1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HI0065
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
2HF9A 4TQUS 4UJ5A 4W7SA 5GJBA 3A58B 2ZM5A 1TTTA 1UM8A 1YR7A 1YZUA 1W36B 4C2TA 2J5XA 1QHHA 3HP1A 2BCJQ 2HDNB 5AUNB 4GBMA 4QFMA 5F9HA 2ZAOA 4M1OA 4BFWA 2OEPA 1FNNA 4OI1A 3RWOA 4A15A 2DWQA 1W0KA 3NIBA 3U3JA 5EP3A 5KPJA 4PAOA 4CT5A 3ZD7A 2V6IA 3D6TB 2O8FA 2CNWD 1QBKC 3H84A 1G5RA 2CBZA 1SVLA 4V0ME 3TSZA 1ZBDA 3GJ8A 3AF4A 3S1AB 4US0R 5FUYA 3K0SA 1TUEA 2JCSA 2WWWA 2IWRA 3GEIA 3THYB 2IYXA 2UZIR 2P5TB 3CKLA 1WBBA 3A6PC 1KO4A 4AYTA 4O3MA 2H16A 4AYXA 4Q9IA 1GITA 3V4FA 1GNQA 3TBKA 2VA8A 1M1YE 1XXHA 1LNZA 1F2UB 2DY1A 2FH5B 3BH7A 4QNRA 3B9PA 2BEKA 5C4GB 3WMEA 5FR1A 4AKEA 1E6CA 4YLGA 5EQTA 3SBDA 2ZRDA 4TMKA 1XJCA 1PV4A 1SVIA 4URUR 1UBEA 1JQJC 1OH7A 2N46A 5FI0B 1VPLA 3B82A 1UJ2A 2C8VA 3BRWD 3X1XA 4BFSA 5EE1A 3A36A 4Q9JA 5FBVB 2BIFA 1E2PA 1FPMA 1MRSA 1B0UA 4OK6A 1BO6A 2WPDA 4PC6A 2QY9A 3SZRA 4DCVA 3BB1A 2IX3A 5CDFA 1CJUC 3GJ6A 3K70C 1T3LA 5BYJA 3KXKA 4OHXA 5TARA 1SKQA 1DAEA 1NN1A 3H1TA 3SE0A 4B2PA 3HR7A 3RS5A 3THOA 1Z2CA 4PAQA 2GBLA 2F9LA 3KFXA 1ZP6A 4YQFA 1LF5A 4OHYA 2GF0A 2I1VB 2ZJ8A 3SFVA 3EW9A 4IDPA 2ECKA 2REOA 1LV7A 2ZRGA 4NCKA 4IEIA 3OIYA 2FA9A 3BGWA 4URWR 1Z0DA 4KVAA 5DSZA 2R2AA 1OYWA 3MWLA 1JBKA 3SHFA 3SEAA 3BWDD 4E07A 4EPYA 2F43B 1IOZA 1QHXA 1DO0A 3Q7QA 1T8TA 3CR7A 2AKYA 3ZDQA 4M9ZA 4MDFA 3QXXA 4GP7A 3AF1A 4KV9A 2FSFA 1F2TA 1KSJA 2GXUA 2R6FA 3WHLA 4HAWA 2Z6VA 4FN5A 3RAPR 2RGNC 4NYIR 3GFTA 4TYNA 1LY1A 4MDEA 2ZAMA 2ZRJA 2JAQA 1SVMA 2IT1A 4LCBA 4MUBA 1XPUA 4A2WA 2PJZA 4OYHA 3U61B 2D2FA 1T91A 3JZMA 4F4CA 4JL8A 1GWNA 1XMJA 1SULA 5J4LA 4DB4A 4PO1A 4RJLA 1M8PA 5FTMA 4RD4A 2EWVA 2EWWA 3R20A 1GRNA 2OG2A 1NKTA 1W4BA 1Q12A 1WE2A 4OJQA 4GMDA 4M53A 3KTAA 4RY2A 1WP9A 1W44A 1D2NA 3QKRB 3ZJYA 3KKMA 2Y8EA 1WB9A 1XEXB 2VSFA 4S35A 2C5LA 1G4UR 5JS8A 3K9LA 4O25A 3P1JA 3EPJA 4DKXA 5DIFA 2J0UA 2CE2X 2IYQA 1SXJE 1OE0A 3DL0A 2EQBA 4ZPXA 4CVNA 4PC3A 2XNSA 4NCJA 2CK3D 3LAWA 4R71A 3VR3A 4B43A 4BRUA 1IBRA 4BRWA 2XTZA 2NO9A 2VLIA 1RJ9B 1FMLA 721PA 4P32A 1QZXA 1YR6A 3U5ZB 2PMKA 1XZQA 1Z5ZA 3PENA 4V0MA 2CHQA 1H65A 5FBRB 1CP2A 3EC2A 1G3QA 2J46A 3FKQA 3K9HA 3B7GA 3U7EB 2IUTA 1TF7A 5FBLB 3L0IB 1J90A 2FE4A 3OEEA 4DDVA 2RHMA 2ZSBA 2YOHA 1XRJA 2OBNA 3KJHA 2JLXA 2I1QA 1G8FA 2OFXA 4WZAE 4G1UC 1KJZA 1H8HD 6Q21A 3I8SA 3VQTA 1G7RA 3VKHA 2W00A 2WWHA 3B1XA 3P20A 2F55A 1DADA 2P6RA 2V55B 1OH6A 1WDTA 3L0SA 2VF8A 4HLCA 4C3ZA 3KXIA 3GJ3A 2ZYUX 5DO9A 1E2FA 3L2OB 4GOKA 1XTSA 2W2TA 4H1VA 2ORVA 4RCZA 3I5XA 3A4MA 5FOVA 1Q0UA 1YQTA 1TU4A 3U60B 4RD1A 1DARA 5EXSA 4KVGA 2XXAB 4ZIRA 3QXJA 1Z8FA 2WWIA 3HJNA 5LBIA 4DRZA 5IK2D 3DM5A 4MRRA 1S96A 4IXMA 1Z28A 5GVRA 5CIWA 1U0JA 1NVVR 2OLJA 3H2YA 4HLDA 3CF2A 4BFUA 4ESHA 1W5TA 1UKZA 2JA1A 4KYIB 4OI2A 2YKGA 2A5YB 2D4HA 2IYYA 1CULC 3B1ZA 4JZKA 3DHWC 4M1WA 4QGHA 1FOEB 1E0KA 1YR8A 4A4DA 1II8B 4E09A 2JLQA 3E5HA 5KDOA 4Q7KA 4RSGA 3HU3A 1PLJA 1ZVQA 3ADDA 1DAKA 3VNVA 1JEDA 4LJ8A 5LB2A 3W6OA 4BGDA 4LZZA 2E9SA 1G8YA 1NJGA 4GT1A 5AUQA 2GTPA 1S1MA 2WMOB 4B3BA 2ODWA 2WIAA 4BFXA 1AS2A 3R9XA 2GRJA 2DYKA 2W6ID 3ZZUA 3X1YA 4DLTA 1UPTA 3L82B 2RGCA 4P4SB 1NBMD 3FVQA 4ZCIA 3QIAA 2H57A 1W4RA 2BMFA 2AHOA 1N6PA 1LS6A 4JLNA 1II9A 2QPAA 4LHVA 5JSZA 3TH5A 1I4TD 5EUMA 3T1OA 3QXHA 1NVWQ 4ZDKA 3CX7A 4PC7A 4DEYA 4B6FA 2PLFA 1ETUA 2ZUCA 3RS7A 1EESA 1ZC3A 5J40A 2CJWB 2XX3A 1HE1C 2D3WA 1BKDR 2PLRA 2DFKB 3HPRA 2J7PA 3QF4B 4URZR 5JFGA 2ZYWX 3PJRA 2BHRA 1OXSC 3SOPA 3K0CA 4HDOB 1ZMXA 4L4UA 1ZM4A 4M21A 1OF1A 4EJSB 4B44A 4C2UA 1MV5A 1US8A 3A8TA 4NPHA 3U3RA 3T1VA 1NN3A 3LDAA 5AJZA 4BFZA 2GJSA 3TSOA 5P21A 1P9NA 1UF9A 4C0KA 1G8GA 2OESA 5B64A 2FSIA 3LVQE 4B74A 3VX3A 2A78A 4KU4A 5L3SA 2BBWA 2G83A 2NO0A 4GI7A 4XD7A 5E7JA 1KJYA 4B2IA 1W4CA 2GZAA 2VTKA 4NCNA 4YMUA 1SXJA 1PUIA 4HI0E 5GJVC 2D2EA 4AD8A 2Q3HA 3TGPA 1W7AA 1QVRA 1S3GA 2VPPA 4KBGA 4NYMQ 4QNMA 1BYUA 2BBSA 3GMTA 5FPSA 3C8UA 3K0FB 3KX2A 3EZFA 3EWAA 4D4MA 3UPUA 2J0SA 4BPBA 2IXFA 2CMKA 4TN1A 4BFYA 3ASZA 2KE5A 1KO1A 2O8BB 1OLOA 2GXSA 1V43A 3MJHA 4A8JB 5DN6A 3OHMA 4B48A 5LDDC 4JLVA 2A5DA 1P2TA 2XAUA 3QEOA 4Q21A 5IHPA 3U2QA 1OXVA 4OQMA 4A0HA 1N5LA 1HEIA 1E4YA 1HURA 4OK5A 5A0FA 1WQ1R 3W34A 3LO5A 3U3MA 3HYRA 1MRNA 4KLNA 3K09A 5FFMA 2YJTD 1T0JB 3B9QA 5SZHB 3U4QA 1RKBA 2NMVA 1EWQA 4XIGS 1U99A 1A82A 3T1QA 3QF7A 1ZJ6A 3ZVNA 1CIPA 3IHWA 2QORA 1KDRA 4UXHA 2QTHA 3FMIA 4JJZA 1GZSA 1G20E 3I62A 4G0NA 4MGZR 3KUDA 2D06A 3BOSA 4IOMA 4NYMR 4BEBA 4DJTA 5JCZA 1E9BA 2WWYA 3IQWA 2VEDA 1UEIA 5KOYA 3MAAC 3F8TA 3RS4A 1DEKA 4XTRA 1RE0A 2EFEB 2F1RA 2ANBA 4B47A 4IDOA 5FBWB 3HU2A 5G41A 3VMFA 2IYVA 2DFNA 2MSCB 4W9MC 4Q02A 3GFOA 2RGAA 1AS3A 1XEWY 1ZINA 3IQXA 1R5OA 2BV3A 3BIFA 3GLGB 1W49A 4DBLC 3OFND 4BZQA 1U8YA 2CL7X 4MGYR 2JLVA 3WYAA 3K0EA 3CNOA 5C2JB 1KHTA 4ZCMA 2DHRA 5A5GA 4Z51A 2ZVQX 1Q3TA 4ARZB 3PUXA 3GEHA 2GVZC 5FOUA 2ZJBA 2G0TA 2DFTA 1NN0A 2DR3A 3AKYA 4NYJQ 5EZ6B 1SGWA 3MGCA 3VKGA 1UDWA 3Q3JB 1A2KC 3RRYA 4P4TA 4AWXA 1IN8A 1P2UA 3NDPA 2QRNA 1BMFA 1T5IA 1T5LA 4P4UA 3GLFE 3LQRA 3DOEA 4QHYA 2EYQA 5EP4A 5JJKA 1RIFA 1JPNA 4A6XA 2WPDD 4DSNA 4N3NA 4D26A 3AVVA 4WBSA 4Q4HA 3FB4A 3SDZA 3TE6A 2OBLA 1W4AA 1U2RA 3ZZTA 3X1WA 4TL7A 2B8TA 1IQPA 3C7KA 1Q1ZA 2AKAB 1ZIPA 4WA7A 5AJYA 2O8DA 3KKPA 2JDIA 3LX5A 2WJVA 3TNFA 1T0HB 1X8LA 1P2SA 2GJAA 5DH9A 4EQ6A 3EAQA 3G82C 1K6MA 1UBFA 2OILA 4GNKA 2HCBA 2JGNA 2XZLA 3NBXX 1ZUNB 2BOVA 1E2MA 3CF0A 4BLSA 3BERA 3I32A 2CCKA 4HDCA 3WYGA 3QXSA 1NMZA 2FFAA 2W0SA 5HPYB 2CEAA 1Q1EA 4ILEA 2HV8A 4C7OA 2WJGA 1MO5A 2QTFA 1CBUA 1GG2A 2QEQA 1M6NA 3BH0A 3W3AA 4GRAA 3IPYA 2H5EA 4LBYA 1AK2A 4TZ6A 4RFSA 2JLYA 2Z0MA 1VMAA 4M1YA 5DISB 3A1TA 1XNJA 3OEHA 2J7KA 1GL6A 1WBDA 3KB2A 1TEVA 2ODEA 3MUFA 1LF0A 2BWJA 4D4JA 1N6IA 3KQHA 4URVR 1OKKA 2E1RA 3B60A 3AVOA 4B2LA 4MKHA 3NTUA 1MR3F 3L43A 4GZLA 3KKNA 3CPJB 3EPKA 4QJ4A 2B6HA 3EZ6A 4LBWA 3CRRA 3IHLA 5HE9A 2ZE5A 4M0LA 2VSXA 1E69A 2ONKA 2IYTA 3GJ0A 3NHAA 1DE0A 2ZU6A 4LHYA 4HUQB 1R5NA 2QMHA 1PVOA 4AKGA 4WW0A 4ACBA 2GCOA 2ZRFA 3KQUA 2ZSAA 3ZQJA 1QF9A 3W8NA 4FI3C 1TQ2A 2X2FA 4L9SA 4DSUA 2W58A 2IS6A 5HTKA 4FWTA 3K1JA 4JKIA 1HQCA 4TT3A 4GL2A 1XX6A 2XEXA 3RS3A 1DAMA 1EFTA 1M2OB 3VNUA 2GK7A 2WOJA 4IDHA 1KIMA 1CRPA 4B3GA 3PEUA 2FOLA 3IDQA 1ZU4A 4DCNA 1ANKA 5EXPA 3K70B 5L3RA 1KTVA 2FG5A 4Q1FA 1YHNA 1TPZA 5KSOA 1M74A 2JLSA 3EIQA 3IIKA 4L5BA 4PC1A 1DS6A 3T5GA 1F6BA 4Q03A 1SKYE 2IHYA 3OEED 1DG1G 4KFUA 4MH0R 3RS2A 3V4RA 3C41J 3TMKA 4NE2A 2ZI9A 4M2LA 1E94E 3CRW1 1Q21A 1RRPA 2WTUA 4KJZA 1D6JA 2XJ4A 3RWMB 2EFCB 1GSIA 4HZUA 5HZKA 3T06B 2HYIC 3FGNA 1HE8B 2IC5A 4JKYA 1CJMA 1NRJB 2QSZA 2GHIA 1MKYA 4E5UA 4NDZA 4PHFA 4HDQB 1DTSA 1OIXA 3B6EA 2JLZA 1GKIA 1FL9A 3UXMA 1OFHA 2CHVA 3NEJA 3CM0A 3B1YA 4B6EA 3MWYW 3A37A 1KNQA 3K0AB 3OE7A 5B58C 2HEIA 3GLFA 4NMMA 3GLHE 3TW8B 4B75A 1Z3IX 2QM8A 4M1KA 1LVGA 4ZKDA 5LD2C 2Q3FA 1WXQA 4A1FA 3SYKA 5JI3E 1O87A 4YMWA 2NZJA 3K53A 4FD2A 4IVQA 3A1WA 2IW3A 1L4YA 2F3TA 2ANCA 1T8UA 4YONB 4FMDF 3THXB 1A2BA 2WSMA 1FW6A 3PUVA 4JLAA 4Q4LA 4QBFA 2GJKA 1KSGA 4XVRA 2NOAA 2NPFA 4U7DA 3K9GA 3PV0A 4OK3A 521PA 1FX0A 3QVUA 2VP5A 3FYHA 4HB3A 2C96A 3BE4A 2O8CA 1UKEA 1P61B 2FFBA 1RFLA 2AWOA 4MGKR 4YXWA 2X2EA 4Q18A 3LBHA 4A0GA 1I2DA 1IN7A 2ZANA 2IA5A 4QGGA 1R7RA 4DIDA 4QG7A 5IF9A 3FKSA 3MJRA 4OHZA 4CF7A 1Z0IA 2OAQ1 3PR1A 4IVRA 2C98A 4KXFB 1E0SA 2FMXA 3Q5DA 3U44A 2C2HA 1NVUQ 2IF2A 1N6LA 5G40A 4HLQB 5TY0A 4ASUA 1NG9A 2ASEA 121PA 2F1HA 4D25A 2J7PD 1M7GA 4GFDA 3Q8XB 2R9VA 5JJLA 2PMDA 1P9RA 1OH8A 4GOXA 1F60A 2O8EA 1EFHA 3CIOA 3VX4A 1ZUIA 2FU5C 2WWFA 4MKIA 1MABA 2RGXA 5DI3B 2IBMA 4CEIA 4TMWA 1FZQA 3KZ1E 3NBZC 4C0JA 1MO3A 1GKYA 1LW7A 1OXXK 2YZ2A 1OB2A 4D82A 4XVUA 4XD7D 2BDTA 4Z54A 2D74A 2OO7A 2XNDA 2WM9B 1UADA 2FGKA 3IKJA 1U94A 3CPHA 3AVPA 4Q00A 2V1XA 1Z6TA 4ZV4A 4NP6A 3HYTA 2PT7A 2LKCA 2VH5R 2J41A 4U5XA 1GAJA 2HJVA 3SBEA 1G291 3QOFA 4D4KA 5L3VA 1JR3D 4EFMA 3RABA 2HT6A 4TYQA 1R0XA 1P2VA 2YC2C 4TLDA 3W9YA 2QBYB 3PEVA 5KPDA 2YHSA 2ZR9A 2MSDB 1G6HA 5DN6D 3ADBA 2HYDA 2EW1A 2XTNA 3HWSA 5FOWA 4HSEA 2ERYA 3O8BA 2ZS7A 5CYPA 4AK9A 2NO7A 3R7WA 1W47A 1F3OA 3BK7A 4CEHA 2YOFA 3CO5A 1XTQA 1ZD9A 5JBQA 2IS2A 2ZRMA 3AUXA 2NPIA 3F5FA 3EZ9A 4I4LA 3C5HA 3R8FA 4DDWA 3RC3A 4DDTA 3NHBA 4QHTA 1L2TA 4PQYA 2FNAA 4BUJA 3JVUA 2WHXA 2RH5A 4Q7JB 4ZDJA 2OZEA 3T61A 5FL7A 2A30A 1D5CA 1Z07A 2QAGA 2PZFA 1XMIA 3AF3A 3B5JA 4I81A 4L8GA 3GLHA 3W8RA 4CGZA 4Q48A 2GXAA 4IW3B 3U3OA 3SHWA 3U3KA 2A7QA 1II0A 1VYTA 1Y63A 2Z43A 1KAOA 2GESA 2CE7A 3CBQA 3T5DA 2ZRCA 4PZYA 1KO5A 1N0UA 3CX6A 1E9SA 2QTVB 3I4LA 5FPHA 2GBLC 3WMGA 3G0HA 2XOKA 1N5IA 1NLZA 5SZKB 5J4KA 2R62A 1KSHA 2JASA 2WSSA 4MQBA 2EU8A 1X6VA 1N5KA 2V7QA 4FCVA 2VQSA 3DMDA 3KXLA 3N2EA 1JEEA 3LLMA 2G1KA 2PX3A 4LJ4A 2VP6A 4PO8A 4K8OA 2F9MA 2OAP1 1G1MA 5JHGB 5K8IA 1HQYE 1OT3A 4LJAA 1EG7A 3AVYA 3C4JA 1C1YA 3KB1A 1VDZA 2DBYA 3TUZC 1ZIOA 2X8AA 3GLIE 3L0OA 4Q4JB 1NG1A 2V4ZA 3UANA 3RNLA 4I1OA 1LS1A 2GEUA 3THWA 1C4OA 3BFVA 4IOJA 3LXXA 2VIIA 2QE7A 4KCGA 5FH9A 2Z83A 3N70A 2PCLA 3TR0A 4A82A 2BBTA 4I1UA 4MYTA 5FTJA 4Q66C 1NP6A 3REGA 2QM7A 3AP3A 2F6RA 2FEOA 4PPNA 1F5NA 2F7SA 3D8BA 4XTCS 2ZI4A 4PANA 2GZHA 3CW2A 1Z0AA 3O8DA 5J47A 2LKDA 2YWHA 1U90A 2PX0A 5CJ2A 2DFLA 1E79D 1XB2A 2AFHE 2QA5A 3V00A 4JL5A 4KFRA 2G1JA 1KKLA 1NI3A 1TQ4A 2JLRA 4F7WA 2PZEA 4XWAA 2KB0A 1VG9B 1XU4A 1YZLA 5AK0A 1HT2E 4LI0A 2CHGA 2ONJA 2JIZD 2XJ9A 3I1FA 2VL7A 3MG9A 3FE2A 3TKLA 3AVTA 2CLDX 1P6XA 1U0HC 3FHOA 1W0JD 4EPXA 1UEJA 4TLEA 3O8CA 2GKSA 3AGQA 4H1UA 3PUZA 3P4YA 4BZXA 1N6HA 2IXEA 1G8PA 4FCTA 3KL4A 2RGBA 2P6UA 1W2HA 4ZKEA 5HCNA 4II7A 1L4UA 3C5CA 1E2KA 3OEHD 3QXCA 4KYUA 3LRPA 4LV6A 4PQFA 1G3UA 1GDDA 3M6AA 3CLVA 5D3MA 1OKKD 1SVSA 4W5JA 5EP2A 3VHXA 4RZXA 4AKHA 4DDUA 4EKDA 1WRBA 2CL6X 1P72A 4C0HA 2AFIE 4LV8B 3OIWA 4LK2A 3QKSA 1KZGB 4PXAA 3M4YA 4M9SA 4CEJA 3B1WA 3KQNA 4U00A 2H7VA 2JEOA 3F3YA 1EK0A 2PCJA 4WOPA 5EE5B 1GNPA 2H92A 2KJQA 5L3QA 3V9PA 4B32A 2RCNA 1YZKA 1FFHA 4UXJA 4A2PA 3FDIA 4GDFA 1DBSA 4TSFA 1G19A 5FTKA 5DLQC 3FOZA 4QM6A 4TT3D 1E2JA 1FP7A 2BJVA 4I1VA 3SYNA 1N6KA 4PR0A 2CXXA 4KITB 2UZ3A 1NLYA 4ZDWA 5EE0A 2QUZA 2ERXA 1JALA 2OHFA 3GQBA 2FX3A 4LHZA 1OYYA 1IAQA 1RYFA 2GVDC 4URXR 2A3RA 2GAOA 4UKDA 2AL7A 4JLOA 4V02A 1JNYA 3QNUA 3ND9A 2FDCA 1K8RA 2WICA 3CF6R 4S2EA 4OHVA 2NZ8A 2A5GA 1ODFA 3T15A 4C9BA 1OSNA 1EX7A 4JBYA 4Q4AA 5AJWA 5A4JA 4IOKA 3GLIA 4RD6A 1HT1E 1TF2A 3AUYA 3QKUA 4PSKA 3QJYA 5L8VA 4JLDA 3TAHA 2XZOA 2FV8A 3RYTC 2HLDA 1E99A 3IILA 4Q01A 2ZI5A 2QAJA 4DCTA 4JLPA 621PA 1CR0A 4EAQA 1R4AA 5SZIA 3TQFA 5JHHB 3LWNA 5CITA 3QPVA 2UVQA 3Q85A 1UKYA 4AIIA 1U0LA 4TMVA 2R6DA 3OE7D 3PXGA 2ODNA 4IFEA 1S0UA 3AVQA 1VCMA 3K0CC 3GP8A 5DHAA 1OJLA 4IEEA 4DB2A 5E95A 1PLKA 2GJ8A 1NNEA 5AJXA 3AGPA 3LVRE 2VRWA 3NBFA 3S1AA 1Z0FA 3WBKA 4LJ9A 4CT4B 1F48A 1Q20A 4TMXA 3G5UA 3THYA 1N6RA 3NVAA 2QP4A 2B21A 4PPFA 1RVDA 4XVQA 1VCNA 2QGZA 5J4YA 1SXJC 4N0EA 4FMCF 1AN0A 3F0TA 3W5IA 1KGDA 3Q5EA 4BFTA 4PPQA 3AVWA 2EFDB 2ZJ2A 4OI4A 4PHTA 1F2UA 1VG0B 4KHZA 2VP0A 4FMDB 1KDOA 4POAA 2R65A 2D7CA 2NO6A 5KNDA 1KI6A 3I61A 1VG1A 1VKJA 3EASA 3CWZA 2RKOA 5BYKA 4A2QA 1FQJA 1E9FA 4LBZA 4LHWA 1GNRA 3EC1A 2WBLC 3L8YA 3QEJA 4Q5IA 5FI1B 4EFNA 1M7BA 2QN6A 4DT1B 1Z63A 3ONWA 4WZ6A 2O0KA 1ZAKA 1N0VC 1D8TA 3JZAA 3SN6A 5AUOB 2ZRHA 1ZNYA 4BLQA 1MO4A 3B1VA 2YVUA 4P3YA 3C14C 3VR1A 4GMXA 4KFTA 3K09C 4RD3A 3BXZA 2H1LA 3CX8A 2OXCA 5HR5A 4RCYA 5KO2A 3RC8A 2VHJA 2JJ1A 4E03A 4LUCA 4TMZA 4ASUD 4BLPA 2IYRA 5AR1A 5IDVA 5J5CA 4DCUA 3LW8A 2BKUA 3R9IA 4XWKA 2C78A 2PL3A 1KK0A 3EPLA 5CLQA 2ZS9A 3UK6A 2KBEA 3QKTA 1CF4A 1COWA 3HU1A 3REFA 4MUAA 1P62B 2F43A 2N1BA 4PZZA 2NIPA 2Z4RA 3A1VA 1P73A 1G64A 1E2HA 3AP1A 4AC9A 1KK3A 2VHQA 1QG4A 4P33A 3WYFA 4DUGA 1GRRA 2XNDD 4ERNA 4HAZA 2EFGA 4OI0A 4WZBE 2QPTA 2X77A 1RPZA 2IEYA 4PAMA 2Q21A 4ITRC 2OE2A 4P0TA 2ZYTX 3KFVA 1KO7A 1DAGA 2C77A 4B73A 5CM9C 1M34E 2GAAA 5LD2B 3AF0A 1W0KD 2KSQA 1XJ0A 1NY6A 1TUIA 2PH1A 1ESMA 1IY0A 1CJTC 4EPWA 3NWJA 1I2MA 4JT4A 4TQ9A 4Y0AA 4DLXA 1R0WA 2PT5A 2IYWA 3A4NA 1UAAA 2A5FA 1VIYA 1UFQA 2ODBA 4R7ZA 3IO5A 1XD2B 1E1RA 1AZSC 1I4DD 3Q7PA 3QKRA 2HT1A 3VU9B 3H0KA 1XEXA 3PUYA 4ZI3A 3W5JA 1FTNA 1KMHB 2B7BA 2ORWA 1FTSA 4QBIA 3CB4A 2RAPA 1KJWA 5KU1A 4HLUA 2DB3A 1S9DA 2WKRA 4LV5B 1OHHA 4ZCLA 3I72A 2GF9A 4UNSA 2WKQA 2WJHA 3IGFA 4RZUA 1R0ZA 2FWRA 3RRMA 2J1LA 1RJ9A 2GEVA 2ZS8A 4G5GA 3FPAA 1SVOA 2ZPTX 2ZUDA 3VKWA 4D6PA 3B13B 3PQCA 1VCIA 1U98A 1CKEA 1E32A 1MABB 4BZPA 1L7VC 3K9NA 2XOKD 4EFLA 3H86A 3P32A 3B78A 1GVNB 3SJAA 1VTKA 2V7QD 1QHGA 5E7IA 5C18A 1UBCA 3CRVA 1KDTA 4O2RA 1N0WA 1TU3A 3U7GA 1G7SA 3NBYC 4JS0A 2J0VA 4OHWA 2VSOA 3QG1A 1QHHB 3TLXA 1JAHA 3DM9B 1RRGA 5EE9A 3FMPB 4EPRA 1YRBA 2EVWX 2GNOA 2IUUA 3ADKA 1YRAA 2Q9CA 1DOAA 2WJJA 2O8FB 2VP2A 2V9PA 5FL3A 2XXAA 1V5WA 3B8HA 3SJCA 3R9WA 4BASA 1Z0JA 2F1JA 4UNRA 1XWIA 2YOGA 4DLVA 2QE7D 3KJIA 4NYJR 3I8XA 1H8EA 5KUTA 4CIDA 2IXGA 2N42A 1AS0A 3AB3A 1YZQA 3SI7A 3SNHA 1N5JA 5AUPB 3EPHA 1QRAA 2WAXA 1VYUA 1VECA 2XGJA 4PC2A 5DHFA 3KDSE 1JPJA 5F3WB 3PIRA 1II8A 1XXHB 3VTKA 1E9AA 5UKDA 5B30A 3UIEA 5HKKA 2YYZA 4PQRA 1HH4A 4TTRA 3GLGE 4R2IA 5JLJA 4MRVA 1U8ZA 1G3RA 5HCIA 2XB2A 4JSTA 1XPRA 1GIAA 2GCPA 4GOJA 1T3SA 1YR9A 4RVCA 5KSYA 1NJFA 3BORA 3QVVA 1CJKC 2FF7A 4O0MA 4P4SA 5H1YA 1FNMA 4HZIA 3CONA 1AIPA 1WF3A 2DCUA 3MFYA 1FUKA 4JVMA 1G7CA 3WHKA 2V6JA 3KUCA 4A9AA 1CU1A 1RW4A 1XP8A 4AURA 2IWHA 1YVDA 4LPSA 5KTYA 2FEMA 4LJ7A 1KY2A 1VIAA 4NCIA 2CJWA 4MRPA 5BQ5A 1A4RA 1IY2A 5BN4A 3QF4A 2ZSDA 1OB5A 2GA8A 2MMGA 3VAAA 3TRFA 4HUTA 1JECA 3NC1C 4JLJA 1FMJA 4EJSA 2VHTA 4D2IA 1R2QA 2WAYA 4V0KA 3QENA 1IJEA 2FGJA 1NL3A 2R6GA 3MD0A 4X8LA 1QDEA 1KMQA 5EP1A 2YNMA 3TUJC 1IONA 4OJKA 1BOFA 1FQKA 1X86B 3C16C 3EA0A 4E22A 3U6KA 4JL6A 3HPQA 4JSYA 4LRWA 2ZRIA 4OQFA 4DLWA 3SJZA 5GVSA 4MYCA 1F2TB 5IK2A 4CW7A 3E1SA 1KI7A 4JVNA 2XSZA 4AY2A 4MRNA 4QHSA 1G9XA 1ZM9A 4XOIA 1TEXA 1EXMA 1UDXA 1KSFX 1YE8A 2ZRBA 5K8TA 3K0FA 1ZW6A 3EG5A 1DG3A 1VCOA 4M4SA 2O8BA 1N6OA 4A8JA 1P5ZB 5J4HA 4L9WA 1TNDA 2XZPA 4WXPA 3OIUA 4U02A 1M7HA 4AG5A 4HB0A 4R2HA 5F2EA 4G5OA 4RD2A 5EE3A 4DZZA 3GJXC 3GJ7A 3NH6A 4PHGA 3EWSA 2WJIA 3KTAB 2GEDA 1IJFA 4KBFA 4LGMA 5E3HA 3DDCA 4XWOA 4JIMA 4F4JA 4NTZA 1E2DA 4OKSA 1A7JA 2Q3MA 4Q9LA 2J0UB 4W5HA 1IXRC 3Q72A 1NY5A 1G4AE 1IM2A 2IL1A 4UXIA 2WMNB 3ECCA 1E98A 1HV8A 1N3BA 2QMEA 4NU0A 2QT0A 2CLSA 4LJ5A 1E3MA 3RRZA 2ZE7A 5CDFE 1UKVY 2AD1A 1XBTA 2HLDD 1IHUA 2ZJOA 4LHXA 3ADCA 1W36D 1NMYA 2J9RA 3SR0A 3OIVA 5E7MA 4YMTA 1KAGA 1PLLA 3ZIAA 4M8NE 5DGXA 3RSLA 1SHKA 1AGPA 4IDNA 3CZPA 2RHDA 1E0JA 1T6NA 3WMFA 3FFBA 2X1VA 5BN5A 2GCNA 2HXSA 3OZXA 2OM2A 2VO1A 2RGGA 4PSAA 3GD7A 3LY5A 4CYMA 1J8MF 1XJQA 4TZ0A 2J87A 3ETLA 4FINA 1XTKA 2R44A 1JJ7A 1TQ6A 4M1SA 3FHCB 3I73A 3X1ZA 3BB4A 1U9IA 3W6PA 4XSHA 3GLGA 2C9YA 4UNPA 3WNDA 2QGNA 5CK4A 4R9UC 2ZTSA 4PX9A 3RANA 4ARZA 2Z4SA 4RFVA 3GEEA 2BJWA 3DPUA 1OXUA 3AF2A 2OSBA 2RMKA 2W2XA 3BAFA 4B3DA 4NH0A 1GFIA 1VHLA 1S3SA 3B85A 4TL6A 3WRXC 2BCGY 4ZIRB 4FMCB 2Q6TA 1S1CA 2GDJA 4O2LA 1SXJD 1X3SA 1YJ5A 5KDDA 5TMPA 1XCPA 3GJ5A 1MH1A 3ZVLA 1GRQA 2Q0HA 3SYLA 1KYIA 3ND8A 4G01B 4WAUA 4C4PA 2PEZA 2OFWA 1NMXA 2TMKA 5JEDA 5F98A 1AJEA 2QG6A 3LV8A 5KHOC 5KSZA 2I3BA 4HYYA 1JB1A 2YWEA 4LWZA 4US2R 5K8UA 2QRZA 4L15A 3GCGA 5FUXA 5KNCA 3H4MA 3QI2A 2QQEA 2P5SA 5LB4A 3ZLJA 2YC4C 1TADA 4Q1DA 3BH6A 3W90A 4HAVA 1GL7A 2CVHA 2EFHB 3BC1A 1K5GA 1E2QA 3E2IA 5JZVA 4EPVA 1P60A 3BBPA 2FPLA 4C30A 3T35A 1U81A 3ZVMA 4TYWA 2QROA 5FUWA 2BKEA 4Q9HA 2H18A 5EXXA 3SS8A 5JWRA 3LH5A 4EPTA 3TQCA 1KKMA 5FPTA 1C9KA 1JR6A 2NQ2C 4DLRA 3JVVA 4JT2A 2MSEB 2QAGC 3U6BA 1W1WA 2ZRLA 3NEYA 4CZ2A 4LC1A 3AEZA 3EIHA 2Z5FA 2ZRKA 1COWD 1KZ7B 2OCPA 5JSZB 3NH9A 2ZSFA 1S2MA 2BMDA 1RYHA 3LW7A 5C46F 3N5CA 3IEVA 3GPLA 1XCGB 1ZU5A 4A92A 4DHEA 4A6PA 1S8FA 4DUGD 1G16A 1NSTA 1R10A 5JI2E 1Q1BA 1TL7C 4Q9KA 3OFNA 1DAHA 1VG8A 1J99A 2GK6A 4YDSA 4G5RA 4Z8XA 3A1SA 3IEUA 2D7DA 1X1SA 1YZGA 1US8B 3MWKA 5CB6A 2XITA 2O0HA 1KI8A 1MO6A 1XTIA 3ZS8A 2WWGA 1XPOA 2V54A 4D0NA 5L3SB 1KI6B 3VR6A 4Q7LA 2YINC 3LX8A 3QPUA 1TQDA 4NYIQ 5JWHA 4HUQA 3ZZ0A 3EX7C 1SXJB 1E9EA 5IRCD 3IBYA 2WKPA 5CM8B 1OXTA 3LQQA 1TAGA 1GILA 1TX4B 5D3QA 3UG6A 1P3JA 1DO2A 4DLSA 1Z47A 2BEJA 4GPTA 1E1RD 4DCSA 2OCYC 2V1UA 1JQLB 5TV2A 4JLBA 1CR2A 3VHLB 5EXTA 3OAAA 4M1TA 1AM4D 4Q7MB 3PFIA 4TLCA 4LSGA 3QBVA 3ZGXA 1N6NA 2CL0X 1TMKA 2QZ4A 1OHHD 4ZDIA 1RC8A 1CLUA 3CWQA 5JS7A 3QBTA 4Q1EA 4DXAA 2HF8A 821PA 5ELXA 2AXPA 4HAXA 3CUEF 4HB4A 2ZR0A 2FJUA 4EIWA 1BMFD 1ZNZA 2QP9X 3PITA 1KI9A 1LTQA 2ZI6A 4LDJA 4C0QC 2ZJ5A 1ZC4A 4A0FA 4W5WA 5C1BA 1J7KA 1W5SA 5JMTA 3U4QB 3FMOB 3RDPA 4DC9A 3TSWA 1EFCA 4DEXA 4I1SA 4KFSA 3AM1A 1OFUX 2CCGA 4B3CA 4HAYA 3B2EA 4G3XA 2AK3A 2OBMA 1Z6AA 1GL9B 2CCJA 4TYPA 1OV4A 5IT5A 2JDID 4MYHA 5CJPA 2GILA 1NVXQ 4HEJA 1EX6A 4GZMA 1BH2A 5FOSA 1NN5A 1OIWA 4DLYA 4V0LA 4V0OA 1BIFA 3BB3A 4QKQA 3EIEA 1E0AA 2PBRA 3DZDA 5JRJA 3K0AA 4Q1AA 4B33A 1ESNA 2RGNA 1DPFA 2NTYC 1D9XA 1KI1A 5JJIA 4LJYA 2QMUA 1XF9A 3IO3A 1E2IA 2G0NA 2QL6A 2J0QA 3MMPA 1P7CA 1KK2A 4CRWB 1H8ED 1Q22A 4LX0A 3LD9A 1KI3A 4WIAA 2AK2A 1EFRA 1P75A 5CK5A 4XSGA 3THXA 5FOTA 1AKEA 1SHZA 4TQAA 4F92B 3X1DA 4US1R 2VF7A 4HATA 2GZDA 1YKSA 2P2LA 1L8QA 4PFSA 3QPWA 2W6JA 4I99A 3PEYA 1GKUB 5HKKD 2OT3B 4KAXA 2FSHA 4TMTA 4M9XA 1IN6A 4JJKA 2UKDA 4BEJA 1NVVQ 2LCFA 3CH5A 3KQLA 2OFOA 1AKYA 1BYIA 1JR3E 2ZRPA 4FWIB 3P26A 2O5VA 2WZQA 4C0BA 2JJ2A 4YC7A 3RSOA 4JBWA 4FMBB 1ZCBA 4Q1BA 1NLFA 2IUSA 3ICEA 2CVFA 1RRFA 3DEFA 4Q4HB 1CTQA 5H68A 2ZEJA 3PVSA 3TR5A 5GJWC 3RRNA 1QHIA 4AI6A 4FIDA 1EFUA 4JMPA 3SC3A 1G18A 2ZI3A 1XMSA 4YMSA 1GTVA 2JLWA 3CZQA 4B34A 4C0SA 1AA9A 1E2GA 4Y0VA 5TVKA 3RHFA 4PSVA 2O8DB 1DAIA 2VP9A 1J8YF 4HAUA 4EQ6B 1XD8A 2WOOA 1IXZA 1XZPA 1GP2A 1KOFA 2QQ0A 4TL9A 5DI3A 4QJ5A 4AYWA 1D2EA 1SVWA 2B8WA 2DWPA 4LY6A 4JYBA 1W36C 2JJ8A 2OCAA 1JXOA 4BWYA 3PEWA 4C7OB 4JVSB 4PO9A 2BM1A 2OLKA 4QL3A 1TF5A 4LPKA 2BM0A 1CR1A 4RFSB 3UWKA 3HR8A 421PA 5HZHA 3BD9A 1HA3A 4IDQA 2XSZD 1KNXA 1OPXA 2D62A 2AD5A 1FUUA 1PJRA 1KO8A 2IK8A 3AKEA 4NL4H 3RVBA 4IXNA 2W83A 1IN4A 4WXRA 2A2ZA 1JXMA 1VHTA 3AP2A 5FOXA 1G5TA 1T4GA 2ZETA 5BN3A 2QBYA 3LXRA 3WP1B 3M1IA 4D80A 4PZLA 1XCMA 2YWFA 3TVDA 2OXRA 5CIQA 4F91B 4LOAA 1XMVA 2REXB 1DELA 3D3QA 4OQLA 2QI9C 4JLKA 2C9CA 3MLEA 2JLUA 1BS1A 4ACAA 3KQKA 1A5TA 2GCOB 1I4LD 3HDTA 3VFDA 3D7MA 1T9HA 4N1AA 1IY1A 1KK1A 1WMSA 2FZLA 3MRSA 2FFQA 2KBFA 4QM7A 3I5YA 2ZIAA 1MT0A 2H8KA 1UBGA 2PEYA 1KDPA 2ZYVX 3QE0A 1KI4A 1XTJA 2WJYA 4OL0A 1JI0A 3BFKA 4LBVA 4MA4A 4QBHA 5FBQB 1E2LA 4YXWD 4M1MA 4BLOA 2BVNA 2G3YA 2YV5A 2P6NA 1FP6A 3EARA 1AQUA 2BMEA 5AWFC 4X8MA 1QVAA 4ESVA 1EWRA 5B57C 1KY3A 3FKSD 2KWIA 2R8RA 5J4VA 2ZVPX 1B23P 4LYFA 3A1UA 2W0MA 3W3ZB 2RGDA 3E70C 3ZIAD 4RD0A 4KODA 4G5QA 2FPMA 3WP0A 3QSYA 3LBIA 4Z1MA 3ZS9A 5CYOA 1ZRHA 4N0DA 1Z22A 5F9FA 3TAUA 1E1QA 1DVRA 1YU9A 2AR7A 2EYUA 3KJEA 4DIEA 2ZE8A 1OFIA 4DWJA 2P0EA 2F1IA 4HZUB 4B35A 2IYUA 4HB2A 3FMFA 221PA 2RGEA 3AKCA 4IFBA 4KSCA 4DSOA 4JVLA 3NXSA 3SQWA 4URYR 1XDBA 1G8HA 3MSXA 3EZ2A 4NHOA 3SQXA 5FTLA 1JR3A 4B71A 2IHBA 4Q4JA 5G3ZA 4ZI2A 3GLFB 2ZJYA 2ZRAA 4KLZA 3BS4A 1CR4A 2CNWA 4RKEA 4YMVA 4G5SA 3AVXA 4QOSA 2ATVA 4NKRA 3UKDA 2QP3A 4X8HA 3AV0B 4BLTA 4QGFA 2V3CC 1N25A 2VP4A 5G53C 1NIJA 1ZM2A 4AG6A 2ZQ5A 5EUQB 2A9KA 2JATA 1ZNWA 2ATXA 1J2JA 1FX0B 2ZUBA 4WVFA 5KDLA 1NF3A 2O8CB 1X8JA 2GETA 5JCPA 3PCRB 3SFZA 1IXSB 3A4LA 1Z2AA 4OBEA 4FW9A 4D0LB 3OF5A 2IYSA 4HLUC 4Q19A 3AQ4A 1YZNA 1E4VA 3ZVRA 4UJ3A 2HXYA 4ZO4A 5FUVA 3SU8A 3CRQA 1Z06A 2ZREA 1Q57A 4DSTA 3NC0C 3TUIC 5FPYA 3NG1A 4UNNA 4BQSA 2ZITA 2QU8A 4X8OA 4A36A 1HYQA 4A0RA 2VHCA 3U44B 2ZU0C 2C9OA 3IIMA 3L0PA 4H9GA 4K46A 3I92A 5FL7D 2AXNA 2QT1A 3Q9LA 1W2GA 4R98A 1Z0KA 3DO6A 1OFTA 5JECA 4BFVA 3WNCA 2H17A 2ZXUA 2C99A 3N2IA 1Z83A 4K81B 2RB4A 4TTPA 4ON9A 5GJCA 3IBGA 4V03A 5JWOA 2O8EB 2X19A 3FFAA 1G7TA 4IKEA 1KI2A 3ZD6A 3LA6A 4ABYA 2DWOA 1R6BX 2WVJA 1P9WA 1Z29A 4CEIB 1XD9A 4OQNA 2WSSD 2FFHA 2WV9A 4PPGA 5KNBA 4NBSA 4KSBA 1ZM7A 4IVPA 3TW4A 2CLCX 1WA5A 4J0QA 1R8SA 2CDNA 1NBME 3CR8A 3CNNA 3QY0A 4Q47A 4RZ3A 3R8CA 2C03A 2AWNA 2ZR7A 1YZTA 1G3MA 3ZH9B 4B3XA 5CB8A 2G77B 4Z8YA 3MWJA 5JEEA 3T1TA 1A1VA 1SZPA 3OAAD 4M22A 1GOTA 2OV2A 4F38A 4DLUA 1Z08A 4FXPA 4TWZA 4EUNA 4D81A 1E79A 1CRQA 1NSFA 3M0EA 2IYLD 2C95A 5G3YA 3UMFA 2G88A 2IS1A 3O47A 3DVLA 1SKYB 2C04A 5EZ5A 3R7WB 3UMRA 2FSGA 5FTNA 5EJEA 1X8KA 3K70D 3X2SA 4MGIR 4CEHB 1N2CE 2QMOA 2G6BA 2ZE6A 3TK1A 4B76A 5AJVB 2K5UA 4BLRA 1ZYUA 1RZ3A 2FPKA 2FN4A 2JIZA 2SHKA 2V8OA 4LC0A 2HCJB 4NONA 1AZTA 1HY3A 3QG5A 3C15C 3DKPA 1W0JA 5DNYB 2IEZA 4LYHA 4Q1CA 5DE3A 2O52A 2CK3A 3AKDA 1P4SA 3DKVA 3PG5A 4LYAA 5GADl 1OIVA 3ASYA 3VR4A 2QAGB 3ZQ6A 4C0AC 3GLHB 4QC2A 3FTQA 3LFUA 1E2NA 4UQOA 4FCWA 3K8YA 5ANRB 3T12A 3GFPA 5SZJA 2NGRA 2AN9A 1R5BA 1Z6YA 2I4IA 4P31A 1GUAA 3TIFA 3DOFA 3P27A 1G3IA 1O3YA 2REBA 2MMCA 2Q9AA 3PUWA 1T3HA 3KKQA 1OH5A 3KJGA 2W2VA 4TTQA 4EDHA 3IPXA 4EJSC 4M9QA 2ZI7A 4RZ2A 3EZ7A 3WNBA 1E9DA 3P4XA 1H8HA 2P67A 4OQXA 2PJRA 1U8AA 1K5DA 3BFXA 5DYIA 5TDHA 2ZROA 1ONBA 4V0NA 4DLZA 2P3SA 1EFRD 3LNCA 3RS0A 3J81k 3WRYC 4MYUA 4TLBA 4MITA 4YDHB 2W6JD 2B7CA 2YWGA 3EXAA 2A5JA 4GSYA 5JRZA 2OCBA 1S4QA 3QUSA 5TXGA 1RRCA 3THWB 3AVUA 1DAFA 2VHUA 3GJ4A 1CS4C 3LLUA 3MCAA 4QJ3A 1Q1QA 2ZJZA 3L8ZA 5BXQC 2F3RA 4JLMA 4A8JC 2GWHA 4F93B 4DT1A 2JJ2D 2IS4A 1X1RA 3KKOA 1NIPA 3CRMA 3LBNA 2KI5A 3WY9A 1G6OA 4TSFD 3DZ8A 3ICQB 3I3SR 1AQYA 3DMNA 2IF0A 5FPKA 4XJXA 3FHTA 4MKGA 1HUQA 4TL8A 3SJBA 3D31A 5CLLA 3ZYCA 4B3FX 5C4MA 2LWIA 3IIJA 4NCHA 3UG7A 1W46A 2PZGA 4D0GA 1ZNXA 1XEWX 3OESA 5KYKA 1XXHE 2W6IA 4F4IA 2ZJAA 3IUYA 3CH4B 4KI0A 3WXMA 2BBOA 1Q44A 2FZ4A 3EA5A 1OW3B 1NBMA 1ZM3A 1E9RA 5H8WA 4XH9B 5K8LA 5HE8A 4C0LA 2WWXA 1D2MA 1SVKA 2WIBA 3BJIC 4LYJA 2VYFA 4DVGA 1IN5A 4TYYA 1W48A 2O0JA 3T34A 5FR2A 5LPNA 2HJGA 4CDGA 1ZD1A 1PZNA 1XFAA 8OHMA 2P65A 2R6AA 1VYVA 4IHQA 1E96A 3O8RA 1QG2A 4IJMA 3UATA 4PHHA 1D9ZA 1SQ5A 2R6CA 2HUPA 5D3MB 2OUKA 5E4FA 4QXAA 3CNLA 1CJVC 5TB5A 1EGAA 2G9NA 2E87A 1LFDB 1MOZA 1G21E 2QENA 3U7HB 1U9IC 4LJ6A 1G41A 2XB4A 2QNRA 2QSYA 4QGAA 2BMJA 3U7FB 4JBXA 4IOLA 2XTMA 4NZYA 1JJVA 1Z6GA 1CEEA 4MKFA 5B2ZA 3QKSB 1QHYA 2J59A 5DI9A 1AGRA 2L0XA 3AH8A 4CEJB 1CXZA 1J70A 1XEFA 1XD2A 4L16A 5DYGA 2NG1A 1Q3HA 4PTLA 3NDBB 2ZSEA 3VU9A 4UNQA 5L3QB 5KSPA 1KMHA 4KO8A 1S9HA 1NKSA 1Y3AA 2ORIA 1G17A 3UWOA 1R0YA 2J3EA 3VR5A 2GJ9A 1Z6XA 5BWMA 1ELOA 5BW8A 3FWYA 1E9CA 4GP6A 2BC9A 3UMSA 4QRHA 3VR2A 1WCV1 2GXQA 4BE7B 4AKIA 2NO1A 4JYCA 5H70A 1QHSA 1R8QA 1JAIA 3NKVA 4D4LA 3TJZA 1GM5A 4BECA 4QBGB 1ZCAA 3TVTA 1XTRA 2QPOA 1QHNA 2IYZA 2ZRNA 4TLAA 2J45A 2B92A 4Z1MD 3CPEA 2DPXA 5M04A 4IRUB 1LB1B 3WBJA 1HTWA 1ZUHA 2VBCA 4RKFA 1ZD8A 1G5PA 3QQ5A 1E1QD 4Q4AB 1E2EA 1PUJA 3GLIB 2Q9BA 3W6NA 2AX4A 2JJ1D 4MRSA 3RLFA
chains in the Genus database with same CATH superfamily
5JV5A 1JNXX 3A58B 4UD6A 4DN6A 3OJ0A 4WV3A 2JEYA 1N9GA 1UM8A 3ADPA 3Q9NA 2FEPA 4C2TA 3CLRD 3E7XA 4WOJA 4MW6A 4K9QA 3RVMA 1F8XA 4QFMA 5HDBB 5A4FS 5HZMA 2C5HA 4IV8A 4UEWA 5AQ1A 2ZAOA 4M1OA 1COZA 2H1RA 2OEPA 4K5QA 5BP7A 3H75A 4DQDA 3JPYA 4BV3A 3EUEA 1W0KA 3NIBA 3VPHA 5EP3A 4WBXC 4MB6A 3D6TB 4UZSA 1KVSA 4QG3A 4MV8A 1EUYA 1ZX1A 1X42A 2IQ5A 3GVIA 5FWDA 3V1MA 2HJHA 1HF3A 5CHEA 5F2NA 5KYNA 3JQGA 1B0PA 3EEBA 4KPYA 1TIBA 2HH9A 5JANA 3R3XA 1CF9A 3VYRB 7ABPA 4GKAA 3DFMA 1TUEA 1YHYA 1EWYA 1ZZGA 1F0NA 2JCSA 2WWWA 2NYAA 4NBLA 2DWUA 2IWRA 3TZBA 4HNUA 1SQ0A 4EGQA 4G0WA 1PJ4A 2G5TA 3JQCA 1Z88A 1Z4OA 5DFAA 2HBZA 4TVSA 2J30A 1GITA 3V4FA 3F97A 4I50B 1GNQA 4DPKA 4FP9A 1S2IA 2YV3A 2HKIA 2GM9A 4JJ7A 5C4GB 3ZHXA 1L7AA 2FPPA 1Y89A 3B9PA 3HDHA 4A03A 1VI2A 2E2WA 3BGOS 1EXDA 4RTJA 5EQTA 4CM3A 4KREA 3C7CB 1NOIA 4F9GA 3NTLA 3B6JA 4TMKA 4F60A 4GRIA 1SVIA 3EZXA 4URUR 3P5BA 4JENA 5FI0B 1VLZA 2BFAA 1DXYA 3BRWD 2Q5LA 1CT9A 2SKCA 3X1XA 2IPNA 5EE1A 2YYSA 3LWDA 1P8AA 3DE1X 2ADMA 1MQAA 1E7RA 1E2PA 3UJ7A 1MRSA 5IABA 4U7WA 1BCRA 2UVPB 1TK3A 3SEZA 4EG6A 3BB1A 3PGKA 5J5AA 3DDNA 4MVJM 3QVGB 2I3ZA 4MTLA 4OPMA 2WLSA 4MQFA 1CIVA 2AJDA 2PJDA 1T3LA 1A88A 3PTLA 5BYJA 3SG0A 1SU4A 3L4KA 3QBDA 2M9MA 1KFJB 3ZCTA 3MBIA 2VZ9A 5LR6A 3MRTA 2DG2A 4BFLA 1MBZA 1DAEA 3PFWO 3H1TA 3F6EX 3PBKA 1L4BA 3QJGA 1YH3A 1ZKMA 3T5CA 3UAXA 2JIRA 2I62A 4CL3A 4PAQA 4KUHA 4ZREA 2C9BA 4K3UA 3KFXA 3BDIA 3V33A 1LF5A 1TJ5A 1F1BA 1V1JA 3LUDA 2I1VB 2V65A 2ZJ8A 4OHYA 3SFVA 4QO8A 3EW9A 3SC6A 2ECKA 2NUBA 1IDN1 1QFMA 1YR2A 2Z5LA 4YACA 4AF6A 5B2EA 2XNHA 3C24A 4TS3A 4RJIA 1Z0DA 5BWCA 2X0FA 4KVAA 2DT8A 5KOHA 1GPKA 1QWSA 4XIJA 1OYWA 1WLSA 3MWLA 4RAOA 2F43B 2GH1A 4Y18A 1QHXA 1DO0A 1Y37A 1T8TA 1IMOA 1CUUA 3IR7A 5JLAA 2ORED 4EGCB 1ZI8A 3GUVA 4HUJA 5E9AA 1FDVA 3ZDQA 5KNBD 5ED0A 2EHDA 3KVNA 3NRCA 3AF1A 3PC6A 2XDQA 1F2TA 1J1ZA 1MAVA 1QG6A 1C7EA 3TRKA 2B4AA 1M1ZA 3TI9A 2GYUA 4NYIR 4F5DA 4TYNA 1CF2O 2C8KA 3DKRA 1EEHA 5DM1A 2Q4TA 3PNBA 2R1TA 1YK1A 2AEFA 3NHPA 4RFLA 4O4JA 4B6JA 3AY3A 1OC2A 4MUBA 1N2IA 2D2FA 4TVBA 2X5KO 3GJZA 3WRWA 1GWNA 1JDBB 1XMJA 1H9AA 2C00A 1A7UA 1WU7A 1PS0A 2J5RA 3AHIA 2BFCB 1TAUA 1EI9A 2OXFA 3D8UA 2CYAA 1NAIA 5BUQA 4WK0B 1HT3A 1ND5A 1DCFA 1WEHA 4FKZA 3W77A 4E5SA 1GRNA 3GF4A 1JZTA 3L9XA 2O2JA 5IS2A 3VZRA 4E51A 1INLA 2ZBPA 1NKTA 1WE2A 4EA7A 1GZ4A 4OJQA 1PGJA 1N2OA 5AVJA 5CB4A 4H77A 1WP9A 4CQJA 2FWMX 3TSYA 1W44A 4ML3A 1QP8A 5CURA 1D2NA 2IQIA 4DRXA 1SCQA 2VSFA 1FBTA 3OJXA 1JX6A 2AB0A 2C5LA 1G4UR 2H11A 3G0DA 3K9LA 5CVTA 3EPJA 1IVYA 3JRWA 5DIFA 4E7PA 4DB2A 5L53A 4Z9AA 3TTTA 5HUJA 1K88A 1TO2E 5INTA 4Y2JA 3HY3A 3ZWWA 4CVNA 5FHQA 4AS2A 4JYMA 3GRVA 1T2FA 5I4CA 4R71A 4B43A 4LF9B 4GLFA 4LGCA 3CQ9A 3J81A 1CY8A 3FA2A 2XTZA 2NO9A 1I3LA 4PR3A 2ZT7A 4HDRB 5ALZA 721PA 1IEQA 1AGXA 1YR6A 3BMOB 3U5ZB 1XZQA 2UYHA 3PENA 3VNRA 1H65A 5LCXA 2FUNB 5DIZA 1NI4A 1YCHA 3TLKA 1CP2A 3EC2A 5TMEA 1VBKA 4C4AA 4R9RA 4EENA 2HMTA 4D7AA 4F3RA 1XKTA 4D8WA 4Z4GA 3KQPA 4NF2A 4U6SA 4DDVA 2FE4A 1GPAA 4ZHQB 1G8MA 2ZSBA 1PRYA 1RKQA 1NE2A 3KO8A 3UYLA 3T1YB 4WNAB 3P2EA 1YMQA 2CLMB 3KJHA 4DNXA 3LQFA 3TINA 1JQ5A 1PEYA 3ZTYA 3G8BA 2FPGB 4QRIA 1KJZA 1H8HD 3I8SA 2FZGA 4X1YA 1BDJA 1JSCA 3P5SA 2WWHA 3P9PA 3IDAA 5IAEA 3R3VA 4HGYA 3GJRA 3AL2A 1J6UA 3JQ9C 1CUCA 4MUMA 5DBOA 1QQBA 4XUDA 1GPBA 3A1DA 3GJ3A 1SQ6A 3N8IA 3EGDB 4RA6B 1ISHA 4GOKA 3RROA 1XTSA 4GWGA 4H1VA 3DLAA 2C0PA 4S1VA 5FOVA 3LBAA 4UVDA 3B36A 5KI6A 5H3CA 3F1LA 4DAEA 4LG1A 3RUEA 4YXFA 2Z6AA 1DARA 1M0WA 2JJMA 2OC9A 3EXEB 4NEHB 3R3ZA 2UU9B 3QXJA 4R5MA 3TOVA 2WWIA 1XA3A 5EHNA 4D3YA 2IBTA 2WLTA 5LYJF 1G2PA 1C0EA 2KS6A 2W90A 3OD5A 3H2ZA 4MRRA 4LFCB 4AZ0B 1GQSA 1Z28A 2O2DA 3OU7A 3QLEA 4TLMB 1NVVR 2JA1A 4HS9A 3BCRA 5KQLA 5CDSA 4MV5A 4KXMA 2IYYA 1T1RA 1ORDA 1CULC 3F5MA 4NHEA 4XXHA 2JZOA 3H7AA 4M46A 3DHWC 3LKDA 1EFLA 1MN6A 1KYXA 4S1TA 2CNNA 3E5HA 7REQB 1UXGA 5KDOA 1UBLS 5LWHA 4L3VA 4NENB 1ZVQA 1G60A 2XHZA 2IBSA 2LPMA 4IG9A 1JEDA 5LB2A 4BNNA 3VO8A 3T94A 2E9SA 3FW1A 1UOQA 3MTDA 2P41A 2X3FA 3E5RA 1U8TA 2RJNA 3DE7X 3LQ2A 3C7DB 3QU4A 4B3BA 4BFXA 5HKAA 2W6ID 3ZZUA 3LSTA 3X1YA 4DLTA 4EFKA 2LGJA 4IINA 3R0JA 4YAJA 3TNLA 4DIBA 4EY3A 2R5WA 1NBMD 1JFFA 1ZGBA 2EKPA 4ZCIA 1FYFA 1WABA 2G9RA 3JQQA 3JWGA 3EMVA 3VJLA 2HX1A 3PLNA 1LS6A 1II9A 4UHCA 1V2HE 2PQ6A 1U3UA 1B41A 2DHQA 1I4TD 1WIWA 3T1OA 2XYRA 4PV7A 1V5GA 2HMAA 2G1UA 2H2WA 2QN3A 5TPZD 1WCXA 2D0DA 1VBFA 2PLFA 2XMCA 1EESA 5E3IA 1DKLA 2CJWB 1HE1C 4ND8A 4XX0B 2J7PA 3PJRA 1S8OA 1H1LA 2BHRA 1O8BA 1ORTA 1OXSC 2OENG 2OO5C 2OZLB 3EEIA 1SBCA 4HDSB 4HDOB 4KXWA 1ZMXA 2AZTA 1ZM4A 1OF1A 2NUTB 4ZCPA 5FV4A 4JP5A 3JQ7B 4NPHA 3AESA 1R12A 3SXPA 3ZN2A 2ASVA 2YW9A 4X1OA 3TECE 1U80A 2W6PA 4CNBA 4EHKA 5EQJB 1P9NA 3H42B 2JZNA 3S27A 1WS6A 3GBPA 4C0KA 2FSIA 3EQZA 1B1AA 5DTIA 2PAAA 4KU4A 4B74A 3QEAZ 4ODIA 2BBWA 2WHQA 4CKZA 1AKMA 4XD7A 1Y8QA 3OECA 1KJYA 3S70A 1W4CA 5E2BA 3E3LA 4YV7A 4EY4A 6AT1A 2BH9A 1SXJA 5THQA 2PX8A 5GJVC 3TGPA 4KAAA 2D2EA 1KYYA 1XZDA 2XOEA 1WY5A 4M0KA 1QVRA 4MP8A 1S3GA 1PZGA 2FWJA 2C88A 1QVVA 5DCUA 4Y1FA 2G08A 1EDDA 2V7TA 3FTDA 4BQRA 1BYUA 1JHMA 2BBSA 4OXKA 5IBRA 3VNQA 3ND5A 3K0FB 3FDFA 4WKCA 3UPUA 1AC5A 2DR0A 2M1ZA 1K0FA 3QPAA 4NU6A 3I8OA 3OHPA 4IVNA 4FU0A 4KXXA 4RK0A 1ZSYA 2X9NA 2O8BB 1VE6A 4QPCA 2GXSA 1V43A 3OZTA 5DN6A 2OFFA 5E4TA 3JARA 5LDDC 2A5DA 1ZR4A 1JKMA 1JAXA 3PDHA 4UHKA 3D8TA 4LCEA 3VHRA 4IJKA 3GZNB 1DC8A 4FQ8A 4OQMA 3D02A 1N5LA 2J0EA 4WOBA 4RTPA 1JSZA 4OK5A 5A0FA 3W34A 5AW9A 2QL9A 3U3MA 5K09A 1U9JA 1VJTA 3C4QA 4KLNA 5FFMA 4WZAA 1H6BA 1T0JB 2PUTA 5TGTA 3B9QA 4MMZB 3ZXUB 3V7YA 2ACWA 3G2JA 3KVRA 4LWOA 5C32A 3HA7A 5EOVA 4RTQA 2QT9A 2J08A 1U99A 4KLCA 3HXMA 3WA7A 3T1QA 4MAFA 3JQFC 2FEAA 3PLRA 3UWPA 2XQIA 1ZJ6A 2Q2QA 1J56A 2VF5X 3TFWA 1IK6A 3OCVA 1C7RA 3URKA 4QM6A 1DX9A 3PT5A 2XUGA 1KDRA 3ZXXA 2QTHA 2OC4A 1D6NA 3N86A 2XB8A 4PCUA 5J1TB 1MW8X 2IPAB 4G0NA 3L6BA 2O3QA 5DX0A 5TR9A 3KUDA 3BOSA 4NYMR 3O2JA 1I2ZA 4IUDS 1Y98A 3EVDA 4TRMA 2I4TA 2J6CA 5CXSA 5T3UA 4DJTA 1EM8A 5JCZA 2WWYA 2YCLA 2B30A 2NAFA 1MLDA 3Q3IA 4FDTA 1A1SA 3RD5A 3TM5A 3RYFB 4RHUA 4OFBA 3N76A 3I12A 4NOLA 1P0PA 2Q3BA 3LHDA 3TD6A 3VR0A 2Q5CA 4MW4A 2ANBA 2PD3A 5A04A 3NB0A 2VJOA 5H59A 1JA9A 3HU2A 4W9MC 3G2KA 1WWKA 2GN2A 1DPGA 1F06A 2RGAA 4DM3A 1L7DA 3S2FA 1G9TA 2BV3A 3WK6A 2VXCA 4PAGA 3IAFA 4HNVA 1DTEA 3WYAA 3K0EA 1SRQA 2XCOA 3OVMA 4FYMA 4N5NA 1VLJA 1YZHA 2A3NA 2O7NA 3GEHA 3NEPX 4PZPA 1AG9A 3AEUB 1XG5A 1XMXA 4KRGA 4WBNB 4FFDA 2ORYA 2G0TA 2OO3A 3Q7IA 4NYJQ 1V4VA 3N8GA 1UDWA 2PY6A 4R1TA 4EHNA 2IZ7A 1A2KC 1NBOA 2XR1A 1SXPA 3RUAA 2O9JA 2RH9B 1P2UA 1C0PA 4LXTA 1T5IA 4YBZA 4JHLA 1PQYA 1NJ5A 3DOEA 2CFSA 3QK7A 3BGDA 4G5XA 1YKGA 1JPNA 4A6XA 5JJKA 1WF6A 1J33A 1T26A 1C30A 4Q4HA 1WVMA 4LY3A 1DJQA 1Z56C 3SDZA 2PE5A 3FOCA 4BZZA 2RHLA 4NQRA 4BNDB 4GXTA 4PAWA 3HB4X 1FS4A 2ZCUA 2DLNA 4KQFA 3KYCB 4OXQA 3AR8A 5IKPA 1JJBA 1DXOA 1PCXA 1W9MA 4J1TA 4WA7A 1MX9A 1YR1A 3ZU2A 3KKPA 4CM9A 2O8DA 1RWWA 1YVRA 4JOCA 1X8LA 2GJAA 2FG7C 3A32A 5DH9A 3V1TC 2HTFA 5DM60 4EF5A 2HQBA 4YYZA 3G82C 4YAUA 1K6MA 2OILA 3V2HA 2XZLA 2JGNA 4RTMA 3UHOA 3KRTA 5BSUA 4AZWA 2BFBB 4BLSA 1CE8A 3EGOA 4HDCA 5IZCA 1UJMA 4KOEC 2ET6A 3RBVA 4C7MA 4KMMA 3CF4A 1YI8A 2FUG1 2ZIWB 4WPGA 1P7VA 4FN4A 3JQGB 2H5EA 4LBYA 3FVRA 3VO2A 4EOGA 4RFSA 1M5UA 2GI4A 4LRTB 1P2BA 1VMAA 2PU7A 5H9WA 2DT5A 1XL0A 3P2JA 4CQMD 1XNJA 2J7KA 3PFBA 5E38A 4YRBA 1TEVA 3DOJA 4OREX 1BRTA 2BWJA 1Q3KA 3HKBB 3JSAA 5K2OA 4W6QA 4EI9A 3F7OA 2J07A 1EE1A 3B60A 4AFNA 3ZW8A 3IXMA 1FTWA 5TF0A 5HJ2A 5AVUA 1EFVA 2O14A 2FQ1A 3CPJB 4DV2B 3A2MA 5TMBA 4LBWA 2WT9A 1ES9A 1Q7CA 3IMEA 3KAJA 2ZE5A 4Z9XA 1BQEA 2VSXA 3RSHA 4MS1A 4HRVA 2ONKA 3E3NA 4WRRA 3NHAA 3CJRA 3C1AA 2ZU6A 2QXTA 3NASA 1SHUX 3CNBA 3O8LA 4HUQB 5LSAA 3BPSA 1TZ2A 4GOND 4MQEB 3RKRA 1H0HA 3NOXA 1JV2B 1N5DA 2GCOA 3A1NA 4J0CA 4E5PA 3VA7A 3BJEA 1GDTA 1I10A 5DNVA 3KYIB 3RSCA 3ZQJA 4EH1A 1MO2A 4LY9A 5JATA 2AN4A 4L9SA 4RVNA 2W58A 4NK5A 2IS6A 3U1TA 2YZKA 4KQJA 1QMGA 3R3UA 1Z26A 4JKIA 4OSOA 1USIA 1J2RA 5SYAA 1FRZA 1RE1A 1XDGA 2I6TA 1BU8A 1YVEI 3RS3A 2VN8A 3O3CA 3OLVA 2ECPA 1L5QA 3F6YA 1O94D 1UBKS 2WOJA 3BBLA 4MKZA 1PJCA 3PEUA 1QNLA 3IDQA 2O3JA 4Q16A 2ID8A 5IVHA 3K70B 1J22A 2V5UA 2WQ6A 3CLUD 4WJLA 3I5UA 1M33A 1YHNA 1VL0A 4JU8A 1TPZA 2QM0A 3BMNA 1M74A 2P30A 4EVSA 1QP7A 3FJYA 3R6WA 4PC1A 5KOHB 4B7CA 1JIUA 1R4MA 1TMOA 2Q5OA 3KWMA 2C29D 4Q03A 2IHYA 3OEED 1DG1G 3TZHA 1EJBA 2VYVD 1NW5A 3EIXA 4JKOA 3GNTA 4DLNA 3RUIA 3U31A 5I5EA 4KMOA 2HIAA 2OHXA 2W22A 4EO4A 2ZI9A 1SC6A 4DQVA 3UWSA 1D0VA 1BRMA 2WU3A 4FR0A 5HZKA 1GSIA 3CEAA 4OLFA 2GN9A 1VPTA 3CE9A 5DTQA 1P1BA 3T06B 1HE8B 2HYIC 4DR6B 3GCDA 5K0SA 1CJMA 4I9HA 4XWGA 4WFIA 1ZLYA 2O5CA 5JQWA 4NDZA 4PHFA 1O9GA 2B98A 1NLMA 4ZJUA 1CV2A 3FFWA 3OWXA 5C8VA 4MVJI 4U2FA 2HCFA 4MLCA 1LRKA 4LRUA 2V9CA 2Y1WA 1KE2A 3PHHA 1UWLA 1Z4KA 4C0XA 3W5SA 5B58C 1P1RA 3GLFA 3TW8B 2FP4A 1E8MA 2OCIA 2RHWA 1ABFA 4B75A 2BRUC 2P78A 1GZDA 5EJAA 3ICVA 5DCLA 2JIBA 1LVGA 3RLIA 2WA1A 4JBLA 1LUAA 5DXAA 3SYKA 3VTAA 5LZ8A 3ZUGA 1E5VA 2VDRB 4FD2A 2CXTA 4B6SA 4YONB 1W59A 3U1BA 3PL1A 1JFLA 1HPLA 3RBXA 1C3EA 1SU7A 4JLAA 2GJKA 2RKWA 1KSGA 1UBRS 2NPFA 3PV0A 3LQKA 4OK3A 521PA 1FX0A 4WGFA 3QVUA 2VP5A 3FYHA 3LCJA 1MJGM 1UKEA 3KOZA 5HX7A 1H2YA 1M8JA 3SSMA 1NF8A 1MHPA 5TVKA 2E4WA 2R1VB 2I9PA 3LBHA 3WIBA 3A9RA 4RIFA 1U1CA 4FNOA 4J76A 1YBAA 4UEOA 2HBYA 4DY6A 2IA5A 5H9VA 1R7RA 4NCAA 3ITNA 5IF9A 2DULA 1CQIB 2SBTA 3BICA 3QWAA 4RF3A 3MJRA 4OHZA 1W5EA 1X14A 3H4VA 3JD4A 1CZKA 1FQOA 1RYEA 5HJ7A 4RMNA 4QVGA 1JHRA 1CZUA 1NI4B 2JIQA 4I9GA 5E6RB 3ULKA 3L5KA 4WD3A 2ODAA 4NQZA 4AJIA 2QKYA 3A70A 1SVUA 4KXFB 1Y3FE 1E0SA 1UKBA 2FB9A 3ERCA 3IP1A 2V4UA 3DHNA 3FAKA 1FB5A 2AFRA 4YI3A 3V42A 8ADHA 1T29A 1N6LA 4HLQB 1LC0A 3RO7A 1I3NA 4Z0HO 4S05A 2HK8A 1ZXLA 5LLTA 5JNUA 4BO8A 3H5OA 2F1HA 4YJKA 2CXPA 2JGLA 4GFDA 2X0IA 3S5UA 5IJZA 5KWSA 2HD4A 1NFQA 2DQKA 4L4ZA 1ENOA 4Y2SA 2AOVA 1JDJA 2DH5A 3CIOA 5DV9A 3VPBA 3IEIA 3VX4A 5C7YA 2VTDA 3LHFA 5HXAA 3QPDA 3E61A 2WWFA 4Y7CA 4YCAA 5EESA 3UB4A 3VUEA 2RGXA 3T0IA 4EGSA 4FB5A 4CEIA 1T4CA 4M0UA 4K0RA 4TMWA 1FZQA 2G8NA 3GFBA 4RK1A 1MO3A 4WCVA 3ZU6A 2A1UB 5F7ZA 2VDVE 2OAEA 5A9SB 3S2IA 1RLTA 4IS3A 4PFJA 4RPKA 2D74A 2OO7A 3OMLA 3G9QA 3DF9A 4KQ9A 4UU0A 4D8YA 4DA0A 4QO7A 2N47A 1YBFA 4NNPA 4M89A 4D42A 2DERA 1BE0A 4C2BA 3HYTA 2PT7A 1C5KA 2I6XA 3JYLA 4RLHA 4RZHA 5AVOA 3ZI7A 5JW6A 4FEYA 4QPPA 3BCUA 1U6KA 3WRXA 3BUSA 1UZMA 2I5PO 1WY7A 4RGVA 4WBNF 1ENYA 1KMIY 1XTUA 2E4UA 3ZWKA 4CCWA 3TZEA 4D4KA 3OOHA 1R0XA 10MHA 1Z4IA 5AW5A 2TRSB 3G2OA 1R16A 2G28A 3OKAA 4PLPA 3W9YA 5BN3B 5KVSA 4PS0A 2QBYB 5KPDA 4BNGA 4F8YA 1MTOA 3V4ZA 2ZYGA 4ARUA 2SKDA 1N9KA 2OCXA 2QUHA 4BNHA 1HG1A 4WEQA 3R7WA 2X14A 3PE6A 1AD2A 1VJ5A 3PPWA 2EZ9A 2XZTA 3CO5A 2PUBA 2ZRMA 3QUBA 5DNEA 2NPIA 3ZWBA 1Z8DA 3N0VA 3C5HA 3OTIA 4UE6A 4K9NA 3R8FA 4QHTA 2CUNA 4PQYA 2CT8A 2O3TA 3DB2A 4ZVKA 1X7GA 3OIGA 4V3BA 2BFFA 4Q7JB 1UODA 3WA6A 4QLAA 1L0BA 1OZHA 2ZIXB 3V4VB 1K63A 1Z07A 3IDOA 5CFPA 1OBFO 3HY6A 3V8BA 3E9YA 2CF6A 1ESCA 2PZFA 3AF3A 3KHKA 4I81A 3HUTA 3W8RA 4CGZA 1R64A 2NACA 2YHBA 3U3OA 2VYNA 4HTFA 3WTBA 3GJTA 3VI4B 3NR2A 4IG4A 2BR5A 3LUPA 2Z43A 2DFDA 4YJGA 2YIDA 1C1DA 3K2BA 2QTVB 3AESB 4M88A 5FPHA 2XOKA 3E9NA 1KFBB 3VBCA 1XRQA 4DIOA 1N7HA 2PAFA 2RJOA 1KSHA 2JASA 2C84A 4R81A 4DA7A 2EU8A 1X6VA 4WNIA 4ETMA 2V7QA 3IKTA 2IYFA 3OFVA 3VOSA 4IDDA 5C31A 4N5IX 2G1KA 3WNZA 2QMZA 4R68A 2XYHA 1AXEA 2VP6A 1G1MA 4MARA 5K8IA 2X7XA 4MJ3A 3PDWA 2WHPA 1HQYE 5BW6B 2BPOA 3SM9A 3C6MA 4X6YA 1C1YA 3S28A 5AOAA 2DBYA 4ZV7A 3TUZC 1JLRA 1T9GS 1ZIOA 2X8AA 2PS9A 3OCZA 4HVCA 2AJ8A 4XGNA 3BWEA 1IXYA 1JIIA 5DHQA 2PXHA 4I1OA 1K27A 3U3ZA 2LP4Y 2F2TA 2NV0A 3F9CA 3NS7A 1C4OA 2ONCA 1HC7A 2PSHA 1N2EA 1D4AA 3BFVA 1Y1LA 4M1QA 3I9KA 1TAQA 4CIWA 1IBKB 2QE7A 4KCGA 1NBAA 4Z7QB 5FH9A 4LS3A 5FNVA 3WIVA 4A82A 1WSBA 2K6GA 2VAVA 2W8BA 1NVFA 1NP6A 1V11A 4RMIA 2NVUB 4D9IA 1C3VA 2IIVA 1X1QA 2DE0X 3QUAA 2QM7A 3AP3A 1VL1A 2FEOA 4I3GA 2IYOA 4MWBA 2NVOA 3AY7A 2GZ1A 4C89A 4XTCS 1PDOA 1KMCA 1KH2A 2O0MA 2PZKA 1H6CA 4N03A 3G0IA 2AN5A 2IYPA 2YY5A 1ZUD1 4B3RB 1C3OA 3QBJA 3RIEA 2Q5IA 2YV1A 3IT0A 4RLQA 4KGZA 1ZK3A 3KZVA 4EQZA 3D7LA 2X1MA 3EMBA 4D3SA 4M83A 5COBA 2AFHE 2QA5A 3V00A 4CF4A 2V6MA 3CVVA 1CW2B 1YJCA 2FW9A 1C9JA 4OJNA 2R1UA 2W6NA 2IHUA 1KKLA 4EUEA 1TQ4A 1YQWA 2E0IA 3CRZA 1SOVA 2PZEA 4XWAA 2AV6A 2KB0A 1YZLA 4DTCA 4IP0A 4V1CI 3F5SA 5ALDA 1H1DA 2E49A 2A67A 2C4KA 2CHGA 4DTIA 4BUCA 5CA1B 2ONJA 1YSCA 2AE2A 2JIZD 3I1FA 1Z2NX 4V2IA 3M3DA 3SYMA 3C3KA 4NOMA 3AEYA 4C87A 3FHOA 2EDAA 5DW3A 5K05A 2PD4A 1W0JD 4KV7A 4GS5A 2ZIGA 4R8RA 3MYYA 4J75A 4B9AA 3PUZA 4FIZA 3W3AD 2IXEA 2JAUA 3HKCB 3JRNA 4FCTA 3KL4A 4J9UE 1AA6A 2AOWA 2P6UA 2VJKA 4BATA 2ZBUA 4QU9A 5HCNA 5TGZA 4JR0A 3GGCA 4IZIA 4KYUA 2YBDA 2YDXA 5I4BA 4PQFA 2MR6A 2WTBA 1GDDA 2XA1A 5D3MA 3FYCA 4L8WB 1CG6A 5JNLA 4MR8A 4BVGA 1OKKD 1SVSA 4TYMA 4W5JA 5B1DA 3LWBA 4YP5A 5TJHA 5KNDH 2X5NA 5E4YA 4DDUA 3ACDA 3QU5A 4ZI7F 1QS0B 4IQ8A 4O4IA 2CL6X 1XZIA 3X1KA 2QR5A 1JJAA 4LV8B 2ZDHA 1ZGCA 3VM6A 2UYQA 1KQ3A 4AW9A 3MLBA 4O4JF 4TWIA 1FP2A 1MVOA 3PHGA 1D2GA 1YBMA 4QUAA 4U00A 4IH1A 1SXGA 4WOPA 2TSYB 5A7HA 2HHLA 4HEHA 4YGYA 1MGOA 3HLYA 3EH1A 3GT7A 3V9PA 4B32A 2QW8A 2VNAA 4G0ZA 1PZEA 3V4SA 5HGXA 2KMLA 4MVJE 3FDIA 4UXJA 1DBSA 4TSFA 3ROQA 5JSFA 4QPZA 5FTKA 5DLQC 4X64B 3FOZA 2YHIB 4TT3D 2Q28A 1FP7A 2BJVA 1QE5A 3T7CA 5CB4F 1CVRA 2PIDA 1Y4AE 2FVYA 4ZWNA 1Y3DE 5LQRA 1B8OA 4A1OA 1ISPA 4JOBA 5I3CA 4R1PA 4E5VA 5TPWA 4GYKA 1JDTA 2CLKB 1KH3A 2OHFA 5CYFA 3WFJA 2V0CA 1HDZA 3UAYA 1TZKA 1IAQA 2FSSA 3ANXA 1HE5A 1PVDA 1QPGA 3JR7A 4PXSA 4P5EA 4BMCA 1OC4A 3AFMA 5IF3A 1AHIA 4JLOA 3EISA 2IUFA 5EI5A 3QNUA 1U3DA 3L8DA 2JIPA 1U3WA 4DMFA 5ICMA 1CE8B 1MH9A 1OXMA 2CUKA 4P83A 4S2EA 5EJGA 4DG9A 2G07A 3L84A 3T15A 3CBGA 3QFHA 4ZAXA 1EX7A 3A4VA 4Q3AA 3RF7A 3RVRA 2VK8A 2P1ZA 2C3UA 4FFLA 4F6LA 1A4XA 1TF2A 2NNLD 3QKUA 4P84A 1QQTA 1IB6A 1RKVA 4HPJB 2BLNA 3H65A 4TKMA 5DMXA 2FV8A 3CSUA 1KETA 2HLDA 3E5NA 2O7SA 2Q8QA 3HFRA 1S02A 2QAJA 3HRKA 5EUBA 1NW3A 1PNQA 2NZVG 4JP3A 1DCTA 1PR5A 3I0MA 1RQLA 5FQNA 4QLBA 5SZIA 2I3GA 3TQFA 4BP9A 2XWBF 4UM7A 4QD3A 4EATA 3QPVA 4LFBB 2F8TA 4C3OB 1GAEO 1QFSA 5KB3A 1ITZA 3WFIA 2JKZA 4F5WA 2ODNA 1S0UA 4FGSA 3WLTA 4FEAA 3GP8A 3IE0A 1QRUA 2MYPA 4IEEA 4MS1B 5EINA 3DOUA 3RC9A 1JPVA 3LFHA 2VRCD 4JI5B 3TD9A 2CLOB 3OOSA 3VU3A 4MWCA 1ADJA 3WLEA 3SE7A 4YT4A 2VRWA 5BW4A 4UTZA 1NNEA 1KFCB 3DOCA 3S1AA 3U4MA 3LP5A 3IOCA 2IPLA 1UK7A 1F48A 3NOOA 4LJ9A 3MHPA 4L85A 4TMXA 1PZFA 2XQGA 4UDNA 5DSTA 4KQXA 3NVAA 1CQZA 2F9FA 4Y6PA 3UTDA 3L8FA 3L6UA 1QWOA 1VCNA 4GBJA 3T41A 3NW9A 3O2QB 5E9QA 4ZAGA 2Z58A 4FMCF 3RASA 1AN0A 4NDAA 3WHPA 5J4YA 2CWWA 2E1PA 2HPZA 1ML4A 2FHPA 1ISFA 3T5TA 2EFDB 2ZJ2A 3A2LA 1J0XO 3CR3C 3DLTA 4PHTA 3FF1A 4TV8A 2P0AA 2YJGA 2VP0A 1KDOA 2R65A 4HWTA 4MUJA 4XLLA 2CL5A 3PD0A 3BCHA 3V46A 4A2QA 1FQJA 4RL6A 3KSDO 4EG3A 4ZAZA 5AESA 4NR0A 3BJRA 4RWEA 1L5SA 2GUGA 4TX1A 4LHWA 4Z4IA 2HOQA 2XKAA 3TSAA 4QUEA 2Z1DA 1M7BA 3QPBA 1F8YA 3EG9A 1NYTA 2ZAGA 3VKVA 3R7AA 2Q7OE 1N0VC 1Z63A 2R8XA 2XUDA 1RWNA 2OORC 3O7WA 4J1QA 3DMGA 2ZRHA 3CNQS 5AUOB 3B1VA 1CHNA 4P3YA 1NT2A 1M2KA 1X7WA 1PQUA 4YRRA 3RV3A 3FKJA 1O4VA 3S68A 4W5NA 4AN1A 3EIUA 1M66A 2ZIZA 2UZ1A 2RC6A 2H1HA 3BXZA 4K26A 4P3XA 1QTQA 1B8NA 2HNKA 3CZAA 4G1FA 4N7RA 3ZDRA 1R37A 2VHJA 4PZDA 3ZV4A 4TMZA 2I3AA 3ZDEA 5J5CA 4PBRA 4LEIA 2BKUA 3JATA 2JCBA 4KO4S 1IBSA 1M1NA 1U2SA 2H6EA 3KV3O 3ER6A 3K0HA 4D56A 2XE4A 4XWKA 4BKQA 4ENVA 3GFGA 3L7MA 3SIPA 3A7EA 3QA9A 1NMSA 3OIFA 3UK6A 3P4UA 5LN1A 2VBGA 1ZG3A 3C3WA 3JD3A 2XVXA 3M6WA 5G1PA 4OYLA 2IOFK 3HU1A 4MUAA 2GUWA 5LJIA 4NICA 4PZZA 4EX7A 3CYFA 5JCOA 5BRNA 4MW7A 4B40A 5C37A 4ID3A 4G5YA 4AC9A 1KK3A 4IBOA 1NJ6A 1U9YA 1C9YA 2HTEA 3NU1A 1EVZA 4LRYA 4B79A 4ERNA 5A5EA 4RIEA 1BG6A 3HZZA 4OHFA 1HZJA 3ET4A 2O48X 3ON5A 1IOVA 4HDAA 2IEYA 3EXHB 2IHJA 4PAMA 4QOHA 1HK7A 1NVBA 1QKKA 4NAUA 1M75A 2QSJA 1ZLXA 4MYSA 1KO7A 1DAGA 4P0TA 4U63A 3SC2A 3WLRA 1ZD4A 4WKPA 2YMLA 3Q41A 5CM9C 1GG8A 4IMJB 3TTXA 1N2XA 2PZLA 3CY6A 4FDVA 1M6YA 1A8UA 3OG9A 1CUIA 4I6JA 3REQB 1XRSB 2YH2A 1NY6A 1TUIA 3ZLUA 1L7RA 2AC7A 2Y0DA 2PH1A 2A88A 1DC6A 1XEAA 1CJTC 1POWA 1RPJA 2VSNA 3B9BA 3NWJA 1I2MA 1FS6A 1C7IA 2ZGVA 4JT4A 4Y0AA 4AO7A 2C5EA 5LNK1 1BQ4A 4YFVA 1L6IA 1UFQA 1E92A 1T24A 2MDTA 2BGUA 2ODBA 3JYQA 5DGDA 5P8WA 4TM7A 4L5AA 1XD2B 1XZCA 5B3JC 3ZD8A 2W4MA 3MM4A 1E1RA 1AZSC 1I4DD 4XGKA 1TLTA 4EO7A 3VU9B 3H0KA 4CTKA 4AUMA 1KWKA 1UEXC 3BFJA 3BSWA 3W5JA 1E58A 4IDFA 1FSFA 1FTSA 3JALB 2O2EA 3CB4A 3B38A 3MEQA 3DZKA 4GI2A 3AHDA 3CXRA 4K9PA 4LW8A 4P8RA 4XQCA 1YDGA 3K30A 3JYHA 1PAUA 5CLHA 3BA6A 4G0XA 4G2TA 4HWRA 5AJHA 1YA8A 2V7PA 2ZUVA 5GIOE 1MXFA 1OHHA 2QUJA 4LV5B 2WJZB 2X3YA 4ZCLA 3CX4A 4ZI5A 1MX1A 5L6MB 5LU9A 2QN7A 2WKQA 5KYUB 5K0LA 2R3SA 4ZFNA 1V47A 2QN8A 1ZUWA 4ZXPA 3VSCA 5IKMA 1KEEB 2GEVA 1GQFA 2ZWIA 4YJ3A 3FPAA 2ZUDA 1F8UA 1XZFA 1DO8A 5H81A 3DE3X 4RIGA 4OKIA 1JI3A 4OGWA 4EGJA 1P17A 3INGA 4F7DA 1XWWA 3M4ZA 4MVJF 3R3SA 1WETA 3DFFA 5K0JA 1L7VC 1M6VB 4Y2VA 3Q7EA 4RTNA 1EK2A 1NC3A 3P32A 1LI7A 2V7GA 4S04A 4P82A 3W1WA 2YMQA 5J2TF 1SCBA 1K4YA 3D6JA 1Q83A 2R60A 3SJAA 1VTKA 1QIKA 2POQX 1QHGA 5E7IA 3JYNA 3NGLA 2G04A 3D2LA 4UULA 1DKPA 2XYGA 2V3VA 1ZXBA 4O2RA 4KACA 5ERXA 3E9MA 1K68A 3VSAA 9ATCA 3PZBA 4JS0A 3NBYC 5LQCA 4CMEC 3QG1A 3WNQA 4UUAA 5JXGA 1FRQA 2GPBA 1E5QA 2Z9BA 3EQ8A 1NYQA 3F4LA 3LWZA 4KGXA 4NU5A 4DC0A 2VWPA 4JB8A 5AJUA 1JHXA 1PR9A 1YRBA 1DZIA 5L45A 1SUFA 4IHJB 5TE9A 5KYXA 1NTRA 3H19A 5DK6A 1YRAA 4X66B 2WJJA 4TLLB 2O8FB 3HCDA 3S99A 2YWRA 4MMXB 1FNCA 4FE3A 2VAMA 5FL3A 1SKBA 4RLSA 1JR4A 4XCQA 3JQAA 3SJCA 2XXAA 1N5RA 3JYOA 1XWIA 1D4ZA 2WZDA 4DF3A 3KJIA 4UCFA 4EW6A 1FJXA 2X42A 4Q1VA 1G6KA 4CIDA 1GPH1 2IXGA 2LDBA 2QQ5A 1AS0A 3EIFA 3HZHA 3X44A 5JR3A 3AB3A 1YZQA 1LX6A 4UU7A 1N5JA 1QRAA 1SIWA 4PYKA 5IEJA 1VECA 4UUPA 1XFDA 3GA0A 1XA4A 3G68A 4W9NC 4ZAYA 1OGIA 4EHJA 1JPJA 1O08A 2C2YA 1PDVA 1E1CB 1GZ5A 2XXJA 3CEMA 4OFWA 1XELA 5F3WB 5EIHA 2YIVX 4MA5A 1T36B 2C9DA 2JHPA 5UKDA 5HKKA 4KNVA 4RTKA 5BNWA