1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords HI0065
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
4B6EA 1T5IA 1W46A 4CW7A 5DH9A 4F38A 1J70A 2NPFA 3IO5A 1G8YA 4IDNA 2OAP1 5F9FA 3KTAB 3A1UA 4XIGS 4D26A 3ADDA 2YOFA 2WJVA 4J0QA 3E2IA 2J1LA 4DDTA 1E2PA 2TMKA 3GLIA 4DWJA 2PCJA 4QXAA 4FWTA 1G5PA 3GLFA 4JT4A 4IDQA 4NCIA 1GTVA 1QHXA 1Z63A 2HXSA 3I32A 1CR4A 2BDTA 4ZCMA 2D7DA 1OIXA 2GJKA 2WPDD 3PJRA 4BQSA 2VHTA 1MO5A 1UEJA 1CKEA 3F5FA 4W5JA 4LY6A 2QAGC 4CVNA 3EPLA 3W9YA 4XVQA 3U2QA 4CF7A 2VP2A 2FEOA 5LBIA 2J87A 3GFTA 1XMJA 3LW7A 2FX3A 1CJKC 3RRMA 2QPTA 2ZRBA 2D62A 4P31A 1XP8A 4IEEA 4MH0R 3AKDA 4WZ6A 2PEYA 1XNJA 3AGQA 5CDFE 4WXPA 5HCNA 2WAYA 4KJZA 3HU3A 1FP6A 4TMZA 1KDPA 3SYLA 1OH5A 3FDIA 2ONJA 4AG6A 5B30A 3QPUA 3K9GA 1GKYA 4HUQB 5KU1A 3ZVNA 2F6RA 4C0BA 4KVGA 5DISB 4TLCA 4KFSA 2VP6A 3CONA 5DSZA 1MKYA 2ODBA 4GZMA 2REXB 1AZSC 4URZR 4XTRA 4ERNA 4A1FA 2X2FA 2Q21A 1GZSA 3EXAA 1OIVA 2J0UA 4LJ5A 3RRNA 1R0ZA 3ONWA 3U6KA 4LBYA 4NCNA 2BCGY 4C0SA 2F43B 4YMUA 1CJUC 3D8BA 5H1YA 3V4RA 2ORVA 2IYQA 4NPHA 3GLGA 2CLDX 3U4QA 1C1YA 2N1BA 3BE4A 2O0KA 1UBEA 4QBGB 3V4FA 1DO0A 4KBFA 1HQYE 2FPKA 3U3JA 4M21A 2FH5B 3B1WA 1Q21A 3I5YA 2BWJA 1G19A 2IEYA 2OXCA 2C99A 4L8GA 4WZAE 4JZKA 4M1WA 2H16A 1TNDA 2IBMA 2ZREA 1XU4A 4Q7LA 1W4BA 4EPRA 2LWIA 3THWA 4E22A 4RFSA 1COWA 1N6PA 1II8A 1UM8A 4II7A 4MQBA 3TW4A 1UEIA 2QZ4A 4QC2A 4S35A 4TT3A 3DHWC 2I4IA 3WBJA 4PC2A 1NBMD 4FWIB 4ZI2A 2Z4RA 4Y0AA 3AP2A 5JHHB 3IIKA 2EW1A 3T1OA 1E0KA 4QFMA 4IFBA 1WBDA 5DI3A 3QPVA 4BFSA 2C03A 2MMCA 2WSMA 1Z0FA 1WA5A 2GBLA 3MMPA 3K0FB 3NEYA 3H0KA 4RJLA 4Z54A 3U4QB 1QHSA 2JLSA 1JPNA 2HF9A 1XJQA 3KXIA 4UNQA 3BXZA 2FGKA 4M9SA 1IBRA 3SBEA 2QU8A 1GRRA 1W4RA 1MOZA 3GLHA 4Q9LA 3RLFA 5LDDC 3FFBA 4RD6A 2C96A 4AD8A 1G17A 1X1SA 2ZU0C 3CIOA 1FQJA 3AF0A 4P4SA 5FPYA 2WWGA 1OYYA 4Q9HA 1DS6A 1P9WA 2R2AA 3A4MA 1SXJD 2IW3A 2Z4SA 3WP1B 2O5VA 1G3RA 1G3IA 1U81A 1F5NA 1HYQA 2XTNA 1J99A 3WMGA 1TADA 1NP6A 1F2UA 2GJ8A 1E1QD 3IPYA 1CP2A 5M04A 3D3QA 4PZYA 1HH4A 1UDWA 1W5SA 1W2GA 2ZRMA 4IEIA 4XSGA 3KKPA 1KK0A 3FMOB 5HKKA 2H5EA 4Q21A 1Q3HA 4QBIA 1W1WA 1KDRA 1H8HD 2JLZA 3ADCA 2GA8A 4DLSA 3PEYA 1GIAA 4MDEA 2VHQA 2PT5A 1SHKA 5JWHA 5L3QB 3GJ7A 4G1UC 4HEJA 1K5GA 4PSAA 2IT1A 1CR1A 3ZD7A 2IF2A 1G64A 4O2RA 2DFTA 4HAZA 4C7OB 5IK2A 4GFDA 1AIPA 1NKSA 4TN1A 3KB1A 3AV0B 1E9DA 4AKGA 1XPRA 2P6RA 1FMLA 2IYTA 1EWRA 4LV5B 1NY5A 3K0CC 4EQ6A 5JJLA 5EP4A 4PAOA 3K9HA 4ON9A 2XOKA 1LS6A 1NIJA 4BLSA 2IWRA 4PR0A 2VIIA 1XEFA 1HTWA 3AF2A 4PC6A 2RGEA 2GWHA 4NL4H 4DEXA 3U5ZB 1E96A 4V0ME 4DHEA 4EDHA 3K8YA 4A9AA 4DDUA 3VU9B 1TL7C 1OYWA 4RFVA 2NZ8A 4UXIA 1X1RA 1SXJB 2ZR9A 3HU2A 5DHFA 2F1RA 1VPLA 4LJ8A 2B8TA 2WMOB 4TWZA 2REOA 1E6CA 3A1WA 1ZU5A 4C7OA 5J4YA 5FI0B 1DPFA 1W4CA 3W8NA 5TB5A 1NRJB 3QIAA 2GILA 1RKBA 3HPQA 4PXAA 2QG6A 4FMBB 5LD2C 2YWHA 1GSIA 3MAAC 4NCKA 4Q48A 4ZDJA 4EQ6B 1KJYA 3TGPA 5EE0A 2QT1A 3GLIB 2XXAB 5EXPA 4JSTA 3OIWA 4NYJR 5KPJA 4KITB 1RC8A 1RRGA 3OFNA 1N5JA 4TYPA 4X8HA 3U3KA 3PUXA 3U7GA 1E9FA 3MCAA 4JLPA 5CB6A 4MDFA 1FUKA 2QUZA 1DBSA 2O52A 3ZVMA 4O0MA 4I1OA 2OFOA 1XCPA 4QG7A 2F55A 2C2HA 1JECA 5CJ2A 2ZRCA 3KUCA 4F93B 1ZM3A 1W2HA 4R2HA 5FBQB 1YU9A 4B3CA 5EE3A 3DVLA 1E9CA 1Z0IA 2J7PD 1ZINA 2QE7A 3RVBA 4DSOA 1DARA 5JFGA 2ZRDA 3KUDA 4RD2A 2PMDA 3EZFA 2WICA 3FYHA 4UKDA 5SZIA 4GNKA 1KI6A 2YINC 1B23P 3BS4A 3AF3A 1NF3A 4I1SA 4JLVA 2W6IA 2ORIA 3X1ZA 2RGCA 4HDOB 3LVRE 3IKJA 3WNDA 1W36B 4PQRA 2ZI6A 3O8BA 2JLYA 3A1SA 4JL6A 1EFRD 3QBTA 4Q4AB 4V02A 4WA7A 4BWYA 3M4YA 4MUAA 3FKSA 4WBSA 2RKOA 2R9VA 3BK7A 4JT2A 1JJVA 1BS1A 5GVSA 1E9RA 1GWNA 4YMSA 1J8YF 1NNEA 1Q12A 4FCWA 2FOLA 4EPYA 2QTHA 2WWHA 3B6EA 5TY0A 5C46F 2JEOA 2XX3A 4R9UC 2D3WA 3L82B 2HLDA 3CRMA 2FZ4A 2JASA 3X1XA 1SGWA 3TH5A 2KJQA 1VHTA 2O8FB 4TTRA 2FFQA 2CLCX 2E9SA 3SJBA 4BRWA 2A7QA 3GLIE 1NKTA 3OIVA 1ZNYA 3AVWA 4DLWA 1A4RA 3PEVA 1UKEA 1G20E 5CK5A 3P4XA 5CK4A 5FTNA 1JI0A 2P2LA 4G0NA 4L16A 4QOSA 4MYCA 3THWB 2VPPA 4GOKA 5A4JA 1XF9A 4EIWA 3CPEA 4TQAA 4OK3A 3FVQA 2HT6A 3TQFA 3PQCA 3EIQA 1G7TA 2QEQA 4QNRA 1HE1C 4RZXA 4C2UA 4EFMA 4G5SA 3CR7A 3CRW1 3LO5A 1L2TA 4L5BA 4URYR 1AS3A 2DY1A 5CLQA 4EPTA 2JLUA 3MD0A 3TSWA 2N42A 4TTQA 1P2UA 4GMXA 821PA 2C04A 5DLQC 3S1AB 4CZ2A 5P21A 2OBLA 1RYFA 2QRNA 3AKEA 3GFPA 4MGZR 3ZIAD 2HV8A 4NP6A 2E1RA 3FWYA 4TLDA 4UNPA 2ZEJA 5KYKA 2HYIC 2CEAA 1II9A 1VDZA 2VF8A 4RZUA 3QE0A 5EUQB 1BYIA 1NVVQ 2HCJB 4FN5A 1FX0B 3QXJA 2G9NA 4QJ4A 4GRAA 3WMEA 2NTYC 2ZVPX 4DBLC 2PLRA 1QF9A 1Z22A 1FTNA 1D2NA 2VHJA 2XGJA 4ZO4A 5EP1A 5AJVB 5CYPA 5TXGA 3R8FA 2IXGA 2UZ3A 4ZPXA 4HZUA 2H18A 3U3RA 3RHFA 3QKRA 4CRWB 2UZIR 1GP2A 3K70B 4NZYA 2GK7A 2VYFA 3CWQA 4DSUA 3A4LA 1KO4A 1YZQA 1XJ0A 2EU8A 1ZUHA 3BWDD 3DOEA 4MYTA 4RZ2A 3LLMA 1E1RD 1U0HC 2OESA 3AVXA 4QBHA 3T1QA 5JS7A 4KFTA 3L0OA 1Z0KA 3ZZUA 3OFND 4ASUD 1M8PA 3K9LA 1H8ED 1VG0B 1PUJA 2JIZA 3NC0C 5FL7A 4QM6A 3VNVA 2OFXA 4XD7D 1E2QA 1OIWA 2PH1A 4HATA 4YDSA 2QAJA 3F8TA 3U3OA 1XJCA 1GDDA 2YHSA 5F9HA 3SN6A 3R9XA 1ZIPA 1KSJA 2Q9CA 4LBZA 2ZS7A 3RYTC 5FBWB 4Q9KA 1JJ7A 3TKLA 3TUJC 4BZQA 4D2IA 4E07A 4QJ5A 3TVTA 4TZ6A 1VMAA 1YZLA 4HZUB 3O8CA 2EFHB 1TX4B 1G5RA 2OZEA 1YZTA 3CX7A 2VA8A 1JR3E 1YE8A 2IL1A 1AN0A 3PUVA 4GPTA 4KFRA 2IS6A 1CU1A 2V7QD 4AG5A 2WV9A 5IDVA 3PEWA 1UBGA 2QQEA 1SXJA 4PSKA 2QP9X 1IY2A 1E2IA 2HYDA 1RYHA 2IYSA 2UKDA 3JVUA 5BYKA 4Q1FA 1Y3AA 2ZRJA 4JLDA 1UPTA 4QJ3A 1EG7A 3GJXC 4TLAA 4Z8XA 4QL3A 4HLDA 1RRPA 1ZW6A 4FINA 4OQXA 2WWXA 1SVWA 2KE5A 2KB0A 1CXZA 2RCNA 3TVDA 4GMDA 2V54A 2ZSBA 4G5RA 4M9QA 2XJ9A 3WYAA 1EXMA 2GXAA 4KCGA 3BB4A 1CJVC 1CF4A 3N5CA 3BOSA 3T06B 2OEPA 2Q3FA 3SYNA 1SZPA 5GJVC 3ZH9B 5FUVA 1ONBA 4BRUA 4HAWA 4OK6A 5FI1B 3R7WA 2W2VA 4PO9A 5D3QA 2PT7A 1JEDA 2CHVA 3DPUA 4AYTA 4C0HA 4IVPA 2H7VA 2QSZA 5KTYA 1VCIA 1DAMA 1Z5ZA 1JXMA 1G3MA 4B44A 5FPTA 1ZU4A 2PBRA 1KTVA 2O8EA 4AYWA 4Q47A 1T0JB 2DBYA 3ND9A 2IYUA 2NO6A 2JIZD 2PZGA 5E3HA 4NYIQ 3ECCA 4OHXA 4CYMA 3SOPA 1DE0A 2PJZA 5IF9A 3BIFA 4LI0A 3THXB 4ZDIA 3LX8A 2DR3A 1S2MA 3D31A 2D2FA 5FBLB 2VH5R 2B7BA 4Q02A 4HAVA 1N6OA 1AK2A 1KI8A 1WMSA 1ZNWA 4FIDA 1NI3A 3MGCA 2CLSA 1G3UA 3T34A 2XNDA 3IIMA 4JLNA 2HT1A 4Q9JA 4OQMA 1QZXA 4ARZB 4RZ3A 1ODFA 1Y63A 5D3MA 1E9EA 3KZ1E 4PHGA 4S2EA 2VL7A 3FE2A 1G6OA 4MKFA 4KSBA 4Q9IA 3IIJA 3THYA 4KBGA 2RGNC 4MRPA 2PL3A 2J46A 3CH4B 2OCBA 3N2EA 1E79A 3CRRA 3U7EB 1XZQA 4A0RA 4BLQA 1W5TA 1XPUA 1SHZA 1Z2AA 1DO2A 3VR1A 1G9XA 2EFEB 4V0KA 2G0TA 3LRPA 3CZPA 4DRZA 1RFLA 1ZM4A 4OBEA 2DWOA 2ZSFA 5HKKD 5BN5A 2O8DB 4LYJA 3RS0A 1D9ZA 3UMRA 4LJAA 1YR9A 4B2IA 3NBFA 3ZS9A 2YKGA 4TYWA 1JB1A 2XSZA 4O25A 4TT3D 2IK8A 1XTJA 2W2XA 4XD7A 2ZI7A 1YZKA 5FTMA 4MGKR 5KSZA 1U8AA 1QRAA 4M53A 4TMWA 2QE7D 4Q1CA 4W7SA 1GRNA 3LQQA 4QNMA 2Q3MA 4PC1A 1N3BA 4C4PA 1Q0UA 1UADA 3BH6A 4F91B 1G3QA 4WXRA 1R2QA 4LWZA 4GT1A 1XD8A 2BOVA 3R9IA 1LW7A 1WBBA 4G3XA 3U3MA 2VTKA 1ZD8A 1NL3A 5JZVA 2NZJA 3QG1A 2RGXA 2WWWA 1SKYB 3FHCB 1D2EA 3BERA 4B34A 1A7JA 1N0VC 3L8YA 4X8MA 2AXNA 1X3SA 1E2JA 3KX2A 3WBKA 4ZIRB 3EZ6A 3SJAA 1GFIA 4A0HA 3LY5A 1KGDA 2QMHA 3VR3A 4Q4HA 2CHQA 1FX0A 3CZQA 5A5GA 4HLUA 3FPAA 5JRJA 4UJ3A 4JLBA 1ZUIA 1KAOA 5DYGA 5J4VA 1DAHA 1RW4A 1TEVA 4XJXA 1GRQA 1XD2B 1W36D 4P32A 1KSHA 5AUOB 1SVLA 1M7GA 3AVUA 1E4VA 3V00A 3UXMA 3KQHA 4Q03A 4I81A 5DN6D 1YJ5A 4IOJA 1BIFA 4OL0A 1OT3A 2Z43A 2ZE5A 1E9SA 4TMXA 2C8VA 2V6IA 3IHWA 4NYMR 3G0HA 4PFSA 1P5ZB 3OE7D 1DG1G 1E2EA 2JAQA 4P3YA 3GLFB 2WPDA 3QBVA 4ZV4A 2AKYA 3HPRA 2IS4A 1KO5A 1T9HA 1AQUA 3ZQJA 1OHHD 2PMKA 3QKTA 3GEHA 2AN9A 3A37A 4N3NA 5BN3A 1HURA 2ZE7A 1KI4A 1E2MA 3RC3A 2JLQA 3NC1C 4N1AA 3C8UA 2F9MA 2OFWA 3TK1A 4PZLA 2DCUA 3H1TA 4PX9A 4RD1A 5A0FA 3C14C 4BLOA 5FTLA 2VHCA 2QM8A 1GL7A 2JJ2A 3KQLA 1JR3A 2F9LA 1N5IA 4MGIR 4BFUA 1EK0A 4DCTA 3EPJA 3N70A 4A36A 5JBQA 4JLKA 4P0TA 1IONA 4YXWA 3RRZA 4MKHA 4WOPA 3B1YA 3I3SR 3IQWA 5DIFA 4EJSB 1TEXA 2C78A 2YV5A 1GILA 3RC8A 4RKEA 1E2GA 4B3GA 4LYFA 4TL6A 4D4MA 3LX5A 4PPNA 4RKFA 1Z8FA 3T15A 3GLFE 4DCUA 3OEHA 3I8XA 1GKIA 3RS4A 3U44B 2JLVA 3LLUA 4NYMQ 5B2ZA 1OFIA 1L7VC 3CLVA 1R0WA 1ZIOA 2A2ZA 3LXXA 4EJSC 4Q4JB 1G7RA 5FUXA 5KNDA 4KLNA 4DLYA 3GFOA 1N5KA 4F7WA 2W2TA 5GJCA 1XMVA 5FTKA 5UKDA 1FOEB 1H8EA 5FR1A 4YMWA 2OCPA 2ZJBA 1PLLA 4H1UA 5GADl 1ZCBA 1SVKA 3NH9A 3VX4A 3EAQA 4DLRA 1GNRA 4KU4A 3KKMA 4CEJB 1Z0DA 2YZ2A 2QGNA 3UG7A 4IOLA 4BFZA 3U60B 3PG5A 2JATA 2QBYB 1E69A 5EXXA 1Q57A 2P6UA 4TL7A 3B78A 3OIYA 5DNYB 2O8EB 1NVXQ 2OAQ1 1YVDA 1CTQA 2F1IA 5JMTA 1Z47A 1UKYA 2F7SA 1OJLA 2C9CA 3C15C 3P32A 4HB4A 4IW3B 1VG1A 4KYIB 1P61B 1EX7A 1Z28A 2ORWA 4HLCA 3U61B 1OB5A 3U44A 3L8ZA 3N2IA 4Z1MA 5AUNB 3THXA 2XNSA 1NJFA 1PLKA 4YXWD 2GCPA 4W9MC 2ZYUX 4BE7B 1X8JA 2GJAA 2B21A 4HB3A 1E0JA 1FQKA 1TPZA 1SVSA 4US0R 4LV6A 2BV3A 4HAXA 5F2EA 2AWNA 4Q7MB 1EFRA 4YLGA 1KK2A 3TBKA 3GLGE 2P5SA 2G83A 4PPFA 4FMCB 3WNBA 4HYYA 1F6BA 3QVVA 5B64A 4CEIB 2OXRA 4DB2A 4LUCA 4NYIR 3LQRA 3LFUA 1OFHA 3W5IA 1R6BX 2NO9A 3A8TA 1KHTA 4NONA 4EPWA 4V0MA 1GAJA 2FFHA 4JIMA 2QP4A 3QENA 4OJQA 1S3GA 5J4HA 1BH2A 5E7IA 4C0LA 1UF9A 4EUNA 1KIMA 2QSYA 5SZHB 3IPXA 3HJNA 5L3VA 1T3SA 1NMXA 4RD4A 3CRQA 1KI2A 2ZE8A 3ZGXA 4F4IA 2ATXA 1AS2A 2AL7A 1NY6A 4IDPA 4DT1B 3A58B 5CDFA 3TIFA 2R6CA 3UMSA 1E32A 2W00A 3KDSE 4B3DA 2XAUA 1IN5A 3E5HA 2FN4A 4C2TA 2RB4A 2WWFA 3ZYCA 2GKSA 2V1XA 3IILA 1XTSA 2HDNB 3TAHA 4B32A 5JHGB 2KSQA 3F3YA 3DEFA 1UFQA 1Z0AA 1KI7A 3ZZ0A 3IQXA 3SJZA 2DFNA 3UK6A 1G6HA 5B58C 5JSZB 2FMXA 2VP4A 2R62A 3H84A 3PEUA 5L3SB 1UJ2A 4I1VA 1LV7A 1LTQA 1AGRA 2ODWA 2E87A 2FFAA 1N6LA 4JSYA 3OAAD 1XDBA 1LF5A 3JZMA 2KBEA 4B2PA 1I4DD 2QT0A 2WIAA 3K70C 4D6PA 4LHYA 3UG6A 3K0AA 1KK3A 3DO6A 2P3SA 3AF4A 4DUGD 4DDVA 4HDCA 3AH8A 4IHQA 3CF0A 3LVQE 4QHYA 3AB3A 4MGYR 5KOYA 1V5WA 1ELOA 1G291 1HA3A 1MO4A 3BFKA 4I1UA 3Q5DA 2O0JA 2XTZA 3CNLA 3LA6A 5FR2A 3VHLB 2NOAA 4D4LA 2DFLA 4DVGA 1P2VA 3JZAA 2LKDA 2DB3A 1RIFA 3RS5A 3T12A 1E1RA 1D2MA 2QY9A 2VHUA 1DTSA 2WKQA 2R6FA 4LX0A 4NU0A 4PAMA 3TUZC 3SFVA 4M1YA 1IAQA 3P27A 3ZDQA 1XWIA 1UKZA 1OFUX 3HWSA 1GITA 3P20A 2DPXA 4V03A 1C9KA 3EIHA 2ZXUA 1OV4A 1DAKA 1OXSC 3MFYA 1AKEA 5JJKA 3PUWA 1E4YA 3A6PC 4OQLA 2QM7A 4KO8A 2CXXA 4MRRA 2X1VA 1FPMA 4RY2A 3MRSA 5JI3E 1KNQA 1TU3A 5C18A 3MJHA 3GLGB 4FMCF 4DCSA 2GXUA 3TQCA 1R5NA 3UWOA 4TYYA 3C5CA 2IUSA 3EC2A 4L9WA 3VR4A 4AKIA 1ZP6A 1ZD9A 2QAGA 2WJHA 1ZC4A 2ZR7A 5FTJA 1U0JA 3NBZC 1XEXB 1ZYUA 2IYLD 5AUPB 4PHTA 3WYFA 2CL0X 2GAOA 3KJEA 2IF0A 2IS2A 4PSVA 3NBXX 1ZVQA 4XH9B 4ESVA 5EJEA 2ERYA 3GJ3A 3NBYC 5CIQA 2ASEA 3GCGA 4NHOA 2H8KA 2Q9BA 2BKUA 4TQ9A 3AKYA 5LPNA 2ZYTX 5EQTA 2HLDD 2FG5A 2FA9A 5G53C 4MA4A 1G8FA 4H1VA 2OBMA 5DI3B 2WSSD 4NH0A 3RS2A 2IYRA 4QBFA 3HP1A 1ZC3A 1P9NA 5EUMA 4WVFA 1AKYA 1HV8A 1G7SA 2FGJA 5AUQA 4N0EA 3RWMB 1D9XA 3SU8A 3QXCA 2QAGB 2EWVA 1W48A 5FPHA 5KDLA 3KQKA 3GLHB 4DEYA 1TAGA 1F48A 1W49A 1PJRA 1P6XA 3QQ5A 2CCJA 5L3RA 1M7BA 2IHBA 1W0KD 3P1JA 4B35A 1CRPA 2PZEA 1KK1A 1EFTA 4IOKA 2YC4C 1E2DA 1EFCA 2EYQA 2NO7A 1KNXA 1MR3F 3VFDA 1T4GA 2ZS8A 4ZDKA 3W6PA 4TTPA 1J8MF 2F1HA 2GAAA 3QXSA 3Q7QA 1N6NA 4CGZA 4JL5A 3QEJA 2PZFA 1DOAA 2BBTA 1GG2A 1E0AA 3Q7PA 2GZHA 4TYNA 4Q1DA 3SJCA 1MT0A 5IT5A 2FWRA 1Z6GA 2ZANA 3X1WA 3CX8A 2GHIA 3AM1A 2FSHA 4XVRA 4CEIA 1KZ7B 1KJZA 2ZJOA 1TQ4A 3IDQA 3AEZA 3CKLA 5J47A 1ESNA 1OF1A 2BBWA 3B1VA 3L0PA 4MKIA 1Q3TA 3VR5A 1ZJ6A 3EA5A 4A0GA 1QHHB 3DL0A 2ATVA 1XFAA 1FP7A 3GJ4A 4FMDB 3SS8A 1P2TA 3NHAA 1M2OB 1N6HA 2HEIA 5G41A 2QTVB 1XMSA 2ZI9A 1IN6A 3B8HA 4FMDF 4TSFD 2CDNA 2CJWB 1CR0A 2H57A 3HDTA 2WHXA 1WP9A 3DZDA 2WWYA 1US8B 4C3ZA 3JVVA 1QVRA 5HR5A 1XMIA 1E98A 1YR7A 2MSCB 2EWWA 2JJ1D 5SZKB 4PANA 5KDOA 2YYZA 4BEBA 2R6AA 4L9SA 1OH8A 4Q01A 1IOZA 1N2CE 3FB4A 3W6NA 1HT1E 1S1CA 2WVJA 4Q1BA 4YMTA 3EPHA 1XD9A 2D74A 1D5CA 3WHKA 2MSEB 4C9BA 2XOKD 3NWJA 1Z07A 5JS8A 2XZOA 3L2OB 3FHOA 1A5TA 1E2FA 1SXJC 2D06A 2VRWA 1T0HB 2F3RA 3EA0A 1KAGA 3MWYW 3B1ZA 3O47A 2J9RA 5C1BA 2ZTSA 2I1QA 2IYXA 1VYTA 3FTQA 2JLRA 1FMJA 4JVNA 2CJWA 1NLYA 3PITA 4C0QC 1IN4A 1TQDA 3PENA 5EXTA 3W6OA 3K0AB 2K5UA 4TMVA 4BEJA 3ICQB 4HI0E 1YR8A 3FHTA 4QGGA 3EZ2A 2AX4A 4GP6A 4HSEA 1XPOA 3CPJB 1Z6AA 5B57C 1NVWQ 1E1QA 2QP3A 2J5XA 2CNWD 3K70D 1OB2A 1N0WA 4B6FA 2ZVQX 4YQFA 4DB4A 2OT3B 5BW8A 3WYGA 2GBLC 3KJIA 4A6XA 2VBCA 2O8CA 2XNDD 3R9WA 1NLFA 1KKMA 3QKUA 3CH5A 1SVOA 2ZRPA 5C2JB 1NSTA 3KFXA 5FFMA 1JQLB 3I72A 5AK0A 4LC0A 2VEDA 4PPGA 4E09A 2ZAMA 2WWIA 2JLXA 2AHOA 4B3FX 1LS1A 3VMFA 2ZU6A 1DG3A 2AKAB 2NIPA 2G0NA 3IUYA 4UNRA 2ZSDA 4URWR 1PLJA 1P9RA 3FKQA 3PR1A 2KWIA 1NBME 3QNUA 3KQNA 1MRNA 3ASZA 1VG8A 2QA5A 2H1LA 4Q4AA 3FOZA 1OHHA 1EX6A 2ZROA 4CEHB 2GESA 4D0LB 2J3EA 3CBQA 5KO2A 3LH5A 4XWAA 4R2IA 1OH7A 1JPJA 3AF1A 2PLFA 2VP5A 4HLQB 2GCOA 1X6VA 2O8CB 3K09A 1G21E 1IJFA 2QPAA 2AXPA 1O87A 2OLJA 3X2SA 4BFVA 4AKHA 3TRFA 2QMOA 1QHNA 1NMYA 1TTTA 3GQBA 3GEIA 2O8BA 1M6NA 3LAWA 4BPBA 3KJHA 4US2R 2O0HA 3AP3A 3EARA 1TMKA 5FH9A 1E2LA 2ZJAA 1YHNA 3TLXA 2AK2A 4CT4B 4HLUC 1Z6XA 1GL9B 2A5FA 5IRCD 5KSYA 4AYXA 4GDFA 2XZPA 3MUFA 2V55B 4GZLA 1HQCA 3FMIA 2FE4A 3GMTA 3LBIA 3PIRA 3I5XA 4OQFA 4FD2A 4NE2A 4LC1A 3UIEA 1BOFA 2GK6A 3I61A 3MSXA 4CEHA 2IYVA 4KV9A 1G16A 2W58A 5D3MB 2QMEA 1WRBA 1LVGA 4Q18A 4JVLA 4MYUA 4XTCS 2GCOB 2QROA 4LJ6A 5HCIA 1W36C 4LCBA 3THYB 2HF8A 1QHYA 4LDJA 1KMHB 4YONB 5FPKA 1P75A 5AR1A 4M1KA 4NMMA 3CWZA 2I1VB 3RRYA 1UAAA 1MRSA 1RRFA 4Q00A 4TSFA 1ESMA 2CHGA 3IBYA 3QF4A 4GBMA 5DN6A 4ACBA 3MWLA 3WY9A 3NXSA 2BMEA 2QTFA 3D7MA 3EC1A 2CE7A 8OHMA 2ZRKA 4O2LA 5K8LA 4G5OA 4LPSA 1GKUB 1CULC 2WJYA 3A1TA 1JAIA 3QI2A 1S9DA 2B7CA 4YC7A 2ZETA 1Z6TA 3A4NA 4DIDA 3BB1A 5ANRB 2GETA 2A30A 2W0MA 3TR0A 1N0UA 1JAHA 2PX3A 1VCNA 2OLKA 1U94A 2YOGA 4ITRC 5G3ZA 1COWD 2ZQ5A 3CW2A 1KI9A 2CCGA 4Q4LA 2CVHA 3IO3A 4UNNA 1KO1A 4PO8A 2L0XA 3KTAA 1NVVR 1T5LA 3WHLA 4KLZA 4PO1A 3Q85A 4IKEA 3LWNA 4A2QA 4EAQA 2JDID 3GJ8A 4D4JA 1NJGA 4DLZA 1JXOA 2RHMA 1EFHA 3W8RA 1VCOA 4AI6A 3LW8A 4QHSA 1BMFD 3G82C 2NO1A 1OE0A 2OUKA 3HR8A 5AJYA 2GXQA 1K8RA 3QOFA 2EFGA 3OZXA 2W6ID 4ACAA 3ADBA 3EW9A 4DSNA 4E5UA 2IWHA 2AR7A 2ZM5A 3I1FA 4JLAA 2OILA 2WBLC 5HPYB 1VECA 1CLUA 1P73A 5CM8B 1OFTA 2F1JA 5J4LA 2QI9C 5EE9A 3T61A 1FZQA 1P62B 2A5YB 2BBOA 4RSGA 2ODNA 4ZCIA 4BGDA 1LY1A 3U7FB 2ZRGA 4B71A 1AGPA 2V6JA 4DJTA 1GUAA 4A6PA 1TUEA 3AGPA 1XTIA 3W34A 2GDJA 4IXMA 5IK2D 1L8QA 5E4FA 1DAGA 3K0CA 3PXGA 1US8A 2GJ9A 1IM2A 4JBYA 4B48A 1S9HA 1OXVA 1UKVY 1TQ6A 4W5HA 1X86B 3AVYA 4ZKEA 1KOFA 1H8HA 2FV8A 3RWOA 2FPMA 1G8PA 1S0UA 1L4YA 1KYIA 4DIEA 1XXHE 1YR6A 1AS0A 4QM7A 2CL7X 3W5JA 5GJWC 5KDDA 4UJ5A 4A4DA 2J45A 4ILEA 1FNNA 1ZM9A 4URVR 1DAEA 3CM0A 4LJYA 2BCJQ 5J5CA 1JR3D 4GOXA 4IOMA 4B3XA 1GM5A 2J7PA 5BYJA 3M0EA 1M7HA 2AD1A 3EZ7A 4DCVA 4OKSA 1M34E 2Q9AA 221PA 3R7WB 2PEZA 2BMFA 2V4ZA 5HTKA 2HXYA 4BLPA 5CM9C 1DELA 3B85A 2BMJA 5BWMA 2JLWA 1SQ5A 2A9KA 3QY0A 2WOOA 2D2EA 4HUTA 4Q5IA 1ZCAA 2P5TB 1LFDB 4RFSB 4V0OA 1NN5A 5EZ6B 2WIBA 1VCMA 3ZVLA 2A5DA 2EYUA 3K0SA 1XX6A 3I92A 4PHHA 2NGRA 3T1VA 3BFXA 1R0XA 1DEKA 3AUYA 1GOTA 2BEJA 2FEMA 2BHRA 4LZZA 2VP0A 1PV4A 4BFWA 1PUIA 1FL9A 2WKPA 4OQNA 1XBTA 4Q4JA 5E95A 2OE2A 1T3LA 1SVIA 3ZS8A 1E9AA 3ICEA 2R8RA 3CF6R 3F0TA 2DHRA 4DLTA 3AVTA 3RNLA 4M2LA 3LXRA 4L4UA 3EASA 2OCYC 1OXUA 3O8DA 1A1VA 3RSOA 3TMKA 1Z2CA 1G1MA 2PX0A 4NCHA 4MUBA 2FFBA 2G1JA 1R5OA 2G1KA 3ASYA 3OF5A 5ELXA 2NG1A 1SKQA 2D7CA 4ARZA 2B8WA 4P4SB 1Z06A 1YRAA 5JRZA 3PUYA 4OI1A 3H4MA 3IHLA 3TR5A 5G3YA 2GEUA 1YZUA 3IEUA 2C9YA 4JKIA 1W0KA 1MV5A 4A15A 4AY2A 5JWOA 2A3RA 2V7QA 2P67A 3BRWD 4IDHA 5G40A 4XSHA 5H8WA 4A0FA 1H65A 1HEIA 2VSXA 2WJGA 1XTKA 1WE2A 4IDOA 4JLMA 2C95A 4LV8B 2D4HA 3VX3A 4LGMA 2JDIA 2OSBA 4M1OA 3DZ8A 3NG1A 2RGNA 5AWFC 4UNSA 5L3QA 3EIEA 3SNHA 2BIFA 5GVRA 1MH1A 2NPIA 3GEEA 1CEEA 1GVNB 4URUR 1GL6A 3VR6A 3CR8A 1ZRHA 1RPZA 1NG9A 2IS1A 2ECKA 4OHYA 3DM5A 1F3OA 4PHFA 4FW9A 1P7CA 1JNYA 4DXAA 1G4AE 3QF7A 1XCGB 2GXSA 4PPQA 4CIDA 5CLLA 2RGAA 3UPUA 3K1JA 4DKXA 2FDCA 4X8OA 4U7DA 1IXZA 1QHGA 1XRJA 2ZS9A 3WRXC 1B0UA 1KDOA 3M6AA 4BLRA 5JCPA 4JJKA 1HE8B 3QF4B 2GTPA 3IBGA 4LHXA 2RAPA 5GJBA 5FBVB 4OI4A 3QVUA 3TUIC 3L0IB 4OHZA 1NN3A 1NVUQ 5LB2A 2EFCB 3VU9A 1XZPA 4DT1A 3EPKA 1IXSB 4D0GA 2GNOA 5KSPA 2AD5A 3AQ4A 4KI0A 3RS3A 1T6NA 3B60A 4XWKA 3Q5EA 3ZD6A 1O3YA 3VKHA 3PVSA 2W0SA 4M0LA 2LKCA 3GP8A 4GI7A 3SZRA 2ZAOA 1S3SA 1TUIA 2ZRNA 5FPSA 3VNUA 1MABA 1Q22A 2Z6VA 3BC1A 2BEKA 3PFIA 2YWFA 3GLHE 4UQOA 2ZUBA 2ZSAA 1DADA 2ZIAA 2P65A 2ZITA 3B82A 3CX6A 3EZ9A 1Q1ZA 1Z6YA 3CRVA 5DI9A 5K8UA 2BBSA 2BKEA 2ZI4A 3A36A 5K8IA 2DWQA 2VO1A 3QPWA 3ADKA 4HUQA 4WAUA 4D0NA 5L3SA 4BASA 4DSTA 1R7RA 3SFZA 2CMKA 1C4OA 1IJEA 5AJXA 5AJWA 1QDEA 5E7JA 3NDBB 1ZMXA 1E9BA 3Q9LA 2C98A 3OEEA 2JCSA 3LBNA 2J0SA 1ZM7A 1ZBDA 1TU4A 1WDTA 5FOVA 1AZTA 2X19A 5FUWA 1NN0A 5EP2A 4DC9A 2QL6A 2FF7A 2IA5A 3PV0A 4MRSA 3FGNA 4ABYA 1AQYA 3T1TA 1OXTA 3DKVA 1U0LA 2G3YA 2ZRFA 2F43A 4Q7JB 4ESHA 4M9ZA 2NO0A 2ANCA 3TE6A 2Y8EA 2HUPA 3K0EA 1E2KA 2XTMA 3M1IA 1KJWA 4CT5A 1E2HA 1IY1A 3DMNA 5EZ5A 4KHZA 5CYOA 3IEVA 2JA1A 1Z3IX 1KKLA 3WRYC 4NYJQ 1N6KA 5FL7D 3SC3A 2WAXA 2IUUA 3DKPA 4NKRA 2GZDA 2JJ1A 2WSSA 3NH6A 4WIAA 2AFHE 4LHVA 4JLJA 1KO8A 4HB0A 2Z5FA 1OKKA 2GJSA 2CVFA 4HAUA 1U9IA 2Q3HA 4EJSA 1E0SA 3TSOA 3MJRA 4GSYA 3SDZA 3T5GA 2CCKA 4Z51A 1P60A 4C0AC 2ODEA 3EX7C 1G5TA 4MYHA 5CJPA 5CB8A 3X1DA 4XVUA 1TF7A 3ND8A 4OJKA 1T3HA 1NMZA 1ZNXA 2XITA 1L4UA 1G18A 4B75A 1OLOA 3TNFA 3E1SA 1S4QA 1PVOA 1NBMA 2J0QA 1W47A 4PC7A 2ZR0A 3TW8B 2VLIA 4N0DA 3B5JA 3WXMA 1I2DA 4MKGA 1K5DA 2YVUA 5F98A 2JJ2D 2J59A 4Q66C 1RVDA 3Q3JB 2IC5A 2GVDC 3H2YA 3BD9A 2H17A 1N6IA 4A2WA 2O8FA 2ZJ8A 3MLEA 1S96A 1KDTA 4IXNA 2YWEA 2G77B 2WM9B 1XEXA 3TAUA 4M9XA 1KO7A 1XTQA 3PUZA 3QUSA 4LK2A 1KSGA 4C30A 4PTLA 2N46A 2QGZA 4FXPA 2B6HA 2ZSEA 2XZLA 2GEVA 3NIBA 5C4GB 1Q1EA 4K46A 4BZPA 3VR2A 1YZGA 4RD3A 5TV2A 4BZXA 1VYUA 3QSYA 1LB1B 2X8AA 2CK3D 4DUGA 3I62A 2IYYA 2R6GA 4C0KA 2FSGA 2YNMA 4R71A 1LNZA 3GJ0A 5BQ5A 1R10A 2GVZC 3WMFA 3BH0A 4DDWA 1G4UR 1I4TD 3ZVRA 3SYKA 2IXEA 2BMDA 4O3MA 4F92B 4M8NE 4TL8A 3KQUA 4URXR 3DMDA 4B3BA 1IN7A 4Q7KA 4U00A 5HE9A 3C41J 4MRVA 1FNMA 4QGAA 1I4LD 2P6NA 1XCMA 5FOUA 2AFIE 2BC9A 3UATA 2Q0HA 2YC2C 2MMGA 2MSDB 3AVVA 5CIWA 3AKCA 2ZI3A 4AIIA 3U6BA 3BJIC 1W0JD 3KJGA 1OKKD 3W3ZB 4QKQA 3RS7A 1VKJA 5EXSA 3LD9A 4YDHB 2BM0A 5DE3A 1S1MA 3ZJYA 3EWSA 3QKRB 3K09C 5KSOA 4K8OA 2OHFA 5HZHA 3CNOA 5CITA 4B2LA 3P4YA 1Q1BA 5FL3A 4MRNA 4U5XA 1EESA 1JBKA 4LBVA 3GPLA 1F60A 4LHZA 4LRWA 3R8CA 3CO5A 2RGBA 3QKSA 4XOIA 1WCV1 2JJ8A 3BH7A 2JGNA 3AVQA 4JMPA 5FOSA 1LF0A 1NG1A 3AP1A 2VF7A 3K53A 2V3CC 4BFYA 2J7KA 1MO3A 2V1UA 2VSOA 3P26A 1DAIA 2WZQA 5TVKA 3HYRA 1QVAA 1JEEA 1QG4A 4ZDWA 4GOJA 1ZNZA 3W3AA 5DGXA 2BJWA 4ZI3A 2HJGA 2ZI5A 3BORA 621PA 1W7AA 4LYAA 3BFVA 5DHAA 4ZKDA 5JECA 1U9IC 4A92A 1QHHA 1QG2A 2XB4A 5LB4A 4Z8YA 3SQWA 2FSFA 4OK5A 5JSZA 1TQ2A 4LHWA 1A82A 1W44A 1ZM2A 2XXAA 1VHLA 2C5LA 3AUXA 2XSZD 4WW0A 3U7HB 1KI1A 2SHKA 4POAA 1IN8A 3THOA 1UBCA 2ZUDA 2RHDA 2ANBA 1NN1A 1W4AA 5EE1A 4HAYA 5FOWA 2ERXA 5SZJA 4XWOA 4JVSB 2OCAA 1ETUA 3EWAA 4IRUB 4IVQA 4NCJA 3L0SA 1K6MA 4TL9A 4TMKA 4B73A 4R98A 4W5WA 4LJ4A 4QGFA 721PA 4TZ0A 1CIPA 5JCZA 4A82A 1VIAA 3RAPR 1MABB 1U99A 3B7GA 1FTSA 5J40A 4LOAA 3NHBA 4FCTA 2ZRLA 5FBRB 2ZYWX 4C0JA 4JYBA 4EFLA 1PZNA 1T91A 4LBWA 1F2TB 2W83A 2KI5A 5TMPA 4UXHA 3MWJA 1W0JA 1E3MA 4TYQA 521PA 1KI6B 4MITA 1R0YA 4JJZA 1QBKC 4KODA 4V0LA 3UWKA 3B9PA 2ZPTX 4P33A 1ANKA 3WNCA 1KI3A 3FFAA 4JBWA 1D8TA 2DWPA 2RGDA 3B1XA 4FCVA 1NSFA 1II0A 3HR7A 1N25A 4B47A 4RCYA 3LV8A 5H70A 1T8TA 2OV2A 4LPKA 1S8FA 5TDHA 2WMNB 4K81B 1JALA 2BM1A 2R65A 1A2KC 3T5DA 3UKDA 2A5GA 4X8LA 4JVMA 3FKSD 1KMQA 1UDXA 1DVRA 2ZYVX 2QENA 3LDAA 1WF3A 4OI2A 4TLBA 1ZAKA 1VYVA 2CK3A 2AK3A 2F3TA 4QGHA 2GRJA 4M4SA 1SVMA 4I99A 2IUTA 2A78A 1F2TA 2ZE6A 1E94E 2IYZA 3D6TB 1RJ9A 2YJTD 5HE8A 2RGGA 4M1MA 3O8RA 3HYTA 4DLUA 5KUTA 1R8SA 3L43A 4JKYA 1U2RA 2X77A 3NVAA 4KFUA 1WB9A 1N6RA 3C7KA 2WKRA 3OE7A 4KYUA 3CUEF 2R44A 1BYUA 3KFVA 5KNBA 2XEXA 2BJVA 3EG5A 3I73A 3ETLA 4JBXA 3AVPA 4F4JA 2OM2A 4JLOA 4Q1EA 3DOFA 1Z83A 3KKOA 4D80A 3R20A 3VQTA 3BBPA 5C4MA 3S1AA 2ZUCA 2CBZA 4G5QA 1UBFA 2ZJ5A 6Q21A 1RJ9B 2QN6A 5DO9A 3OIUA 1EWQA 4OHVA 4M22A 4LSGA 1IXRC 3RABA 2QORA 3KL4A 1XEWY 3BGWA 1HT2E 3H86A 4CDGA 2WTUA 5KHOC 3FMFA 2O8DA 5FOXA 1CRQA 3LBHA 3SR0A 1YRBA 1IQPA 3I8SA 4D25A 2OBNA 4LYHA 1NIPA 2V9PA 1N5LA 3G5UA 3QEOA 4AK9A 2ZRHA 3ZLJA 2V8OA 1XB2A 4AKEA 5JLJA 4UXJA 1GNQA 2YOHA 1OW3B 4B43A 5BXQC 2XB2A 3NEJA 5J4KA 2REBA 1R8QA 2R6DA 4V0NA 4EPXA 3HU1A 2IX3A 2RH5A 4PQFA 4KSCA 5L8VA 4DLXA 5TARA 1TF5A 5JWRA 1OSNA 3QXHA 2QRZA 2ONKA 4OI0A 3DM9B 3A1VA 4TMTA 1T8UA 4GL2A 1CJMA 1J90A 2VQSA 4PC3A 4Q4HB 4B76A 1P2SA 4DLVA 1P3JA 1EGAA 2GCNA 3J81k 3OESA 3SHWA 4L15A 1TF2A 3TSZA 4R7ZA 1AJEA 4FI3C 4YMVA 1U90A 1Q20A 4M1TA 1Q1QA 4NBSA 2WJJA 1FUUA 1EFUA 1G8GA 2XJ4A 3SQXA 4HDQB 5JJIA 3BAFA 1M74A 1CR2A 2ZRIA 3NKVA 1G41A 2W6JA 1Z29A 1DAFA 2ZJ2A 4I4LA 4D81A 2W6JD 4EKDA 5FOTA 4AURA 1RZ3A 4DCNA 2B92A 4Z1MD 1FFHA 1AA9A 1ZUNB 3KB2A 3QKSB 3C4JA 1BMFA 3UANA 3UMFA 1BKDR 5JEDA 5LD2B 1OH6A 1U8ZA 4Y0VA 2A5JA 2FPLA 2IXFA 3DDCA 3QXXA 2IYWA 1J2JA 1E2NA 3ZZTA 1YKSA 4QHTA 4TQUS 3GJ6A 3PCRB 2WOJA 2HJVA 1XTRA 2HCBA 2IEZA 2QMUA 4JS0A 5EP3A 1E79D 5K8TA 4NTZA 1FW6A 1I2MA 2J0UB 4IJMA 4PAQA 3GJ5A 3I4LA 4A8JC 2PCLA 3B9QA 1YQTA 4IFEA 3OEHD 3AVOA 4IVRA 4OHWA 3SEAA 2NMVA 2YWGA 3NTUA 1AM4D 1D6JA 5BN4A 4JL8A 4P4TA 1Q44A 2LCFA 4BUJA 4A8JB 1CS4C 3T35A 4AC9A 1RE0A 2AWOA 4RVCA 3C5HA 4KAXA 2KBFA 3X1YA 1J7KA 2J41A 2RMKA 3NDPA 4BECA 3Q8XB 3VHXA 4HZIA 4DZZA 2QPOA 2VP9A 3CB4A 1XEWX 4WZBE 1II8B 4RCZA 3TJZA 2BVNA 1BO6A 1XXHB 2FSIA 2J0VA 3MG9A 1Z08A 5DYIA 2PJRA 2X2EA 2CE2X 4GP7A 1SXJE 3IGFA 421PA 5HZKA 4M1SA 3REGA 2CL6X 4LJ9A 2Z83A 2FNAA 3W90A 1ZD1A 2EVWX 4D4KA 3ZQ6A 4A8JA 1VIYA 3K0FA 4B74A 1HY3A 3RSLA 3K9NA 3SE0A 3SI7A 3OHMA 1RRCA 1CBUA 3BB3A 2GZAA 2ZJZA 3ZIAA 4AWXA 5H68A 3QJYA 2EFDB 1YZNA 3SHFA 5IHPA 4CEJA 1GNPA 4G01B 4QRHA 3KKNA 1P72A 2QBYA 2DFKB 3OAAA 3VKGA 2FZLA 1SULA 2IHYA 3RANA 4A2PA 4B33A 3C16C 1HUQA 3V9PA 3VTKA 3GD7A 1XXHA 1U98A 1G7CA 3KXLA 2G6BA 4BFXA 1OXXK 1JQJC 1IHUA 4D82A 1F2UB 4BFTA 5JI2E 4G5GA 2O8BB 1Z0JA 4HB2A 4H9GA 3KXKA 4P4UA 3VKWA 1IY0A 3KKQA 2P0EA 5AJZA 2C9OA 2FU5C 5F3WB 4KXFB 2OG2A 5JEEA 1X8LA 2OO7A 1MO6A 5E7MA 1JR6A 3B2EA 1R4AA 2ZJYA 2Q6TA 4TLEA 2DYKA 2GEDA 4JYCA 4PZZA 2WJIA 3CPHA 4BLTA 1U8YA 4ASUA 1CJTC 5KPDA 2GF9A 4US1R 5KNCA 4EPVA 3Q72A 1X8KA 3REFA 1VTKA 1KMHA 1KSFX 1OPXA 1KZGB 5FUYA 2FJUA 2Z0MA 4LJ7A 3VAAA 4F4CA 4Q1AA 2QNRA 1QHIA 121PA 4U02A 2H92A 3QG5A 3RDPA 1WQ1R 2NQ2C 1WXQA 3E70C 2C77A 3FMPB 1M1YE 1SKYE 2CNWA 4ZIRA 5EE5B 3MWKA 2EQBA 2UVQA 3CF2A 4PQYA 3SBDA 1G8HA 4EFNA 3LNCA 4RD0A 2G88A 1NLZA 1VG9B 3WP0A 4ZCLA 2I3BA 4OYHA 2VSFA 2QQ0A 4NDZA 1V43A 1P4SA 1KY2A 3CNNA 1XD2A 4Q19A 2ZRAA 1E99A 2GF0A 3OEED 3B13B 1KY3A 4KVAA 1R5BA 4E03A 1A2BA
chains in the Genus database with same CATH superfamily
1PR3A 1RPNA 2D54A 2VTBA 3O03A 3A27A 1W46A 4MOWA 2WU4A 4B6EA 1SC4A 4XX1A 4CMEC 4F38A 1U0EA 1W88B 3KD2A 4MWSA 4CFSA 5KBYA 2X1HA 1U8EA 4LFCB 3DW1X 4YNBA 5LP1A 3ADDA 1EQUA 5JY1A 2WJVA 3FYDA 2BFBB 2JCBA 3FPSA 2LV8A 1E2PA 1N3YA 1KR5A 1OFVA 2PCJA 4KUGA 3KYCA 3DT9A 1Z2NX 3KPWA 4JT4A 4E5MA 2X1LA 1Q7EA 4LI3X 4E4TA 3DR5A 2HXSA 4L22A 1AZLA 1RAEA 3I32A 2ZLBA 5BR7A 3ZGOA 5AESA 1T9CA 1BMQA 4DKJA 3MTGA 4XCQA 1B93A 1CLEA 1OIXA 1ZOPA 2WPDD 2JFFA 2VXCA 3N7TA 1JHMA 4BQSA 1MO5A 3F5FA 1TI7A 1TJ5A 4LY6A 4P5PA 4W5JA 5K6AA 4D45A 5C5EA 3ZY2A 2FEOA 5LBIA 2F64A 2HF2A 3GFTA 4JGIA 1XZBA 2FX3A 4DA8A 2YZKA 1DV1A 2QPTA 5AI9A 1U2DC 4ZTBA 1C8KA 1O03A 1XP8A 3AKDA 2P2DA 3WWYA 1FNCA 1XNJA 2PEYA 3FZQA 1U0NA 4JB3A 2NU8A 3UWPA 3IVCA 4MCIA 4FK8A 4WXPA 5HCNA 3LHKA 5BSRA 5KU7A 2D2VA 4TMZA 4F9GA 3H2BA 3FDIA 3ZGNA 1OH5A 3H99A 4ZYTA 5BN1A 2FZCA 3CN7A 4GM1A 1JBQA 1GKYA 2EERA 4HH1A 1OZFA 2KLBA 1EX9A 4HUQB 2P9ZA 3VPFA 1HX7A 2F6RA 4LYGA 4BTEA 3G0DA 4HGNA 4RX1A 3UICA 1I7LA 3CONA 3FUCA 4J7XA 4OQDA 1QIEA 5DSZA 5JW6A 3ZWYA 2DWUA 2P9TA 1M5UA 3L1JA 1PFVA 5H80A 4JY7A 4URZR 1C0LA 3UBMA 3AXSA 3BA6A 3TQSA 2OSVA 1V11A 1CS0A 1E7QA 2Q21A 3QNMA 1GZSA 4RPJA 2KPOA 1TM3E 1HOXA 3N2GA 3EXAA 1W6UA 1OIVA 2CDCA 3V4VB 4LJ5A 4N3GA 4PG7A 3RRNA 2NVBA 4REMA 2H11A 4FB4A 1QUFA 4G9GA 4NCNA 2BCGY 3MJTA 4QUEA 3CUSA 1UBRS 4OF4A 1KQGA 2M1ZA 3DKKA 1FNSA 5BMVB 3H1GA 2XYGA 3GLGA 2IYQA 3MVEA 5AI0A 2CLDX 2NTEA 2ECQA 3N2ZB 3U4QA 1C1YA 3WB1A 2XUDA 5KYUA 2KW5A 3ZXUB 2J9FB 3AO0B 3TZEA 4PBSA 4REQB 4BVBA 3WOHA 1P6UA 1YC2A 2X8BA 3B1WA 1UPBA 2P8SA 3AU9A 2P40A 3BYZA 4WFQA 1M6WA 3H1BA 2ZTVA 2H16A 5DM0A 1XU4A 3EYAA 1W4BA 1TJYA 3IDFA 3HCDA 1Z2EA 2GNAA 3NWPA 4E22A 4ZGGA 4KW7A 2W43A 2ZBVA 1UM8A 3RADC 4HFNA 1OXKB 2GTIA 3L7MA 4OEHA 4Z53A 2YJ4A 1FUYB 2VKTA 4HDSA 1N2OA 1DJQA 1U5AA 3NZEA 2WP8J 1IJBA 3M4JA 4XR4A 5TGZA 4C4OA 4ZI2A 2DTXA 2R79A 5SY6A 4EGSA 5A1JA 3T1OA 1MJHA 4CHGA 2EKQA 1UC8A 1D7OA 1OBFO 3ZHQA 4BFSA 5BSEA 1WBDA 1VPWA 2MMCA 2Q0QA 1U0FA 5TQ0B 2AEEA 2I34A 3DMGA 3K0FB 1J23A 3H5OA 5WRFA 1AVTA 3WJ2A 3EUWA 1GXSB 1RQGA 1XJQA 2OY0A 3KXIA 5BOVA 4XRRA 1T25A 3AOGA 3BXZA 4BEVA 2FGKA 4M9SA 5AVKA 5KJFA 4MVJP 3G85A 3LE8A 3C45A 5K51A 2B1QA 1GN9A 3WMWA 2QDXA 3J7AC 4Q0MA 4BL5A 3OZBA 3FPBA 2BLNA 5LDDC 1D04A 1AKNA 1E1YA 1G17A 1X1SA 2BGRA 2VPQA 3E6AA 3AF0A 1E3WB 3BWMA 4TXNA 4COKA 1B74A 2E3JA 3NETA 2R2AA 3A4MA 3HVHA 5DCUA 1SXJD 5T4FA 3VR3D 4F2WA 2O5VA 5ER6A 7AT1A 4AS3A 3DOHA 1P39A 1G3IA 2UZ1B 4H15A 2H1WA 1RYBA 2NZWA 2XTNA 4CMJA 5LNK6 4EYQA 1M76A 3I30X 1NP6A 4KX5A 4B4WA 1E1QD 4Z9YA 2CMGA 4YREA 1HG1A 2GAIA 2H48A 3C6KA 5JXJA 2JFXA 3HKBA 1HH4A 1VA5A 2ZRMA 4IEIA 3DXXA 1PJ2A 2HA7A 3FWHA 4KUEA 4XSGA 5ITZA 3QGMA 4BXOA 3PNPA 4IPTA 1CQPA 4L9AA 4D5EA 1KK0A 3FMOB 4MVJA 4YJGA 3QU9A 3RV4A 2OXIA 1Q3HA 4JWTA 5BV7A 3WWZA 2IPNA 3N7AA 3EFOB 5ESDA 5DTRA 3BK1A 3PEYA 2VHQA 1C9NA 1SHKA 1Q15A 2QXUA 3CBGA 2NU9B 4WFKA 5HYVA 1R4MA 1K5GA 2X58A 2QG9A 5A4MS 4ZQFA 4YO7A 1DEXA 1VJTA 5CLHA 4O4JF 4C7XA 4TKVA 1SB8A 3BK2A 4ETNA 1VXRA 4F5DA 5CX1B 2EF0A 4XJSA 1VHJA 3N0XA 2L69A 1V9LA 3L6RA 3MELA 1A8UA 1XRNA 4KQHA 1TRKA 2YZMA 1XPRA 4EG6A 3NORA 1W34A 4MQEB 1JDTA 2I6UA 3FBTA 3L6BA 4EQ6A 4ON9A 2XOKA 3CGGA 3STYA 1NIJA 2XYRA 3HG7A 1XEFA 3CEPB 3CZ9A 1YQWA 2CJXA 1U11A 2I3DA 5ALRA 3AF2A 4IHKA 4JUBA 2GWHA 5TMBA 3B52X 2WWYA 4A0SA 1GLGA 3GRRA 4DHEA 3FJOA 1YB2A 3BDIA 3F5DA 4A9AA 4DDUA 3VU9B 1A5BB 2H3HA 1O94D 5K0ZA 3CR3C 4WUVA 1L8XA 1U3TA 1V1JA 4CKZA 2MDTA 2W2KB 3T5CA 4OM8A 1E7RA 2YIMA 4H0CA 1VM6A 3WGZA 2Z08A 3GCXA 3EQ9A 2OGTA 3LCJA 3L9XA 1DX9A 1MEOA 2MINB 4JP5A 4EYSA 5J4YA 3TRKA 4C7OA 3GQVA 3BMCB 3LCMA 1IPEA 5TB5A 5TRTA 1NRJB 3WL3A 1TVCA 4F2PA 4WZAA 4EHKA 3IQHX 2X4IA 5LD2C 3UV3A 1GSIA 1SPBS 3MAAC 2HJSA 2PZLA 1OTXA 1XVIA 2NU7B 4O4LB 3L0CA 1YJQA 2Q1SA 2YHUA 3TGPA 3RVNA 5EE0A 2YIDA 2CUTA 3OQJA 2QT1A 4MA5A 3K1AB 4PIMA 3U0VA 2XXAB 2B20A 1EHIA 1A1SA 3ZD8A 2EC5A 2PL9A 3OIWA 4NYJR 1CDDA 2FQWA 1H5NA 2FWPA 4FI3F 4BQNA 3F8SA 3U7GA 3A6JA 4MDFA 2XXBA 3PA6A 3PPXA 1AC5A 1LQUA 1DBSA 2QUZA 2AFRA 1KH3A 2O52A 1XVUA 1Q0TA 1DXQA 2ES4A 1MFPA 2E55A 4YS6A 3ED5A 5ELMA 2B2XA 3LRTA 1U0BB 2AF3C 1V1RB 2ZRCA 1PZFA 1FCJA 3KUCA 4ZP1A 1S2LA 1ZM3A 2REQA 2VF4X 4MVJG 2WP0A 3E23A 1JHUA 4R5HA 4E30A 3VSCA 5IPFA 1CNFA 5FBQB 2HWWA 3W5BA 2HADA 1NV9A 2GM3A 3HR4A 5HKLA 4B0PA 5EE3A 4BNVA 3AZPA 3ANLA 1X2BA 1VYHA 1E9CA 4JB0A 5IULC 2QVXX 2QE7A 3ZU5A 1USVA 4DR6B 1J9GA 3RG8A 4RD2A 1JH8A 1FU7A 5E1DA 2WICA 4DJDC 4MP8A 3ANYB 4C89A 1DGQA 4FFBA 4UKDA 5E38A 1T43A 5D6NA 3H18A 4BU0A 1CY7A 2IH4A 1O5OA 3MCUA 3UYLA 4XR9A 2BEUA 5AVJA 3X1ZA 1M33A 3OQMA 1DC4A 4ZO8A 5IFKA 2GEBA 3MT0A 1HNNA 2ZI6A 5A9SB 3CXRA 1RI5A 2VP3A 1U7XA 2XVYA 4P22A 4AU1A 1GZ5A 1AY0A 5AKIA 3BWVA 2JLYA 2PZKA 4Q4AB 4LVOA 3HVRA 4V02A 4TTJA 2QQGA 1XZMA 2MOKA 2RKOA 2R9VA 1RSZA 5IABA 4RE6A 2BGLA 2CVOA 1JPUA 2HBZA 4GLLA 4TTSA 4D98A 1JKMA 1J97A 1TYBE 4BYGA 1W5BA 1J8YF 1JDUA 1Q12A 2A6PA 2ZAGA 1BFKA 3D81A 2B6NA 3PDIB 4I3HA 3ESZA 2QTHA 1Z88A 2I71A 3D3WA 3IKMB 5COAA 2XX3A 3ETEA 2I6TA 2HLDA 2JFWA 4ZVRA 4A2CA 2FZ4A 1ZH4A 1LBTA 3LRXA 3X1XA 3ANXA 3P2YA 4DGSA 5ICGA 3O21A 3VNQA 3U19A 1I0LA 1OX6A 2VZ8A 3L18A 1ZD5A 3F6PA 3OIVA 2M32A 4ZOQI 5G0SA 2GPBA 4UC0A 3PEVA 1G20E 1QYDA 4F45A 1JI0A 5CFQA 1YUMA 4PYKA 4DIKA 5A4JA 4TRJA 1U6KA 4RQAA 4LG1A 1Z7WA 3CPEA 4TQAA 5DW3A 1TAHA 4C4ZA 2Q27A 2QEQA 3G2PA 4G5SA 1XZDA 3JQ6A 2XGOA 5JC8A 5LNK1 3I9OA 2GPWA 4QQFA 4L5BA 4URYR 5CLQA 5DM60 4CKXA 1PWYE 4QU9A 2JLUA 1KXZA 3TZHA 3UCEA 1BMDA 3VDQA 3D4BA 4GI2A 3LC7O 4DCPA 1FRNA 1S02A 3EBPA 1P2UA 1VI2A 2ZBFA 3IP5A 4RADA 1CUAA 2PS9A 4TTQA 5DLQC 2WKSA 1YVUA 2P2SA 3DCYA 1DDGA 3S1AB 5P21A 4R2JA 2J9GA 1RYFA 4PG4A 3GFPA 1ZGHA 4UHKA 4UTXA 2HV8A 1M1YA 3NLLA 4JAVC 1UPUA 3DPIA 3FWYA 3NO4A 4JC0A 3F74A 2EP7A 3IV6A 1L1QA 1KIAA 2CEAA 3GARA 4Z4CA 5BNZA 2P2CA 1VDZA 2HQRA 3G79A 3GK3A 3KL2A 2QMQA 2LNDA 3ML1A 3R6LA 4KYTA 4MVJH 4QA9A 2Y1FA 1NVVQ 2HCJB 3HCBA 3HLYA 2QE6A 3HDQA 1I6WA 2JA2A 3VOBA 2JGDA 7MHTA 4AICA 1IZ7A 3GIWA 1KDVA 3EUFA 1IEWA 4OSPA 4ZO4A 3ZDEA 4P98A 3DJFA 2O9JA 3PNKA 1X80A 1JVBA 3DZCA 2IXGA 3B6ZA 4ZPXA 4HZUA 1S4MA 4I55F 2OORA 3TO5A 2UZIR 4DC1A 3TE7A 2NAPA 1TVKA 3CWQA 2WC1A 4BXOB 1F1BA 3BWDD 1ULTA 4P08A 3N5KA 1D09A 1U0HC 1UZLA 4GLBA 3AG5A 2VZ9A 4M6WB 3R7LA 3U26A 1Z45A 1MW9X 2IKQA 2GF2A 5A6VA 1JJFA 3PGA1 1T3GA 2C3OA 1WBJB 2R7MA 1GZ3A 1WXDA 1M8PA 3DGEC 4IEFB 4OV6B 3Q3CA 4IX9A 1RRMA 4NJEB 3BT7A 3O8QA 3UWSA 5I47A 3BWYA 3I04A 1OIWA 4HATA 2EEZA 4HNQA 4I19A 3A2LA 2HMUA 2MTBA 3GEGA 1SRQA 2FWNA 1RYDA 2G5PA 2R5NA 4ZYZA 5JVDF 1EJ2A 1ULAA 1ZIPA 1KSJA 3RYTC 3TKLA 4K9PA 3TUJC 4E07A 3KUXA 1R6VA 3UJAA 2D2XA 3C3KA 1BD4A 3OMWA 3P52A 4MV4A 2HY7A 3P9XA 4DMLA 3M7IA 2WIDA 5A7GA 3DF7A 5E0OA 3N0VA 3G5LA 5DIZA 2OZEA 2J09A 2YN2A 3H1AA 3CX7A 4DR7B 5CPFA 2WAMA 5ILGA 4FE3A 4QTTB 4OU5A 2Q1TA 4KFRA 2V7QD 3NALA 3PEWA 2WV9A 5HUQA 1RYZA 2WW8A 2Q3LA 3LG2A 5LZ7A 1DCKA 2MYPA 3K05A 4PSKA 1F9EA 1RYHA 3NUQA 2UKDA 4UDYX 1DKPA 4D46A 2NVUA 3VYRB 1GAQA 4Q3AA 1A8SA 2GPTA 3PWTA 2EFJA 4ENSA 1KYXA 1X1BA 3OEWA 4WINA 3UUWA 2VK8A 1P7ZA 2ZYSA 3OSUA 4UAVA 3TZ6A 5E3JA 2N0SA 2GPNA 4M87A 1PD1A 4HLDA 4ZEOA 1K4KA 2YTZA 1QE0A 1J4AA 3OCVA 3WLTA 1SVWA 5A4AA 2KE5A 3BE8A 1OX4A 2RCNA 4NMHA 5E4TA 5EIOA 5FBKA 3ORHA 3JQ7B 2P2NA 2XJ9A 5BN4B 4MB6A 1WP4A 4JXZA 1CF4A 1QONA 4FYMA 3T06B 3SYNA 2C83A 1XAHA 3AEXA 1L5QA 5FUVA 2ZSIA 3E3MA 2VKQA 3GC6A 4MRAA 1B43A 2VYVD 2XUGA 4U2DA 1V6SA 4BP1A 4RTKA 5JFOA 2OHVA 3FN4A 3JYQA 3JD1A 5D3QA 4L4SA 4BGVA 2HA0A 3MGKA 3BQNB 4V3CA 3TG8A 2CHVA 1N8KA 1O1YA 3DR3A 4AYTA 4CKWB 1I1OA 1W4ZA 4ZJZA 5EYPB 4RHUA 4YFYA 1Z5ZA 3X0DA 1JXMA 1L5MA 2BGWA 2BFDB 3VH1A 1HFEL 1DUVG 3L01A 3OP4A 3PHHA 3U3ZA 1VC2A 3LFHA 3NHLA 1KTVA 4HX5A 1ZAYA 4G0OA 2H4JA 1RADA 4TPKA 4KKXB 3RG2A 3ORFA 3ND9A 5AJTA 3PFCA 2NO6A 4RNCA 4RBNA 5H7XA 1ORDA 4GNRA 2HK9A 1YB1A 4L6AA 3R3VA 4RO0A 3QRWA 1AUPA 4I6JA 4AJNA 4CYMA 3THXB 2UUAB 4LI0A 4D9MA 5HXAA 1Y42X 2YIVX 3OHSX 5AW4A 3EVEA 5ISMA 3WJ1A 2Q2OA 5MFPA 1QGED 3AHEA 3KOYA 3UCFA 3NUGA 1BN7A 1AQ6A 2VBGA 5PGMA 3LC1O 2Q4RA 3DZIA 4O63O 5CA0F 4Q3LA 1KJIA 1N6OA 1AK2A 4FKBA 2J31A 5K3BA 1WMSA 5FWXA 3BGIA 3A2KA 1D1PA 3CEAA 3T34A 2AJLI 4BGUA 4EY5A 5F1KA 2O3JA 4JLNA 1O96A 1HT0A 2G4LA 4TLMB 2GZMA 3DB1A 2VJMB 3UYKA 4QPDA 4EKYA 1C80A 5B2FA 1P74A 2CYCA 3EMVA 1E9EA 4MPPA 3UK7A 1NR7A 1C30A 1BE0A 2VL7A 4PHGA 3STHA 4XGRA 2BMVA 1JKXA 3TTSA 4C6SA 3UOWA 3HP4A 1NW7A 4GL4A 5LA6F 1JHXA 2X0EA 1VQ1A 3THYA 2BMAA 3ISTA 4MRPA 3SAJA 2OCBA 4A73A 3N2EA 4R2WA 4LNUB 2I4RA 4NMXB 1W5TA 1SHZA 1THZA 1Z2AA 4I4NA 4IJVA 3EYWA 2EFEB 3I52A 2P6OA 2V6FA 4B9EA 3ZOZA 1RFLA 1ZM4A 1BC5A 4YN3A 2JBWA 5DCYA 4BLUA 1Y8RA 4QGBA 5JD6A 4RGQA 3UMRA 4LJAA 3RVSA 1H05A 4B2IA 3MJDA 4ERXA 2KMLA 3BG5A 1T0PA 2XSZA 4O25A 3D0QA 4TT3D 4DJ5X 2C07A 2YYAA 4MUHA 5HM8A 4EG4A 1AKQA 1PCXA 5IKPA 3L7DA 4B4OA 1XF1A 4XD7A 4HADA 1YZKA 3IKVA 1HL3A 3PE6A 1U8AA 1I13A 1QRAA 1YVEI 4QEZA 4TMWA 3VMMA 4Q1CA 4W7SA 1GQQA 1CHDA 2QQ5A 4QNMA 5IDWA 3FOEC 4ZAYA 1L5SA 1T6YA 4J76A 4PLGA 4O33A 1RZUA 1ATZA 4IFIA 1EXNA 2WD8A 4LXIA 3UO8B 1HWYA 1UADA 3BH6A 1X1EA 1QH1B 1BVYF 1G3QA 1I7NA 3OQBA 4E13A 1EGHA 1QPZA 2AKEA 2Q28A 4BQEA 1W581 1XD8A 2GZ1A 5FORA 4D6XA 1NL3A 2RGXA 3ZEIA 4DYDA 1C3EA 3JARA 4A8HA 5K99A 1GR1A 3F3SA 3R6TA 3SX4A 2OHJA 3U4MA 4TKZA 2Q9UA 1GUBA 4BO9A 4OX9B 4LW8A 2LXNA 3LNTA 4ZIRB 3EZ6A 4EECA 3FVRA 5CG1A 1T2EA 4RMNA 1KGDA 5DNUA 1EWTA 2BGMA 4AZWA 4A8TA 1C9JA 1D0SA 1D2AA 1I3MA 2GDZA 3QTTA 2FOXA 4ND1A 3KC2A 4U7JA 5JD5A 5JRJA 4JLBA 3ZTYA 1KAOA 2FPSA 4OAQA 2HK8A 1H23A 2O7QA 2C8LA 2PO7A 1TQ8A 1FXWF 1H6AA 2I22A 2I6XA 3PNVA 4J1NA 4KAJA 1IBLB 1SVUA 4OYLA 4KPGA 3V4OA 4XJXA 2XUAA 3L4JA 1T26A 2BD0A 3FMVA 3HA3A 3SIRA 1U5BA 1UDCA 4I7EA 3TZBA 3LUHA 1I4WA 4OLJA 4NLLA 4BNDB 3VAZA 3D6MA 1Y9DA 3IELA 3OPYB 4Q03A 5D1HA 5KJEA 2IOHA 3CLSC 2ZE5A 2OGWA 1QDUA 4BP9A 1OREA 3N86A 1UR5A 1Z68A 1ZKMA 4EG5A 4PFSA 2VEOA 4ZI7F 2CXNA 4NXNB 3BM5A 1C7IA 1IBSA 3G5AA 16PKA 4P3YA 4YYZA 2JVIA 3NXKA 1A9XB 2H63A 2AIRA 1PTJC 1J5PA 8ADHA 4YTEA 5KC8A 1M3SA 3SFTA 4ALIA 3WAGA 1OWOA 1J33A 1D6MA 2AG5A 3HPRA 5ERXA 4TS9A 2X0RA 3WGKA 5EHXA 2PSJA 2IEAA 4PSDA 5ECGC 3DV0A 4DDHA 4DM7A 1KO5A 1RWXA 3PQ6A 1RBMA 3GRKA 3ZU6A 2ZTUA 3WIUA 1SU7A 3IPAA 1QP8A 5DT2A 5ALZA 3OBBA 3UTDA 1VMIA 2VNAA 1G5HA 1Q16A 2Z2IA 1KAHA 1KI4A 5DT9A 4E88A 3FD8A 2B83A 2OD2A 4N1AA 3H2HA 2F3UA 1JQ3A 4FS8A 4PZLA 1PK9A 2DCUA 4RD1A 4M55A 4BLOA 5FTLA 1UQRA 2GFQA 2VHCA 1MG0A 2QM8A 2P78A 3TVYA 1GL7A 1LI5A 1FP4A 1FE8A 1G63A 1N5IA 1RWOA 4JBGA 4BFUA 4MW6A 4XZ3A 5E2AA 4DCTA 2C59A 5GZ1A 4AQDA 3E9ZA 2NSJA 4QASA 1Z7BA 5FULA 5JBQA 2PLAA 2OB2A 5H9VA 1GAEO 1JEYA 2C58A 3B1YA 4YT2A 3IQWA 3FZEA 4G8CA 4D96A 2WU1A 3CF4G 3MTBA 4EJSB 4MQFA 4EAAA 1OAOA 1R0SA 2WJ3A 4HS9A 4LSZA 1SQFA 4YAFA 2YV5A 3DE1X 3ED1A 3EVDA 3EXFA 3OT1A 1CQIA 4LYFA 4PPNA 4RKFA 3MMXA 3UJ7A 1VSVA 5ITVA 3MN1A 1JDBC 2PS1A 2VWPA 4JD5A 3GIDA 4TXHA 4CMBA 3FXAA 2DLNA 2ZK7A 5U4QA 4A5SA 1ZIOA 5I5EA 2Q5CA 1G7RA 3O2NA 1ZZGA 3A6DA 4DLYA 4F7WA 3QE9Y 3C87A 1CE8A 2JRLA 1AZWA 4CQMB 5UKDA 2BYTA 3JRNA 5EKXA 3IE2A 1Y8AA 3S4YA 3C5WP 3CT6A 2RFLA 2ZJBA 4YJFB 4YRJA 1RKXA 4F97A 4H1UA 4Y2JA 3E82A 4CNQA 1SVKA 4ICIA 1YDMA 4OATA 1MRZA 3F49S 1GNRA 4KU4A 5FIUA 2QY6A 4HJXA 4I2VA 4PRLA 2YZ2A 2JATA 3UJ9A 2QBYB 3MTEA 2NNLD 3TIVA 1E69A 2XUIA 3GDFA 3P9ZA 4FR2A 3USZA 2IODA 3DP7A 1H2YA 2R8EA 1FDIA 3NM5A 4TL7A 1E7WA 3B78A 1JEOA 4B3TB 4P8RA 2HNKA 5FADA 1ZD3A 5JMTA 3SZUA 1OJLA 4HB4A 1A96A 1VG1A 2JVKA 1ESDA 1EX7A 3HXPA 4KYIB 1KHHA 4O59O 1C9YA 4Z86A 5SV2A 1H22A 3N2IA 1NUAA 4FB5A 3THXA 4YXWD 4OQYA 3SP1A 3NV7A 4M1ZA 1PJAA 3USES 3UUEA 1X8JA 4BE7B 4D9IA 1LDEA 1BDBA 3ABRB 1LPSA 4AXXA 1E0JA 1X7ZB 4LF5B 1EUCB 1JLLA 1FQKA 1X7WA 3OTGA 2GYUA 1TPZA 1L7RA 2B7LA 1EA7A 5BORA 1OLXA 5TQ2B 5HKAA 4RU1A 4FC6A 1BNCA 4L2IA 5CP8A 5F2EA 1C1HA 3E18A 1ESCA 4LE0A 1WXHA 3CVJA 4TXJA 3GLGE 2FVXA 5K3DA 3ZNOA 2WJAA 4PPFA 5KTOA 3WNBA 3ESCA 3HXQA 3QVVA 4IDBA 4OA5A 1XRSB 2TMDA 4CEIB 3WAJA 1X87A 1YKGA 3T6KA 1FPQA 4X1KB 3V7WA 2IXDA 2QRVA 1OFHA 4K9NA 1R37A 1E1NA 1R6BX 2VDLB 2XT6A 4NONA 4WI1A 4CE6A 4V0MA 3CPSA 1CETA 3CZMA 5D7BA 3SCZA 4D4IA 3D43A 3WGMA 4EUSA 3QENA 3EEBA 5LC1A 5EA2A 2VCYA 1JF8A 5J4HA 1K8QA 1DINA 2PH3A 4BBPA 2OXTA 4GXQA 4O4IB 3ZZNA 1N33B 1KIMA 2QSYA 3HXLA 3IPXA 2Q6LA 3NP7A 1UPFA 2Q1YA 3EGXA 5DGTA 1SQ6A 5LXTA 2W37A 2I5PO 3ZGXA 3DH0A 2B5VA 4OMCA 4MP6A 1DBRA 3ENVA 4BNTA 1MX3A 1NOJA 3C1OA 5HIKA 1JRLA 1THGA 5JVDB 5EKSA 4AG3A 3A58B 4DT1B 4ZEMA 3PNLA 3OZSA 3JD4A 5IUKC 3TIFA 2X9LA 1WSAA 1YS7A 2RAUA 1E32A 4GLOA 5J4VA 1TDJA 2A0XA 4TRRA 3KDAA 3KDSE 4LYYA 5BW6B 1IN5A 3AUKA 3L0YA 3QE4A 3WMXA 4LOJA 4NR0A 4CIAA 1GQFA 1WHSB 3DOCA 3LCUA 1GYPA 2GKSA 2IZ7A 2V1XA 3DEHA 2I6QA 3IILA 2RC5A 3TAHA 5IYZB 3D4IA 3IT3A 1KS9A 4IMPA 3ZHCA 3I58A 1NXOA 3TPCA 3C3MA 2AN1A 2BFOA 2OVFA 3ZZ0A 4QU8A 5HG0A 4NV0A 1YAJA 1X1QA 1ZGCA 4ZMRA 3GLUA 3E9NA 2YV3A 2DFNA 3ZHUA 2EEPA 5E1MA 3ZHZA 3UA3A 3H84A 4MJ3A 3T99A 1O6CA 4RK1A 3ZLBA 5A4DA 4YRRA 3AR5A 2ODWA 3TLCA 2HHAA 3OZWA 1XDBA 4MA0A 5KS2A 1I4DD 2QT0A 3OJEA 3JQCA 1UWCA 4LQCA 3SQOA 3L7LA 4LMPA 5EINA 4EKEA 3HM9A 1ZISA 1J07A 1MJGA 3FWPA 1QTNA 2OP1A 3RVOA 4YRZA 3LL7A 4IZIA 1QIFA 5EWJA 4RK4A 4NG4A 4PGFA 3GVXA 1P1IA 2YNMD 1E5VA 1XZNA 4DY4A 1UT6A 5K9ZA 4MX8A 4IHQA 4FP9A 2XV1A 2YIJA 4H7EA 5MFZA 2UUOA 3UVEA 3SS9X 1MO4A 3DD1A 4I1UA 4RLSA 3ZE6A 1P8JA 5CJJA 4YX9A 2O0JA 1L9KA 3CNLA 5FR2A 4DVGA 2VJCA 2LKDA 1XAJA 4NK5A 5KVAA 5A03A 1KVSA 1D2MA 2QY9A 3DS8A 4FHGA 3I01A 2BJHA 3CMMA 1XQYA 3M1LA 3OE4A 3GPBA 3RTBA 1A9ZA 3VVMA 4IIYA 3HWSA 4FOPA 3O84A 1WMFA 3IMCA 3KCNA 3SZ3A 3G0CA 1JIQA 4MCHA 1C9KA 1YQUA 2GKOA 3DV0B 4PINA 2GYYA 4DMGA 4MS1A 3KXPA 5HCUA 2DKNA 5LA6B 3PX2A 2I6FA 2CJFA 1CRLA 4OQLA 2VUUA 4KE9A 2WTNA 2BP7B 3TIXB 2NSHA 5C1DA 1QSGA 3U09A 2QVLA 3MRSA 1FTGA 1KNQA 4EVIA 4IWNA 1CD5A 3T3MB 3T7DA 4K0KB 4U9UA 4DLNA 4DCSA 4OSEA 3TQCA 4YRAA 3OO1A 3VYUB 4AVYA 5AMXA 1ZD9A 5LUBA 2WJHA 2R5FA 2Q6KA 2A3NA 2XNKA 3P94A 1FNBA 2OLEA 1U0JA 2P3LA 2R6R1 3I4FA 3JQRA 4QDXA 1L8LA 5EWMB 2WQ7A 2Q4BA 3A32A 4HD8A 5LBTA 4LFBB 2FW0A 4N12A 2JZCA 2AMYA 3C4VA 1IFXA 3D6AA 1DO8A 3KJEA 4LZWA 4O4JA 3UM9A 3WGLA 3WYFA 1ZVQA 3OTOB 5D2CA 3D4OA 1JFFB 3N2KA 4UUAA 1VLJA 5BSUA 2ERYA 5EJEA 2WDPA 3GJ3A 2G8NA 3EUAA 2ASEA 1JFLA 1LBSA 4PNHA 2H8KA 4P3XA 1OZHA 1CG6A 5LPNA 4HRYA 4LQDA 2FG5A 5G53C 5CXQA 5HILA 2XKKA 2V7TA 4LE1A 1IQUA 2OBMA 3MTIA 1L1EA 2BTQB 2D5IA 3ONEA 3GGCA 3QE2A 1TO1E 4HDRA 4QOGA 1ZC3A 4J8PA 2JLCA 2ZXFA 3CCBA 3N58A 4LZPA 1RABA 2CSXA 2VYVA 4YJFA 2QL5A 3MZ0A 5KEIA 3RWMB 3FPLA 2SECE 2DM6A 3IV9A 1D7AA 2EWVA 3INTA 2EKDA 2WVGA 4H7PA 3FF1A 4OKNA 4JFAA 4FE4A 4GX1A 3H97A 3JQAB 4HEQA 3KQKA 2F8SA 1GGMA 1RJEA 1TAGA 1W49A 1D6SA 1P0IA 1CJSA 1BWRA 2CNOA 3H65A 1I6KA 3QQ5A 4N3AA 4KRFA 2CCJA 6PFKA 1CY8A 1UANA 4RQTA 1PG5A 1ZHFA 2YH2A 2PA3A 3T7IA 2IHBA 1L7NA 1KRHA 1W0KD 1RC1A 5GQSA 4EG7A 3CE9A 2XDQB 3V4PB 3D6NB 2JEYA 1E20A 1E2DA 1EFCA 3IPLA 4J43A 3ZCRA 1MR3F 5CT6A 3VFDA 1Y1KE 3HNPA 4G4SP 5IT4A 1KEEB 4HQNA 2BGUA 3BSSA 4FNAA 1OWPA 2IELA 2LTAA 3FRIA 5COBA 3TPZA 3HI4A 4X00A 2QUHA 3Q7QA 4J4BA 3X1JA 1XZ8A 2J67A 3HBLA 1Y1LA 2G4CA 5CVDA 1TEZA 3D5QA 4CGZA 2BBTA 4ENUA 1QO0D 4G0QA 2XMDA 4WLNA 2GZHA 2AOXA 4B83A 1XTTA 2F90A 3H6HA 3KVRA 2FR0A 1W85A 1Y80A 4ZO9A 3SKYA 5L4SA 2NU9A 3PCTA 1R4MB 2RHOA 5J5AA 4V38A 2HWUA 3CX8A 4CMEA 3ZCVA 3I23A 2XGSA 4XVRA 4CEIA 1KZ7B 2QJRA 3GJQA 3Q7SA 1LZKA 1OXMA 3VPDA 1YRLA 1ZH2A 1ESNA 2YXBA 2BBWA 5EEHA 3VO8A 3L0PA 1QR2A 1Q3TA 2AZMA 4RVFA 1XQVA 2FVYA 3VR5A 1O9HA 3V5NA 1OLSB 5HJ7A 1ZJ6A 4PYLA 2B82A 4A0GA 5JADA 4XEHA 4Q82A 5J3JA 1XFAA 1R6AA 4WQMA 4C4AA 4Z3KA 1UPCA 3GJ4A 4X71A 1NBWB 4J6FA 2XBUA 1JDZA 3SS8A 4KSYA 4HFMA 3NHAA 3WA6A 2HEIA 3NBUA 1OOEA 2QTVB 1XMSA 3PICA 3TSYA 5MGBA 2PNJA 1W4LA 5ENZA 4XUEA 3BWEA 4XKJA 5JJBA 3HDTA 2PSHA 1M0TA 2G5CA 5DTEA 1WP9A 4I4TF 5C7OO 1U2PA 3R9KA 1US8B 3KQMA 2YV1A 3AOEC 4CM6A 4UOQA 1SIOA 2NZUG 5DBFA 1CF9A 1DDIA 2AQKA 1M75A 2VJNA 1E3TA 3RT1A 2ZWOA 2P7HA 2VDMB 5ALYA 3W9BA 5BUCA 5KDOA 2MINA 4BEBA 4EF6A 3GDOA 1P4HA 2ZPUA 3ND5A 5DNDA 3V1LA 1QJCA 1NMQA 3F4KA 1HT1E 4YMTA 1NE2A 2D74A 3SHOA 1D5CA 5IC6A 3E9RA 2Z04A 4WJZA 1X42A 2KQUA 1IUKA 2MYNA 4X94A 3VAYA 4JBHA 5C8ZA 2XZOA 5JG7A 4C14A 4LRYA 1SXJC 2VRWA 4C04A 2WZBA 3VKFA 3MWYW 4YRBA 1PL7A 2AI3A 3GUUA 3IAHA 4IICA 1Z4MA 1VE9A 5K3OA 1QZTA 4D42A 3QU5A 4IVNA 4B9AA 1FC0A 4JVNA 1AK9A 3HADA 4FM9A 2CSUA 3K0AB 2BPOA 1KVQA 1WHTB 2HO4A 5AVWA 1A9TA 3FHTA 4M0MA 2YFYA 1GPMA 2WTMA 2JGIA 3BGSA 3LVBA 3Q1KA 4HGYA 4YJ2F 3WOVA 1X3LA 5AHOA 3WK9A 4AMVA 2CNWD 2AQIA 1U3GA 3EULA 4MS3B 3NIWA 4B6FA 2ZVQX 4KQCA 4EA7A 4MJLA 3O31A 5BW8A 4DB4A 3PQFA 2PUDA 1ZMTA 2GBLC 3RYCB 3QPAA 1L5LA 1NLFA 3N8DA 4NK4A 3CH5A 1V48A 3LQ2A 2ZRPA 1SCKA 2YHAA 5I9NA 1MENA 1NSTA 2H4ZA 3DA8A 4DCMA 5LP6A 5FFMA 4O4LF 5AK0A 5CTJA 1JQ5A 1ODCA 1V5FA 2ZAMA 4IHJA 1OCEA 3QEMA 3TIIA 2AHOA 1UBHS 3DFKA 4D8WA 4G1EB 1TK9A 3TL6A 3IUYA 4QXQA 2ZSDA 4EHBA 1PLJA 2DPYA 4KQIA 1IL0A 1VG8A 2VHWA 2H1LA 2R8BA 4Q4AA 4TWBA 4HV4A 5EC8A 5KQRA 1A8QA 3FOZA 5LOVA 2X0NA 2GESA 2J3EA 4R2IA 1ORIA 1WKBA 1IM5A 5K7SA 2PLFA 4RIEA 3FCUB 2VP5A 2P62A 2F3SA 3DCNA 3B70A 2RIRA 3DLPX 3NFRA 3K09A 5K0CA 1G21E 1IJFA 4BFVA 1QE3A 3NTVA 2C5FA 3X2SA 1NWHA 1RZVA 2B1JA 4ROTA 1NMYA 1DQNA 4MP3A 1TTTA 1SU4A 1BHSA 2D1TA 2HZ7A 3LFTA 4KXVA 1M2VA 5A06A 5CB4F 1PQWA 3G9XA 5TQVA 4Y2TA 4US2R 2QJFA 1MOSA 5AVRA 2FR8A 1Y82A 3QYAA 1SBNE 1E2LA 3RYFB 3ACBA 1PBNA 1YHNA 2A9JA 5G0WA 3LGXA 4EHHA 5LMCA 1KVRA 3VJRA 5JSUA 2A5FA 1QF7A 4OB8A 1ZJ4A 5KSYA 4GDFA 4G37A 3RYIB 2V55B 2VG8A 3UFXA 3AY6A 3NTRA 4F5WA 3T9CA 3QKIA 3GMTA 4RJIA 1BKYA 2DRIA 3LBIA 5H3LA 2HMYB 1GN8A 3UUFA 4PGGA 4XYLA 2WK1A 2PKQP 1GGVA 4B3IA 3F9IA 3FROA 1QTIA 3I61A 3JQ8A 4B4UA 4RAOA 3FY4A 2QMEA 3FF4A 4P53A 5KYWB 1LVGA 4MYUA 4EW1A 2QROA 3F7OA 1F5SA 1TIPA 2UYHA 2JVJA 4P7KA 1W36C 3AESA 3R4VA 1WSWA 1T3ZA 4CI9A 1KMHB 4GICA 1XI2A 4HKTA 1H85A 1P75A 2AMFA 4NMMA 2AN5A 2H5LA 4CTMA 3M6MD 3TZCA 2Q7XA 3TDNA 1D0VA 2R6JA 1IG0A 2A9VA 3AEKB 4MRMB 3RRYA 5IHXA 1UKAA 1K2WA 1V9SA 1KA9H 2CHGA 3OJFA 4GBMA 4Q00A 1BDJA 1CUEA 1LLFA 1RQLA 1VPTA 3OT5A 4KDRA