2PJDA

Crystal structure of 16s rrna methyltransferase rsmc
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
334
structure length
334
Chain Sequence
b'AFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLSRQMGDNARFSLVATADDVADCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYSVDGLTVKTLPGVFSRDGLDVGSQLLLSTLTPHTKGKVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEGEVFASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFGFHEVIAQTGRFKVYRAIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA small subunit methyltransferase C
publication title Functional specialization of domains tandemly duplicated within 16S rRNA methyltransferase RsmC
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 99
structure length 334
sequence length 334
ec nomenclature ec 2.1.1.172: 16S rRNA (guanine(1207)-N(2))-methyltransferase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF08468 MTS_N Methyltransferase small domain N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pjdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pjdA01
5FCDA 3UJ8A 4YMGA 5K0EA 2OB2A 3F4KA 1KP9A 2IBTA 2PT9A 3UA3A 2NXNA 4HSGA 1TPYA 1JSZA 4PNEA 5K01A 2FK7A 1EG2A 3LL7A 1EJ6A 5CVJA 1L3CA 3FPFA 1XCLA 5E9QA 3BKXA 2PKWA 4BLVA 1I4WA 3HCEA 4CWAA 5JR3A 3M6VA 2PXXA 5C9ZA 5DXJA 5F2OA 1H1DA 2HTEA 2ZWVA 3UWPA 3P9NA 4AX8A 2AOVA 3RW9A 3TFWA 2NP7A 2EJUA 4KIFA 4PYKA 3TM4A 1NBHA 1PJZA 4LECA 5T64A 1FBNA 2VDUE 3G2PA 4B17A 4PYOA 1IM8A 3UJAA 1KHHA 5HILA 3QOXA 1MJFA 4FZVA 4AZSA 2CL5A 1YUBA 3G89A 1WG8A 3CJRA 3UJ6A 3HM2A 2PSSA 5F2KA 2H00A 3HVIA 5E9JA 1XCJA 3G2MA 1IY9A 1F3LA 3UZUA 4RTKA 3BGVA 1JTEA 3EGIA 4ER5A 1G8AA 1WZNA 1P39A 1YB2A 3DLIA 4WXHA 5GP1A 2R3SA 4KVZA 1FJXA 3G7UA 3DLCA 3UFBA 5CCXA 1AQJA 4OA8A 4R6WA 1G60A 4C06A 4GEKA 3P9CA 3DOUA 3BGDA 4V0QA 3LX6A 4CTJA 3AJDA 3JWGA 4PYJA 4HTFA 4YV0A 4PWYA 4PYLA 5JUWA 2ZIFA 3TKYA 1G8SA 3GRRA 2JG3A 3ANXA 5EQJB 4X1OA 1XDSA 5GM2A 4F85A 5KVAA 1DCTA 5KYGA 9MHTA 1KPIA 3FYCA 3C6MA 3G8BA 3EVBA 3LCCA 2JH8A 3LBFA 4XUDA 4CKCA 3FUXA 3ORHA 4E33A 2IGTA 4FSXA 1RJDA 3LDFA 4HGZA 4XCXA 3UJDA 4POOA 3EVCA 3TLJA 4ISCA 5CVDA 3B3JA 4QVKA 5FWDA 4OBWA 5E1MA 3DXXA 1YFJA 2OBFA 5EZQA 2YR0A 5T6BA 5EZSA 1RJEA 1TW2A 5DT2A 1BC5A 3UJ9A 4LG1A 5DWQA 4A6DA 4PGGA 1T43A 1XTPA 3ME5A 3I9FA 2IPXA 4PYNA 4X60A 4YUZA 2GPYA 4F84A 3H2BA 2P3QA 2IIPA 3M70A 2YXEA 4P7JA 5GOZA 2HV9A 4DKJA 2P41A 3AXSA 1NV9A 3PTAA 1G6Q1 4F86A 3CGGA 2B25A 3NDJA 5DSXA 4C07A 3EMDA 3FPJA 2GS9A 3G88A 1BKYA 4RVDA 3NDIA 3NTVA 2IBSA 3KQQA 3HTXA 2P35A 3PFGA 4FT4A 3BWMA 4HH4A 2P8JA 4U7PB 2V74B 3BXOA 5E1OA 2NYUA 5ICFA 1EAMA 4E2ZA 1SVUA 3E23A 3JWJA 3KPJA 4HRAA 1KPGA 3TM5A 3KPUA 4CXMA 3OU2A 5DSTA 3E8SA 4PIPA 5DXAA 1TW3A 2Y1WA 2Z6UA 1WXWA 3BWYA 3HA7A 3M6XA 4P58A 3KQMA 3GXOA 2VZ9A 2ZZNA 2EG5A 2FRXA 2HNKA 3ELUA 3HVKA 1Z3CA 3DXYA 5K0LA 2AOUB 4FR0A 2PT6A 4QTUB 2FHPA 2BR4A 3GU3A 2YXLA 2G72A 2XYVA 5K0GA 5FULA 1ORIA 2P40A 4R8SA 5CCBA 4CKBA 5ICCA 4AUKA 4PYQA 2BH2A 3P71T 3A26A 3DULA 5EGSA 2JHAA 2PVCA 4PGHA 3KQOA 4GOMD 5GWXA 5FWAA 3MB5A 4M7RA 2IFTA 5EVJA 2OYRA 3C3YA 5K0CA 2VDWA 10MHA 5LQAA 1BOOA 2PBFA 3P9IA 2NXJA 5F2NA 4BY9E 2XVMA 3PT9A 3LKZA 3M6WA 1EIZA 5H02A 4BLWA 1HMYA 2BZGA 2O05A 4RVHA 2Z6AA 4RX1A 4C05A 2FK8A 2JH9A 2ERCA 1P1BA 3C0KA 4OA5A 3SGLA 3SSNA 2AOTA 3TPZA 3BKWA 5DTRA 3BZBA 1RJGA 3KKZA 5EMJA 5CUQA 5FQNA 3P2IA 5EKUA 2PV0A 2DPMA 3AXTA 5EHIA 2Y1XA 3MAGA 2AN3A 3C6KA 4X63A 3OZRA 1YF3A 1VBFA 3SX0A 5FA5A 5DX1A 2EJTA 3I5UA 2PJDA 4M36A 3SSMA 4CTKA 4GOLD 4PONA 2IH5A 1JR4A 1VE3A 3DR5A 1O9GA 5BP7A 3OE4A 1KYWA 2B9EA 4DZRA 4YV2A 4MIKA 4BP3A 3CC8A 3EVEA 2WA1A 4ER6A 2CMGA 4P7FA 4GQBA 1X1CA 2P3LA 1IXKA 2BR3A 3CJQA 3B89A 4IV8A 4BP1A 3KR1A 2VP3A 4HG2A 3Q7EA 2O0LA 5GINE 4Y2HA 4RSRA 2QRVB 4KW7A 4EK9A 3P8ZA 1B42A 3A27A 3EGEA 3HA3A 4FGZA 3KPYA 3KR2A 1ZKDA 1DUSA 2AS0A 3P2EA 4RYLA 2H1RA 2PWYA 4DA4A 2O06A 3D2LA 4DCMA 3LBYA 5DTMA 2ZLBA 4E2YA 2JHCA 2UYHA 5EC8A 3NW9A 3OU7A 4GOND 2XBMA 4K6MA 1JQEA 3FUWA 3R3HA 5ICGA 5HIKA 1ZHFA 2LD4A 2OPBA 2IH4A 3HNRA 3SVZA 2ZZMA 4X41A 3AWIA 3TRKA 4YUXA 5EOVA 4E70A 3KR9A 3A7DA 2F8LA 5K0JA 3LKDA 3BWBA 4IWNA 4XUCA 1JSXA 5E8JA 2VS1A 4M38A 2NP6A 2P7HA 3LSTA 4P7KA 4ZTBA 4C08A 2JHPA 4RTRA 1X1AA 4KWCA 3FTFA 1U2ZA 2AOUA 2QYOA 5LQCA 3NMUF 1HNNA 4P7GA 1JTFA 5FHRA 3UBTA 1L3IA 3P97A 3QOWA 5FQOA 2UYOA 2OXTA 3NVKI 4PINA 4EQZA 2ESRA 4PYMA 3FZGA 3IHTA 3G2QA 2OY0A 4QQNA 3A25A 3DXZA 2UYCA 2I9KA 3ELYA 4YMHA 3REOA 4MTLA 2AOXA 3G5LA 1OR8A 5HIJA 4AZWA 4E30A 4NECA 1NW6A 2NNWB 2ZVJA 4QPNA 1EQAA 3PFHA 5IH3A 4C04A 3V8VA 3ER9A 1N2XA 2CWWA 3P2KA 5E2AA 3GCZA 1NE2A 3LGAA 5KQSA 2B78A 1SG9A 2A14A 2PXAA 4V0RA 3S68A 3E05A 5C0OE 1M6EX 5LQUA 3PX3A 3GJYA 2EFJA 5EEHA 5FA8A 2BM9A 2ONZA 2IH2A 2PWPA 1KXZA 3GIWA 1NW8A 5DPMA 5FHQA 3BT7A 4PCAA 1XDUA 5BW5A 1SQFA 3C3PA 1XDZA 3G2OA 5EMLA 1X1DA 4RVFA 2YQZA 2R6ZA 2UYQA 3M6UA 5K09A 3HP7A 1JQ3A 3AY0A 3EGVA 4PYIA 3KQSA 5E2BA 3UJBA 5DX0A 2QE6A 2P1DA 3PB3A 3BWCA 5E1DA 3EMBA 4ER0A 5CM2Z 2Q41A 5DRYA 1UIRA 2WA2A 3GRZA 3VC2A 3EVFA 1SQGA 1SUIA 2QRVA 4AZTA 4GC5A 3SMQA 1AF7A 2V7EA 2AN4A 3UJ7A 2OZVA 5M5BA 1L1EA 3MQ2A 5LQJA 2PXCA 4YUYA 1X19A 4E2WA 2B2CA 3E7PA 3FUUA 1JG4A 2ZULA 3JWHA 3L8DA 4FP9A 3GWZA 3O31A 3M33A 5E1BA 4RTOA 3MERA 1NV8A 3TOSA 1ZGAA 3LDUA 1VP3A 3HVJA 4M37A 5EHGA 5IKMA 1R8YA 3EEYA 1XXLA 5HOQA 3HCBA 2C7RA 3B3FA 3KU1A 1QYRA 3OZTA 4OX9Y 4QVGA 1JG3A 2BM8A 2WK1A 5E9WA 3R24A 4BLUA 4RTLA 3T0IA 4GBED 2ZCJA 3NWEA 1R6AA 5GIPE 3PS9A 2PX2A 5FTWA 1O9HA 4KRGA 1P91A 3CBGA 5CIYA 1L3BA 4RTMA 1RI1A 2AVNA 2PGXA 3HA5A 3UA4A 3RIEA 5D1HA 2ZZKA 1KIAA 1O54A 1VPTA 3CCFA 1RI5A 3OU6A 3R0QA 5CVUA 5G02A 1G38A 2ZFUA 4JXJA 4UOEA 3A4TA 4Y30A 5HIMA 5D1NA 4RTPA 2P3OA 3FPGA 4FS8A 4EVIA 2O57A 4WVLA 5K8VA 1Y8CA 4E31A 1M6YA 2H11A 5EMMA 3RODA 4RTJA 4U7TB 3EVZA 2ZSUA 2EX4A 3MTIA 2G70A 2KW5A 5HEKA 2HWKA 2ZBPA 5EKXA 3BGIA 5EG5A 3T7SA 3VYWA 1SUSA 2AR0A 4MWZA 3K6RA 1RJFA 2HMYB 3ERCA 2FCAA 2YXDA 4AZVA 2K4MA 1Q0TA 1I9GA 3KQVA 1RI2A 4R8RA 4C4AA 5K03A 1WXXA 3I53A 3B3GA 1I1NA 4G56A 5DTQA 2C7QA 3KQTA 5HIIA 2CMHA 2FPOA 3X0DA 4C03A 3I64A 3MTEA 1KR5A 2GAFA 4L7VA 4QDKA 2QY6A 3M4XA 5FUBA 4DCGA 3R9XB 3LDGA 7MHTA 1UWVA 4GF5A 2AZTA 4DF3A 3LPMA 1YZHA 1D2HA 5ERGB 3UJCA 3TKAA 1INLA 3KQYA 5P8WA 4OBXA 5ICEA 1D2CA 3LCVB 3TR6A 5LR6A 3DMGA 4EKIA 3FPEA 4R6XA 3OE5A 3KPWA 3GRYA 2YUIA 5EEGA 1QZZA 3WSTA 5E8RA 5EIFA 3DMFA 2XYQA 3SXJA 5GIOE 2G1PA 4MQ4A 1JQDA 3GRUA 2PX4A 4PCLA 3LECA 2GA9A 2NXCA 3GDHA 3I58A 3TQSA 1ORHA 2ZW9A 3HCCA 3U81A 3EVGA 3IEIA 3MGGA 1R00A 5U4XA 2ZBRA 1D2GA 1Q0SA 3GRVA 2XVAA 1AQIA 2G8NA 3ID6C 3FPHA 2IDKA 5B1SA 3VC1A 1F38A 3CVOA 4QTTB 3A7EA 1AV6A 3PVCA 2C7OA 4PIMA 2JJQA 1R74A 1PRYA 1QAOA 5BXYA 5K0FA 4RTSA 2AOTB 3Q87B 4HC4A 4RVGA 1KYZA 2IDJA 4FT2A 4YV1A 2BR5A 4E2XA 1XJ5A 3IV6A 4DMGA 5DM0A 1L9KA 2N47A 3VSEA 2CKDA 3SSOA 3DTNA 1ZG3A 1EJ0A 2AVDA 3NVMB 1NKVA 2AOWA 3R6TA 1R8XA 4XUEA 2NXEA 4RWZA 5DM2A 2Z6QA 2ZIGA 5HZMA 1YFLA 3FTDA 1RI4A 5C1IA 4LWOA 2B3TA 3HEMA 2PY6A 1M0EA 3OFJA 3FUVA 1VQ1A 2VDVE 3KQWA 4GOOD 3ER8A 3KQPA 3ELDA 1FP1D 2I62A 3HCFA 3GO4A 2IP2A 1NW3A 2AN5A 2QM3A 3CJTA 2ORED 3FTCA 1G55A 3T7TA 1NBIA 1VL5A 2DULA 5GM1A 1UFKA 3MCZA 3G5TA 2PX5A 5DM1A 5EIWA 4DQ0A 3B5IA 4OQEA 5HFJA 3PLAE 3QV2A 3JWIA 3DMHA 2FYTA 4MHTA 5FADA 3O7WA 2O07A 1VLMA 4OQDA 1JG1A 5DM4A 3K0BA 3MCTA 1QAQA 2UZ4A 4ER3A 4QDJA 1VIDA 3P9KA 4DM3A 1KPHA 3OCJA 2G71A 1NW5A 2GB4A 2PLWA 3HVHA 3LHDA 3OFKA 1QAMA 3EPPA 1NW7A 1N7JA 2I7CA 5K0BA 1WS6A 2OKCA 4X61A 4RTNA 2ZBQA 3FUTA 4IKPA 4KIGA 5CVVA 2OB1A 5K05A 5T67A 4EKGA 5MHTA 4YUWA 1ZGJA 3EVDA 4QQKA 4LWPA 5EMKA 3FYDA 2GH1A 3FTEA 3DH0A 3HCDA 3SM3A 5LQKA 4HTFB 3LCUA 3G8AA 1NT2A 4O29A 4KDRA 1P1CA 2OO3A 3ELWA 3EVAA 1RI3A 3FRHA 3KR0A 2YX1A 4FSDA 5DLYA 4YUVA 2ZTHA 1ZQ9A 5CVEA 5DX8A 5LQRA 4A6EA 3NJRA 4ATNA 3B7PA 4RTQA 2ADMA 2HR1A 1FP2A 3KPVA 5DRTA 3PX2A 2GLUA 3DP7A 5BW4A 2PX8A 1JG2A 2C7PA 2YTZA 1BHJA 3IYLW 2ONYA 1DL5A 2I6GA 3OZSA 5K0NA 4E32A 5EPEA 3T7RA 5LQNA 1V39A 4IV0A 8MHTA 1MHTA 4H0NA 2XYRA 3THRA 3MHTA 4Z2YA 1WY7A 2YVLA 3KHKA 1FPQA 5KS2A 3GNLA 3BUSA 5LSAA 4HGYA 3NWBA 4ER7A 3GGDA 2P7IA 3O4FA 4CKEA 3HCAA 3V97A 3SR4A 3FRIA 3OPNA 5KQRA 1N7IA 3TMAA 4RV9A 5CD1A 1QANA 2E5WA 2ZIEA 1R18A 3THSA 1SKMA 4EMSA 4QPPA 4R05A 4KDCA 4GC9A 4GUAA 1XVAA 3DUWA 3CKKA 3EEOA 2ZWAA 1YZ3A 1X1BA 1VP9A
chains in the Genus database with same CATH superfamily
2Y1LA 4UFNA 1Z0ZA 5H4GA 4YDHB 3VJLA 1RYDA 2NXNA 3PUKA 5L9AA 2ZKLA 3W5IA 4UHCA 2BLNA 1Z4JA 2MINA 5CPBA 3ZHYA 4H3VA 3HVUA 2Q45A 2R8OA 2QI9C 3MHPA 4Q4JA 4HCJA 4JJIA 3PZRA 4PLGA 3R9KA 3SK0A 4C0HA 2GBGA 3S27A 4R8KA 3DQPA 3NJ8A 4RY8A 3KOUA 4N6NA 4C6TB 4BX9A 4BO9A 1G18A 2H2HA 4NEHB 3SIPA 3UOWA 5I51A 2JB9A 5EFOA 2FQXA 3G8CA 4R3WA 1L7NA 3TRJA 3VI3B 2I4MA 3I3OA 3KLMX 4Q9IA 4XPIB 1CRZA 4H3SA 3TSZA 1I4EB 3TM4A 3M9LA 3RTBA 2E87A 2G7MC 3UB4A 5LP6A 2A78A 5FUMA 4ZAWA 1G8JA 2WYOA 5I5EA 3UJAA 4W4TA 5HILA 4KLZA 4O2RA 4BJ6A 2Q5FA 3HHPA 2CLIB 1JJBA 1FEZA 1UP6A 2GHQA 1IB0A 2XRFA 5E9JA 1E7MA 2DFTA 5F2KA 1IY9A 5JZOA 1JR6A 3BMXA 4KQJA 5LZ2A 1LJUA 1ECGA 1P39A 1SBNE 3E9YA 4QLOA 5GP1A 1UEXC 2Q9UA 3QZUA 3NEYA 5CCXA 2CLDX 3I39X 1SC4A 1ISSA 3VX3A 1WIWA 2FF7A 3BGDA 3CO5A 4NENA 1KS9A 4BKPA 4DAEA 1C5KA 3KJXA 5A7FA 2ZS9A 2YJZA 3IAM6 1KTIA 1HE4A 2EW1A 2OZEA 4E5MA 1JZTA 1XLTC 1YHZA 2WIAA 3C6MA 2PO5A 3G8BA 5LXTF 5I7UA 3SLRA 5JRDS 2GM5A 4HGZA 2Q3FA 2VHWA 3V97A 4ZCIA 2P4QA 1PFVA 1DMRA 5WRFA 3EVCA 1ST3A 1Q2XA 2BZ0A 3JZDA 2XB9A 2X0EA 2Y93A 4RIHA 5EZQA 5EHXA 3FPSA 1GL9B 1YUMA 2AG1A 3LW7A 5DW3A 2P9ZA 1H85A 1VLQA 5C7LO 2P9FA 3KLPX 1DC3A 4AZ3B 5EWMA 1CUAA 2QORA 3CRW1 3SHVA 3TVDA 4DS3A 4D6YA 3M70A 3IUEA 2PMBA 3WYFA 5C53B 1IXYA 2IYSA 3D4BA 1GCIA 2F3SA 2GAAA 1T9BA 2JD0A 1Q44A 1RM3A 2PRIA 2XCQA 3TSAA 1R6DA 2XIJA 2AYYA 1IUOA 4OQNA 1AKVA 3MC1A 1MX3A 3OFND 4PO8A 3AIMA 4URZR 3U3JA 3EMDA 1L5MA 5B7GA 3KWJA 2DFNA 3B2QA 5FBVB 3EXHA 1UJCA 4MS1A 2JLQA 3RYHB 4AG5A 4EKDA 2QS9A 4YJHB 2HCTA 3ADPA 3QELB 5C1BA 4Y2YA 4FT4A 3SBDA 3AOEA 3QGMA 2OAEA 2C0CA 2Q9BA 3R3JA 4O0LA 3T3GA 3GQBA 2H1VA 3GLFA 1GARA 4DQVA 3VVBA 4RULA 3EPKA 3PGJA 1K4KA 4H1WA 2Z6UA 2P6RA 3NPMA 3MMPA 3DLAA 2CNDA 3CT4A 1P60A 2FKAA 4RU1A 1BVUA 3WKAA 4BC1A 4WNAA 2WT4A 3H7IA 4LQLA 2JVKA 2ZWOA 4NZZA 4B73A 1FUEA 3E3NA 3GU3A 2QTMA 1XKLA 4I99A 5E6RA 3W6NA 3EY9A 4PFKA 3PNSA 2JFXA 4L5AA 4LHZA 3GUYA 4RY2A 3T41A 2BM0A 2JAXA 3HBAA 1EUDA 2DSNA 3OSUA 5T4FA 1ESNA 3KBBA 2HHHB 3R3YA 3HHEA 4N3GA 4JBXA 1JJVA 1Y63A 3C3YA 4NAHA 4DDMA 1TT5B 4NCAA 4CEIA 1NY6A 3U61B 5JLAA 2R11A 3AHIA 3LKZA 1J7KA 3EZ9A 1J25A 3T1QA 2BZGA 4P4NA 1GWNA 1ZK2A 2JLWA 4C05A 2HU7A 3IOCA 5B3KA 3JYNA 1K4MA 3O4RA 2A35A 3WNDA 3OPVA 4EX7A 5CB4A 4P4GA 4Q9AA 2I1QA 3QLUC 1X6VA 3PNMA 4EW1A 2RGYA 3ACBA 1L4UA 1V45E 1XZ8A 2YN2A 2BHNA 1ISFA 5B7NA 2IE8A 1LQ2A 4MYTA 5AHWA 1YR2A 1CY7A 3WK6A 2RGEA 3GJTA 4BQNA 3DKIA 4KMMA 1A82A 2BFNA 2YWRA 3ESDA 3DOHA 2AG5A 4XYGA 5AR1A 4CTKA 3CPEA 3MOIA 1P4RA 3V8RA 4QX6A 5IBPA 4WZBE 3GRCA 1ZAKA 1G5RA 1PS8A 1KAEA 1SKUA 2G82A 3GAFA 4FKBA 4MIKA 3W06A 5JECA 2Y0EA 3OHPA 3D0KA 4D3SA 3ABOB 1PZMA 1H2HA 1TQ4A 2Y2UA 1CUYA 1WXFA 2ZB8A 4QFBA 4ADSG 5FWXB 3C41J 4HRVA 1Z2EA 3ADKA 5FFMA 4QBIA 3MG9A 4TWAA 3VH1A 1RM4A 1ZRHA 2B99A 2BBWA 1E7WA 2P6PA 3A6GA 4LGVA 1P1IA 2FSVC 2VWQA 4HS9A 4AXXA 2ZUEA 2C2OA 3THOA 1GZ6A 3WNVA 3D3JA 3W2FA 4BV3A 1PT8A 1BQEA 1FVXA 2C97A 3AI1A 3HZHA 4MTCA 2FRDA 3A27A 4ENRA 5GGXA 1XG5A 3COJA 3IKTA 3B6EA 4LMRA 3W2HA 1RYMA 2JGMA 3VPDA 2XOKD 3GAZA 3TQQA 2G88A 3ADDA 2A59A 3ENVA 3TDMA 1AA9A 3B13B 2FWAA 2GEVA 4DBVO 1I80A 3U4DA 1ZHFA 5FBZA 1Z0KA 2F1HA 1M34B 2C59A 3NOOA 3NYRA 2XXJA 4A26A 2PR7A 4LXHA 4MWBA 4JJGA 2GYUA 3HKBB 4A03A 5FTMA 4MQLA 4WHMA 1ETUA 1HO3A 1UJBA 2RJNA 2YHIA 2EFHB 3B8HA 3ADOA 2VS1A 2GI4A 4KO4S 3AONB 4K6CA 3LSTA 4ZTBA 2W4QA 3FJOA 3ZVLA 8LDHA 2NO7A 3I6IA 4UKDA 2C5SA 3IXLA 2Y1EA 1M0TA 3AESB 1B8NA 3JALB 2FTKE 4WXRA 3WAGA 5CPFA 3C3CA 2VH5R 3QOWA 2DTDA 5BT8A 3M2PA 3LP8A 1MFZA 1QO9A 4EQZA 1WCIB 3E7DA 3C70A 3K9CA 3EARA 3LGSA 4M2LA 1M75A 1T8YA 3WWZA 4JB2A 4NZNA 2X5JO 3PK0A 4P83A 3DXZA 1HM5A 4H31A 1FK8A 2V96A 1ULSA 5EXTA 2EQAA 1BA2A 3SI7A 1USGA 5ITVA 3LCRA 4EW3A 4JROA 4ENVA 3CXRA 2WJPA 5HWSA 1M10A 4PHTA 1U3TA 3ZY4A 4DCTA 4B3GA 3S6JA 4EGSA 1A2KC 4DUGA 3MUEA 1XF1A 3OFNA 3HQ4O 4ND7A 2X77A 3E8XA 3UV3A 5JNUA 1GDHA 4TTJA 1TEXA 2ZTSA 1RZRD 2NZYA 1JLKA 1UR5A 4N5DA 4R54A 1V4NA 1MRSA 2IOHA 4MAAA 5KYUA 3ZHTA 4DDVA 3IQIX 4Y7CA 3M3HA 2NTYC 5AYVA 3GUZA 1EFKA 3GIWA 3FKSD 3KK0A 1PTKA 1JLMA 4JEMA 3ROTA 1X3LA 4ZA2A 4NU0A 4QSMA 4TTAA 3TW6A 3I83A 1CUXA 4HX9A 5CYPA 3WBBA 1CEYA 4RXTA 2GFHA 3O9ZA 4PYIA 3FRJA 4J0FA 4O4IB 2RK3A 3Q3CA 2FN3A 2QRQA 3Q1LA 4PPYA 5ALSA 3X1WA 5J9FA 2QE6A 1T9ZA 3EBOA 4CLEA 3D6TB 4ZHQF 3ZDAA 4LHYA 4NE2A 4XR9A 4CM8A 5DRYA 3RFUA 1TUBA 1VE5A 4HNTA 1XTVA 2BF7A 2CHFA 3G2NA 4R1LA 2ZM6B 3MGAA 1GO2A 4ESVA 4S1WA 2BFFB 3SMQA 1X8XA 1Q1AA 3C6BA 4I1IA 1NTOA 4LTNA 1FJHA 4MRNA 5CYGA 5F1KA 3FUUA 2ZULA 5J5VA 3HJHA 1YDEA 4HWPA 3S4YA 1R37A 3EQZA 3MERA 4UHHA 1RE1A 6ABPA 4AMBA 3ONEA 4YWJA 3QBJA 3VDRA 1ZAYA 4PAQA 2X5NA 3L8YA 2G4VA 2PZJA 1USKA 1OVGA 3SC4A 2XCRB 5G0UA 1RPAA 1JKXA 3W8RA 1NJ2A 3T0IA 5FKJA 2RH4A 3L02A 4BAUA 5BWCA 3KVNA 3TSOA 5LJIA 3R5SA 1H6AA 4B4WA 4IY1A 1X7DA 4I55F 2Q46A 1H23A 3AI3A 1T5IA 5F9MA 2BMWA 3W3AA 4B3HA 5DGCA 1JMVA 1H2ZA 4WJLA 3BBLA 4HZGA 3WQBA 4YEDA 1E7QA 1RI1A 3MCVA 2Q6LA 4RHEA 1X7YB 3RIEA 3KKLA 4DNXA 1VPTA 3CCFA 3R0QA 5ALXA 3EMVA 1UJMA 2X7XA 3AW8A 4E5DA 4CTNA 1XYVA 1O96A 1W75A 4EVIA 1Q22A 4MKFA 3GGGA 4N5IX 5IFKA 2KB0A 1M6YA 1PR2A 2ZBPA 1AY0A 3DDNA 5SY4A 2NVOA 2ZJYA 1SUSA 5GMOA 2P69A 1TYBE 3DNMA 4E1BA 1NVFA 3A3YA 1LBSA 1T29A 1B3RA 1POWA 2CCKA 1P5HA 2VUTA 2XSZD 4L75A 4ENUA 2WAOA 5I9SA 4RGBA 1U6IA 1E2QA 1X1QA 5BSUA 2XOKA 1XZIA 3B2EA 4LZPA 2XDAA 4OHXA 5LCXA 1PFKA 2FE1A 6REQA 5SYAA 3H18A 3O2NA 3T3IA 3QVOA 4E5NA 5I7SA 1RAEA 5DLPA 5FOVA 3BMOB 1D2HA 2VG8A 1WMDA 2H4HA 3AB8A 4FD3A 1NFRA 1TAQA 2GN1A 3BTSA 3TKAA 3FGOA 4GQAA 2PKQO 1PYDA 3I09A 4HQFA 3DMGA 1C3OB 2GERA 1Z63A 4AJ4A 4QGFA 4BATA 1YRBA 5CLJA 5GIOE 3DMFA 2XYQA 5JSFA 3SAJA 1S3FA 3C8ZA 5JJLA 2WAMA 2YRXA 4O4JB 5ESDA 3TW4A 2OAGA 2W2KA 3HR8A 1SZJG 1YULA 3QHPA 3QWIA 2A6PA 4P3OA 2XDWA 5FUXA 1JJFA 5AT1A 5E2IA 3K0CC 2WTMA 1W0JD 3ETNA 3FGPA 5C5CA 3AIOA 5SZJA 4D4IA 5JHGB 3DZDA 3EY4A 4IOKA 2F9LA 2CEAA 2JI8A 5KQMA 1ZCJA 1OX5A 4KI0A 3T9EA 3MRXA 3A7EA 3ZWOA 3KSZO 3KWLA 3LCJA 2JJQA 1X3SA 4HD8A 3F3KA 2N0SA 2O5RA 4MUEA 5JDIC 3G23A 1KK3A 4I4IA 3LQKA 4MUBA 4HVCA 5FOTA 4DJAA 1RRGA 2BW0A 2HRQA 3QEMA 1M6VB 1E8DA 4RL6A 1L9KA 5T4BA 2IPOA 4C4SA 2AD5A 3DTNA 5G1NA 3RNOA 1EJ0A 4S05A 3M81A 3QU4A 1EESA 1XAHA 4YY3B 1PNOA 3SP1A 1QHIA 2HBRA 4UVHA 2BHTA 4X85A 1F6WA 2WTBA 4ARZB 2PMEA 1UXOA 3CG4A 4KQWA 5JCJD 2XIQA 4XE5A 3FKSA 4B8WA 4WLNA 5EP2A 3H9GA 3AEKA 2UVDA 1FTWA 2IC5A 1HURA 1JLRA 1FQJA 3FWZA 2YHAA 5LWHA 1Y4ZA 3AHCA 1P18A 1HWYA 2AYXA 3DKKA 4D8TA 2DULA 2GUGA 1SHUX 2QLMA 1UFKA 2WICA 4OYLA 4Z9XA 4HNUA 4GE3A 3WHIA 1EYZA 4MV9A 4TMWA 1MJNA 4OQEA 3TSWA 3F5MA 3FYUC 2BSXA 3A1EA 4MHTA 5KYYA 2TYSB 4HWGA 3CGWA 3B53X 1GG2A 2ZB4A 3PUJA 4TL9A 4AIIA 3U4CA 3KETA 4LF9B 1KI3A 4QDJA 4CHGA 1EZ1A 1TM2A 3CUSA 3DW3X 4V1CA 3KXDA 4Z8YA 3VTAA 4H6VA 3WHPA 5IG2A 1G20B 1V5WA 2F17A 3E7WA 4G1FA 4FCTA 3PENA 1AZSC 1UMDB 2J09A 4MMZB 4OOFA 3EIHA 1K2WA 5IARA 2H0AA 2V9CA 2GPNA 1RHKA 1IULA 1ECFA 3QWHA 4RKEA 1X87A 3ND5A 2PAAA 3L7OA 1JEYA 4DADA 3ABSB 2GCPA 3PDCA 1U5BA 1AA6A 2D54A 3FXAA 4EG7A 1ZA2A 2EP8A 3HY6A 3FOEC 3OPMA 4NNJA 1MVLA 4U8GA 1HE5A 1ZVKA 3GN2A 2HMUA 4N03A 4RTQA 4C0SA 1XYGA 2ADMA 3CWZA 4AY4A 4ZVOA 3ZIDA 3DL7A 2W9XA 3U49A 3T3DA 2P79A 3LVQE 3C7AA 4L8LA 2M98A 5LMZA 4NE7A 3KQLA 2H8GA 4UUBA 4EPRA 1MAWA 3HSSA 5JMTA 1ZCAA 1YZVA 1U1GA 2HREA 3L7IA 2VYVD 5AICA 3QLEA 1IZZA 2XYRA 4N0QA 2BEUA 2H2DA 4RD1A 5CAEB 3S7TA 1EUZA 4HMQA 5DCYA 4QHYA 3GOHA 2K7FA 1UP7A 2BPOA 5K2MA 3D1LA 4CEHA 1T9GR 4NP6A 1E2NA 3R3UA 4CETA 3CUUA 3FI0A 4QUJA 1XZCA 1AKYA 4E13A 1N7IA 2NO1A 1J9ZA 2XSZA 4TRMA 3KZNA 4YRFA 1WTAA 4MVJD 1PQWA 3SDZA 4B4UA 5IF3A 2V5UA 4L76A 1D2RA 4G24A 1A04A 2VPYA 2DT8A 1LDNA 5IF9A 4AS1A 4CI0B 4YI3A 4KFCA 3TN7A 5H5JA 5J2UB 3E1SA 5KMGB 4OK3A 2X4LA 4KX5A 2O2IA 4OKNA 4LNHA 2WHRA 1QPGA 2W2OA 3JD0A 4CJXA 4AL4A 1J07A 1EJ6A 1KZYC 4EJ2A 1C4WA 3WIVA 1L3CA 1XCLA 3FD8A 4KXXA 2Q21A 5KHLB 1IUKA 2XX3A 4INJA 2ZT6A 4MLCA 3JYOA 2EKPA 3PCXA 1FDSA 1T1EA 4QOHA 4RM2A 1TUEA 1Z62A 2JW5A 2VDQB 2VHVA 3GC6A 1NQVA 2I2DA 4G8CA 4W5JA 4ZCMA 4AS3A 3OQMA 2OP1A 1E1QD 5BO5A 1R0BA 3DNPA 1M2KA 2JATA 2QRMA 3KJGA 1Z0FA 1R6VA 1T9DA 1ZIYA 2MYUA 4TMZA 4BLPA 1BQ3A 4G81A 1ST2A 1J2EA 2G40A 4EWLA 4RF2A 2XTAA 4E4RA 1I1HA 3EDRA 1W0JA 2V7GA 3AETA 2GHIA 1P1JA 2F8TA 5BN3A 2JCSA 1QGDA 4MCAA 1PFQA 5HCUA 2DPHA 2F59A 4E1AA 5A9SA 1Y0BA 4MEJA 4ZAFA 3OJ0A 1DMSA 1JTEA 2FZLA 4GP7A 2C2XA 3DT9A 3Q4GA 4QASA 4L8WB 3VM6A 3F1KA 4RKQA 3UFBA 4UC0A 5EGNA 4LEIA 1ZMBA 3WQQA 3DOUA 3KLBA 1I1OA 3DD5A 1AX9A 5T6MA 3U4AA 1ZOLA 2AZ4A 1T8TA 3IP1A 1P7PA 5TSDA 2H2AA 4PYLA 4E2FA 4QXPA 2JG3A 1YR1A 5L95A 4TTPA 3H1TA 2QD4A 1SUWA 5HNKA 2AYZA 4CRWB 1W59A 3KUKA 1HFEL 2H1HA 4CMGA 3T4EA 1KPIA 5JCJA 5KYGA 4DQDA 4GL2A 1S8NA 2Q29A 3W05A 1RYNA 2R1TB 3KQUA 1LS1A 1FRNA 3E6AA 2DUMA 1Z6QA 4M0PA 1WSAA 4ISCA 4TX1A 5TQ0B 4F93B 5CA0A 3DXXA 3ZGOA 2AUMA 4Q3LA 4J94A 2BEJA 1THMA 1JE0A 1NF8A 3AY6A 4CLOA 3BHMA 5DTJA 1HLDA 1BFKA 3BAFA 3W7VA 5CNKA 4HN2A 2P3QA 2I7VA 2QLFA 1KS2A 2TMGA 4M0EA 4MUXA 3VXKA 1OH6A 3H84A 3CF0A 1KJ8A 3HN2A 4BFZA 3KEOA 2RI0A 2VPIA 3IIEA 3RJ9A 4YT8A 3HP4A 3L0DA 4JLWA 4JH0A 1EGQA 4PEVA 1QE0A 5SZHB 4AZ0A 5EJAA 4U0KA 3DE1X 3V8QA 5HJEA 3VR0A 5M7EA 1VYUA 2HSJA 4BGVA 5KYXB 3NDIA 8GPBA 1L7DA 3MWFA 3QJ5A 5CFLA 5I45A 4QBGB 3Q40A 2Q2VA 2OGZA 1TB4A 3CZPA 3GNSA 4R2JA 3JQPA 3ORQA 5CW2A 1PK9A 2NYUA 2F67A 2WTUA 2A1UB 4E2ZA 4LOJA 3A3KA 4EF6A 2PKYX 4A0RA 4DVGA 1EGVB 2OV1A 2H8KA 2PJRA 1ADJA 1Z4KA 5DXAA 1G0NA 1TJ3A 4GOXA 2NO9A 1FMCA 2OVFA 3V8MA 2ZZNA 1Z5GA 2AOUB 3ML1A 1UXHA 2YXLA 4JI2B 1GTRA 2UAGA 1SD1A 4ZVVA 2Y1GA 2NSJA 2RGNC 1E3EA 3CH7A 3GRFA 1PGQA 3HRIA 3ZCXA 1JFVA 5CCBA 1M5UA 3GPIA 5BPFA 2MSWA 4OL0A 2FN7A 4NMHA 1H9CA 3L0OA 1KYVA 4XARA 4QUBA 4H0FA 2IXTA 2JHAA 2C1XA 4ZDKA 4BEJA 1KMHA 5HCNA 4XLLA 5JAUA 1XRNA 2C04A 2VF4X 1ZMRA 4MUIA 1AS2A 1PWYE 3H99A 2ECOA 5F2NA 1WQ3A 4FLFA 5J47A 2ATIA 2JAOA 2Y2VA 4CQLB 5TMPA 1MOSA 1P3Y1 2AL7A 3AF1A 3UBMA 2HAEA 1T5TA 1JVSA 4MVJA 4NG4A 3BIJA 1I13A 4DA7A 4RPCA 2PZFA 4RXUA 1PGOA 5G0SA 4JJZA 5HR5A 2ORIA 5KKCA 1SBCA 5D5PA 1E0KA 3DEAA 3SGLA 4A36A 2OCAA 1FYFA 2EZTA 3LX5A 1JIUA 2MSDB 3B1VA 1UFRA 1QOQB 2IV2X 3UHOA 1M2NA 4FHCA 3ZYZA 1NVMB 2OVBA 4L4YA 2VJCA 4QODA 1J8YF 2WE7A 5FA5A 3BK2A 3R7LA 3R9WA 3WYDA 3EQ6A 2R1VB 4PR3A 3FOBA 3R6WA 1GZDA 1KJIA 3QHQA 3MMZA 4M1TA 3BXHA 5CXQA 3BXXA 3CC8A 4W5TA 1ONNA 4NCKA 3GJ4A 4EDFA 4GGMX 4FFSA 1WHTA 2XT6A 2VHQA 1E1QA 1PWZA 1H8ED 3B89A 3EXAA 2WKQA 2JGEA 2YUTA 5D87A 1W9HA 4FBLA 1CZHA 4ETWA 3Q7EA 3GJ3A 5J2TA 1OX4B 2LKCA 4QAQA 3E4CA 1OXKB 1XYYA 4JJ7A 1JMKC 2A9PA 4YP0A 3KPYA 2PSDA 5HE8A 1GTZA 1SQ5A 4UHEA 2XD9A 2RHWA 4RNDB 2EL9A 5JVDB 2PPLA 3H9EO 5C8ZA 3COZA 1GILA 3H2ZA 2GPBA 1CCWA 1MBZA 3MJRA 4LJAA 2Q3MA 3WYCA 4K6MA 4JLSA 4M8KA 5AQEA 5DCUA 5L3SB 2G08A 3TW8B 3ODGA 4FOPA 1TI7A 2B35A 1PZNA 2X0KA 1HSOA 2XQKA 1JUDA 1NUQA 1R9NA 1VIAA 4ZAYA 1I7PA 3PE6A 4MPDA 3LRTA 5JSZA 1XZNA 3BWBA 4L0CA 2QMUA 3CB4A 5ALJA 2FEWB 4HS4A 1KI2A 3SNHA 4Y18A 2IW1A 2WTNA 4BFSA 3FTFA 4H4DA 2ZU0C 2GYYA 4DM7A 3GY0A 2NZJA 3CZMA 2ACWA 2MSNA 4G5YA 2VXOA 1SUEA 2PYDA 2E6KA 3UBTA 2AZMA 4BNHA 1BNCA 3AY7A 4KSCA 1UIMA 1MFPA 2E1RA 1WDLA 4RVNA 2R79A 1VBKA 2GTPA 3ZTTA 5EJ5A 2VDLB 2CV1A 3F78A 1G64A 5CDFA 4C7OB 1XALA 3L8HA 5JSQA 3E3LA 1L7XA 1WVIA 3IE2A 3ITEA 4CKEB 4LF7B 2ONJA 1R4MA 2QM0A 2Z04A 1QHNA 1U8UA 2W11A 4CUKA 3TJMA 4MTLA 2I99A 1FB5A 4NCIA 3ZHXA 4Q4LA 5CP8A 2Q6VA 4Q0MA 3MCAA 3DBHB 4N49A 4B7AA 1I0IA 3PT5A 4OXQA 4J3FA 4N4AA 5KTPA 1U8AA 2C8JA 3QVXA 1NE2A 9GPBA 1JU9A 4G01B 1CNFA 1N3IA 3BSSA 5AIAA 4R2IA 4WNIA 2UU9B 5DHPA 4DARA 3LY9A 5ALTA 1NIPA 3UY4A 1P1FA 2GCOA 4UUAA 4F04A 5AVTA 4H9GA 2NUBA 3E82A 2PWPA 4BJ3A 2Q1YA 3REGA 3H3JA 2O0HA 3GA7A 3G5AA 4NRDA 2UUAB 1SQFA 3D1VA 1UDRA 3LLSA 3VNBA 3L1UA 3GEEA 3EEFA 4IG4A 4CCSA 1RU3A 1RLIA 3ZI7A 1SHTX 3P9ZA 1SRRA 5K09A 1PNRA 3NP7A 1Y5LA 3MWEB 1KU0A 4Z7JA 1Q84A 4AFNA 4EB6A 1WP9A 3LD9A 3PB3A 2JEOA 2OR3A 3V2IA 2P1ZA 2ATCA 2D3TA 2PKCA 2WA2A 2ZSIA 1UC9A 3IXQA 1JTVA 1MRNA 1QIIA 4HYYA 4O2AB 4XPIA 4UTRA 3O6VA 1FX0B 2B21A 2IYVA 1ZM7A 2OZVA 4OHZA 2GF2A 4CG3A 4FDVA 3JY6A 1NVEA 1WW8A 2RGCA 3EWIA 4OGLA 4D9GA 2NU6B 2QLJA 4ZPXA 1EVLA 3TJRA 1KMCA 1N3LA 1Z45A 2C00A 3HVJA 3QUCA 4IXDA 1JIQA 1ODKA 3Q5EA 4IWXA 1XXLA 3ANSA 1BWQA 2F2TA 3KV1A 4PSVA 2O1XA 5TT0A 3H5VA 1AO0A 4ESHA 3OM9A 1KY5A 3HU3A 5ESWA 2B1JA 1FMTA 3R24A 4ZVMA 4A16A 4KHPB 2QVBA 3NTUA 4GBED 2BYTA 1PUJA 4HNSA 3N0XA 3W5BA 3PS9A 1V6AA 4ZU6X 3VU9B 3S2IA 3TSCA 1DIGA 2R68A 3H6KA 4TV9F 1J23A 1HETA 3RTCA 4DR5B 1VMAA 3NGMA 1P0CA 2O3JA 3TI7A 5KTNA 3P9PA 4IJQA 1Z4IA 3ABRB 4EKEA 1BJRE 4X20A 3NALA 5HIMA 3PR3A 2B5VA 5HYVA 3PEYA 2MSEB 4MP6A 4PQYA 2P4UA 1EGHA 1KH3A 5CT9A 4PQGA 3U7IA 2IXFA 4U7TB 3MTIA 2JGRA 4F96A 2KW5A 4E5UA 2P4EA 2GSWA 5I4CA 1PS9A 2GYVA 3VYWA 4LDJA 2ZB3A 4JR1A 4U2DA 2WNHA 4EY3A 4AZ3A 3SHWA 3ERCA 2O48X 4HFJA 1ZRMA 3T7EA 1X74A 1H22A 2PH7A 4P0TA 4XAQA 3MPOA 3DMTA 3UMRA 2XKJE 3N74A 5H59A 5DWVA 5DSZA 1R0LA 2A0XA 5FFFA 1GTG1 4EZBA 1AKQA 5KKAA 5CLGA 3ESQA 1KR5A 2H16A 1X7WB 4QG3A 1YS2X 2J07A 4HWSA 3ESAA 3V2UA 4AMVA 4OP3A 4XX1A 3WTCA 3IR5A 4REOA 3RYHA 1J6UA 1YZHA 2XPCA 2AI1A 1K6EA 2F3RA 1XZBA 2EP7A 5KYWA 4HNAA 3KUUA 5ETJA 1TUGA 3B5EA 3SS8A 3F73A 1UBFA 3VTZA 4F72A 2D0OB 2PUCA 5AHXA 4YT5A 1GVNB 3LUDA 3B3AA 4OBBA 1I7DA 1A9YA 1JKFA 3HL4A 4KK3A 3SF8B 3LL4A 4Z0TA 1JB1A 4LXTA 5EP1A 2YUIA 2IBSA 4V3CA 3CNHA 2G36A 2OXCA 1QHHA 3SZMA 4HGRA 3GRUA 4BFTA 1ISPA 2PS0A 3RAPR 1UPFA 4BC0A 4P0PB 3PHGA 3PV0A 4FN4A 4ZV7A 3BQMB 3PF9A 5EE9A 4ZC1A 1WUYA 2AJDA 2ET6A 1QBKC 2YINC 2PYZA 2ZBRA 4WY5A 3ZGLA 1OPRA 3AR2A 5C1OA 1D2GA 3R6LA 3K96A 3FCXA 1VIYA 1OBCA 3O8OA 3A6HA 3GQVA 5BV2P 4QYWA 2DQSA 3GIDA 1CVIA 1KDTA 2OTCA 3HYSA 3KYCB 4PC7A 3TAHA 1AV6A 3AW9A 4NDNE 2OG2A 3BL8A 1GPNA 1N5OX 1TT5A 2IY8A 2YV5A 3FMIA 3UH0A 1A77A 3CPSA 3O2QB 4FCCA 4Q1DA 4RF4A 1ZUHA 2H5LA 1I32A 2J3MA 1A5BB 1FNDA 2ORWA 1LNZA 3CUVA 3H8WA 4QM7A 3T5CA 4JLOA 2ZIXB 5F9FA 1UM8A 1ZG3A 3I2FA 1FYVA 3QBTA 1RAGA 3R6TA 4YACA 3PNLA 1PT5A 3A1DA 5DULA 3L8ZA 2HCRA 3Q11A 1XQXA 1NLZA 1YQTA 2C54A 2FFHA 4AUNA 1P9OA 5KKNB 1J2JA 3T7IA 2RHBA 3AJAA 3D8HA 3HDQA 1EQUA 3I8XA 4PC2A 4JB0A 1OPXA 1T3TA 1Z15A 2DWQA 3KTFA 5IPFA 2OORC 3OJXA 1PJ4A 1F0PA 1JHAA 1U7HA 3SQNA 3KOYA 2QZSA 3NUZA 1DELA 1I8TA 1TTHA 1NN1A 1R8SA 4TWJA 2P5SA 3W0LB 1E6MA 1OB5A 4BX2A 5HRAA 5K6AC 2JLBA 2RC6A 2C8KA 4H27A 4UNSA 1B0ZA 1T6ZA 4Y6RA 1XXHE 4M83A 5HFJA 3DB2A 4ZQEA 1TVCA 1BMFD 1N5DA 3O4HA 3PI6A 2IHUA 2QY9A 1VLMA 1AMNA 4C0KA 4URFA 2UZ4A 2HLDD 2NUPA 1QAQA 4F7WA 5JZVA 3CXUA 1UMBB 1P31A 2O8BB 3LYAA 3PRKE 1CE8A 4LGYA 1Q1BA 1CR1A 2E89A 2X1HA 4NKRA 3JD1A 1J2YA 4JLNA 2VP9A 1RXWA 1XI2A 2Q4DA 3LGXA 3WLIA 5CB6A 3SXPA 3UOGA 1WZCA 1UK9A 2HN9A 4PM4A 1XE3A 3M83A 1VHWA 3S1AB 5FNVA 1ZD9A 2OFFA 3VKVA 2IHBA 2VQFB 3CRQA 4TPKA 3TKLA 3C85A 4V0SA 2KWIA 1NT2A 4IEFB 4YUVA 3ZXUB 4WCVA 5F9HA 3Q8LA 2L82A 1C80A 1C7FA 1NJ8A 4JLAA 5LQRA 2O0JA 1E3WA 1V47A 5B30A 5IJ0A 3RIXA 1U98A 3HKBA 1T5BA 4ATNA 2WMNB 5AUQA 4DANA 1KDZA 2FSIA 1Q7TA 4HEA1 5GTDA 2VBGA 4B4OA 2GJSA 2WWRA 5DCWA 1M7BA 1OYOA 3HWX1 3QQPA 4AI6A 4NL4H 5ALGA 2AKEA 1DL5A 3CA8A 2OO5A 4RK0A 4MYSA 1USVA 5D3MA 1USIA 3I1IA 3M0EA 4MRRA 4LSZA 3A9UA 1DCKA 1XZHA 3R40A 4LOIA 1Z38A 4A0QA 4UM9D 2WC1A 4WBSA 1PKXA 1WCIA 4MI3A 3U4GA 1H9AA 4V0NA 4P84A 2XLBA 3MELA 2QX9A 2NU7A 4RLHA 1OHHA 2OCXA 4P32A 5GZ6A 5LA6B 5I7RA 5KJFA 3IOYA 4I14A 5IJXA 1SZCA 4EITA 1JZQA 2R44A 4KMRA 1LA2A 1RBQA 2R8RA 1X8JA 2V6MA 3EGXB 2EFEB 4ZT6A 1V37A 3AM4A 1EVYA 4H15A 4M4SA 3I12A 4IDEA 3SYNA 2XZTA 4OHOA 2FZVA 2DHCA 1JNXX 5CURA 1JIVA 1ZN9A 1XD2B 4XCQA 5CT4A 4V0KA 1HORA 2QGNA 1F8YA 5A05A 2WD8A 3RS7A 5C7OO 3EEOA 1T8SA 3UWKA 1T13A 1CUZA 5PGMA 1AUPA 3NV7A 2VWHA 5FAKA 1QUEA 4HSGA 1XRJA 1QDEA 2AKYA 3FLAA 2FK7A 3LL7A 4P81A 3H8SA 4X8HA 1DWPA 5IEJA 2GF9A 2GRJA 3PL5A 2R6DA 4Q1AA 4AQDA 5AIBA 4LE2A 1JYEA 4QHTA 3K92A 4JBNA 1TAGA 5ERXA 1Q0UA 4JODA 3EXIA 3WRWA 2FDXA 1OAOC 1KH1A 4K9DA 4YRCA 4CODB 2VXBA 5HF5A 3UWPA 3C45A 2WWIA 4FE7A 3A9WA 1G21B 1P1RA 1REQA 1VLZA 3QVVA 5EN4A 2ODEA 3STTA 1W25A 3GL9A 5ADVA 3PDIB 1SCUB 3PXBA 1SVIA 1V8PA 3D2CA 1NX6A 1IJKA 2VT3A 3JYHA 3K9HA 3SJUA 1NU8A 3VPHA 3WDMA 1YUBA 4HF7A 3AKDA 4M86A 3G9XA 5FF9A 3ZLBA 4JL8A 4FCWA 2LP4Y 3W6UA 4WPGA 1JQKA 5C1PA 1FYDA 2BFFA 2W37A 1D1SA 1QF9A 4BRUA 3S2GA 1YCHA 3N7UA 4IDCA 3HWRA 1L5SA 4PFSA 1DQSA 1HZJA 5AOCA 4A5SA 2SKDA 4ZRMA 1ZVVA 3BJZA 5H80A 5A4DA 4MAMA 4L7QA 3LT0A 2KLHA 1SXGA 4V0QA 1XTBA 4FX2A 4IJ6A 1NDQA 4MNTA 4N76A 1YB4A 2PANA 2IWRA 2QM7A 2X19A 4HXEB 3DZCA 5ENZA 3Q3IA 4MW0A 2QTLA 4QQRA 4DLZA 1QG0A 1NTRA 3R2JA 4RDCA 3RHFA 1K2VN 3TPFA 3W7AA 3DD1A 1T4GA 2PL9A 1NAIA 1S2GA 2CFRA 2PCJA 4X8OA 3UJDA 1WMEA 2GJAA 3K15A 5BR4A 4MB0A 4NDZA 2QV0A 1O5TA 1YL5A 3GARA 2DM6A 1KBZA 6GPBA 3U3XA 2OHHA 1AH2A 5KEIA 1X7YA 3CZCA 1BC5A 1IY1A 3O3MB 2FR8C 4MZXA 4BJ1A 4RD2A 3NC4A 2Z8ZA 1T0UA 4ZAXA 1BMFA 2J3LA 1Z8HA 3JS5A 5EJMA 3FZYA 1NZFA 1K7SN 3B6JA 2IU3A 3BTUA 4L50A 5C8VA 1MB4A 1VSUA 4YCAA 4RA9A 3E22B 3WYGA 1NM5A 2I76A 2BV3A 2KQUA 5KWVA 1K3UB 2FW6A 3ZZUA 5HKKD 1U8FO 3RH0A 4J1TA 3E81A 3BHIA 2DTEA 3N2IA 2GHTA 5DHTA 1U1FA 4YCMA 3AUKA 2FUCA 4U7PB 5KPDA 4EZIA 1UC4B 4FILA 4RH0A 1KOJA 3HY3A 2A58A 3BMOA 3LPLA 2A86A 3GA5A 3O75A 3ZW7A 3ZX5A 4RQAA 2E82A 5HE9A 1CFZA 3DEKA 1RAHA 3A8TA 4Q3NA 4Q12A 4F3RA 2VDNB 1Z0UA 3B1YA 4KLCA 3RS8A 4EENA 2EG5A 2FRXA 4JJ4A 3D5TA 5P8WA 4R3NA 4DRZA 4R40A 4KXWA 2P6OA 5CIWA 1UBOS 3LUPA 4COKA 5C34B 1HLFA 3OICA 1MDFA 1OY1A 4HQOA 3EASA 4O4LF 4O4JA 1B6TA 3KLOA 3N53A 1V5FA 3ISVA 2QGZA 1J9GA 4RUKA 3PTLA 3QNMA 4UM7A 1KI6B 1E6EA 4OMFG 2QYTA 2YBDA 1TAUA 1VA5A 3O82A 1L5RA 4QTYA 1OXUA 2EJWA 1GUYA 5TB5A 4BB5A 4EPXA 3GLTA 4UAJA 3LPCA 1EIZA 2R87A 3AUTA 4YJFB 4AP5A 3B6MA 1TEHA 4UTZA 1GGKA 3MCUA 2DFVA 4GDMA 4WD3A 2FW8A 2QOEA 2CDRA 1I2BA 2E5LB 4E5SA 1UFQA 5DTRA 1R4NA 1X0XA 1RJGA 2DEUA 3AYXB 1YONA 1WCYA 3GW8A 3TIVA 2PMCA 4EG5A 5AW6A 5HM6A 1NWHA 5AHRA 2YRWA 5BMOA 5HA5A 5HZHA 1PNVA 3SSMA 3OO0A 2X2PA 4GOLD 1EVIA 3AVTA 5KVVA 4P92A 1SIOA 2OHXA 3HB0A 3P94A 4R1QA 3GCWA 5AM0A 1AUVA 5B2ZA 5A3SA 1FNNA 3NXKA 4Z1MA 4RWEA 1C3EA 1HFWA 2GASA 3V2GA 3OZVA 1TLLA 1SVOA 4IXTA 1A9SA 1PL6A 4P7FA 4IIHA 3TL2A 4TYQA 3DHWC 1FRVA 1IXKA 4HT3B 4C7KA 1KOGA 4S1PA 3WA6A 3OEHD 1NP6A 1TGYA 4D2IA 4MR7B 3AI2A 2FPPB 3F3SA 4NPAA 2VHTA 1NVXQ 4IEEA 3P9QA 2P27A 4EA6A 3RUPA 1AG9A 2EERA 3AGQA 2I03A 2WE8A 3PUIA 2O59A 1ID8A 3IALA 4U7FA 2QRLA 2ZXFA 3VDMA 4IDAA 2CY0A 3MNFA 2UUOA 2NYAA 5ADWA 3T3NA 2HF9A 1NUHA 3DLPX 5C5EA 4LF4B 5DTMA 1ZZGA 1Y4SA 2JDID 1ICEA 1WXHA 1Z0AA 2CLSA 1NR7A 2WNIA 3FUWA 1G20A 1QHYA 2O3UA 1GD1O 4ZHSA 5DYWA 3CH5A 3T5BA 1KYIA 4NJMB 5IBQA 3HNRA 4B6GA 3KSAC 3UPUA 1P80A 3CSUA 1LVUA 3GEHA 4BUJA 1NMEA 4W63A 3H4TA 2F8MA 2WU4A 4NTZA 2WU8A 1XBTA 4CN8A 4WK0B 3NRJA 1HDYA 2OEPA 2CMKA 3OQ1A 1I4OA 4U6QA 3JQFA 4X6XA 4N8DA 3DDOA 4QOSA 1W88A 1J90A 2ZT8A 1T0HB 1U0JA 2LGJA 3DAOA 4K40A 1RHJA 2LTAA 4JU9A 1SUPA 1DGQA 2GBPA 1KEVA 3DHEA 1VRVA 3AUYA 3P97A 1O1YA 5AM5A 3ZHCA 1OASA 4AKSA 1U4SA 4PINA 3DFUA 4PYMA 1Z37A 1LGYA 1S89A 3PXGA 2ZVPX 5HFAA 2X4GA 3GFGA 4PVCA 5A5EA 4G09A 4IZOA 1JYSA 1RIIA 2P2LA 3SLGA 1EMDA 2G9UA 5ALRA 3S55A 3AGPA 1Q0RA 1LDYA 2XHEA 3DXFA 2QQEA 2ZVJA 4BKUA 5C7IO 4QPNA 4IIGA 5IH3A 1TCCA 2IS2A 1MGPA 3BIOA 3GRPA 4QQFA 2ZJ3A 2EHJA 4DL9A 5KQSA 2NPOA 1P3JA 1JBQA 3DEFA 4R0VA 1NJ6A 4OHUA 3KL2A 5A6SB 4HXYA 1A8HA 5HOEA 1DTWB 3DMDA 4X7PA 3TWOA 2ONZA 3FCAA 4QUIA 1U0BB 3SF0A 2NVUB 3E5HA 2C4WA 4Y2QA 1EWKA 3BT7A 4LCEA 1O89A 4RJTA 1O4WA 3OWOA 3G6KA 3HDTA 5KAMA 1WZEA 1YS7A 3FB4A 4U9HS 4X1YB 3KOXA 1VDMA 4ZV4A 5C8YB 3M6UA 5I8PA 2A57A 5LQDA 3U5ZB 2XMBA 2HSDA 2O2XA 3K0AB 1I7NA 3SYMA 1ATZA 5BN5A 2I33A 4LDRA 4OHCA 4G2NA 3S1LA 3TZ6A 3PHCA 3OY7A 4ER0A 4D9BA 4F2PA 3JAKA 3EGCA 1N78A 4JZKA 4RQBA 4UJ5A 3OJCA 3ZU2A 4XJXA 3NDBB 4GLJA 1GG8A 2J3QA 2RAFA 5ALLA 1X13A 2CXNA 1KP2A 1JTFA 4E5KA 4U6SA 1QX3A 4CM9D 5DHQA 2B2NA 3NANA 1U8YA 3SQMA 1WMBA 4D9NA 3KE9A 3L1VA 2HQBA 2XB4A 2PBRA 1KJ9A 2OECA 1ABBA 1P0IA 4IS3A 1DZIA 4I19A 2E85A 1JS1X 3W5VA 3J7TA 3RUEA 4MS4B 1U7UA 4RTLA 1MB2A 2E3JA 1N5MA 2VXYA 4ETIA 5IAOA 1V8OA 2Z9DA 2XY4A 2R5FA 3Q3EA 4KBFA 5KTRA 2PX2A 4RBNA 3FE2A 1AS3A 3UAWA 4TTQA 3RSOA 3H2KA 2XODA 5B58C 1JAHA 3G0BA 4DFDA 1APBA 1DI0A 1GAQA 3GT4A 3KJQA 4YA6A 5AJHA 4RTMA 3FOFC 4EO9A 1QDLB 2IPMA 3UICA 1IOZA 1KH2A 4RABA 2R1TA 3UV7A 1IK6A 1RQXA 3EOZA 4Q5IA 1PGJA 4UOEA 5BNWA 2R97A 1AUXA 2P3OA 1SH7A 1X15A 3E27A 2C5BA 3VJRA 3N2NA 1DO2A 1PV4A 3OEHA 4W5RA 1ECJA 3MS7A 3JPYA 6Q21A 1KBOA 2FPWA 4INPA 3JARA 4F3TA 2OHJA 3BYZA 4HDKB 4YCJA 1I9GA 3ETDA 2RGBA 2QZPA 3GDWA 3HYRA 1PDWA 2A0UA 4L78A 3OM0A 1LJLA 1N25A 5HIIA 3SEFA 1FSPA 1MV5A 2BFDB 3EXFB 3LQRA 3EWNA 4WWHA 3ETJA 2JDIA 2YOGA 2VRCD 2HF7A 2V3WA 3OZ7A 4NBNA 3FAKA 2FWRA 4NYMQ 2EBFX 1ODFA 2Z1MA 4D9CA 3O94A 3UJCA 3OPXA 1ECLA 4DR2B 1U9ZA 1BH2A 1JHYA 4B48A 4CMCA 5JYEA 1EP3B 3GJ7A 4ZYLA 3GJ0A 1IXZA 3IA7A 1G41A 2A1UA 4IW3B 1XNRB 4BPBA 1P7CA 2HDOA 2FAXA 1EU1A 1U3VA 3WQSB 5DNUA 3BB4A 1NRJB 1X38A 1CF4A 1I3NA 2ROQA 4D98A 2CVZA 3UK0A 1WW2A 3LECA 4OG2A 4CKBB 1XEFA 2N75A 4DDTA 1JFRA 3SOPA 1CR4A 3NP9A 3STYA 3N0VA 3TTXA 1WETA 2D06A 2ECQA 3U81A 2UZ1B 4FFVA 3MGGA 2J5XA 4UEJA 2JAPA 3ZDQA 3C74A 3RYCA 4RNCA 3A10A 2F55A 5CH8A 4MR8B 2I3ZA 2XNSA 4IIBA 3TCNA 1Q1GA 2WDPA 4Y0NA 4JVMA 2CCJA 2H2IA 1Z2AA 4L07A 4WJKB 1H2EA 3EAFA 2PU5A 1CUJA 4WOBA 2FPLA 2FLVA 3EZGA 3QLTA 4UCXA 4BLRA 3GLFE 1E64A 4RPJA 1Z75A 3R6GA 1YVRA 4EFDA 2YZ7A 3S5UA 1QC5B 5JMWA 2X0RA 4MVJP 3QPDA 3VTKA 3ZCVA 4E2XA 3EXEA 2N47A 1FS5A 3W5AA 3MCWA 1OXBB 5F4BA 2HJVA 3JD2A 4BB0A 1U0NA 3LAWA 4TYWA 4HJXA 3CG0A 4RLSA 2IYNA 5E6UB 4N7MA 1VI5A 2ZBGA 1PJQA 1EFCA 3ZK9A 1ZESA 3OIUA 4WK2B 3N8KA 5FWYB 1UBTS 1M0EA 1L7EA 1HPLA 3B1JA 1A9RA 4WRRA 3U44B 4B6FA 4D74A 5CEEA 2IP2A 4D3YA 2F6RA 1DPGA 1HQKA 3M2TA 3WKCA 2H5IA 3FG9A 1V9CA 5C35A 2ZJZA 4RF5A 3R8FA 4HB3A 3QOYA 4S12A 4TMYA 5EPOA 4U2BA 2Q2QA 3K9FC 1N6RA 2YDXA 3V42A 1QU3A 4Q7LA 5AW4A 3A37A 4V0MA 1TGVA 4UTVA 1JXOA 1Q6ZA 1ZBDA 4Q93A 2DG2A 4OQDA 4RK7A 1J5EB 1JHPA 3PNQA 1K6JA 3T8YA 3WWOA 1PYGA 2C9OA 4UXIA 1RMYA 4I5FA 1OX4A 4J0DA 2C4NA 3UFXA 3OFKA 3QTLA 3SVTA 2ICAA 4TT3D 3G59A 4YUAA 5KNBD 1CRWG 2VT2A 2HKIA 3PXUA 2BMFA 4CM9A 4DXHA 5BPHA 5IJWA 1KEPA 4AF7A 5E7JA 2G9NA 3L18A 5AVXA 2FFQA 3U1TA 1QHEA 1QH8A 2OB1A 5JVDA 1SG0A 5MHTA 1E6WA 2I4TA 1FRZA 4LWPA 4NCXA 3UENA 4EM6A 5FUVA 3RUIA 4ZYXA 3W2EA 1W36C 1QQAA 4HK4A 3RT1A 3HCDA 5J1TB 4BRZA 1GADO 3TI9A 4EYQA 5L3SA 1R6BX 3LY5A 1P1CA 7REQB 4JLKA 4KZKA 2YQ4A 1BYIA 5LKRA 3NXSA 4TVSA 3A6PC 4BFLA 2H63A 3I2YX 4U5XA 1E4YA 1VRWA 2JFVA 2WUDA 1R0WA 4LYDA 4M9SA 5DE3A 3RVNA 3CUTA 3UCEA 4B7UA 4JA2A 8ATCA 2XMDA 2JGDB 4MULA 2Y0CA 2YMQA 1Y1KE 4FFBB 3RSZA 1DEKA 4WUVA 1KOFA 3W8FA 4EY7A 3S44A 2QVXX 4INAA 4NH0A 5FR2A 4F5ZA 3AVOA 1KDOA 1CV2A 5EWLB 2WVJA 3DZIA 1QIEA 4ZYWA 1EG7A 5CFQA 1BVRA 1KEKA 2JEYA 4F9FA 1UAYA 2B9VA 3GGDA 1LI5A 4CKEA 4N5MA 3BE8A 1V11A 4F92B 3Q2IA 4LY0A 4C6SA 1EFVB 1WAMA 2JASA 4JLMA 1VKRA 5FLEX 3KEGA 4JUDX 5JYBA 3KAPA 5GZ3A 4XB1A 1P44A 3BILA 1EK1A 4UVIA 3ZIAD 1WWKA 1JHZA 4D45A 3DBHA 4GC9A 5JLJA 5TQ2A 2LCIA 1L1RA 2HDWA 1G63A 2ZRBA 3CVWA 3EPHA 3H04A 3L4EA 4Y2XA 1SCQA 1GZ7A 2BMAA 4K0RA 3LBNA 2C2YA 1UZLA 3N2GB 1L0BA 1M6HA 3N9IA 5E7QA 1EG2A 2XMZA 1JR3D 4FYHA 3WZMA 5L6LB 3EZFA 1N9KA 4LRQA 1R9JA 3GF4A 4EUNA 4BAGA 5JR3A 1FDVA 1CW2B 4D82A 4MRVA 4CGYA 1I2MA 4MWGA 4YJ3B 4AX8A 2H4YA 3W5DA 2DT5A 2B36A 4BBZA 1C0LA 2H2FA 2IEBA 2RMKA 4YT4A 3I5YA 5HSGA 2M32A 3L4BC 3OMXA 5AOAA 4U5QA 2R48A 1E1NA 3A9SA 3L93A 3CX7A 4MGEA 4PYOA 2R00A 5AKLA 1HTTA 1VC2A 1OV6A 2CL5A 2XMSA 221PA 3CJRA 1MXHA 4O2AA 3FCYA 4ZVNA 1FX0A 1UFOA 3O5AA 1ZSVA 2GVNA 3BGVA 3BPSA 3KD2A 3NWPA 4X3CA 1G8AA 5A5FA 1AU9A 1TMOA 2CEKA 2NU6A 2R3SA 2R5WA 3HDYA 3ONDA 1H1LA 1N2HA 3URMA 5JC8A 2BFAA 4J4BA 3LNTA 1R6UA 3CWQA 5KPJA 1FYEA 3AB7A 4Q4AB 2W4IA 3H17A 1MAHA 1ZXBA 3JWGA 3EFOB 3MN1A 4QZVA 1IPEA 1RPZA 2PS1A 1X70A 4XX0B 2DAPA 3ZS9A 4I5DA 5KVAA 2XQJA 2LPMA 3W5HA 4F9EA 3FFTA 4N3CA 3SEZA 1N2GA 1P29A 5DI3B 4QDOA 4WN9B 5FUYA 5K7SA 1RW4A 2WJYA 2HO4A 3HEBA 4UXHA 3VU9A 3WGVA 3MSXA 3NBKA 4XCXA 1L5NA 4N0EA 4TTTS 3ONFA 1GUBA 2B1GA 3U40A 1TCVA 9LDTA 2Z6AA 1TKCA 1YFJA 4JKYA 1YDFA 2VR1A 4IZHA 4XLTA 5EZSA 5DT2A 1Y5MA 5PNTA 4M1YA 2X8WA 2VUUA 1EBFA 3GD7A 3ZZMA 1KQ3A 1XTPA 3ZE8A 4BJHB 1ML4A 3UH1A 4A0SA 1VCOA 3H2BA 4BNYA 4ME6A 3ROFA 3AXSA 3UGJA 4TSRA 3DBRB 2QVGA 1IJBA 2FI1A 2FF5A 3IDAA 4K2AA 1QTRA 2PHZA 1K3TA 3O0DA 3ORRA 1HQCA 4C07A 4TT3A 4CTMA 2ZU6A 5LL6P 4H35A 5KNBA 2C57A 2AC2A 3AU8A 4RVDA 4B3XA 5EKTA 4G0UA 2XB2A 2FWBA 3B20A 4ZARA 1UJ4A 4JKOA 2HK8A 3EZ2A 5IYZF 3V4RA 4F5YA 3TLXA 4DIOA 3VR5D 1W4ZA 1X7WA 1F2DA 3K6JA 2H2GA 4Y6SA 3GG9A 4NATA 4W5HA 4QLBA 1DRWA 4ESOA 5FBKA 4CXMA 2M1ZA 3OU2A 3E8SA 4G8DA 4Q9HA 3UGTA 5B6PA 2YHBA 2BAGA 3RAFC 1NXQA 4P58A 2D2EA 2DUJA 4Y6GB 2CUNA 3TH5A 3IERA 5K0LA 1XN4A 4D3DA 2DLDA 4FR0A 2QD2A 2BZ1A 4QTUB 2FHPA 4CL3A 4N5NA 4ZOLF 3R5JA 4TLDA 5T7BA 5KC8A 3DL0A 2P40A 1IQPA 2WD9A 1GGMA 2BCEA 4XQ0A 1A76A 3WGNA 4BAZA 3MXTA 3OPYB 3FHTA 4OHPA 1IBKB 3LVRE 3ZHQA 5FOWA 1T6NA 2VHUA 3FPBA 4LK2A 2WB2A 4GUDA 3E15A 1TXGA 4M7RA 4B44A 2CYAA 5L8VA 4ZI7B 1ZUNB 1JH9A 2BVNA 2GBLA 2GCIA 1I3CA 4P31A 4CHTA 3D4PA 1EP2B 2XVMA 3VH2A 4AYTA 2W58A 5JATA 1T4CB 1GCOA 1MT0A 1W52X 1BN7A 3KYCA 3ICCA 1L5GB 5LP6F 1FL9A 2WZDA 2UXCB 1W47A 1U8EA 3ZIAA 1SPXA 1QGUA 3II6X 3E2PA 2O0KA 4A2QA 4LVOA 1X1SA 2AN1A 5ILQA 1HRKA 5IVKA 1N1GA 4FEGA 2XCUA 2X5OA 1I14A 2GPSA 3IBSA 1U9CA 1VBFA 1YBAA 3WR5A 2AFRA 3JZAA 2B4RO 5EMNA 4EZEA 3QEJA 1JR3A 4R4JA 5LUAA 2GCNA 3OIDA 4PONA 5K3BA 1JR4A 5EJ6A 4J91A 1E4OA 5LFAA 2XA9A 4NONA 1ENPA 1NHWA 3O3OB 1N5LA 4LC9A 1H3FA 4XGQA 1ZC4A 3LPAA 4QECA 3NAGA 3Q3GE 1OCEA 4MQUA 3ZWQA 4DUZB 1DUIA 2HQ1A 3EF3A 5REQB 4FGLA 3VJMA 3EUWA 1SBHA 3RVDA 5DM60 3BTVA 3TQTA 1M2OB 1CKEA 2QRVB 3S2ZA 4NWIA 1P77A 4CMKA 3TOVA 2OZKA 1N8TA 4NBKA 1DUSA 1W0CA 2J5QA 5CXXA 4X84A 3MRTA 5LOVA 1UMBA 3IP3A 3SS9X 3OOSA 2O6LA 1XDWA 4UAUA 3CSSA 4KIUA 3OE1A 4E2YA 1EKXA 5B6JA 4KRFA 2X7HA 5K3EA 3LOPA 1O8CA 1U1DA 3VYTB 5JROA 2QX7A 4KB5A 3HDJA 5FLXA 3RS3A 4Y9DA 1S4MA 1T5OA 4JLPA 1SUAA 2SNIE 4DLSA 3STWA 2JGNA 2IEZA 3ENWA 3S1AA 2XHZA 2F48A 4WGGA 2Z6VA 2QLBA 1JIXA 4PGMA 5AFSA 4C08A 4H59A 5FR1A 2XUIA 4WLUA 2A2ZA 3RYTC 5LQCA 4P7GA 3DO5A 4K28A 2FSUA 1L5VA 4TVKA 5IJZA 1DKUA 1G291 1O58A 1UEIA 1WR8A 1UQRA 4P22A 4B3MB 1VBMA 5IJ9A 3CRRA 1XL1A 3DOJA 5AK6A 4D42A 1U2RA 2AXPA 3GUCA 4MV8A 4EP1A 4YXWD 2APJA 2MHCA 4MYHA 3H5TA 2VTVA 2VJMA 3AR8A 1QIFA 4NU5A 4LXQA 4HYEA 3LZCA 3DEZA 4ACAA 1OLSB 1VFNA 5EP4A 3HR4A 3G49A 4N82A 1VCHA 1V9SA 1TFUA 1B2RA 1N75A 2YWEA 1ONOA 1OZGA 4W8HA 3LGAA 1IK4A 3SQLA 2PR2A 1TZBA 1Y80A 3BJEA 4X95A 4ZTZB 1Q0ZA 3QVUA 2DKNA 3O1LA 1TOAA 1SZPA 2VC2B 4G0PA 2VXCA 4HADA 3PFNA 3UWDA 4GZ6A 3VR5A 4E03A 5A06A 1JALA 2PFGA 3BXFA 2JLSA 1ONSA 4TLMB 5JS7A 1DKPA 4MARA 4WNCA 5CB4F 4R7TA 2GPJA 4GLOA 4IH9A 1YBHA 1TJ5A 2PGLA 3RS9A 1NNLA 4I8IA 4TS4A 1Y4UA 2PNFA 1WY5A 1AQLA 1JQ3A 4F5DA 2DUUA 4LV8B 4BQQA 2DY1A 2WUEA 3I9KA 4R9RA 2J32A 1I3LA 3EMBA 4AO6A 3UMBA 4OIFA 1E5LA 5CM2Z 3EDOA 4EKNB 3WMGA 1X86B 1V3TA 1N2JA 1G21A 1LKZA 1XTKA 1KVRA 2HMTA 3GFPA 4L1KA 4LN1A 4UVGA 4B75A 2I55A 3KVYA 2M6SA 4YV7A 5IM4F 4U9UA 4D3FA 1SHJA 2V8OA 3MQ2A 1ZD3A 1G4AE 3DZJA 1TCUA 1M74A 4MGYR 1I5OA 1IHUA 1JDJA 1GAWA 4DOMA 3WGJA 2VTDA 2ODAA 1AKTA 2ZREA 3ABZA 1Z9BA 4LJLA 4TL7A 5K6TA 4J7UA 4QVGA 1Q20A 3USCS 4PO9A 1JFTA 2CUKA 1CERA 4OXKA 4EUSA 1T2EA 4H6WA 3G0HA 2OD2A 4AJPA 2O8CB 4DYVA 1CWUA 3OZGA 2Y1CA 4G6ZA 2NV2B 5EJGA 4BP8A 1BTOA 2ZYWX 1TCBA 1LTQA 1GPWB 2Z5LA 4L6IA 2FPRA 5HMMA 4QWWA 2QMYA 4NC9A 1Y9EA 3IJ5A 1F9EA 4UTNA 4AJKA 2AMFA 4GDFA 2DB3A 3KB1A 1RHMA 5CIQA 5BYKA 1VPWA 1DJOA 2WBLC 2OZLB 3KVVA 2Q5IA 5TF0A 3BTOA 1EDEA 3K5WA 4O4HB 3TG8A 1D1PA 1RD4A 1JA1A 3PC2A 3CVXA 4JLJA 3V4LA 1H3EA 4XR4A 2MSCB 3DEHA 2XADA 3M8KA 2W98A 4KXLA 1O2DA 1NFQA 3L6BA 3ZDEA 1E9DA 5JXJA 1JEQB 1JDZA 5JW6A 1G5PA 4PNZA 1R10A 1XB2A 1DIHA 2VFAA 3KALA 3WWEA 1E8MA 3CF4G 3WGZA 2OCKA 2IP4A 2KS6A 2XAUA 3CX4A 2JLYA 3B51X 2CK3D 4C4AA 3O84A 3U26A 3FMGA 1I1NA 3PJFA 3QLUA 1E62A 1RWQA 4LISA 4Y9TA 1T0PA 1Q2UA 2HB6A 4HUJA 3C1OA 3ZNPA 1FS4A 3KXKA 1E2MA 3RVLA 3VX4A 1KYYA 4L7VA 2Z4TA 4LJYA 1EDZA 3H1BA 4RHFA 2AXNA 4FB4A 3RSLA 2XWBF 2G9RA 2P0AA 2O1SA 4K6FA 1AK9A 3FBWA 3N59A 1GPUA 4DXAA 1MCZA 1MC8A 1SN7A 1V95A 3DCIA 1VECA 1JWBB 3RQSA 1KC3A 3VKWA 1B74A 2BM1A 2D8AA 1P2BA 3OOEA 2CNLA 4GMFA 4JGIA 4LK3A 5EEGA 3U3MA 1G2PA 1MABA 4YRNA 4QVIA 1FZTA 1LB1B 3RVBA 5JD4A 4J1NA 2VF7A 3ZZ0A 4PBRA 1XZEA 3PRYA 4LQCA 1Q3KA 3TIIA 1IZ9A 1ID1A 2VN8A 2RIRA 3ZQJA 4GPD1 3TTTA 1R16A 4GR4A 3TFQA 1P1KA 2BBOA 1QZ3A 2X0NA 4UE2A 4JT2A 2QX6A 1NY5A 1N1MA 2ZRHA 1MO6A 2V6JA 4IX1A 3ZKAA 1YV9A 4YXWA 3ID6C 4H7EA 2IDKA 3CVOA 4ZCQA 5FV4A 1J24A 3HDHA 3L5KA 3PVCA 3UHJA 3DF9A 3R9IA 5COQA 3ONWA 1QAOA 2LDBA 3CLRD 3HGMA 4MYRA 5BUQA 1ZVMA 2H9IA 2IDJA 4IMIB 3QKRB 2WABA 4LYGA 4YJFA 1W44A 3NCHA 1K3FA 1GYRA 2XYHA 4R3UC 2C3YA 1XPJA 3BSWA 3F5QA 3RHTA 1PJLA 1SD2A 2IIVA 1MJ5A 1PSZA 3NC1C 4K7JA 1O97C 2X8JA 4PQEA 2BFEA 4N40A 4U39A 5HGJA 3A0UA 5BUSA 4ALIA 2V97A 2P9QA 1JLLB 1PT6A 3RK4A 4Q18A 4D9EA 5AI6A 5HF9A 1E2FA 2HIHA 3CS3A 3WJ7A 4EGFA 1DCMA 2CE7A 1T0JB 3KAJA 4GAEA 2FE4A 1G6HA 1GRQA 1JT9A 1ZWLA 3FSEA 2DR2A 4FKMA 4WBNB 1U2SA 4DDHA 5EKSA 3GGSA 2JJ1D 1NBIA 1LW6E 4DNOA 5EKDA 4CMEC 3PLAE 1V3UA 2NLOA 4DLBA 4BN4A 4NYMR 2OCPA 3H86A 1BU8A 1M5TA 2NZVG 3N8IA 2I1VB 4FR2A 1NIJA 2PCLA 3C1TA 4J0CA 3GZTB 4JJ6A 1C3LA 4JLUA 4S1VA 5G41A 4ZVRA 4E08A 1KEWA 4MCHA 2FPPA 1FDUA 2EWWA 1W0KA 3IODA 3P9KA 4F8JA 2FNAA 4XEUA 1A97A 2PLWA 4LVCA 1P5FA 1AMOA 2IJGX 4MI9A 1FLAA 3S3TA 1GT91 1N7JA 4PZZA 2ZJ0A 3O8BA 4OB7A 1PL7A 2ZBFA 4D25A 5T67A 1ZJJA 1D8AA 3F6BX 4B09A 1DC5A 2FJUA 4ZT2A 1QS0B 3ZI4A 5HKOA 5IKPA 5FWNA 4J4TA 4Z53A 1MXFA 4D8YA 4I0WB 4CL8A 4D9IA 1JZSA 1YVUA 2I78A 3DH0A 4DUPA 3TDKA 5KTMA 4EARA 4QYIA 3QNUA 2PGOA 4NJMA 3TZCA 1XMOB 3EVAA 1WZ2A 2YJGA 1O5OA 1CHDA 2QMOA 1FFBA 3IUPA 1KJWA 4R2LA 1D6SA 4N9WA 1STOA 4F7DA 3WG9A 1QONA 1ZU5A 3D0QA 3JQ7B 1JDSA 5KAPA 4D0GA 3ZI0A 3QA9A 1JLHA 1K9VF 5D7BA 3U5TA 2ZUUA 3FNIA 3Q41A 2PJZA 2XDYA 3BWDD 1KE1A 2GK7A 1AMUA 4KFSA 2J9FA 4L85A 2R96A 3WGMA 4B80A 1J5PA 2NW6A 4BCCA 1RRFA 1VE6A 3GNLA 1KYXA 1YQGA 2PRKA 3K1YA 3WLFA 5DGIA 2P7IA 2RFLA 4OFBA 2XWQA 2OSVA 3OLWA 1K6IA 5TNXA 4BMNA 1RXIA 3U39A 1D07A 2XNDD 2CK3A 3D7SA 1QANA 4CDGA 2OM6A 2VL7A 1DTSA 2D1SA 3VU8A 5IABA 3CVJA 2VTBB 2RC5A 3A6ZA 4KDCA 3QA3E 2GPAA 2J5RA 3DUWA 1CQIB 1SKYB 1NMYA 5FRDA 2G0TA 2B7LA 2OB2A 2JFPA 3OKAA 3HJCA 3K1TA 2MOKA 5B5SA 1MX9A 2QJOA 1EFPB 4B3SB 3IB6A 4MVJH 1DTWA 2E48A 4PHHA 4YIKA 5C81A 5CDFE 4R71A 3U80A 4KQEA 2NVUA 3DM9B 2WD7B 1CQZA 3FNRA 3HCEA 5TLSA 1M1UA 1NF3A 5C9ZA 3MWDB 1O77A 3MS4A 2P77A 2A5GA 3TGLA 2AOVA 1QVVA 3FLEA 5K8CA 4I1YA 3KTAB 2HIGA 1L4NA 4UHJA 3V34A 3ZCPA 1MTZA 5B57C 1EIWA 2IT1A 3K0AA 4BXOB 4G4JA 4LECA 3DWFA 2NGRA 1R5NA 1IQRA 2WUVA 3HACA 1D5WA 4L8GA 2WT8A 5HP4A 1D0IA 4JI5B 1KHHA 4CLRB 2VT6A 3BCUA 1WG8A 3L0YA 3DL4A 1SWWA 1DWOA 5I7OA 1RBMA 1HA3A 1JT2A 1BWSA 4LGMA 1NW9B 4JYAB 3HGQA 1UJ6A 1E1MA 2YJ5A 2HI0A 1N5KA 1CEXA 3SZRA 2QVYX 1XZFA 4DIUA 4B6JA 2OUIA 2ZRGA 3JXEA 4R16A 3UUFA 1LW7A 2J4CA 3L0SA 3MMNA 1LPAB 3JAWA 4X66B 5BV7A 5M29A 2PH3A 5I8WA 4Y2RA 5KX5A 1II9A 3OF3A 3F6YA 1EXDA 1GFSA 1NYTA 5KC9A 4PSUA 9MHTA 1ZN2A 3FYCA 3GVIA 3OF2A 4FHDA 5K1ZA 4BNDB 1BGVA 4HRXA 4POOA 1JXAA 2HJRA 1OFUX 3IPCA 1OI3A 2AJLI 4QPDA 2CJWA 4BYGA 3G9ZA 4X3OA 3IP6A 2CLFB 1TW2A 2KLBA 1W581 1LRJA 3MTBA 3RJTA 3SIWA 4D80A 1YOBA 2QYSA 4NV1A 3DQQA 4F9TA 3WGLA 2W42A 3OCZA 3NBQA 1MP0A 3C97A 3ZV7A 1LZKA 1J33A 2I5PO 2P2SA 4EPYA 5TARA 4CPDA 2C7VA 2NVBA 2QTCA 2ZUSA 4RANA 3A6FA 3D9QX 5HHTA 5JDIA 4H1TA 4KBYA 4DKJA 5EZYA 3D6AA 2W6MA 1BE0A 2OC4A 2BSQA 4D56A 4YDQA 2QR2A 5E4JA 4HDKA 3MEQA 4OGFA 2A0YA 3H83A 4XWGA 5I7HA 5A5DA 3Q88A 1N8NA 4HLUC 3INYA 3IQGX 2EKDA 3PHIA 4IMPA 5JD6A 2WWFA 2DLCX 4C0XA 3F0TA 3EZXA 4DLYA 5CLLA 4DLAA 1PX2A 1HYGA 2BFDA 3DJFA 1BJKA 3P9XA 4Y1EA 5TVGA 1O6BA 2TMDA 3CLSD 3JYPA 4KGZA 5E1OA 4F6RB 7GPBA 4KI7A 4BNZA 5ICFA 4WACA 3ZWDA 4F4IA 4NDAA 1WDTA 2PA0A 4HRAA 4FHZA 3MFYA 1XTJA 1RQRA 2BMJA 4RS3A 3R7WB 2EFCB 1PEAA 4Z54A 2V6GA 1A8QA 2VSFA 1M8GA 2X2OA 3ZN2A 3HA7A 5BRJA 1Y3HA 3NT5A 1Q74A 3ZE9A 1DBSA 1FDTA 1GG9A 4IIJA 2PWAA 4ENSA 3MJDA 4HNGA 4YMSA 3FYUA 4C2TA 2D1YA 2V59A 4YP1A 2D0DA 3HP1A 5FULA 3BREA 4MUHA 4Q48A 3ZU6A 1BDHA 4KUEA 4A8JA 1UOQA 4QLAA 1N5RA 3DFZA 2WVAA 5IDYA 4CKBA 3PC4A 5ICCA 2H7CA 2R47A 3B82A 1Y8RB 2J31A 2MYTA 3PCRB 1H6DA 3ZOZA 2PT7A 2PVCA 2YVQA 3BEDA 5SV2A 4B3FX 4ARUA 1T3LA 3W9BA 2IS1A 5IANA 2YIDA 4R9VA 4MR8A 3PGMA 4RKYA 2D8MA 3RRXA 1Y7PA 1I51A 2PGIA 1YQDA 3SM9A 3PJDA 4H08A 4XWTA 4BNTA 2GNOA 2XNDA 3ACCA 3SYLA 3WL8A 2R751 3I6ZA 3HO8A 3I1YA 3RWOA 1NL3A 1R2QA 1YASA 3CE9A 2YMMA 1Z25A 2H3HA 3UQYS 1M8KA 2CCGA 3BZBA 1J39A 2HH9A 2PWZA 5FYDA 1QC5A 3P2IA 2EEZA 4B1FA 4LV6A 1GA4A 4TSKA 1N6NA 3BE5A 3F8TA 5EJEA 4R5MA 2Z1DA 3M4YA 2ZYAA 3OZRA 2PGDA 3OZDA 4GPAA 1QZTA 2XBLA 4ALMA 2H7XA 1DFIA 3HXTA 4NFSA 1GPMA 2Z95A 5E6UA 1UDCA 4IJ5A 4N3AA 1K75A 2JI4A 4JN6B 2H4FA 5MGNA 4TUYB 1ZGGA 1LTHR 2HM7A 3NG1A 3AHEA 2XVXA 1T8PA 3C7DB 1QRRA 5DZSA 4NH4A 1G8MA 2AF4C 2QR3A 4H2DA 2KJQA 5ENDA 1ZHHA 4IIYA 5DTIA 4EMTA 1O0BA 3KR1A 1ZMXA 4H17A 4JJEA 4HG2A 3OIWA 2JA2A 2HRDA 1C30A 4G0MA 3L7LA 1NVTA 3QG1A 3KCNA 2OPHA 2UYYA 4HAWA 3CEAA 1J2UA 2JEZA 3HBMA 1WSWA 1ZNZA 3D2BA 4CV0A 2JFGA 5CA0F 1CU1A 1OUMA 5ER9A 4F8YA 4LDAA 4ICIA 2VYQA 2YVUA 4IHJA 4D41A 2XCSB 1IY8A 3I37X 1R0CA 3ET5A 4LOLA 5EC8A 1BFUA 4UDNA