1HTWA

Complex of hi0065 with adp and magnesium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HI0065
publication title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1htwA00
1HQCA 2YKGA 3MWKA 1UM8A 4NONA 5DYGA 3GLFA 3RWMB 2NZ8A 3GLIE 3NHAA 3NVAA 2IL1A 2L0XA 4M1OA 1NLYA 4HLDA 2CCGA 2ZRCA 1PUIA 2A78A 2ZYTX 5KSPA 3OF5A 2WMOB 4MQBA 3GJ4A 3SC3A 2ZTSA 4C4PA 4JLMA 2QRNA 1JEEA 2AWNA 1IN6A 4X8OA 3D7MA 5FUVA 4AKHA 4B2PA 1M2OB 3QF4B 4FIDA 1GSIA 2A5FA 5A0FA 4HYYA 3RC3A 5M04A 2VRWA 1VCNA 4GT1A 1XCPA 2WWFA 1Q44A 5IF9A 4A82A 3KQKA 2VHCA 5TMPA 1E0JA 1DAKA 1E9DA 1KO7A 1UJ2A 2QORA 4MUAA 1PVOA 1UEJA 2C77A 3LFUA 5EE9A 2NO0A 1ZUIA 5AJVB 2HYDA 4Q9KA 1R6BX 1QVAA 2ORWA 1RZ3A 5BWMA 3L0PA 1XPRA 2FDCA 2B7CA 2OFOA 4LJ7A 3WHLA 3U6KA 1P2TA 4KVGA 4M0LA 3FHTA 2JCSA 4ZV4A 3A8TA 3I8XA 3PEUA 1XEWX 1BYUA 1GKUB 3EW9A 3FPAA 3LDAA 4V0KA 2BOVA 2B8TA 3VU9A 5EQTA 4L9WA 3QKTA 1CTQA 4BRWA 3RDPA 3GLGB 1T5LA 4F92B 4GNKA 3IQWA 1NVUQ 4LBVA 2OE2A 4WW0A 3CZPA 3R7WA 5JWHA 3MLEA 1A7JA 2Q21A 4DSTA 2JIZD 3DMNA 1SXJB 2IS6A 2W58A 4QJ5A 1T91A 4Z8YA 1Z28A 3VHXA 2KBFA 3ICQB 3MMPA 5AJXA 3UANA 3IO5A 2FFQA 2H92A 1XXHE 3CX8A 2IHBA 4S2EA 3X1DA 3PIRA 5JSZA 3IIKA 1O3YA 1CIPA 4NKRA 4G5QA 3U4QB 3OHMA 2GCOB 5F98A 4H1UA 3QXJA 4URZR 1M7HA 3N70A 3BORA 4TMZA 4W5WA 5FFMA 2JGNA 2FSHA 1G3RA 3NXSA 4JJKA 4UNRA 2IUTA 3NWJA 1GL7A 4NCNA 3ZQ6A 3U6BA 4C2TA 3AVWA 3W6OA 1AGPA 4MRSA 3KL4A 3OESA 1L8QA 3CPEA 1Z06A 2REXB 4RD4A 2HXSA 4PO9A 2HYIC 1KGDA 2RGNA 5EUMA 2A2ZA 2WIBA 1N2CE 1VIAA 4EJSB 3ZS9A 4IOJA 4KODA 2GDJA 3K70C 4Q47A 2WICA 1Z0KA 4ZKDA 2CL0X 4BFUA 4RZUA 2GBLC 1XTRA 4HDQB 3ZVMA 2ASEA 2VBCA 5L3QB 2A5YB 4RKEA 1JR3A 4TT3D 1N0UA 4AIIA 2WAYA 2C5LA 1LW7A 3CF6R 4EPXA 4A15A 4NBSA 2J7PA 3U7EB 1E1RA 5H8WA 4DHEA 1W5TA 4TMTA 3OEHD 5IDVA 1GFIA 4Q03A 3PENA 2DYKA 1II0A 1UPTA 1B0UA 5L3VA 4W5JA 2XTMA 1NL3A 2CHVA 1GVNB 4KSCA 4PPGA 3CF0A 3Q72A 5EP1A 5CLQA 2VYFA 2XNSA 3PUWA 2ZITA 3QUSA 4PQYA 5AK0A 5E7MA 2CMKA 2GAAA 3CONA 3I4LA 5EJEA 1OV4A 1ZMXA 1E2EA 3ADDA 2BMEA 1NG1A 2DFLA 4RFSA 4L15A 4OHXA 4ESVA 2ZRBA 4DLVA 3FWYA 1DAMA 1DARA 1ZBDA 1ZIPA 2QPTA 1Z6GA 4J0QA 2ZRIA 1Z0DA 1Q0UA 4PC1A 4TMKA 1UAAA 5DSZA 1F2UB 3ZIAD 5EUQB 3CO5A 4PSAA 5FR2A 2J45A 1GG2A 1RW4A 4LHVA 3QQ5A 2DFNA 1E32A 4BFYA 2MSDB 5GJWC 4A8JB 3TSZA 4RD3A 2C03A 4GP7A 1OPXA 1NP6A 2XJ4A 2ZVPX 3U44A 4JL6A 1FNNA 3EG5A 4QNMA 2D7DA 2AL7A 5CITA 2ZR9A 2FG5A 2YJTD 1KDTA 1KNQA 1H8EA 2C98A 2ZJ2A 3ONWA 5IT5A 4MKGA 3LWNA 4B74A 1NJGA 3LX5A 4PQRA 3CNOA 1ZNYA 3VFDA 1W47A 3U7GA 2WZQA 2FEMA 4D4LA 3D31A 1G3MA 3OFND 4C7OA 1AIPA 4HB2A 1HT1E 2BHRA 2C04A 2EYUA 4V0OA 3T1TA 1HT2E 4PSKA 2XGJA 2VP6A 1E2LA 4IOLA 4QGFA 4DDVA 1U2RA 1VG9B 3U3OA 2JLYA 1U9IA 2CL7X 5KUTA 2JIZA 4I4LA 4BLSA 1KIMA 2ZQ5A 4M4SA 4UQOA 1T8UA 2G1JA 1BMFD 2JLRA 2ONKA 4R98A 5FOUA 2ZIAA 2R44A 1RRCA 2KJQA 4IVRA 4CT5A 2XZPA 3T12A 4BZQA 3AKEA 4CEIA 4NTZA 4DWJA 4QGHA 3HU1A 1LY1A 3KFVA 5CDFA 2GA8A 5JCZA 1ESMA 4KVAA 4I1UA 1Y3AA 5EE5B 1I2MA 3BERA 2PT5A 1SVOA 5HPYB 3FDIA 3K1JA 4S35A 1OFHA 2JJ2D 2FGKA 1J2JA 1HH4A 1R8QA 3MG9A 2WJJA 4I1VA 4KV9A 3FHOA 4DB2A 1XTQA 1SKYE 5A4JA 3F0TA 1P75A 2H1LA 1E1QD 2V4ZA 2IYYA 2B7BA 3T15A 3P20A 5J5CA 3EA0A 3IO3A 4GI7A 2AFIE 4NZYA 3TK1A 4BFZA 5KO2A 2D2EA 4PZLA 2BBOA 3CUEF 4KBGA 3OIUA 2D06A 4Q4JB 2XB4A 1PJRA 1XD2B 2P6NA 2WKPA 4US0R 5BYJA 5BYKA 4PTLA 3KDSE 1AS2A 1E94E 4JLOA 4JVLA 4LYHA 1W0JD 2HLDA 1AQYA 4RD6A 3CBQA 2VIIA 4JSTA 2OAQ1 1WBBA 4UXHA 3TUIC 2DWQA 4ZPXA 2A5GA 3LBHA 1CRPA 2CL6X 2DB3A 4LJ6A 4LC1A 4BFTA 1ZM2A 3IEUA 4LYAA 1UBCA 3HWSA 2BKEA 3QKRA 1P9RA 2G1KA 3BFVA 2LKCA 2UKDA 3LAWA 4NCKA 1II8B 4PO1A 4RD2A 2VL7A 2BKUA 4B6EA 1UKEA 3KKPA 4XVUA 2UVQA 5K8LA 1XEFA 4OHVA 4XD7A 4UKDA 4Y0VA 4ZDKA 4PHTA 4Z1MD 2O0HA 1N6RA 2AHOA 4DEYA 1UKVY 1ZCBA 1Z6AA 3EARA 1W1WA 5FH9A 4RFVA 5B57C 1G7CA 2IA5A 3F8TA 2ZRLA 3DKVA 3B1YA 1RPZA 2ZE5A 4B3CA 1US8B 5GADl 2A30A 3FFAA 2TMKA 1EFRA 1NY5A 4CT4B 2JJ1D 3Q5EA 4TWZA 2VHQA 5G41A 4KHZA 4OJKA 4BLQA 3C14C 5DN6A 2VP4A 1YZGA 2CHGA 3K0AA 4OHZA 2V8OA 4IRUB 4DC9A 2PEYA 3AUXA 5FBQB 3MGCA 1OYWA 1EFUA 4II7A 2GHIA 5AJZA 4PHGA 2QL6A 4UXJA 2NO7A 1I2DA 3DPUA 4X8HA 1G41A 2VHJA 4RSGA 4DKXA 4XWKA 2QROA 5BN5A 2CK3D 1M6NA 4L9SA 4KYUA 3A4MA 3TR5A 1CBUA 2EFDB 1XMIA 1M74A 3SEAA 3UWOA 5F9FA 2D74A 2REBA 1U8ZA 4H9GA 4KXFB 4UJ5A 3EC2A 2ZJYA 1FW6A 1CJMA 4V03A 2E87A 1UKYA 1Z22A 3KKNA 2J7KA 2QGZA 4MKHA 4QG7A 3RRYA 4LBZA 1XD8A 3LVQE 1F48A 3LW7A 3TR0A 4LY6A 5HCNA 1DAEA 1Y63A 2GKSA 2VH5R 4LSGA 5DISB 4Q7LA 4YMTA 1P2SA 2AWOA 1BMFA 2Z0MA 3EX7C 3ZVNA 4PFSA 1ZVQA 3RSOA 4JVSB 4AKGA 4OHWA 3KTAB 3VAAA 1ZM3A 1X8KA 3RWOA 3VR2A 1GM5A 3WMFA 3X2SA 1OB5A 4MGZR 1PLKA 1NN1A 5FUYA 3ZLJA 1J70A 1SVWA 3ZZUA 4FCVA 2XB2A 2QMUA 4OKSA 4MKFA 3CB4A 1E9BA 1QG2A 3LH5A 3QPUA 1L4UA 1U94A 5SZKB 3SYNA 3VR3A 4FI3C 3LXRA 1U0LA 3FMIA 1XTKA 3N2EA 4RJLA 4AD8A 3QOFA 2W2TA 1L4YA 2GXQA 1GIAA 3ZJYA 1J8MF 1NSTA 4ZO4A 1TX4B 2GF9A 5KPDA 4JS0A 2HUPA 1OH5A 1FFHA 1YQTA 1KZGB 1Z5ZA 2BV3A 2QPAA 2QE7A 4D26A 2DY1A 2QMOA 4W5HA 3FKSD 2W83A 4B71A 5G3YA 3F5FA 1XMJA 2HXYA 2OV2A 3R9WA 3C15C 4LJYA 3GLGE 1N6NA 2CLCX 3SJBA 1SZPA 1S9HA 4C0HA 3CKLA 4EFNA 1NBMA 2GRJA 4FW9A 4JIMA 4XVQA 3IUYA 4KAXA 3X1WA 2QP3A 4GOKA 1SXJE 3CRMA 4JVMA 2IYQA 2VO1A 2ZRHA 4LRWA 4Q4HB 4LBWA 4AWXA 5CJPA 3GLIA 3R9XA 2GK7A 3NEJA 4JLVA 3V00A 2CJWB 1NN0A 1IY2A 1AN0A 1XJQA 3K0FB 5B2ZA 1G8YA 1OXXK 4KSBA 2EWVA 4QJ3A 2QTVB 4FD2A 2RGAA 4LHXA 4B2LA 2KBEA 2WBLC 5EE0A 4D81A 2I1VB 1EX6A 4MDEA 4WZ6A 2EWWA 1XZQA 5KPJA 5G3ZA 4B76A 1X1SA 3M1IA 1W49A 4DDWA 1TQ6A 2I1QA 4JL5A 3QSYA 1EGAA 1Q1QA 1SVSA 2V9PA 1KO8A 4FMCF 2OCPA 1Q1EA 1DAFA 4AG5A 4NE2A 5CM9C 2FPMA 4GMXA 1M7BA 3AF4A 4H1VA 2R62A 4QC2A 4A0RA 4LV5B 2B21A 4X8LA 1ZJ6A 1E2JA 2G9NA 2QTHA 1T0HB 1ZM9A 1FOEB 5IK2D 2JDIA 4DLXA 4HZUA 3GEHA 4CRWB 3NG1A 4I99A 3K70B 4D6PA 2O8CB 3E5HA 3MWYW 2N46A 3KXLA 3SBDA 1G6OA 1NLFA 2YWHA 4PR0A 3K09C 4DSNA 4P4UA 3UWKA 5JLJA 1OXUA 2A5DA 2ODBA 2QQ0A 5KDOA 2GJ8A 1OKKD 3THWB 3CH4B 2XSZA 1CRQA 1L7VC 4TL8A 2GXUA 2NGRA 2OZEA 3SI7A 3T1VA 1AZSC 4Q18A 3AVPA 2H18A 4TL6A 2OILA 1WB9A 4B73A 1KMHA 4GP6A 4YQFA 2F9LA 1PV4A 2CE7A 3DO6A 3I8SA 3UIEA 2YZ2A 1KKMA 1K6MA 2VP5A 4QHTA 4GSYA 1ZM7A 3SQWA 1HYQA 1XXHA 2PL3A 3UPUA 3EXAA 1S4QA 2OFXA 3RRNA 1BOFA 4B47A 1ZC3A 3I73A 2P5SA 3B2EA 1CF4A 3DEFA 2JLQA 2BDTA 3SQXA 4C0KA 2BCGY 2C99A 4TLAA 2ZYVX 3LLUA 2P2LA 3QXHA 2PT7A 4R9UC 4EIWA 5AWFC 4LHYA 3D8BA 3KKMA 3CH5A 3GLFB 3W8RA 3PEYA 1JPJA 1E9EA 2WKQA 3NBFA 1FQKA 221PA 2ZS7A 4LBYA 5FOSA 3GLHB 5LPNA 3T61A 3IIJA 4A0HA 3A1WA 1W4RA 4ARZA 4JT4A 2ZM5A 2YWGA 1ZP6A 2FOLA 1YR6A 2ZAOA 4KO8A 1EK0A 3L8ZA 2ERYA 3RANA 2D3WA 4M1KA 3KXKA 2IBMA 1FL9A 2IXFA 1XCGB 3ASZA 5JWOA 1FTSA 1P4SA 2NTYC 4PANA 2IEYA 5GJVC 2HF9A 1W5SA 1Q57A 2NOAA 1DG1G 4E07A 4JZKA 3WBJA 2IYSA 2O8FA 3GD7A 3LNCA 4ZI2A 1DEKA 2QMHA 4Q4AA 4NU0A 1EG7A 1EFCA 4DB4A 3CZQA 3ADBA 3RHFA 2R6AA 4LJ8A 2OXCA 2GEVA 4HEJA 2G0NA 4OYHA 2GEUA 2XXAA 4M2LA 1M34E 2BMJA 2WWIA 1NMXA 2ANCA 4HLUA 3WXMA 3LVRE 2H16A 2J46A 2W0SA 2PCJA 4OK5A 2QPOA 4XIGS 4JVNA 4JKIA 2CBZA 3UXMA 3W6PA 1IY1A 1I4LD 1P60A 2ZRMA 2WWYA 1CJUC 2P3SA 1G5PA 3GJ7A 2BCJQ 1LS1A 4M9SA 1HURA 4FMCB 3ZVRA 3MSXA 2PMDA 3TIFA 4OQMA 4DXAA 4EPVA 3R7WB 3VR4A 4XWAA 1RFLA 4EPYA 1R0YA 2W6IA 3AKDA 3GJ5A 2GF0A 4HUQA 1XEWY 2J87A 1RJ9B 1AZTA 1VTKA 3LQQA 3TSWA 1T6NA 1NLZA 3BFKA 4DCTA 1JQJC 4O0MA 4WBSA 3GJ0A 2ZYWX 4NYMR 3KB2A 4U7DA 5BQ5A 4O3MA 3NBZC 3FGNA 4FMBB 2ZUDA 3AQ4A 4IVQA 2WOJA 2RKOA 4Q1EA 5B64A 4CVNA 4BFWA 1JR3D 1XTJA 3AF1A 3NIBA 4CEJA 1NRJB 1RE0A 1SVLA 3EIQA 4ZCMA 3SS8A 1UADA 2RGGA 4LZZA 1JAIA 4HB0A 1GAJA 2RGBA 4OK6A 1RRPA 2J7PD 4IDOA 4E09A 1E1RD 1HUQA 4GPTA 2GILA 3BH7A 1S9DA 2NO1A 4F93B 4GOXA 3B82A 2BJVA 2XITA 2AR7A 4TLBA 5JI3E 1KDPA 4DLUA 4Q19A 4WZAE 1F2TA 1CJTC 1FPMA 4V0NA 3SJCA 4CEHA 1DTSA 4LJAA 4TTQA 4OI2A 3BGWA 4P4SB 3H1TA 3QBVA 3VHLB 5L3SB 1T3SA 5SZIA 5HE9A 3UG6A 4B3BA 1MO4A 3QF7A 1FTNA 2FE4A 3BH6A 3DZ8A 5TV2A 5KU1A 1SHZA 2IXEA 1CLUA 2VP2A 2ZU6A 3IBYA 3SJAA 5JEEA 5JHHB 4D82A 4G3XA 3X1YA 3DMDA 1E69A 1G8GA 4NYIQ 4BASA 1KTVA 5FPKA 4GBMA 5K8TA 1XRJA 2IYUA 2A3RA 2FSGA 3BH0A 4TL7A 2QAJA 3IBGA 2HEIA 3CX6A 1OXSC 1YZLA 2QAGC 1AQUA 1NN3A 2RGEA 4BEBA 3A1TA 3AF3A 5FTKA 2XTNA 2IF0A 4CW7A 4ERNA 3K8YA 3WRXC 1KNXA 3U3RA 5AR1A 2AKAB 1KI4A 2OHFA 2WJVA 3F3YA 1Z0AA 5L8VA 5KTYA 1Z29A 1H8ED 3AVQA 1GL6A 4Q7JB 5JBQA 3EAQA 2ODEA 1T5IA 3RS3A 4D2IA 4FCTA 4A36A 1P9WA 1X6VA 3ETLA 2PMKA 4HAWA 3TAUA 4LOAA 5AJWA 2ZRAA 1X1RA 2ZPTX 2IXGA 1GUAA 1HEIA 1KJYA 2ZJZA 3NC0C 4R2IA 1KJZA 2QSYA 4NDZA 1D2MA 3B78A 3T5GA 1XWIA 1NVXQ 2GVZC 4KFUA 2JA1A 1BKDR 1LTQA 2PCLA 3PUZA 3BJIC 2QGNA 1II9A 1WP9A 5CJ2A 5GVRA 1SGWA 3CWQA 3THYA 1ELOA 1HTWA 3TLXA 1CS4C 1EWRA 1ODFA 5EP3A 1ZCAA 4HATA 2GK6A 4IDQA 3SR0A 1AJEA 3M6AA 1I4DD 4Q1AA 2C2HA 3TMKA 5FTLA 1VCMA 4G5OA 2IYVA 4DT1A 1E98A 4O25A 1E2PA 2QENA 3KXIA 3PCRB 3T1OA 1G7RA 2ZR0A 4ZDJA 1C1YA 4ILEA 5KNBA 4BLTA 1G7TA 4ZIRA 1OW3B 4EDHA 4TLCA 2EFGA 4KCGA 1ZD8A 3AV0B 3GJ3A 4RD0A 1KHTA 2HDNB 2RGCA 1E6CA 3HPQA 2BIFA 2DPXA 3EZ9A 4M1YA 1E9AA 5TY0A 3H2YA 4ZCIA 2QM7A 1X3SA 2BC9A 2O5VA 4AY2A 2MMCA 3QKUA 1Q1BA 4P3YA 4P4TA 2FFBA 1E2MA 1G8HA 3ZGXA 5FI1B 2EFEB 2HLDD 1OB2A 2J0UB 2ZJ5A 4ABYA 5EP4A 3SYLA 1RC8A 4B6FA 1VPLA 4R71A 1COWA 4ACBA 5DE3A 4QXAA 1ESNA 4QBHA 5K8UA 1NMZA 2GNOA 3OE7A 1Q3TA 1RIFA 1JQLB 5UKDA 4B3GA 3SE0A 3KB1A 2QMEA 4PAOA 2FSFA 3I5XA 3MUFA 1GZSA 1U8AA 2SHKA 2W0MA 4XD7D 4E22A 1U81A 1TEXA 3U61B 1XTIA 1ZW6A 3BC1A 4Q9LA 3KQNA 4KYIB 4MGIR 1NI3A 5DGXA 2IWRA 3ZD7A 3ZVLA 1OIVA 2OM2A 4B43A 1N6KA 4B3DA 1TUIA 4A2WA 2OCAA 2ZREA 3UK6A 4UNSA 2CEAA 2ZSBA 1EFRD 2LCFA 3EPLA 3QG5A 2F1JA 3QF4A 2GJSA 3H86A 2WJHA 2ONJA 4M1WA 5DN6D 4PZYA 3CIOA 4PC6A 3RYTC 1XNJA 1FUKA 3EPJA 3HP1A 5HTKA 4US1R 4Q01A 1AK2A 521PA 3QY0A 1ZD9A 1CJVC 1Z6TA 2F43B 4QBGB 4WVFA 2V7QA 2PLFA 4GL2A 3KKOA 1R7RA 1R5OA 2OLJA 4LHZA 3A37A 4LPSA 4YC7A 4QKQA 4M21A 4D25A 2KB0A 1EX7A 4JLBA 3GJXC 1JPNA 2EQBA 2WWXA 4OI1A 3TQCA 1IN4A 1GITA 2G0TA 2Z4SA 4WAUA 4WOPA 5TVKA 4A2PA 4DUGA 1XCMA 5HE8A 2WOOA 1E2GA 4DLZA 3GLGA 1KDRA 2PZFA 2J3EA 5F2EA 4GZLA 3SHWA 4TYWA 5BN3A 1SVKA 4QNRA 3ZD6A 3LO5A 3SU8A 4DCSA 3MJRA 3MCAA 2R6GA 2JLUA 1SXJA 2WHXA 3QXSA 5E3HA 2VA8A 1G20E 1QF9A 1QHGA 1P9NA 5BXQC 3VQTA 4XVRA 1C9KA 2AXPA 2QT1A 4TSFA 4LV6A 4DRZA 3U4QA 3LV8A 1OH7A 2J5XA 3FMPB 2Q9BA 4YDSA 3AB3A 5JZVA 1MRNA 4US2R 1JXMA 1LVGA 1L2TA 5B30A 4B3XA 2Q9CA 1GILA 4KFTA 3GLFE 2IYWA 2JATA 3M0EA 3UG7A 3TUJC 4UNQA 2JJ8A 2FJUA 1WBDA 3H4MA 3A36A 1VECA 4TN1A 3GLHE 2FA9A 5AJYA 1MABB 1JJ7A 1H65A 3HYRA 3GQBA 4HSEA 4RY2A 4TMWA 3CNNA 2ZEJA 3WBKA 1ETUA 4EJSA 1IN8A 1XDBA 1A4RA 2BBTA 3FVQA 2EFCB 3R20A 1E2HA 2KSQA 2GAOA 4BGDA 1IJFA 1KI6A 3CLVA 1YU9A 2VSXA 2QE7D 2RGNC 3TVTA 4TYYA 2ZJOA 3MWJA 2ATVA 5L3QA 3AP2A 2ZI3A 3TAHA 4AURA 3HU3A 2ZS9A 4AYTA 1UEIA 2IX3A 1NBMD 2Y8EA 5BN4A 2FFAA 2DWPA 3B1VA 4MRNA 3JZMA 1XEXB 1R4AA 3CRQA 4NYMQ 1N6PA 1VHTA 2QP9X 4B75A 4JBWA 5DI3B 1R2QA 1TU3A 5A5GA 4O2RA 2R6DA 3HU2A 3RABA 3VX3A 3PITA 2CLSA 3WYFA 2VLIA 1RRGA 1ZNZA 4AYXA 2GXAA 3WNBA 4HUTA 3TH5A 1F5NA 4D0NA 5DLQC 2FN4A 3LY5A 4BFVA 3A4NA 3CRW1 3CNLA 3WP0A 1TU4A 1YZUA 3SN6A 4FCWA 3IHLA 3RS5A 3IIMA 3L0OA 2F1IA 1G64A 3KJIA 2O8DB 5HCIA 1QBKC 3Q3JB 4D80A 4C30A 3GEEA 2IS1A 2ZUCA 4KLNA 3GLIB 2F6RA 2X77A 1DO0A 1XP8A 4JBXA 4DJTA 3L82B 1G21E 4HAXA 3PEWA 1R0XA 1OLOA 3GJ8A 2ZE6A 1ZIOA 4DBLC 4TZ0A 4IDNA 4M8NE 4A8JA 2RGXA 4Q9IA 3FTQA 4D0GA 2JDID 3L8YA 1C4OA 2E9SA 5HKKA 5IHPA 2QQEA 5FBVB 1QHSA 1Z8FA 2YV5A 1JI0A 4OBEA 6Q21A 2IF2A 4DLRA 2HT1A 3JVVA 1XFAA 3FE2A 4U02A 2O8EA 4NYIR 3EPKA 1B23P 4ESHA 2Z83A 1XX6A 2CE2X 2XSZD 3RS2A 1DE0A 1DAHA 2AD1A 2B6HA 3K9LA 2QBYB 4XTRA 1E79A 2FFHA 1OJLA 3NH9A 4PC2A 4F7WA 4R7ZA 2YOFA 4FMDF 5ANRB 1LF5A 3A4LA 1VIYA 4JJZA 1HE8B 1Q3HA 2J41A 4XOIA 1J90A 1WDTA 1FUUA 1VYUA 5EP2A 2X1VA 3FKQA 3ZQJA 2LKDA 3EIHA 3TUZC 1W36D 3RS7A 2J59A 4NHOA 1U9IC 3AKCA 5FUXA 3PJRA 1EFTA 2CVFA 1NJFA 5FI0B 4Z54A 1FMLA 1ZUHA 2BEJA 2O0JA 1A5TA 2YNMA 1W0KA 2Z5FA 3A1VA 3RAPR 3KKQA 2Z6VA 3PEVA 4EQ6B 3K0SA 4B34A 3KJHA 1ZU5A 5D3MB 1GKYA 3VR6A 2O8BB 2HV8A 3A1UA 2F1HA 3A58B 1E9CA 3GFPA 1E9FA 1IBRA 4TMVA 3BOSA 2RHMA 2DR3A 2QAGB 3AF2A 3PUYA 3SNHA 1W44A 3TKLA 1NF3A 2BM1A 1AS0A 3EASA 4URWR 3W3ZB 4BFXA 3BIFA 1NG9A 2CVHA 3E1SA 5EZ6B 4F4JA 3B1XA 1Z6YA 3WYAA 4A0FA 4MDFA 3KJGA 3CPJB 2WPDA 4Q4JA 1K5DA 1XD2A 2ECKA 3EC1A 4POAA 4A0GA 4LK2A 1CR2A 2XNDD 4I1OA 4Q1CA 5KDLA 4DCUA 2YWEA 4BECA 4ARZB 3K0CA 1KI2A 2ZXUA 2FZLA 1MT0A 4LUCA 2QM8A 1MO3A 1VDZA 4ACAA 1QDEA 1J8YF 1ONBA 4OI4A 3LXXA 3DKPA 2RCNA 5E7JA 4RCYA 4UJ3A 4OQLA 4AYWA 4JLPA 3X1ZA 2ZE7A 3BK7A 1CJKC 1Z0JA 3WP1B 1II8A 1SVIA 4N3NA 1N6HA 3I5YA 4GOJA 5CIWA 1TPZA 2O8FB 4Q4AB 2Z4RA 1AKEA 3FHCB 3AF0A 4LWZA 4PHHA 4Q7KA 1N0VC 4HAYA 1FX0B 2W6JA 4Q1DA 3SJZA 2OUKA 1FMJA 3Q8XB 3VTKA 2VPPA 2W6ID 3L2OB 1V5WA 1OH8A 3MWLA 2RMKA 4B48A 1W7AA 3C5HA 2BM0A 5FUWA 4PAQA 4EUNA 3KQUA 2J9RA 1Z63A 2ZSDA 4PPQA 2NO6A 4ASUA 1US8A 3L0SA 2MSCB 3AEZA 3RRZA 2ZRDA 4PHFA 3AVYA 5JECA 4BWYA 1JNYA 4IFBA 1R5NA 3NC1C 3N5CA 3P32A 2PBRA 1XZPA 1DELA 2QTFA 4YMWA 1IXZA 4Q9HA 4OQNA 5FOVA 3PXGA 3NEYA 1FQJA 2R6CA 2IEZA 4P33A 1P7CA 1SVMA 1P2VA 3QBTA 2PX3A 2PX0A 2JEOA 5FL7D 3FMOB 4OQXA 4BUJA 3QVVA 1G1MA 4Q1BA 3O8DA 5FTJA 5LB4A 2F7SA 1D2EA 4F4IA 2FF7A 3RVBA 4B2IA 1QHNA 3D3QA 2HCJB 4G5SA 5AUOB 1G8PA 3DL0A 3S1AB 1KI7A 1LS6A 4KU4A 4GZMA 4EPRA 1QHHB 2W00A 3A1SA 2ZI4A 2OFWA 5JWRA 2AN9A 3UMRA 1IAQA 4QJ4A 3PR1A 1XD9A 2FEOA 2J1LA 1AKYA 1A82A 3WY9A 2W2XA 3B13B 4CEJB 4URYR 5JFGA 2C95A 3SFVA 4PC7A 2V1XA 2YVUA 1S96A 4QHSA 3HJNA 1MH1A 2GESA 2JLWA 1KKLA 1FP6A 1LNZA 2JLVA 4XTCS 2QU8A 3MRSA 4KITB 2G3YA 2REOA 4BE7B 2GEDA 3KTAA 1TF7A 4HB4A 3R8CA 4EKDA 1F2TB 4JKYA 1G6HA 2GETA 1QHIA 2YOHA 4M9QA 3KQLA 1HE1C 1KSJA 2OG2A 2NO9A 3TRFA 4DSUA 5J4VA 1N5JA 2Q3MA 2G6BA 2C9CA 1WE2A 3W90A 1W4CA 1FP7A 2XOKA 4YDHB 3QENA 3QI2A 3WRYC 1PLLA 4C0QC 4MUBA 2IUUA 3LD9A 2ZRNA 1P2UA 1XF9A 4K8OA 1S1CA 2F1RA 3K53A 3M4YA 1XPUA 2O0KA 2ZRPA 4XH9B 4QOSA 4TLEA 2WJIA 1OFTA 2BWJA 2VP9A 4P31A 1DBSA 5KDDA 3ECCA 2HT6A 4DLYA 2ERXA 1D2NA 2OBLA 3VR1A 1SKYB 2XNDA 1KYIA 3CRVA 2QP4A 1DVRA 4OI0A 1JAHA 3MJHA 1CKEA 3NBXX 1XJ0A 2ODNA 5HZKA 1G4AE 3Q9LA 3BAFA 1NKTA 4G5GA 1U8YA 3ADKA 4LC0A 1MOZA 4JLAA 3VU9B 2CJWA 3K0FA 4MH0R 3REFA 3VR5A 4UNPA 4DLSA 2QN6A 2D62A 1Z08A 5FOXA 2V1UA 5JCPA 2NQ2C 1ZNWA 2XJ9A 4GFDA 4RVCA 4C9BA 3B85A 3ZDQA 2ZUBA 4A1FA 5JI2E 3QXXA 3BRWD 3H84A 2XZOA 2IS4A 1NVVR 4IDHA 1EFHA 2FWRA 1OFIA 3V4RA 4IHQA 1S1MA 1WF3A 2O52A 1KAOA 2D7CA 4K46A 2ZI7A 3P4YA 4MITA 2XZLA 5JSZB 5IRCD 5LD2C 1NIJA 5AUQA 1N25A 1W2GA 3SHFA 1P61B 1YE8A 5SZJA 4AK9A 4URUR 4DCVA 4TTRA 2J0VA 1YR8A 3IPYA 5FOWA 1RVDA 2P0EA 1E96A 4OL0A 3L0IB 4LCBA 2C9YA 1DAGA 1TUEA 2H17A 4OJQA 1UBEA 4IKEA 1EWQA 2JASA 2WWWA 1JXOA 2PJRA 3V9PA 1SHKA 2ZRKA 1KAGA 1IJEA 5EXXA 4RKFA 4MYUA 5FL7A 1COWD 5LBIA 2O8CA 3GMTA 3ZS8A 1KJWA 2YC2C 4LPKA 3TBKA 2DBYA 2QRZA 4LI0A 1S8FA 3AP1A 2GBLA 4FN5A 4CDGA 1Z3IX 3CR7A 3OE7D 4AG6A 2BEKA 2D2FA 3LX8A 4D4KA 2FH5B 2OCYC 2FSIA 2JLXA 3DM9B 3HPRA 5EXSA 3ZZTA 3TQFA 1ZRHA 2WV9A 4DCNA 1W2HA 1TAGA 3B9QA 5ELXA 4QM7A 2RH5A 2Z43A 4Q5IA 3RS0A 1TTTA 5K8IA 4XSGA 1G18A 2G88A 5EXTA 2ZJ8A 2IT1A 2DFKB 5TARA 5C4MA 4TZ6A 2IYTA 1T0JB 2EYQA 3RLFA 4M9ZA 4M1TA 3G0HA 1E4VA 3ASYA 2BMDA 3LW8A 2NG1A 3O47A 2WVJA 4LJ4A 1E9SA 4O2LA 1O87A 1JEDA 1UDXA 3QNUA 4Q4LA 1XB2A 1KI3A 2H8KA 2OBNA 3GLHA 5HR5A 1F6BA 4JLKA 1W36C 1M7GA 1WCV1 2ORVA 1E99A 4PC3A 1H8HA 3NTUA 4AKIA 2V7QD 4RFSB 3AVXA 3U7FB 1LB1B 1OIXA 1WA5A 2KWIA 4N0EA 2WTUA 1Z2AA 4LYJA 4B35A 3CPHA 1BYIA 4ITRC 5C2JB 2C78A 2HJGA 1SQ5A 3BWDD 5E95A 3EA5A 1ZINA 3GEIA 1DAIA 3NKVA 5AUPB 3T06B 2X2FA 4FWTA 4HZIA 2CNWA 4L16A 4DUGD 2V6JA 3MAAC 4HAVA 2KE5A 4FWIB 5J47A 4IFEA 5J4HA 1T3LA 4ZKEA 1G7SA 1Z6XA 1DG3A 821PA 1T4GA 4PAMA 1GNRA 1YKSA 3I92A 4PX9A 5DNYB 2ZI6A 1SXJD 4M53A 3U44B 4YXWA 5JJKA 1YZTA 4BEJA 4Z8XA 2ZU0C 1GNQA 2H7VA 1G5RA 2JLSA 4QBFA 5CB6A 1GDDA 121PA 1JJVA 2Q9AA 4TTPA 3VMFA 4WZBE 4JLJA 1D8TA 4TSFD 4R2HA 2FPKA 4HLUC 2DCUA 4GMDA 3BB4A 4A6PA 4C7OB 5B58C 3MD0A 2B8WA 3WNDA 2QY9A 1NVWQ 4I81A 3OIVA 1OXTA 1UKZA 2FU5C 3C8UA 3QPWA 4MA4A 1XBTA 5CK5A 4A6XA 1G17A 2OO7A 5C18A 1RJ9A 2ORIA 2IHYA 3OAAA 3EZ7A 4ZDWA 3T1QA 1U99A 2QUZA 4NCHA 2CHQA 4IEEA 4ZI3A 4PZZA 5FBWB 1IOZA 5FBRB 1YHNA 2PJZA 2WAXA 3BXZA 2YINC 4QGAA 5KYKA 1G3IA 1GKIA 4RZ3A 5JEDA 2R65A 3W8NA 1TADA 4CEIB 2ATXA 2CCKA 2Q3FA 3P26A 4HB3A 1QG4A 1IHUA 3P1JA 4QBIA 3NH6A 4U5XA 1OHHA 1M1YE 5EZ5A 1GRRA 3I1FA 5C1BA 5G53C 5FPSA 2XX3A 3I61A 1PUJA 5P21A 3EPHA 2ZRFA 2G77B 2ZETA 4A9AA 4KLZA 3W5IA 2X8AA 1KK3A 3W6NA 3CW2A 3QPVA 1Q1ZA 3I72A 1U98A 5DHFA 4DSOA 5DYIA 4IXMA 2I4IA 4NCJA 1MKYA 5GVSA 3O8BA 3H0KA 2RGDA 3WNCA 3CRRA 3NBYC 4P0TA 3ZH9B 1ZU4A 3QKSA 2FMXA 1KI1A 4N1AA 3WHKA 3AM1A 1HQYE 4D0LB 1KI6B 3THXA 4DLWA 3QXCA 3EWAA 5H70A 2H57A 2NMVA 1ZM4A 2WIAA 3QVUA 4X8MA 4P4SA 3GPLA 4LJ5A 1VG0B 1IY0A 1GP2A 4G01B 3TW8B 5L3SA 1XU4A 2V55B 2PZGA 2XEXA 2ZAMA 3IEVA 1CULC 4UNNA 5CK4A 1JECA 2V3CC 1PZNA 1VHLA 2WJGA 1MO5A 3U60B 4V0ME 2GWHA 1G5TA 1AA9A 1G9XA 1HV8A 3QKRB 3THOA 2WSSA 5KHOC 4WIAA 3EZFA 5H68A 1KOFA 5J40A 4IOKA 1N6IA 1HY3A 4BQSA 2V6IA 2XAUA 1TL7C 4EFLA 2CLDX 2AD5A 2JAQA 1YR7A 2F3RA 1YZQA 1XMVA 3C7KA 3EWSA 4BLRA 3KQHA 3IDQA 621PA 2OCBA 2HCBA 1G19A 1OIWA 2EVWX 4W7SA 5HKKD 1XPOA 3IGFA 5TDHA 2N42A 1X8JA 2FV8A 2FNAA 3IQXA 3TW4A 4QFMA 3SBEA 3HDTA 1E0SA 3DDCA 1T8TA 2IC5A 5FTMA 4TYNA 4G0NA 2J0SA 2V54A 1LFDB 5TB5A 1UDWA 1AM4D 3IILA 5F3WB 1SULA 4C0SA 1RRFA 4M9XA 3K0AB 4Q7MB 1E79D 1WQ1R 2A9KA 5DHAA 4EFMA 4OHYA 2QSZA 5HZHA 1N5IA 1TNDA 1QHYA 1RYHA 1VYTA 1Z07A 2B92A 3AGPA 3HYTA 3K9NA 3L43A 3TNFA 4IW3B 3DVLA 4URXR 3X1XA 4KFSA 3T35A 2LWIA 3RSLA 1E0AA 4BZXA 2ANBA 3ZZ0A 3SFZA 4FXPA 2AKYA 2NIPA 3KX2A 4Z51A 4F4CA 2O8EB 4F38A 4AI6A 2VSOA 4NCIA 4YMUA 4DEXA 1OF1A 5F9HA 4PXAA 4YLGA 3DM5A 2GCOA 1W0KD 1KSGA 2ZSAA 1BH2A 4G5RA 4M1MA 5GJBA 1CR0A 4A4DA 4PPNA 4V02A 4OQFA 3B60A 1KMQA 1DS6A 3K9HA 5C4GB 1DADA 2QEQA 4Q66C 4N0DA 4C0LA 2X2EA 5KSYA 3G5UA 4CZ2A 4DVGA 2VHUA 3FOZA 1TQ4A 2WJYA 4M22A 1OSNA 1ANKA 3DHWC 4AKEA 1GL9B 2OLKA 2A7QA 2DHRA 2OSBA 4DLTA 3AP3A 3MFYA 1FNMA 2Q0HA 2IS2A 3PVSA 4Q9JA 5FPTA 1M8PA 2WPDD 4DIDA 2QA5A 4DIEA 4JLDA 1WRBA 2QI9C 3C41J 3QG1A 1E3MA 1GOTA 1T3HA 4XSHA 2VHTA 5AUNB 1P5ZB 2J0UA 3ICEA 3PUXA 4GDFA 1NVVQ 2NPFA 2QT0A 2VP0A 4CYMA 3RRMA 4IVPA 3ND8A 2VF7A 3ND9A 5JMTA 1JR6A 1I4TD 3PG5A 1G3UA 2YOGA 4MRPA 1CEEA 1IXRC 1R8SA 3V4FA 5CYOA 1E2KA 2AFHE 3T5DA 4C0BA 3NDPA 3Q85A 4IXNA 4EAQA 3T34A 1IN7A 2RHDA 2HF8A 1W4AA 2W6JD 1Q20A 2KI5A 5E4FA 1KSFX 3EIEA 2BBWA 1ZAKA 2GCPA 4TT3A 2MMGA 1BIFA 421PA 1QRAA 3CR8A 4TQUS 4KFRA 4ASUD 4GRAA 5SZHB 2ZVQX 4MGKR 1U0JA 3SDZA 3LLMA 3CWZA 1VKJA 1S0UA 3OEHA 1R5BA 3C4JA 2PZEA 4BLPA 1RKBA 2RAPA 1GNPA 1F2UA 1S3GA 1YVDA 4U00A 5EXPA 2VSFA 4IEIA 5JS7A 5KSZA 4ZCLA 5FR1A 3Q7PA 1ZUNB 2K5UA 1OYYA 1GRNA 4A92A 3PUVA 1YR9A 2BMFA 3LBIA 4JLNA 3KZ1E 1ZNXA 5CM8B 3KUDA 5LD2B 2F43A 3BB1A 2F9MA 4V0LA 4JT2A 1JB1A 1UBGA 3LQRA 4HDCA 4DDTA 4MGYR 2EFHB 1Q21A 4HAUA 5H1YA 1MV5A 1K8RA 3BD9A 4NYJR 2Q3HA 3AKYA 2IK8A 3FYHA 2F55A 3I62A 3RC8A 3ZIAA 1MO6A 1SKQA 5EE3A 4RZXA 3B6EA 3B1ZA 4LDJA 2ZR7A 4QGGA 1EXMA 2FZ4A 3E70C 3K09A 3UATA 2QZ4A 3QE0A 1UF9A 1NN5A 1W46A 1NSFA 1Q12A 1W48A 1Z47A 4HZUB 3GP8A 1P3JA 1D6JA 2A5JA 3B5JA 1N5KA 1KI9A 1JALA 1J7KA 1X8LA 1P6XA 3C16C 3KFXA 4JSYA 1JR3E 5DH9A 1LV7A 5FTNA 1WXQA 1N0WA 2OESA 4AC9A 3D6TB 2YYZA 5FOTA 1CU1A 1FZQA 1X86B 5DO9A 1P62B 1SXJC 1Z2CA 4Q1FA 4XWOA 2GJAA 4HLCA 1KSHA 3U3MA 2YHSA 3HR8A 3OFNA 3FMFA 3W9YA 1KMHB 1XMSA 4K81B 2HJVA 1VCOA 4QL3A 1KI8A 4BRUA 4ON9A 4CGZA 2XOKD 1Q22A 4JBYA 2QG6A 1XXHB 4MRVA 1OXVA 4PO8A 4CF7A 3IKJA 2P6RA 1AS3A 1VMAA 4KI0A 5L3RA 4TQAA 1EESA 4RD1A 3U5ZB 2IW3A 1MABA 4JMPA 4Y0AA 4IOMA 4QM6A 1W36B 4NL4H 2N1BA 1D9XA 2P5TB 2OBMA 3QEJA 3SOPA 5D3QA 3TGPA 3U3JA 1VG1A 3RS4A 1TQDA 2GCNA 1E9RA 1E2IA 1OT3A 1KK0A 2AK2A 3JVUA 2P6UA 4P32A 1OH6A 2IUSA 1D5CA 4EJSC 4HLQB 4MKIA 3OZXA 3Q7QA 2JJ2A 4WXRA 1IONA 4C0AC 3LA6A 2ZRJA 2GJKA 2G83A 721PA 4Q02A 1E1QA 4NPHA 3VKGA 1Z0FA 1XEXA 4QRHA 3A6PC 2WMNB 1MR3F 4I1SA 1NIPA 2PLRA 1TF5A 2BBSA 1S2MA 5DI3A 3GCGA 3TE6A 3FB4A 3GJ6A 4Q00A 2ODWA 4LYFA 1IM2A 2H5EA 3BE4A 2FPLA 1UFQA 1E0KA 3AGQA 3AVVA 2UZIR 1IQPA 1DPFA 5JRJA 1IXSB 1W0JA 1R0WA 2XXAB 2WSMA 3TSOA 2ZS8A 3O8RA 1ZD1A 3JZAA 2PH1A 2GXSA 2FX3A 2ZSFA 1MRSA 3DZDA 1XTSA 4TLDA 5CYPA 1CR1A 5JRZA 2O8DA 3B9PA 5JJIA 4HI0E 2IYLD 4PSVA 4DDUA 1T9HA 2C8VA 5CB8A 4IDPA 2GTPA 1KY3A 3GFTA 1YJ5A 3N2IA 3P4XA 2GJ9A 2JLZA 2ZYUX 4A2QA 3K9GA 4Q48A 4Z1MA 4WA7A 4PQFA 5LDDC 2E1RA 2CDNA 1A2BA 4LV8B 4HUQB 2DWOA 3DOFA 1D9ZA 2IYZA 1VCIA 2C96A 1CXZA 1TF2A 2ZSEA 4L4UA 4EPWA 3QJYA 3B8HA 1G4UR 5CDFE 3Q5DA 3LBNA 2VF8A 3K70D 4D4JA 2NPIA 1YRAA 1CR4A 4FMDB 2AK3A 4C3ZA 4IJMA 3BFXA 1N6LA 4ZDIA 5KNCA 4TQ9A 3GFOA 3WMGA 4A8JC 2WM9B 3OEED 2ZI5A 2JJ1A 2XTZA 4LHWA 3P27A 1TMKA 1YZNA 4LX0A 3OIWA 1KY2A 1NY6A 4Q21A 1G3QA 5J4YA 4BPBA 2R6FA 4JYCA 3R8FA 2QBYA 3UMFA 3SYKA 4NH0A 2R9VA 5KNDA 3TVDA 5TXGA 2GZHA 2OAP1 4LGMA 5E7IA 5J4LA 3BB3A 1R10A 1ZC4A 2I3BA 1QVRA 2OEPA 1LF0A 5KSOA 1E2NA 3KJEA 2MSEB 3SZRA 4TYQA 3EZ2A 2RB4A 4QHYA 1TQ2A 5EE1A 4HAZA 1E4YA 1NNEA 4JL8A 2WWGA 4MYTA 3NDBB 4JYBA 1KO1A 1R0ZA 1AGRA 2R8RA 2CK3A 4B44A 1UBFA 3DOEA 3FFBA 5JHGB 4WXPA 1NMYA 3AVOA 4BLOA 5G40A 2PEZA 2X19A 4NMMA 4CEHB 2CCJA 3WMEA 1N6OA 1S3SA 4EQ6A 2UZ3A 3E2IA 4MYCA 3U2QA 5FL3A 3O8CA 1H8HD 3U7HB 5D3MA 5FBLB 2O8BA 3QEOA 5FPHA 2VEDA 4D4MA 1J99A 4URVR 2C9OA 2QAGA 4HDOB 4XJXA 3PFIA 2ZANA 3U3KA 4C0JA 3IHWA 2CNWD 3RNLA 1E2QA 1YZKA 2ZI9A 4PPFA 4F91B 2IYXA 1GTVA 1OE0A 3CM0A 2WKRA 3C5CA 4C2UA 3KUCA 2ZE8A 2ZRGA 2VTKA 4RZ2A 2CXXA 3BBPA 5J4KA 3NHBA 4B33A 3VNVA 3VKHA 2FGJA 2GZAA 3AVUA 2BVNA 1DOAA 1A1VA 4DZZA 3K0EA 4YXWD 4KJZA 1XJCA 3ADCA 4BZPA 5CIQA 2BJWA 1ZYUA 4YONB 4G1UC 1P72A 2AX4A 1N5LA 1V43A 2R2AA 3EZ6A 3HR7A 3K0CC 5CLLA 4B32A 2P67A 1HA3A 4KBFA 4YMSA 4Q4HA 2OXRA 1N3BA 1Z83A 3I32A 4EPTA 2P65A 3VKWA 2GZDA 1FX0A 4TYPA 1CP2A 5C46F 3OIYA 3CX7A 1QHXA 3FKSA 4V0MA 1KK2A 1W4BA 3UMSA 4YMVA 1TEVA 3OAAD 3B7GA 1U0HC 2WWHA 1OFUX 1VYVA 3CF2A 1E2FA 1KK1A 5LB2A 4L8GA 1KO4A 3THYB 3I3SR 2NZJA 2QNRA 8OHMA 2GVDC 5JJLA 2F3TA 4CIDA 1JBKA 5GJCA 1E2DA 2ZJAA 1BS1A 3UKDA 4B3FX 4DT1B 3AH8A 5FPYA 3VX4A 1K5GA 1G16A 4NP6A 4TL9A 1KDOA 1OHHD 2W2VA 3B1WA 4UXIA 3TJZA 3ZYCA 4E03A 5KOYA 5JS8A 4ZIRB 1A2KC 3IPXA 1QZXA 4MRRA 3BS4A 5DI9A 1WMSA 2EU8A 5BW8A 1KO5A 3AVTA 3W34A 1VG8A 1YRBA 4TMXA 4OK3A 3S1AA 1RYFA 2IYRA 3OEEA 1QHHA 4MYHA 2IWHA 2Q6TA 3THWA 1Z0IA 3W3AA 3WYGA 1IN5A 3J81k 2D4HA 1GWNA 1F3OA 4BFSA 3PV0A 3REGA 3R9IA 2J0QA 2YC4C 3W5JA 3VNUA 3PQCA 2ZJBA 4FINA 5IK2A 3QIAA 5DIFA 2ZROA 1BO6A 1P73A 1PLJA 2DFTA 1F60A 3LRPA 2EW1A 1G8FA 2VQSA 1G291 3G82C 1GRQA 4NYJQ 4W9MC 2WSSD 4M1SA 1DO2A 1NKSA 2OT3B 4LJ9A 3QKSB 1NBME 1OKKA 1KZ7B 3AUYA 4RCZA 2AXNA 4E5UA 3THXB 1U90A 2YWFA 4L5BA
chains in the Genus database with same CATH superfamily
1HQCA 3G9XA 4NOKA 2EDCA 1ADGA 4FE7A 1GPYA 2NZ8A 5BWCA 5LCXA 1L4GA 1GZVA 2ZBVA 2P9HA 2P3LA 2IUYA 5ALFA 3ZLBA 4CM4A 2H2DA 1NLYA 3GNSA 3MCVA 1JL3A 1UOQA 2WUEA 3GG2A 1G5HA 3PA8A 5HKLA 1YQUA 2CDAA 4DV1B 4QXMA 1A3CA 3VPDA 4BBPA 4JLMA 2QRNA 3I53A 3VI3B 1A4IA 5KMGB 5DK6A 3O9VA 1EEXB 2J4DA 1QZTA 5A02A 4JUBA 4L75A 4JR1A 4JY7A 1SC6A 1GSIA 1H2EA 2A5FA 3EQ7A 1DDGA 1Z8DA 4QQFA 5E9AA 4HYYA 5A0FA 3WKCA 7AT1A 1VCNA 1E7YA 4KIUA 4O63O 1ZRSA 3KEFA 4HD8A 2WP8J 3P71T 2H1HA 1DAKA 2QTNA 3WZLA 4COKA 1YTUA 1KO7A 2LCIA 1J1ZA 1UJ2A 4MUAA 3SLRA 1UEJA 3IBFA 2NO0A 1ZUIA 2HYDA 1QVAA 3WGGA 3JQ8B 2MT9A 4EA6A 3OPYB 4Q82A 5AVUA 1LPPA 2CFIA 1MB4A 3ZDDA 4LRXA 2TYSB 2Y4OA 3OZDA 2CFOA 4R4JA 3U6KA 1DKQA 2IHTA 2A9OA 4G0PA 4BMDA 3N58A 3G2NA 1DO8A 4IIHA 3FHTA 2AEJA 4LKRA 4FEYA 2VZ9A 1S2NA 5IM5A 3I8XA 3PEUA 4AZWA 3DSRA 4E13A 3P96A 5JNRA 3EW9A 3FMVA 3AR5A 1BEZA 5SY9A 5BRJA 4WLOA 4V0KA 2BOVA 2B8TA 3RARA 5EQTA 2Z6UA 4L9WA 3IEKA 2EC5A 4BRWA 4ND5A 5DLPA 3MJFA 5HF9A 3RDPA 2GS9A 4TKVA 3GLGB 1EWKA 3DTVB 3IQWA 1IBMB 1SUSA 4C89A 5ALGA 4YRFA 3GBSA 2HRDA 5IC5A 1SG9A 2Q21A 1XGKA 4PQGA 1I1HA 1TZMA 3VPBA 2D2VA 2TRSB 2BGUA 4UVHA 3V7WA 1VL6A 2HJWA 1UR5A 2QZJA 1J0XO 3GAFA 4MZXA 3WWEA 5IHXA 4YJHA 3NVDA 3IULA 4AROA 3ICQB 3KR1A 4KX5A 1T3ZA 5IVIA 5CEJA 1QYXA 4B81A 4E51A 2H92A 4K9LA 1XXHE 3KWJA 3K5IA 1LU9A 3TLGB 5AYVA 5GV7A 4S1WA 2AUTA 3RYFA 2XNKA 2CKMA 3A06A 1B2RA 1UK6A 3GRRA 1WX1A 4D3DA 1W2WB 2J8ZA 4M6WB 3OHMA 4MW2A 3EQ2A 1CDOA 1EAMA 2B61A 4H1UA 4ZICA 1A8QA 1RXCA 3M9WA 4UUOA 2FSHA 1UQUA 2X58A 3EJWA 5ALMA 4B87A 1HSOA 2JFQA 2XUAA 3NXSA 3QE9Y 2ZSKA 5EMKA 2DEUA 3KHUA 3OY7A 2O2JA 3P9CA 5DM0A 1Z0ZA 2H9YA 3ZQ6A 4DNQA 3U6BA 1OWNA 1SUCA 1QRRA 3GA0A 3LO8A 3VUFA 4YBZA 1RHRA 2WU8A 1Y8RB 4ETWA 4RD4A 2GZRA 5BNFA 2ZUEA 5LZ2A 1Z68A 2WIBA 1N2CE 5F7JA 2Y27A 1KR2A 1UKAA 1V8ZA 3TIXB 4TWAA 3RTBA 4Q47A 4X3OA 2CNOA 2CL0X 4U63A 2YMQA 1GR0A 2R7NA 2GBLC 3MCZA 4RTMA 2H48A 4J0GA 4MR8A 1Z6PA 5CP8A 1OC2A 2APJA 3AMVA 4D8XA 4CPDA 3KSBC 4EKYA 1IHDA 4XGNA 3SBOA 3ZX5A 1NULA 4EPXA 5M2QA 4NBSA 1JEQB 5JW6A 1HQDA 2J7PA 5BN4B 1E1RA 2Q2QA 2X6QA 2KS6A 4DG9A 2P75A 2ZIEA 1EE9A 3CVJA 5IDVA 3RSFA 1GFIA 2OVBA 2QMYA 4MS1B 2ZUUA 3ORQA 3OCVA 4K0KB 3PD1A 4KSCA 4AMUA 4CKYA 1PT5A 1ST2A 2C2XA 1PT8A 4P0QB 3D6VA 1GRCA 2NAFA 5CLQA 3SSNA 1L3CA 2ZITA 1XKTA 3DMYA 4PQYA 2RHLA 2ZYDA 5AK0A 5E7MA 3GRYA 5BRNA 3SHVA 1UQTA 4HC4A 2O2XA 1NJ5A 3AUKA 3GPIA 3I42A 2LIPA 3QK7A 3WWOA 1OROA 1ICEA 3NWPA 2NVWA 1MTOA 1J2YA 3GH1A 4PNEA 1Z6GA 4P4NA 5I8WA 4FFLA 3LLCA 2BLLA 3G0CA 3L7LA 2DQKA 1QQTA 3WQRA 3WWPA 4YAGA 4TMKA 1F2UB 4DXDA 4M8LA 2E4VA 3P2OA 4Q15A 5CVJA 4UFPA 1SURA 1RW4A 1T9CA 2M6LA 2P9JA 3GHYA 1LXCA 1E32A 1J39A 5JO0A 3F97A 1CJSA 4DCOA 3PHGA 2XT9A 4OXXA 4RD3A 2Q1SA 4GP7A 4YROA 2HBZA 3B53X 3CZCA 5K0GA 1Y6FA 4K6FA 1FNNA 3W5UA 2ZR9A 4GGPA 1P7PA 3GI1A 3LOPA 3P2JA 1H8EA 1RXYA 2VCHA 3HTXA 2HY7A 2OSVA 3GUVA 3LWNA 4MKGA 1CT9A 4X6LA 5D6NA 1VCHA 2OHVA 4B74A 2IUFA 1ZNYA 3D7SA 3FXAA 3ESCA 4RHFA 2QLTA 4CN9A 5B36A 3GA5A 1PV1A 3RS8A 3D31A 4GXTA 4LVCA 4W1PA 4BNLA 5JISA 4PNZA 1N2EA 3TR6A 4GR9A 2Q3CA 3OFND 3WL5A 4HB2A 2BHRA 4V0OA 4DQKA 4QSHA 2ZBQA 1CUVA 4PSKA 3VH2A 1F8UA 2R11A 1N5MA 5KI6A 2H63A 2W37A 4K87A 4QGFA 4DDVA 4NOJA 3EX7C 1IXYA 5EXEA 3U3OA 4WWHA 3WWZA 1JG7A 2ZCUA 2JLYA 2CL7X 3W4IA 4PLHA 2R751 4LFAB 1I80A 2COEA 4C4RA 1GQQA 5JTTA 3H16A 3HE3A 4CKCB 5I48A 2X6TA 4HAOA 3TL3A 3PP8A 1HKUA 3RFFA 2GLXA 3GLTA 1M0WA 2NADA 4R98A 2ZIAA 3BCRA 3HB4X 2Z9DA 5HEKA 1NUQA 3RUCA 2X5JO 4M88A 3EISA 1HXHA 4IVRA 5DJ5A 4CT5A 3T12A 3AKEA 2HU2A 3HKDB 2C4MA 2Q8QA 2QTGA 4CEIA 2YCBA 3S28A 1BDBA 1LY1A 2JFFA 4L9RA 3BFJA 1V5IA 1OWMA 3GOHA 4HGRA 4KVAA 4I1UA 1Y3AA 2W2NA 3H2ZA 4OPMA 5EE5B 4ZZ1A 3G8AA 4BO5A 3FDIA 4YV7A 1OFHA 1SCUB 2Y99A 1PNTA 1PV2A 2WJJA 1C7ZA 1G0OA 1UT5A 3WLKX 4YCLA 4LOKA 3F0TA 1P75A 2Y1GA 2V4ZA 2IYYA 2B7BA 2HL6A 1N32B 4Y6SA 1SEVA 3PR3A 3IO3A 3EYWA 4ND6A 4MB0A 3WWYA 3TK1A 4A91A 4D8VA 1KIAA 2D2EA 4PZLA 3ZV3A 2BBOA 2C7VA 4Z4IA 1IEQA 3IAXA 1V3VA 5JH7B 4Q4JB 5HF8A 2XB4A 5KEIA 2P6NA 3BK2A 5BYJA 5KTKA 2OCXA 4PRKA 2VRBA 1FVXA 4EW1A 2JHAA 3EFEA 4MVJA 1AQYA 3UH1A 3UKOA 1ESEA 1U7TA 2G5TA 2OAQ1 2VIIA 1PI3A 1YI0A 2XOEA 4WK0B 1C30A 1PYGA 2DWQA 4JLWA 1BD4A 4RJ2A 4LJ6A 2CLMB 3B9RA 3IEUA 2G28A 4IY1A 1N92A 3DKIA 1XRMA 4KIJA 2OHJA 2UKDA 3F47A 4PO1A 2DSTA 1R9MA 1JPUA 3LCUA 2IUEA 3KKPA 1DV1A 4RA9B 2PQ2A 4FC6A 4OHVA 4FR2A 5JQWA 5DULA 1ZW1A 4UKDA 1P19A 4XD7A 4Y0VA 2OGWA 3I1YA 3RQSA 1C7JA 4PHTA 3GB9A 3LUFA 4XWYA 4YV2A 3CLTD 1M2WA 2CDCA 4LS3A 5GY7A 1IEWA 4HDNB 3LC2O 3OHSX 1J2RA 1Z6AA 3EARA 2QXTA 4RFVA 4XWTA 3ZH2A 3Q6MA 1ZESA 1LPSA 4FT4A 4DQDA 5AW6A 3FAZA 2E4ZA 2Q9UA 2MYNA 3B1YA 5LKAA 4F4DA 4IXTA 2QLMA 4AVYA 3DFFA 1N7HA 4B3CA 1US8B 3QWAA 5GADl 2TMKA 2YTZA 1FLNA 4TWZA 4ZZ2A 4IZIA 1C9DB 5CVUA 5G41A 3HSSA 4KHZA 2NYRA 1SUWA 3FCCA 3MSCA 3PRKE 1Y5MA 4L02A 2VP4A 3UK0A 2EBUA 3EUEA 2V5VA 3Q3HA 1QE3A 2YWJA 2HQ1A 2V8OA 4FS8A 4F3CA 1KHHA 1IZ8A 3LUGA 5LC1A 2XQGA 4QLOA 5FBQB 4DA0A 3MILA 2NU8B 1FCJA 1RCUA 4TSKA 1K8YB 2I4TA 5I7EA 2FWNA 5ILQA 1JILA 1I2DA 1O1YA 4LOJA 3J7AC 3DPUA 1PFVA 3RHZA 4OH7A 3RLIA 4EH1A 1AD2A 1NAIA 2AI2A 2G5CA 2QROA 3CUYA 3FCXA 2G6TA 1M6NA 3LBAA 3G9TA 5JMWA 3OQNA 1EKXA 3A4MA 4HDMB 2EX0A 1E4EB 2ZBUA 1M74A 1P4HA 3I52A 4WESA 3SF8B 3UWOA 5LOVB 4BO8A 1Q7EA 1Y1QA 2REBA 1A5ZA 3CXUA 4RHYA 1YMQA 5DGCA 3SF0A 5ICSA 2EGHA 1MB9A 1GT6A 2QYTA 3C5VA 4I0WB 1A4UA 1CJMA 2ZJFA 4V03A 3M4JA 3UQZA 2E87A 1FW6A 1ZEMA 3UA3A 4XJVA 4PGGA 4QG7A 3T54A 3EDCA 4TTVA 2UYQA 1NMSA 2BF4A 2Q2VA 3RRYA 2Q07A 1K0UA 3HB1A 3EQZA 3RYIB 4EYOA 2FDRA 2ZIWB 3OJCA 4IF6A 2PH5A 5HBGA 3HV0A 3UWPA 5HCNA 3VYVA 4AG3A 3RG8A 1PR3A 2FPPB 1EXVA 1RYBA 4Z4QA 2LGJA 2AWOA 1CVIA 1Q2UA 1WSAA 3L4BC 4EL0A 4YR9A 3QPDA 1JT2A 3R0VA 3KTAB 1UMBA 1G9TA 1EUDB 3BJRA 3E48A 2OXIA 1ZM3A 1BD3A 4CLOB 4F1WA 1JQEA 3HCAA 5HCUA 2FCRA 2PAFA 1JLRA 4MGZR 4RM3A 4EGCB 1FZTA 3I64A 1THTA 4XYMA 5AVOA 2Z4TA 2I2WA 2XMPA 5FUYA 4DA6A 1CQJB 3NIGB 5IXSA 4YI3A 3SK0A 1NBIA 2WFMA 2GEKA 4FCVA 5E8RA 1OWPA 3HY4A 3S27A 1QV7A 5CW1A 5LU9A 2QMUA 4YJ2A 4MKFA 4EYQA 1QQAA 2WUWE 2IGBA 3C3WA 4BP3A 2BFBA 1E1DA 2PUBA 2FPIB 1L4UA 1V95A 5SZKB 3VR3A 1XDZA 2R1TB 3LXRA 1U0LA 4D97A 2F4VB 4RJLA 3Q8MA 1LKZA 3DDOA 2R4QA 4O1MA 1UC4B 2VLBA 2DGDA 2GXQA 1WZCA 1JFSA 3ZJYA 2GHRA 1DLJA 4ZO4A 5DZSA 1TX4B 2GF9A 2ACWA 5DV9A 5MF6A 4EB0A 1V4VA 1OH5A 2XT0A 3KETA 5ADWA 3FX2A 5BVHB 3BGSA 2GYYA 5JIBA 1OD6A 1VPTA 3VPGA 3R9WA 1N6NA 3N39C 2CLCX 2QL7A 5TS3A 5ESWA 1SZPA 5CRIA 1S9HA 4YDRA 4CCAA 3PJFA 5LDHA 1F6DA 3L3BA 4KQGA 1OXMA 2GRJA 4FW9A 1IZZA 1FDOA 4GX2A 4KQFA 4DQUA 2I54A 3V9AA 1VSBA 1JG2A 5IDYA 3ZHVA 4NULA 1X14A 2XDYA 1PEDA 4JVMA 2IYQA 2VO1A 3K6SA 4QGSA 4JI4B 4UUNA 3OP1A 2G1UA 3P97A 3R9XA 3PBKA 2GK7A 4JLVA 3E9QA 2OZPA 1AN0A 1XJQA 4FNOA 4QUAA 1G8YA 5DRYA 5ALUA 5F1KA 1DTWB 5KX5A 2QTVB 4ALKA 1ZUNA 1IK6A 1MJHA 2BAGA 2NUTB 3A6GA 4Q1VA 4UDYX 3ZI7A 1A72A 2I1VB 5L6MB 4AP5A 2EWWA 2VNAA 3K20A 3GLQA 4B76A 5DW0A 5EFZA 1B0AA 3UFXB 3WSWA 2BI8A 2D0DA 4TMFA 4RKQA 1EP3B 2Y93A 2QTAA 4DDWA 4QQRA 1TQ6A 4JL5A 4KV7A 4GOMD 5ADUS 3QSYA 1OBOA 1TT7A 1SVSA 4ZCQA 3BMOA 2ZPUA 3THRA 1Q1EA 4KQJA 3QNMA 3EA4A 4AG5A 3EIWA 3GMDA 4GMXA 1W35A 3NHKA 3QE3A 4N40A 1BC5A 5CM9C 3PXDA 3W3AD 4EK9A 3W4KA 4FQ5A 1AHHA 4R40A 4X8LA 1VBFA 1WW3A 4XJSA 2QTHA 2Z1DA 3A6FA 4BMYA 5HJ7A 1P3Y1 2VTEA 2QTZA 2FFJA 5IKEA 5IK2D 1L7DA 2PR7A 2JDIA 4XIIA 3K72B 1ILEA 3AI2A 2HBRA 2PS9A 2Q1YA 2F48A 4UHJA 4Q05A 3T7DA 3V97A 3GBVA 1JFLA 3KM0A 1JKJB 3MWYW 1UPCA 4AUKA 4PU0A 5K51A 1I2AA 5THXA 3EXEA 3RUAA 3SBDA 1BU5A 1NLFA 3WC4A 1XA0A 3NPAA 1YKFA 3N2YA 3OQBA 1OXUA 4MAAA 5JLJA 2YQ5A 2A5DA 3GH3A 4P1ZA 3T4UA 2PGIA 3F7OA 4HYQA 1NXOA 1PR2A 1OKKD 1VLHA 1JMYA 4WCVA 5JJBA 1CRQA 4G5XA 2OBBA 3V42A 3SI7A 2R00C 1EMDA 2AG8A 4JX8A 2H18A 1VKNA 2I6UA 1E5DA 4J7XA 3ANYB 4N8EA 4OM7A 1NLUA 1KMHA 1XDDA 3M83A 1PV4A 2FVXA 2CE7A 1G20B 1E1YA 5C8XA 1UM9A 1G8MA 4E3WA 4O4LF 4H7EA 1ZM7A 3VZPA 1NVEA 1WO8A 1AQIA 2CHUA 1RTTA 1N0HA 3UPUA 1MF7A 3WTCA 1AUXA 1BOFA 3OO1A 2VTVA 3OOYA 2P5SA 3VVMA 4LF9B 4Q3AA 1J49A 1V5GA 2BDTA 4C0KA 4DARA 2CV0A 3EEYA 3DLIA 5KNCH 3QXHA 2PT7A 4R1UA 1K7YA 1K98A 1X80A 3ETHA 1JLLA 3KUXA 2BFDB 4M0KA 3GLFB 3GA7A 2IOFK 3NBFA 4LBYA 5ED0A 2YZMA 2ZG6A 3KG2A 4K9DA 1BWRA 2QWXA 1UK7A 1FSPA 3ET5A 1TPYA 3O2SB 1W4RA 2G76A 1I7NA 4HEQA 1QO0D 4ARZA 5CBKA 2B1GA 4ALJA 1E8NA 2C4TA 2ZAOA 1U04A 4IZHA 2XXJA 3SX2A 1MX5A 4OA5A 3L8HA 2XKKA 4A1OA 4RPLA 4Y6GB 3ZNNA 3KXKA 3ER6A 2IXFA 1HDOA 2BR3A 2GRUA 4W99A 1Z62A 1Y3BE 3E8XA 4B17A 4MUGA 2FR8A 2OC9A 3FOCA 4PANA 3QVXA 1B4DA 3ZU2A 1IJKA 4E6EA 4JBHA 1RJWA 1U6KA 5FI3A 3ZUGA 1DG1G 4IJUA 3DCYA 4JZKA 4HMQA 1M75A 2BRUC 4Q4AA 2P9GA 1KL7A 5KCZA 1EG7A 1EFCA 2V7PA 3UAYA 1OXBB 3ADBA 2R6AA 1ZVJA 4N7JA 4MZDA 3NGXA 5F2NA 3KT8A 2GEUA 2JJYA 4JUDX 3WMXA 1HX7A 3WICA 2Q5QA 2FE1A 1EYZA 3AK4A 1NMXA 1U4NA 1UKBA 2I67A 2O48X 1V35A 4G4JA 3RIEA 2J08A 3WXMA 5IJ9A 3DE2X 4XYGA 1XSEA 3LVRE 4FVTA 1XP5A 3MJDA 4LXUA 4C6TB 5B7NA 3FOZA 2CBZA 3AHCA 3S1SA 4H31A 5KYWA 2NQTA 1IY1A 3KQVA 3TTXA 4JI0B 1P60A 2WSYB 3EXG1 4G97A 3I2FA 3N7TA 3GJ7A 1W88B 2GBPA 2BCJQ 4KL8S 1LS1A 3HCEA 4M9SA 1PT7A 3BTVA 3MRVA 2X0EA 1M0SA 3OT5A 4KGXA 1U8TA 4OQMA 3OE4A 3ZX4A 3VR4A 4DXAA 3GZ4A 2KM1A 4XWAA 1RFLA 2X8JA 5ERYA 2IZ6A 4TWIA 1LLCA 2CLIB 2CVPA 2JFBA 5A03A 5KYXA 5KYUB 1CUFA 5C7YA 2RIPA 4LF8B 4ENWA 3LQQA 5I8ZA 1T6NA 4MR9B 1QGAA 3BFKA 1WLYA 1JQJC 4O0MA 3GJ0A 3CLTC 3ISTA 3A9TA 3SJ7A 4A73A 4PZCA 4U7DA 3DZJA 3FTEA 1G21B 4J94A 3UT5A 2NV2B 3AETB 3R7LA 3FGNA 3EXHA 3AQ4A 3VH1A 4BWFB 1R1DA 2OHHA 1T1EA 4TS3A 5J1TB 4IVQA 4ZGBA 2IH5A 3MJVA 2DM6A 4MB6A 1C0KA 4BS9A 4KPYA 1WPQA 1OV6A 1SBIA 4IDAA 2DFVA 3BEDA 3NIBA 1Q95A 4C43A 4CEJA 3F9CA 1E3EA 3D6MA 3KQSA 4RZQA 3P9PA 3L8GA 1FYWA 1UADA 2YR0A 5LA6A 1JAIA 3W9BA 1GAJA 4EG0A 2IPOA 1RRPA 4E09A 2AMFA 2FPWA 3IV6A 4X1YB 4QPCA 1NRWA 5IYZF 3T7RA 4DWOA 1OZFA 3PLRA 1EH5A 3I9NA 4Y9DA 1Q0SA 3G88A 1K86A 2NO1A 3KOXA 3UC9A 5JXWA 3QKIA 5CVEA 1B14A 1K7CA 4XKJA 3SQOA 3U56A 5JASA 2A33A 4WZAE 2IPXA 1V1MB 4V0NA 3SJCA 4RFLA 4Y6PA 1UKCA 4TTQA 1NI4B 4UBNA 4CR8A 1RKUA 4DWVA 4L73A 1ENOA 1GGNA 4EB6A 1OAOC 2J6IA 4PWYA 5SZIA 4B3BA 1QJCA 1PT6A 2AQHA 5KJCA 4NENA 4RIGA 5TV2A 3B9BA 1E3IA 2JF0A 1ZIYA 2ZDHA 4KDRA 4RPGA 3TOCA 2WHQA 1EP2B 3IBYA 4RGQA 3QX3A 2XB8A 1HTTA 3B7PA 3CLSC 4ETIA 4AB1A 3U5TA 2OD2A 3LQFA 3AEUA 1RHKA 5KC8A 2XD9A 4G3XA 3JYQA 4PX5A 4UFOA 1JU4A 1W73A 4KQHA 4L6IA 5BV1A 1KY4A 1KTVA 2IYUA 3IP1A 3M1AA 3BWEA 1QG0A 3CX6A 1W34A 4N12A 2QZ9A 3L46A 2HHCA 3AHJA 2H1SA 4BEBA 3WWCA 4KXYA 3LZDA 4MVCA 4UW9A 2PT6A 1DKOA 2FP4A 4DUPA 4BMZA 1GTL1 5BSTA 3RVLA 3HLTA 3PKZA 4DNPA 5LYJF 4BNDA 5IANA 2JW5A 3AUSA 3MGGA 2FEXA 1SC4A 2AKAB 5FLEX 1UPBA 1IYZA 1Z0AA 1DWPA 4LA4A 3WKEA 5B55A 3IELA 1JRLA 1JBQA 4Q7JB 2PKQO 1E7SA 5JBQA 2B1QA 3A4YA 4FT2A 4D2IA 2CDBA 4X44A 1U1DA 2JANA 5GM2A 2JKYA 4A36A 3JX9A 5GPBA 5HS4A 1QTIA 3F71A 1NYTA 3L6CA 3TXYA 4B4VA 4HAWA 2ZSUA 1BS9A 1VBKA 1PL6A 3TAUA 1XLWA 3TZQA 5LWHA 1PUXA 1VKZA 3DV2A 5EXDA 1S3FA 1FMTA 2CUTA 2PXXA 1GUAA 1HEIA 1KJYA 2ZJZA 3E9MA 3EUAA 3NC0C 3NUGA 4HWRA 3HGMA 4AO8A 1D2MA 3EHEA 1DQYA 3D7NA 1NVXQ 2GVZC 1KERA 2PCLA 3PUZA 1PSZA 3BJIC 1V16A 4Z3OA 1GPUA 5BPFA 3D1JA 1JAYA 2O1XA 1SGWA 3A05A 2E37A 3PJGA 3THYA 3KYDB 4AZ3A 5D5QA 1EWRA 3FDXA 3TLXA 2DF8A 1Y1PA 2VXOA 3VRHA 3VZSA 6REQA 3UHAA 4CTNA 3M6AA 4TSRA 1H4SA 1I4DD 5CDGA 3WJ7A 4YP6A 2AB0A 2RK6A 2XECA 3TMKA 1DXYA 1VCMA 4JQYA 4QDTA 1C1DA 2B30A 2BD0A 3BSYA 3K9WA 3CSSA 4DF3A 2IYVA 3EAGA 1E98A 3IMFA 4WH0A 4X6UA 2BLNA 3OZFA 5ENVA 1G7RA 3GAAA 1KKUA 2AFRA 2Y9MB 4LQLA 4V0QA 3OPXA 5KREA 2AJTA 4NHEA 1RMYA 4ZIRA 2GD1O 2NUAA 3O4IA 1HMPA 3FWNA 1H0SA 3LXMA 3Q6IA 5I7AA 5GIOE 2IX9A 2XNHA 2Z1MA 4KCGA 3VA7A 2ZJ0A 4CKXA 1DWUA 3DVAA 4R9SA 4CUKA 4KMMA 3N05A 4ER0A 2AR9A 2H11A 3GRCA 3HPQA 1V48A 4PFQA 3DHNA 4MDHA 1VLQA 3EZ9A 3LKBA 4M1YA 3SR4A 4ZMSA 5FUMA 5EIEA 4P5DA 4Q3KA 1JEAA 5MN6A 5HRUA 4D42A 4GNRA 4P81A 4P4TA 4MR7B 5L9AA 1E2MA 4CLRA 5A4AA 1SFRA 2HLDD 3DE4X 4UU1A 5B6JA 4RL4A 1OB2A 1RC8A 4B6FA 1YDFA 2AZDA 2LNDA 4QT0A 4YRPA 4W1QA 4Z9YA 3R76A 4H0FA 4XGIA 3TRDA 2HSGA 2IVFA 1SG0A 2YHIB 4QXAA 3DWIA 4G1EB 3OM0A 1LK5A 1QP0A 3QU9A 2GNOA 2R8ZA 2O54A 4FBGA 1RIFA 2O5EA 3FOBA 3BXFA 3QYFA 1V96A 2PBLA 3KB1A 4KGZA 1AN9A 2WC1A 3SE0A 4OMFG 1PEAA 4AJ1A 1U7XA 4KXVA 4PAOA 4KQ1A 1SWVA 4QEZA 5JFOA 2SHKA 1KQPA 5K0EA 2WIFA 4KYIB 1T26A 2A1TR 4JP5A 1NI3A 4Q6BA 1Z5PA 4HQFA 2ZATA 4Z4CA 1BEEA 2OZKA 5F3RA 2CFSA 5CEFA 3R6DA 1RYZA 3U0BA 1DWOA 2OCAA 3A9SA 2A84A 2Q1WA 3P0HA 3PL1A 1ITZA 2BMAA 2CEAA 4UNSA 2LCFA 4FFBB 2QVYX 4DJDC 3QG5A 5I9BA 4BZZA 2PWYA 1M2OA 2GJSA 4HX2A 3UMBA 4E2ZA 2LDXA 3REOA 2ONJA 1GNTA 1SC3A 1BH6A 2WSBA 4NATA 1N5OX 1N8NA 1UK9A 2JFOA 1QLJA 3FAKA 5DN6D 4DR1B 3A6ZA 1XO1A 1RQRA 1O6GA 2DT8A 3ONVA 1XNJA 3MTEA 2H4WA 1FFDA 3T38A 3ZHUA 1BGWA 3QY0A 3B2NA 1ZD9A 3K05A 1XK7A 4LZWA 3RSQA 4OJYA 3A3PA 4EJMA 5J2TA 1XZGA 4I1IA 5T3YA 3ZWVA 2Y76A 1C9JA 1DKRA 1SUAA 1KEEB 1WSBA 4LPSA 2RD2A 2KB0A 1OTHA 3HJUA 3PGKA 3TZEA 4BNXA 3PHCA 5AIBA 1JPNA 1UP6A 4EHKA 1AGXA 2BUCA 3PXAA 4DBZA 3D3WB 3FDJA 2Q6KA 3Q9NA 4MLZA 2WTNA 4AP9A 1HDIA 1PL7A 4WAUA 3LGAA 1U1EA 3RAJA 1I0ZA 1XCMA 4IO1A 5HE8A 1YQWA 2D8MA 2H1WA 1E2GA 1V5FA 1WHTB 4WVLA 4DLZA 4BKRA 2WYUA 5C8YB 2PZFA 2O59A 1AKNA 1JYEA 2J3EA 3DT8A 4GXRA 4J75A 1I5EA 4Q3EA 3T5BA 3VHRA 4EGAA 2EKZA 1GTZA 3IQIX 4QOEA 1F8GA 5CNIA 5B3LA 3A04A 4DCSA 4MX8A 3SM3A 3MCAA 1LQ2A 1SXJA 1RJGA 2WHXA 2R6JA 4MKRA 4WEQA 3OIDA 4R54A 3SSAA 5E3HA 4WNAA 2ZUFA 1XCOA 5BSUA 1CZUA 4R1TA 5B1YA 3H11B 3TOSA 2IIPA 4R9NA 3VR0A 2EATA 1IVNA 2I6XA 2ZUSA 4HPJB 3DE7X 4OB6A 2D13A 5C5CA 3DXZA 1PZGA 1RXSA 2R8XA 3VR2D 4ZAXA 1C9KA 4TSFA 3U4QA 4M0MA 1VZ2A 3PWKA 3FMPB 4MQFA 4YDSA 5D1HA 4REQA 1Q0LA 5TT0A 4AUMA 5DK4A 3DOCA 1LVGA 3UAGA 1L2TA 2C8LA 2FN8A 1JZTA 1N3IA 4ID3A 2XQIA 1MZPA 1GGFA 1DOZA 1XN4A 1ZH4A 2DJIA 4HR7A 1DFGA 1GILA 2B4KA 4MWBA 5T8KA 4AY4A 4EMUA 5I7WA 3LHDA 3IB3A 2YYYA 3UG7A 3CUWA 4C7XA 5LN1A 2Q41A 1D03A 1PJQA 2PUWA 1P45A 5AHRA 1T10A 3G2JA 4HGNA 3PGLA 2IFTA 5AJYA 1JJ7A 1H65A 1VA4A 3HYRA 2B1RA 2D5CA 4HSEA 4RY2A 4TMWA 2ZEJA 4BX9A 4UTXA 5AI5A 3RJ9A 4EJSA 3T41A 3DYBA 3LTEA 1S6YA 4GIBA 2OOSA 2C5GA 4MUNA 4GVPA 2EFCB 4DADA 3D54D 3R5XA 3ZW8A 4HWOA 1FYDA 2GAOA 2CYAA 3D1LA 3D4PA 3S2SA 1IJFA 3I2YX 3CLVA 4G4SP 3E1KA 2W98A 3OO0A 4JP3A 1YU9A 2DFDA 2C42A 3LECA 3MS2A 1L8AA 2EIXA 3GUCA 3TGWA 3MHTA 2H0AA 3BULA 5F7ZA 3MM4A 1X19A 2H06A 2CB0A 4CQLA 1T3TA 4XWWA 1JEYB 2G07A 2EF0A 2YY7A 3A7EA 5FQOA 2A5LA 4NFSA 4K2AA 2JLAA 4POOA 1Z38A 2G9ZA 4XPIA 5E6UA 1ECLA 1R4AA 3CRQA 3LHIA 1DMSA 5AXDA 3PLAE 1T8RA 2HWKA 2W6CX 4JBWA 2GAFA 2ZTLA 4BKQA 1R2QA 2QTMA 3ZWCA 3HU2A 1J9EA 3MBKA 4KAAA 4IIBA 3FNQA 3VX3A 3EFBA 4AMZA 4N65A 1RRGA 4AYXA 1BRMA 4DANA 4TTTS 1RPTA 2XF8A 2YBDA 4D0NA 2DHCA 3A4NA 3AR4A 3KKZA 1QYVA 2QQGA 1TU4A 5FNVA 3N53A 4KWEA 1SB8A 1STOA 4K6OA 4LKOA 3WV5A 1GG9A 1ZIXA 3IIMA 2PVSA 3L0OA 4EG5A 3KJIA 3FDFA 1A95A 4MAMA 2WG2A 5HCIA 1QZUA 2RJNA 5EGSA 5C9ZA 2H4HA 4IXDA 3ZV4A 1RAFA 4Z49A 3DAGA 4FJ1A 3U31A 1L0BA 2P1ZA 4BWVA 2LUOA 5JVDF 3IUMA 1D04A 1CY8A 4IIJA 2FF5A 4F6RB 3IDZA 2VNKA 3MCWA 3OX2A 5E6RA 5A5VA 1CCWA 4IDNA 4A8JA 4GE0A 3Q7IA 4Z2AA 4AQYB 4TZ0A 3PXUA 4D0GA 5KVAA 3L8YA 5ICMA 2L82A 1TOAA 1XVAA 2J4FA 3LU1A 5TVGA 3WBKA 1N3LA 2IP4A 2NV6A 3PC7A 3PKIA 2JGDB 3CY6A 3ENVA 4HXGA 4MVJH 4QA9A 4PX2A 4WN9A 2YV5A 4XLLA 4M37A 4OGKA 4TUYF 5CVTA 4J2HA 1P91A 2A94A 2DUUA 1YDMA 5COBA 1RJDA 4U02A 1S8AA 4NYIR 5JYDA 2HK7A 1I14A 2Z83A 4YRRA 3RS2A 2AD1A 1Z4JA 1ULHA 2POCA 3HJCA 3O8QB 4W5NA 3G9ZA 3VZDA 4UNIA 2QF7A 2QBYB 2PYZA 4XTRA 1M34A 3M6VA 3O31A 4F21A 3JARA 4B3SB 4N8DA 3JR7A 2C2KA 2QVZX 3ME5A 4YAEA 2YFKA 5G1NA 4ZI7A 5FJJA 2ECPA 5JROA 3QH4A 4F8YA 1H0RA 1I2ZA 1Q3HA 4HFRA 2FMTA 4ZQBA 1P17A 1MO2A 5JR3A 1FUUA 3O4FA 1N8TA 2LKDA 3EW7A 1R4NA 3PR2B 1W36D 1VYHA 2YJ6A 3A0RB 1PZHA 3B1KA 3LBFA 1U9IC 4G1BA 3AKCA 3EMKA 3Q0EA 4J43A 4LRQA 3SOZA 5LXTA 1JA9A 1EFTA 2JFPA 2R68A 3M6FA 1N8KA 2W4IA 3OCJA 1ZUHA 1LLFA 1TYCA 4Z54A 3T99A 2B37A 2YNMA 4CIAA 4D3ZA 2Z6VA 4BO2A 4EQ6B 5F1YA 4CI9A 4YCCA 4EO4A 3ZHOA 4IYJA 3BRSA 2MJLA 3VR6A 4MW6A 3A1UA 5JXGA 1H23A 1E9CA 1GA4A 3NJRA 2UYYA 3FNHA 4ND7A 4TMVA 5EAIA 2RHMA 3L7NA 4KOEC 4MVYA 3SYRA 2PUDA 1LBHA 2JZNA 2QAGB 1WXHA 2OXEA 3AF2A 4QPNA 4WGGA 1SIOA 4YECA 1W44A 3F7NA 1PKXA 2DBZA 3OP4A 1TGYA 3EASA 3GUYA 4MI1A 4URWR 5FUBA 5H5JA 3W3ZB 3BAZA 4Z7JA 3FI9A 1XYYA 4L22A 3U7JA 1QHFA 3NUQA 2QM3A 5EZ6B 3WYAA 4MDFA 1EI9A 3KJGA 1CS0B 3PTZA 4JZYA 4OOFA 5CLIA 3SSOA 1XD2A 3K4HA 3EC1A 5HSGA 1CR2A 4FILA 4DCUA 2YWEA 4YR7A 2OORA 4XQEA 3K0CA 2GBFA 2VYND 3ONNA 5DLYA 2FZLA 4LUCA 3JAKA 3LT5A 4OI4A 4NDNE 3CE9A 4F04A 2V7GA 3BSFA 2EG9A 3ILYA 3LXXA 4UJ3A 1JVBA 4RTRA 4AYWA 2CMFA 2MSLA 1H1LB 1O54A 2HSZA 3C39A 4GZ3A 2O3SA 3NALA 1HMYA 2AC2A 1YE3A 1Z0JA 5ALDA 3WP1B 5LIRA 3H2JA 1KRWA 1G60A 1N1DA 2W2OA 3MGBA 1JYSA 1YFKA 5CIWA 3FPGA 1AKEA 1VSVA 2G7ZA 3AF0A 5E9QA 5JAZA 1D2CA 4HAYA 4J4TA 1TM2A 4BV8A 4CFZA 2AMVA 4MP3A 3OMLA 4HXFB 5CLGA 1GUYA 2PO5A 4B48A 1B0ZA 1JV2B 1IPFA 3E9YA 5FHQA 1ADJA 2H4FA 4EUNA 1QGOA 2QV7A 4BE9A 3ZWWA 4MMZB 4X90A 2IEDA 3S2IA 5FLXA 1Z63A 2GHTA 1W9HA 2QLLA 2IZ7A 5CGQB 3RVKA 4TVOA 1DC6A 3L0SA 4LDZA 1ZHOA 3CUTA 3RJZA 2CEKA 3AEZA 1WVGA 5LLSA 4R2JA 4UU0A 3QJ5A 2O1EA 3P4UA 2YFHA 5BV0A 4KQEA 4NJEA 4EX7A 3KR0A 4EEXA 3NHLA 4JBLA 5CD1A 4NFLA 1DELA 1ETHA 1NM5A 4O2AA 4B7UA 2ZP1A 5FOVA 4EUKA 2O6HA 3T3PB 2GA9A 3DOHA 1QIHA 5BMVF 3TL6A 7REQA 3HJFA 2R6CA 1E62A 1NJ8A 1GU1A 4GWKA 5CNJA 1UJ6A 1P2VA 1EHCA 5I7OA 2QUAA 3FMOB 3U4AA 5A2GA 3T7EA 4OF4A 1QOPB 4ZOQI 1MIOA 2D1RA 3JQAA 4B09A 1D2EA 1LCIA 2FF7A 3IDFA 3RVBA 5FA8A 4B2IA 1K6JA 1MA3A 4Z7OB 1J2UA 2XDAA 3FOEC 4GZMA 2W00A 3A1SA 3I6BA 2C9DA 1BX3A 1I9CA 2A1UA 4KXUA 3SC2A 4AJ4A 5BV7A 3PR1A 4EZBA 1T2EA 1JHMA 3VV2A 4DC0A 4O3FA 1A82A 3C6BA 3L02A 3B13B 4URYR 1H9CA 1GVHA 4HH0A 3LUDA 4PC7A 4LI3X 2AMLA 4YRIA 3OFKA 2YVUA 4RH3A 1S96A 3HH8A 2BZ1A 4YT2A 4AJEA 1MC5A 1C8KA 2B36A 1O5IA 3M81A 4DXHA 3MRSA 3HNRA 4G0MA 4LISA 1YB2A 3NANA 2G3YA 2REOA 2NTEA 3WLOA 2RGWA 5AM2A 3H4TA 2C5SA 1XVTA 1SUIA 4HB4A 3R8CA 1K5HA