1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HI0065
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
4M1MA 2AD5A 1UBGA 3F3YA 1KMHB 4JJZA 3GLHA 3NHAA 2OESA 4PAQA 5KSPA 1TUEA 2JCSA 3PITA 4M4SA 1K5GA 3UMSA 2WHXA 1QRAA 4CEJA 1UEIA 4CGZA 1GILA 2BM1A 1FW6A 2V7QD 4M9SA 4LC0A 2ZRIA 4LOAA 2C95A 4Q7LA 4LDJA 3SBDA 2VSOA 2R65A 2CE7A 3TR5A 1I4TD 2WM9B 1ESNA 4LV5B 4Q4JA 2IXEA 1CF4A 4G5SA 2EWVA 3IHLA 2FPLA 5EP3A 1XCMA 5IK2D 3KUDA 3FOZA 1M7HA 1G18A 2E9SA 3BERA 3M1IA 2XSZA 1UKYA 4PZLA 2EYQA 5EE0A 5FPTA 2WOJA 3EPHA 3L43A 5DYIA 1RZ3A 4PPNA 1RRPA 4GFDA 4C3ZA 5FI1B 1GDDA 1U98A 1DEKA 4HAYA 4JL6A 4FMDB 4LCBA 2ANBA 4ON9A 4IOLA 3RAPR 2D7DA 4XSHA 1HV8A 4DCTA 3VQTA 4P4SB 5FOVA 1SVLA 4QBGB 4QKQA 1R7RA 3T1QA 2O0HA 2ZYVX 1JPNA 1R0ZA 4WZBE 1EESA 2O8FA 4DC9A 4C0LA 3HYRA 3THXB 4TMVA 2J7KA 1XTSA 2GZDA 2IC5A 2NO9A 1E99A 2HLDD 4LYHA 2BBOA 2NPFA 4EQ6A 2Z83A 3EWAA 2GXAA 1DS6A 1PUJA 1IN8A 3K1JA 1EX6A 2W6ID 3QE0A 2GAOA 1CRPA 1Z06A 2XTMA 3C5CA 2FPMA 2A5DA 4C0QC 1P9RA 1XD2A 3LX5A 4MKIA 5AJYA 4G3XA 2ZE5A 2JDID 2ODNA 3EPKA 5CJPA 4JS0A 1E79D 1MO3A 1G8HA 2C03A 4GOKA 4A8JC 3R9XA 4WZAE 2D2EA 3QKSB 2ZR9A 1I2MA 4U5XA 3ZYCA 121PA 1G3UA 1MKYA 3Q5DA 2ZU0C 1F48A 4C7OB 4URWR 1E9EA 1FL9A 2QMHA 5J5CA 2JLWA 2G9NA 3QQ5A 3H2YA 4M1YA 2PT7A 4M22A 1VIAA 1UEJA 3LY5A 1G20E 1GITA 1Z0JA 2OFWA 4DCVA 4BZPA 2ZRPA 3WMFA 1RW4A 2QP9X 3FWYA 4XTRA 4EIWA 4CEIA 1H8HD 1RJ9A 2OCAA 2QM8A 3R7WB 1Z3IX 3A4NA 4G01B 3B60A 1M7BA 4PSAA 4PZZA 5HKKA 3WBJA 1KIMA 3N5CA 2FJUA 5LB4A 1JB1A 4PHGA 2QUZA 4JYCA 5CYOA 2QM7A 4D4LA 2VP2A 1BKDR 5KDOA 3H0KA 1AZTA 5FBLB 3BGWA 4LBWA 1N5KA 3P26A 3ZLJA 1KDRA 2PL3A 2VHTA 5K8IA 3FFAA 3KXKA 4PC1A 4XSGA 3M4YA 4H1UA 3OIWA 1LF5A 1KOFA 3CF2A 5CIWA 3UWKA 4AYTA 1XPOA 3I5YA 1S96A 2ZRDA 1P75A 2W00A 4IDPA 5CB6A 1DARA 4OL0A 1FFHA 2NO0A 4PTLA 1YZKA 3UXMA 1ZP6A 3NTUA 2WWWA 1NVVR 4TMTA 4WW0A 4BPBA 4LZZA 5CLQA 5JJIA 4B34A 1TL7C 3RS4A 4NL4H 1W36D 1SQ5A 3QXSA 1KKMA 2Q3MA 2B7BA 4DIEA 3OAAD 4Q02A 3CRMA 2DHRA 1GL7A 4Q4AB 1GRNA 2IYUA 3W8NA 2ZJYA 3DMDA 3ADDA 1U9IC 3Q7PA 3W5IA 4N3NA 3W9YA 4A2PA 4JL5A 2C5LA 1KK0A 3CF0A 5AUNB 1P73A 3LFUA 1IN7A 2CK3D 1VG0B 3VU9B 3FYHA 4P33A 4PZYA 1HT1E 1E1RD 5EXPA 2DY1A 1KO7A 1ANKA 4M9XA 4OI1A 1Z0KA 4A6PA 3MWJA 3K8YA 3QXXA 5DO9A 1PJRA 1ZD9A 2JEOA 5E95A 3VTKA 5BN3A 2HV8A 4HAVA 2J59A 1RYFA 5K8TA 1U8YA 1CTQA 3LRPA 2E87A 1BMFD 2VSXA 2P65A 2D62A 2CHVA 2OT3B 3IBYA 1ZM4A 2ONKA 4JIMA 5DN6A 1E96A 1TQDA 4BGDA 4TQAA 4N1AA 1E1QA 3RS7A 2PT5A 3OZXA 2P6RA 1HH4A 4LHXA 2GVDC 3IPXA 2GEUA 4BFWA 1PV4A 1F3OA 4TLEA 3TH5A 4XWAA 5M04A 4RZXA 3FKSD 5DH9A 4HSEA 1AGRA 4ZDIA 4D82A 2OLKA 1Q3TA 3CONA 4LJ8A 1MABB 1ZU4A 2RGBA 1P9NA 1Q12A 5FPHA 1O87A 1LVGA 2HYIC 1F60A 1KNXA 1P2UA 2RGDA 4MKFA 4EKDA 2WWFA 3BB1A 4M1KA 4FD2A 2AX4A 1IXRC 1YKSA 2PZGA 1W44A 1KK1A 2SHKA 3SJCA 1JBKA 1UKEA 1ZUNB 1ZYUA 5EP1A 4MYUA 5FPKA 2QQEA 3KQKA 4TYNA 3ZD7A 2XOKA 3BJIC 5HZHA 2VL7A 2YJTD 3CO5A 3D31A 3IKJA 2CDNA 4MKHA 5FTNA 1WF3A 2O52A 3UKDA 1TU4A 3L0OA 2BCGY 1G8GA 1TQ4A 1CJMA 4RKEA 2BBSA 2EFCB 4M1TA 5J47A 1NBMA 4Q9JA 4O3MA 2ZJ8A 4IFEA 4A8JB 3LH5A 2ZJBA 3LXXA 4BFYA 1KJZA 3AP1A 3PENA 4OHVA 4KLNA 4QNRA 4XD7D 4F7WA 2PCJA 4RD0A 1XRJA 2WV9A 1OKKD 3T35A 3K0CC 3TQFA 4LJ7A 4V0ME 3RRMA 1W4BA 1II8A 2GK6A 2FN4A 1NLFA 1N6LA 2NQ2C 3B82A 3ZZUA 2IYTA 2WWGA 4BLTA 3ETLA 2NO6A 3TQCA 1ZCAA 3MAAC 2VHJA 1E0JA 3X1ZA 4D0GA 1YZNA 1MV5A 5AJXA 4PC6A 4IVRA 2F3TA 1CJVC 2HCBA 2IEYA 2CCGA 1G9XA 5EQTA 2ZREA 3QVVA 5BW8A 4NYMR 2FMXA 4ZKEA 1SVMA 2WBLC 3OIUA 4MDEA 3OEHA 1SHZA 3X1YA 2QGNA 2I3BA 1MT0A 1SULA 4KLZA 1SKYE 1Z6GA 3CPEA 3I8XA 2VSFA 4A2WA 5CDFE 2O8EB 2A30A 2QN6A 4DLZA 4UQOA 3LDAA 2Y8EA 1B23P 5FPYA 2IF2A 1G19A 4AG5A 1LTQA 1XMIA 3Q85A 4KJZA 1W0JD 2VHUA 3U44A 1A2KC 2ZSBA 2GJAA 2KBEA 3NDPA 3UWOA 3QEOA 1E9SA 2A5YB 1UF9A 4KSBA 4XWKA 3THWB 5ELXA 5HCIA 3BB3A 3LV8A 4ERNA 4EPVA 3FMFA 3W3ZB 3WMGA 2QGZA 1OXVA 1S3GA 1W5SA 4G0NA 4BLPA 5AUPB 3IILA 1LS6A 1W2GA 2F3RA 4KFRA 4DSOA 1ZD8A 2RHDA 3RWOA 4AYWA 4DRZA 2ZU6A 4TLDA 3QKRB 4DT1B 1E3MA 3VR3A 4Q4HA 1XCGB 2QTVB 1KMQA 3G5UA 3IGFA 1NRJB 4HUQA 3UG6A 1TQ2A 3PUWA 4K46A 1LS1A 3X1WA 2C9YA 4PO8A 5E4FA 3EA0A 4FXPA 3GLGA 3A4LA 4JLOA 2ZEJA 5JHGB 4TL9A 5J4KA 4DDUA 2YWEA 1E2HA 2ANCA 4PQRA 3TJZA 2R6AA 2EQBA 1E2PA 2FGJA 1E0KA 3K0AA 3ADCA 1A2BA 1KDPA 1U8AA 2O8BA 3TMKA 2OILA 3KX2A 1VHLA 1D9XA 1XJ0A 3U3KA 2IYQA 2XJ9A 5E3HA 4JSYA 4US0R 2BKUA 5FOUA 4DVGA 1G7CA 1Q3HA 2ERXA 2N1BA 1VYUA 4Q1BA 2XNDA 3CLVA 3CRRA 1JEEA 3BXZA 4XVRA 2REOA 1CR2A 2F43B 3FPAA 4B75A 1F2UA 1U90A 2BM0A 5G40A 2QT1A 4XOIA 3MSXA 4PAOA 4C0KA 2B21A 1AA9A 1K6MA 2WWIA 2O5VA 4WXPA 4ACBA 4DLTA 1NVWQ 1VCOA 2B92A 4C0SA 1LB1B 3RS0A 2JLUA 4FW9A 2OBNA 2NZ8A 4D2IA 5JCZA 1UBEA 3T61A 2GF9A 1P7CA 3MWKA 3VR5A 4AY2A 5D3MA 3GEHA 2OBMA 2PJZA 3SYNA 1ESMA 4RFVA 4X8MA 1ZMXA 1DBSA 1XBTA 2IWRA 2DFNA 3JZMA 2WIAA 2ZRGA 2O8CA 2YOGA 5CIQA 3GLFE 3EIQA 3FFBA 4LJYA 1DELA 2RHMA 1SXJD 3F5FA 3VX4A 2CL6X 3QF4B 4GT1A 3WBKA 3A1TA 4Q47A 3O8DA 1L8QA 3GLHE 1F2TA 5EUQB 5HR5A 4F38A 3SBEA 1OPXA 2G0TA 2KE5A 1H8ED 2Q0HA 4PSKA 2J3EA 4QJ3A 1OFTA 2VF8A 3AF2A 4ZV4A 2NIPA 2X77A 4HUTA 1S3SA 2HXSA 3CNNA 1QG2A 4OI4A 3TW4A 3AKDA 4DWJA 1XCPA 2WZQA 2WPDD 3VR1A 4LJ4A 4I1SA 5EZ6B 1T8TA 3EWSA 3BFVA 4AYXA 4JKYA 4EJSA 1Z6TA 1Z0DA 4NTZA 2V6IA 3A8TA 1IOZA 2AN9A 2MMCA 4GL2A 4TT3D 2OFXA 3T12A 4FMCB 2AD1A 4PPFA 3IQXA 2DWPA 5F2EA 3PIRA 1E2EA 1TADA 5DIFA 4Q01A 4OQLA 4P31A 1LF0A 2R6GA 2ZRCA 3LW7A 2DWOA 2ZRHA 2EFHB 1W0KD 3CRVA 3FVQA 5AJWA 4JBXA 2PX3A 1G8YA 1R8SA 4PHFA 5G3ZA 3AVQA 2JLYA 4URXR 1XEXA 2ZI9A 2ORIA 3DKVA 1BYIA 4GZLA 1GKYA 3ZVMA 1H65A 4UNNA 5ANRB 2RGXA 2CXXA 4E03A 3OHMA 3BK7A 1QHYA 3U4QB 4OJKA 5J4HA 3L8ZA 5JLJA 2ORWA 2VLIA 2F6RA 3EZ7A 1Z07A 4F4CA 2A7QA 2B7CA 4IVQA 1KY2A 1YR8A 3AGQA 5FL7D 1U81A 3VR2A 2RH5A 3AKEA 1G3MA 3VKWA 1UDXA 2JLXA 2WSSA 3MCAA 3BAFA 3AVXA 2IS6A 1OH7A 4Z1MD 2BCJQ 5JECA 1US8B 3IQWA 3SHWA 4M1SA 1TEXA 4GP6A 4BFZA 5BWMA 1PUIA 1E2IA 5CJ2A 3P27A 3X1XA 4ASUA 2NO7A 2QPOA 3CNOA 1T91A 4ABYA 4MGZR 4DJTA 3K09A 4NHOA 2FPKA 5FBVB 5CYPA 5JI2E 3D7MA 4B47A 1JR6A 1QVRA 1JR3A 1Q1BA 1R6BX 3B85A 3GFPA 3I92A 3R8CA 1ZJ6A 3W6NA 4LHWA 5AUOB 1HA3A 3BB4A 2EFGA 2C04A 1QDEA 1QHGA 3HU3A 4RSGA 4V02A 4DEXA 4D26A 1LFDB 2IX3A 4OQNA 4V0KA 3I61A 1Z0AA 2RCNA 3SS8A 1GSIA 3VR4A 3PR1A 1XJCA 1XEWX 2J46A 2QAGC 4V0OA 3WYAA 3ZIAA 1OE0A 1P5ZB 2FZLA 2XZPA 4NDZA 1OIVA 1QVAA 4I99A 4NBSA 3T15A 3AVWA 3B78A 4PR0A 1NMXA 1PVOA 5TARA 3JVVA 3ZD6A 1M6NA 4DLVA 2GJ9A 3EX7C 1CLUA 2W6JD 2GTPA 3LVRE 3R20A 5LBIA 5TVKA 3GMTA 3VFDA 4AIIA 4W9MC 3AV0B 1DAFA 1ONBA 4IKEA 1KHTA 3H86A 1E9FA 3ZDQA 3U3OA 1CIPA 4Y0AA 5TV2A 1S2MA 4IJMA 5JEDA 3BIFA 3F8TA 3OFND 2F9LA 5KOYA 4IRUB 4BFSA 4Q9KA 2KI5A 4XIGS 4B74A 4A36A 3P32A 4AD8A 2J0SA 3W34A 1J2JA 1XTQA 4HLUC 4GRAA 1N0UA 1YJ5A 3P4XA 1GL6A 4FN5A 2D7CA 4OQMA 3QUSA 1KO8A 1II0A 1W36C 1M1YE 2RGCA 1KK2A 3GJ3A 5FOWA 4JLVA 4AURA 3M0EA 4MGYR 5CM9C 1E2JA 4PAMA 1QHIA 4BUJA 4D81A 4IOJA 3KZ1E 2AXNA 1ZD1A 1W2HA 5AJVB 5GJCA 1TMKA 4ZO4A 1G8PA 2WOOA 2AXPA 2G83A 1NKSA 2ZI5A 1IAQA 2H57A 4U02A 4EDHA 1VG9B 1X3SA 3C16C 3KUCA 4PC3A 4Q9IA 2Q9BA 5JWHA 3OESA 3SDZA 1Z47A 4P4SA 3ZZ0A 2IYZA 4G1UC 5IHPA 2Z43A 4M21A 2ZRNA 3NHBA 1KTVA 2C9OA 4BWYA 4YMUA 1TU3A 3THXA 1CR0A 1R0XA 2X1VA 1XJQA 1U8ZA 5G3YA 2QMOA 2AK3A 3NVAA 4C0JA 1OB2A 1JECA 2DBYA 2J9RA 4B2IA 2H8KA 3BWDD 5D3QA 1JNYA 4NU0A 1UBFA 3V00A 4TTQA 1FQKA 1DG1G 1FTNA 4CIDA 1VECA 1WXQA 1MH1A 2F7SA 2W58A 3MLEA 3QNUA 3R8FA 1Q1QA 2JIZD 2AL7A 5F3WB 3VNUA 1E2QA 3EW9A 2OFOA 2N42A 4L15A 1G6HA 5EE9A 3RS5A 4EUNA 4YXWA 4M2LA 2KBFA 3QKSA 2ZIAA 4J0QA 3WNBA 3R9WA 1KAOA 1SVIA 4HLUA 1XTRA 4IEEA 3ICQB 2ZJ5A 4MGKR 1FUKA 4DEYA 1GG2A 4ZI3A 5KSYA 3EPJA 1GAJA 4C7OA 3BFKA 5JJKA 1QG4A 4LPSA 2GKSA 1YZUA 3G82C 4TYPA 4WVFA 3RLFA 1GFIA 1BO6A 2GILA 1N6HA 4DLUA 2IS2A 1OYYA 3N2IA 4LWZA 3R7WA 3VX3A 3GEIA 3LAWA 4YONB 1FTSA 3CKLA 3B1ZA 3U3RA 2P6NA 3QJYA 3TAHA 1OIWA 2NMVA 1NBME 2D06A 1CULC 1Q0UA 1AKEA 5EE3A 2GBLC 4RD4A 2FOLA 3SNHA 1KDOA 4D0LB 4RVCA 3DO6A 3LLMA 1XB2A 2CNWA 1NIJA 1KAGA 3SYKA 2FWRA 3SOPA 5A5GA 1E4YA 1KZGB 1NIPA 2H18A 4KFSA 3SFVA 3TAUA 3I72A 4AWXA 3K0EA 4TTPA 1ZUHA 4JLNA 4NP6A 3SU8A 2RGNC 1G7SA 5EXTA 1G4UR 3AUYA 4KITB 2XX3A 3RRYA 2PJRA 4JLMA 3CIOA 3OIYA 2VHQA 1GOTA 5EUMA 1VDZA 3IIMA 4OI0A 1KI9A 4B3CA 3DDCA 3L0IB 1RRCA 1G1MA 2GRJA 1NVVQ 2ZPTX 1Q21A 4IHQA 4KHZA 1TF7A 2QAGB 2QZ4A 2GZAA 2UVQA 5A4JA 2ODWA 3C4JA 1W4RA 3TUZC 2H7VA 4DSNA 4A9AA 4QXAA 5KDLA 4CEHA 1J90A 4IFBA 2OHFA 4Q4AA 4WA7A 4D80A 1A5TA 2QA5A 5IRCD 5DSZA 3DZDA 2DYKA 1G3QA 4IDOA 5FH9A 4OQXA 4XVUA 5C1BA 3K0SA 2G0NA 2VBCA 3VU9A 3N2EA 3G0HA 4OK5A 4ZDWA 1QHNA 2Q3FA 3QKUA 4I81A 4LYFA 3GPLA 1KSJA 2JLQA 1MRNA 5L3VA 5IF9A 4RY2A 4US2R 3B1VA 3KL4A 3AGPA 4RCYA 1S0UA 1E2FA 5KU1A 3KDSE 2VP6A 4L16A 4TLCA 3HWSA 5FTMA 5HTKA 2OUKA 1S8FA 1W36B 3VKGA 1K8RA 2OAQ1 4O25A 1V43A 2YC2C 2O0JA 2CE2X 1OT3A 1RC8A 2QRNA 4BLSA 3B8HA 2ZJAA 1HYQA 2ZJZA 3PJRA 4TYYA 1KO1A 1ZC3A 2J45A 3I73A 4BFTA 2AHOA 3FGNA 1N6RA 5KYKA 2J5XA 2ZR0A 4TLBA 5L3QB 2IYLD 2VEDA 2ZRJA 2AFIE 2HDNB 3GLGE 2YOFA 2YWFA 2DFLA 1N0VC 5JBQA 2OSBA 3CX6A 1U0LA 1UDWA 5DGXA 1R10A 5K8UA 1MABA 1QHXA 3HDTA 2VRWA 2VHCA 3GJ0A 4HLDA 3U6KA 1XWIA 2QENA 1Y3AA 1KSGA 3EXAA 2D2FA 5FTJA 1UADA 3C41J 3EG5A 5JSZB 3ICEA 5B30A 1II9A 4HATA 3FDIA 1NLZA 1W1WA 4M9QA 2IYRA 3FKQA 5IT5A 2JJ1A 3IDQA 4DBLC 5JRZA 4WOPA 1OHHA 2QG6A 2FE4A 1YZQA 3KTAB 2PCLA 4LJAA 4DLYA 4DDVA 1Q20A 3L2OB 3AB3A 1DAKA 4MUBA 3CB4A 4DLSA 3UG7A 1YR9A 1AJEA 2ZRLA 1WBDA 4R2HA 1VG1A 4EPYA 1DAEA 2IYVA 4YC7A 5FTKA 1G3IA 3RC8A 4CEHB 3GEEA 1X8JA 1Q22A 3FHCB 3NKVA 4A8JA 2OCBA 4BRUA 1G7TA 4W5WA 4CDGA 4P3YA 2BMDA 2IXFA 2W83A 2A78A 3PUYA 2VP0A 2FFHA 4NONA 4LY6A 2JASA 1EXMA 4BEBA 4TMWA 1EFCA 5EE5B 2OG2A 3OE7A 3ASYA 1RYHA 3QSYA 3NIBA 1YRBA 3W3AA 2YC4C 4KVAA 3KKQA 1KDTA 2WMNB 2XAUA 5DNYB 1C1YA 1E69A 2OXRA 2W2VA 3MG9A 3TR0A 1D8TA 4URUR 1KKLA 3S1AA 1WBBA 4G5OA 2A5FA 4W7SA 2HEIA 3H84A 5KNBA 1Z5ZA 3K9HA 4PO1A 1Q57A 2EWWA 3Q5EA 5DI3B 4NYMQ 3WHLA 1XU4A 3B7GA 3RS2A 4LJ6A 1A82A 4BFUA 1G5RA 2WSMA 1AS2A 3CR8A 4HI0E 1GNRA 1X1RA 4NYIR 4CF7A 4LJ5A 2O8EA 3Q72A 2OCYC 2BWJA 2IYXA 2J41A 2XSZD 3A6PC 1EGAA 1PLJA 1JI0A 4OHWA 4HB4A 3A4MA 3DM9B 3LA6A 3QKTA 1VYVA 2ZVPX 5FBWB 5L3SB 2ZYUX 3THWA 1OB5A 4G5RA 4NKRA 1N5IA 3HP1A 3MJRA 2FSGA 2IS1A 1X8LA 1XXHB 1RRGA 4IOMA 2QE7A 2ZYWX 1AKYA 1KI1A 3EIEA 1GIAA 1IY2A 4Q1FA 1N6KA 2GEVA 4BRWA 1U9IA 4US1R 3CR7A 4EFMA 4QJ5A 2ZJ2A 3QKRA 4DT1A 4TLAA 3AM1A 4A82A 2PEZA 2I4IA 5BXQC 3HR8A 1IQPA 4B32A 3I1FA 3DOEA 4OK3A 1FQJA 2ZROA 1ZW6A 3PG5A 4BFXA 2QNRA 1WMSA 3CUEF 1M2OB 4HB2A 2ZTSA 2Z4RA 5LB2A 4QGAA 2FF7A 3UMRA 2ODEA 2R62A 3D6TB 1I4LD 2RGGA 3LNCA 5C18A 3GP8A 1EFRA 3DKPA 3NXSA 1E9BA 4PPQA 3KJGA 4JBYA 2FEMA 4ZIRB 4PQYA 1VIYA 2ZYTX 3HU2A 2OZEA 2WKRA 4CYMA 2ZSAA 2MSCB 3UMFA 1JR3E 4BZQA 4NH0A 4HEJA 4F4JA 2VA8A 4XWOA 2AKYA 1IY0A 5HPYB 3RSLA 4QM6A 3DOFA 2I1VB 3FMIA 3BFXA 4YMVA 3S1AB 2F43A 5H8WA 3AF1A 2DB3A 5HKKD 1KJYA 4BFVA 2IYYA 2PBRA 4RZ2A 3V4RA 5EE1A 2XEXA 3B2EA 1Z28A 5A0FA 1EX7A 3QVUA 2VH5R 4B71A 4ZKDA 3TUJC 3WP0A 2YINC 4KFUA 4QBIA 3NH9A 3W90A 2F1JA 2PMDA 5J40A 3W6PA 2HT6A 4UJ5A 2HYDA 2XB4A 1N6IA 2ZXUA 5KPDA 1D2NA 1L2TA 4JLKA 4MA4A 4U7DA 2RGEA 1A4RA 3ZVRA 1N5LA 1MR3F 3I4LA 3SQXA 5KNDA 4UXJA 1NKTA 4IVPA 3TBKA 3QF4A 2CL7X 1TEVA 1ZNYA 4IDQA 4C30A 621PA 1X6VA 2FH5B 2ZRMA 4HAXA 3O8BA 3EAQA 4DIDA 1WQ1R 2ZQ5A 2QP3A 5SZJA 1BH2A 4URZR 2ZJOA 2KJQA 3CX7A 2WWXA 2JJ2A 3X2SA 3FTQA 4CZ2A 1GM5A 1OH5A 2Q9CA 1VKJA 2MMGA 3K0CA 2C78A 1HY3A 2H1LA 4JT2A 3TSZA 3DVLA 4EAQA 3BH6A 4MRNA 5K8LA 2QI9C 1XMJA 3RHFA 3O8CA 4P4TA 4TMXA 3U7FB 1HE8B 4HLQB 2HJGA 4TYQA 3V9PA 1SHKA 1RE0A 3NBFA 3DZ8A 2IW3A 3L0SA 4TMKA 4IOKA 2PEYA 1ZNXA 3CM0A 1GVNB 5DI9A 1COWA 1DAIA 1SVKA 2NG1A 3QENA 2QROA 1KI3A 1D6JA 3SR0A 1FP7A 4YMWA 4N0EA 1KI8A 2J7PA 2WAYA 2W0MA 2GJ8A 4TL7A 1E2MA 2FSIA 2FU5C 1CU1A 1EFUA 3EZ2A 1NMYA 1JAIA 3KJHA 4A1FA 1U0HC 2WKQA 3PQCA 2IK8A 4E5UA 2HF8A 2F9MA 821PA 4XH9B 4ZPXA 1CP2A 1DAMA 1XEWY 3AKCA 4WXRA 4C4PA 5DN6D 1VCIA 3U4QA 1E1QD 2VP4A 1Z8FA 2DFTA 4DLRA 2ZRBA 4RZ3A 1FUUA 1HE1C 3IEVA 1W49A 1MOZA 2KSQA 4POAA 4MYCA 1O3YA 2EFEB 3THYB 2JLZA 3TE6A 1R5OA 1WP9A 4A2QA 3DHWC 5TB5A 1YU9A 4TZ6A 3L82B 1US8A 5DE3A 1IJFA 1KI6B 1T0HB 1IXZA 3GLIB 1NG9A 4TZ0A 8OHMA 2G77B 1JJVA 1P6XA 1E6CA 1EFHA 3PCRB 2ZSEA 4P32A 2RB4A 3JZAA 3CPJB 5FUVA 2ZUCA 4OI2A 4Q1DA 5JCPA 3QOFA 2ZSFA 4LV6A 4AKIA 4KFTA 5EP4A 2XOKD 1Y63A 2FA9A 3U6BA 2V3CC 1G8FA 4I4LA 3K70D 2CCKA 3AH8A 4X8HA 3PEWA 1EK0A 3EA5A 2KWIA 5TMPA 4URVR 1XMVA 5TXGA 1NBMD 4QM7A 3KJEA 3QI2A 2B6HA 4BZXA 2HCJB 4RFSB 1GRQA 3GJ8A 4S35A 1G4AE 1CR1A 4Q4LA 1E2NA 4HDQB 3CWQA 2BBWA 2WJJA 3EASA 4LI0A 5G41A 4GNKA 1ETUA 2BKEA 4TSFA 1R5BA 2BJWA 4I1UA 4DLWA 3MGCA 2I1QA 1S1MA 3GJ4A 4PC2A 4R9UC 2BC9A 4NZYA 2QMUA 5IDVA 1GRRA 5KHOC 3LBHA 4HZUB 4YDHB 3U7EB 1G6OA 1TQ6A 3MFYA 4NYJR 4Q66C 4QBFA 2LCFA 4HYYA 1FP6A 1HEIA 2ORVA 4D25A 3AQ4A 4GSYA 2GCOB 4K8OA 1E32A 1FZQA 3P1JA 2YNMA 1U0JA 5GVRA 1NNEA 1KSFX 2ZANA 3C7KA 2C8VA 4OQFA 4B73A 3FHTA 221PA 5KPJA 1IN4A 4MYHA 2AKAB 5SZKB 4KCGA 5EZ5A 3OEHD 4DCNA 4ESHA 4OHZA 3U3JA 2O8DB 4DUGA 2N46A 4JLDA 3CF6R 4HAUA 2XTNA 2IXGA 3X1DA 4B6EA 1R8QA 2QY9A 3IBGA 1YRAA 4JT4A 4AKHA 3C5HA 3LQQA 1IY1A 3RVBA 1XP8A 5J4LA 1ZCBA 4Q03A 1HQYE 2J0UB 3K0FB 1A7JA 3N70A 2BVNA 3TGPA 3OEEA 1P2VA 5JHHB 2QEQA 3CH4B 4PX9A 4QFMA 3B6EA 4Q1EA 5FR1A 2WWYA 1NMZA 2B8WA 4Q7KA 4EFNA 2BMEA 4KVGA 1I4DD 1JALA 3BH7A 3Q9LA 2PLFA 1ZAKA 2V7QA 4HLCA 1Z08A 4UXIA 3VHXA 2ZI3A 2X2EA 4Z8YA 2XJ4A 3EARA 1ZM7A 4DHEA 5IK2A 4DDTA 2ATXA 4E22A 2R6DA 4BE7B 5F9FA 1CJTC 2ZE6A 1XZPA 1P4SA 3SEAA 4JBWA 2HJVA 5CB8A 1YE8A 3UANA 3BBPA 3GD7A 4MRPA 4CT5A 5HE9A 1UAAA 2ZI4A 1P9WA 2Q21A 2EU8A 2YYZA 3BORA 3A1SA 2Z4SA 4TQUS 1C9KA 4MITA 1FMJA 1XXHE 2L0XA 2PH1A 4GMXA 3RSOA 4BQSA 2HT1A 2OBLA 1RFLA 2MSDB 4KBGA 4QGFA 1AGPA 4OHXA 2ONJA 3WMEA 4JLPA 1E98A 1N6NA 3B1WA 5KSZA 3SI7A 2HLDA 3ONWA 5B58C 2XNDD 3LX8A 1KGDA 1XDBA 2IEZA 4B3BA 2W6IA 4NCIA 1JQLB 1VCMA 1XF9A 2X8AA 3QPUA 4ARZB 3PEVA 1MO6A 4R98A 3NEJA 3WNDA 2ZAOA 5P21A 5FI0B 4A0RA 2OO7A 4X8OA 2IYWA 3GJXC 4LC1A 1P2SA 2NPIA 2JDIA 3NBXX 3P20A 1KJWA 1E79A 3BS4A 4RZUA 5C46F 2G1JA 5HE8A 3DL0A 2AWOA 2WJVA 1G3RA 3RRZA 2ZE8A 1P62B 1CS4C 1HURA 3T5DA 1E9CA 1UM8A 3TKLA 3AKYA 3B1YA 3FE2A 2BMFA 3ZVLA 2ZM5A 2ZR7A 1D9ZA 4Y0VA 2YOHA 1NSTA 4BECA 4LHVA 4FINA 4LSGA 1H8HA 4LV8B 2NTYC 3QG5A 3ZVNA 1NP6A 1KI4A 1P2TA 2YWGA 1KYIA 2ZSDA 1VPLA 4W5JA 3IEUA 2LWIA 4A6XA 3KB2A 3GCGA 2QAGA 4R71A 2OEPA 1GNPA 4WZ6A 1JAHA 4A92A 3C14C 1F6BA 2C2HA 4M53A 4P4UA 5EJEA 4KODA 4YMSA 2W2XA 3F0TA 3GJ7A 5DISB 5UKDA 4AK9A 3U7GA 3BOSA 3IPYA 1DO0A 2UKDA 3LW8A 4FI3C 3WP1B 4MKGA 4O0MA 4L9SA 3SJBA 4LGMA 2AWNA 4OJQA 2AFHE 1S9DA 1P72A 3IO5A 2V8OA 1OXSC 2F1IA 1C4OA 2CJWB 1CEEA 1BS1A 5JI3E 3LQRA 3RANA 3T1VA 2QSZA 1G64A 1X1SA 4KI0A 2QT0A 3Q8XB 1YQTA 1T8UA 1ZNZA 3KKNA 3IUYA 2F1RA 1W46A 1D2MA 4QGGA 1XX6A 2QORA 6Q21A 5TY0A 3ADKA 4QJ4A 2QL6A 3OAAA 5FUXA 2ZS8A 1I2DA 5FOSA 2ZI6A 1R0YA 1YVDA 1GUAA 1ZU5A 2CLDX 2ODBA 1NF3A 1GTVA 4JJKA 3SZRA 3NC0C 5B2ZA 1XFAA 1LW7A 2XNSA 3CRQA 3OIVA 3B13B 3FMPB 2CK3A 5EP2A 5L3QA 1ZINA 5F98A 4M9ZA 1E2KA 3ZZTA 4D6PA 4DB2A 2FV8A 2IBMA 1E1RA 3DEFA 4X8LA 3AP2A 1YR7A 1WA5A 2WSSD 3CBQA 4GMDA 1Z0IA 4FCWA 1IXSB 1FNNA 2WAXA 3OF5A 3QBTA 5TDHA 1DAGA 2IUUA 4B3GA 1S9HA 2BIFA 1OXTA 2YHSA 4ASUD 3QPVA 5JSZA 4B3FX 4C2UA 3AVTA 3K53A 4MUAA 3V4FA 4QHSA 2V6JA 4YLGA 4MH0R 1KSHA 1X86B 2XTZA 1BMFA 1JR3D 4BLRA 3GFOA 4A4DA 5JS7A 3QY0A 2NOAA 3E1SA 3EZ6A 4ZDKA 1NN5A 3KTAA 3SE0A 3CZPA 5AK0A 3SYLA 4B35A 1T5LA 4QRHA 1NY6A 4E09A 3QBVA 2J1LA 2ASEA 1Z0FA 4HAWA 3ZIAD 3FKSA 1DVRA 3IIJA 2DFKB 1AN0A 1U2RA 3NG1A 1KNQA 3HPRA 4V0LA 2P2LA 4E07A 4DB4A 4QOSA 5F9HA 2K5UA 5AR1A 4D4MA 1G16A 2FG5A 4KV9A 4AG6A 4DKXA 1IN6A 4PO9A 3GLIE 4S2EA 5J4YA 1LV7A 3WXMA 2QQ0A 3QG1A 2GXQA 3U7HB 3PUVA 1PLLA 3PFIA 3PV0A 4HDCA 4LBZA 2XITA 1E2LA 2VP9A 3A37A 4G5QA 3A1UA 1E9DA 4R7ZA 3H4MA 2IYSA 1E9AA 2REBA 2DR3A 3KKPA 4JL8A 2FSHA 4B3DA 2UZ3A 3C15C 3UIEA 2RKOA 4Z8XA 2CBZA 2J0QA 1OF1A 1QHHB 1W48A 5DHAA 4O2LA 1T0JB 1AS0A 2GBLA 3SC3A 4QBHA 1ZBDA 5CK4A 4LBYA 3BE4A 2OLJA 5H70A 1Z29A 5DI3A 5BYJA 1XPUA 3ND9A 4B33A 2VF7A 1N5JA 2BEJA 3MMPA 4WBSA 4XD7A 5HCNA 3PXGA 4GI7A 1FX0A 1OKKA 2BBTA 1ELOA 3WYGA 4NYIQ 2RGNA 4OK6A 1NJFA 1W4AA 2PZFA 3EZFA 2CMKA 1EWRA 3CZQA 3EC2A 1QBKC 2FFQA 3AVUA 5FFMA 4JLJA 3GLFB 2A5JA 5LPNA 2XXAA 1XMSA 2O0KA 3TW8B 5FBRB 4JMPA 3NDBB 4PHTA 1SVOA 1NSFA 5L3SA 1L4UA 1OV4A 5AWFC 3GLHB 4F92B 1E94E 3ND8A 1N2CE 1PLKA 3KFXA 2J87A 1XXHA 4HAZA 2JLSA 3CX8A 4KU4A 4CEJB 5DYGA 3QF7A 2XGJA 1AZSC 2B8TA 2OXCA 2JGNA 1MO4A 2JATA 3I5XA 3D3QA 3IHWA 3RRNA 2ZVQX 2P6UA 1DO2A 1T9HA 3AF3A 4Q4JB 1OH8A 1IM2A 2GJSA 3LWNA 5B64A 1ZC4A 1XNJA 1R2QA 2WVJA 2WICA 2X19A 4TWZA 4CT4B 1N6OA 3NH6A 3SFZA 1T4GA 1FPMA 1S1CA 5FR2A 1T6NA 1IONA 5KSOA 4B2LA 1W0JA 2ZETA 3MRSA 1SGWA 3RDPA 2H16A 3WNCA 4URYR 4EPTA 2GF0A 1IBRA 1XEFA 2FDCA 1OXXK 2CLSA 2NO1A 1ZNWA 3WHKA 4YXWD 2OAP1 1TNDA 1GKIA 1TUIA 2AR7A 2GCNA 3LO5A 4ZIRA 2GDJA 4HDOB 1CJKC 2P67A 5DLQC 5FUYA 3MUFA 3QIAA 3WRYC 3QPWA 2O8FB 3FMOB 4JZKA 3SHFA 2GAAA 1SXJC 4Q1AA 3TLXA 2YVUA 2GA8A 1W47A 4EQ6B 4XVQA 2QBYA 5SZIA 1E9RA 2ZS9A 4GDFA 2FSFA 3ADBA 1M8PA 3LBIA 4TMZA 4N0DA 4H1VA 3SJZA 1AK2A 3K70C 1UPTA 4JVMA 1XD2B 4B76A 3LBNA 2V55B 1E0AA 1J8YF 1NL3A 1SZPA 2ECKA 5C2JB 1SKQA 3RC3A 1NN3A 1FX0B 2CNWD 3I62A 2YV5A 3BC1A 3UATA 2QMEA 5CK5A 3RNLA 5G53C 3ZGXA 1ZIPA 3A58B 2UZIR 2Q3HA 4C0AC 1BOFA 2G3YA 1DE0A 1HUQA 2A2ZA 2NZJA 3K9LA 1VHTA 4JSTA 3R9IA 2XXAB 4LJ9A 1UJ2A 3IO3A 1WB9A 2IUTA 4CEIB 2EVWX 1RJ9B 2IF0A 3AVVA 1KI7A 2G6BA 2QAJA 3PUZA 4O2RA 4QL3A 3Q3JB 2ZRFA 1NI3A 2V1XA 3CRW1 1ZM3A 3A1WA 3MJHA 4I1VA 5JFGA 1Z63A 2C9CA 1Z83A 4F91B 2JLRA 3TSWA 4KSCA 3RWMB 1VCNA 2VO1A 4M8NE 1M34E 5GJBA 3KQNA 3DM5A 2YZ2A 4TQ9A 1L7VC 3E5HA 1M74A 4HZIA 4ZCMA 1TPZA 4DSUA 1XD8A 4IXNA 2BEKA 3LXRA 4Z51A 4MYTA 3EPLA 2PLRA 2ZRKA 4KYIB 2ZUBA 4Q00A 1SXJA 3AF0A 1RIFA 2FFBA 2R6CA 4LBVA 3ZH9B 2R44A 2GXSA 4DCUA 4MRSA 3T1TA 2AK2A 4UKDA 1OXUA 3HR7A 1H8EA 1TX4B 2IA5A 1NG1A 1VG8A 4NCHA 1TAGA 4EFLA 4LYAA 1GP2A 2IT1A 3WYFA 1U99A 4TL8A 2JA1A 2P3SA 3RYTC 4TYWA 4FMCF 1NVXQ 4QG7A 4RKFA 4C0BA 2WPDA 1HTWA 1RPZA 3WY9A 1UKZA 2LKCA 1M7GA 1CJUC 4B48A 2QBYB 4IDHA 5FTLA 3U61B 4GP7A 4KO8A 1VYTA 2R9VA 4D4KA 2QPAA 1ZRHA 4HB3A 3KXLA 3AVYA 4B43A 4FWIB 4TT3A 4JVNA 4V03A 1KO4A 1IHUA 4D0NA 5JMTA 2PMKA 3MWLA 3THYA 1JPJA 1LY1A 3GFTA 2WMOB 3JVUA 2ZUDA 3ASZA 3T1OA 1AIPA 2BV3A 1G291 1JQJC 1KI6A 1W0KA 4QHYA 3GLIA 3ZQ6A 1J8MF 5GADl 4U00A 2VPPA 2GHIA 2IHYA 4JLBA 3TK1A 3UK6A 2EFDB 2LKDA 4L9WA 4Q7JB 1SVWA 4Q9LA 3GJ5A 1NY5A 1HQCA 1NLYA 4RD2A 3KB1A 2CEAA 3MWYW 2JJ1D 1Z22A 1KK3A 1N25A 2V9PA 4KYUA 4QHTA 3CPHA 1OHHD 4G5GA 1AQYA 2JLVA 1GL9B 3WRXC 1AQUA 3LLUA 1UBCA 1KI2A 3J81k 3T5GA 3W6OA 4L5BA 1Q44A 3NC1C 3U2QA 4B2PA 1FNMA 4RD6A 5FL7A 4NCKA 2QTFA 2H17A 4TN1A 1F5NA 4RFSA 3RS3A 4Z1MA 1LNZA 2HF9A 4UNQA 2W2TA 1TTTA 4LHYA 4M0LA 4LUCA 5BYKA 5JWOA 3TUIC 3RABA 4R2IA 1FMLA 1D5CA 2TMKA 4XTCS 3OE7D 1N0WA 4RD1A 3QEJA 3ZS9A 5FOTA 2DCUA 2FZ4A 2WTUA 2QPTA 5JWRA 4F4IA 4P0TA 4HZUA 1E2DA 1SXJB 2CCJA 2VIIA 3B1XA 5E7MA 2ZS7A 2GEDA 3A36A 4NYJQ 2ZE7A 3I3SR 2WJGA 4AKEA 5JJLA 4UNPA 1GKUB 3VNVA 3NWJA 3K70B 1X8KA 2ZI7A 1XTJA 2GCOA 2GETA 3L8YA 2ZAMA 1IJEA 521PA 4H9GA 2Z5FA 1G5TA 3B9QA 4PHHA 2Z0MA 1YZLA 1N3BA 1V5WA 2C96A 2XZLA 3E2IA 5LDDC 5SZHB 1T3LA 5BQ5A 1FOEB 1VMAA 2A9KA 2O8DA 3A1VA 1WE2A 1OSNA 2W6JA 3W8RA 5B57C 4Z54A 3EC1A 2C98A 1II8B 1WDTA 2ERYA 4LX0A 4EJSC 5LD2C 1BIFA 1GZSA 2RAPA 3TNFA 1RRFA 4FIDA 3T34A 1XPRA 2WIBA 3NBYC 1OLOA 1GWNA 2J0UA 3K0FA 2H5EA 1P61B 2FEOA 2Q6TA 4MRRA 2PX0A 3PEUA 4UNRA 3OFNA 2NGRA 2KB0A 1Z2AA 2WJIA 1QF9A 3TVDA 4DLXA 4CW7A 4HB0A 3L0PA 2V54A 4OBEA 3E70C 1XZQA 1ZM2A 2GZHA 4DCSA 4PC7A 2J0VA 2QSYA 1OJLA 4F93B 2QE7D 2CVHA 1JXOA 1VTKA 3C8UA 1KZ7B 3CW2A 1DAHA 2IHBA 1DG3A 4FCVA 4PPGA 2IL1A 2QU8A 2R2AA 5BN5A 4OHYA 3O8RA 2ZRAA 2CVFA 4GZMA 4GOJA 4CVNA 5FL3A 1OIXA 1Z6XA 2HXYA 3CWZA 3U3MA 4GBMA 1SVSA 2OE2A 3TRFA 4BASA 3GQBA 2PZEA 3BD9A 3CNLA 2D4HA 4WAUA 1G21E 1EG7A 2G1KA 4B44A 3U44B 4AKGA 1ZUIA 2R8RA 1U94A 4KBFA 3PVSA 1EWQA 1EFRD 721PA 3LVQE 1E4VA 1D2EA 1YHNA 4IEIA 3IIKA 4LYJA 5AUQA 2DWQA 4II7A 3KFVA 1R5NA 1W7AA 4UXHA 1P3JA 2X2FA 3THOA 2FGKA 3K09C 1R4AA 1Q1ZA 3AEZA 4Q48A 1G7RA 1CXZA 2E1RA 4M1OA 4C2TA 2V4ZA 2WWHA 3PUXA 2BJVA 3VMFA 4L4UA 1L4YA 4EPXA 2YWHA 3DMNA 4ZDJA 4Q4HB 2WKPA 4ILEA 4EPWA 4DDWA 4K81B 1T3SA 4HUQB 4ARZA 1OFIA 4LHZA 2VQSA 4XJXA 421PA 1DTSA 1OH6A 5BN4A 3GLGB 1J99A 2RMKA 2R6FA 2REXB 2G88A 4WIAA 4MDFA 2JIZA 2W0SA 2EYUA 5EXXA 2IWHA 4DXAA 4Q5IA 1OFUX 4IDNA 3ZQJA 4PANA 5FOXA 3GLFA 3K0AB 4W5HA 2P5SA 3KQHA 3EZ9A 2C77A 4JLAA 1QHSA 1RVDA 1MRSA 4NMMA 5J4VA 4KXFB 4OYHA 2O8BB 2F1HA 5C4MA 1KO5A 2WJYA 4UJ3A 4ACAA 1B0UA 2RGAA 2BMJA 1N6PA 4B3XA 2A5GA 5FPSA 1YZTA 4QGHA 4MQBA 1DADA 4C0HA 5KO2A 3LD9A 4OKSA 5FUWA 5CITA 1F2UB 1NN1A 3KQLA 1RKBA 3H1TA 1GNQA 4I1OA 2WJHA 1IN5A 2P5TB 5JZVA 1A1VA 2JAQA 3ZJYA 2JJ2D 3I8SA 3K9NA 5C4GB 2OM2A 4DZZA 3HPQA 1DPFA 3EIHA 3FHOA 4IXMA 2CHQA 1J7KA 1NVUQ 4FMDF 3NBZC 5D3MB 1HT2E 4NCJA 3UPUA 3SQWA 4NCNA 4V0MA 2GWHA 3MD0A 1MO5A 2BDTA 3KKMA 1ODFA 2D3WA 2CHGA 2GCPA 4MRVA 4Q1CA 2XZOA 3I32A 2O8CB 4YDSA 3B5JA 2XB2A 3DPUA 2CJWA 2ATVA 3HYTA 1E0SA 1T5IA 2ZITA 2H92A 5L8VA 1CRQA 2CLCX 1NN0A 2CL0X 3AF4A 4ITRC 1WCV1 2FFAA 2C99A 5JRJA 4FCTA 1F2TB 1COWD 3U60B 2V1UA 1XTKA 1J70A 1YR6A 4PQFA 4TL6A 3SN6A 2QRZA 3VHLB 1AS3A 3U5ZB 2J7PD 4BLOA 1Z2CA 1ZM9A 4ZCIA 4DSTA 5E7JA 3M6AA 3TSOA 4V0NA 1CKEA 1WRBA 2JJ8A 3Q7QA 1DOAA 2GXUA 4EJSB 4AI6A 3HJNA 5LD2B 4Q19A 4CRWB 2BOVA 2YKGA 2F55A 1Z6AA 4FMBB 4UNSA 3ZS8A 4A0GA 4A15A 4RJLA 2IUSA 2GESA 5CDFA 4NE2A 3REGA 2VYFA 4PSVA 3ECCA 4Q21A 5GJWC 4QNMA 4ZCLA 3AVPA 1K5DA 2VTKA 4B6FA 1ZIOA 5JS8A 1Q1EA 3GJ6A 2GK7A 1TF5A 2QP4A 3BRWD 4JVSB 1PZNA 5H68A 1TF2A 4IW3B 1QZXA 4QC2A 3AUXA 3W5JA 1KMHA 2A3RA 2Z6VA 3KXIA 3HU1A 4ESVA 4KAXA 3P4YA 4GPTA 1XEXB 4LPKA 1YZGA 2IS4A 3QXJA 3FB4A 5E7IA 4RCZA 5CLLA 3TVTA 2D74A 4GOXA 1Z6YA 2MSEB 1ZVQA 5HZKA 4Q18A 5H1YA 2FNAA 1G5PA 1OW3B 2Q9AA 5L3RA 4A0FA 3T06B 2DPXA 1G41A 4C9BA 3KQUA 2GVZC 2GJKA 4A0HA 1E2GA 2QTHA 4LK2A 4Q7MB 1CBUA 4EPRA 3NEYA 4D4JA 5FBQB 3O47A 3KJIA 5DHFA 1W5TA 4BLQA 3VKHA 1UKVY 4NPHA 4TTRA 4JVLA 5KNCA 1JXMA 1EFTA 4TSFD 1R0WA 2GNOA 3REFA 3SJAA 3B9PA 2OV2A 2VP5A 3VAAA 4YMTA 3PEYA 1JJ7A 1XTIA 1XD9A 2FX3A 5GVSA 5JEEA 3BH0A 2P0EA 3TIFA 1KY3A 2HUPA 3AP3A 3QXHA 1NJGA 3K9GA 4JKIA 1QHHA 4LRWA 3AVOA 4PXAA 1OYWA 2OCPA 1S4QA 1JEDA 1G17A 5EXSA 5GJVC 3CH5A 1UFQA 4RD3A 4Q9HA 4L8GA 1BYUA 1AM4D 4MGIR 3VR6A 1W4CA 4FWTA 1CR4A 3D8BA 3QXCA 4DUGD 4JYBA 1SKYB 5AJZA 1OFHA 1T3HA 2EW1A 4BEJA 1P60A 5CM8B 5KDDA 5KTYA 4M1WA 5KUTA 2BHRA 1SXJE 3KKOA 4ZI2A 3OEED 4YQFA 4AC9A 4PFSA
chains in the Genus database with same CATH superfamily
3N7AA 3TW8A 1UBGA 3F3YA 1N0HA 5EKTA 1DRWA 2DETA 2IIPA 2A0FA 3GLHA 2OL4A 5KSPA 4PAQA 3D5QA 4DJ5X 5B7NA 5DOVA 4G86A 1VPWA 2JCSA 4D9HA 1K5GA 1YTUA 4JUCA 3VO2A 1UODA 3LCJA 3M6FA 3LLCA 1UEIA 4C6TB 4CGZA 4OX9Y 3T4EA 1FW6A 5F77A 5AO9A 4M9SA 4F9TA 5JAPA 4GBJA 3CKYA 1MC5A 1XVTA 5NULA 1M2VB 2XMGA 4EM6A 4QYTA 2WQ6A 4JI7B 1ESNA 4Q4JA 4I1PA 1QGUB 1GPWB 1JQAA 3NWEA 4FFOA 5BUQA 2PD6A 5IK2D 1VHDA 1ZGAA 3Q87B 4Y6PA 1G18A 1H9AA 4PZLA 5EE0A 1XKLA 2EYQA 2BF4A 1Y9AA 3EMBA 3S27A 4XWGA 1I0LA 2WG1A 3EFBA 4CMIA 1DT5A 2WHRA 4DC1A 4F8EA 3ZVKA 3EPHA 1SQFA 5JXWA 3FAKA 4GFDA 4AZTA 4QT4A 5LNK6 1PWEA 2I9PA 3HZZA 6GPBA 1U98A 3BMOA 4TV9F 4AM8A 4JL6A 1KPIA 2JZCA 1W9MA 2C1ZA 4FMDB 4ON9A 4IOLA 3RAPR 4NG4A 4XSHA 1HV8A 5E3IA 1PQWA 1UOPA 1NHGA 1SVLA 4I4IA 5B5SA 3PL1A 1UKAA 1VL5A 2C2BA 3EXG1 1DEAA 1TIBA 1ZW1A 3N0RA 4FYMA 1W85A 5BSTA 4WZBE 2DEUA 2YDYA 2O8FA 3DQPA 5I9MA 4DC9A 3THXB 1UBNA 1NXVA 4TMVA 5ES4B 1FNSA 3RIXA 1KFJB 2NO9A 1P9LA 1WQ3A 3ILHA 4B7UA 2HLDD 2A1IA 1Y42X 2BBOA 2GZRA 1D7OA 2WD9A 2Z83A 3F78A 3W04A 4EQ6A 2FW7A 1QTIA 3TKYA 1T10A 4EGFA 3S1LA 5TF0A 1IPFA 2C59A 3QE0A 4Z4HA 2FRXA 2OOKA 2FPMA 2QD1A 3LX5A 4BNUA 2NSDA 1DJPA 2CF6A 2WQZA 3O1HB 1FX1A 2PHZA 3FYCA 1NRIA 1GPYA 3ZCPA 3GO4A 3HYLA 3L1KA 3KVOA 4F11A 1HZZC 1Z5PA 3RKRA 1RYYA 3UW3A 4UEJA 3ZPXA 4ZT7A 3A4VA 4FKMA 4EZIA 2P2NA 1MKYA 3JYLA 4FKZA 1C1XB 4IIJF 2ZU0C 1DC7A 3UEOA 2GLUA 1UCFA 4KNWA 4TKZA 5BWNA 3CNHA 3PNPA 5J5CA 2QLBA 4EYSA 2RAUA 4M88A 1Q2UA 5AVVA 4B45A 4JT9A 1QRTA 3QQ5A 3H2YA 1H42A 3BE6A 3C1TA 5EMMA 2FJPA 1EP1B 1KQOA 2IEAA 3CZMA 2VZ8A 4GE0A 4ZT3A 4BZPA 2JZNA 2QLFA 1RW4A 2QP9X 3FPFA 1H8HD 2QM8A 1K4YA 1VE5A 1D2CA 4NU6A 4P0PB 1Z3IX 2ZKIA 3WIDA 4G01B 3NT4A 4PSAA 2YJ3A 4IQ4A 5HKKA 3O03A 1FDSA 2P6MA 3WBJA 5A5VA 3R74A 3EAFA 4PYJA 3N5CA 2FJUA 3QV2A 3SX2A 1NJSA 1TW3A 1JB1A 1MOSA 3DDZX 3W7BA 1ZAYA 4JI3B 1ZCFA 2QUZA 4R9RA 3QUBA 2B5WA 4ZOAA 1LVUA 3HA7A 2ZB2A 1RQLA 2FN8A 3IQEA 4DTCA 5BUCA 1O0CA 1AZTA 4LBWA 5K0NA 1SUDA 1EPUA 3C7AA 5CFMA 1RXYA 1XUOA 1UC5B 4LF6B 2IHNA 2E18A 2G6TA 3M4YA 4GIBA 5MDHA 1LF5A 4AYTA 1PF7E 2B1GA 1KQNA 5AHRA 1D4ZA 1P44A 3I5YA 4XARA 1CS0A 1P75A 3PHCA 3D6AA 3AHGA 3Q6MA 2Z6UA 4KTVE 3B70A 4UOQA 3IKVA 1XDUA 1KJ9A 1ZBQA 3A1EA 2NO0A 1YZKA 3PC4A 1DCTA 3NTUA 4QOHA 3MTEA 1RU3A 3ESCA 1RP7A 3ET4A 4PIMA 3DZCA 2B5VA 5JJIA 1U8UA 2RHWA 3TLMA 3E9RA 4LGCA 1SQ5A 3QXSA 5MN6A 2Q3MA 4RX1A 3EF3A 4DIEA 4Q02A 1HT0A 4G63A 2VXYA 3H8SA 3SVTA 4Q4AB 4A0SA 4ND1A 2NSHA 3W8NA 5JSYA 3ADDA 3Q7PA 3W5IA 1H0KA 4QOJA 3VNBA 1XA4A 4JL5A 2CFCA 3CLSD 4YP0A 2VCEA 1I0ZA 1H6DA 2Q45A 1YNSA 3VU9B 3FYHA 2E5FA 4P33A 1TYCA 1A98A 1U11A 2VHEA 4RVSA 3AR8A 3WLIA 5CGZA 4GPEA 3LCUA 5KJEA 1T2VA 2DY1A 1U3DA 3H11B 3K6RA 4M9XA 5KS2A 4CM9A 1Z0KA 3I1YA 4EVSA 1FS5A 1C7EA 1RM0A 3K8YA 3BCUA 3QXXA 1Q7EA 2FZWA 3MILA 4BUZA 4RDCA 1UDCA 2RCYA 5DO9A 1PJRA 1W73A 1E3LA 1WZCA 2V5UA 4X91A 1PG2A 4HAVA 5ESWA 1NW9B 3LKZA 1QX3A 1BMDA 2WU3A 1XRLA 4BNKA 2BLNA 4BBZA 1NI4A 1PT7A 3ZTTA 5KX5B 1SPBS 1VL8A 1PEDA 2AGVA 1FQWA 2VSXA 5CYFA 4JUIA 1NXOA 3IXLA 4H7PA 1P1FA 2OT3B 4YA6A 2F1KA 4PGHA 1QTQA 4DYHA 1GTZA 3D6JA 1E96A 4BB0A 4YAUA 1TQDA 1YS9A 5KHAA 2JAOA 4HHEA 1EB9A 1ODTC 3T35A 4PS1A 4NXNB 2G8NA 4BEWA 2PG3A 4LHXA 2BFFB 2GVDC 3IPXA 1Z2EA 4CG2A 4IDFA 1F3OA 5AD1A 4JU9A 4XWAA 5E1OA 2HWKA 2JS7A 4DR7B 3ASVA 1C14A 4H35A 1OI7A 4ZDIA 3R0VA 2GARA 2OLKA 4G0ZA 1B8NA 5KAMA 1ZU4A 1WDKA 3F5QA 2WM3A 4YMIA 3WX0A 4NCXA 5A1TA 4RTMA 2GK4A 1LVGA 3SP1A 3QEAZ 4WTOA 3UHFA 1N75A 1EVJA 1P2UA 2WWFA 4M1KA 4FD2A 3WQQA 3D6HA 1YKSA 3MIZA 2JFBA 2C58A 1CS0B 3WRYA 3TNFA 5EUBA 2SHKA 2FSVA 2A14A 4DN6A 3OQVA 3MC1A 4ZPJA 2O2ZA 3IVRA 3WYDA 4MYUA 2QQEA 3WGLA 3HXQA 2XLBA 3DS8A 1PL8A 1XNQB 5HZHA 2XCQA 3SZOA 1T1IA 3D31A 1UP6A 2IU6A 4LZJA 1GPAA 1U1EA 2LNDA 2O52A 4LMBA 1L5OA 2FXVA 1T2EA 2WFLB 3EIWA 3VO9A 1TU4A 4CKXA 1QLWA 4BDTA 2BBSA 5EINA 4F72A 3EGEA 2JLCA 4MCAA 5A62A 3VDXA 3B51X 3PF8A 3LXXA 4MVJM 3OETA 1JT2A 2HY7A 1G0NA 3PENA 4QICA 4XD7D 4P3KA 4BO1A 1TLLA 4MAAA 1OROA 2JFVA 4RD0A 2H0QA 2BW0A 2ILVA 1QCYA 3PIIA 4V0ME 3ZDDA 1HX7A 3ESXA 1O08A 2PGJA 3IR5A 4PYQA 2NQ2C 2EP7A 3B82A 3Q9SA 4MUGA 4V0SA 3STYA 4K40A 3DB1A 3LFHA 1QR2A 4IJQA 3MMXA 2AXEA 2HADA 2G5CA 4I5IA 1U8CB 4YCSA 3AFHA 4YX9A 4ZVKA 3ETLA 1RAEA 4AS2A 1PHRA 1A5ZA 1ISHA 1PR4A 3GEGA 1K3TA 2NM0A 1E0JA 1BG6A 1EZ1A 4Z53A 1D1TA 3X1ZA 4KQIA 1RWVA 2XB9A 5AJXA 3UWPA 1TJ4A 1ZMOA 4UFPA 1MAHA 1X9HA 5F3RA 1FYWA 3T52A 4CMEA 2XMQA 2JHCA 4RPJA 5E6RB 3CSDA 1T2FA 1Q0ZA 4HWPA 4V2IA 4WMLA 4BYMA 5D87A 1SOVA 4YJ2F 2YWRA 4J2TA 3G6WA 3RARA 1SVMA 2E4VA 4OLBA 4X7BA 4I8IA 2JIMA 5AP9A 1R0CA 2EF0A 2WTMA 3OEHA 1Y3CE 4KLRA 4LYDA 1MT0A 2DPYA 3HWX1 4BU1A 1SKYE 1Z6GA 4XX0B 2DWUA 3I8XA 3WGGA 1U2GC 4EJ6A 4JYAB 1WOYA 2BH9A 3A6FA 3QE2A 1B23P 2AA3A 4QDXA 2Y8EA 3QUTA 2Q5FA 3L7LA 4O5OA 1B2RA 5GM1A 2P68A 3PX3A 4YV2A 3UZUA 2XYHA 2OZKA 1USKA 1UL1X 4HEQA 3H6HA 5ERYA 4AL4A 1WZEA 3SWWA 1JDNA 3HKEA 1A71A 1G2IA 1E9SA 2A5YB 4ZV7A 3PTAA 4Q0MA 1S8NA 2QVLA 3P94A 3BDAA 2PJDA 1CUDA 3B2QA 4Y6SA 3EXFB 4R8LA 2H1SA 1RXUA 1P4JA 5FCDA 4YPOA 2PE5A 4BLPA 1QVWA 2P35A 4M38A 1K1EA 1KP9A 1LS6A 4IFTA 1OZGA 4DSOA 2IXDA 2I29A 2OFPA 1VMIA 3IVCA 1NW6A 5DWDA 3VAZA 2I9KA 2QMZA 3QKRB 4BLUA 4DT1B 3L49A 3TLZA 3RVKA 1VKZA 4Q4HA 3FNIA 3DGEC 2QTVB 2Q5JA 3WLQA 2ZBRA 3IGFA 1NRJB 4HUQA 1PD0A 3UG6A 1XVLA 3G7NA 1TYAE 3HJFA 2VLBA 1X1AA 3CLRD 4PO8A 1AA6A 2HK6A 4AP6A 4OMCA 3CNBA 4TL9A 2XRZA 1Y7TA 3VRHA 5E2IA 5AVYA 4L7VA 1FFWA 2YMMA 3TJZA 3E53A 3G2OA 4KO3S 4EG7A 5AW4A 4H4CA 4E2ZA 2FGJA 5AHWA 1E0KA 3PQ6A 5ADHA 5FWYA 3N6XA 4XQ9A 3VDMA 1U8AA 3GBPA 5EG5A 2EATA 2AJCA 3QYJA 5HILA 2ACWA 2GN9A 3GC6A 3VZRA 5CFLA 3H99A 2H9YA 1M2NA 4EYEA 4IWXA 1XJ0A 2EWMA 3KPUA 3U3KA 1QTNA 4CQMB 4DQUA 3G5TA 3UV3A 3ZCUA 2XJ9A 1UBKS 3FLMA 3A2LA 4LCJA 1T26A 2CJFA 4MRMB 3MTDA 1NUUA 4XFJA 4YQEA 4DVGA 2N1BA 1KYXA 4B6OA 3BXZA 3HFGA 3K9CA 1HSZA 3BL5A 4L51A 5JVDA 3DPSA 4P86A 5J2UA 3P2KA 4NPAA 1IVYA 4MIKA 3BWEA 3PXDA 4C0KA 1GYQA 4PAOA 4MUKA 2B21A 1TK2A 1WULS 2WPNA 4DLTA 3RADC 2B92A 4MGHA 5JPCA 2XCIA 3E3LA 5HOEA 1QCZA 3BTVA 3PWKA 2N1MA 2VVTA 5F1YA 5JCZA 4NI5A 4PW0A 3CC8A 4MKRA 4DMUB 3CKKA 2I55A 1C9YA 3VR5A 2WFAA 4H3KB 3EFOB 5DJ5A 2PJZA 2I4NA 3DBRA 3U37A 1ESMA 3L46A 4LDAA 4RFVA 4X8MA 3QNWA 4LTNA 4TKUA 5DB4A 2IWRA 4PZDA 4QXOA 4NCBA 2JVKA 3DXYA 2JIQA 2ZRGA 2C61A 3I1IA 2YOGA 3TL3A 4OGGA 4AB1A 5CIQA 4CR6A 3EIQA 3NCHA 4AY5A 3G23A 5JLAA 2RHMA 2WB4A 3F5FA 3QLVA 3F5DA 2CL6X 3C3XA 3GOHA 4GT1A 1QGED 2E7ZA 3A1TA 4Q47A 5D84A 5DGIA 1QAMA 5DRYA 3S2YA 4OOFA 4QYXA 2JCBA 3WI7A 1W4LA 2HUNA 3AEKA 1OPXA 2KE5A 2Q0HA 4G4IA 5THKA 4AMBA 4F38A 5LUAA 1C29B 1PN3A 3AF2A 4KPYA 1GZDA 1I4OA 4HUJA 4PRZA 3TOVA 4P98A 2FR8A 2HXSA 1BCSA 1ZD3A 2VNAA 2VS1A 3FUXA 3TW4A 4QTYA 3SS7X 1ADCA 4B3IA 1KRWA 2WPDD 3FD8A 4F2HA 2DLCX 5EZ6B 5H59A 1C8KA 2Z08A 3BFVA 2CZQA 2ZUSA 3L6RA 2YWCA 4AYXA 5CW2A 2V6IA 3E9EA 4WERA 4RVFA 1YBFA 2AN9A 5CVEA 4PXSA 3W2HA 1H0SA 3PGJA 4K88A 5IFLA 4LJSA 2MHCA 3FDZB 4ISBA 3T12A 3ZWQA 2YIJA 3LVFO 4KMMA 5CFNA 4ZMRA 1M73E 4MUHA 4AXXA 5DIFA 5B36A 4OQLA 4UVGA 5AKHA 2R6GA 3VO1A 2RGRA 2W8BA 2ZRCA 4N7JA 3ZWXA 2X0NA 1ORRA 2FAXA 2QTTA 3TQOA 3URKA 1SD5A 1G8YA 1R8SA 4PHFA 1CR6A 2DLDA 2ATEA 3AVQA 4O4IF 1QOPB 4W1SA 4URXR 4Q34A 2ORIA 2HHJA 5LYJA 1HKHA 4I14A 5EWMB 1RPJA 1PZFA 1BN6A 5IJAA 4EYGA 3ZVMA 5K51A 1AKWA 3W2EA 4Y8VA 3DT9A 4K6OA 1RNLA 5AM5A 4ERXA 3P0HA 4HF7A 3VSCA 1Y7HA 3RVSA 3MOGA 2YXLA 4XFKA 5DTJA 4YP5A 1YA8A 4CKWB 1AN9A 1L7MA 2F6RA 3B3GA 3T95A 4F4CA 2PBFA 4RK7A 1YR8A 3M2TA 1P9OA 1PR5A 2OZLB 1KDVA 1YRWA 3VKWA 3L4JA 2G0AA 2WSSA 2NLOA 2IS6A 3P52A 4B7ZA 2IH5A 1SBNE 2WUFA 4GP6A 4BFZA 5BWMA 1HE4A 1EI9A 3T1NA 2ZTMA 1YS7A 3HCDA 1SCAA 2QPOA 3OIDA 1T91A 4TRJA 4NRDA 4DJTA 4QDOA 1XZFA 4J75A 1ZHOA 2PRKA 2H1HA 4NBKA 4BKUA 5FBVB 2SECE 4YJ3F 3ZJUA 3LM8A 1NTOA 3OCCA 4B47A 1QVRA 4KDFA 4R7TA 1JR3A 2JCXA 4Z9BA 1XRSB 3ZNOA 2YJ5A 3AIIA 5BSKA 1DX4A 1RWOA 4KGXA 4Z0PA 1HA3A 1Z4JA 3GK3A 1N9GB 3HFRA 2HQSA 2EFGA 1LPAB 1E5QA 4RSGA 5BSFA 3NNNA 4PG7A 5LZ5A 3ZHZA 2J30A 2PQ0A 2VNJA 5C8XA 5ITSA 3I61A 1SU7A 3QVMA 3KETA 1P5ZB 4Y2SA 2FYTA 3M6VA 4NDZA 4E30A 2HSWA 4ZO7A 1U28C 3HGQA 1QVAA 3R6TA 1N5DA 3CN7A 4ZOLA 5H81A 1CEXA 3B78A 1U7WA 4TVSA 3R3SA 2D5BA 4PR0A 4Z7OB 5ALOA 3MXTA 4G8JA 3G2JA 1EGVB 2ZJ4A 5FL7D 1M6NA 1OX4A 1VKRA 1NA5A 1OFUA 1UXHA 2GJ9A 2H1FA 3DDHA 3UAWA 4BGIA 2W6JD 2QR2A 3DL7A 3KZVA 3R20A 5LBIA 3GMTA 2VFAA 2JH3A 2EFYA 4I1RA 4D99A 4L4ZA 3T9EA 1ULHA 2IPLA 4F04A 4RPIA 1D4AA 2XXJA 4H2DA 3EUAA 4Y0AA 5TV2A 1S2MA 3QFFA 2Y92A 3BIFA 1VL1A 1TPYA 4IBOA 5IPFA 5PGMA 1HWYA 3VPFA 4X65B 3KAPA 2OR3A 3MCTA 4Q9KA 4XIGS 2XCLA 5JANA 1GPMA 2UZAA 3FVWA 4GL4A 4HQLA 3HKBA 5J2TF 3BCSA 3O38A 3SDSA 3D2AA 1J9EA 1P3Y1 1QNLA 2OHGA 4J4TA 3P5BA 4OQMA 3GI1A 2RGCA 1QO0D 2VHXA 5T8KA 3DBIA 4PTZA 3GARA 1BOOA 1VQ1A 4HN4B 1ZEMA 4KOEC 1U2EA 4HWRA 4TXHA 3RC2A 3RM3A 3QM1A 1U3CA 4G8BA 2HCRA 4AURA 3OEWA 2FP3A 2WSIA 5LMUB 2PS9A 3M0EA 3O8NA 3GDHA 1M34B 4NU8X 4FX5A 5CM9C 4ARIA 3RVJA 1TZMA 4IOJA 3CLSC 4UTRA 1YDGA 2WHPA 3LFTA 3OTWA 3ONDA 4QYIA 2AVNA 4ZO4A 5HKBA 5L53A 3HCNA 4YBZA 2JI7A 2QX4A 5ABPA 4Q9DA 2J6HA 3K6SA 3HB1A 3RGWS 2ECFA 3H18A 1G8MA 5IBRA 3FM9A 1RSZA 1X3SA 2BFBA 1UQRA 4J6FA 2CXSA 5CCDA 3D0QA 4QXMA 5FFFA 2HU2A 5EXDA 1KQGA 1GD1O 2Q9BA 3HXOA 3OESA 1QWOA 1W5EA 4P4SA 2MSNA 1N5RA 1X42A 2UZ0A 4G1UC 4K5QA 2QN8A 2ZRNA 3T7RA 4EYOA 5IHPA 4ZJYA 2Z56A 1Z45A 2C9OA 1G8SA 1NQVA 4BWYA 1QZZA 4YMUA 1TU3A 2GQ0A 4XQ0A 5DYTA 1DMSA 3CZ5A 3LUDA 2HZ7A 3IOCA 3LO8A 4L0MA 1CR0A 2PFGA 1R0XA 3VHXB 4CMHA 1XJQA 3CHYA 4PICA 1CJSA 3A6KA 5WRFA 4A1OA 4R0NA 4F2PA 2ZGVA 1WNFA 4WI1A 3VC7A 2M1XA 3LZDA 3OLXA 1PGOA 4M1QA 4BCCA 4EJFA 3DE7X 3G0IA 3BWDD 5KKCA 3COWA 1JNYA 3F97A 5CA1A 3C3CA 3ZD9A 4I4TB 2VF2A 3NAZA 1CQJB 1UZLA 2BTQA 4CM4B 1WXQA 1XRNA 3IAHA 2P9YA 2F7SA 2NZUG 4CIBA 1PS8A 4YCLA 2QN3A 4MW1A 2GN8A 1IBMB 4EI9A 2PH5A 5EE9A 4TRNA 3N2YA 2J33A 3RS5A 4AUKA 2D13A 2JKZA 3EMDA 2TYSB 4XGNA 3D6NB 4J0QA 3R9WA 3ICQB 2YS7A 1TJYA 3HDJA 2WEKA 1FUKA 1UXOA 2EIXA 3R5TA 3CX3A 5KSYA 4C03A 3ZGNA 2CLEB 1T9GS 1SA0B 1UWLA 3BFKA 3Q40A 1SCUB 3G82C 4WVFA 3LHKA 5IUKC 3RLFA 3IC5A 1RLIA 2V96A 1W76A 2XYGA 4L4YA 4RDIA 4UM9D 4U6QA 5FUBA 1RJFA 1XZDA 4IXWA 1X80A 5AM3A 2W6MA 3N2IA 5JMOA 2J4FA 2UYYA 1YONA 3E2MA 3R7WA 7ADHA 1ZDMA 3NLLA 1BH6A 2RK4A 4QU8A 1SWVA 3ANLA 3NT5A 3C74A 5A02A 3CKLA 3V34A 5A1JA 3B1ZA 3QJYA 4L4XA 3FI0A 1P8AA 1NBME 1J2YA 2D06A 2XE8A 2X22A 1AKEA 1MAVA 1O5OA 2GBLC 3K92A 2FOLA 4QA9A 5K3BA 3OI7A 3ZBUA 4RVCA 2D6FA 1XB2A 4J3NA 2HA2A 2CNWA 5JRDS 3SOPA 2BZ0A 3AJEA 3JQAA 1SOMA 1VRVA 4IUCS 4KBYA 1H2HA 4A0QA 4X1YB 5EGSA 5U1PA 2VSQA 4B1FA 5TPZD 2V4UA 4NP6A 2F59A 2JJMA 3SU8A 1G7SA 3HYNA 4MVJE 1G4UR 5A05A 3K30A 3OE4A 3AUYA 1Y5IA 3LL4A 4KITB 1MOPA 3PE4A 2LXNA 2PJRA 4BKMA 2I4MA 3FG9A 1NAIA 3D8NA 4GXRA 3NVMB 2OD2A 4BBPA 1VXRA 2VA9A 2VBIA 3L0IB 4MQ6A 3TL2A 1NVVQ 4FFSA 1Q21A 3ELWA 4IHQA 5FORA 2PVSA 2OHXA 1NFFA 5EZQA 1MQ8B 2GZAA 2VZ9A 3C4JA 4HX9A 4DCMA 3DAYA 5KTPA 5EMNA 4CEHA 4J43A 4QU9A 5HQJA 1UMCA 3WMWA 5BQ3A 2H2HA 1JVBA 1VE7A 2QA5A 5IRCD 2HMTA 1GGMA 4G1FA 4X0EA 5KYUA 2WD7A 1FZTA 4OQXA 3EK2A 2W2LA 2FPWA 2ENWA 1LXCA 1PHPA 2G0NA 3CUTA 3MLBA 3SZUA 2Q3FA 4K6CA 4C78A 4Q24A 2IE0A 4D3FA 3ZHQA 1C4KA 1V11A 3ORQA 3AERB 3G17A 3UJCA 2GCEA 3CB2A 4JC0A 4K6GA 5IZCC 1QCCA 2FEPA 3KL4A 4BNNA 3GT3A 4D9GA 4HNTA 4EATA 4DSAA 1DJNA 2VP6A 5FTMA 5HTKA 3RRJA 2Y1GA 3E7FA 3F6RA 5EJAA 3SIWA 3EQ2A 4QARA 1W36B 3I01M 3G8CA 1B6SA 5L45A 1YKGA 2CE2X 5A5DA 2B4RO 2BR5A 4BLSA 5D6OA 3O90A 2JAXA 4EGQA 3OPVA 4JYPA 4RQTA 2ZJZA 2AE1A 3GJQA 5CBPB 3AOEC 4ROTA 4B6GA 3I73A 4ZRDA 2TS1A 1XKTA 2AHOA 4BFTA 4B3GA 4XUEA 5A4IS 4S3MA 1N6RA 2P4UA 3A3NA 1P5RA 3O7MA 1Z5WA 2ZR0A 5L3QB 2VEDA 1R6DA 2AFIE 4PCAA 4YECA 2YOFA 4UDNA 2BFDA 5T3YA 4C21A 1YACA 2DFLA 5DTIA 1GUBA 3CLRC 3HUUA 3D4NA 4GYKA 3TQHA 1PZEA 4CCAA 4FDMA 5JPIA 1UDWA 4IY1A 3MTAA 5DGXA 5K8UA 1U1GA 1MABA 1QHXA 1P8JA 5HIKA 4EHHA 2BDUA 2CXQA 4DFDA 2HJRA 3LPLA 3EXAA 1FXSA 2WINI 2D2FA 4I9FA 1UADA 5KNCD 3EG5A 1PNVA 3JPWA 3UAGA 1JFVA 5A2GA 3AY6A 5JSZB 3KYCA 2HU5A 4PZAA 2QE6A 3FI9A 4Y67A 3IUBA 1IC6A 4UAGA 5JCJA 2FPIA 1E61A 1HDEA 3IDQA 5LA6F 3RS9A 3THSA 1U0TA 3OFVA 5ALGA 4ZVTA 3RAGA 4QSMA 2FPPA 3RYHA 4BWFB 4TKLA 3VI3B 5KYVA 2FE4A 4OQPA 1YFJA 4DLYA 1B6TA 2F8LA 4BAGA 1Q20A 4BQFA 5JNVA 2IX9A 2O0LA 3CB4A 4RTNA 1WF6A 1AJEA 3HZOA 2ZRLA 2M6RA 1A97A 4PGMA 1VG1A 1ORVA 2P41A 2FUKA 4FFWA 4OB8A 4X1KB 4WADA 4Y6OA 5ER6A 5FTKA 5K0GA 4G4SP 1Y80A 4CEHB 2NTEA 2IP1A 1X8JA 2QZJA 2R5FA 1M1XB 3AY0A 1KAHA 4A8JA 2ZWOA 1VE1A 2JFUA 4J4HA 5DNVA 1Z8DA 1DQPA 1MX3A 3B1JA 3HN2A 2BMDA 4P3YA 1G2PA 2W83A 4W5WA 4JI4B 3QEKA 1UOEA 3PUYA 4BNYA 4NONA 2IGBA 2RHGB 1S8AA 4PG6A 4OTZA 1WXFA 4TYMA 1EXMA 3M49A 4BEBA 3BGIA 4TMWA 1TJPB 2DTXA 4TXJA 4P08A 4DABA 3OE7A 2VT7A 3ASYA 4ANFA 2JFXA 4L5YA 3QSYA 2B98A 2O2JA 3EF0A 1UZNA 2ALJA 2QUAA 4DOMA 4NMLA 3LOPA 1V11B 2YC4C 5I9NA 4KVAA 1NASA 1CZRA 1R0SA 2JJQA 4J7AA 4S2UA 4KPUB 4UTXA 4HGQA 3TRKA 5DNYB 4EB6B 3HKDA 4Z1OA 4M87A 5IM4A 3AM3A 5FUMA 2NWQA 1DSSG 1XR3A 1J9GA 1Z0UA 2O9JA 3G0CA 4JZYA 3DMGA 3AHFA 4UM7A 3N74A 2A5FA 4TXMA 1LGYA 4W7SA 2GEBA 4X20A 2HEIA 3H84A 3S44A 3MOSA 2AI3A 4YP1A 1EFKA 4ER6A 2ZBUA 3K9HA 4BNWA 5JDCA 3JAMA 4NYMQ 3E05A 4GW3A 1A82A 1N7HA 2AQHA 5EJMA 3IUQA 4PBTA 4BFUA 2WSMA 3TRDA 2ZWVA 1B8PA 3BSFA 3TLGB 5I47A 2PX2A 4HCJA 4BGUA 3AWIA 3OM8A 3OOSA 3FVVA 3RBVA 1TIPA 2O8EA 6NULA 2PWAA 4GKJB 3A6PC 1DIAA 2JJYA 1I51A 4IHJB 4P36A 5C9ZA 3R75A 3D54D 3VNQA 2G80A 3HVKA 1AE1A 4CUZA 3D3KA 4AICA 4B31A 1ZHFA 2GD6A 3AQIA 1T6BY 5HDBB 4KXNA 3DLBA 4JA0A 4I3GA 4MI9A 5F12A 3VNRA 1RQPA 3IX7A 1MD9A 1OZHA 4RSHA 1N5IA 2H5IA 2VQDA 1TM7E 3KKZA 1CZOA 1MTOA 3H87A 3NWBA 4G65A 2QV7A 3UUWA 2AW5A 3EIEA 1X0XA 1GIAA 1PFKA 1N6KA 2GEVA 1OT5A 1KKUA 2QM0A 1UQUA 2A0KA 2YJ4A 3A3KA 2O3TA 1FNCA 1WUKS 4L02A 2ZJ2A 4XAQA 3AM1A 2Q6IA 1HE3A 2PEZA 2I4IA 1UMDB 1DC8A 4DMRA 4KXWA 1MFPA 4F9FA 4ZCTA 1O4VA 3I1FA 3LT0A 2DKFA 4KN9S 1L4EA 1M0WA 1RCTE 1ZW6A 4RV9A 2ACEA 2EEZA 5ECDA 4EWLA 2O59A 1T5SA 6AT1A 5DPMA 2C54A 4HB2A 2ZTSA 2Z4RA 4ENWA 4QGAA 5KWEA 3M6IA 1AUPA 2K7FA 3UMRA 3INTA 1ISPA 2V58A 2X3YA 2NU8A 1FSSA 1CQZA 1T15A 1AQLA 3DMHA 1JDVA 3NXSA 5I6DA 1E9BA 3D7KA 3BL8A 4R2KA 5IAOA 1VIYA 1K6EA 4EG3A 2AT1A 4HQNA 2YRXA 2ZYTX 3ZU6A 1BXRA 2L18A 2OZEA 1LLCA 1RYEA 1A3CA 4F4JA 4L73A 5LMCA 3KAJA 4EHDA 4BAUA 4L0DA 1IY0A 1NX6A 2HWWA 4LY3A 4E1VA 5HPYB 1H3FA 5JSQA 3BFXA 1WUTA 3FZYA 1MAAA 1SUEA 4OVKA 4YMVA 4D8UA 2NU6A 1YRYE 1X13A 1YOBA 2F43A 2Y0CA 2G9QA 4GECA 3TI7A 1FP2A 2GCGA 1AZLA 5DNWA 3V7YA 2C7GA 1G42A 1T5DX 2QTLA 5HKKD 5EERA 1ZIYA 4MSUA 5EE1A 1Y48E 2NQTA 1L7OA 3E9ZA 4BVHA 2O50A 2JHGA 3NM6B 4QGSA 1I3NA 1V6SA 3D3EA 4O4JB 3ZX4A 5DW3A 1UFOA 5MN5A 1Y6ZA 4N9WA 5K05A 1P4GA 4OHUA 2F00A 4UJ5A 3ZY5A 1SVNA 2Z30A 2HYDA 3SLRA 4WBNA 1KH1A 4JLKA 2Q5OA 3F46A 3QVXA 3VZBA 4W7IA 5HM6A 4YT2A 3ZVRA 3B3FA 1UT6A 3I4LA 3OBIA 5HIIA 2WSYB 2QLLA 3UHJA 4F1WA 1KJIA 2C3YA 3O3CA 3EQ8A 1B0ZA 2BEVA 2CL7X 2VUTA 3QK7A 1TEVA 2YBEA 1BJKA 1GZ7A 4IDQA 2QZPA 621PA 4HNQA 1JG2A 1GGEA 4L5AA 4O29A 1YJ8A 2CD9A 3CXRA 3L6BA 3EAQA 4KRXA 1YE3A 1UK8A 1WQ1R 4OJTA 4R7GA 1PFGA 2B35A 2ZJOA 2WWXA 1AKQA 3X2SA 5ARDA 5DX1A 1EDOA 4OAPA 5AT1A 2H4XA 2MMGA 3K0CA 2VNHA 1T0BA 1RYMA 1GPBA 2QUJA 5AVKA 2E4YA 2OV6A 4GKVA 4KQ2A 4LVCA 3TSZA 1JHQA 4CJXA 2BN4A 4C1BA 4ZOCA 3GH1A 4F6RB 1MC1A 4IR7A 5KKAA 4O2AB 4D0SA 3QE3A 2QI9C 1XMJA 3KNZA 2AFIA 4QDZA 4UZEA 1RM5A 2XIJA 1KH3A 2YFKA 1NQAO 3MCVA 3ZNPA 4CIWA 3U7FB 2RI0A 5E6SA 4GM1A 4LMRA 2HJGA 3P9RA 1YB4A 1I3OA 4MIYA 4TMKA 1ZNXA 4F3TA 2VPXA 3LY9A 4CKEA 1KI3A 1INLA 4PWYA 4BKQA 3ASUA 1FP7A 4PBRA 3SR0A 3JX9A 3S0JA 3NP7A 1Y8RA 1AK9A 1QVZA 1NOJA 2WAYA 1OLXA 4QQ8A 5DM4A 3QSGA 2CNOA 3Q2IA 4UARA 3LC7O 4U7FA 1PRYA 4UVIA 5AOBA 1A8HA 3S2SA 1GQQA 3UWDA 2IK8A 4MR7A 1AY0A 1NMQA 2F9MA 3F3MA 4LDRA 3HQ4O 4ZPXA 1XEWY 3SMVA 4ND7A 5JTTA 4JK3A 1VCIA 2UAGA 1U1FA 1L3CA 3FLAA 4MX8A 1QDLB 1GGJA 4EW1A 2WA2A 4LXXA 5TT1A 4QXPA 3TLAA 4D6YA 1DKNA 1KWGA 2RG7A 2NXCA 1U0NA 4G09A 1C3JA 1TO6A 1O3YA 3MTBA 5J59A 3GUUA 8AT1A 4D42A 1WP9A 3D4BA 2EERA 3DHWC 3ER6A 4H6PA 5EJ5A 1YU9A 3L82B 1US8A 4UEQA 2OV3A 3ETDA 3WWOA 5A2QA 4FM9A 1R8JA 1SELA 3O1JC 1P6XA 1EFHA 3OWXA 2Y1KA 2ZIXB 2ZSEA 4P32A 5BMVA 1MEEA 3JZDA 2AEJA 3H2GA 4ND2A 4QTZA 5FUVA 1L4FA 3OZDA 2RBKA 2ZSFA 4HP8A 1I5EA 4GS5A 5ESDA 1D2HA 4M54A 3MJVA 4MEJA 4NV1A 4YJFB 3ZW9A 3DE5X 3EHDA 4HYTA 5AHKA 5DMHA 4REOA 1G8FA 1E7MA 4I4LA 4Z9YA 3K70D 2QUKA 3MF4A 2CFOA 5EWJB 4RAQA 2XTJA 4FOSA 2FZVA 4NICA 1NF8A 4O6VA 4WGGA 1EK0A 3EA5A 4CI9A 1V45E 3DMYA 5DNUA 1NKVA 4URVR 4I08A 3G9ZA 5TXGA 4D57A 2O14A 1XHLA 3KJEA 1SOAA 2WYUA 2OCXA 2IOQA 3ZDBA 1GRQA 3OZRA 4S35A 1SIBE 1RACA 3O92A 1G4AE 2P0AA 5KOJB 1E2NA 4OP2A 3DL4A 3GAAA 3EASA 1O0BA 3CUKA 1N2GA 1NBOA 1SWWA 2BKEA 4L74A 4JASB 5TQ0B 3TKAA 2BJWA 4V1CA 4DLWA 2I1QA 1S1MA 1SPXA 3GJ4A 3GUCA 3L6CA 2BC9A 3NHWA 4FGLA 4NZYA 2QMUA 4R9UC 3IP3A 4TV8B 3AF5A 1SBQA 3E22B 1GRRA 1XYVA 2JCVA 1BS9A 2QW1A 2Z8XA 1VSQA 4QASA 3USES 5KHOC 1ZSYA 1TQ6A 3U7RA 2GHTA 3B12A 4FWBA 3WO0A 5AIBA 3TEJA 1HEIA 2ORVA 3NONA 3F6BX 1RDFA 2RKWA 4L6IA 1K08A 2BT4A 2XNKA 1O57A 2YNMA 1U0JA 3O1IC 4YRAA 1YVEI 1NNEA 1KJQA 3DZIA 4GD3Q 1Q0PA 2BD0A 2C8VA 2FW6A 3HO1A 1C5KA 1RWXA 3Q3GE 4EP1A 1VRWA 2H54A 1JS1X 2AKAB 4BNFA 3CX4A 3OEHD 3P9PA 2QLJA 4GF5A 4ESHA 1KPGA 3NB0A 5JFTA 3VH4A 2VHZA 3JSXA 1NZFA 2BFEA 3CG4A 3JTMA 2N46A 4JJ8A 3LPAA 2W4IA 4EF4A 5LQJA 3EUWA 4HAUA 2XTNA 2IXGA 2GM9A 3X1DA 5GTDA 1R8QA 2PNFA 2QY9A 1CUYA 1YRAA 2FPGA 3D8HA 3PFFA 4JT4A 1P33A 1P5HA 1ZCBA 4HWTA 3LZ6A 4MS1A 4W8GA 2J0UB 2V74B 3GVXA 4JI6B 2YUIA 3WDMA 3PRYA 3OEEA 1VI5A 3V1NA 3V7WA 1HPLA 1VC2A 3IEKA 2QEQA 1XMQB 2E0IA 4QFMA 1WS6A 2C2ZA 2GO1A 5DK6A 5JG7A 1CNFA 2B8WA 3D64A 2PGXA 4ALKA 3FZGA 1I4DD 1CW2B 2ZIVB 3H4IA 2CB9A 2W71A 4R40A 4MQEB 1P74A 5C8VA 2WYOA 4H1WA 3ORRA 3GJYA 4IG4A 3E3NA 3U80A 3COZA 1A8QA 2VAWA 4HLCA 4HNGA 3AM4A 3BHJA 3E1KA 4JNKA 5DT9A 4NZPA 2FVXA 3QVLA 4F97A 2DBQA 5BN5B 4M49A 3RTAA 1IM8A 1I9GA 3BT7A 2R4UA 3TPZA 4NOMA 1H4SA 3EARA 2DTEA 1UBOS 2JAHA 2IXTA 1R3DA 4M6WA 1QV9A 3I9FA 4DHEA 4DDTA