 1MOPA 1QGAA 1SEVA 4H7KA 4ENTA 3FZYA 3IMKA 2CGEA 4OXRA 5F98A 2EC5A 3R6TA 1B3BA 1KI6A 4HDNB 3GRAA 3SJUA 3MJEA 3EPHA 3TJRA 3I5YA 4RVDA 3SSAA 1QFXA 2IELA 4F2GA 5CBPB 3BMNB 2F8SA 1JFFA 2RONA 2QX8A 3GRZA 4J0GA 1G5HA 1P1RA 3O94A 4NV3A 4WOJA 4BATA 4D4MA 1ADBA 4PPGA 5DCWA 2X6QA 3GFOA 3ZH9B 1J0BA 4JLJA 2DSTA 4MNTA 3OOWA 2MINB 3DM5A 3ACBA 4R7TA 5TT1A 3OPXA 4M9QA 3PI6A 1JEQA 4TVKA 3H9CA 5CX1A 3ZWPA 3LCUA 1K3UB 3L1IA 2XT0A 1B0ZA 3SF0A 5C81A 4KXUA 1CFJA 2OZKA 3OMWA 3WIDA 2CVFA 1FDOA 1ZOIA 2ZJYA 3EG9B 1CPYA 1OLXB 2D2IA 4TRNA 1PLKA 3S1LA 4I5IA 1HEIA 1GG2A 2HQBA 3FVRA 2BMWA 1QIFA 3EXAA 2GCEA 3P0IA 3GHHA 4H1WA 1V41E 5CA0B 1NFFA 3ETJA 4BECA 3OEHA 4O8CA 1A8QA 4Y9SA 1ZK4A 1RAAA 1WS6A 2ATXA 2P4HX 3JALA 4W9MC 2BMDA 3LJKA 5GTDA 5EUMA 5KU7A 2W4MA 2I6QA 3F8WA 4IIJA 2I2FA 4AMUA 4AMBA 4BNNA 4MYUA 4FE7A 3ZGYA 3KLNA 1YBVA 3VPHA 4EBBA 2CC2A 5FA8A 4D3FA 4F96A 1K7EB 2AFIE 3PNSA 1A88A 2H4FA 4AP5A 1YDMA 2JLBA 4M54A 3DQZA 3SX4A 2NP7A 1RAGA 2PSEA 1WF3A 3ZTWA 3TK1A 1WU7A 4B0PA 2C2ZA 3OJCA 1VKJA 3ISJA 1KXJA 1FQKA 1SVOA 2PZGA 2E5WA 2WNIA 4J1NA 1FFXB 1OKKD 2BRUA 4NF2A 4WECA 1NVXQ 4UHDA 1HM5A 5T8KC 3UK2A 4B48A 2R6HA 1A2BA 4HDKB 1NLZA 5B5SA 1DBPA 5EIFA 2AG6A 4FEEA 4JI8B 4QJ5A 1T8YA 4EFNA 3FYTA 2BTEA 1PLLA 2LWIA 3FKSA 1EGMB 4YHHB 4G5XA 3MYRA 2NPFA 4X1KB 1I5EA 1ZM3A 4BP9A 5CIQA 1SCNE 2W43A 5K3SA 3ZUPA 1Q74A 2O8FB 2FV8A 2GILA 3GJYA 2X8JB 3ZCPA 1HORA 2IP2A 3D4OA 5FTKA 2IITA 2NV2B 4I6EA 4CM4B 1E2GA 1TD1A 2JGRA 4FR0A 1UQRA 1T36A 2PTHA 4N5DA 1YTLA 2BP7B 1WSAA 1XLVA 1YZ3A 2VPYA 3I6QA 1GUYA 4NONA 2CFRA 3NWPA 3WTBA 1RFGE 5ITWA 5D5QA 3LK7A 2R2GA 2QD3A 3SC2B 2ZAYA 2BEUA 3L7CA 2Y4NA 3FPGA 3MT9A 5FWXA 1M0TA 1QOZA 1L3BA 1PJSA 2PL1A 3DXZA 3PU6A 4ILKA 1CQJB 3WLEA 3DTVA 2FY8A 2CSXA 2J0SA 1VCNA 2IW1A 3VSCA 3QXHA 5CA1A 4JI4B 1PNOA 2L2QA 3ZBQA 4O4JB 4TS9A 3EDMA 3KTFA 5ALPA 3RQIA 3F3SA 1U8UA 3EYWA 3WWEA 5CU7A 4YRNA 3RAGA 4TZ6A 3AY0A 2XOEA 3V7FA 2LPMA 2VEOA 2Y1OA 4V02A 4OL0A 3I53A 3JZAA 2HLNA 1KIFA 1JFVA 1LRJA 3D6NB 4NP6A 1PRYA 5G3YA 4B45A 5AFSA 6PFKA 1W59A 3OFND 3LCRA 4NKRA 1DCMA 1QRDA 4YV7A 1ES9A 1TKRA 2EKBA 4LXTA 4UTXA 3KIPA 4NESA 1JVSA 3JQCA 1QONA 3ITKA 5ESWA 2J9XB 3IIJA 1KOJA 1I80A 4RJIA 3EJWA 1M2OA 3NG1A 4LFAB 2D06A 4IIBA 4MQEB 1ZWKA 2DFKB 2DT5A 4G1BA 1S8FA 4UNNA 5HFJA 2P75A 5I8PA 4IDQA 3E8XA 4IWYA 3OBBA 2RGBA 3CQ9A 4UPVA 1AK9A 4DV6B 1MVLA 1ZUNA 4JP1A 3RV3A 4E5PA 4ZVMA 4MVJG 1MAAA 4J9UE 4PLHA 3VZCA 3W5CA 1XTPA 2ZAMA 4INAA 2D5LA 2ZBVA 3P9XA 2G17A 2HQRA 2ZDQA 2XMBA 4FYVA 4RHXA 5JDIC 5SZHB 4O0LA 1M1NB 4M6WB 4MUXA 3BH7A 4RK7A 3SQDA 4BN0A 1P9LA 1YOVA 4D4KA 4IVRA 3ZJVA 3PEVA 2QORA 2VP3A 2ZIEA 4FUQA 4IDPA 4DDHA 1J5XA 4M36A 4JKYA 1DKUA 2I3AA 4LWPA 2PRSA 1YOBA 3JVIA 2HWUA 4L73A 1WXGA 3V3TA 5A7FA 5AVYA 1IULA 4CXMA 4H7IA 2PMCA 2C4MA 1YCDA 1G16A 1R0RE 3BQNB 2D4HA 1Y1PA 5AMXA 5FWAA 1EUDA 1BQEA 4N6OA 4X1IA 2XEDA 3PXEA 3UPTA 3BCUA 4JLSA 1K2WA 3WBKA 2HXSA 1NNSA 2GVZC 1CEYA 1V4VA 5CB4A 1KFKB 3GCXA 4J0JA 4YGYA 4EZIA 1X15A 2C1ZA 3DEJA 1DSSG 5HMMA 1EK1A 5BWLA 3AR4A 4ZTZB 3QY0A 4R2LA 1CP2A 1LNZA 2HB6A 5JG7A 5IH3A 1L5ZA 3ESRA 3A4YA 2NUAA 3M2TA 4KDEA 2Q41A 4S2EA 1NX9A 2Y77A 1NOKA 1I2ZA 1WV1A 2AYZA 2I34A 4MR9B 1U7WA 2XNJA 2GM3A 4GPD1 2OC9A 4P3XA 1TAHA 1J97A 3DEAA 4Q7JB 4DCJA 5KKNB 4LZWA 1N8NA 3DFZA 1Q16A 1H2RS 4GSYA 2UYGA 4ZT7A 5E4JA 1RWMA 5ALUA 4KACA 1AO3A 2HV9A 2JHPA 5AHRA 3UZUA 1FL9A 2RH5A 3RUCA 4ZI2A 1KOFA 1Q91A 4EQZA 1NYLA 4K87A 3UY4A 5G1OA 1PBTA 4B81A 5CVVA 1C1YA 5B3JC 4U2CA 4IF6A 4PZLA 3ZHQA 4J43A 4AN0A 1ZL0A 4FGKA 4HL6A 3MM4A 2ZIVB 1WUTA 3JD2A 1T2EA 4BNVA 2PMFA 5JJBA 3DBHA 5K8LA 1NKTA 4A3SA 3HXTA 4C6SA 1QQ7A 2XVAA 5B1YA 3TZQA 4K1XA 1IJFA 2FX2A 1FFEA 5C2JB 1FP6A 4Z4IA 2ZKIA 4RKWA 2OPBA 3KJHA 2QNBA 4IP0A 3V9AA 3DOOA 5J23A 2YXDA 2ZE8A 4W5WA 5CT9A 5IXYA 2XW6A 5JAZA 2XWBF 2YNMC 4WA7A 1D4ZA 4DGSA 3KQNA 3NP9A 3CVOA 3O8QA 4L4RA 4RD3A 2OB2A 3IO5A 4A0RA 3TSAA 4I3GA 2XT6A 3T3IA 1A7JA 6LDHA 4EGCB 1JLLB 5FO1A 3QVLA 3GCGA 1FYFA 1WULS 2ZQ5A 3CLSC 3O8NA 4MLDA 1ZCJA 1ZK0A 3IILA 3C7AA 3KVNA 5TT0A 3SKXA 4CF3A 3WLPA 5BSHA 1RI3A 4G89A 4HQ0A 5T57A 1PJBA 5DW3A 4B3TB 3A6DA 1EFTA 1K3FA 1NOIA 2HZBA 2I4NA 2MYUA 3LE8A 5FBHA 3ZHVA 1NDHA 1JBQA 4R51A 4QT4A 2IU3A 1K08A 4MEJA 4NMHA 1L8QA 1FP4A 1N2IA 3CSDA 4ZT6A 1M74A 1VE3A 1Z5UA 2H1SA 4G26A 3AJDA 3UN1A 3ICWA 5AP9A 5EESA 1W0JA 3ENKA 5CA0A 3FPHA 2RGYA 2YWFA 2J85A 2XX3A 2WWIA 1QHNA 5IXJA 2EV9A 3WRVA 3A1WA 4TYQA 4ODIA 1N7IA 1WSBA 1JF8A 3GG2A 3RJTA 2ZTSA 5FTLA 5L45A 1Y1KE 2V7BA 3AHDA 1UXIA 1VJRA 1E2NA 1C5KA 4QXMA 1YCHA 3BRCA 2H1CA 5KTTA 4R9NA 3VVMA 2HFJA 2ENWA 4A0GA 3ETNA 1XRRA 3AG5A 1GPNA 2W2PA 5EHIA 2O48X 4S05A 1JMKC 1X3LA 5FYQA 3ZGVA 5F7OA 3C1OA 4Q4DA 4KE8A 1UKZA 3TUIC 4ND7A 3HKEB 1SOUA 1Y33E 3P5BA 4TTPA 1KS9A 1P39A 3SC6A 2DBVO 2I7DA 3QQ5A 4Q3DA 2OLEA 2VH5R 4AU1A 5MFPA 2HNBA 1T5SA 5IVHA 4G0UA 1SHTX 4AG6A 5BWMA 1WPRA 3ANTA 1L5YA 3QWHA 3MAGA 4RVUA 2RI1A 3IA7A 2OQ2A 5JY6A 4D44A 4PAQA 5E4TA 5GJBA 3E15A 2IOFK 2CXNA 3E6AA 4AD8A 3PX7A 1ND6A 4IH4A 1WP9A 1KR5A 2EJVA 3PUHA 2PH1A 2PZAA 1F60A 1GKLA 3VU1A 1XTQA 2OCAA 4JENA 1I7QB 3X1JA 1CNFA 3GHYA 4BV8A 3L9XA 2VP5A 3LW8A 4X8LA 5E0OA 3W5IA 5JWOA 2DPXA 1SWWA 1I7LA 1IY2A 3QVKA 3ZDEA 4H6WA 3NBXX 1F5SA 1FDRA 4QEZA 3IVGA 3MQ4A 3PHIA 5DXFA 4OI4A 3RIMA 2ROQA 2GGSA 1LTHR 4XVCA 4W7SA 4YRMA 5IJ0A 3KD3A 4O2AF 5BV7A 1S9HA 3Q9UA 4OJYA 3IMCA 1KKUA 1M9NA 1GV0A 1TA4A 1YRQA 4ALIA 4C4TA 1ZP6A 3ZCUA 2CDAA 4L8LA 3W6PA 4BFTA 1M0EA 4DJAA 1MEOA 1O89A 4R40A 1SKYB 5EVJA 2V1XA 2EL9A 1OX4B 3PNKA 1N3YA 2BZSA 3A9TA 3FUTA 4DLXA 3DDHA 4R31A 2GAAA 4N1AA 5BV2P 4FKBA 4GGOA 4D9NA 5KVAA 2NQ8A 2V3WA 2Q1WA 2JFNA 5KINB 4JYZA 4FCCA 3BFXA 4ZJPA 4FHZA 1EUZA 1QYIA 5LQSA 4I4CA 2VBGA 2PL5A 1B4DA 4BMSA 2QGZA 2V7UA 2QIPA 2QB5A 2VWGA 2WE8A 4YS6A 1K7CA 3DMRA 3C3KA 2WIAA 3N70A 1A76A 3L6EA 2C2YA 1DX4A 2PVPA 2XUAA 1UDRA 1N3LA 1YJQA 2QRMA 3RJMA 5YASA 3AR8A 5AESA 2DLNA 4CLRA 4PEVA 1EH5A 5LB4A 1RI5A 1GVHA 4EARA 3I52A 3PC7A 4JD5A 3G85A 5BNIA 3L8EA 4G5SA 2WHYA 2WNHA 2D5BA 2UDPA 2LCIA 1A5BB 1HDEA 3G5TA 4ZZ2A 4BFSA 2IYOA 2OFWA 2QD5A 4ESOA 5G1NA 4NECA 3AWDA 1AOXA 4IVPA 1SBZA 2XNKA 3NHAA 1HYEA 2WJIA 2XRFA 1AKTA 5CTAA 3MWDB 3KQVA 1KMNA 3C1AA 1RXVA 3OPYB 1JIIA 4EHBA 4F1KA 3COWA 4IH9A 1BKSB 1RM4A 3P0EA 1L4HA 2VT3A 5HCUA 3CX3A 2BONA 3KZ1E 3NWBA 4FX2A 4BNDA 1NVUQ 2WVAA 3DL7A 5AK5A 4JOQA 3UMFA 4IVNA 4HEA1 4MI1A 3UOAB 2P5SA 1I7SB 4FBMA 3M82A 4FLEA 2IY9A 2VA9A 3BM5A 4WASA 5EIAA 4DQLA 1GL3A 2YIDA 1F1JA 1YR9A 1M2KA 4L57A 2O2HA 1F0KA 3MIIA 4Q0MA 4UBNA 4Q9KA 5IC6A 5LBTA 3VH4A 1CLEA 2ZSBA 5BSKA 3OEED 2ZVDA 2I55A 3ZLVA 3GCDA 3K35A 3M2PA 1XDZA 4B5KA 4L6CA 3PF8A 3I9KA 4JH0A 4TKUB 1KDYA 1OZ0A 1N0UA 3PQFA 4L5YA 1NIJA 4V38A 1V8OA 2SBTA 1WQ3A 3HP1A 1QGYA 2YXBA 4WKNA 4ERXA 1GG8A 4NEHB 1RKBA 1NF3A 1SKYE 1L7RA 1Q6YA 5A4IS 2VSNA 1KYTA 2O0KA 3DMNA 3S28A 2ZM5A 1WQ1R 3WGHA 3FD8A 2XMGA 4DLAA 2H16A 3QBEA 4FZJA 5A3SA 2F55A 2KE5A 4CCAA 1XTIA 2IYTA 2QK4A 1RADA 3TLGA 2ZP1A 1G21B 1FLNA 3B70A 1Y7LA 4GC9A 4DBZA 1JSLA 2W6JA 3OF3A 2W9XA 3C3BA 1P5RA 3P45A 4HWTA 1OI3A 2VNKA 4CMHA 2AFVA 2EQ5A 5LOVA 1KHTA 2IY7A 3A2NA 3CLTD 5AVTA 3BJRA 2R87A 4F8YA 1W94A 3WQSB 3GP5A 3QVUA 1G3QA 1QS0A 3QXJA 4E33A 3T9CA 4G5YA 2XUQA 3JD3A 1KKLA 4EATA 5JNWA 2HBRA 4WKOA 3ST7A 3DBRA 4C03A 3NIGB 2O7VA 1JKMA 2WIFA 3IP7A 4NPHA 3T4PA 1VLJA 1APBA 5IANA 3FNGA 3K94A 4RJTA 1NMXA 4QXRA 4AJPA 1NX6A 1PL8A 3FLEA 1SUFA 2R5NA 4UFNA 3DCYA 3RSGA 1XZHA 4ERNA 3MINB 1TJPB 3VHQA 4D2IA 4LISA 2NSHA 1A8IA 4H17A 2W2KB 2VJDA 3CF2A 3E2MA 5EIHA 1WRBA 4ENSA 3WL3A 4XRRA 4R1PA 1XCJA 1G9TA 3SR4A 1D09A 3ASUA 4BX9A 3FHCB 4RHFA 4YRZA 5IZCA 4OHXA 4AZ3A 1WDMA 4H7PA 1Y3DE 4P38A 4Y9UA 2ZSUA 4KREA 3RE1A 2H17A 3WWYA 3TD2A 1U9YA 3CX8A 1J8MF 2BC9A 2KI5A 3I1YA 4EB3A 3ZE0B 1TT5A 1L3CA 3EYAA 4JJ7A 3MB5A 1KAOA 2J5BA 1NN5A 1R9JA 4M87A 4RTRA 1UBHS 1W5TA 5EE9A 1QJ4A 1GNTA 1EZ4A 4CQNA 5HDBB 1WOYA 4MKFA 3FZNA 5DCYA 1MO3A 4JFRA 4XGKA 1TJ5A 1RIIA 2XVXA 3TOCA 2P6RA 1HT1E 1W25A 3K4PA 3ZS9A 2PE5A 1HURA 1E99A 1TYCA 1ZMOA 1DEHA 3LP8A 1FNBA 2M98A 2Q5HA 4DT1A 2I3GA 4WV3A 3U39A 1U7ZA 3PR2B 2GYVA 3A1EA 2ZATA 2FPKA 3VNRA 4Y1RA 3TR0A 3UXYA 1ZN9A 4JKOA 4IRUB 2RJNA 3WYFA 4E21A 4Z2AA 2A1TR 3ZY2A 1GGKA 2DH5A 2I2AA 5KBYA 1RJGA 3IJEB 2D1TA 3TLJA 1U6IA 4LF7B 4G0QA 2LZ0A 4AFNA 3WGLA 5BR8B 2I3BA 3GJ5A 2PZMA 4GIBA 4P7KA 3UV6A 1E0JA 5GY7A 1WW2A 4LN1A 5IBPA 1V3QE 1TVCA 1W87A 3PITA 2BI4A 3DZ8A 3G9ZA 1FE8A 4MYHA 5KJFA 3ZQKA 3ZQ4A 2D8AA 2J3QA 3LH5A 3WLTA 4MHSA 3R5XA 5BMVF 2REQA 3Q7EA 2AMVA 3SYLA 2GB4A 3IQZA 1U2QA 5J1TB 5AUQA 5JALA 4DANA 1P7ZA 3GGJA 4YRKA 4R1UA 3CG0A 1TQ4A 1ZFNA 2Z3ZA 3LK6A 3WKDA 3Q7SA 4M7WA 4V0LA 1SEPA 1D2NA 5HUJA 1E1DA 1JGTA 4MINA 3T15A 3U3DA 3NEJA 2E6KA 1RSZA 3HJTA 4OAPA 1C81A 3S2EA 3IAFA 4P3PA 5C5CA 1GZ5A 1ID1A 4MPTA 1LH0A 5E2AA 2AJLI 1MGOA 4KLCA 2BZ1A 2AKYA 1ZC4A 3G1TA 3PF9A 4NG4A 4B2LA 1PX0A 1SKMA 2I4LA 3CF6R 3GLGB 1R66A 1Z9BA 4KJZA 2OPHA 3EGCA 1Q77A 3KP1A 3PHHA 4JP5A 3GFRA 4ZZ1A 5K09A 4Z53A 1JAIA 5AT1A 5AK6A 3OO1A 2WY2D 1Y6QA 2CMFA 2AHRA 2JKYA 1E6WA 5BSTA 5K8IA 3L6RA 2BGTA 5F1PA 2J3IA 2C3OA 1IMJA 1BXRA 2IWRA 4F4FA 1YRBA 1R9MA 3C3MA 3OFNA 1TUEA 2QN3A 3FBGA 4NZNA 1QLJA 3JYQA 4UQPA 2BDEA 3I39X 4YO7A 4MWOA 1D7OA 1JHAA 1XDGA 2PT6A 4HI0E 2BFDA 4B17A 4RO0A 4D7AA 3FPBA 4K03A 4KZPA 3I12A 4RHTA 5BYAA 1WVIA 3HYSA 4NZPA 2IPLA 3SKYA 2VZ8A 3E9RA 3PQ8A 1EG7A 4ZAWA 4UTNA 1F14A 4G01B 4CW7A 5MDHA 5KIAA 1GY8A 3C8DA 3FB4A 4W6ZA 4DMKA 4EVQA 1TGVA 2ZWAA 3DTVD 1AGYA 3H9QA 4F45A 1H2FA 4GWLA 3HNPA 3HXKA 3VSEA 5IJZA 3A0RB 1LPPA 1IRIA 1QHHA 4PLYA 2VYND 1E6UA 1QV9A 2NNLD 1AA9A 4KP7A 1FDSA 4Q4AB 4XIFA 3N0TA 3N2GB 1YKSA 2G7ZA 2XRMA 4DXAA 4MVJA 3WRYA 2NN3C 4R2JA 4CEJA 3PFIA 4F1JA 4S3MA 5ICCA 4KSBA 3B6JA 1GCGA 2QTGA 2NAFA 1ORHA 2PGLA 3CUYA 3U3OA 3C87A 2WLTA 2ZI6A 3GEIA 3T7JA 1YTUA 4OLJA 4PHHA 3BGSA 5LC1A 4AJ4A 4ZMBA 4QELA 1SUDA 2GHIA 5IC4A 1EM8A 1N5IA 1VSVA 2O5RA 2G36A 4WRRA 3F96A 4BL5A 1XPOA 3K0AA 1E2EA 2ZFUA 4RE5A 1G38A 2I03A 3HO1A 2QKYA 4BWGA 3BXHA 4FYHA 1U7OA 4XD7D 2W2KA 3U17A 2XRZA 4TT8A 3GCZA 3MGAA 4X20A 3PP8A 5ALSA 5IDXA 1HNWB 3NWJA 4NZZA 4OL9A 4U5QA 2WWVD 4ZMSA 2XVZA 1GTMA 2QPTA 3GBPA 4L72A 4J91A 4OXKA 2F3PA 2PH7A 3H9EO 1OGYA 4L74A 1LPMA 1Y42X 3MTIA 4B83A 2O3QA 5ITSA 2PSHA 1MO5A 4OGFA 2RD2A 1KO1A 4KEAA 4KMMA 4UBIA 3U7QB 4XDYA 3VYWA 3IERA 5BMOA 2XD4A 1VJDA 4OQZA 5DN9A 4QTYA 3TG2A 1DQYA 2X5XA 2QXTA 2R96A 3V7NA 2QTCA 4UC0A 3MJHA 4K9MA 3LC0A 4R05A 1FIUA 4GF5A 3NYQA 4LJ5A 3WWCA 5C0OE 1NMYA 3UCXA 5DTMA 4YP9A 1XTZA 3HPQA 2NZVG 2OG2A 1I4DD 3ISVA 1EK0A 3F46A 3ZHOA 1VKZA 3RIXA 4HVTA 3WGYA 4F5YA 1IBMB 5HJ2A 4ZVKA 3DZJA 4M9XA 1BDIA 4TYNA 2FQYA 2FZEA 3EUWA 5JLJA 3ZGLA 5AQ1A 4FUTA 2W7TA 3IXMA 3T5CA 4CZ2A 4EIWA 2Z8ZA 1QIMA 2I8AA 2HHHB 2R8ZA 4ABYA 3AU9A 4P4NA 5JRJA 1SPBS 4MO9A 3UWKA 1KY4A 3TEMA 2ZIAA 3PWTA 4CCYB 2Q1UA 1K75A 1U8ZA 2CCKA 1CG6A 2PKQP 3AEQA 5LA6A 3JVUA 5IDQA 4WK4B 7REQA 3FVTA 2Z2KA 1SB8A 2A0UA 1T1SA 1YJCA 3AZPA 2OCBA 3FSEA 1ZGGA 2DPMA 1KDZA 2A3NA 4QATA 4EYEA 2I4TA 3LC7O 4V1CB 3G0BA 2AN3A 1O1YA 3IBCA 5AVSA 3THWA 1YJBA 1KAEA 1WPXA 4N8SA 1C7JA 1YV9A 2ZRKA 1VLLA 3MWGA 1I4TD 4XDZA 1OBFO 4LDPA 4JR0A 2IKSA 3ZCTA 3KEFA 1SK8A 1FTGA 3C8ZA 3T9DA 5KEIA 2ZZKA 1E7WA 3HYCA 1VSBA 5KYYA 4L50A 1E8NA 1N6OA 5IXSA 1P2UA 2QR2A 4BB9A 4IYJA 5I3CA 3OQJA 5K8VA 5DHFA 2VBFA 5DKFA 2PR2A 2TRSB 4O8ZA 1RQLA 1BMQA 1XEXB 3VMMA 2BFEA 1UK8A 3FDFA 2HGZA 4FLMA 1YDHA 1JIQA 2DFLA 1NUAA 4G07A 1PZNA 4R9SA 1JKFA 4IGAA 4RH0A 4YCNA 1N2OA 1Q17A 1LDBA 3BIJA 3IP5A 2XDQA 1JR6A 3PQ2A 4AG3A 3GLHB 1EZ1A 3VZRA 1C4OA 3ER9A 5F1OA 3IBGA 2Y1LA 3HZZA 5C37A 3GEHA 5F52A 3OC6A 3Q7TA 1IM2A 1J8FA 3QWAA 3UWDA 1S02A 5I4CA 3A2KA 4KQ1A 3RS8A 2VP0A 2OYRA 1E0AA 5F12A 4DCUA 5LQKA 1O03A 2FFAA 3T94A 2R60A 4JJEA 3H75A 5DCUA 4RTPA 5E3IA 3E1KA 2FEWB 3EZFA 5JPIA 3UCEA 2H9IA 1GZVA 4WUVA 5KNDH 4I99A 4F5DA 2GESA 2QV0A 1ECLA 1M1YB 1TO1E 3OM9A 3HCOA 1D6SA 2GTPA 2VRWA 2X4LA 1I9CA 2YYAA 4D82A 3QBTA 3T9EA 5H9WA 1UBUS 2D7JA 2I22A 2VUSA 1P1BA 2QE7A 1P1KA 2AT1A 2NZUG 3V3KA 4DWOA 3G2KA 3FMPB 2AEEA 4AS2A 3CR8A 3UQYS 5DF1A 1TK9A 3Q3VA 2AK2A 1SRQA 2AOVA 5CLQA 5EERA 5FTNA 3HUDA 3Q3HA 2KQUA 5CMLA 2Q5EA 3B8EA 2MT9A 3W9BA 1ZU5A 4B8ZA 1D5WA 2J0QA 4IX9A 3S2UA 4BB6A 1FBNA 5A02A 2ZGVA 1GD1O 1K3TA 2BBOA 3CZ9A 5E7IA 3B52X 2RHJA 3IT0A 2Y3IA 4OXQA 2GA9A 3CZMA 4TMFA 5EJFA 1MB2A 4CTOA 1E5DA 1RRGA 2R7LA 3EF1A 5ARBA 1ZK1A 4OG2A 3MWLA 2OOKA 4X20B 4KQFA 2CMGA 2QG6A 2IZ1A 1OR8A 2PX0A 5AUNB 2GTIA 1VJ0A 2M1ZA 2PU7A 3L43A 3ITNA 3ESAA 1G9SA 2J9RA 3IHWA 3RVPA 4S1WA 1MW9X 3TSOA 4EP1A 1NNLA 4I8DA 2RGRA 3OZFA 5DIZA 1DS6A 2G70A 2OHGA 4BJ3A 3L1JA 4GKJB 4FWTA 1X3SA 4KSCA 3ENQA 3GVIA 2HNKA 4KYUA 1VE6A 2ALJA 1VGVA 3LUHA 4JROA 3ZWMA 2O2ZA 4PINA 1YL6A 1X1TA 1JJVA 4MKZA 2POQX 2C8JA 2Z6VA 4KXMA 5CFPA 3T5GA 1QORA 2VNSA 1L1QA 2HJVA 4C1BA 4EBFA 1G8HA 1YFJA 3ZG6A 4HRVA 3ZEAA 4MV0A 4DMCA 2Q45A 4FDTA 4MJLA 4NU6A 2ODNA 3HVKA 2X8AA 3GPBA 2GWRA 4OJKA 1B7GO 4DNOA 1HWYA 4RK5A 5KU1A 1RYZA 4U2FA 2IGBA 3R9KA 1HZZC 4DAOA 2OC4A 3QI2A 3QTBA 3PTLA 4JL8A 4PS1A 4BEBA 4EHAA 5JSZA 3Q8XB 4NLLA 1XPRA 1V16A 2XDYA 4KAJA 4ZKDA 2HRBA 4IIHA 1GGNA 3PGMA 5EKUA 2ZSEA 3B1WA 2D5CA 2OM6A 5IKOA 4HDRA 4PCVA 4ESEA 2PBLA 3BXPA 4UQLA 3T06B 2IUEA 3SY8A 4UVDA 3I8OA 1EG2A 4QECA 2G5CA 3D8NA 5JECA 3UGQA 9MHTA 1NRWA 2BHNA 1CR0A 2WC1A 1QTRA 4O2BA 4FGSA 2FN4A 4OFWA 3V33A 4IFTA 3VVCA 3V1YA 4KRFA 4N5HX 1BDJA 2ZJ5A 1T35A 3OOYA 4YP5A 1VXOA 5U4XA 1KZ6A 4ZCQA 1E4OA 2FPPA 3QKWA 4L08A 1R6BX 3OKCA 4Q7KA 3RTCA 4GL2A 4N4AA 2IU6A 3JASB 1MTOA 5CH5A 5JO0A 4O4JF 2TMYA 1DWPA 1G8AA 1TE2A 1DKNA 3PEFA 4KMSA 4IIFA 2IXAA 4OSPA 5KAPA 3UB3A 16PKA 1I94B 5C8DA 4LOIA 1S3IA 1QHEA 4DRXB 1QG2A 1UFRA 2ATVA 2VJMB 4DCPA 5EP4A 4MR8A 2HCFA 3UBMA 1LWOA 1OU0A 1OYVA 4MHOA 4F8JA 4ZZ0A 4IF4A 2G6TA 3N0WA 3UXMA 4NICA 4M2LA 3VPDA 3WJ7A 5J5AA 1KI7A 3K2IA 3HJFA 1F8XA 3BK7A 2RH4A 2VPPA 1NUQA 2BDTA 2M6KA 3SE7A 3TLMA 3G2QA 2FN8A 1UQUA 5H82A 4EHHA 5SICE 3FSJX 4UEWA 1CWUA 1DBRA 1T8PA 1E77A 1TLFA 2VF5X 2KX7A 3HR8A 4RLFA 4ZODA 3RUAA 1TQ2A 3ZHZA 5FV4A 2PRJA 4HFRA 2QL7A 4PC2A 2FWMX 4QLOA 3ZHUA 5HRAA 5I4BA 1VPWA 2WAAA 2PGIA 1SBYA 3OJXA 4ABTA 2ISSD 2EJTA 4Q1AA 2XZLA 3QF7A 4CETA 4I4TF 3D8SA 1Z6QA 1VG0B 2NU9A 2WUWE 5IU6A 5FXMA 3K9LA 4M89A 1OGJA 4HRXA 3HY4A 3VYRB 3WLAA 1L5RA 4A2WA 3CUWA 3KEOA 3IUYA 1WNFA 1VKHA 1IY9A 2P40A 2DFNA 2NT3A 1I1NA 3PZBA 3VXKA 4GM1A 2QYHA 3OLQA 4CBVA 1MA3A 1L7BA 3LXUX 2FLVA 3KSAC 1M2WA 1JDUA 2F8MA 3JY6A 1RLOA 4L3WA 3KEMA 3PRHA 1E8MA 1HDIA 5AW5A 2P6OA 1BX3A 2X4GA 1Z63A 3GOQA 4RVHA 5AKEA 3PJDA 4F93B 3GUZA 4OMUA 4Z9AA 1MG0A 2HJHA 1OZHA 4LY6A 2ZTLA 4K2AA 3H5RA 1XV5A 4NBLA 1IVYA 1LFAA 5AKZA 2OLKA 3WISA 2NTNA 3P2YA 3WOVA 5A5DA 3TGPA 4HAOA 3OT4A 4D9HA 2Q5FA 4JSYA 1UPAA 2B8EA 1DXHA 2RGXA 1YU9A 5EZSA 3P4UA 1DPFA 4L85A 2WAOA 2IYVA 1XX6A 5AI5A 1SC3A 3M9LA 4IMJB 4CF5A 3GAMA 3I01A 1Q0PA 1AF7A 5GPBA 4B32A 4MQBA 1XTUA 2OP0A 3H5TA 4YGXB 1F5NA 5KUTA 1V48A 3DDNA 3S8MA 4TV9A 3OPVA 2JGMA 2RBEA 3OM0A 4OOFA 4CN9A 2DCMA 1UBOS 3S0JA 3ZQJA 1F8YA 1P1FA 3ESZA 2VDLB 2WSMA 1G66A 4RTSA 3TQRA 4L5AA 1MIOB 3OJFA 4O4HF 1Z8DA 4GFDA 1OFVA 2M6RA 3A70A 3VC1A 3RSHA 4YQFA 3G82C 3NC0C 4G1UC 4OHKA 1QE3A 2DM6A 2QTAA 2VDNB 3GUUA 3QEOA 3LY7A 4D1YA 3SQMA 2JA1A 4HDAA 3IDFA 3IIIA 4ZYTA 3D4LA 4YROA 2VSXA 4B74A 3LZCA 4LGCA 5IZCC 5L3SB 3NYRA 3ZCVA 1D9XA 4CTJA 4XZ3A 5EIEA 4Q3LA 5GVRA 4FYJA 3KTAA 1FFBA 2FWRA 2CUNA 4YR7A 1QO7A 5NULA 3E05A 2XCSB 4EKIA 4EGJA 2V8BA 5T6MA 3ZLBA 2C4WA 5FUBA 1QH1B 4AY6A 2Z4RA 3LOQA 4EGQA 3Q3EA 5CEJA 3GX1A 3RSLA 1N8SA 3V1MA 4AO8A 2Q1TA 2V7PA 4MIEA 3RB8A 2ZJAA 1V95A 3FPJA 3N8HA 4RE6A 4ND2A 5EUQB 1Q15A 1RAHA 3BMNA 1AB5A 4EHFA 2ZB3A 4V0QA 3W8EA 4DIMA 4I3FA 3HY3A 5IJAA 2GLUA 1O0SA 4A0QA 4EQ6B 1IB6A 1MC8A 2FPXA 4Q19A 1NQOA 3EQ6A 2PUEA 1X6VA 4LAFA 2O0LA 4YRCA 4JQOA 2MINA 1ZUD1 3IVXA 3KV1A 1ZLYA 5E9JA 4CJXA 1T3HA 3N75A 4WJLA 2F1HA 2FEKA 4RFSB 3QKTA 1FZQA 1Z08A 3WHLA 5HXAA 1L1EA 1LEHA 3PQ3A 2GUWA 1T5DX 3VZPA 1ORVA 1OCEA 2PGDA 4YRIA 4JYCA 2FPPB 1Z37A 1SG6A 2LBPA 1JDVA 1PWYE 4Q6WA 1GNPA 1IAVA 3R5JA 4TWAA 1X19A 1ND5A 4H7DA 1HC7A 1TQHA 3IVMA 4J9VA 5C8ZA 4KO3S 2E85A 5ALTA 3HA2A 1F6WA 2V6MA 1U98A 3LPLA 4UHJA 3RFTA 1HQYE 3IQFA 3NTXA 1HLPA 3LCMA 4DZTA 1NLYA 1TEHA 2HLHA 5KDLA 4PONA 1T1GA 4RZXA 4BKPA 2ZYIA 3NHYA 4N8EA 1IHOA 3AYXB 2IIBA 5JD3A 1JIKA 5ALVA 1LDGA 1M0WA 1NSTA 5JHGB 2CYBA 1GEEA 1T0PA 1Y3HA 1ONBA 3GCWA 4GWKA 2EJWA 3EMBA 4H15A 4AB1A 1J1ZA 4H16A 2QUHA 1ULSA 2IOFA 5C1PA 3NORA 1U2GC 3HBNA 3O91A 2W6MA 1GUBA 1SKUA 1XTJA 2E21A 5CIWA 3S4YA 4FTWA 3BTVA 3VU8A 5DPMA 5CW1A 3MTQA 1QX3A 1OD6A 2H0RA 5I9MA 4XCQA 1JLRA 3SIWA 3UV3A 3PQEA 1QP0A 3OG9A 4KIUA 4BQPA 3R3UA 4RAQA 1P75A 4JBGA 3PC8C 2ZSKA 1W85A 2Q1SA 2PUHA 3BSWA 2NV6A 5DGHA 3FTDA 4B79A 3GT3A 4C7BA 4JI2B 1N6IA 3MGGA 3NU1A 1OASA 4OUKX 2VFAA 4XWKA 1FZTA 3DWFA 2OUKA 1AU9A 2LV8A 2RKBA 1O97C 3GJTA 5I7WA 1AH2A 2DLCX 1LPNA 4LECA 2YWDA 5LP6F 1NMZA 4HYYA 5JXJA 4CDRA 2XI4A 3P9PA 2Y2VA 4WKBA 1IZYA 1ULBA 5EA2A 3ON5A 4PR3A 4TTVA 2ECQA 3WFJA 1T9HA 2VPIA 4ER3A 2H3HA 2J9ZB 3GV0A 4GX5A 3SJZA 3T0IA 1DDOA 3UOWA 4JLWA 3A1SA 4D5GA 2FJ0A 1XRJA 3HBAA 4JU8A 1DQZA 4XFDA 3FZGA 1KRXA 2ZYHA 1P5ZB 1FCJA 1IATA 3W2EA 3T1NA 1M8FA 1DAPA 3LT4A 3HLTA 2Z6UA 2V55B 4JI1B 3Q5EA 3R6GA 5KNDD 3PKJA 5CHYA 4PY2A 4B3XA 4RM3A 3DWIA 1GRNA 5HBGA 4TLCA 1U0EA 1IK6A 4PHGA 1DAOA 1DLIA 3O9ZA 1YR8A 1ELOA 3R5FA 1T8UA 4ZPXA 3BGDA 3ZE9A 5I6DA 4KR6A 2B6NA 4PZ0A 4HNVA 1ULTA 4UAGA 2JFFA 1E2MA 4PXSA 4HLNA 4NQZA 5KYUA 4Q4LA 3WTCA 4AKSA 4BMPB 2ZREA 2VIIA 1GYPA 1KGDA 4MR8B 4RDXA 2OR3A 3I72A 4X54A 4BQIA 1UPCA 2F67A 2VLBA 3MUNA 5HIIA 3L8CA 4MP6A 5B57C 3L5OA 4AJ9A 3EVZA 4JELA 5AR1A 3JWPA 3OZAA 5BURA 4NYJQ 3CF4G 4Q4HB 1OA1A 5JQWA 4BVAA 4EPXA 4JL5A 1EVJA 5G2OA 3W9UA 3ZNPA 3O9MA 3SS7X 1KMMA 1FMTA 2Z57A 1UPBA 2GCIA 4A0SA 1OUMA 1U2SA 2A5LA 4RZSA 1JDJA 1W5EA 1PO7A 2AE1A 4PIPA 3I4FA 2F6RA 3JYNA 5H59A 3F9IA 2JCYA 4CL3A 4OMFG 5M34A 4IWXA 1WAMA 4KDCA 1NW6A 4D26A 2GH1A 4QXAA 1YKFA 1YOVB 2IOHA 1V7ZA 4HNHA 1NSYA 5T4FA 1GUFA 4L5BA 3LL4A 4B7AA 7MDHA 2QBYB 3LWNA 3PJRA 1VI6A 4FMBB 4N8DA 2RIRA 4OH7A 1VJGA 4E1AA 3N2EA 2OYSA 3EGXA 3I5MA 3TM4A 4YT2A 2X42A 1O2DA 4AY5A 2OGUA 3VNVA 3OWXA 5J2TB 1CRPA 3BCHA 4MV3A 1V2GA 1USUA 3QFCA 4W4TA 1M34A 4J3JA 4UM9B 1N92A 1ZRSA 5KYKA 3PPXA 3COZA 4NOKA 2JEZA 3RARA 4WXPA 2QE7D 3WGZA 3K09C 1EWTA 2EBUA 1W8DA 3RH0A 2CKDA 3RUDA 4ZQBA 3MMXA 1JEEA 3BMOB 4UU0A 3EPRA 3SSOA 4HUTA 3A6EA 1G5PA 2G76A 2DKFA 3R2JA 5TEVA 3JSXA 3WLKX 4N54A 1JHQA 2GM4A 2O2DA 5CB4F 2WEKA 1A3CA 4P3KA 4PW0A 4PRLA 5CFLA 4R1TA 2CV0A 3F6YA 3D0QA 3IPLA 5THQA 3D3EA 2NO7A 1JQ3A 2PKYX 3DOEA 5H5JA 4DEXA 4N65A 4AZWA 3R6LA 4L22A 2VK4A 3M81A 4JJFA 2BTQA 4UM9D 3PZRA 2RMKA 2ZQZA 3H5WA 3N5KA 4WOBA 5TV2A 2E4AA 3NHUA 3UK1A 4B6FA 2R8YA 4BJ6A 4MW9A 1RLMA 5IFLA 1C8VB 1WWKA 1KXZA 4KFRA 3SM9A 4GQAA 1GRRA 3W8NA 3NXKA 3KX2A 5IYZF 4ZZ3A 3HCBA 4RL6A 5EJ6A 3ENZA 3NXSA 2GAJA 1KP9A 3CUEF 4AYWA 1N36B 1GU7A 1Z5NA 2ODPA 4KOAA 1RIFA 4B4WA 1PS0A 2FK7A 3NFYA 4TXNA 2OHVA 3QU4A 4YREA 2GHQA 3S5JA 5CDFA 3V8PA 4ITVA 3LZ6A 4RPJA 4N0PA 1VA5A 2YXLA 4YY3B 1XKQA 5JXHA 1R6DA 2HADA 4BQOA 4D8YA 3KALA 2VUUA 5CM9C 3FIUA 2VNHA 3PL1A 2C61A 2RGUA 3Q8WA 4LK3A 3GVXA 1F17A 3EXEA 3ZC3A 4UHBA 3DVSX 4IIYA 4JVOA 1NBMD 1UC4B 2CXTA 1AIPA 3KVRA 3MCUA 4D8WA 3N6VA 4RTNA 1UZAA 5H68A 1KHHA 4BFVA 4LCJA 3DBHB 3WL4A 4ARAA 1LSOA 1XA4A 2LD4A 2BGGA 4ND5A 2BUAA 2J4FA 4TOIA 3TIIA 1O5IA 3UAZA 2DQSA 2H51A 1ZKMA 4TL7A 4IBOA 5EQTA 3OKAA 4D81A 4ZCRA 1EIZA 4WFQA 2MSNA 3VRHA 3QVGB 4C0BA 1PSDA 3V4VB 2AXQA 2DUJA 3QX8A 1FFDA 3FFTA 1JHPA 2L69A 1GKYA 3M1AA 4TSFA 4B46A 5JAPA 2EKZA 5E1DA 3GJ8A 2QRPA 5KMGB 2XDAA 2Q3LA 4YJKA 1AUPA 1JLLA 1T91A 2EKPA 3CEMA 4C20A 3A9UA 3CXUA 3MWJA 1QF9A 4FFDA 4QBIA 2AQ8A 5A6SB 1RZRA 5CR9A 3SR3A 5EJAA 1RVV1 4RTMA 2AFHA 1QBKC 1VM6A 2XE8A 4MA0A 3RU3A 1TCCA 4QEDA 1Q0QA 5CJJA 2DBRA 5AI4A 4RQBA 3V32A 3KXKA 4EVIA 5EXDA 2ZJZA 1QSGA 2W5UA 1MAUA 2QTZA 4G84A 4MCHA 3WB2A 4BZXA 2PUJA 3BB1A 4OP2A 3VFDA 3GVHA 4N3BA 3VV2A 2V7WA 3CN7A 3JQ7A 4XQ0A 4DMMA 1L5VA 4RUKA 3GW8A 3UPUA 2L19A 1ZEMA 1ZH4A 1FP1D 3LF2A 1TKCA 4FOPA 5I8ZA 2ZSHA 4HGZA 3X2FA 5GADl 1IWOA 2O6HA 1KBQA 3IP6A 5FOXA 3TWOA 4BLPA 4NBVA 4DR1B 2WU8A 2PKCA 3F6EX 2VZ9A 4L5JA 1YDFA 3CEAA 3EY9A 5TIIA 4FYPA 4WZAB 2W0SA 2KJQA 3FJOA 3NGMA 1NC3A 1QFYA 1PAUA 3B2EA 1UKCA 5C7YA 1BHQ1 2OBMA 4LI0A 3TZLA 1JT2A 1DJOA 4HLQB 1NPTO 1JHMA 2FE1A 4IG9A 3WDLA 2WINI 1S6YA 3FSRA 3S7ZA 2QE6A 2VDPB 4U7FA 4D98A 3ISTA 2BFCB 2NTJA 1N33B 3BH0A 3ERCA 4ZYVA 4K9QA 1U0TA 1GL6A 5EL0A 1CY7A 3RJZA 1XZIA 3S1SA 3W7BA 1ZR4A 3VZBA 2CFTA 1ZX1A 1RZRD 5FI5A 4KH1A 4P3YA 4RL4A 3VHXB 2FSGA 1VSQA 1M34B 5F76A 4HQ6A 5ENZA 5KREA 2DF8A 4NCIA 4BQRA 4R1QA 3W8FA 5A3QA 2ZT6A 5BVHA 2X9GA 4OPMA 2FSFA 1DAHA 4W5OA 3V4RA 2QAGC 3AUSA 4QUHA 2ABWA 4ITUA 3ZXSA 4DWJA 2HW8A 4QPPA 1AQYA 1NVVR 1XD2B 4GD3Q 4QUAA 1ZD9A 4KU4A 3NOXA 3VM6A 3WAJA 1R8QA 4NCBA 1N32B 3L92A 1DNPA 4JLKA 1G8GA 3VC3A 5C3UA 2X5OA 2XNHA 2WIKA 1EVIA 1H23A 3OU7A 3KJIA 3ZDYB 2MSCB 1JDSA 2WJZB 3LUDA 3NJRA 3KV3O 3FUWA 1JILA 4LI3X 4FSHA 1VG8A 1SU8A 4MUFA 4D3ZA 3BL6A 1DO8A 3T0GA 3T9AA 4Q4JA 2CNWA 1JB1A 5T3YA 1UWCA 4AZTA 3KWMA 3TLGB 3AIMA 5BWOA 1RXYA 2VSFA 3NKFA 4MRVA 3VI4B 3VZQA 3I1JA 3MBIA 5HWSA 1Z17A 1JPVA 3KQPA 2PX8A 3VAYA 1ETUA 4D5EA 2B2XA 4D0RA 5KNCH 2I62A 1L4FA 3NT5A 3VTZA 1UJ2A 2I8CA 4IGFA 4MKRA 4A6DA 4GQIA 1ZCZA 3H6HA 3LXMA 1THGA 4J0CA 2OAP1 3RVDA 3KHUA 3RUEA 4HNRA 1E2PA 3QA9A 4GWGA 5EZYB 3WNZA 3RROA 1M8GA 1WB6A 3UT5A 3QX9A 1K0UA 4KFTA 4F60A 1Z4MA 4K6KA 4KHPB 1YS1X 5FNZA 4ED9A 3B89A 2H08A 1D6NA 1XZGA 2CLHB 1K86A 1XDWA 1YHYA 1ZN7A 1EE2A 3P9QA 3QWIA 4LZOA 4MLCA 3D5TA 5CAEB 1OWLA 3UKJA 1A5ZA 2YV1A 1ZINA 2Z04A 3EXEB 4RXMA 2Z2IA 1DHRA 1I3NA 5KPDA 2WKWA 4KN9S 2C8KA 4ND3A 5AUPB 2JFZA 5CG1A 3ODPA 1NVGA 2ZRNA 3GRRA 5JV5A 4BY9E 3SXUB 1C80A 1VKRA 3RYTC 4Q3CA 1DOAA 5ALZA 4OB6A 3AESB 1AZSC 1V6CA 2YHIA 3KHSA 4GXTA 4H1HA 1ZITA 4MGKR 5LD2C 4DR7B 1KQ3A 4C7OB 3QJ5A 4XX0B 3V6LA 4FSDA 4NCNA 2IXFA 4XQEA 1C0EA 4O1IA 3M83A 4F3TA 5DM70 2VDWB 1OLOA 3H4MA 3CMMA 1GADO 4MV5A 4KN6A 1Z5GA 4K26A 2PBRA 4WLFA 3VC7A 1Z0AA 2I2CA 3EARA 3OJWA 2EXXA 3I2YX 2P2YA 1I3LA 1JVNA 4AAYA 1FJXA 1LJUA 2HJ9A 3R0XA 4EB8A 2XQKA 1KE1A 5C1OA 2CSUA 3TOSA 3ANNA 4HAIA 4WQMA 5J1SB 1ACLA 2O2YA 3GFSA 4D43A 4DLNA 1LZKA 3D8TA 3E9ZA 3EHEA 3FMIA 3H0KA 5LKAA 5BR4A 3QLTA 2Q4DA 1A9PA 3KAPA 3FDZB 1U8AA 5CLJA 1P4HA 3WYCA 5IAAA 2UZAA 1Q0RA 1ATZA 4UOZA 2IU0A 1D2RA 2ZTMA 3N2LA 5AM4A 1Y5LA 2Q3EA 5G0WA 5A9SA 3TZKA 5LQRA 3LYUA 3RJ9A 2ZJOA 5E6SB 1L8LA 1LVHA 2C2BA 5JT1A 3WMGA 3C2QA 3F3MA 4PX9A 4U5XA 2I1LA 4TWZA 2DAPA 1XHFA 2XUJA 1Q95A 1BROA 1L3IA 1FEZA 2CLCX 4FMPA 1PJTA 3VDXA 5C80A 5IAOA 3I9V6 4Z3OA 1G9XA 3QV1A 1GPMA 3DCJA 4RK6A 2C7VA 4IJ5A 4LQLA 3CWCA 4HS9A 1JQLB 1PCXA 2DBQA 1KZHA 2A9QA 2QJWA 2XHEA 4KAXA 2XGJA 3ZNNA 2V7TA 4A6EA 1Z2PX 2OWDA 2XOKD 3BWYA 1QFSA 2HDOA 4IHJF 5FB3A 3PICA 1LXCA 4MMXB 1QG4A 2DBYA 4JUCA 3GJ0A 3KSRA 5IVDA 4BN5A 5TQ0A 3FX2A 1VE1A 1H6AA 1JIVA 2Z0MA 4NJMB 1GL9B 4QG3A 5J4HA 1S3GA 2C9DA 4W6QA 1DC8A 1MXFA 2X9NA 4Y7CA 4X7MA 2JJ2A 1Z7WA 1PQ4A 2E4XA 2IQIA 3GJXC 4LJKA 4RCZA 1O5OA 4C2TA 1NULA 3AM1A 3AUXA 2IWHA 1G20B 1N0HA 3R23A 4F3NA 3FAZA 3U60B 2GFHA 1Q11A 4MUEA 4D79A 3QKUA 4P58A 1EP2B 2HWKA 1H2ZA 3TDNA 2YY6A 3KSZO 2JGNA 1X2EA 3WL5A 3S68A 1WDLA 5C5IA 3LY9A 2YFQA 3S81A 2GZ3A 2YNMA 1EUQA 2GAFA 4BTEA 1PJ8A 5DM1A 4WLEA 4B44A 4ZV4A 4RMGA 2A4KA 2WMDA 2OCGA 5EQFA 2C7QA 5I7SA 2NOAA 3ZU2A 5BRJA 3D4BA 5CX4A 5ARDA 3QBDA 3WLJA 2R7AA 2WFMA 3PR1A 5FYDA 3ZVKA 1PFGA 2GZSA 4HD8A 4DL9A 4C78A 1PR1A 3HUFA 5H0IA 1P7CA 3TB4A 5EIOA 5A3RA 2A3RA 4R81A 1CUFA 5K8JB 1Z73A 1ECFA 4WNYA 4YWJA 1HZZA 3S40A 2GWHA 3IJRA 3KOZA 3EAQA 5C7LO 1RKXA 3ED5A 1H85A 2EP5A 3ZK9A 1Y6RA 2UKDA 2Q9BA 3BS4A 4BQFA 3JQEA 3OESA 4RM2A 4ENUA 2YVKA 4DLYA 4EO7A 5ALNA 2YDYA 3LRTA 3KPVA 4WZAE 1WBJB 2R8BA 3LHSA 4C30A 3TXAA 1FX0A 2MSWA 3CVYA 1SUBA 2VN8A 3BJEA 4WFIA 3BWBA 1IHPA 4CFZA 3RVNA 1U2RA 1KY3A 1DAFA 4L28A 3UXHA 2D2FA 4FGZA 2VNIA 4OYHA 2WM3A 3CZAA 4RVCA 3X1ZA 1CE8A 1N2CB 1C8LA 2W98A 2BT4A 3H2BA 4DCCA 3WICA 1Q44A 2AN5A 1G8PA 4BKRA 1DRKA 2Q07A 1YB7A 1E1KA 3L84A 3HGMA 3USCS 4DSUA 1R6TA 1I32A 4KIGA 5KTSA 5CA0F 1NRIA 1Z47A 1U90A 2DSNA 1PNTA 4JVMA 2YH2A 2XTJA 3PC2A 4JYBA 4OJMX 4M1SA 4PHCA 3TNFA 4FDLA 3LDAA 4WLUA 2PN1A 2OGZA 4U2KA 4YJ3F 5DM0A 2BFDB 2PCJA 3PLAE 4CF6A 5AKGA 4IS2A 4OBEA 3A6HA 3ODGA 1F6DA 3QF4A 1Q2XA 3AY3A 3RF6A 4ND4A 1E1CA 1T8SA 3G5UA 3B7GA 4MW2A 4WD3A 5AXAA 4YR9A 1BXRB 1D0SA 3JTEA 4S1PA 1D1PA 3P8ZA 3L4KA 3K0SA 4DWVA 3OP4A 2NYRA 1K68A 3RC3A 3L6BA 4I1VA 2C0PA 1KRHA 4HUQA 3O95A 2D74A 5FUMA 2AGVA 1WZEA 1ULZA 3STYA 2AUMA 3B5EA 2FPWA 4Z5XA 4D9JA 3AHHA 3BF8A 1S4QA 2A1IA 3CKMA 3RJ5A 1URPA 1EGVB 4QPCA 4Q1DA 5EI5A 3Q7PA 2X6TA 5FNVA 2D5AA 2PSDA 4LHEA 1CRQA 5HYVA 3BZBA 5CGQB 1GTVA 2HA7A 1HDGO 2QTNA 2VXBA 2XBLA 3PYXA 1QLWA 5EZYA 3FI0A 5GM2A 3VR3D 3JPYA 4H0CA 2X9QA 4PFQA 2WSIA 3RG2A 4C87A 1LVUA 4CQJA 1FMCA 5FOWA 1PFYA 4ZIRB 5CCDA 3OQPA 5JZOA 1IUKA 3K31A 4MVJF 2C2MA 4XM2A 4DW8A 1H9CA 3STUA 1RLUA 2BTOA 5DWQA 1Z5VA 5CB0A 1HT2E 1OT5A 5K0EA 2PVCA 5SYMA 1SC4A 3ZDQA 3MTAA 2I66A 4Q3NA 1B15A 1GRQA 2HQSA 3UO8B 3LTNC 4BX8A 4K46A 2RIPA 1AJEA 3TFQA 1P62B 4GKVA 2Q5QA 1JQJC 2ZSAA 3M6IA 5KC9A 2I1VB 1ZA1A 3SQLA 3AHEA 3AEXA 2JAWA 2DWCA 3GF4A 4GOXA 2YNMD 5FA5A 1NQXA 5EXEA 3ZWQA 3K0KA 2BCEA 5B12A 4G0ZA 1Z5OA 1KQFA 1CQWA 1WEKA 3TE7A 4HN4B 4RGBA 1YCGA 1U28A 4YRFA 3SEAA 1M7HA 3ZU4A 1PZFA 1S4MA 5C9ZA 3DZGA 3ACCA 1XMQB 4I8IA 3B1XA 4RK0A 2HF9A 2JJ2D 4CDNA 1EVKA 1RJEA 2G88A 5FT9A 4IJVA 4QOJA 5JR3A 3I8SA 3VR2A 1SA0B 1F2DA 2UUAB 2AZDA 3EVBA 1N8TA 1Y98A 3HSKA 4IGIA 3PEWA 3HHEA 3IALA 3ZE8A 1OB2A 1LLCA 3LYLA 4C0LA 3U4HA 4UCFA 5B1IA 3PNQA 2FZGA 1A8PA 1JEYA 1HDYA 4CLEA 3O2SB 2F64A 5C18A 5A3JA 3I32A 1C1DB 3O3NB 2X76A 1ESZA 4F3YA 3GLGE 3FLBA 3SFTA 1SQSA 3D6JA 1ICEA 1QGDA 2HR1A 4W8GA 3K30A 1D2CA 1JDBB 2XZDA 2Z8YM 4UUBA 5FUWA 4KQXA 4CMJA 2PA0A 1H4SA 3ICPA 3AUAA 3A6GA 3AKEA 5FFMA 5BOSB 5H8WA 1HDOA 5BN4A 5KTRA 5KQMA 3LLVA 3VKGA 3EOBI 4X5OA 1GA6A 5TE9A 3U4QB 2X2FA 4MV1A 3IE1A 1EK5A 3BRWA 4OHWA 1PGNA 3L04A 4FWIB 2ERYA 2OZPA 3UMMA 1SUPA 4UDXX 5ETJA 4HR7A 4JB2A 4URUR 4P0QB 4ZU1X 1U2EA 1Z8NA 2Z3VA 1PNVA 1IN1A 4XRGA 2WPDD 3GZJA 1G6HA 4LXXA 2DHEA 1KIMA 1NSFA 3GLSA 4PTYA 3WADA 3WG9A 4DR4B 4RXUA 1CU1A 1OJLA 2AS0A 1QRSA 1KFEB 1QGOA 2VHZA 4PNEA 3SVLA 3EWSA 1M7GA 1E7RA 1E3IA 2ONYA 1UPUA 1U3FA 2DU8A 1NW9B 3NVAA 1DEKA 1JEJA 3PIIA 4RKEA 4XR9A 3SFZA 5I45A 3VSBA 3H3JA 4Z0HO 1U0LA 3QZUA 4WBXC 1CS0B 4YRQA 4QRDA 4GM4A 2WABA 3TKLA 1CQPA 2FDXA 1LK0A 3ENVA 2ZPAA 3IMGA 4LXHA 5COQA 1G98A 4C0QC 3S1AA 3D8HA 4RJKA 3K73O 4X85A 1WY7A 3U31A 3GGOA 2GN2A 4P54A 5F33A 5THXA 1P72A 2F1RA 3ACDA 1SKQA 2FPSA 4MROA 3J81k 2W2MA 3K3PA 3T3PB 5HKAA 2ASVA 4DUPA 5B30A 3FCUB 4MHTA 2XAAA 3GGCA 1Q1QA 3DT8A 1EX6A 3CRW1 1VJCA 1XJ0A 4RENA 3IVAA 2OQIA 3N8DA 3I04M 2JRCA 4ZI7B 1X38A 2O19A 3ROFA 1ISJA 2B8NA 4L0QA 4N03A 3OLWA 1UBCA 1XF9A 3BWVA 4BPBA 4PG7A 4Y6LA 2Q0QA 3N2IA 4IXNA 2BR3A 3OD1A 1CY8A 2VHQA 1WXQA 4W1SA 3A9WA 1NZFA 5LUBA 3BGVA 3LQRA 4O6VA 3AGPA 1N1MA 2O0HA 3SD7A 4JT8A 5E9QA 4EUHA 4URYR 3PIDA 4K9LA 3FUVA 8ABPA 4WY8A 3STHA 1L7MA 1PLJA 4F11A 2QAJA 4QYWA 2VXOA 4FXPA 1DKMA 1U8TA 4PLTA 3DYVA 5DTJA 2GERA 3NV7A 1MZVA 2NO1A 1A27A 2NUTA 1MJFA 2V7QA 3EG9A 3LQQA 5AHOA 3CVJA 3PDIB 1YR3A 1ZW6A 2VP9A 5KO2A 4N41A 3JYPA 2V6JA 4Z99A 1PWXA 3OQOA 1PN3A 4MS1A 4DC0A 4QICA 3UJ3X 3T3OA 1IDN1 1JI3A 1KMCA 1U3UA 3KT6A 4OU4A 2VEDA 2WT4A 1ACJA 1G2OA 4YK7A 5FQOA 3EASA 2W37A 3OHSX 4HZUA 3PXAA 2C8VA 4O4LB 3K0CC 4XIIA 1FVOA 1L8XA 3P7MA 1X1SA 4PPNA 3UHAA 4IDFA 5HK9A 5I7FA 2D59A 2QN2A 3KPJA 2CNWD 2XKJE 4GYWA 2EYQA 5T4BA 3U09A 3PFCA 5JFOA 5GV8A 2BFWA 1XB2A 5HHTA 1R3UA 5LNK6 1IRXA 3K9GA 1YJXA 3VH1A 4YRSA 2ZT8A 3K8ZA 4J6FA 1VL1A 1G5QA 2FXVA 3EXIB 2CK3D 2WM2A 2PUWA 2YJ3A 5AJHA 3TD9A 1XTBA 3LTEA 1AN0A 1K7XB 2V7GA 4GM0A 2P2NA 3F90A 3WOHA 4YJ3A 4Z1OA 3ZYCA 4OQQA 4XDGA 3C1UA 4MUMA 1MU0A 2CNLA 3GK3A 1L9KA 1X7ZA 2ETXA 3O4JA 2RAVA 3OQHA 5JSKA 3UANA 4NYIR 5AH0A 2XVMA 3I42A 1L5QA 2QP4A 4HX9A 3GT4A 4C6TA 2IDJA 1EJ6A 3D59A 1SBHA 4R9VA 3RFXA 1T3ZA 2PZ8A 5CCEA 1DFGA 2ID9A 3H84A 2JBAB 2GJ4A 5TLSA 4HB2A 1L9XA 1Z2OX 4C9BA 1W44A 1XQYA 4L5CA 3VX3A 4UM7A 1CVRA 2XOXA 2PSSA 2Y1GA 1PK9A 3AVPA 1JPJA 4QQRA 3A1UA 4R0NA 4GBMA 4LXQA 4QGBA 1U02A 4US1R 5CLGA 2QLFA 2OORC 4N47A 4DIBA 4EKDA 3QW2A 3NCHA 1Z74A 1TFRA 3FCEA 4PO9A 3QOFA 3F5QA 4IQ8A 3PDUA 5LQJA 4EUKA 3BB4A 4HMQA 1A2QA 4JLMA 2YMMA 3E35A 2P6PA 2A0KA 5DEOA 3JASA 5IULC 1JTVA 1RD4A 3BOSA 1TCVA 3UWPA 2R6R1 1T5OA 4FJ2A 4H4EA 1M3SA 3C97A 3EBOA 4WJKB 2NYVA 3DT6A 4JEHA 2FFJA 3B36A 1VLVA 3C85A 4TVBA 3W7AA 2BOVA 4KPGA 2BMAA 4L5IA 1T3SA 5JBQA 1UT8A 5DBIA 4X1OA 4G0PA 4BLVA 4RLSA 4WPGA 3AMVA 4KQKA 4FPXA 4DV3B 3LA6A 3RM3A 2II6A 2VDUE 4REQA 4FDVA 1Y80A 3GY0A 2WTNA 4WE3A 3BIFA 1JZTA 1RYBA 2IA5A 2R6JA 4XD7A 1SC1A 2O05A 3PB3A 2IFTA 2BEVB 1CF2O 1ZQ9A 4CG2A 1QQAA 2GN1A 2R8OA 2GI4A 2V45A 4CVNA 1DAKA 5JPCA 1EFPA 3HXQA 2XMDA 4JASB 4F6RA 3Q5DA 2EKLA 3Q3JB 2ETVA 3NOVA 3SQXA 1JFLA 4HH0A 1H42A 1T8WA 2XUGA 5AICA 5FIUA 1ETHA 4CIXA 4Z54A 1NWCA 1T6ZA 1VRVA 4DCMA 3AUFA 3T7KA 4ZJUA 4WDQA 3AVUA 1YDGA 2XYPA 4O2LA 5KOHA 1WG8A 5F7ZA 4FFNA 3N0RA 3TLZA 5ICEA 1IHXA 4EI8A 3OF2A 2ZB7A 3NO4A 2VYNA 2GZ1A 3H86A 4IOJA 2WYOA 5A3VA 4TSFD <