1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HI0065
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
1T9HA 5ANRB 1UEIA 1KNQA 3QXJA 2DCUA 2ZYUX 4MYTA 2JEOA 3QKSA 3DPUA 4QJ5A 1SVKA 1NLFA 3PQCA 1ZVQA 2OCYC 3R7WB 4L9WA 1SZPA 2KE5A 4MUBA 2QT0A 3QQ5A 3W3ZB 2A9KA 3NDBB 1UF9A 3NXSA 4ERNA 3EZ7A 3ZD6A 4NBSA 1V43A 1W0KA 4OHYA 1SQ5A 5DLQC 1Z63A 2EYUA 1XMIA 2GEDA 5D3MA 2RGXA 2BHRA 3GD7A 1W4BA 2AWOA 3OEHD 2W6JA 4FI3C 3Q72A 2Q3HA 4JLDA 4IDHA 3CUEF 4C0HA 1R8QA 1RRCA 1JI0A 2KB0A 1DAIA 4LUCA 1OJLA 2QE7A 1XTIA 4QGHA 1AKYA 3ICEA 3RDPA 4G3XA 5HR5A 1FNNA 1E9DA 2XAUA 3AVWA 4YMUA 1U9IA 4C3ZA 4JLJA 2DYKA 4JIMA 2IW3A 1UFQA 4D0GA 3NBXX 2IYYA 1O3YA 4PC6A 1CBUA 4W5HA 1CLUA 1U8AA 3GLHA 1U81A 2V8OA 5EP2A 3RHFA 4LBWA 1E2EA 1GRRA 3MFYA 3RS0A 4PTLA 3R8FA 3NEJA 3NBYC 3TKLA 3LW8A 5TDHA 5BN4A 3VR2A 4ZV4A 1IN5A 5FBWB 2AD5A 4GMDA 2V1UA 2DWOA 1ZC4A 1DAFA 1KHTA 2N1BA 1VCNA 2KBEA 2XJ4A 2AKAB 1IN6A 3NBFA 1TTTA 4PXAA 3C4JA 1KKMA 1KGDA 2QQ0A 2QRZA 2FZLA 4URWR 4LYAA 3NVAA 3CZQA 1J70A 1GL9B 3NWJA 1SHKA 1G8PA 2EFEB 1UKZA 2GKSA 4GOJA 3SYNA 2OEPA 4B2LA 1JB1A 5F9HA 4MH0R 5FPTA 1E2HA 3EXAA 4UXIA 1AZTA 4OHWA 3HDTA 3AEZA 3BB4A 2CCGA 4L5BA 2QPOA 3N70A 2OFOA 1UBFA 3B1WA 4KBGA 5TY0A 2YKGA 1FX0B 4V0ME 2OXCA 2YV5A 4BFVA 3T34A 1J99A 2XZOA 3CBQA 3TAHA 1XF9A 4OHVA 4HZIA 2PZEA 2PJRA 4JJZA 4YMWA 1VG1A 1E4VA 4OYHA 4D4LA 4HSEA 5EP4A 5DHAA 4E07A 3I92A 4RKFA 4QJ4A 5DE3A 1HE1C 2QU8A 4JL5A 3GLIA 4A82A 2WAYA 1C1YA 1CIPA 5F2EA 3C7KA 3BH7A 2OBNA 5J4VA 4IDPA 4LX0A 1R0WA 3T1VA 2PT5A 1G1MA 3IDQA 5BN3A 1W4RA 5AJWA 3THXB 3ZDQA 1OHHD 4KU4A 4BEBA 4CEIA 2VLIA 1FP7A 5J4HA 1Z0KA 3NDPA 3LLUA 4CGZA 5IK2D 1N2CE 2IF0A 1W36B 1Z28A 1ZD1A 2ZR7A 3K0AB 1NJGA 4P4TA 1N5IA 2ASEA 4IXNA 5CDFE 1E94E 2FSIA 4TSFA 2O8EB 5HE8A 1KZGB 4NE2A 3OEEA 2EFCB 2IYTA 5H8WA 2ZIAA 5IT5A 1EK0A 3TH5A 1F2UB 4GBMA 1Q57A 1Y63A 3HU1A 2ZAMA 4ZDJA 1DAEA 3U4QB 1SVLA 3AF2A 4EUNA 3W6PA 2XZPA 1GAJA 3M6AA 4Q4HA 2R65A 3KDSE 1BMFD 1Z0IA 2A5JA 2YNMA 1YZNA 4MRVA 5LD2C 3Q8XB 2IYQA 4AI6A 3SE0A 1SXJC 4J0QA 3HU3A 4HLUC 4FCTA 1JR3D 1W36D 2X2FA 1D6JA 1UBGA 3AVPA 2PCLA 3KQKA 3LVQE 1FTSA 3MWKA 1XXHE 4B71A 3ADBA 4OK6A 821PA 1QHHA 1XRJA 3PUVA 1E9RA 1TQ2A 2WTUA 3DMNA 3QF7A 4B3DA 5EE0A 2O52A 4M53A 1F3OA 3KJGA 1DADA 1WE2A 2XNDA 1TU4A 2H5EA 3DZ8A 2ORVA 4RZ3A 4TYYA 1G7SA 4WOPA 3B5JA 4V0MA 4EIWA 1G17A 4DSOA 5K8TA 1G3UA 5FBVB 1FQKA 4R2HA 2ZANA 3DO6A 3OE7D 4ZI2A 3E2IA 1WP9A 4P4SB 4RD3A 5L3QB 2RGCA 4GFDA 4HAYA 4UJ3A 1V5WA 4Y0VA 5E7JA 1Q20A 1AIPA 5JFGA 1OFTA 3GLGB 3LH5A 2BC9A 1G5RA 5JHGB 2QAGA 2F3RA 4LV8B 4TT3D 1KK3A 4MKGA 5E4FA 1S1MA 2DR3A 3EPJA 1Z47A 2ONKA 2OCBA 3BAFA 3VHLB 2O0JA 2GZHA 4MA4A 3MWJA 2OAP1 4JVSB 4CT5A 1E2FA 2CEAA 3QXSA 4LSGA 1E9CA 4IEIA 5TB5A 5DISB 4TTPA 4TN1A 2CE7A 2QEQA 4RFSB 3QF4A 4Q19A 2Z4SA 2WKRA 5CDFA 5HCIA 3RSOA 3RRMA 3AVUA 1KOFA 1GTVA 2QTHA 2ZI5A 2G0NA 4PAOA 3ZZTA 1TQDA 2FMXA 2WIAA 3WBJA 1XD2B 4DCNA 1LS1A 4BFTA 5FPKA 1Q0UA 1Z06A 3BWDD 2GVZC 1XJCA 3KKQA 4NCJA 4EFMA 3FOZA 2HCBA 2FA9A 1YJ5A 1R4AA 3W5IA 5CIQA 2C9YA 3DM9B 2XTNA 5FBLB 4EQ6A 3I5XA 2ZSAA 1HT2E 4D4JA 1E1RD 3O8CA 1WA5A 3KB2A 3SQWA 3LLMA 3ONWA 5J4KA 3ND8A 4XWKA 1TMKA 4V03A 1JECA 3AQ4A 2OCAA 4DT1B 2WOOA 4F4CA 1RFLA 2ZYWX 3MSXA 2P5TB 2A3RA 3THYB 1XXHA 4TQ9A 2ZM5A 3RS3A 3THWA 3V00A 2BKUA 1QHIA 1R8SA 1KI2A 1HQCA 5JCPA 2IEZA 1E9FA 1Q3TA 3U3JA 4TMVA 1G5PA 2GETA 4KFRA 5JS8A 1FMLA 1KDTA 2VSFA 1T8UA 4A8JA 2ZRJA 1Z07A 5FBRB 2WZQA 2GZDA 3QKRA 4KVGA 3PEWA 4DB2A 1N6PA 3VNVA 5LD2B 2R6AA 5EXPA 4C0SA 5C1BA 3I61A 2W2VA 1SXJB 3KXIA 3VHXA 3BRWD 4MGYR 5FUXA 4TYNA 2ZUBA 1COWA 1OB2A 2AK2A 4GMXA 3BGWA 1JPNA 1NSTA 4TLCA 4YXWA 2D7DA 1X8LA 1XCGB 1ZM2A 1RPZA 3T5GA 4HAWA 4V0KA 5G41A 2ONJA 2VP0A 2FPLA 2G9NA 3CM0A 4A2PA 4UNQA 3FGNA 5FI1B 3T06B 1FW6A 1N6NA 4B43A 2BMDA 3NHBA 4AY2A 1OXXK 1TF5A 3EPHA 2ZJYA 1EG7A 2QM8A 2WOJA 5TMPA 3PUYA 2MSDB 3TE6A 5DGXA 4EJSC 4US2R 1XU4A 2IYRA 1PVOA 2HJVA 1P5ZB 3CB4A 1FMJA 2RHDA 4DEYA 3QG1A 2CMKA 2YWFA 3NIBA 4LPSA 2GHIA 1I2MA 1AS3A 1FP6A 1SXJD 2J3EA 5CITA 2JLQA 4LWZA 3U6KA 3UG6A 2F43B 3CRQA 2ANCA 2P6UA 2UZ3A 1N0VC 1G3MA 4CEHA 1LNZA 3HPQA 3OZXA 4N3NA 4PAQA 5FOWA 4B74A 2OESA 2JJ2A 2GNOA 2IEYA 3CWZA 2PBRA 1VIYA 3B7GA 1F6BA 3L2OB 3ZS9A 5KHOC 3NHAA 5CB6A 2FU5C 2A78A 2ZTSA 1ZNYA 4IVQA 4MRNA 3O47A 1E96A 1TUEA 4F38A 5AWFC 3VR6A 1NMZA 4NCIA 2A7QA 1OW3B 5P21A 3A4LA 1G3QA 3HU2A 4LHYA 4LJAA 3TSOA 2NIPA 4BLPA 3QXXA 1GUAA 3F0TA 4DUGD 3BH0A 1M7GA 1YR8A 2G88A 2FSFA 1XEWY 4BRWA 2CJWA 2PZFA 2FSHA 2ZS8A 3W90A 3OEHA 4LV5B 2RGBA 3PEVA 3WRXC 4JLPA 2OO7A 4A0FA 3IPXA 3DDCA 4QKQA 4U5XA 2CVHA 3GJXC 3Q5DA 1OKKD 4MKFA 4DJTA 5HKKD 5AUPB 2WMOB 1RRPA 2FX3A 2D2EA 1H8HD 3R7WA 3QJYA 2V3CC 2RGDA 2DPXA 5J40A 5AJZA 3TR0A 3IHWA 2NTYC 1ZM4A 2DFNA 2JLSA 1IY1A 1NG1A 1G19A 1L4UA 2ZROA 1RKBA 3L0IB 4XWAA 1PLJA 5L3VA 1XBTA 2C78A 5SZKB 2RGGA 4NCNA 4RKEA 4PO8A 1MOZA 4ZDKA 3VR1A 2K5UA 3EW9A 1GITA 2AX4A 3D8BA 4FMDF 1FZQA 3W8NA 1WBBA 2VHQA 1W0JD 1P2UA 2VHUA 1R7RA 3EASA 5AK0A 5EXTA 3UG7A 1G6HA 1S9HA 4PZLA 2IX3A 2PX0A 1JR3E 5FPYA 5EQTA 1QDEA 1G7CA 4ILEA 1P9NA 5CB8A 2IA5A 4A6XA 3PJRA 2QY9A 4TQAA 2BBSA 1S2MA 5JWRA 2X1VA 3OFNA 1UEJA 4B47A 4FMBB 3K0CA 1IOZA 3EC1A 2VHJA 3QEOA 2Q6TA 4RZXA 4CZ2A 1MO5A 2PLFA 4NYJR 3C15C 2FJUA 5KSOA 2B7BA 4KSBA 2JLZA 2Q9AA 2FNAA 3KL4A 1S3GA 1ZRHA 3TVDA 3CZPA 1GL6A 1NRJB 2WJYA 4FXPA 4PPQA 3K09A 3K1JA 4TLBA 4IOLA 3FFBA 3P1JA 4ZKEA 4TZ6A 1ZNZA 5FR1A 4GRAA 5JCZA 4PHFA 1YU9A 1W2HA 3OAAA 1MKYA 4RVCA 1EX7A 4LYHA 4EJSB 1E2KA 2ZI4A 1DO2A 4PC2A 2J0UB 3IO3A 3W3AA 3QVVA 5FL3A 2FGKA 5JSZA 1R10A 4MKHA 2NZ8A 4LI0A 2BJWA 4LHZA 4KVAA 4B48A 1YRBA 2IC5A 5L3SB 1P4SA 3BBPA 2NPIA 4RCZA 2Z83A 1OHHA 1WCV1 1ZAKA 1HEIA 3GEIA 3MGCA 3L43A 4UKDA 2QUZA 3TSZA 3FPAA 3ZGXA 2HT1A 2ODBA 1D8TA 4PSAA 4Q00A 3ZQJA 2JDID 4A0RA 1Z2AA 2QN6A 3VFDA 2V6IA 2C04A 3TQCA 4QBHA 3ZIAA 2YYZA 4Q7KA 2G0TA 5A4JA 4BFSA 4D6PA 2ZJOA 2YC4C 1KO4A 2YZ2A 2H16A 3U5ZB 1GNRA 4X8MA 3NH6A 3SHWA 4FINA 5EZ5A 2ZPTX 3GLGE 2W58A 4GDFA 2B6HA 2A2ZA 2B92A 2OHFA 1T5LA 2IS4A 1Q1EA 3ZZ0A 3C41J 4QFMA 1YZGA 4LRWA 3THXA 3C14C 4QM6A 1BMFA 4P4UA 2QSZA 3KXKA 3TNFA 4Q5IA 1KTVA 2ZE8A 1LF5A 3LO5A 4B75A 5EXSA 3U3RA 1KSHA 4B2PA 1E2DA 2WWHA 1HYQA 4CIDA 3K0AA 2F55A 3C5CA 3PVSA 4GOKA 4Q1BA 1G5TA 1VG8A 4Q03A 2JJ1A 2O8EA 1VG9B 1TNDA 4HB2A 5CM9C 3DKPA 4DCTA 4N1AA 3CWQA 2J46A 3EX7C 4HUQB 4K8OA 2VP5A 1JAHA 1NI3A 1F60A 2RMKA 3A1SA 1F2UA 3U7EB 3SC3A 2YWEA 1SGWA 2OE2A 2KJQA 1UADA 3U4QA 3REGA 1RE0A 2OZEA 3RRYA 1P60A 3OE7A 2IYSA 3JVVA 4Q9KA 2ZETA 2L0XA 4V02A 3IPYA 1HE8B 2ERYA 2WJVA 4JLNA 3TRFA 4DDTA 3P32A 1OE0A 2EVWX 2OFXA 1II8A 2ZI9A 4Q01A 3SJAA 2BMEA 1M1YE 5FPSA 3P26A 5E7MA 2ZSFA 2CHVA 3KKPA 2ZI7A 1CJKC 4P31A 2P5SA 3FMPB 4EDHA 3B9PA 3UXMA 1BYUA 2FE4A 4BLOA 2CK3D 4Q48A 2ORIA 5G53C 1UAAA 4OJKA 5K8IA 3N2IA 1EFTA 5GVRA 2DFLA 5TV2A 3HPRA 1HA3A 1KSGA 1OXSC 3EA5A 5FPHA 1KI4A 1ZIPA 1ZM3A 2NGRA 2O8BA 1T5IA 3AKCA 1LY1A 4P4SA 3NG1A 2HF9A 3A1UA 3C16C 4GP6A 5L3QA 2E9SA 1KI3A 4R2IA 2J87A 1CEEA 1SXJE 4LHWA 5FUYA 3C8UA 1TF2A 3ADDA 2VP9A 2WV9A 4A0HA 3GLGA 3B6EA 3LWNA 4JKYA 3IQXA 1ZD8A 3KQLA 3SBEA 3AM1A 2ZE7A 1MRNA 2JIZA 1KO7A 2ZRBA 5EE3A 3WHLA 2J0VA 1U94A 1NN3A 2H57A 4M9QA 3KUCA 1E1RA 2QTVB 4I1VA 1AK2A 2BKEA 2FEMA 3CNOA 1X86B 2C8VA 4ITRC 2MMGA 2NO1A 1TEXA 4RFSA 1XD8A 2QBYB 4QGFA 3UANA 5HZKA 1S8FA 2UKDA 2Z4RA 5EZ6B 3FKSD 5KO2A 4Y0AA 3IUYA 1G8GA 3KJHA 4XSHA 4EFNA 1GNPA 4ZPXA 2GJ8A 3P4XA 2J7KA 2REXB 3GP8A 3DVLA 4UQOA 4FWTA 1TU3A 4POAA 1P2TA 2BMFA 4LJ5A 3TUZC 2VHTA 2ZJBA 3Q3JB 2GAOA 1J8YF 2E87A 1E99A 1GKUB 4YDSA 4KBFA 1H8ED 4B34A 4OI0A 1OH6A 4NYMQ 5H1YA 5JJKA 4CT4B 4JVLA 5GVSA 3CPJB 3W6OA 1XTQA 1KY2A 1H65A 3I1FA 3QBVA 5KDOA 2HUPA 2VTKA 2ZJAA 1VCOA 3SDZA 3W5JA 3LBNA 5JWOA 4IDOA 4DT1A 4ZO4A 1E0KA 3FMOB 3U3MA 2QGZA 3THYA 4HYYA 4ASUA 4OL0A 4IVRA 4G5GA 3ZYCA 3QIAA 2NG1A 3E70C 2YOGA 1P75A 3RS4A 1JBKA 2IYZA 2V6JA 4QGGA 3VU9A 1NN5A 3HJNA 2Q3FA 1GKIA 2YOFA 2ZRLA 4V0NA 3LQRA 5JEDA 5H70A 4GL2A 2D06A 2RB4A 4B3BA 4C4PA 4MGIR 4MUAA 1AM4D 1IY0A 4OQMA 1DBSA 2CDNA 4YMVA 2PMKA 1OH7A 1D2EA 4H1VA 1RJ9B 1E9AA 1A82A 1E79A 1W46A 2ZEJA 1JAIA 2QSYA 3AF1A 1P2VA 3K9GA 4IEEA 1N0WA 1SXJA 1S9DA 2V1XA 2IT1A 3D31A 4HLUA 4KV9A 4LC0A 3SYKA 2ORWA 1OH8A 5BYJA 2FH5B 3EZ2A 1TQ6A 2QG6A 4DVGA 3B1XA 4EKDA 5L8VA 2DB3A 3U3OA 3JZAA 2GCOB 4AURA 3AVXA 3PENA 1ODFA 2NO6A 3D7MA 1U0HC 2BCGY 2VF7A 2ZRIA 4M22A 1FNMA 1SULA 1KMHB 2ZRMA 2JLVA 3T1OA 4Q7LA 1MH1A 5CK5A 3CR8A 4JLAA 1WBDA 3CX7A 4EPTA 1YE8A 1YZTA 5CK4A 4DBLC 2WWGA 2QP3A 4Q4JB 5BN5A 2P6RA 2RHMA 3FKQA 2WJJA 4TQUS 4DIEA 1NLYA 1M7BA 1OXUA 3BB1A 2RGNC 2Z6VA 3A1VA 3ASZA 4PQYA 1Z83A 1GG2A 2CCJA 2F43A 2XXAB 1W5SA 4R98A 2F1HA 2QT1A 1ZNXA 2X19A 1E2NA 4XOIA 4OKSA 2EFGA 4I1SA 1ZM9A 1AS0A 3BORA 1UDWA 4O2RA 5FUVA 2OAQ1 5JWHA 4DDUA 3R9WA 3W9YA 4AKEA 3TUJC 1CTQA 3PG5A 1IN7A 1CXZA 4FMDB 2ODWA 1K8RA 2IUUA 5B57C 1N25A 4G5SA 1JXMA 2WSSD 3ADKA 2CNWD 1QRAA 4AKIA 1KI9A 5KUTA 4C2UA 4M21A 4G5OA 4QGAA 1VCMA 2WKPA 1NIPA 1NNEA 3VTKA 2QMHA 2ZREA 3GJ0A 3SEAA 1WB9A 3MWLA 3KJIA 3WBKA 1A2KC 2QQEA 1W0JA 5BWMA 4A36A 4DLVA 1EXMA 1TADA 1XZQA 3SS8A 6Q21A 3A4NA 1YRAA 2NPFA 5CYOA 4OQNA 4PZZA 5FOSA 2IXGA 4KCGA 1JXOA 1ANKA 1M8PA 1XTJA 2VIIA 3LV8A 4BEJA 3KFVA 1YQTA 4Q4LA 1D9XA 1XEXB 2ZRDA 2DBYA 1U9IC 1VIAA 4QJ3A 4XVQA 4IOKA 1I2DA 4AKGA 3CRRA 4Q1EA 1VHTA 1NLZA 2YWGA 2P65A 3Q9LA 3QKUA 1KDOA 4FD2A 1S1CA 3TUIC 5K8LA 4Z1MA 3KQNA 2KWIA 2ZUDA 1CJVC 2G1JA 2CLCX 4O25A 4PAMA 4KFTA 5FH9A 1J8MF 4PHHA 1W1WA 4G5QA 3QY0A 1O87A 2OILA 1PLLA 3NTUA 1DG1G 2V7QD 4UNPA 5DI3B 4CVNA 2J0QA 3AP2A 3PUXA 3WP0A 1KJYA 3M0EA 2D3WA 3GFPA 3NEYA 4AC9A 3ZVNA 3WYFA 1G8HA 3MJHA 1CR2A 4XTRA 2W6ID 2ZJ5A 1GDDA 3B2EA 3OESA 1JEEA 4M9ZA 1BH2A 4HLDA 3REFA 4P0TA 4PSVA 1NN1A 2VPPA 4WIAA 1NY5A 2XEXA 1E9SA 2CXXA 1LV7A 4DCUA 3WNCA 4A2WA 3K0SA 4DB4A 3B1ZA 4HB3A 4KAXA 1YR6A 2WJGA 2MMCA 1S0UA 2N46A 4EFLA 1TEVA 1BOFA 2GK6A 4Q7JB 1F5NA 3AVOA 1G3RA 3AKYA 3EC2A 1ZUIA 3H0KA 4II7A 4ZI3A 4JYBA 4DLZA 1KY3A 5IDVA 2J1LA 2O5VA 4CF7A 1MABB 2D62A 4QXAA 4EJSA 3L0OA 2NQ2C 2WIBA 3PV0A 3GLFB 1U98A 3ZVRA 2WBLC 2O8DA 5KSYA 4M1OA 4DDWA 1CR4A 2FN4A 4L15A 1T4GA 1XP8A 1ZCBA 3GJ3A 4LCBA 5JI3E 5L3SA 2AR7A 1G8YA 4NH0A 2QZ4A 4B3XA 4B44A 3DHWC 3CO5A 1G21E 1SVWA 5G40A 3V9PA 2I3BA 1S3SA 4TL7A 2B8WA 3EPKA 1IN8A 2WM9B 1GOTA 2BVNA 4D0LB 3L0PA 1W2GA 1RRFA 2XOKD 4Q4AB 3LFUA 4B6EA 2D4HA 1E2GA 4QBIA 1J90A 3QPWA 3RABA 3RWMB 4B32A 3B60A 4HAZA 4S35A 4URUR 3O8RA 1JALA 3GJ6A 2EYQA 4JL8A 4NL4H 1NMXA 4UXHA 5CJPA 2QP9X 2RKOA 3IIMA 1T0JB 5EXXA 5A0FA 4D82A 1QHNA 3QKSB 2FEOA 3DKVA 3SZRA 3T5DA 5H68A 2FG5A 1SKQA 2QENA 3VKWA 5G3ZA 3BS4A 3UWKA 2V9PA 4D80A 4JLOA 5EE1A 3ZJYA 1DEKA 4H1UA 1M2OB 2GEVA 3LRPA 3Q5EA 2R62A 4PHTA 5JLJA 3WRYC 2C9CA 4BUJA 4LHVA 621PA 5D3MB 2GESA 2JGNA 2UZIR 4IOMA 1A2BA 3LDAA 1M74A 3FHTA 1XTSA 1N6RA 2A5FA 4JT4A 2OFWA 1MO3A 5FTLA 1CR0A 1XPOA 2VSOA 2WWFA 4YQFA 5J4YA 1KDPA 4TL9A 2X2EA 4QHTA 3C5HA 2PJZA 3LXRA 4URXR 4XD7A 4Q02A 1BKDR 2IUSA 2JLXA 1T8TA 2QAJA 3QI2A 1NVVQ 4HUQA 3VR4A 4E22A 4YONB 4E5UA 2R8RA 5EUQB 1N5JA 3GEHA 4OQLA 4DLTA 1UPTA 3GLHB 2DY1A 5J47A 1G6OA 4AIIA 2HJGA 2PZGA 5SZHB 1IN4A 2PCJA 4XWOA 1W0KD 2R6CA 2W83A 3FTQA 4KFSA 3U6BA 3RS5A 5HCNA 2XB2A 3U3KA 5DNYB 1E9EA 3CONA 4Q7MB 2CLSA 3KKOA 3EZ9A 5LPNA 3LVRE 4XH9B 2W6JD 3AH8A 4R9UC 1TF7A 2FZ4A 4H9GA 1OYWA 3N2EA 1Z3IX 1C9KA 1N6KA 1VDZA 2F1IA 1R2QA 3THOA 3UMFA 1L7VC 5KNBA 2QE7D 1CP2A 1N6IA 2EFDB 1Q1BA 2C03A 4OI1A 2WAXA 5C46F 2BBOA 2W00A 3K9LA 1XFAA 1KK0A 3HWSA 2FFHA 4QRHA 3T15A 3TQFA 3MWYW 4LJ6A 4QNMA 4BPBA 1HY3A 2WPDA 1BYIA 3G0HA 2CHGA 2ZS7A 2ZYTX 3FKSA 3KFXA 3IHLA 3HYTA 1VMAA 3BE4A 3CX8A 4TL6A 2X77A 1E1QD 2C5LA 2GXUA 2ZRFA 4G5RA 4IFEA 2F7SA 1T91A 2JASA 2Q0HA 4IDQA 2EFHB 2R6GA 3GLIB 3CF0A 3CH4B 2QI9C 3QXHA 1QBKC 2IL1A 4IJMA 2ATXA 1Q3HA 4M1WA 1LB1B 1TX4B 3A8TA 4TLDA 4WXRA 4TYQA 1DELA 4L16A 1KI7A 5FOXA 2VH5R 4A15A 3MMPA 2OXRA 4M1SA 4PC1A 2C96A 3WNDA 3PEUA 1OH5A 1JQJC 2ZI3A 2VBCA 4MQBA 2QBYA 3KQHA 1NVUQ 1P2SA 3O8BA 3L82B 4JT2A 421PA 1II9A 2V4ZA 4HDQB 3UKDA 4M2LA 3K70C 2QP4A 2JLYA 1FQJA 3WMGA 2X8AA 3NC1C 4F7WA 4LYFA 3OIYA 5UKDA 3FMFA 4DLYA 4XIGS 1JPJA 4V0OA 1A5TA 3HP1A 4FWIB 2IS1A 4RSGA 3KUDA 4G1UC 2GWHA 3VNUA 3X1WA 4RD1A 4GT1A 2JLWA 2H17A 3S1AB 1Z5ZA 5E7IA 4A8JC 3U7GA 4BFUA 4BECA 4Q4HB 2IYVA 3A58B 4NYIR 2DFKB 1ZUNB 4BZXA 1Q1QA 1A1VA 2EQBA 2F3TA 2E1RA 4C30A 1UKVY 2HYIC 4HLCA 1DS6A 1U0JA 3T12A 4C9BA 1QZXA 2B8TA 3AGQA 2RAPA 4MDEA 1FPMA 2IK8A 1MO4A 1OXVA 4A6PA 4NMMA 1DARA 4M9XA 3OEED 2ZXUA 1QHYA 3AF0A 3SU8A 1NN0A 1U2RA 2HV8A 2FV8A 4C7OB 2VA8A 3VKGA 3IIKA 4KFUA 4NPHA 4C0QC 3R9XA 3DOFA 4MYCA 2BEJA 3PEYA 1DE0A 4JL6A 4KITB 3GEEA 4NU0A 3IEVA 2IHYA 4FCVA 3P27A 1RJ9A 2ZE5A 1DAHA 3K0FB 4TMWA 3EWSA 4AK9A 4EPVA 3M1IA 3TIFA 3CPEA 3H1TA 5C2JB 3CF2A 2IBMA 4BQSA 2AWNA 2GCOA 4NDZA 4ARZB 3ZVMA 4ON9A 5DI9A 3H4MA 2Z5FA 4ACBA 2HF8A 5KDDA 4TTQA 2VO1A 4C2TA 4PO1A 1KJWA 4TMTA 1KMHA 1FX0A 4BZQA 5IK2A 2FPMA 4I81A 4I1UA 5M04A 4DLXA 4M1TA 5GADl 1XD9A 1N5KA 4PQRA 3VKHA 4Q4JA 2ODNA 3IBYA 5KYKA 1X8JA 2WSSA 3GFOA 4B6FA 4UNNA 1HT1E 3EPLA 3J81k 1MV5A 1VYUA 5JS7A 2I1QA 4HAVA 3EWAA 2KBFA 1DO0A 1X1RA 1KSFX 3FE2A 3SJCA 4A2QA 2CLDX 2XXAA 1IJFA 3RYTC 4JYCA 2XJ9A 4D26A 1IXRC 1Q12A 5EE9A 2XB4A 3VX4A 1HH4A 4L8GA 3U60B 2RGEA 1E2PA 1YR9A 2WKQA 3B78A 3BIFA 4KO8A 4EQ6B 1XPUA 4Z51A 2H92A 4NYMR 4BGDA 5HTKA 2J41A 1SVOA 1AQYA 2BM0A 3QXCA 4TMZA 4JLVA 1XMJA 2C2HA 1XDBA 2GBLA 4JSYA 3SJBA 4UNRA 4OK5A 1JR3A 3KXLA 1Q21A 4DSUA 4IRUB 1KDRA 3RLFA 1TAGA 4HB4A 5L3RA 2XZLA 3B1YA 1WRBA 1VG0B 4DWJA 1WDTA 4CW7A 1XXHB 4QOSA 3TK1A 1GIAA 2IHBA 3AUYA 1XTKA 2D74A 3JZMA 4KXFB 5FFMA 4LPKA 1Z6XA 3SN6A 4A0GA 3V4RA 3TBKA 3T1QA 1XZPA 2D7CA 1CKEA 1X1SA 1N3BA 2V7QA 3RNLA 1CULC 1JQLB 4DLSA 2CHQA 4OHXA 1IM2A 3EZ6A 3PXGA 5GJCA 4AYXA 3RAPR 3U7FB 4HDCA 2YOHA 3MJRA 1OYYA 1XMVA 1HURA 1MO6A 1W49A 3L8ZA 1I4DD 2FF7A 4A8JB 1E2IA 1IXSB 2HXYA 5HPYB 4HEJA 1CU1A 3QKRB 4MGKR 3ADCA 2W6IA 5FI0B 3WP1B 2QTFA 3AVVA 3U44B 1XEXA 3K0CC 1GNQA 5SZIA 3SOPA 4NHOA 4NCKA 4TT3A 2Q3MA 4AWXA 1G4AE 1Z6TA 4MDFA 2JA1A 2QA5A 2ZSDA 1GFIA 4LZZA 3BXZA 4RCYA 3K70D 1N5LA 2A5DA 2ODEA 3UATA 1CJTC 3K09C 3X1ZA 4CDGA 4PC7A 1G4UR 5TARA 3VR5A 2Q9CA 1SKYB 3EIQA 5JRZA 2EW1A 1GWNA 3BK7A 4TLAA 2QORA 3K53A 4LC1A 1VKJA 4HLQB 2W0SA 1R0ZA 4TWZA 2B7CA 3A1WA 1OPXA 3D3QA 3H86A 1IHUA 1XTRA 3MRSA 4IFBA 3SNHA 4DCVA 5KSZA 4S2EA 2AFHE 4YMTA 1DPFA 2J7PD 4IDNA 1E2MA 1L4YA 2J59A 4NP6A 2BWJA 2EWWA 3LQQA 2OLKA 2J5XA 4W7SA 4JBWA 5GJVC 4B33A 3AGPA 4B76A 2MSCB 1CJUC 3I32A 4A4DA 3D6TB 1EFUA 3SR0A 4WZBE 4Q47A 2OLJA 4QM7A 3AB3A 2AN9A 2JLUA 2F1JA 2ZJZA 1P9WA 2W2TA 2JATA 4CEJB 2F1RA 1P9RA 4P32A 1FL9A 1MABA 1PUIA 1AS2A 1NVWQ 1QG2A 2IUTA 4F4IA 2FWRA 1HQYE 1HUQA 4C0AC 1M34E 1P3JA 1NF3A 2O0HA 2RGNA 3PUWA 4FMCF 1XD2A 4DEXA 1OB5A 1F2TB 1AN0A 2DFTA 4HAUA 4DZZA 1E6CA 1ESNA 4BWYA 4HATA 4P3YA 4N0EA 3EZFA 3ZVLA 1CRQA 4Q4AA 4IW3B 3L0SA 2JJ2D 2LCFA 3F8TA 1EFCA 2ERXA 1UBEA 2REOA 3LBHA 1JEDA 2O8FB 4KLZA 5B64A 1RVDA 3P4YA 3ZD7A 1G16A 3RRZA 3K8YA 2BDTA 3QNUA 3RC3A 3B8HA 4X8OA 4R7ZA 1FUKA 1M7HA 2ZE6A 4RD2A 4ZCIA 1ZC3A 5JJLA 1OT3A 2AK3A 3GLIE 4JVMA 1A4RA 3JVUA 1EESA 4C0LA 2RGAA 4QHSA 5TVKA 1KIMA 4D81A 4PHGA 3FDIA 2PH1A 2F9MA 3EIEA 4L4UA 4NZYA 1E2JA 1SVMA 1LFDB 121PA 4Q1FA 1UKYA 1JJVA 1R0YA 4LJ8A 4KYUA 4LBZA 1E2QA 3CPHA 3G5UA 1L8QA 3Q7PA 1YKSA 3CH5A 4Q9IA 3AVYA 4MGZR 5DSZA 4FIDA 5BYKA 3M4YA 5FTNA 4F91B 3A1TA 3R9IA 4NCHA 1KAOA 2QPTA 2A5YB 2AXNA 3K9NA 3I72A 2QROA 2YJTD 5CYPA 2C99A 4D2IA 3AVTA 4C0BA 1KO8A 4LGMA 5GJBA 1G41A 1OFHA 4EPWA 2JAQA 2QNRA 4M9SA 3RANA 1R6BX 4O3MA 3TGPA 2C9OA 1E1QA 2OUKA 1EFRD 1KI6B 5KSPA 1G8FA 1HV8A 2AD1A 2MSEB 5KDLA 4DLUA 3TJZA 2YC2C 3ZQ6A 3R20A 1UDXA 4QHYA 4URZR 1XWIA 4W9MC 1B0UA 1S4QA 3EIHA 3AF3A 5F98A 3SJZA 2O8CB 5F9FA 3TMKA 1G64A 1M6NA 1KO1A 2QMOA 3SHFA 1RIFA 1YZUA 5JSZB 3ASYA 4LYJA 4DUGA 3B9QA 1QHSA 3OFND 4OQFA 1P72A 2IS2A 3QSYA 3I4LA 5C4GB 3RS7A 4HUTA 4L9SA 3DL0A 4GOXA 3FYHA 2XGJA 5FL7D 3QG5A 3BC1A 2QGNA 2VQSA 4IVPA 2JCSA 4IXMA 3NBZC 3IGFA 1Z0FA 3DEFA 2GZAA 1ZNWA 1YHNA 2OBLA 3CNLA 3EARA 5FOUA 1S96A 5IHPA 2R9VA 2C98A 2P2LA 3N5CA 1OKKA 4Q1AA 3QEJA 5E95A 1NL3A 5HKKA 1ZINA 2H1LA 5DN6D 4XSGA 2AKYA 2ZI6A 1IJEA 1KK1A 1YVDA 1H8HA 5DIFA 2HEIA 3OAAD 4HZUB 5JZVA 3X2SA 4TTRA 3O8DA 1JNYA 2QRNA 1K5DA 2GA8A 4UXJA 2WSMA 1E3MA 3W8RA 2RCNA 2R6DA 5KTYA 1ESMA 4D4KA 3GFTA 1EWRA 1UKEA 1W4AA 4XJXA 1SVSA 2JLRA 3FHCB 4RD0A 3U2QA 1E2LA 3T1TA 3UMRA 3MD0A 2KSQA 3F5FA 4BFXA 4JZKA 3ETLA 4AYTA 4BFWA 3U7HB 4RZUA 1AGPA 3T35A 3IBGA 3LAWA 3QOFA 4BLSA 1XPRA 5E3HA 2CBZA 4X8HA 4MYHA 1WXQA 4V0LA 4AG5A 3Q85A 3DMDA 1UBCA 3ZIAD 3WHKA 5LDDC 3B82A 5CLLA 4MRPA 1OFUX 4W5WA 4US0R 2A30A 3IIJA 1MT0A 2AFIE 1Z2CA 4JLKA 5HZHA 1D2NA 1ZP6A 1NVVR 2A5GA 4KSCA 2HDNB 1P7CA 1XJQA 1P61B 1GRQA 3SBDA 5B58C 4MRSA 2GF0A 1W4CA 2OSBA 1R0XA 2OBMA 5CJ2A 3S1AA 3VX3A 3X1DA 3SQXA 3VAAA 4Q9JA 4EPXA 4URVR 3BFKA 2LKDA 3DZDA 2GAAA 3LA6A 2G6BA 4G01B 4DXAA 1II8B 2GXSA 3I8XA 5BQ5A 2PLRA 2WHXA 2J9RA 1IAQA 3T61A 4MKIA 3RWOA 4DHEA 1ZU5A 1DG3A 3A36A 2ZRAA 4U02A 1XB2A 3OIUA 3PIRA 4PX9A 2JJ1D 1FUUA 4JBYA 2IS6A 1FFHA 2Q21A 1PUJA 4Q9LA 1RC8A 3TR5A 1ZBDA 2GJSA 5FUWA 5SZJA 1CRPA 2JDIA 4JVNA 4C7OA 2FOLA 2FFQA 2NO7A 2CCKA 1XEWX 3I73A 1OIXA 2ZYVX 2HLDD 1OV4A 5JI2E 5D3QA 1OIWA 2O8BB 4TYPA 1AZSC 1G20E 2FFBA 3K0FA 1OXTA 1ZW6A 1D9ZA 1ZU4A 3G82C 1Z8FA 2YHSA 1G3IA 2HYDA 4B35A 4ZIRB 4BFZA 4RZ2A 2J0UA 3CW2A 1J2JA 4LJ7A 1EWQA 3I5YA 4DIDA 3LXXA 1US8B 4ARZA 2ZU6A 5JJIA 2QL6A 3HYRA 2HCJB 1E98A 2IXEA 2CL7X 2ZVPX 5C18A 1IY2A 2G83A 4PC3A 4MRRA 1N6OA 1SKYE 3NH9A 1Z08A 1OSNA 4RFVA 3KTAB 4O2LA 2F6RA 3WXMA 2YWHA 1YZKA 3KKNA 4WAUA 5DO9A 5FOVA 1PV4A 4QC2A 1FOEB 1TL7C 4Q1CA 4XVUA 2WICA 2I4IA 4LBVA 1X8KA 4LHXA 1Q22A 2QM7A 2GCNA 3AV0B 4DSNA 2XSZD 1XEFA 5FTJA 4W5JA 1Z6YA 5KPDA 2GXAA 4B73A 221PA 2J45A 3AKDA 3UMSA 1KAGA 4NKRA 2GVDC 3KX2A 4GZLA 3RC8A 2ATVA 3QUSA 2JIZD 3IQWA 4JKIA 1NBMD 1G7TA 4UJ5A 4E03A 2ECKA 5KU1A 3QPVA 1W47A 4BLTA 2PMDA 3EG5A 4FN5A 1W44A 1ZYUA 2LKCA 2WJIA 4P33A 4KLNA 3SI7A 1W48A 4Z8YA 1R5BA 1T6NA 2GJAA 4U7DA 1AA9A 5B2ZA 1BS1A 1KI1A 3RSLA 2ZRGA 3W6NA 2ZRKA 3WYAA 1G291 3MCAA 1GSIA 4M8NE 3IO5A 5CM8B 5JHHB 1ZUHA 1GZSA 1LF0A 1EGAA 3LD9A 3GQBA 4US1R 1YZLA 3WYGA 4D4MA 2CK3A 2VSXA 5AJVB 1VHLA 3ZZUA 3PCRB 3VU9B 2GRJA 3B1VA 2BIFA 3PR1A 1QHXA 2QMUA 4HAXA 2BJVA 3X1XA 1VCIA 1PJRA 1ETUA 3IEUA 4F92B 2OCPA 3WNBA 3B85A 4TMKA 3FFAA 5ELXA 1VYVA 4B2IA 2J7PA 1W7AA 1GRNA 2V54A 3E5HA 4GSYA 4LDJA 2ZQ5A 2IYLD 1NSFA 4TYWA 1Z6AA 2GXQA 3B13B 3U44A 1E69A 5JMTA 4JLBA 1X6VA 3VR3A 1GVNB 5FOTA 1R5NA 2FDCA 3CNNA 1Z29A 2VHCA 4JS0A 2IYXA 1GILA 1OFIA 2CL6X 5JRJA 1BIFA 2QAGC 3GJ7A 4I1OA 4ASUD 2R6FA 4RD4A 4IOJA 1KSJA 4LOAA 3MUFA 2NMVA 5AR1A 2PEZA 5K8UA 3UPUA 5DH9A 1ZIOA 1G9XA 4JMPA 4LJ4A 4I4LA 5AUQA 3CRW1 5LB4A 4FMCB 2IWHA 2ZRCA 2ZAOA 1E32A 2PL3A 3A4MA 4FCWA 4KJZA 3LW7A 5AUNB 1NKSA 5AJXA 1LTQA 1E0JA 1I4LD 2BM1A 4ZDWA 4GP7A 1GM5A 4ESHA 2HXSA 3NKVA 4KI0A 5IF9A 3IILA 3FWYA 2XTMA 1II0A 1DVRA 4LV6A 4DCSA 1E79D 1ZM7A 2R44A 5EUMA 3OHMA 1T3LA 1QHGA 4LK2A 3E1SA 2AHOA 4G0NA 3QVUA 4R71A 2VYFA 3DM5A 1AJEA 4M1YA 3UK6A 3QE0A 2C95A 1H8EA 1XCMA 2WWWA 2WJHA 3UWOA 4AD8A 2ZITA 2BCJQ 3EAQA 3GCGA 1VECA 4CEJA 5KNCA 2Q9BA 2VP6A 4M4SA 4CEIB 3X1YA 5JBQA 3I62A 1DAMA 2YINC 4ABYA 2CVFA 1U90A 3EA0A 5JEEA 4NTZA 2NO0A 2VP2A 5DHFA 4AYWA 3TVTA 2BV3A 3SYLA 3CKLA 2WWYA 2ANBA 5KNDA 2ZVQX 4PPFA 4A1FA 3RVBA 1RYHA 3CIOA 3K0EA 4Q9HA 2ZR9A 2BBWA 2Z0MA 3K9HA 1F2TA 4F93B 2H18A 5LBIA 2NOAA 2ZSEA 3Q7QA 5A5GA 3PUZA 4JJKA 3U61B 2FGJA 2VEDA 3AP3A 2IYUA 1U99A 1Z0DA 4EAQA 1P73A 4ZDIA 1KI8A 1XJ0A 3FVQA 1CJMA 3H84A 4WZ6A 2IYWA 8OHMA 5BW8A 1N0UA 4DRZA 2O8FA 1D5CA 1QG4A 1VTKA 2GTPA 3W34A 3KZ1E 1Q1ZA 4PZYA 4PO9A 1ZMXA 5IRCD 2YVUA 1Q44A 1GL7A 1K6MA 4B3CA 2I1VB 3WMEA 1Z0JA 1QVAA 1XNJA 4PQFA 1NY6A 1I4TD 1N6LA 4BE7B 3OIWA 4GI7A 4HI0E 2ZJ2A 3CR7A 3BB3A 2G1KA 3GPLA 3KJEA 1UJ2A 4XTCS 3TAUA 4WZAE 1QHHB 4TSFD 2XITA 1R5OA 2DWQA 1L2TA 4DLRA 3PITA 2JJ8A 5FR2A 4E09A 1WQ1R 1EFRA 3AKEA 2GJ9A 4BASA 4DSTA 5EE5B 5TXGA 2P67A 5EP3A 1NJFA 5FTMA 4ESVA 2PT7A 3WMFA 2IWRA 2F9LA 2N42A 4DDVA 1LW7A 2VL7A 5FBQB 1NG9A 2FFAA 4JLMA 721PA 4LBYA 4Q66C 5KOYA 1BO6A 3HR7A 1KMQA 3QKTA 4GNKA 2G77B 2VF8A 3CRMA 3GJ5A 1X3SA 4N0DA 1OF1A 4Q1DA 2P0EA 5DYIA 3BH6A 4Z8XA 5FL7A 4C0JA 4BLQA 2NO9A 4OHZA 2QAGB 1U8ZA 3CLVA 4TL8A 2CL0X 2TMKA 5J4LA 3CX6A 5HE9A 5C4MA 2B21A 4AKHA 4Z1MD 2GDJA 1RYFA 5CIWA 1Y3AA 2Y8EA 3TW8B 3ZLJA 1NVXQ 3ZH9B 3MG9A 3TW4A 4A9AA 3BJIC 3LY5A 1KJZA 5DN6A 1ZCAA 1KKLA 2XNSA 3I3SR 2XNDD 1KI6A 2WWIA 3AF4A 3KKMA 3BFXA 4A92A 3QBTA 3RRNA 1OIVA 4UNSA 4EPRA 4F4JA 2ZRHA 4TZ0A 1YR7A 4ZCMA 3QF4B 2J0SA 2O8CA 3AUXA 1SHZA 4OQXA 3SFZA 3ICQB 1TPZA 4TLEA 4B3GA 1B23P 2O8DB 2CNWA 5AJYA 3GJ8A 3LX8A 3QPUA 1MRSA 4PR0A 3RS2A 1ELOA 5EP1A 4YC7A 1DOAA 2ZJ8A 4Z54A 4OJQA 2REBA 5EJEA 5F3WB 2C77A 4U00A 1IONA 1KZ7B 3FMIA 3L8YA 1CR1A 4TMXA 1ONBA 2QPAA 4URYR 4ZCLA 4D25A 2CE2X 5G3YA 3SFVA 4AG6A 4LJYA 5B30A 1Z22A 3HR8A 2BOVA 1D2MA 4C0KA 3FB4A 3KB1A 4QNRA 5J5CA 1LS6A 3UIEA 2SHKA 1NIJA 3ZS8A 3OF5A 2AL7A 1AQUA 4K81B 5LB2A 2OV2A 1AGRA 2W0MA 1KK2A 1E4YA 4WW0A 3A6PC 4HDOB 1RRGA 4HZUA 4D0NA 3MAAC 4RD6A 1RZ3A 2UVQA 3AVQA 3GLFE 3VQTA 2XTZA 4NONA 1VPLA 3K70B 4MITA 4QL3A 2ZU0C 2ZSBA 1NBME 2W2XA 5BXQC 4BFYA 1T3HA 3THWB 2IXFA 1QVRA 4PFSA 1K5GA 4JBXA 4PSKA 4JSTA 4DC9A 4O0MA 2ZR0A 2EU8A 4WBSA 3AP1A 2R2AA 3LNCA 4M0LA 3PFIA 2ZUCA 1ZD9A 1F48A 2P3SA 3OIVA 1DAKA 2GILA 1A7JA 2GK7A 1U8YA 1EFHA 4K46A 4XVRA 2DWPA 2WWXA 4PANA 1LVGA 1IBRA 1OLOA 4BZPA 2WMNB 2GJKA 3ND9A 1CS4C 2PEYA 4OK3A 4RJLA 2XX3A 4BRUA 3GMTA 1G7RA 1RW4A 3V4FA 3BERA 2D2FA 2AXPA 4MYUA 2O0KA 4LJ9A 4OI2A 2ZRPA 2V55B 2HT6A 5FTKA 3KQUA 2FSGA 4OBEA 2VRWA 2HLDA 3LX5A 2IF2A 4PPNA 4M1KA 1U0LA 3NC0C 1Z6GA 1TUIA 3GJ4A 2NZJA 4NYIQ 4B3FX 1ZJ6A 3CRVA 4YMSA 2KI5A 3DOEA 3H2YA 1IQPA 2WVJA 4QG7A 4WA7A 1PZNA 1NKTA 4IHQA 4I99A 5DI3A 1SVIA 1XX6A 2RH5A 4FW9A 1JJ7A 4ACAA 2GEUA 1G18A 4GZMA 4QBGB 1XMSA 1GKYA 1KNXA 1YZQA 3WY9A 1KO5A 1TQ4A 1Z0AA 1P62B 4RY2A 2EWVA 2BMJA 1P6XA 2H8KA 2GF9A 2ZRNA 3BD9A 5AUOB 1EX6A 521PA 4Q21A 1W5TA 4WVFA 4XD7D 4LY6A 3VMFA 4CRWB 4YLGA 4DLWA 4NYJQ 1QF9A 1N6HA 3LBIA 1COWD 2FPKA 1WF3A 4BLRA 3GLHE 4YXWD 2OG2A 2PX3A 2Z43A 4CEHB 3F3YA 4WXPA 2XOKA 3BFVA 1NP6A 2LWIA 4KHZA 1GP2A 1MR3F 1IXZA 4GPTA 2P6NA 1XCPA 2VP4A 3BOSA 4ZKDA 1WMSA 3P20A 2OM2A 2ZS9A 1E9BA 1T0HB 2BEKA 4Q18A 2XSZA 2OT3B 1E0AA 5DYGA 4ZIRA 3IKJA 1T3SA 5JECA 1JR6A 4X8LA 2QMEA 4YDHB 1UM8A 2G3YA 3GLFA 3FHOA 1DTSA 1AKEA 4CYMA 2H7VA 1NMYA 3ECCA 1US8A 1NBMA 4KYIB 1C4OA 5CLQA 3MLEA 3QENA 3R8CA 1E0SA 2CJWB 1KYIA 1CF4A 1PLKA 4IKEA 1FTNA 4QBFA 5GJWC 3TSWA 1VYTA 3KTAA 2DHRA 1DAGA 4EPYA 4DKXA 4M1MA 2GBLC 3I8SA 4HB0A 4KODA 2GCPA 2WPDD 1W36C 1J7KA 2BBTA 3A37A 3CF6R 4OI4A 1HTWA 5KPJA 3TLXA 4PPGA
chains in the Genus database with same CATH superfamily
5A3JA 1KNQA 4JXZA 3FNRA 4V38A 4TWJA 3QXJA 1NW6A 3FR8A 1NGSA 3QKSA 5A05A 4QVKA 4QJ5A 5DGHA 1V8ZA 2H31A 4LKRA 1UKCA 1HNNA 1ZVQA 2OCYC 5F1PA 1QS0A 1R6DA 4EWLA 3L4BA 4H1TA 3TL3A 4O29A 3W3ZB 5AD1A 1OLSA 1D0IA 4AS2A 3NNNA 1JVBA 2EG9A 1W0KA 3BWVA 1Z63A 1PYDA 3MGGA 1NU8A 1HM5A 1ZL2A 3BSWA 2GEDA 5D3MA 1U0NA 2NTJA 3MRTA 3SDBA 1T4BA 2RGXA 1NBOA 1GL3A 3GZJA 4KV7A 1EE1A 3GD7A 3EOAI 3RJZA 5LU9A 1ADYA 3KLOA 3KYIB 3OEHD 5HJ2A 4P3XA 1HFWA 4FI3C 1XL1A 2AVDA 3RRFA 3NIFB 1HDEA 1P9LA 3N3BC 3OTGA 1C7JA 1T25A 1YS1X 3AEYA 3AM3A 4O08A 4QUDA 3ZE9A 4DQ0A 4HNSA 1JI0A 3QEBZ 4RYDA 5KJEA 1RLMA 2PUCA 5EJ4A 1QK4A 2O2EA 2QE7A 1P2FA 2BMWA 4AMYA 4RJJA 4QGHA 1AKYA 1NF9A 3FB1A 3L6UA 4HXFB 1QBGA 4U2GA 1DIGA 4WFJA 4XDYA 3RK0A 1FNNA 1E9DA 3MTQA 4A3SA 3AVWA 4FGWA 4YMUA 4F5EA 1PEAA 1U7UA 2IW3A 3SXPA 2ZIGA 4NBVA 1KEPA 3KEGA 2V7BA 1O3YA 4IYRA 4PC6A 5GQSA 1WXHA 1U81A 2V8OA 1JA1A 2YXDA 3OIFA 1E2EA 5WRFA 2EJUA 5ARDA 3QM1A 4PTLA 3NBYC 3EGXB 1J8QA 5BN4A 5JTUA 3VR2A 4XD2A 3OA0A 2VT2A 3AEXA 2AD5A 3GJZA 1RQXA 3IMGA 5EMJA 4RZSA 3BKXA 3E27A 3URKA 1CQXA 2PX5A 3EGCA 2ORED 2EKDA 3EFEA 2N1BA 5H02A 1PBNA 2XJ4A 3PFBA 4QOIA 3KV1A 3TD6A 3VPBA 2H4HA 4EA9A 5JNLA 1KGDA 1T9KA 1S01A 5C7OO 2QRZA 1CUWA 5FEUA 3VVMA 4LYAA 3NVAA 1R6XA 1X70A 2WYWA 2XA2A 2Z9CA 3NWJA 2E18A 1SCDA 1G8PA 2RH8A 3OZIA 3SYNA 4PYNA 2I4MA 1IY8A 3BCUA 3I37X 3MOIA 2PXHA 4CQMD 4Z4FA 1JG2A 3AONB 5IN5A 5K9ZA 1OZAA 4U2DA 4KIFA 4V0RA 1GG9A 3V97A 2R85A 4OHWA 3UJ8A 2EP7A 2XY4A 4EKEA 1J0AA 1IJKA 1CY2A 2CCGA 3I39X 4FEYA 4WCVA 1GFWA 2P6PA 1XAHA 2EL9A 2QPOA 4LF9B 3H4VA 1CJBA 1WZIA 1JLHA 4V0ME 2YV5A 3BDAA 4NEQA 1D0VA 2X8JB 4BFVA 3LGXA 2AEJA 4QEZA 5HYVA 4HZIA 4PTZA 3A9SA 3OLWA 2ZBEA 1D6MA 4WY8A 4W4TA 4R7GA 2RD2A 5ER9A 1JHMA 1O03A 1C7FA 4HSEA 2H0RA 3PWSA 4JI4B 3O9ZA 2QAIA 1P4RA 2YFHA 3FR7A 1H0RA 4RKFA 3C6XA 3DXZA 4JL5A 4A82A 5SY4A 1M6WA 4CQNA 1C1YA 1CIPA 3PGKA 2WU1A 3DLCA 1SC1A 2C1EA 5ESWA 3BH7A 2OBNA 4IDPA 4F12A 1T6XA 3T1VA 4F1WA 3TLZA 1T2DA 3AX6A 1UIRA 5BN3A 2LV8A 1U2EA 5AJWA 2YFKA 4RBNA 1FVHA 1U31A 3JRNA 2I66A 2GVNA 4BEBA 4CEIA 3F46A 2CFTA 2DJIA 3A4IA 4N0PA 4R1NA 4RLHA 4LY3A 4YJGA 5J4HA 1WX1A 3EWIA 2FYTA 4EARA 1RJGA 4GSLA 4K88A 1N2CE 5IK2D 1Z28A 1ZD1A 2VUTA 1LDBA 3OLQA 2VZ0A 4P4TA 3BL8A 3KC2A 1V4NA 2C2ZA 3IJPA 4DMLA 3U16A 2ASEA 1EUYA 2H4ZA 2Y93A 5HIJA 4DNQA 3LLSA 1E94E 2VQEB 4TSFA 1JFTA 1JEOA 1M67A 3PGVA 5AKXA 1V1RB 2IYTA 5THKA 3O4JA 4EEKA 4D6YA 1P74A 3OOJA 1BS9A 3N8KA 1UZLA 3UMMA 2HK8A 1EK0A 4C0WA 2FP4B 4EX6A 3QUQA 1F2UB 1BXZA 3WLNA 1MAUA 1Q57A 4JUAA 3Q7RA 3ISVA 4AZWA 3FJOA 3HU1A 2ZAMA 4ZDJA 3G49A 1DAEA 2IZZA 1Q2XA 2YN2A 4EUNA 3GA7A 2XD4A 3N0WA 4H6WA 3KDSE 1U3TA 2YNMA 3F6YA 3P9ZA 3SSAA 3EG9B 4HYTA 4X1YB 3L1HA 1BQEA 1AQLA 2CJFA 5F33A 4ZVTA 4KNVA 1FVOA 4AI6A 1UP4A 3RUDA 1SXJC 4XPIA 4YUXA 2UZ1A 3NV7A 1CS0A 4IJ5A 3KU4A 3EGDB 2HPAA 3FNQA 2N9UA 4G36A 4KFCA 4X41A 3AVPA 3K4PA 3KQKA 1FTSA 3R3YA 4NZMA 3RSSA 1KWGA 4ZZ0A 2PG3A 4RIGA 4CMEC 1F7VA 1GSHA 3BA6A 3QF7A 1CD5A 4B3DA 2ZBFA 5LA6A 1LQUA 1PWZA 2AFRA 4M53A 4AMZA 4EHAA 3SSMA 5I4IA 5HZMA 3FTDA 2OB1A 1FPQA 1TU4A 2H5EA 5H81A 1VBMA 1TC1A 2HRCA 5JATA 3S2FA 5KJ1A 4N4AA 4WOPA 2VAVA 2FFRA 3SX4A 1IM8A 2E1PA 2XUGA 3ZNQA 2AOXA 2FUNB 1T6YA 3D7RA 4MRAA 4UBKA 2ZANA 2G08A 3DO6A 4X84A 2L69A 1WP9A 4CFYA 7GPBA 1ISSA 4B6RA 4QOEA 1WJGA 3UPDA 4Y0VA 3UYLA 1GKKA 4K3UA 2WTNA 4ID3A 4FJ2A 5IBPA 4B7CA 3GLGB 5KSWB 3EEOA 2DQSA 1E3EA 1QE3A 1JH9A 2F3RA 3WLJA 1DBIA 3CKMA 4TT3D 1KVUA 2AG1A 2HPHA 3GR6A 2JZNA 2DR3A 4EZBA 1IBMB 4KEAA 1L4MA 3VSBA 4H0FA 4R3WA 1S3FA 2O4UX 5G0UA 5KYUA 3TW8A 1Z8HA 3I34X 1A95A 1C7IA 1DL5A 4OVKA 1ZUWA 4MA4A 3MWJA 1L4LA 3AR4A 1DFHA 5C46F 3LDGA 1BTOA 2OAP1 1D1PA 4NK5A 1M1UA 1E2FA 2CEAA 4LSGA 2X7XA 4WOBA 2EERA 5DX1A 1UC4B 4MRMA 4ZGGA 3W5BA 4L4ZA 4TN1A 2EW8A 2CE7A 2VT7A 4RFSB 2ZBQA 4Z4EA 3U4IA 4TN5A 1L5HA 2R7NA 3LHIA 1N7GA 4PRYA 4YRAA 3L7MA 3CJQA 5HCIA 4TXHA 1W52X 3HZOA 4PAOA 3ZZTA 1VE7A 2FMXA 3ICPA 4N9QA 4XB1A 4ESOA 1R8XA 2Q5FA 1SBCA 2H54A 3CZ9A 1QVZA 5FPKA 1FDWA 1Q0UA 5JD6A 1Z06A 1X87A 1VL8A 2V74B 5H5JA 4GQAA 5CUQA 3HWWA 1PNVA 1AGNA 4GKJB 1NVDA 3BSYA 4CBVA 4EQ6A 2BFFA 4QO8A 3WLEA 3TFWA 5BW6B 4DNXA 2OLEA 1V5GA 2HK7A 3C3AA 3MINB 5MDHA 4JP3A 1CW2B 3BCRA 3WTCA 1M2JA 2EX0A 2JHFA 2C92A 3R3ZA 3SQWA 1DPGA 3EUAA 2REQB 3STYA 3TQRA 4XWKA 1VFPA 4V03A 3DLBA 3V8MA 2OCAA 4KQJA 4WKOA 4F4CA 4GMKA 2PWPA 1RFLA 2G25A 3IODA 4M0CA 5EFZA 2HZBA 3MSXA 2A3RA 3MS7A 1XXHA 4G07A 2R4TA 1B76A 4AJ2A 5DYNA 4OGFA 2NU8A 4B3HA 4AKTA 1Y8QB 4ZOLF 3PDIA 1KI2A 1QCZA 3LPMA 2A84A 4WESA 4B8WA 4IV5A 2B82A 2CYCA 1NHWA 4M7PA 1LJ8A 4NXMB 3U1VA 3RVLA 1G5PA 2HPVA 1GNLA 3DT8A 3GYGA 1FMLA 4LZNA 3UAVA 2DG2A 1I6LA 3G88A 1T8UA 5AVUA 5BYBA 3VSAA 2PRSA 4TRRA 3ELYA 5FBRB 3I12A 4KVGA 3QKRA 4YS6A 1G20A 3VNVA 1J25A 4EY5A 5EJ2A 2O3JA 3KNZA 4HH1A 5FD8A 1QYIA 2GRAA 5LD2B 2HQ1A 3LPLA 4V0SA 5C1BA 1ZRMA 2BUAA 4I6EA 1SUWA 4M8LA 1QUEA 4J16A 1R66A 4U3JB 2J9FA 3IQGX 3VR5H 5BNIA 5G4KB 4OLJA 5IFLA 2D0OB 2HMWA 3LVFO 2GPYA 3UJ3X 1UJ6A 4YCDA 2AK2A 2GUGA 1Q0SA 3BGWA 4GMXA 1NSTA 4FZ3A 4OMFG 4TLCA 1ZM2A 2HFJA 1Z5NA 5A6SB 2Z9DA 4LQ4A 1KQNA 2CFCA 1ZH0A 1TM2A 2FPLA 2G9NA 1L7OA 4A2PA 1Q0RA 4GBJA 3FGNA 4RVSA 2A33A 4BB0A 1FW6A 3ROPA 1VHQA 1S7CA 2I67A 4JFAA 4PYRA 3NI2A 3NBUA 4AY2A 1IDN1 1EG7A 2E5WA 3EMKA 4P7GA 4CV0A 3EEFA 2MSDB 1BVUA 4F6LA 1WY7A 4H6XA 1O8BA 4US2R 3TIVA 4B6SA 1WLYA 2HWXA 2XMDA 5TJHA 1DHTA 1P5ZB 5KX5A 1FMJA 2WW8A 3M5DA 1OX4B 3DE1X 4QX6A 3IAS6 3QG1A 4LC9A 3W05A 2CMKA 4YIKA 1YXMA 4LPSA 3K5PA 1FP6A 1SXJD 2J3EA 4G5FA 1QORA 4QJIA 1A98A 3D6HA 4LWZA 2LDXA 2BW0A 1DKLA 3DWIA 3MHPA 4F8EA 1KRWA 4LJKA 4G8CA 4JWKA 1XALA 1ODSA 2Z5GA 3OZXA 4WGFA 1MCZA 4FZRA 4CEHA 2VHZA 1RM5A 4AROA 2H85A 2OA0A 1UBOS 1AV6A 2GCGA 4ZT4A 4TS9A 2JBAA 2YJ3A 2GNOA 2IEYA 3CWZA 3AR7A 3DL2A 3CF4A 2K4MA 4UBNA 3VOAA 3B7GA 3L2OB 1F6BA 5G02A 3K4HA 2P4HX 3DXXA 2FU5C 3L8MA 3N58A 2HIMA 4X00A 3ZWYA 1SG6A 2FMTA 4MRNA 5KYXA 3WK8A 1MAHA 3O47A 3KUUA 3IRVA 5AWFC 4NCIA 1OW3B 5J3JA 4QPPA 4IIJF 3QU2A 4RL6A 3VYSB 5JSKA 3KOXA 1O94A 1T2UA 4N41A 1U0TA 2PLWA 1IB0A 1EP9A 3RG8A 3V7UA 4EZEA 3ESRA 1HDOA 4MWDA 1AZWA 4Q9AA 1UAGA 3B1FA 3BTVA 4BLPA 4BQEA 2I2DA 3H2IA 4HXYA 1IJBA 3X3HA 3F0TA 1F1JA 2A94A 1M7GA 1SNYA 1YR8A 5COAA 1XEWY 5I9SA 3RTDA 3OPYA 2CJWA 4QELA 1G5HA 4O2BA 2FSHA 1ONOA 4RPLA 1JHUA 4JJIA 3OEHA 2P2GA 2YXEA 4LV5B 2AI1A 4XYBA 2I03A 2IIQA 2YCLA 2Z2YA 3DMGA 4NSNA 4ZAVA 4PZPA 2OO7A 3PDUA 1V45E 4IIEA 3DDCA 1Y7LA 4JR2A 5DTQA 2FI1A 3Q5DA 1OKKD 1V8DA 1ZIXA 4LA4A 4BBZA 1RCUA 2BGLA 1MTOA 1SEPA 1YVRA 2WMOB 3T8YA 4C3VA 2Y2UA 3K5IA 1H8HD 3F8WA 2R8XA 5DSXA 1L5KA 1SKBA 4MB6A 1B8VA 1WXIA 3F6BX 4QU5A 2PKEA 2HRRA 4XWTA 1EEXB 5DHUA 5DPMA 2G82A 3PHIA 2CZGA 2H07A 3RT1A 4RZIA 4CMKA 2YS7A 3L6RA 4XWAA 2VSYA 1PLJA 3R6DA 1K7YA 2FAXA 3UFBA 3O9MA 4RKEA 4PO8A 3OOSA 1MOZA 1Z5WA 3KAJA 3SICE 4UFPA 3EW9A 1BQ3A 3IQDB 1EFPA 3D8BA 5ARCA 2A0UA 3H19A 1VBFA 3L6CA 1L1FA 3W8NA 4PLCA 3EC7A 1KMIY 3DDOA 2GBCA 4JBIA 4PZLA 1IZ7A 1JR3E 5HBRA 5CB8A 6LDHA 1PWHA 1RJDA 2PZBA 1M33A 2CHUA 3F73A 4YRKA 2YYAA 1QH9A 1G63A 1TA0A 2JGDB 2Q2WA 1AGXA 2DT8A 3TN7A 3QW4B 2X1VA 4MJ3A 1OTHA 1W9MA 3F74A 5JWRA 5K0GA 1UEJA 3MA0A 4U7FA 4ND6A 4NARA 3ZDEA 5CFNA 5KNCH 2ZRQA 1QWSA 4DCCA 3E9DA 1XLVA 2QLBA 3FMGA 2PMEA 4EO9A 3FSJX 1CX9B 2FJUA 5KSOA 1U0GA 2B7BA 3UH0A 2G28A 5K3DA 5ICMA 4KPFC 3OY7A 1M0EA 3M70A 1PZMA 2FZCA 4RVNA 2WJYA 3LRXA 3K09A 1QF6A 4WXMA 3K1JA 3O2SB 1NUPA 1KA9H 3PQ6A 1QCDA 4GOLD 1CIJA 4IOLA 3FFBA 3P1JA 4FD3A 2Y05A 4ZKEA 3FCXA 4DA7A 4TZ6A 3CKKA 1ZNZA 2CLIB 2P9ZA 4EVQA 3P0IA 1L4NA 1YU9A 1W2HA 1Z7YA 4PHFA 5T8KC 3HXQA 2FPUA 2QTZA 4GWLA 3UM9A 2HR1A 2VXYA 1T8YA 4RF5A 3G3EA 1EP2B 1CY1A 1T0PA 3W0LB 4XWGA 2PL5A 3IO3A 3D6JA 3W3AA 4GI3A 5FL3A 5JSZA 3N2KA 4Z53A 4MS4A 4TKVA 1G9SA 4D92A 5GVSA 3QEAZ 3PD1A 1ENPA 1S2OA 5G1OA 3GVHA 1NXOA 1PR0A 1C4WA 1Y7TA 2XMBA 4CF5A 1JLMA 2G1PA 2NPIA 4RXMA 5DXAA 4UE3S 2Z83A 3K8QA 5IVKA 2FN7A 1PJSA 5DT2A 1HE2A 2AJ8A 3SZMA 3TLAA 1UPBA 2ODBA 1C0LA 1D8TA 1RXIA 2IYAA 3GRFA 4PSAA 3OTOB 2ZJFA 2QN6A 2FEPA 2P11A 3A6JA 4J3NA 4B3TB 2NWQA 2V6IA 4IR7A 1TJYA 1I0ZA 4OQPA 3ZU6A 1HNXB 2C4WA 1UDBA 1Y8RB 1ZOLA 5FO1A 2ZFUA 3PFCA 3ZIAA 1UOOA 2VYCA 4Q7KA 1EWVA 4KE8A 1CETA 1VLHA 2YZ2A 4B9AA 2H16A 4X8MA 4AUNA 5CX1A 2YY7A 1BXRA 5COBA 5EIXA 4ZT5A 2WFZA 5BURA 1FU4A 4GDFA 4O4JA 2B6HA 3C1TA 3ZKWA 3EA4A 4W6QA 2JFHA 2Q4RA 2MYUA 5I7FA 3HJCA 4P4GA 3FD8A 5CGZA 3MS2A 4CLOA 4HTAA 4QFMA 4ERXA 2IEDA 5CLHA 4MIEA 3C14C 2Y1OA 4DRXB 1C29B 4QM6A 3PEEA 4P4UA 5I9IA 2QSZA 3TNFA 4TM7A 5IJWA 5KHLB 1DJOA 1KTVA 4W1RA 1GHTA 4B2PA 3T9BA 1R3DA 4KMMA 4GPAA 3T41A 3R5XA 2NZUG 3OQIB 3FUCA 4KQKA 3IAM6 3RRBA 3HCBA 4GKAA 3K0AA 4CIDA 2F55A 3C5CA 1JH8A 3ZCVA 1X7WA 2G8LA 3X1MA 1ZAYA 5F4ZA 1KJJA 1G2PA 4HN2A 1C4KA 5A1TA 2VVTA 4V0QA 3LYHA 2AF3C 1CZNA 2ZT6A 2JH3A 3FWPA 3PC8C 5FUQA 3AY7A 2Q27A 3TS1A 4HUQB 3OIDA 4K8OA 2ASVA 2VP5A 3TDNA 1YHYA 3DTVD 1NDQA 1TC2A 1VIMA 4PG7A 4Y6QA 2NU7A 2NN3C 1F60A 5EKXA 3VBEA 1WBJB 1VM6A 1YS2X 2GN1A 3A1SA 3N76A 4KPUA 5CA0A 2NVOA 1WPRA 1GV1A 2QTLA 4ME6A 1JG1A 2OE2A 4XB2A 3WI7A 1L7XA 2KJQA 2OYRA 3X44A 8LDHA 3U4QA 1SUIA 1SIWA 2GOYA 4FM9A 3MYRA 4WLVA 4C03A 5KTPA 1RLTA 2QYHA 1WPQA 3MJTA 3OCYA 1LNQA 1U7TA 2IVZA 1T0IA 3M6MD 1E4OA 3H1BA 4V02A 2WJVA 3TRFA 1RACA 2OFXA 2NXJA 5B1DA 2BMEA 3SJAA 4D3YA 3QH4A 2O05A 5FPSA 3HFRA 3JWPA 5E7MA 1SZCA 5ALPA 5EWLB 2CHVA 1YVUA 4ZXPA 4OYYA 1P19A 2ZI7A 2AQKA 4LXIA 4ZVOA 5CNJA 3QLEA 1RWOA 4RZQA 3UJBA 4V2UA 1QIEA 3JQQA 2IOHA 1NV8A 3BWEA 3KS9A 1IN1A 4EDHA 1RP7A 2JGMA 4DFDA 2IH5A 5IDQA 3QE2A 1DZIA 2XIJA 2IPLA 5BWLA 3G17A 3KDAA 3L4SO 4WN3A 3IVXA 1A76A 4UOQA 3SLKA 4OJKA 3NYWA 5K8IA 5CMLA 3I1IA 3O94A 1E4EB 5D8DA 3GJYA 4DV4B 3KUKA 5BWOA 1EFTA 1W8DA 3KEMA 4LZWA 5GVRA 3UFXA 3KXDA 2W6CX 1NXTA 2YVKA 1XK7A 5DM1A 1ZM3A 5AW4A 3EH2A 3ICWA 1I33A 3GB9A 1BDHA 4LF4B 2C5AA 2J33A 2ADFA 5ECGC 3NU1A 4BC0A 1MB3A 4HHEA 1ICIA 4P4SA 3WGNA 2HF9A 3MTAA 4LF5B 5L3QA 5KVAA 5FCDA 1OI2A 1XQ9A 2B8NA 5F73A 2ZLBA 1R4NA 3ANTA 4TLMB 1QANA 2DZDA 4XUEA 1N2IA 2VP9A 1FMCA 1MVLA 1EVZA 3LWNA 4JKYA 3TNYA 3VH1A 2HIHA 4AX8A 4E46A 3SBEA 4PNZA 3G6KA 5FHRA 4R2XA 1MRNA 5JH7A 5A5VA 1JR2A 1GYQA 3C3PA 1KDVA 2NUAA 1NJ5A 2Y77A 1ZRSA 3CBGA 3K9BA 4E08A 1PGNA 2H57A 1NJSA 4P7BA 4NS1A 4XFDA 5EWMB 1WNFA 4W5NA 4PXYA 3HKDA 2QTVB 4W1PA 4ZOLB 1ORVA 1NXQA 2FEWB 3ES9A 3EQ9A 3GGOA 3OPQA 3LLCA 2X5JO 3E2PA 3F5DA 4U4AA 1TEXA 4R2MA 1XD8A 2QBYB 5DTIA 1S8FA 1E62A 1QYRA 2XCUA 3FKSD 1RZUA 2QDXA 3OX1A 1IRXA 2Q6KA 2QTTA 3MWFA 5THQA 2NVUA 1G8GA 2MSWA 4XSHA 5REQB 1PJCA 3CSUA 2BE7A 4RGYA 1GNPA 5A5FA 4ZPXA 5EIFA 2DJ5A 2XQGA 3MZ0A 4GVXA 5FWYA 5I4KA 5KTKA 4EMTA 2QW8A 1TW3A 3DVLA 2B4QA 1HLGA 4YR7A 1A69A 3AO0B 5HUQA 5LWHA 3TB6A 3TUZC 5FBZA 3A6GA 2YQ4A 2MSLA 4LRXA 2HLHA 1DZ3A 1T1GA 3S2GA 1CZUA 5BSUA 3NR2A 3WK6A 1J8YF 1YO6A 2E87A 2JFXA 4K9MA 2PM8A 3HMQA 1U2ZA 2MR5A 4KBFA 4B34A 5BSTA 4Q1VA 4OAQA 1EK2A 3FIJA 3VPXA 4CT4B 3CWCA 4LRQA 1J49A 3CPJB 2PFSA 4O1HA 2VK2A 3Q6MA 2W7TA 1XTQA 1XZKA 1KVQA 1KY2A 1VJ5A 1HZJA 2VTKA 2ZJAA 2J67A 1VLLA 3GELA 4IDEA 2HQRA 5HF6A 5JWOA 3DHYA 3FJYA 3QUBA 4IDOA 4DT1A 4YRRA 5D3KA 1T2VA 4F2WA 1DWQA 3C3JA 4RK1A 2TMDA 3U3MA 4YQZA 4KAAA 1SB9A 3PNYA 4JDUA 4OL0A 1N4AA 3W4KA 4JHXA 3JZIA 2IEGA 3H1EA 3ZYCA 4K9RA 1CY8A 1DINA 4IZOA 2DHCA 1P75A 2Q4TA 3NHLA 3UK7A 2V6JA 4WHMA 3HJNA 3AB7A 2Q3FA 4OREX 4EGFA 3DBRA 5HM8A 3ND5A 4NBRA 5JEDA 3K5HA 4CM4A 4GL2A 2JHGA 4N3BA 3VH4A 3B12A 1E92A 1CVIA 3BMXA 3VO1A 5HFAA 3WAJA 3KVVA 1JEJA 4MGIR 3G2NA 1ZVVA 3FPGA 3WBBA 1AM4D 4QIHA 4EI7A 4ODIA 2RG1A 1XIVA 3ZHOA 1V8FA 4YMVA 3EDMA 3KR1A 4JJ6A 5K8CA 3DBVO 2K87A 1AUXA 4HZGA 1E79A 4IEEA 1P2VA 1DKMA 1SXJA 1DC5A 2V1XA 3FLBA 2IT1A 3D31A 4WH0A 4KV9A 3D6FA 3TD9A 1TO1E 4RH0A 3SYKA 3OZCA 1BWRA 2ORWA 2VZ8A 5I8ZA 4JDPA 1ZHHA 5BYJA 5LQSA 5F23A 3HBJA 1XK6A 5CBPB 1JWLA 2QG6A 4DVGA 1R8YA 4OLFA 1B15A 4CMEA 3WGQA 3U3OA 3JZAA 2WHPB 2GCOB 1UDCA 1ORIA 2PGXA 3AVXA 4J7CA 4AT1A 4Q24A 3M1LA 2HL6A 2NO6A 4ZI7B 4ILKA 3MGKA 3PT9A 4JVOA 4RK7A 5DTRA 5TX7A 2G9UA 4M22A 1DUIA 3DC7A 3SSOA 1EG2A 4AJJA 1FNMA 4C6TB 5IM4F 4Z9BA 1CPYA 5K0SA 1PNOA 2XB8A 5BV0A 2CD7A 3NWBA 4IL5A 4E6EA 3GPCA 1USUA 1Z36A 3TRHA 2FQYA 1PS9A 3CX7A 2C88A 4Q12A 4R6XA 2P3OA 2AH5A 5CK4A 4EPTA 2P6RA 1TPYA 1ZKDA 2WJJA 3KLBA 4NG5A 4EYSA 3LUJA 1GU1A 1P8AA 2YZNA 3HY6A 3RQSA 3RIMA 3WYCA 4BVGA 4DIEA 1OXUA 3WNZA 5H9WA 4UUOA 4EG3A 4XGNA 4A26A 2F43A 4JJ7A 1XO1A 4U2BA 2F1HA 3VTFA 1MFPA 4EG7A 4GBED 5B37A 4RK5A 1JQEA 4OKSA 1SK8A 2D1FA 3KJNA 1ZM9A 4U7GA 2EHDA 5IAAA 1AS0A 1NBHA 1PHPA 4O2RA 3T5AA 2QQ5A 2HH9A 3C7TA 3L4KA 5JWHA 3B20A 1QIFA 4L8WB 1ABEA 4EKGA 4DDUA 3OT1B 5HDQA 2CXTA 5SYNA 2FEXA 3TUJC 4H17A 4IO1A 5ECYA 1YZFA 3ZDZB 3QHPA 5BNWA 3BULA 4X7BA 1Z16A 4C2AA 1T0BA 2JFOA 7YASA 2AXQA 3RREA 3KYDB 4MVYA 1GAXA 1EXNA 4MUXA 4F93B 2VDQB 2ZBDA 3HXTA 3JY6A 1YVEI 3COWA 4I9HA 3ADKA 3O1JC 1T9AA 1C8BA 4B7UA 1KXZA 5KUTA 1FTQA 1AX9A 1TIKA 2PUEA 5JASA 3RU3A 1BH6A 1L4GA 3GJ0A 1YZYA 3MWLA 4A0QA 5K1ZA 4QUJA 1MUUA 3EVZA 5HFJA 1CB7A 1P6QA 4UPDA 1JDUA 3NHZA 1GR1A 1EXMA 6Q21A 1XZQA 3A4NA 1G1AA 2COEA 5CYOA 4OQNA 1LUAA 4HNQA 1UANA 2XT6A 5FOSA 1JXOA 3S29A 1JN0A 3TLKA 4D97A 2YXNA 1XTJA 4BEJA 3TSYA 1F14A 1WPGA 3FRJA 1D9XA 3K30A 3TNLA 1XEXB 5LUBA 1PNQA 1AT1A 1F38A 3ZX4A 1JLSA 1U9IC 1VIAA 2Z56A 3FYCA 2QZZA 4G23A 4IOKA 3WO1A 3MFQA 2GLTA 3R5FA 2QNBA 5M3BA 1EK1A 1KRXA 4GX2A 3N9IA 1V1MB 1UK6A 5FH9A 5LJLA 3T3EA 1W1WA 5IP5A 3QY0A 3LFTA 3KJFA 3NPAA 1XQVA 1I3KA 2V7TA 2V7QD 2CDAA 1N8KA 2VAWA 1QPBA 4OBBA 3AP2A 4CVNA 2J0QA 5AH0A 1CP3A 3EW7A 1EDZA 2IPXA 3M0EA 1QX3A 3E1KA 3WYFA 5HM6A 1TJ3A 4DNOA 4WQMA 3G5AA 3JQBC 4DADA 5U4QA 2JA2A 4I1YA 4XCXA 4D6XA 4JI2B 2WD8A 1BH2A 2WWTA 4BO9A 1VSUA 3REFA 4HDMA 4PSVA 3K6SB 4KPEC 3K94A 1L7QA 4WIAA 1PQ4A 3TWOA 5LQJA 1NY5A 2QLMA 4GDMA 3NPMA 1K66A 3TSAA 2CV0A 3C3DA 1LV7A 1B6SA 2WYIA 1QNFA 3WNCA 3K0SA 2HV9A 3RQIA 3B1ZA 4G2TA 4WBNA 3ZOKA 2WU0A 4HTFA 4J0KA 5CLJA 3OJWA 5E2BA 1S0UA 5AK6A 1RDFA 4I2VA 1YOVA 3CS3A 4EFLA 2MINB 1BOFA 3FGZA 3P9KA 3PE4A 3WDLA 1T9BA 1U3WA 2RBKA 2ODAA 3DYBA 4U2CA 3VR5D 4CIWA 1ZUIA 2HJRA 1JEYB 1V26A 3F47A 5JXWA 3G1UA 3UK0A 5LYJA 4X24A 1MABB 4NY1A 3H16A 1NPDA 1SBNE 4IKPA 3PV0A 3GLUA 4EGJA 1TMYA 1T2NA 3E84A 3GFQA 2WBLC 4I46A 4X65B 2O8DA 5KSYA 3ZY3A 1BDJA 3L9XA 2OGTA 1U0RA 1CR4A 5BN1A 1T4GA 2EZ8A 3GJ3A 5E1BA 5DXJA 5JI3E 2QN7A 4B3XA 2YXPX 1P7YA 4WZZA 2B36A 4HS4A 1HKHA 4YWJA 1FU7A 1EMDA 3V9PA 1P1CA 1DWPA 2I3BA 1H4VB 2B8WA 4TL7A 4DL9A 4JT8A 3H6KA 1UM9B 5ITWA 4D0LB 1AMNA 1E66A 1U2PA 2ZB3A 4ABTA 1P9OA 2HFKA 3E82A 2CBXA 3MM4A 4CIBA 5KEIA 1J90A 1X1EA 2CFOA 3DLPX 3QPWA 1A72A 3B60A 1PR4A 4IJQA 4UDOA 3GJ6A 4NL4H 2EYQA 3TOVA 1UMKA 1A9XA 2HHHB 3QE9Y 2RKOA 3DZCA 4GWKA 1JFLA 4MQEB 2BONA 3CYFA 2A8YA 5F52A 4D82A 5K3OA 4DM4A 5H68A 1Q91A 1SKQA 5SV2A 3H2SA 1PFKA 2FZ5A 3ACDA 3ZBPA 1RE1A 2Q2OA 4BVAA 3M6IA 2Z95A 4M87A 4JP5A 5GM1A 3Q8MA 2WD7B 3DDNA 4U2KA 4D80A 4G89A 4JLOA 2RHHA 3ZJYA 1TM5E 4P53A 1ZGBA 3WAKA 2GEVA 4F0JA 1RQPA 2AZMA 3LRPA 4D57A 4PHTA 2W6QA 4ES6A 2C59A 3MMNA 3QOYA 3W6ZA 2KMLA 3D3WB 2JGNA 1OFVA 2UZIR 4IOMA 3KPWA 3ZHVA 3HKBB 4EI9A 4ZEVA 3WIDA 1XTBA 2DPYA 2QD3A 3KSMA 1N6RA 4JT4A 1PRYA 1RWKA 1UOEA 1CQIA 1VA4A 3Q10A 4WXHA 2QZ9A 3VNAA 2WWFA 1JFVA 4O4HB 4AIRA 1JDBB 1KDPA 2BPOA 1T15A 3AR8A 4L3OA 4TL9A 4YP6A 3C0KA 1H2AS 2DY0A 1JW9B 4G4JA 5J1TB 2QW1A 3DJFA 1XCOA 1QKJA 1QGOA 2R11A 4ENUA 4GGPA 1Y4ZA 1SPBS 4Q3DA 4NZNA 5A3RA 2NSHA 1DJPA 1BSVA 3D0OA 1AQNA 3OQNA 1PK7A 1CUXA 3GLHB 3COZA 5JDCC 2NTNA 5J47A 3O38A 1VHDA 2P6MA 3R9XA 2HRDA 3T38A 2L18A 4NPAA 5D6NA 4L08A 2R6CA 3NTVA 4HGNA 3E7WA 3RS5A 3MB5A 1DBPA 1DSSG 2X1MA 3QLJA 1EGQA 3E9RA 3EZ9A 1TOAA 3PJFA 3PNPA 3VPAA 2R6JA 2H4YA 2CMFA 3PNOA 4YUYA 3KKKA 1TF7A 3TRJA 4H9GA 3T3PB 1O97D 5DHSA 1Z3IX 5D7BA 1ZFNA 1I7LA 1R2QA 2H1SA 4UMVA 1L7VC 4YYEA 4BKMA 5BV1A 1T2CA 2ZTLA 4K9LA 1ZO8A 4TWRA 5BRAA 1CP2A 2IYEA 2FUG1 3L3BA 2XUIA 1Q1BA 4G09A 3TJRA 4IV8A 1T1JA 5ICCA 1TCAA 1G8MA 1E5DA 1GDHA 2WAXA 3PIIA 3KVRA 3JPYA 3S5UA 3B5EA 3HCFA 2OP1A 3TG8A 2QUIA 4FN4A 4S0ZA 4NG4A 4BU1A 4YT4A 4Y2VA 5CVTA 4LJ6A 5K6AC 4Z0NA 3RT9A 1UOQA 1NUAA 3TR6A 1FBTA 1BYIA 2WPDA 4HG2A 3VUFA 2PL9A 3UMYA 3G0HA 4LE1A 3FKSA 1D4AA 2W90A 1ZJZA 2PKXA 2HA3A 2BFDA 3AFOA 2NSJA 1VMAA 1E1CA 3BE4A 1PJTA 5T8KA 1E1QD 4B5KA 4W99A 2QJOA 2ZJ3A 4BTVA 3MGAA 1M72A 2O9JA 1R18A 1Z39A 4EGAA 2W2PA 2EFHB 5LKRA 3QU4A 3GLIB 3CF0A 2VAXA 2QI9C 3QXHA 2Q3BA 4YRQA 4RPKA 1QBKC 2IL1A 1UZAA 1DDIA 1L7AA 3QFFA 4RABA 1JI3A 4R9NA 3V8BA 5HZGA 5J5VA 1JKIA 3O8OB 2AJBA 4Q4DA 1BROA 4UUPA 3F6EX 3N6VA 1LKZA 2VCEA 3OKFA 1NVMB 5JCJA 2VH5R 5IXJA 4A15A 1M0SA 2NZXA 1KE1A 5B7NA 2OXRA 2FXVA 2X0KA 3QFRA 1HLDA 3WNDA 4ALNA 5F21A 1OH5A 1JQJC 2B1QA 3KQHA 3O8BA 4JT2A 1II9A 3M33A 4HDQB 3TECE 3GNTA 2GZRA 3QELA 4M2LA 1RPNA 1UMDB 3RYHB 1FQJA 1ISMA 4Z4CA 3RAEC 1EHIA 2GZMA 3BA1A 3QJGA 5UKDA 3AUTA 1TM1E 1TYDE 3P2KA 4AJ4A 5A4KA 3T95A 2NUPA 4RSGA 3QEMB 1J8VA 1E9VA 1T5DX 3LIIA 1KYWA 3AR6A 4RD1A 3IKTA 1BCRB 4GT1A 1C81A 1M5RA 3SBXA 3N2LA 2E4UA 4A8JC 3A9UA 3LBYA 2HMAA 3ZJUA 3HFGA 4OXNA 4ENPA 1BMDA 1Q1QA 3E9EA 5F3RA 3MNFA 1IUKA 5FPQA 4OLHA 1FDOA 2Q6OA 2BI4A 3Q3VA 4C30A 3T5TA 1UKVY 1H2RS 1LDMA 2HBZA 1W1IA 2C61A 3M4NA 4ND8A 1DS6A 3HCAA 3OZBA 1RI1A 4WKGA 3WIVA 4ALKA 4C9BA 5A2GA 4GI2A 1B0AA 2RAPA 2X9QA 5C31A 2UYQA 3AL0C 3BXHA 3OC6A 5JJCA 4YJ2A 1AUPA 2IK8A 5SY9A 2FWJA 3AUSA 1MJHA 3C3WA 1C80A 1K2VN 3JYNA 4KXXA 1UC8A 5D5HA 4A6PA 3HJHA 5BMOA 1DARA 4NZ9A 4M9XA 2PQ0A 4UMEA 5BV8A 4CV1A 1ECBA 3NHFA 3GW8A 3R2JA 4BGUA 1V8OA 2V6BA 3I0MA 1U2RA 3SHQA 1PL8A 4EQZA 3WV5A 4KFUA 4C0QC 4PO3X 3O84A 3WOVA 2BEJA 1I36A 3QHQA 4LXHA 2H1HA 3PQ7A 4IY1A 4WKNA 1OWOA 3H18A 2IHYA 1WDLA 4FCVA 3OZDA 2ZE5A 1DAHA 4TXMA 3HM9A 4OHBA 3EWSA 3OJLA 1GPJA 2HA5A 4WV3A 2N47A 2AI2A 4URHA 4IXDA 3V4PB 1VP9A 3CVXA 3TIFA 2PKQO 3CPEA 3CEJA 2LCIA 3ODGA 5DNUA 5JLJA 2BF4A 3HDGA 2OO5C 4PSUA 2XKAA 4HWTA 4RVUA 3TOZA 3I8OA 4YCJA 2YWCA 1UBHS 5BXYA 1TD9A 1A4IA 2VJMA 1NMQA 2O5RA 4ON9A 1RP1A 5HF9A 5DK6A 4C7VA 4RXTA 3DBOB 2NX2A 2IY7A 5DYTA 5BPFA 3RADC 1CUIA 4MK4A 4G9GA 1M2HA 5BORA 5KJCA 4C2TA 4KE9A 3WGHA 3KTDA 4EG0A 4TMTA