2QXYA

Crystal structure of a response regulator from thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
LTPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDVFEGEESLNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of a response regulator from Thermotoga maritima.
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxyA00
1A04A 1GLGA 1Z13A 4PZ0A 3VNBA 4M88A 1F4VA 5IUKC 4N41A 3JS5A 2ZWMA 5HSGA 2R4QA 2MYPA 2FXIA 2GKGA 4MR8A 3NNNA 4MS3A 1DBWA 3LUFA 2QU7A 3CZ5A 3HVRA 3FFXA 1JFTA 4MQEA 3EQZA 3JVDA 4RY8A 5KC8A 1ZDMA 1KRWA 3EGCA 3E61A 4OBBA 3K9CA 3GV0A 3LUKA 3LKVA 1JFVA 2OQRA 4Q6BA 1YK1A 3N0WA 1J56A 1HEYA 4JOQA 1A0OA 1QP4A 5JS2A 1EWVA 2E4VA 3G85A 4G0QA 3QX8A 3OQNA 5IEBA 1L5ZA 3ILHA 4XAQA 3Q15C 5PNTA 1MAVA 1SRRA 4W5NA 3F6CA 2H0AA 1P6QA 3LUCA 3EDCA 3EULA 2E4WA 3FGZA 4MQEB 4XLTA 4KPYA 3HUUA 5TQ2A 5TQ0B 3RVQA 4MLCA 5KC9A 3OLZA 5HKOA 3OLYA 1D1QA 4TMYA 4IGAA 1EFAA 3HK2A 6ABPA 1NXWA 5T3YA 1H9CA 3BBLA 1CEYA 4P98A 1GUDA 3H5WA 3RVJA 1JL3A 3UKJA 1LJLA 3SNKA 4YV7A 3LMKA 1QQAA 1W25A 4JA2A 3BRSA 3LOPA 5CNKA 3LUHA 3BILA 3C3MA 3IDOA 3KLNA 4MQFB 4WXMA 3SAJA 3RH0A 2PUFA 1NXXA 2YHAA 4ZPJA 5EWMA 2FMKA 2JBAB 4N0QA 5TPWA 4EVQA 4F8JA 3OM0A 4Z4EA 2F8TA 1VRVA 4YGXB 4YWHA 1YTUA 3KLOA 4W5TA 2VK2A 3F7NA 3CZCA 3KJXA 4OG2A 1ZH2A 3LUGA 1W9HA 4G0PA 5IX8A 4RXTA 1D1PA 4KVFA 3CFYA 1Z26A 4TN5A 1JH9A 2WMYA 3OO1A 4N0PA 4IRXA 4Z0NA 1P6UA 2R48A 4RK1A 1JLKA 3KG2A 4Z4CA 3I5AA 4E7OA 3QLUC 1RZRD 4S04A 1JDPA 3LUDA 4MR9A 3CHYA 2PE5A 4O1HA 2W42A 1RNLA 3SG0A 3E3MA 2PJUA 2FTKE 2KYRA 1QMPA 2NUBA 3GBVA 1ZY2A 2A9RA 1PHRA 4YLEA 3I45A 4EGSA 4RS3A 2NZVG 2QVCA 4MRMB 1U8TA 1MIHA 5F64A 2WWVD 2PUBA 4W5OA 4FE7A 1P2FA 1USGA 3GRCA 1YMUA 3N6VA 1NXSA 3CG0A 5GOTA 4LRQA 5JS1A 4XASA 1NXTA 5TQJA 2IYNA 3OO0A 1FQWA 2GWRA 5EWLB 1C0EA 3S99A 1PNRA 4W5QA 1YS6A 4NCBA 4RSMA 1FFGA 4IMJB 4XARA 3QEKA 4YRZA 5E3JA 1ZH4A 4KZKA 5ED4A 1BVHA 2FEKA 2XDYA 1JF8A 4DQDA 4PE5B 4XFKA 1OXKB 1PUXA 2E4UA 4WT7A 3SM9A 3T38A 3NNDA 5CNIA 4G0ZA 4Z99A 5JNVA 1DBQA 1JBEA 1YMVA 3I09A 3RVMA 3O75A 4HNSA 6CHYA 4Y9TA 1DCKA 3LTEA 4KNYA 1P8AA 1AB6A 5JNUA 1F51E 1VPWA 3T6KA 2IPMA 3RVRA 2MYNA 2PKXA 4G0MA 1KGSA 4GNRA 4PYRA 2FEWB 2QZJA 4ZYLA 5IEJA 4ZJPA 1XHEA 3H5LA 4O1IA 4YP9A 1QPZA 4Z9BA 3T95A 4RK7A 4DADA 2NT4A 3HXMA 3FMVA 5TQ0A 1MB0A 2JCGA 3OLWA 4KK4A 2RJOA 2PUEA 4L85A 2CHFA 3H1EA 3MF4A 2RGYA 1NTRA 3KCNA 5FWXB 5IULC 1ABEA 3DGFC 4GPAA 2LIVA 1ZHHA 3EJWA 4FB4A 5ABPA 2L2QA 2E4YA 4DN6A 4O5AA 4YR7A 1TLFA 2A9OA 3GT7A 3H75A 3D02A 1LBHA 4IMIB 4FE4A 1D2AA 1GCGA 1JYFA 3CRNA 5KI6A 4WXEA 4MQFA 4UHJA 3M9WA 4EVRA 2GBPA 3CNBA 3T8YA 3KKEA 1DC7A 3GBPA 4L4UA 2JBAA 4Z9AA 3IPCA 4MS1B 4Z4FA 3RVSA 3L49A 4XXHA 1K68A 2JVIA 1DJMA 4QYWA 4Z4IA 4HYEA 2HJ9A 5JNSA 5FWYB 2IPNA 3HCWA 4S05A 2JRLA 1ZAYA 3EAFA 3NBMA 1NY5A 2LP4Y 3Q7TA 1E6KA 1TM2A 2P4UA 3H5IA 5KQLA 5KWSA 1TMYA 2Q5CA 1SXGA 4EYKA 2DRIA 2R47A 3I42A 3MIZA 1NXVA 3Q7RA 1Y1LA 1RXEA 3D8UA 4KQ9A 4OATA 3KYJB 3DLBA 3CLKA 4RXUA 1EWKA 2FEPA 4IF4A 4IILA 3JY6A 1FFWA 2FQWA 3O1IC 3QLVC 3HEBA 1ABFA 3RVOA 2FLKA 3M6MD 3OMXA 1YS7A 4H3KB 4PEVA 5B3JC 5JNWA 2PUAA 5IBQA 2FMIA 1KRXA 4F11A 4Z4GA 1KMIY 2HQOA 3MA0A 4RK6A 1ZGGA 4CBVA 1PEAA 2TMYA 3JPWA 4MRMA 3A3KA 3UUGA 4OLAA 2R25B 2P9HA 5BR1A 3HS3A 4JB0A 3DBIA 4RY0A 3W9SA 4JP1A 2FN8A 2QVGA 3H6GA 3HDGA 3N75A 3HSYA 2WRZA 4MPTA 2I6FA 3HV2A 3CKMA 1RXIA 1Z15A 3EQ2A 1APBA 3RVNA 4W5RA 1R8JA 1DP4A 2FQXA 1GCAA 5EWLA 1K66A 1JFSA 2NZUG 3NHMA 1RZRA 3H6HA 4N47A 1ZITA 5GQSA 2OENG 1ZVVA 2JK1A 3O2QB 1D4ZA 3NNSA 3ROTA 3IPAA 3JPYA 4G0OA 1SXIA 2F8SA 5JNRA 1DCFA 1QQBA 3OQOA 4NCAA 5IUJC 4H60A 2QSJA 5DLEA 4D6YA 4G0YA 7ABPA 3Q9SA 3OLVA 1Z17A 2ID9A 2CHEA 4RDCA 2IOYA 2PL9A 4KREA 3CTPA 2RDMA 3HDVA 3C3KA 2IPAB 1CYEA 1BAPA 4WUTA 4OTZA 4EVSA 1VLZA 3DGEC 2AYXA 1TJYA 3URMA 3CU5A 2YHBA 4OLBA 1U0SY 1C4WA 4E7PA 1Z12A 2GX6A 1FSPA 3SY8A 1SXHA 4UHKA 1XWWA 4RK5A 2PUGA 5FBHA 3MQ4A 2FMHA 4MS4B 5CNJA 3FFTA 4RKQA 1SD5A 5FWXA 1GUBA 3KS9A 5D2CA 1VKRA 1CHNA 2J48A 1U04A 3N53A 1NATA 3RQIA 3NHZA 1NXOA 1USIA 3RVPA 4ML3A 1M5TA 1Z25A 4RK0A 1E2BA 2FVYA 2WY2D 5I4CA 4NQRA 1YK0A 3QX9A 2MSLA 4QYMA 4LDAA 3H5OA 1LBIA 1BDIA 1YIOA 2FKAA 2FN9A 5DKFA 5TE9A 3KHTA 2N9UA 3GL9A 5TPZD 5C5EA 4LE1A 4F3TA 1TVMA 5BRJA 4MS1A 2PUCA 4JB2A 2QV0A 2QW1A 1MB3A 2VUIB 4Q6WA 4RZSA 5FWYA 1LJUA 5JNTA 4RK4A 4G0XA 2ZAYA 2O20A 3QLVA 1ISRA 3GA5A 2HPHA 3R0JA 3QK7A 2WJWA 3FFWA 2A9PA 3GWGA 4JASB 5B3JA 5DGCA 2PMCA 1DG9A 3Q7SA 3MMNA 5EWJB 3IP7A 5BRAA 3QELB 2A9QA 2JB9A 2HQBA 3KYIB 1JDNA 3F6PA 2PAFA 3MYYA 4YS6A 4Q7EA 4RXMA 2GI4A 4LZLA 1JX6A 4MAAA 4RV5A 1BDHA 1PNTA 1L5YA 4LE0A 1LK0A 2LBPA 4P1ZA 3TB6A 5KQPA 5IUNC 4N76A 2LPMA 4QPJC 1JHZA 1U2QA 3LUJA 5C5CA 3QLUA 4NV3A 2FMFA 3C97A 3ILYA 4KV7A 3VNAA 4RU1A 4PICA 2B1JA 3A10A 5CNMA 4QICA 4ZMSA 1PEYA 2IPLA 1EAYA 5CHYA 1QKKA 3JVIA 4F12A 5HM6A 2FQYA 2L18A 1QNLA 2IKSA 4WZZA 4KQCA 1Z2EA 1A2OA 3TX6A 1JYEA 2V0NA 2MSWA 4MR8B 4MS3B 2JVJA 1RPJA 4B09A 1QP0A 1NXPA 4KFCA 3C3WA 1EWTA 1FFSA 2QXYA 3FDFA 2IDMA 1D5WA 3O1JC 3UK0A 4HNRA 2L17A 3KSMA 5T7BA 4WWHA 1USKA 2BGGA 5FBKA 3HM9A 1OXBB 3TO5A 1QP7A 3B2NA 4YCSA 1U2PA 2VYCA 2WB4A 1M2FA 1DBPA 1WETA 1Z2DA 2LUOA 3O21A 3HUTA 1YVUA 3A0RB 3H1GA 3O2SB 5HQJA 3M9XA 2MYUA 3O1HB 1JWLA 9ABPA 5DTEA 3O2JA 3IP9A 3L6UA 1M2EA 4F06A 1DC8A 1EHCA 5TQ2B 4ETMA 3KTOA 3H5VA 3A0UA 3H5TA 3ROFA 4ETIA 2FLWA 3N8IA 4EYOA 4KMRA 4EYGA 5KQMA 1MVOA 5BQ3A 3LKBA 2PUDA 1URPA 1T34A 2H3HA 4G86A 2CWDA 3OLXA 3CG4A 4MS4A 2L19A 1E6MA 4H3HB 1DRJA 3G1WA 2PL1A 1M5UA 3RVLA 3SQNA 2CD7A 4KK3A 2AYZA 1Z18A 2MYTA 2RJNA 4D6XA 3IP6A 4TLMB 4HNQA 5EWMB 2WJAA 1I3CA 1DZ3A 2NT3A 3EODA 3OMWA 5KQGA 3DLHA 5TPWB 1ZESA 3K4HA 1QO0D 4EYQA 4LE2A 3QLTA 2HSGA 3IP5A 3QEMA 4RY9A 4LDZA 3OM1A 4ZMRA 3P9YA 1QO0A 3JTEA 5DCLA 1DCMA 3H1FA 4YO7A 4ETNA 3DZDA 3LUAA 2PLNA 2X7XA 2VUHB 2JVKA 3HO1A 1UDRA 4EY3A 3BREA 4TLLB 2M1ZA 1ISSA 4Z4HA 1ZGZA 2M98A 4MR7B 5EWJA 3QELA 3MM4A 4MR7A 4MR9B 4EUKA 2FSPA 3O74A 3LFTA 1B00A 3RVKA 1DRKA 4G97A 4JAVC 4D74A 1Z16A 3N0RA 3C6QA 5IC5A 4KRFA 1BA2A 1ZN2A 4N03A 2E4ZA 2ID7A 4NICA 3GYBA 3HZHA 3QEMB 3HJFA 2MSKA 4MLDA 1BDJA 5TPZA 2FW0A 4LX8A 1XHFA 4MYRA 4MGEA 3TMYA 3TD9A 1E6LA 2B4AA 1IIBA 3N0XA 4RKRA 3F73A 2HQRA 4RWEA 8ABPA 2QR3A 3OQMA 3BRQA 1AB5A 3CS3A 2E4XA 3Q41A 1S8NA
chains in the Genus database with same CATH superfamily
2WWWA 3LBIA 1EK1A 2Q3JA 2YRWA 4X6YA 3IXMA 3EVZA 4II7A 4EPWA 2W6JD 4EMUA 5D3ZA 3PKZA 4BGVA 4COOA 2WUWE 5FO0A 2W8BB 4IDCA 4XTRA 4YQYA 3SKVA 3UBMA 5KU7A 4R6XA 1YA6A 1E5QA 4BVLA 2GASA 1OSNA 1TYBE 3L2OB 3ZLVA 3PHCA 4QRHA 3N76A 4U4AA 1EI9A 1EAMA 1V7PC 3KQPA 4HUJA 1WB6A 1WVGA 5AMXA 5IZ4A 3GLGB 1ISMA 1CJMA 1YZTA 1ZVJA 3AIKA 4B3RB 1IY0A 3FR8A 1MG5A 4HT3B 1J8YF 2VZ0A 3UICA 5E7IA 4WASA 2MINB 3TLZA 1QV9A 2D1SA 5DM1A 3FPJA 3KR2A 1PX2A 1EDZA 4LDRA 2JGNA 3UV3A 2XQVA 5CVJA 1QP4A 2VWHA 1KDOA 1Q92A 2I2FA 3UN1A 1VA4A 1T36B 4XM2A 4JJAA 3ZWVA 1A9XA 1SR8A 1EFDN 1UZUA 1EM8A 1IHUA 1XRMA 2BMDA 3JQ7B 4NJEA 4MUBA 3ES9A 1OHHD 3RUDA 2QV7A 3QVLA 4ARZA 2EEPA 2H31A 2YCBA 5JBQA 5K8UA 2O1EA 1WUIS 3B78A 4OX9B 3EPHA 5KAPA 4GQIA 1OE0A 3O1LA 3VR6D 3X2FA 2ES4A 4C07A 3TQOA 2PX4A 4XWKA 2WT8A 3OKFA 4DVJA 5E1DA 4Z3OA 1LRLA 5ALYA 3SDSA 4ZK6A 6ABPA 1NXWA 3RR2A 1W0KA 4B8WA 2X9LA 4QJ3A 4A7PA 3ICQB 4YH1A 5JSZA 2G9UA 4AG3A 4B3SB 1E2JA 4KR3A 3EZLA 3IO5A 2WA2A 1NPTO 2IF0A 4PLVA 4LHWA 4XVCA 2LR0A 3ZI7A 3LUHA 1GEEA 1VXOA 2RIPA 3C3MA 3P9KA 5LUAA 2XECA 5AUNB 5FTLA 5IBRA 4ZPJA 2Z04A 4I5GA 4HWPA 5E9QA 3LRTA 2HCBA 5HZMA 1MQSA 1EFTA 3UMJA 3WMEA 2I78A 3ICOA 2O3RA 3QKIA 5AM2A 2G04A 1NAIA 3AUFA 1T2VA 5EUBA 4BRZA 2O2SA 4PWYA 4OG2A 1P9NA 4AP5A 5BWNA 2OQIA 1QX3A 2W2LA 4JN6B 3T5BA 1G2PA 3JQQA 2X6TA 4I9FA 1LQTA 2BDTA 2VXYA 3S1AB 3GCGA 1U0FA 4RABA 2BZ1A 2P5TB 5COBA 2Y1GA 2BKLA 1G63A 4Z4CA 3I5AA 1N6LA 3PEWA 4Y1RB 5JLAA 2P6RA 1VL1A 4B9EA 4J43A 2PE5A 1UJBA 5H0IA 1JZQA 4I7EA 2EKDA 1OX4B 4J0JA 1WW2A 1N2CE 4L3WA 4KV9A 1RNLA 3HCNA 3L1JA 1VG0B 4IH9A 2H1IA 1NU8A 3HVUA 3SZOA 3H5AA 4JI2B 4C05A 4YECA 3I45A 1E18A 3BIWA 2CMFA 3BK1A 3GFSA 1P39A 4CEJB 2D7CA 2B99A 2CJYA 4EPTA 1I0ZA 3QVWA 2FPGB 3LFHA 5EJGA 2V7QA 2PUTA 1N2XA 2GBGA 3IRUA 4IIJA 5BSFA 1JSRA 4QFDA 2VQEB 4TKVA 3C14C 3OFSA 1PR5A 3PRJA 1K88A 2XPCA 4EENA 1UOPA 1DO2A 1ULHA 1W48A 3BQNB 2FVXA 1EEXB 1NXTA 1RJGA 4G89A 2PS3A 4AKEA 4L9AA 1KI1A 1KZ9A 3ORRA 1E77A 4OQ4A 4RSMA 2WABA 3M49A 4K0RA 2X4DA 1LDMA 2R87A 3HR4A 5CD9A 1SC3A 3N2KB 1RAFA 4DYDA 5F7XA 1O54A 2O2CA 5C46F 2BCEA 4WT7A 3S27A 4D9BA 2HSDA 1C8LA 1OFGA 3E23A 4AUKA 3OD5A 5J9FA 1SK8A 4Y6QA 1QHHB 1UOEA 4GKAA 4XX0B 2Q2WA 1FY2A 2QLJA 2P65A 2QX6A 2XVZA 4TMWA 4LN1A 1MX5A 5LJLA 1X6VA 2JEOA 3RHFA 3RRBA 2GEUA 4CMEC 3U16A 1UKAA 2W6MA 2QD4A 1FSSA 1P2BA 3FPHA 3GF4A 3LT2A 3LTEA 3BSFA 3MS2A 4KO4S 5CYFA 3SYMA 1E7WA 1T6ZA 1YS9A 3EG9B 4KQ1A 4LHYA 4UE2A 4ZYVA 1YFLA 3QU2A 2IPMA 1T91A 1UC9A 3T1NA 2PJZA 4I6GA 2Y1KA 2RB5A 1HQYE 2BGLA 2IVZA 4GNRA 5D3KA 4TQAA 3FJ1A 4C6RA 3LS2A 2JIOA 2ZAGA 3TK1A 1OLOA 2P6MA 2Q5LA 3F9RA 5G0TA 2O2EA 4LSZA 1JIVA 1P7CA 1ESZA 1Z6AA 2J5QA 1UPBA 3KOWA 1TTQB 3NOOA 4M0MA 2WVJA 4I4NA 4YJGA 3RWOA 3DE1X 5J4VA 4AXXA 3QKRB 5IULC 3R3JA 1DJLA 2A78A 3EXEA 2ZI7A 4LJKA 3G2OA 2ZJOA 2ZRMA 4GLOA 4M9XA 3DD1A 4N01A 7MHTA 2Z6VA 2GBIA 1GZVA 1XU4A 4BKOA 1QZUA 1Z5OA 5I9BA 4FE4A 4H7JA 5DLYA 1UFRA 3QBDA 4GSLA 3JZFA 1TM5E 1FVHA 2M6KA 3A2MA 5IRCD 3SU8A 1A8SA 2B69A 4D02A 3SKXA 1CEXA 3PXDA 3TFOA 2CV2A 4Z4FA 1M10A 1V5FA 2GJKA 3BMCB 1N92A 1RLOA 3BXZA 3AXTA 1OBOA 3L4BA 2AT1A 3RHSA 4LX0A 3FAZA 4JLDA 4M6WA 3R9XB 4RCYA 4ZV7A 1Z7YA 1IN8A 4KQ2A 3REQA 2B1GA 3ZWNA 2EJUA 4XDZA 4EQZA 2VK4A 3GB9A 4QBTA 4ZGGA 1VA5A 2IITA 3C8MA 3EN0A 3L7CA 3LXMA 1TMYA 1I3NA 1XNGA 1SUDA 4MEJA 4PFJA 4BXOA 5AVXA 1Y3CE 3RYIA 3FF1A 3MTEA 4JCOA 4U6QA 4WL0A 4Z0TA 3RS4A 3TW0A 2GRUA 2FPPA 4US1R 4DRXA 3BICA 4HWRA 3P2OA 1TADA 1FNBA 3SDBA 3F49S 4ZZ2A 1YVPA 4JXZA 4EX7A 4D81A 4CKZA 3P1JA 1O0BA 1X80B 2V8BA 5HKAA 3FWNA 1PFVA 4UUOA 2JJ1D 4RK6A 2W83A 5AK5A 2IS4A 1H6AA 3L8DA 4KE6A 4RY2A 3ID6C 1SVSA 2JGIA 4EHHA 1TQ4A 1PIWA 2QUHA 1SAYA 3AL3A 4M1MA 4RY0A 3OWXA 1ZXXA 3BDIA 4Y18A 3T5AA 3NYIA 4FYXA 2OGSA 2B21A 3OLQA 4MWGA 3NJRA 4U7DA 3LQFA 1J20A 2YIVX 4W7SA 5HZGA 3C6BA 5HTKA 2PD3A 2I6FA 4HAYA 2XTAA 4LMPA 4N5NA 2JI7A 4KN8A 4TL7A 4E09A 4E5MA 4K6HA 1MAHA 2ZIZA 1EVZA 1WEHA 3EDMA 4PHCA 4TMZA 5CJ2A 4DDHA 1LK5A 3NC4A 5E95A 1YQTA 2QIOA 1FW8A 1JFSA 1G16A 1X38A 3ELUA 3PFGA 3SR3A 2OENG 1EUDB 2OCKA 3LZDA 1S4QA 4NE9A 3VR0A 3IYLW 5E6SA 5TLSA 3T5PA 2HGZA 1MAAA 1F2TB 3PCRB 4KQWA 4FHDA 4MW0A 1XWFA 2HBQA 4NKRA 1D6MA 4TSRA 4D5GA 5IJ9B 1CDDA 4O4HF 2BP7B 5J4YA 5C51B 1JDTA 3MILA 4OAPA 3COVA 1PN3A 2E0IA 1TOAA 3W5CA 4UZEA 3RS8A 1IJKA 4O4JB 2JGKA 1AS0A 3L9XA 3MSCA 2XBUA 4PG5A 1BNCA 4X1KB 4D98A 5BSHA 4KREA 2FFAA 4TL6A 1D8TA 1WZCA 3KWFA 1JU3A 4GZ3A 2YBEA 2AI2A 4N6NA 5AH0A 2WAOA 1UIRA 1M6EX 3EZYA 1X1SA 2ZANA 1Z0UA 1HE5A 1L7RA 4PW0A 4BZXA 1DEKA 1QJCA 4XLLA 3RSZA 2VQFB 4BFYA 4R2MA 4KYUA 1CV2A 1Z9BA 1FSFA 1U3VA 3KOZA 1K89A 3JWEA 2F3TA 4IIEA 4V0LA 3UGQA 3FHLA 3KYCA 2WTXA 3SDZA 3I6YA 1TTPB 2ZSFA 1YHYA 2FWBA 4O08A 1QNFA 1DX9A 3KV1A 1FVOA 1FMCA 3WQBA 3W7BA 3OLCX 1B0ZA 1Z25A 1WF6A 1M34B 4D0RA 1PKXA 4OK6A 2FVYA 3ZGOA 1SBIA 3K73O 1KQ3A 1Y8AA 1AQLA 1N2IA 1YK0A 4AO8A 4ZGWA 5J3JA 1IM5A 3E7XA 4WAUA 5C5EA 2HDOA 4EI7A 2J6BA 3D3JA 4OHWA 2P5YA 3AETB 1JDZA 2QQGA 2VYVA 3B6EA 3OQ1A 2KSQA 3THYB 3DO8A 2QV0A 1BU8A 1HEUA 4Q6WA 1LK7A 4PO8A 3DE6X 3KJGA 5E2BA 2D6FA 4RPIA 4O0MA 1DX6A 4TKUA 5FUYA 4RL6A 1ISRA 4ES6A 2JDID 3R0JA 2O8FA 3TRFA 2MMGA 3L4EA 4DOMA 4ISBA 2D5CA 4MUXA 1H1LB 3SX2A 5EWJB 2FPMA 1R3UA 3AEUB 3OZCA 4YDSA 3WGOA 1MIOB 4JKIA 5ADVA 1D3AA 3P9PA 3EVTA 4HI0E 4MEAA 4FYYA 1UBFA 1VL5A 2SKEA 3F1KA 2VYND 2V7XA 4FD3A 3I5YA 1ZMXA 5LQRA 1LVHA 3CXRA 2QUJA 1PK7A 1U1IA 2QTCA 2FK7A 3ONEA 2Q7OE 2WYWA 1NM5C 3I9NA 2QVYX 2IOFA 4JOCA 3MS4A 1WW3A 1NR5A 4ZCMA 3LK7A 1I24A 4BY9E 3A25A 2BPOA 2QLBA 5DGXA 2QF7A 2FKNA 3LUJA 5C5CA 1NBEA 1QGDA 3FVTA 3M3HA 1X1RA 3Q7QA 4MMXB 2AJTA 3TTUA 1Z4IA 4HL6A 3UWMA 1VB3A 3CTMA 1LS1A 5AXBA 2JFFA 1CY6A 4BP8A 1EWQA 3JALA 5B1DA 2QX4A 3W79A 2XCIA 3KL2A 3DL7A 3A32A 5BUQA 3LGSA 1P3Y1 3C4VA 1PFQA 4CG3A 3HJRA 2Q8PA 2VBIA 4EGFA 4YV0A 3RJ5A 1YVEI 2CHQA 3E3OA 1IBMB 3FOWA 4KQCA 4FEEA 4WOPA 1OLSA 1SQFA 3FCOA 2C99A 4A1OA 1QFXA 4E1BA 1P0QA 4Q47A 1LA2A 5KSWB 5K0SA 1CQZA 1BMTA 1GTMA 2R60A 4ENTA 2EWVA 3AR9A 3RNOA 4UW9A 5K6AA 1DQNA 4TMXA 5FBVB 4BFUA 3IAEA 1ADJA 2HCFA 3UFXB 5F2NA 2O7RA 4Q66C 3N2EA 1EVJA 2OE2A 1RRCA 1GILA 2V7GA 3B2NA 3R5TA 3MZ0A 1Y3BE 3GFFA 4M37A 3WLOA 3ITNA 5JSFA 1KI6B 1UP7A 2QENA 1OAKA 1W6UA 3V2UA 1WETA 4LFBB 1WB4A 1PQPA 5G02A 1NKSA 1QAMA 4IIVA 3HUTA 3GVHA 3KPWA 2P1DA 4KXNA 4PGMA 2I3BA 1PYDA 2MYUA 4M49A 4Y8VA 3BFPA 3U4CA 9ABPA 4IUYA 1SUWA 5L4SA 1C1XB 1UH5A 4Q7KA 1W85A 3MINA 4AN1A 1SIBE 4QAQA 5FLEX 1F3OA 2EIHA 3O3NB 1D8AA 1OPRA 1Z5WA 1W59A 2PFGA 3MEQA 4LBYA 3T3HA 1UXOA 2IUFA 3QV2A 2Z95A 4NV0A 3WIVA 2DXIA 1T1RA 4QDTA 4YQZA 1QRRA 3PUWA 4A82A 5FOSA 1FP4B 3KWLA 4UQPA 3P45A 4F04A 2GTPA 2AN1A 3GA0A 1RAEA 2JCBA 3OWOA 4E2WA 3OIWA 4LOKA 1T34A 2B8EA 4NJOA 5THXA 1PJCA 2OBNA 3JZMA 4M1TA 4XH9B 1WV1A 6AT1A 1E4VA 1EE9A 2PX8A 3CKKA 3QU9A 4PNEA 5GZ3A 3EQ7A 3LVQE 2DFPA 4EZBA 1XD2A 1XFDA 4YUXA 4L4YA 1NJ5A 4M9QA 5AIBA 3KAKA 5E9WA 4L7VA 3PQ6A 4I3GA 2BFOA 2DWPA 2ZETA 3LO8A 4PHHA 4ZOQI 4OLHA 4JI0B 2O4CA 3F4KA 1UMKA 1ZESA 1G20E 2QJRA 3FYUA 1Q22A 1CUSA 2F8MA 5F1OA 1QO0D 3BUSA 3KZMA 1S3SA 4JEIA 5H3CA 1E9AA 3I30X 1VG1A 4DBLE 2RHMA 3M6UA 2DLNA 3KLMX 5FNVB 1D09A 5TR9A 4EW1A 4CTMA 4YCMA 3ANMA 1I13A 1SQ5A 4C0SA 4PVCA 5DCLA 2C2BA 3W5AA 2BKXA 2JH8A 3GRZA 3T4EA 2FPSA 3KUDA 3UXEA 1LDEA 2DSNA 1MF7A 1S02A 2B98A 2JVKA 3SBEA 4KFRA 5FBQB 3BAFA 3L40A 3VHRA 1U2EA 4PQRA 4ZI7A 1GFZA 1R5NA 1AQ6A 1J8FA 1U4OA 4GNKA 1VJCA 3SXUB 4Z4HA 2WQ7A 2H63A 2BI7A 4X9XA 5DCWA 3W2GA 1UCFA 7GPBA 2KQUA 3QELA 4UU0A 4ZZ1A 3ER8A 4DLKA 3C6ZA 1RQNA 4X84A 4FGUA 4X63A 4HAUA 2IBMA 3ZVKA 1T2AA 2JGFA 2C4HA 3OOJA 4M1OA 2PU5A 4QFCA 5KKAA 3CLRD 2XXAA 4ZN6A 5JCPA 1NBME 3RIMA 4Q82A 1DPGA 4I19A 2KBEA 2B8WA 1KMNA 3GPDG 4J0CA 4PZUA 2UUAB 2HHLA 2QP9X 4LY3A 1Z5GA 1C3VA 3TN7A 5HJ5A 2RC6A 5HCNA 3GGGA 2B8TA 3EC2A 1L0BA 2B4AA 1G6KA 2VA9A 3QP9A 3D1JA 1NJFA 1NUAA 3Q5GA 3JASB 3AFGA 5F5LA 1P7PA 1XMPA 2VF4X 2X0FA 3U1VA 1SZDA 2B34A 2P9CA 1QVRA 1ATIA 4AZTA 1DPFA 1GKKA 1YJAA 1DFIA 5DZSA 4MA5A 4LF6B 2XMGA 5EIBD 3NVKI 1HK7A 1Z22A 2OFOA 3NASA 4EUFA 2Q2QA 2NGRA 4F46A 3N3BC 4Z8XA 1BG6A 5LXTF 3RSLA 5HYVA 1Z7EA 1XRLA 2DJ5A 1Z0IA 2VHYA 2WP0A 2ZJFA 4GMKA 4N3NA 4QJIA 4U6NA 3S6JA 5B2FA 5K7SA 3JW8A 1HFJA 4RH0A 1PJRA 2DBZA 5F35A 2REBA 3NC1C 3N58A 3UCEA 4HD8A 1V0JA 4YRPA 4F38A 3AR6A 3ZHUA 4OP1A 3HJNA 1KK0A 3B7WA 4ZOLB 4ZI7B 2YVAA 3CLHA 4YRQA 1XPOA 4EBBA 4IDFA 1QZ3A 1JLSA 3TUZC 1TA0A 1J56A 1KP3A 1G7RA 1A0OA 2O2XA 4EY7A 3EGIA 1F2DA 3JWJA 2G36A 1HGXA 3LY9A 5ALTA 3YASA 3W2IA 3G85A 4J0EA 1ORVA 4JA0A 3HSKA 4R16A 4ARUA 3GT0A 4DEYA 1H1DA 4KQXA 1KPIA 5EHNA 3I01M 3CIOA 3WGUA 4D6PA 3ILVA 4KXWA 1P33A 4Y9SA 1MTZA 4OHZA 3UJ7A 1FYEA 4RGYA 4RD4A 3EDCA 3RW9A 1Y5NA 2LD4A 4MQEB 3K15A 2ACWA 3AI3A 1ZR4A 3OSUA 5TVGA 1P80A 4MRAA 3QVGA 1KU6A 2GK6A 4MLCA 5ES3A 1KEKA 4EMBA 2YNMD 3QBJA 3A04A 5CB4A 3E05A 1Q6YA 4FFNA 1EFAA 1P5ZB 4NBUA 4GUAA 3HKEB 3ZK7A 3VOBA 3I8OA 2ARKA 2FW6A 3BCRA 3DZBA 3S1AA 3SIXA 4BHTA 1YUBA 4JUBA 4XRGA 2IWRA 2W2KA 2BHLA 3D2CA 3OCZA 4GPTA 2XBMA 3WY9A 5F78A 4ZQIA 1DUSA 1YR8A 2IYEA 4YYZA 1YWGO 2IOQA 3N59A 3RH0A 4QM6A 3R5FA 4LC9A 4Y0AA 4ZO7A 5EWMA 5H59A 4BX8A 3JVUA 1CUIA 4NX2A 4EVQA 1FE8A 1FQJA 1N2EA 2QMOA 2JHGA 4J76A 5EE9A 3RHZA 4JWTA 1DWPA 1EFLA 1ULTA 2FUG6 1IEXA 1GEGA 1W30A 1Z28A 4KIJA 3S44A 1T6YA 1L4YA 4IYJA 2JATA 5CX1B 5KYWB 2FPGA 4EJ6A 5BMVB 4M87A 1K8RA 5AI5A 2E18A 1K98A 2JAHA 3LVBA 3LYHA 4N5HX 4IS2A 2BM8A 2RBGA 2VP2A 1YAHA 4JVLA 4KRGA 1EUYA 3Q12A 2HHHB 1E1RD 1N5LA 3FW1A 2P7HA 5HGJA 2PH3A 4RF4A 3CB2A 1C8KA 1J0BA 4MR9A 2X86A 3THWA 3QNUA 2Z1MA 5KVVA 1TD1A 1GWNA 1BH2A 1P19A 5HMLA 1WX1A 3I5XA 5GONB 3KQOA 1PDOA 1MOZA 2CFTA 2PJUA 2Y2UA 1WKBA 2C31A 3E27A 4IHJA 4LYHA 4UEKA 4DLTA 3EMVA 1GNSA 2QVCA 2F43A 3LWDA 1K92A 1Z2AA 1L4BA 3NTRA 4G4SO 4LBWA 4BZQA 4JJEA 3RBXA 4S1PA 4RIHA 3ROPA 3UJ8A 1ZW6A 3A9VA 1UBEA 1IWOA 4UPVA 1P2FA 1HFWA 3NAGA 1K5PA 3ZZ0A 3VAYA 4ZQEA 1U2GA 4W8GA 4JI6B 1PR4A 5I7SA 3R3SA 2PH5A 2ZRPA 4IG4A 4O2LA 3TVTA 3O7WA 5BW5A 5I7VA 2F90A 3OCUA 3OHSX 3PQCA 4GSYA 1MC5A 4KZPA 1UINA 3FR7A 1VHDA 4TMVA 3EXAA 1XTKA 4QO7A 4WKBA 3JR7A 1YS6A 2AJBA 4UMFA 4A2PA 1ESMA 3M1IA 1EFPA 1E99A 4B83A 4PZPA 2IUUA 2O2ZA 3VDMA 3FGPA 1Y5RA 3IPRA 3RC3A 1ZWKA 2P3SA 1ZH4A 3T34A 3TLXA 1FYWA 4B1FA 1LTKA 2WVGA 5JEDA 4UPEA 1OXKB 1PUXA 2E4UA 4M8SA 4AWXA 5DPMA 4LCEA 4YPFA 4JLBA 5DI3A 2GZ2A 4XA8A 1H0RA 2D54A 1H93A 3ABZA 4G0ZA 4PC7A 4WN3A 3V7YA 3OTGA 3R5XA 4PLWA 3EX7C 2EF1A 3WYFA 3ZD8A 5JBIA 1QQBA 3ZD7A 3PDIA 1QOPB 3BE6A 3CLVA 1ZLYA 3I4LA 1IUOA 1CUGA 3M33A 2GN2A 4FJ2A 4YPOA 1KQFA 3AR2A 2GYVA 2OZPA 1VSUA 3IBFA 2ORED 2WG1A 3HYLA 2Q9AA 1ZGCA 4O4JF 3RVRA 2XRFA 3V4ZA 4BO8A 4ZCPA 1JKIA 2WWHA 3AHFA 3H86A 5KYYA 2SKDA 3W4JA 3GJ0A 3MGKA 4E2XA 2IOFK 1UMBB 2YDXA 4L9SA 2ID8A 3M6FA 5KQRA 3AM3A 3T95A 4CKCB 5LL6P 3DV2A 2QTTA 1T8RA 4OOEA 1FW6A 3AF6A 1BXRA 2QT1A 4L0MA 4ZOEA 1PWZA 3MTGA 3ZDFA 3ESCA 4D9EA 1MW8X 1B14A 1EFVB 1BS9A 2NZJA 2OYRA 5JPIA 1CPYA 3OFKA 4GXRA 5CDSA 2JFOA 3WHPA 3MTAA 2H51A 4G0VA 1KZ4A 4KXUA 1Y8QA 4B3DA 4FCWA 5T6MA 1I2MA 3AB7A 4DN6A 1GTSA 3M6IA 2PZMA 3DMTC 1TLFA 3GRPA 4ENSA 3CVVA 4DV2B 4Y3UA 1YOBA 1QH1A 3S8YA 5JJKA 4LNAA 4YJ2B 1GCGA 1P91A 1I5EA 1ZEJA 1TE2A 2AVNA 2P69A 3VPBA 4BKUA 2F1IA 1ODIA 3BE5A 3R76A 1C30B 1A4XA 1D9ZA 1WDMA 1V6SA 3ZZMA 1C0PA 4NP6A 4ZEOA 2OD2A 1P8JA 4HDKB 3ZGXA 3UT5A 3FETA 4ZD6A 3WMXA 2BFMA 2VJDA 1XVTA 4HQOA 2IELA 4K6OA 4Y2HA 3S0JA 1GQYA 5BURA 1MV5A 2WSBA 4EEKA 1OZAA 3G88A 4L15A 3D4LA 1HDZA 2HOQA 3A3NA 2RGXA 1M72A 3OQHA 3Q3GE 4RD1A 4AECA 5BVGA 4JBYA 4S05A 4PGGA 2B5VA 4JP2A 3SZRA 2ZZKA 4GM4A 2WAAA 4RTKA 2PXHA 1N2CA 4CRWB 5AK6A 2Y0EA 5ESWA 5I5EA 2P2DA 4IWXA 4ZAGA 4DSAA 3LP6A 2YCLA 4YRNA 5IVKA 5JALA 2YWBA 4QUGA 3KT0A 1Y6JA 3HVKA 1I6WA 3UC9A 1ECGA 5C7OO 2INGX 1TNDA 3PEVA 4MYCA 1IRXA 3CF2A 3IURA 3FBTA 1F20A 1JAXA 1PEAA 2D2XA 4TUYA 4B3CA 4CBVA 3D3QA 3A9UA 5JWRA 1OXTA 2Y0CA 3A3KA 1V3QE 2CKDA 1SHJA 2A5DA 1BS1A 1Q7CA 2DFTA 1U9IA 3ZCTA 3T9FA 2WHQA 3BX1A 4F8YA 2Q4EA 5LKRA 3K0CA 4D8UA 1BX3A 1YIAA 2ZRAA 4GYWA 3WQHA 1VJDA 2OCGA 1DP4A 2QVXX 4WCFC 4CLRA 3D3WA 3AO0B 3SGLA 1RD4A 2O14A 2Q0SA 4I9NA 2PMWB 2NZUG 4W6QA 2I2XB 4WESA 2ZXUA 1HTWA 3LX6A 1PUIA 3M3DA 1D2RA 2HXYA 2JK1A 2OOKA 3BE8A 3GRKA 1EYZA 3NVAA 1OVGA 3JAWA 4QUHA 1SXIA 3CUKA 3O03A 1IHPA 4F9TA 3L6BA 3FMPB 4Z9YA 2A58A 1Y1SA 2J3HA 1AF4A 2PX0A 3TIGA 1GQFA 3ZE2B 4BRWA 4D6YA 5BY2A 1BXZA 1O1YA 5CVEA 2R1TA 5E4FA 4A91A 3GVIA 4U2DA 1XN4A 2BEJA 1K8XB 4RETA 2ILVA 2IZZA 3AOEA 3GOQA 3Q7IA 4RDCA 2GPSA 2R751 3TGPA 2QW8A 2IPAB 1YH3A 5T5QA 1AGNA 1X86B 2VWPA 4WUTA 5BWBA 4GICA 5FPSA 2AQKA 2FG7C 4PIVA 2ZBUA 1Y1KE 2CNBA 4WNAB 1IB6A 4CM3A 3JR3A 5K8TA 1RE1A 1MGOA 1FCJA 3P9SA 2WYVA 4TQGA 1TAGA 2VNKA 3GFVA 4KU4A 5A5DA 1SXHA 1L6RA 1NQUA 2P3LA 2QRQA 2X15A 3AEQA 3GAAA 3K16A 4WRRA 3LZ6A 3U7QA 2XD9A 1HXHA 1N8SA 2W7TA 3PDJA 4CR6A 5EVJA 2C97A 5ESDA 5K51A 2EZ8A 4GLFA 4BO1A 5JFGA 2IU3A 4FGKA 5LQSA 3T9DA 3RQIA 2C4WA 1MC4A 1VCOA 2HRRA 3NDPA 4GZ5A 4ML3A 1GPUA 1JQ3A 1FTYA 2Q6LA 3CUYA 4PLCA 4W7IA 4KIUA 5AKEA 4A2WA 4DIEA 1X0VA 4MGHA 2QTBA 3EUEA 3QX9A 2YUTA 1L7QA 1P62B 4HFMA 4TTJA 1KDPA 1P4HA 3O8OB 5TE9A 3B9BA 1IZYA 3HKCA 1TVMA 1ZFNA 1C1YA 1U7XA 1ARZA 2MR6A 4G6ZA 1K6JA 1OAOC 1WMBA 2OLJA 1K06A 1IONA 1MAWA 3DULA 3PICA 4JB2A 1H66A 3P7MA 4K40A 4NENA 2OZVA 4YJKA 1AQIA 1N3LA 1VDZA 2W37A 1V4BA 1PBTA 2WF5A 3BXXA 3PWKA 1RQPA 4QQ8A 2BEUA 5FNVF 1POXA 4NCHA 4BMNA 3FLBA 2HPHA 3HYNA 1A8IA 1JQ5A 1P5JA 3H0KA 3D0QA 1H2YA 5KTMA 2QL7A 2NSJA 4MI9A 5KNLA 4EKYA 1UPUA 4B6PA 3FZNA 2YQZA 3X1XA 6YASA 2C78A 1AXRA 4IS3A 4J7CA 4CM8B 4EFMA 5C8ZA 2ZUCA 1IN4A 1D6JA 5FO1A 4BFSA 1I1OA 1XI2A 1I51A 1TEVA 1PNTA 2GK3A 4B9AA 1OJLA 5IJWA 1LK0A 1RLIA 2FWAA 2X4GA 1UMDB 3VNVA 3IPXA 3S2EA 3PGJA 1NJ8A 1WUTA 3BMNB 3MGCA 3KQUA 3GJSA 1XDZA 5J2TA 5E1MA 5HS6A 5IDYA 5KCZA 1MPXA 3WWCA 2EZUA 2JGLA 2WTMA 1V47A 3A10A 2Y9PB 2J87A 4P3OA 5EZQA 3PHJA 3TR5A 4RVGA 2NM0A 4PONA 3LD9A 2IQ5A 4XWGA 5EXDA 4NZMA 2Q5JA 3AJAA 5DCUA 4F12A 2HPAA 4HB0A 2G8LA 4AKHA 1UEJA 3LQ1A 4GLLA 4U39A 1Z6TA 1XJWA 3KP1A 3DTVD 4D9MA 4PR0A 4GU5A 2IZ6A 4BEBA 3EGOA 3ETLA 2BRUA 2Z5VA 5G0SA 1UMCB 2HF8A 2QAGB 3Q7PA 4MKFA 3K8YA 4CIYA 1QHXA 2PUVA 5IK2A 2IHBA 3ND6A 2JZOA 1XKXA 4FMBB 2IDMA 2NXCA 3R2JA 3JYNA 4UU1A 3EFBA 1WZUA 5DX1A 1IZ9A 2A6PA 3C16C 4BLTA 4JLKA 1M2VB 5FXMA 5K8CA 1YRLA 4NAVA 4N6OA 1WKVA 4OO3A 3D8RA 1DBPA 3ZBTA 3L3BA 3HP7A 4ZOLF 3ZJYA 2BZSA 5ITZB 4DV3B 4J4BA 4NYIR 2WZDA 1B0PA 1RQ2A 5IT5A 1I8TA 4WDQA 2OESA 3A6FA 5BVHA 2P9GA 2CNNA 1VL6A 3UHJA 3KEFA 2ATVA 4YAWA 1R2QA 4RVNA 2SICE 3FDIA 2ZIUB 1TXGA 5KHLB 1H65A 3HN6A 3FCEA 3CE6A 1J0AA 4L57A 5JS6A 3EEOA 4EYOA 4ZDKA 2A0UA 2EFCB 2N1MA 3OTHA 1Y9DA 3TQSA 4ZVRA 5J4KA 4TROA 2OFPA 2FZ5A 2ZBGA 1LZLA 2MHCA 4J1NA 4ZU1X 4BX0A 4YQFA 1BVRA 1NNUA 1KPGA 3X0DA 1HZJA 4M21A 4U7WA 3VO1A 2JIZA 5EJ2A 4X54A 4DLVA 2WMNB 4ON9A 3RS7A 3ZWCA 2B61A 4C30A 1HDOA 3IT2A 4EVIA 4IXDA 2ZUBA 5M2QA 3AKZA 3UJAA 4B80A 1KK3A 3EODA 2Y1EA 3ZXXA 3TOZA 3GFPA 4DCSA 3C5EA 1F0NA 1QFZA 2ZT8A 5AJVB 4BX2A 4XPIA 1J5EB 3TW4A 1RYBA 2JJQA 3RGWS 4RSHA 3AP1A 1NJSA 5TEVA 3WLJA 4F4IA 1V1MB 3KOMA 2Q07A 1FJXA 5K4HA 4CKBA 3ESQA 3P9ZA 3PC7A 5CT5A 3SBDA 3NM4A 1S9DA 2VUHB 1NX6A 1YQ9A 3ZI4A 5BN3A 4C7OA 3RAPR 4C3VA 2JJ2A 1KGDA 2YN2A 4KBYA 5JI2E 3QXHA 2GUWA 5BMVF 2FWPA 5LA6B 2DCMA 2M98A 3DT6A 3NRBA 3UGJA 3RK4A 1PF7E 3CURA 2JZNA 3OX3A 4HDCA 3UMMA 4EPXA 4DR3B 4UCXA 4XYMA 1PL7A 3KKPA 4CETA 1E4EB 4G5XA 1YL7A 4KRFA 1OLUA 2XKJE 4OHPA 1VMDA 2N46A 2OV4A 5BSTA 4GOJA 5GONF 2F67A 2WPDA 4KI0A 3TRJA 4LTNA 2HMVA 1UAGA 1XZDA 2MSKA 1CUHA 4ERXA 2V3VA 3NI2A 2FW0A 3MBOA 4WK6A 1CUXA 1THZA 1X1TA 3DKRA 3TPZA 5JJLA 4EG8A 3AUXA 5TGTA 3J81A 4YX9A 3HLYA 1A4IA 2CL0X 2CCKA 5KYUA 4AYTA 1DAKA 2DY1A 5JCOC 3OQMA 3BRQA 2FP4A 2EX4A 2ZG6A 3OEHA 4TX1A 2AFIE 1S8NA 3DHVA 4PZYA 2FPUA 2PPLA 5JDCA 3L6CA 4RKWA 1Y9AA 2HSEA 3M4NA 3PFCA 3WWPA 3GCXA 1TZCA 1G3RA 2C1EA 2DBVO 3K9LA 4LZNA 5J63A 2AI1A 2GKGA 3R9IA 1LPSA 3KXPA 4N7RA 3WLKX 3ICEA 3WHKA 4J03A 3I37X 4MQEA 5IC6A 1A1SA 4J16C 4DYVA 4LI3X 3HL4A 2AOUA 2UYCA 4GW3A 2O5EA 1PQ4A 3TLAA 2GDJA 1PCXA 1S2IA 4Z86A 2ONKA 3H8JA 4N5DA 3U26A 1C1DA 3TKYA 1E6EA 4WFJA 1SVIA 4ID3A 5DYYA 2NO7A 3E1GA 1CTQA 1EX7A 1IU9A 4QXQA 4RVFA 1V1RB 5EHXA 3N07A 4KE7A 4K6CA 3ICVA 3ABSB 4LNUA 1X2EA 2ECPA 5CG2A 1XRQA 3JCZA 2WIDA 2B7CA 1D4FA 3QITA 4LJLA 2H16A 3H7AA 4GRAA 3JWIA 2RGCA 5KVSA 4FFBB 2R7LA 4M53A 4CQMD 4LMRA 3H18A 4U7TB 4D9KA 5D5HA 1RVDA 3D8HA 3NM6B 1HG0A 1R37A 2Q3LA 3AYXB 4PPFA 2I33A 3FB4A 1VJTA 3KUUA 5EZ5A 4D9IA 5BOSA 5HWSA 1JQJC 2ZIEA 2JLVA 5REQB 4A6EA 1Y5LA 1ODFA 1GLNA 2XA2A 2WYHA 3I5UA 4TMYA 3DFFA 2LGJA 3HL0A 5H81A 1H9CA 1MOPA 2HBZA 4IIYA 3SLKA 2B3DA 4WSOA 8ADHA 3PQ8A 1KYYA 1G20A 1XKLA 2CXPA 2OLEA 1CVRA 3GFGA 4GC9A 4JC4A 3ZLBA 4YV7A 1MABB 2ZSJA 4DQVA 5CA0B 1ES9A 1ZKDA 2X0EA 1PL8A 4ND2A 1RTTA 1ZCFA 3EC7A 1IWPB 3EGXA 4L3OA 2FMKA 4YJ2F 1RP1A 1SUEA 3G5TA 3WTCA 3JVVA 3T1VA 1LY1A 2Q4RA 2YV5A 3W1WA 4WNCA 4Z4EA 3V8BA 1Q44A 2XUKA 2YFHA 5HPYB 1U94A 3F7NA 1HPLA 1OFTA 1PW7A 2XLBA 2O3SA 5FUMA 5TB5A 4KHPB 5H5JA 2G09A 3TCXB 3CRRA 3FPFA 4PYKA 4S35A 4F0JA 4R9VA 5FWAA 4LJ5A 2WM2A 3KWMA 1YASA 4QXRA 4C7VA 4N0PA 3B2EA 4CVNA 1GAWA 2BUBA 5A6SB 1D2EA 4ZAFA 2J5KA 1NBMA 1TA9A 3MUNA 4JI3B 3DMRA 4BVBA 2J7PA 4CEHB 4TV9B 3QPWA 3FLMA 2G72A 1GD1O 1TT5A 2F8LA 2QRLA 2RGEA 2ZBQA 4L08A 1E61A 3T4UA 5FEUA 2CV1A 3K70B 3A2KA 1SUSA 2J0SA 1L2TA 4U7JA 3GHYA 2FUKA 2YW2A 3VC7A 4BBZA 1SQGA 2V7QD 1R6VA 5EJFA 1U8TA 1PR2A 2R5FA 1EXMA 2ZYAA 1JFLA 3U7JA 3X1MA 4C4RA 3BE4A 2BFCA 1AE1A 5EC8A 2PUBA 1A4RA 1XR3A 4CMEA 3WB9A 3W06A 1J09A 5HOEA 1WCXA 2WU4A 4TMFA 4TTIA 5K3SA 2WICA 2Z4SA 4OM8A 3OPYA 5U1PA 1XJCA 4U5XA 3FUWA 3ZXYA 3C7DB 4DKJA 2J6IA 2Z56A 2CW5A 4IWYA 4LRQA 3OKAA 4GR9A 2YXLA 2QG9A 1X9IA 3MRVA 4CMAA 2PKYX 4H0NA 5EWLB 5A04A 4X62B 1JI3A 4U1RA 1KAMA 4PYNA 1E1DA 2W48A 2VOJA 3ELYA 3L1UA 4NU6A 4YRZA 4GXQA 3VPXA 4P4SA 3NKFA 3N0VA 1LX6A 1NA5A 4PLZA 3OURA 3KOXA 2YN4A 1DXHA 4PE5B 5CDFE 1N6PA 1LWNA 3QWBA 4HNAA 3FRIA 1ZD8A 1PSDA 4FQ7A 2OXIA 3UOAB 5K0ZA 1YGYA 5EE5B 3QI2A 2FPKA 5D1NA 5HF6A 3O4FA 1L4KA 3PYLA 2H5IA 2OZLA 2ZREA 2XE6A 2ZWPA 4F5YA 1FX0B 1KE2A 1UPFA 5J5VA 1SBNE 3AF4A 4OXIA 2VT3A 1B0UA 4XFJA 4K03A 3HDYA 1R18A 1F51E 1E2MA 4QVIA 3DMHA 3R5HA 4BMXA 3I92A 2ZXFA 2OHIA 1VKZA 3GLHB 1XTPA 1BFKA 3Q6NA 4PYRA 4MB2A 5ALFA 2GYYA 2DT5A 3I6ZA 4O1IA 5FORA 5B1SA 1U0JA 4QASA 4MVJH 4CF7A 5L95A 3A6PC 2XNDA 3DF7A 1AKMA 2HF7A 2CN1A 3I23A 2Z57A 1Z5UA 1GITA 3GFBA 3NBQA 4LGCA 1XK6A 2XIQA 3N5KA 1GY8A 3HKBB 3W5IA 1JG1A 1ZHHA 2DHEA 3CEAA 2VEOA 4GXNA 1SU4A 4NZYA 3THOA 4DHEA 4B3IA 4DIBA 4AC9A 3OBBA 1GDTA 3H75A 4BEJA 1H0HA 5JRDS 3PUXA 1E66A 4Q3BA 1RM0A 2C88A 4UHJA 2I03A 2GBPA 4P36A 5KCMA 5A02A 1L1EA 3JQAD 4BAGA 4Z9AA 3DVAB 3FKQA 5DMHA 3RPEA 4NLLA 3CYFA 4Y7CA 3FX2A 1GRQA 3UMBA 2IZOA 3D8NA 1KTVA 2JVIA 5FBRB 4QUIA 3DE4X 3WRWA 4BFTA 1J90A 3VNRA 4ZJUA 5BV1A 5FPTA 4XDYA 1EK0A 2QX7A 2B36A 3BGWA 1NY5A 3P8ZA 2LP4Y 1DIHA 1ZIOA 1MJGM 1E6KA 1R8YA 2QLMA 3E9NA 4FR0A 4GM0A 4Q4DA 5AIAA 4BO2A 1N3IA 2Q41A 4J2OA 3R7LA 1FK8A 1OFHA 4KX5A 1CEEA 3KYJB 1ULUA 4JNKA 1RI5A 3ITKA 1JQDA 4KW7A 1ZZGA 2N42A 2QYOA 4IF4A 4JH0A 2C5AA 2COUA 5KS2A 1F0YA 1KDRA 3FBWA 3GDOA 1J23A 2P77A 1P75A 2AWOA 2P8JA 1EGHA 4BFCA 2QXTA 4PEVA 2BGJA 2V55B 2WHRA 3EIXA 1D6SA 4J49A 2UZ1B 5KYNA 1RQ7A 5DYGA 1JUDA 2XCUA 3AV0B 3WA6A 4I1RA 3HCPA 5DM70 3H8SA 1XXLA 3KLPX 4EP1A 3LDAA 2JGRA 4I5EA 4MRMA 3UUGA 5DTIA 1BS2A 1CFZA 1IC6A 2G1AA 2XD4A 3NWOA 2IW1A 3OEEA 4DMCA 4DVGA 5JW6A 2FMUA 4D0SA 5J5CA 3DC2A 2FCAA 2DECA 3B9RA 5AD1A 4OJKA 2ZRHA 3C70A 3N75A 4KUEA 4OQYA 2DUWA 1CF4A 3WGQA 3QKTA 4OXYA 3UXHA 2H4HA 4B4DA 1O97D 221PA 5FFFA 4RGBA 3MWEB 4QOIA 3DFIA 3QF4A 1R8JA 2DBYA 3SF8B 3T3PB 1RWKA 1Q0QA 4YQEA 2PWAA 2X2OA 2CLEB 1SHUX 3D54D 3PE4A 2P2YA 3AM1A 5MFPA 4V2UA 3HEAA 4IIUA 2DWQA 5KNBH 3IQDB 5JROA 5JAUA 1U8ZA 1D4ZA 1I6KA 1ONBA 2OHJA 5JVDB 5HBRA 3KQQA 2VRCD 3OM8A 3E35A 1DV2A 4TN1A 5JNRA 1PGPA 3MRXA 6GPBA 1ND6A 2GYWA 2V1XA 1PEKE 2GSDA 3F7MA 3I52A 4P3NA 4QU5A 4BUCA 4B33A 2YIMA 3WHIA 3NT2A 1Y1RA 3PKIA 4G0YA 4C08A 3Q9SA 1H2FA 1V25A 3AWIA 4PIPA 5CLHA 3JQ9C 1JWBB 1CIVA 2YICA 3D0OA 2VJQA 4QSHA 5MDHA 4ALNA 1IG0A 1JILA 2ID4A 4MYDA 4Q37A 1R5JA 1EQAA 2X3FA 2HT1A 3GAFA 3K1AB 5CM2Z 2FSSA 4BO3A 2Y27A 1TJYA 1G8FA 2I8LA 4I3FA 4FR2A 4G4GA 1W19A 3NC0C 1XAGA 1E2DA 2RHOA 4RYDA 1M73E 2D0OB 2JFZA 1YRBA 3AERA 1R0RE 4HPWA 4MCIA 4EELA 4EJMA 3B8HA 1W4ZA 3BD9A 1Z4LA 4KE8A 4TT3D 1P1CA 1UM9B 4JENA 1B6SA 3UTDA 1GGEA 3BFVA 3ZS8A 2NAFA 5JZBA 2J9ZB 1V3UA 1XK7A 4JJIA 4RMHA 4RFSB 2PGOA 4UPDA 2FRDA 3F8SA 5AXCA 3MWDB 3G0GA 3L5KA 4IUCS 4H1VA 3TRHA 4ALKA 4C0KA 4C5CA 2XTZA 2CE2X 2WY2D 4NQRA 2VYVD 1T0IA 1L7EA 4QYMA 1OQAA 4AZ3B 5IYZA 3MCUA 4DA0A 1HDYA 1WQ1R 3T1YB 3E3AA 1BQ3A 5KPDA 3IPLA 1G66A 3HN2A 2QJWA 4MGKR 5TT0A 4Q9KA 5FWYA 2FSIA 1Z0JA 3HJGA 3C6XA 5IVHA 3I2JA 1A9SA 2WJWA 3OECA 3FFWA 3VKFA 4B82A 4BGIA 4Z7QB 5EP4A 3A6GA 1N33B 2JGDA 5LQAA 4DMHA 1JTEA 1ZJ5A 4GD3Q 5KIAA 2WFLA 2HQBA 4MVJI 4R71A 1Z6GA 3K6JA 3DAGA 3RFCA 1Z7GA 4Q3EA 5DNCA 3VUEA 2VQSA 3LC7O 3M89A 5CJJA 2KWIA 1EB8A 1Y82A 4K46A 5SY6A 2I8AA 2VYQA 4WA7A 2R11A 3D8BA 5LNK6 4EEXA 4X1OA 2EDCA 1LWOA 4KITB 1IM2A 1PZNA 2ZXEA 1QKIA 1JKJB 4IKPA 3DEAA 1FC0A 3COSA 4B71A 3KR1A 3ITDA 2HMAA 5AW1A 1Z0DA 4RQUA 4RU1A 3RANA 5A7FA 1M2VA 2H7CA 1NC1A 4J2TA 5B7NA 5FWNA 1DBIA 4ZMSA 3QEOA 3C3EA 2H00A 5JYCA 1KNQA 5LNK1 2A57A 3SS7X 3VHLB 3R6TA 4WBNB 2AG1A 3J7TA 4QATA 5ALEA 1XLTA 2OXRA 4XM0A 5AP9A 4Z4QA 4K9QA 5BR8B 2O7SA 1LUAA 4H1TA 2DBRA 3S7ZA 1J8QA 1B76A 2IYUA 1TPZA 4GWKA 1Z33A 5L3SB 2H2IA 1A97A 3PSAA 1FL9A 1WE2A 3RUIA 3EZ9A 1P4SA 3GVPA 3ECAA 3CZMA 3K94A 4Q7MB 4ZCLA 1OKKD 2PUJA 4YALA 1U7UA 4AURA 3KYBA 3H13A 2YKGA 4G8BA 2WKWA 1OXBB 5A5FA 1T6XA 3NW9A 1HMYA 3LT4A 4MGIR 1B4DA 1U2PA 2I6UA 3O9VA 3AWDA 2VYCA 1QGUB 1CZRA 1CK4A 2VIIA 3FNGA 4RCZA 4CT4B 4ZQHA 4D4KA 2ZZMA 4G5QA 1MMFB 1XVUA 2A8YA 3TNDA 5AW8A 1O0SA 4UEJA 3IJEB 3UV7A 1P1JA 5L3QA 4V0ME 2O57A 4H7EA 5EMNA 3DHYA 5DGDA 3VYTB 5FLXA 4QOSA 4R6WA 5A3RA 1TK9A 1ZU5A 2ZBRA 1HRKA 1TIBA 5E2AA 3SSMA 4BP3A 1DC8A 1IRIA 2MSNA 4F9FA 2HYDA 1FP1D 4HLCA 1IDOA 2FLWA 4YRTA 1N6HA 3I34X 1YRAA 3PT5A 4R9NA 4WLFA 1XXHE 2AQIA 1IATA 3TI7A 3U0VA 4IAOA 4E4YA 5LMUB 2FR1A 3AESB 2HBRA 1UDXA 2ESRA 3D7RA 2IEYA 3MUEA 4KBGA 3SC6A 2IH2A 4XRRA 3BH0A 3AU8A 1XP8A 4FFSA 2EDAA 2QZ9A 1M2OB 5F76A 3RVLA 4ZRMA 4AM8A 4CE6A 3JQGB 2GHTA 4BQRA 3G7NA 3I72A 3G9UA 4HNQA 4JBLA 3IAM1 3TQIA 3W6OA 4UHFA 4PZDA 4GOXA 5CA0F 1E0JA 3I9V6 5KQGA 1KIMA 3E48A 4OY3A 4P7BA 5EJEA 4B45A 4DUGA 1XTZA 2H65A 4PR3A 4EYQA 4L51A 5AYVA 5ILGA 4YAUA 1XD8A 4S1WA 3DO5A 4RESA 2OBYA 3EAGA 4RHCA 3QEBZ 1E2IA 4CR8A 1UFVA 3EIUA 2CUNA 4KPEC 2LV8A 2ZAMA 2O0HA 5A3JA 3T9CA 1P2SA 2OBFA 5E4JA 3WKCA 3D4BA 2P68A 3PT9A 4N8DA 3HO1A 4H18A 4TZ6A 1L5RA 1MU0A 2CVOA 2DR3A 3IHKA 6PFKA 1BKSB 2ZUTA 2M1ZA 3GEDA 1YDMA 4JOSA 1HUQA 1Z7BA 1TPYA 3K6KA 3KVNA 2FE4A 4GP6A 3V3TA 4X94A 1I5OA 3F90A 3WMRA 3NXKA 5AI0A 4C78A 1JU9A 2HMYB 4NDZA 2I7CA 1HKUA 4FBMA 5C1IA 5JRZA 2VF8A 4MB0A 1H5NA 2I91A 3AY0A 1PK8A 3H4VA 4TV9F 1BHJA 1U3TA 3B36A 3NGXA 4LNHA 4MK4A 5IC5A 1G6Q1 4JLMA 4KXYA 4MUYA 4OX9Y 3OCWA 1A7UA 3QFRA 3S8EA 3ND9A 1FOEB 4F3YA 4UHBA 2HZBA 2ZJYA 3BHJA 2VXBA 4CKEB 4HX5A 1I01A 1XHFA 4UTVA 3LF2A 1Z08A 2RKWA 3OQIB 2R7KA 2Q1UA 3IEPA 3VUFA 3KQLA 3PFFA 3O47A 1NUSA 1IIBA 2PYIA 5DBIA 4L0QA 2P3QA 2IIQA 3HBAA 4L4XA 4N0DA 4G1MB 3CEPB 1N57A 2IF2A 4ZI2A 3BIXA 2O0JA 4PZ0A 1MQ9A 4WJZA 3ZVMA 1U3WA 3F3KA 2EJBA 3IBCA 4WV3A 4C1BA 5KJ1A 2GILA 5LN1A 2HDWA 2H1SA 4CM7A 5JU6A 3GUVA 1E2KA 2YXEA 4MS3A 3G0HA 4OQMA 2C57A 1FNDA 2XCRB 3ZX5A 2NV6A 4C0HA 2ZIGA 1KAHA 3WYGA 4U3JB 4BDTA 3S29A 5LDHA 1BW9B 1SKUA 1YR3A 3UC5A 1U1EA 1ZDMA 2C3OA 1DUIA 2DKNA 4GX0A 3K0FA 3HKDB 2CBXA 1NTOA 1X2BA 2OQRA 4DJFC 5K0TA 4HB4A 1L4NA 1UK7A 5JDIA 2IGBA 3U4IA 1RJDA 5D7NA 1K5DA 3LKZA 1AHHA 3TRKA 3IJPA 1HNZB 3FAKA 2BFBB 4ZVOA 3G2PA 5J4LA 4PSAA 3HGMA 1CY8A 3WAKA 2DWUA 3B48A 3L0YA 3GEEA 1NWHA 1X39A 3JWPA 3ZXIA 3A4IA 1ECJA 4OA5A 2PEZA 3VPDA 3VJLA 5DM2A 3QPVA 4BATA 4XLTA 2PSFA 4FI3C 1WUKS 1E2LA 4K3UA 4TVKA 1N32B 4QUJA 5F77A 2MDTA 3W2EA 2D00A 3VU1A 4XCXA 4B7UA 1EFRD 1NLFA 2OK7A 2WKSA 2AQ8A 3AW9A 1COWD 1QKJA 4FD2A 4QPNA 4OI0A 1TYEB 2YMPA 3A14A 5ALZA 5A2GA 3MJFA 2BM9A 3NG1A 5KWVA 5AJZA 5DBOA 3AFNA 4BWYA 1YFJA 1G4AE 1WBDA 3IQHX 1Y0BA 1YHNA 2Q8NA 3LPNA 4FJ1A 4WKGA 4E88A 4MQFB 1E6CA 1FDSA 1EJ2A 4B75A 5F9FA 4G5YA 3DAFA 1CVIA 2XUZA 1W44A 1CS0A 2X76A 4M0LA 4U8HA 1RBZA 3UUWA 4F8JA 2WK1A 3IOMA 5CK5A 4HLQB 2OHGA 1UWLA 4KPUB 2FZWA 1YTUA 1KYTA 3O83A 3PNMA 4X1YA 2B7LA 2Q1YA 5CVUA 4Z1MA 4I1SA 4US0R 5F3WB 2NU9B 4MHOA 2D2VA 3LY7A 3W9BA 1P2VA 1XJ5A 3GBSA 2QTZA 4J0FA 4IOKA 1D1PA 2H5LA 3CFYA 1QM5A 2EZ4A 2JFUA 4BJ5A 2SCUB 5MF6A 3DOHA 3OO1A 2YYYA 2C3PA 3WRYC 3M4JA 2CY0A 5J47A 4NZPA 4YLGA 5KMGB 4X7PA 1QS0B 2PR7A 4QLAA 4HS4A 3RUFA 2NW6A 5LM3A 1W581 4EHAA 4TT8A 2X42A 3PC8A 3K09C 4O1HA 4YB8A 3U31A 1IULA 4DA9A 5E6RA 1JIIA 2QDXA 2V7BA 4F72A 2UXCB 2OXFA 1QMPA 1ECLA 3QVUA 1IUPA 4GS5A 3DEKA 9ATCA 4UTRA 1JJ7A 2X5XA 1Z8NA 4WKPA 3SQOA 5H9WA 4BN0A 3CM0A 4PYLA 4QVKA 4GAEA 4LY9A 4Y2VA 2AFIA 2VK1A 3CPJB 2O0LA 1XELA 4B84A 1U81A 2O6HA 1Z2PX 3B3GA 3QVSA 4BQQA 2XDWA 3N6VA 3PNSA 2GB4A 3FLEA 2HK6A 3WZLA 1UDCA 2E82A 5JSYA 4F6CA 2CCJA 3JWGA 2PH1A 1HOTA 2ZFUA 2C54A 4TM8A 1WULS 4XASA 3TUIC 1NOIA 2H4FA 3N7AA 2VBGA 3GGSA 1FQWA 4CLEA 2QAIA 4LHZA 3PX7A 1TQDA 1U8UA 2GVNA 1BO6A 2CSUA 4MWOA 4TV8B 1C9MA 2QJFA 4LWZA 4XARA 4EF6A 3V4RA 1JG2A 3AHIA 3GNLA 2Y9MB 3EGWA 4IVRA 2R6JA 3K0HA 1N2OA 2V6BA 3ZKWA 2B4YA 4A3SA 2W6QA 1GFIA 1SRQA 1K8QA 1YQUA 3VZQA 1LW6E 4Y0VA 5I7EA 4JCCA 4OQXA 3I09A 5JVDF 1MNQA 3JYQA 5HFNA 1R7RA 4II3A 3WRYA 5B36A 1O7JA 4ZODA 4QNMA 1VPWA 1B8VA 1KJJA 1ZINA 4BNNA 3HJHA 1TZBA 3E22B 1FPQA 3PIDA 5AXDA 4QWMA 1O94D 4F4DA 2XMDA 4YK7A 1VKHA 5EQTA 3KZ1E 1FLAA 2DTDA 4OMUA 4RJ2A 4RMIA 4ECEA 1ZPDA 4Y2TA 1RPZA 2YJ4A 3VYVA 1IQPA 4INAA 4BE9A 4P32A 5TQ0A 5KJ6A 2FW7A 2V4UA 4HQNA 1IH8A 4UMDA 2UUPA 4JJGA 3O8QA 4MV1A 4WBSA 3UJCA 2HTEA 1L5HB 4DY4A 2AG6A 4YJHB 2VUTA 2IUEA 3B60A 3AR5A 4FDAA 1KRHA 3ZOZA 1ML3A 4HAIA 3ZCUA 1BMQA 4NARA 1R4MA 4M1WA 3B89A 4V1CI 4F5WA 3G0DA 5KI6A 1ZD3A 2CHUA 3BG5A 3CLSD 4MJ3A 4ENRA 2O2GA 3P2IA 4RZ2A 5KYTA 3T8YA 1B2LA 3K4PA 3KKEA 1CB0A 2JH9A 4YI3A 1CIPA 1U11A 2JBAA 1R64A 3KTFA 4W5JA 3DVLA 1MOSA 2UZ1A 4FFDA 3P5BA 4NH4A 1CLUA 1R6UA 2Q3MA 2QD5A 2JLRA 2SKCA 2YZMA 4KN5A 4KWEA 5A7GA 3ZC3A 1FTQA 4OKIA 4XKJA 4FHZA 4NZNA 5CT9A 4Q3NA 4ZQCB 1GUAA 2CVHA 2IP4A 5K3FA 3PSHA 2XR1A 1ZN7A 1SULA 2GN4A 4ZALA 1Z3CA 2PGIA 3OZ7A 1RXEA 3NBFA 4R68A 3BWBA 3K8ZA 1KZGB 1I33A 1V41E 2AN3A 2CLSA 4IOMA 4WKCA 4MA0A 3ODGA 4OU5A 3FHCB 1Z68A 5DYWA 3AV3A 1OU0A 2XB6A 1RRFA 1U02A 3AR3A 3EFEA 4UJ3A 4N0EA 3WNVA 4F4FA 1ZOOA 1GARA 4URFA 5FL7A 3VR5A 4TRJA 1NN3A 5B3JC 4AYWA 2XMPA 1AGRA 3LKDA 4Z4GA 1O6ZA 1VHTA 3AJRA 3EXHA 4UOZA 5MHTA 3TG2A 1J5XA 5FJJA 3IQXA 2M6LA 1PEDA 3DTYA 1N2SA 1X14A 2GEDA 1ZQ1A 3GNQA 3IUJA 4OLAA 4ZREA 3VR2A 4JB0A 1P0FA 3W9SA 3VDQA 2WJPA 2LDBA 3F8TA 4UTZA 3U6BA 4C0QC 2JAUA 1FFBA 2PX2A 3MJVA 2WRZA 4RQAA 4EO9A 3PNPA 1J0EA 3GIDA 4CDGA 3KJNA 1DAHA 4OGLA 3QM1A 4CI0B 3C1TA 4KAJA 4D2IA 5BW4A 3P20A 4IZHA 4RDHA 3FCXA 4WBNF 4QGGA 5CDFA 1AHNA 4M7WA 5ICMA 4QXPA 3TZLA 1MH1A 4Y6LA 3UCFA 1ZMTA 2RMKA 3PNVA 5D86A 1SC6A 1V45E 2Q8QA 2OC4A 1PLJA 2DSTA 4J9VA 4RTPA 3AIOA 3AUJB 1A8PA 1US8B 4AQ7A 3T4PA 1CEQA 1FB5A 1SCNE 3CLTD 3VH4A 4BJ3A 5DM0A 2I54A 4F8EA 2IHKA 3MELA 2OV2A 3HY4A 4WZAB 1QTIA 1QHEA 2E6KA 2ZE6A 3PUVA 3WLEA 2VP0A 2VCYA 1BWPA 1ZUWA 3EZ2A 5IM5A 2Y76A 1O6GA 3IEMA 3NS7A 3PGA1 1U28C 3UATA 3I2HA 2RCYA 2ID9A 3HH8A 4LA4A 2ECKA 1NMQA 2CHEA 5FV7A 2IEZA 5CA1F 5CLFA 1QK3A 1NP6A 4DHWA 1K6XA 3U3MA 3VMMA 1TK3A 5I7UA 3QWAA 3S4YA 5IH3A 4EMTA 4NBLA 5L4LA 3H2YA 5DULA 2WIJA 3T5CA 1GZ4A 1KJ9A 3HWRA 3I1YA 4LGMA 1EFUA 5ECYA 1FFHA 3URMA 4NNOA 2YN0A 2Y68A 1XT6A 3AKCA 5JECA 3PFIA 4GI5A 1FSPA 3ROMA 2TECE 2YOFA 2AF3C 2BFEB 3GUUA 4ECAA 2J0EA 1X7WB 3NYWA 5AUQA 1ID8A 4JBNA 3D4PA 1VLQA 1SIOA 2R44A 4MV8A 4UEWA 4HAVA 1U04A 2I7TA 5B1EA 4DCNA 3RO7A 3E7DA 4RK0A 2KI5A 1YF3A 1RXUA 1NIPA 1QX4A 5M29A 1YZHA 5CXSA 4LFAB 4ZTUB 3BGIA 1V9SA 2IYVA 4B6FA 2VHVA 3KHTA 1VG9B 4YIKA 5L45A 1KTIA 2WB2A 3H1AA 2PMBA 1SD2A 4H0CA 4UCFA 1G38A 4MS1A 1H2HA 1DQZA 1L9XA 2OECA 5C5IA 2QW1A 2H2AA 4D25A 1VPLA 1JHRA 3F71A 1SHZA 4QA9A 5JNTA 2AOTB 4G0XA 4IQ0A 1SZCA 3GNSA 3BB4A 4N7BA 4ND3A 2V74B 3ENWA 4FIDA 4Q4HB 1PZXA 1H94A 1KFEB 2X0NA 3F6SA 4LC0A 1HYBA 3CF6R 4MIKA 1D2GA 3JD3A 3WBKA 2WWYA 2IX3A 1ZUD1 5TS2A 3MMNA 1O4WA 2IZ1A 3QPBA 4ZO6A 3VPFA 4RA6A 2PSHA 5DK4A 1XLUA 3VGJA 2JB9A 1S7CA 2W6ID 5LZ5A 4ZOBA 4KR9A 3B5JA 5GV8A 2PMEA 1QANA 5EIEA 2VHEA 1RYEA 2IS2A 1YZLA 3G9TA 1U1CA 3A7DA 3LOQA 5EIOA 1G0OA 4MAAA 3T7JA 1R0LA 1OY1A 1SEVA 3WK4A 1P1FA 4O2AA 2HJGA 4EG6A 3U40A 1E3QA 1YZYA 1SKQA 5G4KA 4GQAA 4HSGA 5DBGA 3RIHA 1HO3A 2V45A 2ZT5A 5G1NA 1RADA 3EAQA 4M9CA 4PICA 1XZLA 3LCMA 1TW2A 2ZWOA 1NNLA 2OFXA 3WL6A 2GSWA 3NHLA 3LWBA 4NFLA 1XB2A 2P78A 2X8JB 3CLRC 4NDNE 5GJVC 2L18A 2OXEA 3PS9A 1TCVA 3EMKA 1A2OA 5JYBA 3WIBA 2C1ZA 2V0NA 2PH7A 3H5RA 3RYHB 5ALMA 4EPYA 4XJXA 1RPJA 5EHQA 3SSNA 4Y2UA 4B09A 3M6XA 3ABQB 4NG4A 4Q16A 3C1AA 2W0MA 2E89A 3BMQB 3JARB 4K9OA 1BGXT 1S1MA 2IEDA 3UK0A 3ZX4A 5JQWA 1Z37A 5HF5A 5T7BA 2FHPA 3GI1A 1FQOA 2DHQA 1WA5A 5FBKA 1N36B 4HAXA 3GJYA 3MCVA 3C5VA 1BJRE 5A9TA 3ZIDA 5HK9A 1LRJA 2XXBA 3DBHA 1FUKA 2IHJA 4UM8B 2HEIA 1EA7A 2LVBA 1XRRA 5LMNB 3R7FA 1M2OA 3UH1A 4EB6A 1Y3FE 2ZUWA 1E79A 1ACLA 2WJGA 3PEFA 1MB2A 3I8XA 3AUAA 1MX9A 4EKDA 4BVAA 4HVTA 2HX1A 3L7JA 3NJ8A 3IDSA 3NHSA 2EHDA 3DNFA 4OFWA 5LXTA 1E6WA 3OT1B 2DUNA 4IFEA 2ZRGA 1E9BA 1L6IA 2AXNA 5CPFA 4A0GA 2GKOA 1HTBA 4XR4A 1JECA 4DTIA 3L0ZA 3A6HA 1R8QA 2PNFA 4LZOA 4UNQA 4CQLB 5C7IO 4G63A 4XWWA 4HHEA 5DDIP 1ZS9A 3U3JA 5AVZA 1XMVA 3NT5A 1ZNQO 4PV7A 4YMSA 1P6XA 2R8BA 2OAEA 2DFVA 4RADA 3IXLA 3OZRA 5CMLA 3V2IA 2XKBA 4Q1EA 3WWZA 3OUUA 1NLMA 3RROA 2VPQA 2J32A 3R09A 1R16A 3WSVA 4WVFA 1P4JA 3IIKA 2W6OA 4DLXA 3RFFA 4TS9A 5BYBA 4I14A 5TMDA 2PLAA 1JR3A 2QTHA 1QR6A 2YNMC 1EG2A 1PLKA 1QIGA 2HSGA 4QJ5A 1RHJA 4C7BA 4LPKA 5F52A 4XSGA 2EGHA 3H1FA 3VSDA 2RGDA 4B2LA 2HMTA 5LZ8A 3OQIA 3BDVA 3P26A 1IEWA 4RANA 1SCKA 1VE5A 1SBQA 3BREA 2AJLI 1IQRA 2QG4A 4HGPA 4ASUD 1ZGZA 2HLPA 4MV4A 4AW9A 4XJVA 5K0NA 3S2IA 4UMVA 4CDMA 1DRKA 1ZJWA 3HB4X 2GCGA 1NMYA 2R00C 2WC1A 5IDXA 5I4KA 2PSEA 4MWEA 2C59A 4JMLA 4RBNA 1RHKA 3UZUA 4DMGA 2XEDA 4US2R 1L5OA 1UEIA 2RONA 4KXLA 4YT4A 1ZW1A 3I9JA 5A0VA 1BDJA 1EJBA 1DQRA 1N6KA 2HB6A 1JAZA 2M1XA 1SUIA 3DAOA 2O2HA 3PFWO 3R24A 3PTAA 3LXXA 3I62A 1S2MA 2H48A 3HHEA 4X00A 3WLTA 1PVOA 1KFBB 2OGWA 2VJMB 1JBKA 3CH5A 1W35A 1DOHA 1C3OA 2Q9CA 2JLAA 5BV2P 5HOQA 2RGNA 4TS4A 4G37A 3G2MA 1G9SA 2ZCUA 2I2BA 5EAIA 3QIAA 1JEQA 2Z2KA 1MRSA 2VAMA 2ZYHA 3LU1A 1FBTA 1HQDA 3R3YA 2RH8A 4NMHA 3RV4A 3W3AA 3U81A 4PG4A 5KNDA 4LSWA 4MR8A 2WF6A 1ZCBA 1A2KC 5JCJD 4AJJA 4HNTA 1FFDA 3O4GA 3WAGA 1K7XB 3TB4A 4DQXA 2RGGA 2RI0A 2WAXA 3GQBA 4TV8F 4EPVA 2HR1A 4UAUA 5CJPA 3H83A 4OIMA 4LBZA 1JA0A 4LOLA 1JXMA 2GEKA 3C87A 1XRPA 3JZAA 3KVYA 3HCAA 3QWHA 5DGIA 5EPEA 1X94A 5B55A 4AKGA 1PKEA 2AFHB 2RB4A 3BWYA 4QARA 4V0MA 3BMOA 4UZFA 2C4VA 5TARA 4IZOA 4YUVA 5EJ6A 4MI1A 2PZKA 1RDFA 1NW8A 2GCNA 2R5WA 1KI2A 1WF3A 4J0KA 4M1QA 4PLFA 4FX5A 3SVTA 3ZWAA 1GZDA 2QN9A 3MQFA 1L5KA 3F6YA 2IV2X 3R7WB 3ETJA 3U7GA 3GP8A 5CVTA 3N8GA 1XMIA 1WOYA 3FIJA 4Y6SA 2CNOA 4BMYA 3KQKA 1XXHA 2BMWA 3CINA 3K9QO 3EULA 3FHOA 2AEMA 3FGZA 3EE6A 1RJFA 2OZEA 3HVIA 2Q1TA 3DFMA 4QIHA 4W8HA 4TRMA 1TEZA 1RYYA 3RVQA 1XCJA 2TSYB 1PVVA 1K3FA 2J4CA 4G26A 1YI0A 2HQSA 5EJIA 5DHTA 4YVFA 4Z7OB 4O6VA 4WXRA 4I55A 1DDGA 3URKA 2DYKA 1JYSA 4BAZA 4YP6A 4UE3S 1YL6A 2WTNA 3K5WA 1RR6A 1PGOA 3EZ6A 3W5UA 3LOPA 1G8PA 3U44A 3FE2A 1VLVA 2WAYA 2ZLBA 3ISTA 3AILA 3MMPA 4RGQA 5JADA 1IBLB 3IDOA 3KWJA 4F4HA 3MHTA 1X87A 3PNOA 5DX8A 1O89A 2VTBA 4FYJA 1ADYA 4J0GA 4L8WB 4PBSA 3S2ZA 1Y9EA 4AMZA 4D44A 2Q4OA 4I36A 1JDUA 1C0LA 3BH7A 1N4AA 3LPAA 3UWSA 1AQNA 3VYRB 4B2IA 5CG1A 4NMMA 3DDHA 4LOAA 2CLLB 1SCIA 3G17A 3IEUA 3NIBA 3QVOA 4NE7A 2QUAA 2QU8A 3T4XA 5H8WA 4C4ZA 2A5LA 4GP9A 5CXXA 1S3GA 3VDRA 1NKTA 4DQ0A 1GRCA 2EW8A 2IX9A 1G18A 1N77A 1SC9A 5EPUA 1DX4A 3NUQA 4PNHA 5D7BA 3QLUC 4TMKA 1LBQA 4JUDX 4W9NA 4A0RA 4BS9A 2HYIC 2XTMA 3TZKA 4FLFA 2XEXA 3RRYA 4GH5A 1I1QB 3E3MA 2Z58A 4V2IA 4WXHA 5JAIA 5HEKA 3GBVA 2JIQA 1L1QA 2VJAA 4FDUA 5T64A 3VISA 4Y1FA 4ED9A 3PEYA 4I50F 4YR9A 4HDRB 5AKGA 3A9CA 3FOFC 4P0QB 3VHXB 1SC4A 4H1WA 2J0UA 1H3FA 3HPQA 2AUNA 2FU5C 3JYOA 5EKDA 5ALPA 4IH4A 1FUYB 5AJUA 3GY0A 1ZIDA 4RM3A 1DAPA 2WD7B 1MC1A 2FY8A 2GJ8A 3D6AA 2O8NA 1KDYA 2OQ2A 5F3DA 3KZNA 2BV3A 3VBCA 5EMHA 4DANA 1NXSA 1WXIA 1WTAA 1WHTA 2N75A 3TX2A 3T3OA 3P5SA 1DU4A 5K03A 2G88A 2NAPA 2YFKA 3EA5A 3G79A 4BKQA 1MLDA 2YXBA 4Y9DA 3ZWYA 3NDBB 3AY3A 5EZYB 3W2HA 1N0VC 4F86A 3E4CA 5E3JA 1NVWQ 4U7HA 5BWOA 3E2PA 3SHOA 1RVV1 5A3QA 4RVCA 2BMVA 2ZJ8A 2H0RA 2QYHA 5HDBB 3R3ZA 5KREA 1YV9A 3QMPA 4Z99A 5EQJB 3VZCA 4YT2A 3AVPA 1CJTC 2A14A 2J8ZA 2JI6A 3LA6A 2HHCA 4HMPA 4K86A 1KK2A 6CHYA 3RAGA 2VDMB 4GX5A 2G4CA 3OE5A 4Z9FA 4XUCA 1I0IA 1SVUA 2AZDA 1QHSA 2BMEA 4L5CA 4KNYA 4GKKB 1FSZA 5IDVA 1JVBA 3T6KA 5D5PA 3T7TA 1CVLA 1N0UA 4UATA 2CC2A 5E6UA 1JQAA 1QQ5A 4LRUA 4K0KB 2Z4TA 3WL8A 5DASA 2R62A 1KYQA 3WK7A 5ECGC 3J7AC 2VHUA 1WPGA 1SXJA 2WIFA 3AUSA 1YE5A 5BUZA 2W2TA 4MPRA 3UGKA 2RARA 4EOGA 4DR1B 5JCZA 2AI3A 4HUQA 2JBHA 5BUCA 1VJRA 3TZCA 1KO8A 1W4CA 4DCVA 3AHEA 3RAEC 1XTJA 3IUMA 5FT9A 3T3IA 2YYAA 3GT7A 1KBZA 4XD2A 3D02A 1TJ3A 3JQCA 4FVTA 1IOVA 1T2UA 5H68A 4N8EA 3NONA 3UWDA 1OI2A 1UKBA 3C2QA 7AT1A 1HTTA 3NHAA 3ZY5A 3IL2A 2RGRA 1IBRA 2DFDA 2WDPA 3H9QA 1E0SA 3PDUA 1GNVA 4Y2XA 4XXHA 5JH7B 3EWNA 3RSQA 3U5TA 3B7GA 1EGVB 5JNSA 4JL6A 4R0VA 2QM3A 4TRNA 3OFND 3QNMA 4ZVQA 2O19A 5HKBA 3N2GA 2AMLA 1U90A 1XZQA 3Q7TA 5LQCA 2YZNA 4CUZA 3W1EA 2J7KA 1BEUB 1T9GS 4LXYA 2W6CX 4R2WA 5F7ZA 4EKEA 1DKPA 5BNTA 3RC1A 1T4CA 4OATA 2H4YA 3CLKA 1Z29A 3KSZO 4K9MA 4UARA 2QEQA 5ER9A 3ZCRA 3P2MA 4A27A 1VIVA 2PZEA 4IFIA 4IJ5A 4A8JA 2EKLA 3B7PA 1QVVA 4B48A 5JNWA 3JQPA 5ER6A 1DTEA 5LP6C 4WN9A 2QRJA 1FFXB 2QTLA 4YJFB 1E7SA 4PX2A 2B30A 1BJTA 1VRWA 4QQNA 1ENZA 4IP0A 3ZV7A 4B6JA 3K35A 2WU1A 2Z3VA 2HPVA 3TNLA 1B6TA 5IT9A 4EY3A 4URXR 3L7KA 2CJXA 2FN8A 2ECQA 4BMZA 2ZRBA 5BN1A 5FFMA 4AZWA 3HDGA 4FCVA 4MW9A 3GNTA 2WJIA 5TIIA 5M04A 5ICEA 3PL5A 1RHQA 3DBRA 1QIFA 1XJ0A 1JHPA 4LGYA 5KVAA 1S3IA 1FTSA 4UNPA 4BZPA 1Z8FA 1GCAA 3N74A 4HO1X 3RQSA 5CM9C 4F5DA 2IL1A 3CONA 1V8PA 2OBLA 2GM9A 1AKTA 1A5ZA 1W46A 2X7JA 3TOSA 2XGMA 3KSUA 2O8VA 2O2IA 1IAVA 1QG2A 3H6HA 1Q0PA 3FUTA 4BU0A 1DC3A 2DTEA 4EZEA 1ZVVA 4KVZA 4BO7A 4EI9A 2GHQA 1NXQA 3JPYA 3EY9A 3RODA 4DA6A 1E98A 2HQ1A 1K7FB 1UC5B 4FMDB 3WBJA 2OCBA 1I2CA 1DCFA 3DFZA 3NB0A 4DDWA 2C2GA 2C9ZA 2XKAA 5BNIA 5LOVB 5IJAA 2BR3A 3DZIA 5H4HA 3Q4GA 5CRIA 1ZKMA 3DWEX 3NV7A 1P9LA 4RDXA 2EX