2PJDA

Crystal structure of 16s rrna methyltransferase rsmc
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
334
structure length
334
Chain Sequence
AFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLSRQMGDNARFSLVATADDVADCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYSVDGLTVKTLPGVFSRDGLDVGSQLLLSTLTPHTKGKVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEGEVFASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFGFHEVIAQTGRFKVYRAIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase C
publication title Functional specialization of domains tandemly duplicated within 16S rRNA methyltransferase RsmC
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 334
sequence length 334
ec nomenclature ec 2.1.1.172: 16S rRNA (guanine(1207)-N(2))-methyltransferase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF08468 MTS_N Methyltransferase small domain N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pjdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2pjdA01
5FWAA 2AN5A 5DTQA 3KQMA 5DRYA 5GM2A 4EVIA 2B3TA 10MHA 5DM4A 1JSZA 3MAGA 4PYKA 4RYLA 3UJDA 4CKEA 3FPJA 5E2AA 5K03A 4FP9A 2IFTA 3A27A 3DULA 4E33A 1R8YA 3ELDA 3KPWA 5HEKA 3HCFA 1N7JA 3BUSA 3TMAA 1RJGA 3HVHA 4NECA 4RVFA 1NW7A 3O7WA 3A26A 3HCEA 3ID6C 3LBFA 3OCJA 3CJRA 3QOWA 4LG1A 1ZGAA 4QDJA 4ZTBA 1JTFA 4MHTA 4DF3A 2R6ZA 3QV2A 4ER6A 4PINA 3P71T 1SKMA 1G8AA 4Y30A 3EGVA 5FA5A 4YV2A 2G8NA 1HMYA 1TW2A 2N47A 2QRVB 2GS9A 4R8SA 3GRUA 3D2LA 5P8WA 3OZTA 5ERGB 3AY0A 4QQKA 2PX8A 3GRYA 4V0RA 3EGIA 2VS1A 3Q7EA 3TLJA 2AS0A 3SM3A 1Q0TA 5K09A 1IXKA 3M4XA 3VC1A 1FPQA 5EZSA 1SUIA 3PFHA 2JH9A 2IH5A 1NKVA 1RI1A 2PX4A 5U4XA 4V0QA 5CD1A 2C7RA 2B78A 4AZVA 1AV6A 3EEOA 3G89A 1XVAA 3OE5A 5GIPE 4CXMA 3LGAA 3MCZA 4C08A 1R74A 4PIPA 5DT2A 3DMFA 3G5TA 4YUYA 3NVKI 2EJTA 1KXZA 3HCBA 3JWJA 1AQJA 3R24A 4ATNA 2V7EA 2AOXA 3CJQA 1RJDA 3O4FA 3P97A 2EFJA 5LQNA 4RTSA 2AVNA 3UJ8A 4CTKA 4HGYA 5BW4A 4MTLA 3KPYA 5K0LA 3EVBA 3CC8A 2O06A 2AR0A 3JWGA 4K6MA 3SGLA 1XDUA 3TKAA 3PVCA 4M38A 1BC5A 2VDWA 4AZSA 5LQJA 1I1NA 3GGDA 3EGEA 2HWKA 2AOWA 5GWXA 4P7JA 3MGGA 5E8JA 1VPTA 1M6EX 4X61A 2G70A 2IPXA 4OQDA 4KIFA 2ZZNA 4RTRA 1NW8A 2JJQA 3GCZA 5IKMA 3FUTA 2BZGA 4PYQA 3TM4A 5EMJA 1QAMA 3CJTA 5K0JA 4HGZA 2I6GA 1VE3A 2YVLA 3NJRA 3EEYA 3JWHA 3TPZA 3ER9A 5BW5A 2FRXA 2ZSUA 1KPHA 2O05A 3BXOA 3KU1A 3BWYA 3B3FA 3THSA 1ORHA 4E30A 1KHHA 3OZRA 2AOVA 3T0IA 1G8SA 1XJ5A 3HP7A 5HIMA 1I9GA 3RIEA 4YV0A 3HA3A 4PYMA 3TKYA 1KYZA 1P91A 1SQGA 5HOQA 5BXYA 1NBIA 3KQTA 1XTPA 1VIDA 3G2PA 5DLYA 1EJ6A 2P1DA 2Z6QA 2NXCA 3UWPA 5EGSA 3IV6A 3P9CA 3K6RA 2ZLBA 2LD4A 1L3BA 2ZTHA 1JQEA 4ISCA 2CMHA 3G2QA 4G56A 4E2ZA 3T7SA 5K0BA 2P7IA 4FZVA 1MHTA 5E2BA 3TM5A 3C6MA 1KYWA 4IV0A 4QTUB 3FPGA 2FCAA 3PTAA 1SG9A 3EVZA 2IH4A 3LKDA 4FSDA 3BGDA 4AUKA 2NXEA 3ME5A 2DPMA 3B3GA 3P8ZA 4EMSA 2ZBRA 5JR3A 5EEHA 1JG3A 5ICGA 4E32A 5EIFA 2IBSA 4Y2HA 2WA2A 3E23A 4LECA 4PNEA 3UJ9A 2WK1A 2ERCA 2PXAA 2IDKA 4RX1A 5ICEA 2NP6A 3I53A 3M6XA 1JR4A 3LHDA 4C03A 4YV1A 4RSRA 5CVVA 5CVUA 1X1CA 3HCAA 3LKZA 5E9QA 3AXTA 3LX6A 4KDRA 3PX2A 5E8RA 3KPJA 3WSTA 2Z6AA 1OR8A 2A14A 1P1BA 5FWDA 5JUWA 5DM1A 5E9JA 4KIGA 1RJEA 3DXXA 4GOOD 2QYOA 4XUCA 2OO3A 5EZQA 5MHTA 3ELWA 2B25A 5HIJA 3CBGA 3P2EA 2ZIGA 2CMGA 3QOXA 2C7OA 2DULA 3TRKA 2C7PA 5T64A 2VZ9A 5CUQA 3AJDA 3THRA 1YUBA 4DKJA 4E2WA 5KQRA 4ER7A 2ZFUA 3HVJA 5FQOA 1TPYA 3HVKA 1JQ3A 3B7PA 3EPPA 3LDFA 4PIMA 5D1HA 3EVFA 5DWQA 5DM0A 8MHTA 3R0QA 2OXTA 2WA1A 4HC4A 2KW5A 3ELYA 1AQIA 3P9NA 2GB4A 3T7RA 3EMDA 3LDUA 2ZW9A 2PXCA 2BR4A 3A4TA 3FTDA 3BGVA 5IH3A 2E5WA 3UJBA 2PWPA 1X19A 5E1BA 3RODA 5LQUA 3IEIA 5FADA 1XXLA 2GH1A 5F2KA 3MQ2A 5D1NA 5DX8A 1JG1A 1FP1D 1U2ZA 5FTWA 3OU2A 1BHJA 2BM9A 3R6TA 4PYIA 5DX0A 1NW6A 1NV8A 4C04A 2ZWVA 1FBNA 5FUBA 2C7QA 2FK7A 2VDVE 3AWIA 1Y8CA 3LCUA 4FR0A 2HMYB 2QY6A 5GP1A 1QANA 2ZIFA 4HRAA 4HTFB 5LR6A 3KQVA 1FJXA 1PJZA 2H11A 3GIWA 4RV9A 2FYTA 4AX8A 2GLUA 3LCVB 4R6XA 4PWYA 4HH4A 1ZGJA 5FHRA 4GOMD 5HILA 3SSOA 4P58A 1PRYA 1EJ0A 3KR2A 2PSSA 3SSMA 4A6EA 4RTQA 3GWZA 3HNRA 2K4MA 2UYQA 2ZBPA 1UWVA 3CKKA 3MTEA 2HR1A 1R8XA 1VBFA 4EK9A 5LQRA 2Y1WA 5CCBA 4KDCA 3FTFA 1L1EA 5EOVA 2UZ4A 2ADMA 4MIKA 3I9FA 3HVIA 1G6Q1 2JH8A 1ZG3A 1NW5A 2UYCA 5T67A 2EG5A 4C05A 2ZZMA 2PJDA 4RTPA 4F86A 2G71A 3SXJA 3JWIA 1VQ1A 1WZNA 5DTMA 1JG2A 2UYHA 2VDUE 5K05A 3LPMA 2EX4A 1YZ3A 3UFBA 1Q0SA 1EG2A 3UBTA 1NE2A 4RVHA 4GOND 3PFGA 2FK8A 2NNWB 3HA5A 3H2BA 3P2KA 3FRHA 1JG4A 3NDJA 3TQSA 5ICCA 4PGHA 5K0GA 4DA4A 2H1RA 3FPEA 2ZULA 3EVEA 1VP3A 3IYLW 4WVLA 2AOUA 3A7EA 3FUUA 3EVCA 5EMMA 4P7KA 3TR6A 4DMGA 5GINE 1BKYA 3LCCA 3GRVA 4O29A 1NBHA 4EKGA 1INLA 2XYQA 2QE6A 4LWOA 4P7FA 1YFLA 2R3SA 5EVJA 2YTZA 3C0KA 4PCAA 1R6AA 2F8LA 1FP2A 3G88A 5B1SA 1M0EA 3O31A 5HZMA 3FYCA 3RW9A 1QAOA 1UFKA 3I58A 1KR5A 4QVGA 5EQJB 3TFWA 5CVDA 2YX1A 3FPFA 3KPUA 2ONZA 3UZUA 1KIAA 4QQNA 3NMUF 5FHQA 4AZWA 3B89A 3DOUA 5HIIA 5EG5A 2Q41A 5DPMA 5DSTA 3NWBA 1DUSA 1WY7A 1ZKDA 2VP3A 1SUSA 1X1DA 3C3PA 4DCGA 5GM1A 2AVDA 5C1IA 4ER0A 3MCTA 4YUVA 3L8DA 3G2OA 3GNLA 3P2IA 3PT9A 2AZTA 3V97A 2PT9A 3MTIA 2YQZA 5KS2A 2ORED 4YUXA 4X41A 4BLUA 2OYRA 4PYNA 4QPNA 2AOTB 5K0CA 1XDSA 4CKBA 4DZRA 3GO4A 3Q87B 1VL5A 3MB5A 1RJFA 1WXWA 5KYGA 1ORIA 3M33A 3CVOA 4L7VA 5K8VA 1D2CA 1SQFA 4PONA 4R05A 3FUXA 1R00A 2ZWAA 4E2YA 3OFJA 5CCXA 3MERA 4E2XA 2IH2A 3E7PA 4DCMA 3KQWA 3KQSA 3FUWA 5DTRA 3VSEA 4C07A 3T7TA 2HV9A 3BKWA 2JHCA 4KWCA 5E9WA 3HCCA 1G55A 2ESRA 3A7DA 3FYDA 5CM2Z 4Z2YA 4FT4A 2P3LA 1RI5A 3DLIA 5EKUA 3KQPA 5T6BA 1VLMA 2PBFA 1P1CA 4X60A 5FULA 3NWEA 5K0FA 2V74B 3NDIA 1YF3A 5DRTA 3DXYA 3PS9A 3LECA 3DP7A 4UOEA 5HFJA 2FPOA 1YB2A 4MQ4A 5CIYA 5DXJA 2PWYA 1XDZA 4E70A 3C6KA 3FUVA 5LQKA 2OBFA 1AF7A 2NXNA 2XVMA 2ZZKA 4BLVA 4C4AA 3DUWA 2CL5A 3UJ6A 4QTTB 5HIKA 3R9XB 2OB2A 4H0NA 4QVKA 4PYJA 1P39A 1XCJA 1DCTA 2YXEA 2I62A 2P35A 3S68A 3LSTA 3GRZA 5EMKA 3IHTA 2OB1A 4GEKA 1IY9A 3NTVA 3G5LA 4KVZA 2IBTA 1L3CA 3GXOA 2XYVA 1TW3A 1Z3CA 2QRVA 3HTXA 5LQCA 1H1DA 5H02A 3KR0A 4JXJA 2PX5A 4YUZA 4HTFA 3E8SA 3KQOA 5EHGA 4DQ0A 4M36A 3ERCA 5K01A 1QAQA 2Y1XA 1G38A 1NT2A 2G72A 4QPPA 4XCXA 4M37A 4M7RA 3KPVA 1SVUA 2PXXA 2JHAA 3F4KA 3GU3A 3UJ7A 2P3OA 3DMGA 3M70A 3DXZA 3LL7A 2GA9A 3KQYA 9MHTA 3BZBA 4KRGA 3M6VA 3KHKA 4FGZA 3CCFA 3SVZA 1JTEA 4RVGA 4POOA 3FRIA 2YXLA 2YR0A 4OX9Y 3G7UA 5EEGA 3BGIA 1KP9A 4FS8A 3BWBA 5DM2A 4BP3A 5C9ZA 5K0EA 1QZZA 2CKDA 3DTNA 5LSAA 2HTEA 3HEMA 3OU6A 3EVGA 5EMLA 4YMGA 2PY6A 4HG2A 2O07A 3BWCA 5KVAA 4PYOA 2P8JA 2PLWA 2QM3A 4F85A 4GF5A 3PLAE 1O9GA 2FHPA 4X63A 4PCLA 4OA5A 3P9IA 1XCLA 2OZVA 3BKXA 4XUDA 4BLWA 1WS6A 3FZGA 5GIOE 3G8BA 5E1MA 4RTMA 4RTOA 2P7HA 4EKIA 1NW3A 3DLCA 4KW7A 2XYRA 1X1BA 2B2CA 2ZVJA 4B17A 3EVDA 2XVAA 4P7GA 4XUEA 1IM8A 4IKPA 4OBXA 1N7IA 2P41A 2GAFA 1MJFA 1YZHA 1RI3A 3UA4A 1JSXA 1V39A 3SX0A 3FPHA 4OQEA 3G8AA 3SSNA 2CWWA 5M5BA 1F38A 3A25A 3NVMB 4A6DA 1B42A 3AXSA 2O0LA 3M6UA 2Z6UA 3NW9A 2EJUA 2BR5A 1N2XA 3CGGA 2NYUA 1I4WA 2AN4A 5F2OA 1KPIA 5FQNA 1DL5A 3UJAA 3UA3A 1NV9A 2NXJA 3EMBA 4OBWA 2BH2A 2IDJA 1O54A 4GC9A 3REOA 2G1PA 3ANXA 2HNKA 1T43A 3G2MA 3OE4A 3KKZA 2ZCJA 4MWZA 1UIRA 2OPBA 3R3HA 1HNNA 2AOUB 1O9HA 3I5UA 3K0BA 4GOLD 3GJYA 4GUAA 4X1OA 2ONYA 2IGTA 2AOTA 3ORHA 3KQQA 4FT2A 3GDHA 3M6WA 2PKWA 4OA8A 5KQSA 1ZHFA 3C3YA 4U7TB 4RVDA 4CWAA 4GC5A 3PX3A 1G60A 3P9KA 3TOSA 4CTJA 2OY0A 3VC2A 2H00A 2IIPA 2OKCA 4GQBA 5BP7A 2NP7A 1VP9A 3BT7A 3GRRA 3PB3A 5E1OA 1JQDA 1ZQ9A 1L3IA 2IP2A 3HCDA 4HSGA 4PGGA 3DH0A 2PVCA 4BP1A 4EQZA 5F2NA 4CKCA 2P40A 2PGXA 5CVEA 4RTKA 3V8VA 5LQAA 1EQAA 3UJCA 1L9KA 4RTNA 5FA8A 1D2GA 4LWPA 2PX2A 5EHIA 3DR5A 4C06A 3ER8A 3HA7A 1M6YA 4WXHA 2XBMA 7MHTA 3E05A 2YXDA 3BWMA 2O57A 3SR4A 4F84A 1BOOA 2BR3A 3HM2A 2YUIA 3LBYA 5ICFA 1WG8A 2AN3A 3OU7A 4QDKA 3LDGA 5DXAA 3B5IA 2UYOA 3DMHA 5DSXA 3OZSA 5EIWA 4E31A 3VYWA 3OFKA 5FCDA 1X1AA 3KR9A 2PV0A 4R8RA 4GBED 5C0OE 4AZTA 4ER5A 5EPEA 5CVJA 1YFJA 5DX1A 3I64A 3KR1A 4FSXA 1RI4A 4RWZA 5E1DA 2ZIEA 3X0DA 4DM3A 4BY9E 3B3JA 2B9EA 1WXXA 4ER3A 2JG3A 1EIZA 2I7CA 3ELUA 1R18A 5K0NA 3SMQA 4IWNA 2GPYA 3OPNA 1QYRA 1F3LA 1KPGA 3FTCA 2BM8A 4U7PB 3EVAA 2JHPA 4YUWA 4RTLA 4YMHA 5G02A 5EC8A 5GOZA 2I9KA 4PYLA 3MHTA 1D2HA 4RTJA 2P3QA 2PT6A 2ZBQA 1RI2A 5EKXA 3U81A 3FTEA 1EAMA 4R6WA 4IV8A
chains in the Genus database with same CATH superfamily
3DM9B 5FWAA 2FSGA 3C5WP 5I4CA 3AGQA 1CLEA 4ZOEA 1W85B 1I3MA 1NJ8A 4ZOBA 3BA6A 4IM7A 4EY4A 1UJ5A 1YSCA 3ESDA 5ESWA 1TZCA 2C5FA 4R5MA 1I13A 4DV5B 2AF4C 3DULA 3OE7D 5I9MA 4V0NA 5FXMA 1B26A 1NZJA 4F6RA 2W4IA 4L72A 3LBFA 4QDJA 1Z0IA 3AOEA 4ZTBA 1ZGAA 4BLPA 1DC5A 2VJCA 3RRMA 3W78A 1MC4A 1UAYA 2GVNA 3F9CA 3WWPA 1HA3A 1SZJG 3PUYA 3QK7A 3RB8A 5A4KA 5HPYB 3FW1A 1W59A 4RKEA 4DW8A 1U7PA 5P8WA 2GESA 3J81k 5F98A 1G64A 4E4TA 2IUFA 2UKDA 2ZRKA 4BN4A 2HJSA 2OXIA 3SMVA 1Q0TA 4IDAA 4B3RB 4YO8A 4M21A 3WNVA 3MTGA 1SUIA 5JAIA 5JWRA 1GTZA 2OCGA 4INJA 4DA7A 3C5VA 5AICA 3P20A 1NX9A 2XDQB 1Z7YA 1Z8DA 3O1JC 3TTYA 1K68A 4AZVA 3EEOA 3AG5A 1JIKA 2PT7A 3KSMA 3WISA 3MCZA 4OM7A 2P5SA 3N8DA 5F9HA 5EZYB 2XWQA 1KXZA 1B3RA 3C1UA 1Y80A 4JT9A 5HQ3B 4P83A 1EESA 1OWLA 1P6UA 3GGOA 3DEFA 2QX7A 1KSJA 2QX9A 2LR0A 3CC8A 4YP7A 5KYXA 2CXNA 2VSQA 3NX4A 2EW2A 3TK1A 3WK9A 4DWWA 2I3ZA 4MWGA 5ABPA 3TSYA 3MPUA 1A98A 1BW9A 2IOFA 2QMEA 3E27A 3PHBE 4JT2A 4KH1A 4GS5A 4OQDA 4BGVA 1ISMA 1J49A 1DB3A 4P53A 2QMOA 1G5FA 3GCZA 1DC6A 3HJNA 5K3AA 4EO9A 2BZGA 3PXUA 3BL8A 2NTVA 3TE6A 4IDQA 3QJGA 4HGZA 1ZRHA 3T9DA 1JIIA 1KKUA 2IPOA 1HY3A 2PZMA 1OU4A 2Q5FA 1PI3A 3DVLA 1J70A 1I32A 3DZJA 3FVVA 3GD5A 4XM1A 1KBQA 1GSOA 2CWDA 2OCDA 1M7GA 1MLDA 3SYRA 9LDBA 1ORHA 2REXB 3WBBA 4O63O 3CPSA 2OR3A 5CXXA 1RQGA 1QH8A 3WIEA 5FFMA 5LC1A 3TJRA 1NBOA 1X8JA 1KK0A 2QYHA 3MHPA 4HDNB 2C4MA 3QVWA 2BFDB 2HWWA 3DDHA 1E6KA 5BVGA 3TKYA 2DWPA 5T41A 3SKVA 1SCIA 1Z2OX 3W1WA 3VO2A 3H9JA 3QQ5A 5HOQA 4BUZA 1G59A 1EVLA 1YI1A 3G2PA 4QC2A 4DA6A 4UCXA 5GVRA 1P3Y1 2EWWA 5FTMA 3TTXA 1EE9A 1PUIA 1X9IA 4ENQA 1Y3BE 2ICAA 2XUPA 3TE7A 4ZVKA 3E5HA 3HV2A 3AUFA 3M34A 1L4UA 1ZDMA 1USIA 4P2GA 2EKQA 3C6QA 4FZVA 3RIYA 3EQ9A 3KTAB 3IR6A 3C6MA 3VPSA 4EGJA 3LW8A 2JLYA 3THYB 3VTKA 2HPZA 3FPGA 2WFZA 4NG4A 4QBGB 5JROA 4TXNA 5DI3A 1UODA 2Q6IA 1BHSA 1WOYA 5EWMA 4F56A 4CIWA 4E09A 4OBBA 4XGNA 3HA2A 3WFJA 1E9EA 1J8QA 1C9NA 3BZWA 4IIDA 5JSZB 1R12A 2ERCA 2PXAA 4E5MA 3BJEA 2GN9A 1N6NA 3F97A 4KU4A 5AKLA 3VAZA 2JLQA 5FPYA 2JRCA 3L5KA 3RUEA 1C9KA 4BO8A 4KXUA 4W5QA 2OCIA 3KZKA 1QZXA 5COAA 3I2KA 4AJJA 2ZM6B 4YJDA 1TOAA 1B73A 1M3SA 1SKYE 4QODA 2X4IA 4PX5A 1QRUA 3A4LA 4F60A 5B2FA 4N47A 2C7OA 1Q12A 3R7SA 2J46A 1QP4A 4EUHA 4BFUA 4GMFA 2V5UA 4RGYA 3NT4A 4YT5A 2BHRA 5KQRA 4ZI2A 2K5UA 3COYA 1P77A 1XQYA 2QZSA 4RD2A 1FFHA 4S1PA 1A3CA 3L0SA 1N5KA 4G5RA 1CB7A 3TWOA 1X14A 1Z5GA 4M8IA 2KW5A 3UOWA 5GY7A 4WA7A 1T8WA 3AETA 4JIGA 4A8PA 1A69A 4X71A 1XA0A 1I3CA 4GM0A 1V96A 3RM3A 3VYUB 3WGUA 4XWKA 2P90A 2PUHA 3CQ9A 4MWEA 4J0GA 3V3KA 1JXAA 2DHCA 2RJOA 3DKIA 2EGHA 4YPOA 1W5BA 4FMDF 1SK9A 1R0WA 2JIPA 1SCKA 2WM9B 3HBJA 1WCWA 3OJFA 3QG5A 5E1BA 4Z7QB 1UBLS 1IWBB 1IUKA 1EFPA 2XMPA 3MINB 3R6WA 4OUDA 4ZYXA 4QUBA 1J42A 3GAAA 3LZDA 5J1TB 3ZK8A 2CV2A 4XPZA 4C6TA 4LPKA 3AI2A 1VYUA 1D0IA 2XNCA 1DLJA 4K40A 1LBQA 2QNIA 5D00A 1G21E 3LBNA 2VDVE 4DLWA 1OX4B 3H3JA 4QUDA 2IEGA 3F6BX 5A3VA 2FFAA 4M9QA 4AP9A 3TG8A 4D4KA 1IWPB 3EH1A 4HTFB 4I1YA 3IBYA 1R3DA 2DP4E 3T61A 3HU3A 1WKBA 2X1MA 4MKXA 4P0QB 3CR3C 5LIPA 2FF5A 1TA4A 1S02A 4UUQA 1FVHA 3CYFA 3DYBA 2H1WA 2NUPB 2VK8A 1M10A 2Y9MB 1W76A 2WIJA 3QEKA 1GTL1 2V5VA 3A1DA 1UJ6A 2BEVB 3MOGA 4LYGA 4LGYA 1ZH8A 1BXGA 3I9OA 2WI8A 4LV5B 3F5FA 1HLPA 5F2EA 1QVZA 4EBBA 2IYPA 2WSSD 2Y1WA 3O8QA 5A5DA 1Z12A 5JU6A 3HJBA 4OQLA 3DBOB 1NN1A 4MIKA 2CE2X 3C97A 1GGNA 3PQFA 3SEAA 4GP7A 1H65A 4CLOA 4JITA 3JQDA 2F8SA 1F5SA 5T67A 1WY5A 3BQ9A 1Z5UA 1QNLA 1YKGA 1ZM7A 3TPFA 2OK8A 1WZNA 2HK7A 4DIBA 5FOTA 1O5OA 4CL8A 1UK8A 1OILA 1NMYA 1Z8HA 1Z7EA 1Z5WA 1DIHA 1EG2A 1W5SA 3D2BA 3HLKA 3NBYC 3QHAA 2QV0A 4RVHA 3FF4A 3WG9A 2VYVD 1ZONA 2VPYA 3PFGA 4ZO8A 1A9OA 3MM4A 1LLFA 4E1VA 5EJFA 3U9SA 5E7MA 3IKVA 3P9ZA 4G5XA 1FYFA 1QR6A 3E9NA 1NVDA 3IYLW 4WVLA 1JQJC 2F3TA 4UKDA 3EVCA 5EMMA 4DMGA 2QWXA 4ZYZA 4H6WA 1KDTA 2GN8A 3FFTA 1HQDA 2HH9A 1XL1A 1DU4A 1ZRMA 2BMVA 1XTZA 4XAQA 3QUQA 2RGRA 1CETA 3E61A 3MGKA 4XX0B 4DCJA 3HCNA 3LZCA 2XRYA 4DPMA 1E2LA 2G80A 1V7QA 1SHKA 4EUKA 4R0VA 4HCJA 2X9LA 4DWVA 3T5PA 3F6RA 2FPXA 4TQ9A 2VJLA 1XVIA 3KU4A 2RHDA 2WC1A 1MENA 2QTAA 1JYFA 3B6JA 4I08A 3COVA 1N3BA 4IGAA 3RD5A 4D4HA 3NBZC 4ZXFA 3DOUA 5D5HA 5DSTA 3TEFA 1DUSA 1TCAA 3G79A 3IH5A 4FOLA 4XVUA 3AO0B 1W8DA 3LU1A 1I7DA 4HWSA 1D2AA 4Q66C 2YV3A 2O5EA 3RFCA 4C0JA 4EKDA 5DNEA 3NFRA 4QAJA 2HNAA 4WN9B 1ISIA 1P7PA 4FMCB 1FRFS 4XB6B 4KR0A 4FYVA 3DT6A 3NEPX 1L8LA 4PYNA 4BMNA 4OU4A 1V1RA 4CW7A 4L0CA 3WA7A 4CEIB 3AVYA 1W46A 3O8BA 4XVHA 1YAJA 1DAOA 2JFYA 3D8TA 1XD8A 1RYNA 4JMLA 3R7WB 5JD4A 2OORA 1WXWA 2EWVA 2O7SA 2AXNA 1Z6GA 1XHLA 3L7KA 5BSKA 5K8VA 1VG0B 3UUFA 1NE7A 1YDHA 2IYWA 3PI7A 1H5QA 1OLUB 2J85A 2PQMA 2QTRA 3MERA 4NBKA 2BGGA 4Q3OA 3VJKA 2CYBA 4OHVA 3O8NA 2RHLA 3CRRA 1TZJA 4QU0A 4X97A 4OTZA 3H8VA 3UK0A 3TQQA 3V1YA 3GRPA 1N3YA 4GX1A 1H0SA 1PSDA 3D3EA 2QD1A 4YWJA 5HQJA 4ZJZA 2WD7B 4ZZ2A 3ASYA 3FNHA 1NY6A 4MVYA 1E9AA 4QULA 3LLSA 3RS5A 4ZCRA 3ZWNA 4OJKA 4ZCPA 2ZRAA 4WASA 1G41A 3DXYA 4BO6A 1OIXA 1YB2A 4NBNA 3SJBA 1N0UA 3ZZMA 2VYFA 2XV1A 2AKYA 3B3QA 4LRWA 3EBOA 5C34B 1O5TA 2CLSA 2XVMA 1MGPA 2A0KA 3LT5A 4ZVMA 1DLIA 2WD8A 3G0CA 5HIKA 4S0ZA 1T5IA 4QVKA 1L5HA 2Q7OE 4YJFA 3MRSA 2P65A 3C3KA 2P35A 1OREA 2GNOA 2HA6A 2YVAA 4LJ9A 5H68A 5HFNA 5JBNA 1J97A 2CKMA 2WUVA 1Y42X 4MKFA 4NJMB 3ZU3A 4ND2A 1NMEA 3A10A 4QBKA 1JA0A 1YR3A 2OXCA 3Q3EA 5FJJA 3W3AH 4Y2UA 5LQCA 3QXSA 4F9FA 4LJ5A 3NVDA 5K1ZA 5CM8B 1PJ8A 3UF0A 1AS2A 4A0FA 3G5AA 4C1NA 4LA4A 2WV7A 4DIOA 1VBNA 1C0IA 1NC3A 2C2WA 2ZUVA 1GL6A 3OT1B 4CQMD 3FSGD 1V9LA 1OPRA 4IXNA 4DARA 1V95A 1YVEI 2G72A 2P9CA 1V8DA 2A4KA 2XGSA 2GZ2A 5AXDA 3KPVA 4W9MC 4BNLA 4WHMA 2WWVD 1NVWQ 2YFHA 1PL8A 3SS9X 4D3YA 4AXBA 4W5RA 4FGZA 1G2PA 3HJGA 4O6VA 2WJHA 1JAHA 2MYTA 3WIUA 3TD6A 4AY4A 4HX2A 4E5SA 2UZ3A 4R9RA 3UK2A 1MRZA 1QGOA 4M60A 3UXHA 4IOLA 4CN9A 2CUNA 2HNBA 3LRPA 3CNEA 1AS0A 2AFIB 2VRCD 1SEPA 2C9CA 3C3CA 3GZNB 2J0EA 2YHSA 4DYDA 3FY4A 2PY6A 4ENVA 4YRSA 4FFMA 2QR5A 3BMCB 3SLGA 2JATA 1QIHA 3DBVO 3D1JA 1GNSA 2XZDA 3TW4A 4OA5A 4Y7CA 4M1YA 4DLYA 2C0PA 2H0QA 4QFCA 1C7EA 3U7HB 1G98A 3CTMA 2XCSB 2JLBA 4G24A 1C3EA 1I2MA 3AHFA 2VHCA 2Q0SA 2C00A 4B17A 2XOXA 3E70C 4IMJB 2NWQA 1SHTX 3ANMA 1DRKA 3ILVA 3Q0EA 1VE7A 4HB3A 4LWQA 2JA1A 4ND5A 4EQ6A 2DVMA 3RS2A 2GAFA 5CFNA 2RGUA 1V5FA 1H5UA 1ZNXA 1VL1A 1WZEA 3B6ZA 1CJTC 4TL9A 1GAJA 3VR4A 3CPJB 4LQ4A 4A8JA 3W8FA 2HRBA 3THOA 1Q21A 3DB1A 3QU2A 2R9VA 1II9A 1IEVA 4K9NA 5EIXA 2J6IA 4F91B 4QZVA 1SU8A 2C54A 2AN4A 5A4FS 2NOAA 3AUTA 3BXZA 4PZAA 2F3PA 1C3JA 2XADA 3UJAA 2NXJA 3RUAA 4GOKA 3TIFA 1EEHA 5AKEA 1HQCA 2AEMA 1O54A 2WNSA 3I0NA 1HLFA 3C3AA 4X1KB 3VPHA 4E6PA 5AHOA 1QU2A 3NASA 3K71B 3R3JA 4P3PA 2ZYIA 1ULSA 2B4AA 2DG2A 1EFTA 2P9JA 3H5NA 1IB6A 3VI4B 2ZCJA 2GKSA 1WOMA 1XYGA 3AC0A 4PRKA 1ONOA 1NR7A 1TLLA 3CH4B 2Y1CA 3T41A 2HIGA 3BSFA 3TAUA 3KQQA 4IUCS 5BQ3A 2AK2A 4KBYA 3F1LA 3U56A 3N2IA 3HDHA 4YR7A 4RVDA 1DKPA 2CFSA 3VDXA 1G60A 1EVKA 3GHHA 2X7HA 3P9KA 1W2HA 3LWBA 3WL3A 1VSQA 4DQLA 2ZIZA 3ZDAA 1F2UA 1JG7A 4C89A 3WLIA 4YAJA 1YR9A 1YR1A 2O59A 3PWSA 4MKRA 5NLLA 1CQZA 1U1DA 2ODWA 3C3WA 4YRIA 2DFKB 3HYSA 4UEKA 2ID8A 3BD9A 4MVJE 4AS3A 3CT4A 2JCBA 3ZDQA 4MUMA 1VRCA 3NHKA 3SR4A 4F84A 2QZPA 4Q47A 3FG9A 3QLUA 3HM2A 3RQSA 3T1YB 5ICFA 2ZT7A 1ZD2P 2MSKA 3VNBA 2AIRA 3AF3A 1C0LA 5ALHA 5EWMB 4AKGA 1WLYA 1U6KA 2ZQZA 4KH0A 1DC3A 4FYHA 1HE1C 5HGXA 5JADA 2QYSA 2D5IA 1XBTA 2JFFA 2WSYB 1D1TA 4GRIA 4RMNA 3JQBC 1GGJA 4EW3A 1RC8A 4RKQA 4PAMA 2GDZA 1VCMA 2O0MA 4J8PA 5H5JA 1YOVA 2H2FA 3HXPA 4MRNA 3WOVA 4FZ3A 2VUSA 3EVAA 4J03A 3FGNA 3UW1A 1Z74A 4LGCA 1WCYA 1Z4PX 4V2IA 4E21A 1R88A 4W7SA 1CV2A 4JJGA 4LXYA 5GJCA 4DSZA 4ZI3A 4AJ2A 2GZDA 5CA1B 1I7QB 3PGA1 4YRRA 2C84A 4R6WA 4AJ9A 1VGRA 2LBPA 4N6NA 3VDMA 2I6TA 3VPDA 1CTQA 1GKKA 4DMUB 1I2ZA 1LWOA 2VJMA 3KD3A 1UZAA 3OEHD 4PYKA 3UJDA 1XNJA 1SBTA 3T4EA 1VXOA 1TU3A 2CYAA 4DPLA 2B4RO 3V6MA 3WLQA 4NX2A 3GDFA 2OFXA 2X42A 1R8YA 1ZWKA 3VU9A 3BUSA 3TMAA 4F04A 3WLSA 4FFPA 2WG0A 4TWAA 3HCEA 2HWYA 2VYNA 3T6KA 3MW8A 1ZGBA 4G1BA 4PXYA 3RVRA 5F76A 3P19A 3QV2A 3W8RA 4ER6A 1AHPA 4G5OA 4OI0A 2O2SA 1EFPB 1UJ2A 5FA5A 3NC1C 3E22B 3R5JA 4UJ5A 5ALLA 1SCBA 2N47A 4H16A 4II2A 3R7BA 4BCDA 3O8CA 4C6TB 1ZM2A 2HQRA 2QPAA 3QJ5A 1NU6A 3ZCQA 4I4TA 5KYVA 2PX8A 3SJCA 3FOEC 3QV1A 1M2OB 3FPBA 1M2FA 1QYWA 2IHVA 2W8BB 4DA0A 2KM1A 2ORIA 5CCEA 3ADKA 1XMPA 1UP4A 1CWUA 3FHLA 4KL8S 1VPVA 4AJKA 3QFTA 3QPUA 4EAQA 5B5SA 4LC9A 1SQ5A 4UM9D 3E84A 1FRZA 1G20E 1R4AA 4J29A 3QKSA 1A72A 4N0PA 5I9BA 5JPIA 3UMBA 4BKUA 1FXWF 3HJUA 5DTRA 2PV7A 1JEEA 4LOJA 4EHBA 4F4UA 3HCBA 5JDCA 2VQFB 2FPGA 1G9SA 4IR7A 4BO9A 1KH3A 1OFTA 4HVLA 1KZHA 3O8QB 1MAWA 4MXDA 3DDOA 4Y6LA 5AW9A 3WQQA 3KPYA 5A1JA 5B1YA 1TF7A 3FFBA 5F9FA 2VIIA 4TSKA 3W8DA 1CW2B 4AMZA 3ELBA 4K81B 5LJLA 5BQOA 3KDAA 5F3DA 2C4NA 2PSFA 2LKCA 2VNJA 5GWXA 4CKWB 1M8FA 2O2CA 3F8TA 3K9NA 4WXYB 1LPNA 1GT6A 3V4PB 2ZSHA 3ECCA 2JJQA 3IHKA 5KYUA 1OC4A 4FEEA 4WZBA 5EMJA 3TM4A 1Q1EA 2E4WA 2FWRA 4ROSA 3DW1X 2FEPA 3L7CA 3AFHA 3P5SA 3SDBA 2NZYA 1X7XB 4L6CA 4WOKA 3O4JA 5JWHA 1E1RD 3KTOA 4JC8A 2ZSUA 5DB4A 5FYQA 3BXOA 1HORA 2OFFA 5BW8A 2W2NA 2HGZA 2OHGA 3A4YA 5JTUA 4AKTA 4RF5A 5CDSA 2X23A 2GZAA 1U1EA 4WCDA 4X20A 5LLSA 2V6GA 2PHZA 4UNQA 3HUUA 1LQUA 1E5TA 3RFTA 1BX0A 3QXHA 3DM5A 3GC6A 3H17A 4URYR 3IKMB 3IUPA 1GSAA 4ZAFA 4QRDA 3UV7A 1EFRA 3C7KA 4OCZA 2WIGA 4AXXA 4FE3A 3MT8A 3RFXA 4K03A 1LNZA 4RESA 4DJFC 2CLMB 5BXYA 4TL6A 1XHEA 2CXQA 1PTJC 4QUIA 1ZMTA 2N3ZA 3K0KA 4G1VA 3V80A 4A73A 3AKCA 4M0KA 2AL7A 5DO9A 5JYDA 3QNUA 2OG2A 1JQEA 1CS4C 4WNIA 2A84A 3ZJYA 3CO5A 1CFJA 1I2BA 1Q3TA 3CGWA 4K6OA 1AUXA 1ULZA 1DRUA 4Q3CA 4UCQA 5T6MA 4C6SA 3HU2A 4ERNA 5F7XA 3HADA 1Z37A 3PL5A 4Y2RA 1GHTA 621PA 2YHIA 3BH0A 1CKEA 4ADSG 2JB9A 2Q3CA 2Y0BA 3BK7A 1VJGA 4BMCA 3B3GA 3ZHCA 3EDRA 2H51A 4H1TA 3S81A 1CJKC 4M2LA 5DN6A 3EVTA 5E4TA 3PJGA 5F4BA 3ROMA 3N5CA 3I5MA 4NZPA 3LG2A 4KEAA 1VIMA 5ICEA 4DBZA 4I1IA 3NH6A 1L9XA 2P9FA 2MSCB 3QBVA 4RJJA 4YAEA 2P2NA 4FNMA 3LCMA 4YAGA 1A4IA 6ADHA 1MRSA 3OQPA 2W6ZA 2GK4A 3U3MA 4DVGA 2A9PA 2GI4A 3ZY6A 5C52B 2I7TA 2V9ZA 4XUCA 4B2LA 5MHTA 3VX4A 3M6MD 1VI6A 2V9PA 4J0EA 5DHPA 2ZIXB 4ZU6X 3D1LA 4DAOA 2K6GA 4JQZA 4DN6A 2DULA 4DR2B 1TGVA 2RH8A 2AB0A 2VI5A 3JATB 1R64A 3K1JA 4Y2VA 2LIPA 3BFJA 1SKQA 3QXJA 3ZHXA 5IUJC 3N05A 3THWA 3LK7A 1O96A 4CR7A 4DNOA 1Q0QA 3CLVA 2OENG 1HSZA 3DCIA 1IMJA 3FKSD 2RH4A 4JJ4A 1SUCA 3PBKA 1A5ZA 5I8ZA 5LMNB 3QSGA 5EWLA 2M6KA 4CF5A 1B4DA 2EYQA 3IFSA 3D6TB 4MITA 2ZBDA 2FZEA 1X19A 1NONA 4FHEA 2HHAA 3Q2IA 1M8JA 2HPVA 5FJIA 3W77A 4MCAA 2R48A 2RKWA 3VZBA 2O2IA 1FSFA 4JWTA 4JZKA 2VJKA 3NORA 5FBWB 2QAIA 1E1NA 3QELB 4JBXA 5G1OA 4IDFA 1GSIA 1DMSA 4BJ5A 2HLPA 2B3DA 3V9PA 4OK3A 1A9ZA 4IFEA 3F8WA 2XA9A 3CG4A 4D9GA 3BH7A 3Q7PA 3ZWDA 3HBLA 4N0QA 2AQ8A 2E48A 1AK9A 1G4AE 2HMYB 2IYFA 5GP1A 4HRAA 5I9TA 3KQVA 3KWMA 2FYTA 3KUUA 4HNHA 2Z04A 2JARA 4WXRA 4PWYA 1C4WA 5AM1A 3NBKA 4B7UA 2PR7A 2R60A 1Q50A 2PSSA 2XECA 3AB7A 5AK6A 2PGAA 3CE9A 3QF4B 2XMDA 2J0UA 4NBVA 3HYNA 4H08A 1Y4DE 2EHJA 4I81A 1NJFA 4KMSA 1QVWA 5MFZA 2UXCB 4KDCA 4I6JA 2NN3C 3MD0A 4IRMA 5K4GA 1G7SA 1NPTO 4A7PA 4ODIA 3FCAA 2JH8A 1MXHA 5AOAA 1Y6RA 3LQKA 4EARA 1C7JA 5IK2A 2QTLA 3RC9A 4O1HA 1GPNA 1M2VA 2DJIA 4YP0A 2OWDA 1SXQA 1O95C 2IJGX 5DTMA 2OSVA 2VPXA 4MS4A 5EE9A 4D4MA 1PGQA 4RQUA 5TEWA 1U0EA 1W87A 3WICA 1NE2A 1HYGA 1TF2A 2JGJA 1H2XA 1LSUA 2VF5X 4FFVA 4JVOA 1E6LA 2I2XB 1SQSA 4PZDA 3PUHA 4QPJC 3H2BA 1S4MA 2BIFA 2RK3A 5K0GA 2IOQA 3WLNA 1VP3A 2D2FA 1U28C 3R5XA 1CUBA 1K89A 4JJFA 1Z5OA 1JKJB 2VHWA 3GRVA 4OQNA 3DV0A 4DMFA 4GI2A 1POWA 3BIFA 2AXEA 2JFZA 3DZDA 2HBYA 4OQPA 2FEMA 2YTZA 3VNRA 4TN5A 1XMQB 4MV7A 3TH5A 3B7GA 13PKA 4CMJA 1YFZA 4MUEA 4EQ6B 3RVMA 2EL7A 1JLHA 1NHWA 4A8JB 1KR5A 2WTNA 1PWXA 4R2LA 2GPBA 2YX1A 3NM5A 3HU5A 1KIAA 1I4DD 4BTLA 5FUXA 4YUAA 3V1UA 4CG1A 3VO1A 1GXSA 3H2IA 4FJ1A 3PSHA 4OSEA 5TVGA 1SD1A 4W4TA 3UHOA 3B89A 1M8PA 4O4LB 3A6PC 2ZXUA 2DXIA 1PL6A 3F3KA 4G85A 5JNUA 3DE6X 2ZAMA 5JR3A 2G5TA 3V4FA 3NEYA 3RADC 2WT8A 3PTLA 1LC0A 1E3QA 3MCTA 4JGBA 2XIJA 4H17A 3LUGA 1N1EA 4KQMA 3JTMA 2QR2A 3TI7A 3ZE9A 2GNPA 2BHLA 2FOLA 4BO5A 2R6R1 4KNWA 3DPIA 4YUXA 3NAZA 3D0RA 3WMRA 2DYKA 3PNMA 5DMXA 2AC7A 4AVYA 1UZMA 3UWSA 3IKLA 3IQWA 2GZ3A 3E9QA 1VL5A 1V1JA 3ASVA 4H60A 4CUZA 5KYGA 4J1TC 3DBIA 2F4NA 5CA1F 3CVOA 5DGIA 1H4SA 1GUDA 3NDPA 3K1TA 5E6UB 2GVZC 3OJCA 4K2AA 4S1VA 4K9DA 2DFLA 4F5EA 2CB9A 1UFRA 3DZHA 4Q3NA 4KLCA 5CT8A 1DC4A 5C1OA 3NJ4A 4B6SA 2JA2A 5J2UB 2AD5A 5DNDA 1HTTA 1BN6A 3KSRA 5JJIA 3OTWA 2EP5A 1P0PA 1A9XB 3EC1A 4X7BA 5CM2Z 3EE6A 3SLKA 4B5LA 3ZJUA 1GQ2A 1P2DA 4FSHA 2XBUA 5HRCA 1PR4A 1A9RA 1ZU5A 2JK1A 3BMXA 1GR1A 2RG1A 9LDTA 4HAWA 5FULA 4YRKA 2RAVA 4ZALA 5HTKA 5HE9A 2H29A 4JX9A 4JLOA 4JI1B 1P80A 5HUJA 1OYOA 4PC6A 1U94A 4MQ4A 3UVEA 3RSFA 1Z0AA 1XDZA 3D3WB 4TLLB 4P8RA 2DPGA 4V24A 2AWNA 3EFEA 3JQ7A 1M7HA 1ZO8A 1DQSA 1BCSA 2CL5A 2Y1KA 1L4MA 4DDHA 2MT9A 4PV7A 4YB8A 3W06A 3PEVA 4QFMA 5T4HA 3CVWA 1NI4A 5ISMA 2I4TA 3WNDA 1BRMA 1GNTA 2ECOA 4KVZA 3EXHC 5BSTA 4LF5B 3BJZA 3E8XA 3IBSA 5KHLB 1TW3A 1YOVB 2APJA 1SFRA 2O2DA 3GNQA 2C0QA 4ZVSA 4LBVA 5TB5A 1NF3A 4MPDA 3E8SA 3KQOA 1NP6A 4PLYA 1I1OA 2FMHA 4YHHB 3PEWA 4IJ5A 2UUBB 3FOBA 5K01A 4DNQA 2QG9A 2QP3A 3OEYA 3IRUA 5EWJA 4O02B 2FWJA 3QW4B 4FUTA 2NVUB 2NU6A 4UM8B 2ZVQX 1MJGA 1DAPA 4KVAA 4A5OA 2GFHA 4ENSA 2NSDA 1UWCA 4BNYA 2FNAA 1QHGA 4HGPA 1NN0A 2OBXA 4MVXA 1T8YA 2Q5JA 4HGOA 2Q3FA 2GZMA 4QNMA 5DT9A 2EX1A 3M6VA 3PWTA 3TZHA 4AJPA 3VU9B 2ZUSA 2WFMA 5B58C 5BQPA 1EINA 2G63A 3JQPA 1XO1A 1NYQA 4OQQA 5FR1A 2ETXA 1ZUHA 3ZIAA 4C76A 1T5HX 3QP9A 1VE6A 5B7QA 1DZIA 4EVSA 1MV5A 5L53A 1EXMA 2W83A 1ZICA 3DTNA 1U8ZA 3FRJA 2HSEA 1G9XA 3N87A 4ISBA 3OU6A 3ZWQA 4HG2A 4NL4H 1TVKA 2O07A 4IZHA 2HFKA 4RK1A 4I4TB 3OC6A 5B6PA 2VTKA 4FM9A 4IAOA 4YIKA 1S9HA 1ATZA 4XUDA 4UHEA 1VJDA 5EXTA 3OG9A 4OXXA 4FJ2A 3D0KA 8GPBA 3C45A 2A4MA 2YWCA 3A6DA 1RLJA 1X42A 1I8TA 4LJLA 4QBIA 1X1BA 5JTTA 3KNZA 3S2GA 1C41A 1XX6A 3QKSB 4M6WA 5BT9A 2XUHA 5BY2A 3BWEA 1EMDA 1EG7A 1YZQA 3ITKA 3BHJA 1HO3A 1XP5A 3BMQA 3Q1KA 1SVIA 2B7CA 3GP5A 5DXFA 2ARKA 2NV2B 1HT3A 1HT2E 1RHMA 2WOOA 3JRWA 2Z6UA 1G8MA 1GG2A 1VG8A 2HK6A 3ENQA 5IF3A 2FAXA 4YC7A 1RWKA 3HUDA 3VDQA 3PXCX 3EUEA 1G6HA 1QOQB 3UAVA 3UXEA 4E5DA 1AUPA 1LPBB 4PN3A 2RB5A 4JFAA 3GB9A 2O4CA 1J0XO 3PDUA 4MV0A 2QLLA 4EB0A 4O2BF 3Q3HA 1II0A 2RHGB 4WZBB 5AIAA 3GFGA 3JQGB 5JEEA 2AOUB 1B0ZA 2AMLA 3GFOA 4QNNA 2J7PA 4EL5A 4NXMB 3AP1A 3URMA 1QO7A 3FTQA 4Y9SA 2OHIA 3ZLTA 1WDLA 3GDHA 2ATXA 4LXTA 1O0BA 1E66A 5HHTA 5KQSA 1COWA 5B1HA 1ZITA 1GQRA 4WESB 3BBPA 3PEUA 4IUYA 3W0LB 1BZYA 4NZMA 4JVNA 1JU9A 5LN1A 4CTJA 3GJ4A 4W63A 1KSFX 2IIPA 5BO5A 2I1QA 5JE8A 4URFA 4CQLB 3KQLA 3GRRA 3PB3A 2WZCA 5HF6A 3R9IA 3QPAA 1L5OA 3VOTA 1E2MA 2H4JA 5F2NA 2JFOA 3RAGA 1UPCA 1O89A 2IU0A 4BFVA 3GQBA 4NFLA 4YRZA 1Y98A 3DE7X 5CYOA 3ZI7A 4BLRA 1MX5A 3VTFA 1KTIA 3UJCA 2CSXA 3QVGB 4J16C 3WL4A 1VLZA 4LWPA 4XD7D 1D0SA 2AXQA 1U2SA 3VHQA 2JI9A 2JIZA 3EY4A 3T9FA 2YUIA 4XARA 2XRMA 1LBSA 5AW0A 4IIFA 1VHWA 1YCGA 3FA2A 3HCWA 3PVZA 1FX0A 3MRTA 2QMQA 1VE5A 4UBLA 5EFOA 5EIWA 1JBKA 3MUEA 4QEKA 4C0QC 3VYWA 4DJTA 5I7FA 2QTWB 4KO2S 4N4AA 1NAHA 1R9MA 2CFIA 4LYFA 4ZWNA 3FNRA 1I4OA 1UK9A 2WB4A 3TX2A 1KEUA 2V45A 3BM5A 2RG7A 3CIOA 1RI4A 2CB0A 3GK3A 3RHTA 3T34A 3V7UA 3X0DA 1H1LA 1TDJA 3T3IA 2J3QA 4Q16A 2PZ8A 1A4XA 1NZDA 3BRQA 2PVSA 4IGEA 4PHHA 9ATCA 3TSWA 4AURA 3ESXA 5CPFA 5IAJA 1HYBA 2I71A 4DCOA 1UPUA 4FR5A 2VH1A 4ZN6A 1DEAA 4RTJA 1L7PA 4DT1A 4H4EA 1FS6A 3HB5X 2PGLA 1H05A 4FFSA 2Y68A 3KJQA 4DIUA 3E3AA 1R0XA 3F6SA 3UG6A 4KCGA 2RI0A 4IZOA 3REFA 1HE5A 4GICA 4LBZA 4P2BA 2YRFA 1DAHA 1KYTA 5TT1A 5HM8A 2HDNB 4MQUA 1OVMA 1ODJA 2GPTA 4IXTA 1U8FO 2QRLA 4KQGA 3GYGA 3KLOA 1N5LA 5CEEA 4LJRA 2DBYA 3KPWA 4LXQA 4MIOA 4QOIA 1N7JA 1SBYA 1SCNE 4RK4A 2BBSA 5HEKA 4KFCA 1PG2A 2BELA 4LJ7A 4PX3A 5EWLB 3TVDA 5IYZF 4C20A 4R41A 5I4IA 2HY7A 3MJTA 5IVDA 5L40A 1SA0B 2R8EA 2WQ7A 3HBFA 1GUBA 2G1JA 3KVVA 5FBLB 4R2WA 2X0JA 4GT1A 2R6ZA 4MGKR 4HI0E 2OCXA 3H5VA 4BKMA 4ILKA 4ZOLB 3WTBA 5KOHA 4HXYA 1YI8A 2IUTA 4QTZA 3RFVA 3D8NA 1H0KA 1JHZA 3NBXX 5JPDA 3FPCA 4ZT3A 4TMVA 3AY0A 3LV8A 5AXBA 3PCRB 2J4DA 5KX5A 1B74A 2FW6A 2ZJ8A 3CONA 3SM3A 3TLJA 4KSYA 1GGVA 4Z4IA 4TMFA 2H59A 2MINA 4EJFA 4J91A 3OC0A 4M9CA 5EXPA 3L4SO 4QOFA 5EJ9A 3BIXA 3KM0A 4LRUA 2QGFA 4P4SA 2C4WA 3BS4A 4YLEA 3KWJA 4TL7A 2PRIA 1CUFA 2FPIB 1KMIY 1VYTA 2VSXA 3G5TA 3WL5A 3NVKI 4GGPA 2LWIA 4GPBA 4I1RA 3VR5D 1R8SA 3R24A 2H0AA 3CJQA 3N7TA 4BNGA 2QD5A 4H1UA 4BCBA 4O4LF 1IEXA 2HWUA 4O0LA 3MIZA 4EW6A 2A57A 3A1NA 4EGQA 1JJ7A 3VV2A 1N25A 1VXRA 3S2UA 3E2IA 4EECA 3IE1A 4EEXA 1ZIOA 5MDHA 2OQRA 3L06A 1R6XA 2Z8ZA 3WLEA 1TM4E 2HQ1A 1IOVA 1SIUA 1M2VB 2OO7A 4XRGA 5WRFA 3GFFA 4OMFG 3ZUGA 5AW1A 1EZ1A 5IW8A 4MS4B 4N41A 2Q2WA 3PITA 4M0PA 2FWIA 5EN4A 2UZ0A 4LPSA 3W05A 2VA8A 2RC5A 3R74A 2PUWA 4G63A 3OPYI 4EG1A 2VDMB 1F8XA 4GP9A 1K86A 6AT1A 1T0PA 4B6EA 4LUCA 3E0XA 3DONA 3C74A 4W5WA 2E4UA 1DVRA 1A5AB 3LT2A 1T9DA 2IYNA 3FCSB 3T7JA 4BVAA 3EPHA 1J2RA 4YFVA 3ZVKA 3VHXA 4LNUB 2Z2XA 4YJGA 4FKBA 4NPHA 4S24A 1QG6A 4AMVA 1V8FA 3HI4A 4JNCA 4BJ6A 5KVVA 4JMPA 3AH8A 4X3PA 2AV6A 1H0HA 5FNZA 4QDTA 5L4SA 4D9HA 1PVOA 4YREA 1L3BA 4DR4B 1SOMA 3KKMA 4DCCA 3IE2A 4E2ZA 1BA2A 4IO1A 3H1BA 2R65A 4J3FA 3ZS9A 4BFTA 5CDYA 1BVHA 4F9TA 4E3ZA 3VU3A 4BATA 2WABA 1OXXK 3IA7A 5CDFA 4KQEA 1PLKA 3KQKA 4GOJA 1DCKA 5BWLA 1DO2A 5DYTA 3GOQA 3I8OA 5KDOA 1L7OA 4ZVTA 1OOEA 1VDMA 2Q5IA 3C6YA 4Z2AA 3H65A 1LH0A 3C87A 3JRXA 4JJ7A 4XWGA 3BF7A 4J7XA 3FOAA 3CSUA 3KEFA 3M6XA 5D3KA 3G0IA 4E4RA 1OW3B 2ORWA 1K8RA 4KDRA 2NO5A 3WRVA 2NU8A 4DC0A 1MVNA 3LWNA 1KY2A 2EQBA 3FZEA 4KIGA 3G2NA 3VX3A 1E62A 1W2GA 3R40A 1YFKA 5TQVA 5JT1A 4F21A 3N5KA 1JR3A 1UPTA 4NCHA 1NURA 1QX4A 1UR5A 2GJSA 2ZIGA 3JZIA 3QOXA 2JBAA 2CVZA 5IMSA 1Y7PA 3INGA 4N7BA 2JAWA 4FGWA 2FP4B 1CXZA 4PC2A 4MX8A 2EP8A 4EY5A 4PAWA 5FLXA 2H3HA 4UNNA 1NOJA 4Y2TA 3E9DA 5AM4A 3ONDA 5DM0A 1NTOA 3R2JA 5C37A 2WA1A 3GGJA 1C9EA 4JY7A 1GTMA 4P3NA 4F1JA 5BV0A 1FBTA 3AVPA 4Y2JA 821PA 4U2BA 4HATA 1NYTA 2E5WA 3DTVB 3PUIA 3FWZA 3HRKA 4GXNA 4QRIA 3K09A 1USVA 2BEWA 5SY6A 4AJ1A 5F1PA 2RHBA 5JD3A 4IX9A 3FGOA 4Q9LA 2R6CA 2EGGA 1NBEA 4I5EA 2IQIA 2HU7A 2VDJA 2D59A 3ZXYA 5FTWA 3HWWA 1NI4B 1SBIA 1MV8A 4BQQA 2CDBA 1NW6A 2E6KA 1RAGA 1YCDA 1MVLA 1ZMBA 5FUBA 4B3FX 1T2CA 1L5YA 1XQXA 2ZXEA 2HB6A 4P34A 4OKNA 1QK4A 1Y9EA 2OA0A 1DBIA 4PIVA 2OPHA 3R7LA 4BRUA 1O6FA 3G7NA 1XVLA 4Z6KA 2V7GA 1SZPA 3G8DA 5ILGA 3EZ7A 2YMPA 4TQUS 5EKSA 3TNDA 2RHJA 2OCYC 3SSMA 3UMCA 1H9CA 3UAZA 1JDJA 1TAUA 1DJNA 4QU8A 4DV7B 5H1YA 2XE8A 3HACA 3VR2D 1VBFA 5CVTA 4U63A 5L6LB 3U60B 3MTBA 3TSAA 4DQKA 4I5FA 4TKZA 4IJMA 4E5NA 1KH2A 5BMVA 2AMJA 2VJDA 1G6Q1 4Q1EA 3U3XA 1JDVA 2VAXA 4HFJA 3PC8A 1O58A 3GFBA 4QYXA 2VUIB 4FHDA 2I8LA 4KI0A 3JWIA 3NT5A 2JGAA 1JSRA 1YZ3A 3K32A 5HW0A 2Z3WA 4IIXA 4AIRA 2YW2A 1E3EA 5DCLA 1IEWA 5BNTA 1PUXA 5KVQA 2Y8EA 1GVHA 2IVZA 1HQYE 3IPAA 1Q57A 4PGHA 3SF8A 4X24A 3G17A 2WUEA 4HB4A 3K4QA 3A7EA 4X6XA 2HU5A 3V9AA 4RGQA 4EFKA 2OGSA 2SNIE 1T9CA 1YRAA 3OP4A 3R20A 5ITZB 1QIGA 2FPPA 2XYQA 1RR6A 1TYDE 3REQA 4ZYTA 1LLCA 2O3SA 4M6WB 1THGA 3H6GA 2J3LA 3WLMA 3O31A 4O2RA 3EDMA 5DHFA 2PS3A 4R9UC 3ZE6A 2PK3A 1IHPA 4OIMA 2WWXA 4OGLA 1WAMA 2Q1SA 3THXA 1BYUA 1KFJB 1DOHA 3BMQB 1FDIA 4TS9A 3SY8A 5A2QA 3SX2A 3B7WA 2JGFA 3KPUA 3UMJA 1FVXA 1V4VA 1VGVA 2Q62A 2TRSB 3DMRA 3KSZO 5K2MA 3UB2A 3VFDA 2C2BA 2ZJBA 3UUWA 4AZWA 5GAJA 2FSVA 4JYBA 2DJ5A 2YZ7A 2Q41A 4TT3D 4CKZA 2X40A 3WLLA 4KOEC 2AUTA 1I3KA 5DW3A 4LXHA 3RVOA 1RAEA 2B7BA 2NLOA 1UXKA 5IXSA 4FEAA 2QI9F 1WB5A 2UZ1B 2VPIA 4UD2A 1OI2A 2HV8A 1G5PA 5KS2A 5ESDA 1H66A 2X6RA 2FUNB 3NBUA 4K46A 1VLJA 5JQGA 2PKYX 2C5AA 5JMWA 2O20A 1W36D 5UKDA 1ABBA 3WLOA 2AR9A 1XQ9A 3Q87B 3PE6A 4NYJR 4NPAA 5BN4B 4EDFA 3LIIA 1JR6A 5FTLA 4P81A 1EWVA 3CM0A 1C1DA 2VUTA 1PJSA 3H87A 3K72B 3D1VA 1BE0A 1ORIA 4DXHA 1EKXA 1O03A 1Y6GA 4R05A 1Y4AE 2ETVA 3FUXA 2IYLD 3QFSA 5E0KB 3B2QA 1F06A 1NULA 2HKIA 3K0AA 3KQWA 4MCHA 1KWKA 1MFPA 1FFBA 2Q1YA 3UC9A 1I2DA 3N0RA 4J0CA 2XJ4A 4KWCA 2PUBA 2QMZA 3LQ4A 4FI3F 1W9MA 3A6GA 3GQBB 2M9MA 2GAAA 2ZE7A 4M1SA 2IEBA 5FOUA 1O8CA 1I1HA 1RI5A 3DLIA 4ES6A 5GTDA 4PNHA 5A05A 2P77A 5EIBD 4Q1BA 4WJLA 3EF0A 2QRJA 1UZNA 2WE8A 3GWGA 3NDIA 3A9RA 3PEFA 4G65A 4ZQIA 1ARZA 1NVVR 4Q3DA 3VR0A 1TX4B 3ZE1B 1Z07A 3KYIB 4AWAA 1RLTA 3T38A 1STOA 3WHPA 1W0KA 2A5LA 2HF7A 3AK4A 4MK4A 2YNMD 4HNVA 3BSWA 4R8VA 1YJBA 3VM6A 1EB9A 3KDSE 2AZDA 1EBUA 1WKCA 3U4MA 3O21A 2I62A 2WOJA 3GUUA 2FMKA 4WCFA 1PT5A 1R0BA 4L51A 4UEJA 4YAWA 2BP7A 4DG8A 3IKTA 3MWEA 2NMVA 3ZCRA 4AZ0A 4QHYA 1UDCA 2JW5A 3WLTA 2B37A 2J3JA 2NTEA 1ABFA 3ZZ0A 3O82A 4E7PA 1PZHA 1S01A 3E1KA 3IOCA 3GRKA 4TTVA 4YCNA 4HT3B 1TCUA 4J0DA 1VL2A 4Z4FA 2FW7A 2GEUA 1E8DA 5AKXA 1P3DA 2DBVO 2G9VA 3HYCA 2E21A 4JR0A 5EA2A 1PD1A 3SYNA 1G2QA 3VU1A 4DIDA 4ER7A 4EFDA 4KQCA 4M7RA 2FMTA 1CR6A 4R3WA 3E9MA 2VK1A 2O52A 4TVBA 3RUFA 4HPXB 1ACMA 2P3OA 3DMGA 4DDVA 3O8OB 1IXZA 1EB8A 4ZO4A 3HN6A 1UDRA 4NZNA 4OSOA 2XIQA 3P0HA 1ATIA 1HYEA 3SX4A 1JIXA 1KMCA 5TMDA 4BBAA 5LMZA 2EWMA 5A9RA 3NOVA 4OX9Y 5B37A 5H4GA 1VSUA 5EIBC 2JI6A 2LGJA 2Z5GA 4FHCA 2VL7A 1G6KA 3NIWA 1G8PA 2JZCA 3QA3E 4TOIA 3TRIA 5KOHB 1Z88A 3EHDA 1KJ8A 1KO8A 3RKRA 3FVRA 3AEKB 3PU6A 4GKVA 4BVBA 5CBPA 1UKYA 2R8ZA 1AZLA 3OX1A 2YNMC 4GF5A 1LBIA 4J0JA 1S2MA 1ZNWA 3USCS 4JA2A 2HZ7A 1EDDA 2B8JA 2MINB 4HTAA 4WLNA 4XIGS 4KR9A 5E1MA 2KMLA 5IBPA 2DUNA 2P4HX 2QPOA 2L2QA 4ZQGA 3ZPXA 5LFAA 2ZIVB 5C32A 4E22A 9ABPA 4KGXA 5D3QA 4P4SB 4B4VA 2ZIAA 3FZYA 2Q5QA 4Y3UA 1EDZA 1PDWA 3HXMA 3B5JA 4XUEA 4GKBA 4HDQB 1PWEA 16PKA 1EBFA 1OT5A 2ZKIA 4MYCA 5AM0A 2IHTA 4CM4A 1RYBA 1TJ5A 4I1UA 2CWWA 3ZCPA 2CFCA 1QVRA 3BSYA 4CMIA 4EPRA 1VSTA 3GGGA 1V8ZA 4ZHQF 1S89A 1KJWA 2PZLA 2ZE6A 3EBLA 2JLWA 2WTEA 4ZMSA 2F3SA 2Q28A 3ZBUA 5ALDA 2PR2A 5ECYA 4OLBA 1XA3A 3E5RA 2CW5A 3DVSX 1ISPA 1EVYA 3A05A 4HN9A 2YC2C 1IZ8A 4OHXA 3LYLA 3BXXA 4S1NA 4RNDB 3PDJA 2GEDA 1BRTA 1EHCA 1UJBA 1W25A 4IDNA 4U9UA 3GJYA 3ZE0B 4CG3A 3ONWA 3SDSA 4NU0A 1ZOIA 1UBNA 4MIYA 4EDHA 2Z9CA 4Q4JA 5AW2A 1DJPA 3D02A 2C8LA 5KQLA 1PQUA 1UFOA 3U48A 1IXRC 3EZLA 2OZPA 1MD9A 2QBYB 2POQX 1EVEA 3EUAA 4G5GA 4BKRA 3QITA 3TOSA 3F2IA 5HBGA 2WIKA 4HUTA 2WG1A 3VHXB 5FF9A 3HE3A 2W0MA 3AY7A 3CRMA 2AI1A 3H6KA 2ZTUA 1T3ZA 4FHZA 5ALXA 1L5KA 4TSFD 1UBJS 1GUYA 1DFHA 2RGNC 2PVCA 1D07A 2D1YA 2R1TB 3LQFA 2GXQA 3OM8A 4CKCA 3HKCA 1DAFA 5CVEA 3B2NA 3TLKA 3V8VA 5LQAA 3OVMA 2EBFX 5HK8A 1ZHOA 5TJHA 3VR5H 1NF9A 3I6QA 2XB2A 1JR2A 4WJKB 3DEKA 2XAAA 5CLIA 1YQ9A 1CJUC 3CR8A 4BPBA 3RS9A 5BWOA 3QWAA 3L8ZA 7MHTA 3I9LA 1ZGZA 3JWEA 2V6MA 4I1SA 4GDFA 3HH8A 1OXTA 1BE8A 2XNDD 2ZJZA 4H7IA 1XZLA 2CCGA 1AKEA 1QFMA 3I01A 4QXMA 5LU9A 2CXSA 2ZJ7A 3OZSA 3WL7A 4HLNA 1OXSC 2BT4A 2I0FA 3AUYA 4G0XA 1BKDR 4GG1A 3IIEA 4GBED 3TJZA 5CVJA 4C0LA 3F78A 2Q4RA 4E5KA 3FDJA 4MPRA 3OCCA 3Q15C 1G0NA 1PLLA 3DTYA 5IVPA 1P0FA 1V8OA 2OBLA 3A28A 1DC7A 4FDVA 2Z30A 1EA5A 4IHKA 4K9LA 5AK5A 5E7JA 1JDNA 1HM5A 1A88A 2R1ZA 2J3IA 3K0FB 4RZXA 3DOJA 3IT3A 5GOTA 3CA8A 3VKGA 2NSLA 1C7FA 1KP2A 2WPDD 3QRWA 1FFXA 4F8EA 1YIDA 2JBAB 4NZZA 3W04A 4WMLA 5KTRA 4O2AB 4UUAA 1WMEA 1MZPA 4XYMA 1PWZA 3L7IA 4CT5A 3ETHA 1CFZA 1MAHA 4QOHA 4ZODA 1HFKA 4H35A 2AEFA 1QB8A 2V65A 4L5JA 4BASA 1W8IA 1YWGO 4R81A 4TVKA 2Q21A 1VPEA 3O7WA 3ID6C 1B3BA 2F3RA 3PEEA 1XVTA 4H4DA 4LG1A 1OHHD 2GCNA 1WUKS 1NUAA 2BEWB 4M9UA 4Q9IA 4A0SA 3DWGA 1J8VA 3JZDA 4I66A 1JX6A 4LZOA 1EGHA 3P71T 1H5NA 1MBZA 1NUHA 1BVRA 5C8DA 1SKMA 4QLOA 3BORA 4MYDA 3BX1A 3DZCA 3L40A 2V7QA 1U9ZA 3EWAA 2XODA 4Q4AB 5CFLA 2DQYA 2IEYA 1NXOA 3AR8A 1NG1A 1SHJA 1R0YA 3LK6A 1J23A 3N70A 1E4VA 4QQKA 3RC7A 4MJLA 3RC1A 3ML1A 3TMKA 3BXGA 3LUJA 3T0GA 3RVSA 2AS0A 3GJ3A 1IJBA 1ZIYA 1DIAA 4C4TA 3A1CA 2CHEA 1BFUA 3IP7A 3AEXA 1OCEA 3K16A 3QLJA 2AE2A 3D4IA 4GPZA 1I14A 1NJ5A 2I6XA 3BJMA 3K8OE 4NAUA 5HJ5A 4PN7A 1KQPA 1RXCA 3NQ41 1HE8B 2LUOA 3EFHA 3TXXA 3TG2A 4JL5A 1CR2A 4ARUA 4E14A 5DT2A 1YS2X 1F2TA 3LY5A 3W4IA 3K5HA 5DYIA 5JRDS 2V7EA 2GO7A 2ZYWX 4AUNA 2XEDA 1QKKA 2HUNA 1DFGA 1QZUA 2HBZA 4S1TA 5BMVB 1VJ5A 1NXTA 1PT7A 5FWYB 1XDUA 2VVTA 3IMGA 4G41A 2C83A 1G1AA 3VKVA 3GAFA 1KK1A 3BHIA 4EGCB 4TTQA 1FC0A 1R6TA 2ZETA 3OQHA 5B7GA 3GJXC 1PVVA 3OPYA 5IT4A 2FEKA 4A0GA 3HM9A 2FSHA 2CUZA 4FOPA 2VSFA 3M4YA 2YINC 4UE6A 5DHTA 5KI6A 1MPXA 2WF6A 1TZKA 4KAJA 1NBMD 2PX0A 1CQIA 3IT0A 4NBRA 3FZQA 2IYZA 1IUOA 3SR0A 1J07A 4PY2A 1Q1QA 1CQXA 3JWHA 2IEZA 3NFYA 3TTSA 4YCSA 3E3LA 1J9EA 1N1MA 3ADBA 3U7GA 4LISA 2HJVA 3BWYA 1DUVG 2JPDA 4G8CA 5C53B 4MI1A 2MR6A 3HY3A 2ZR8A 2NZVG 2FPPB 4UATA 3FDFA 3REQB 1TVMA 1NNLA 4JLUA 1JKXA 3LQRA 4QQFA 3AZOA 5J5VA 2VXCA 3F46A 5JDIA 3GGPA 4U5XA 4YV0A 2PGDA 1H6DA 4M46A 2BHSA 3MJCA 3OIYA 4RCZA 5DCYA 3ANNA 5K4HA 1XAJA 3U49A 1YQWA 2X15A 5THXA 4DQDA 2CV0A 1IDN1 1PKEA 3THXB 1WB4A 3KUDA 2VT6A 4B3DA 2QW0X 1G4HA 2CK3D 2ZDHA 3KAJA 3O4HA 3UHAA 1P2FA 3KB1A 4GKAA 3PHJA 4XQGA 1BVYF 2DWUA 5LYYA 1ZNYA 2PBLA 3RAJA 3EDQA 1OLSB 4BKQA 1P5HA 5AMXA 4AKHA 3W3ZB 2QTVB 4QTUB 4ZT7A 1GLGA 2P5UA 1KEZA 2H65A 2PL3A 4MGZR 5LP6F 1VKZA 1LSSA 2GXSA 2Y71A 3OPQA 3ZI0A 4MUYA 5IBCA 2R79A 4D79A 1A1VA 1CHNA 1JG3A 5ED0A 3SI7A 4E32A 5C5CA 5ICGA 4L4SA 1PJBA 2DHEA 4Y2HA 5KPJA 3L5OA 2ZT6A 2CNWA 1SY7A 1C3OA 3SBDA 1LFAA 1KY4A 1Z2EA 2BWJA 2Q6TA 2QPTA 2A1TS 1FNMA 4FFRA 1P1RA 2QZZA 1OZGA 2VFAA 4Y2SA 3V8EA 2BONA 4RCVA 4RSRA 5CVUA 1OBVA 1C1DB 4MMYB 2ZI5A 4GLLA 3RUCA 2GHRA 3LLUA 4QDZA 5TPZD 5LWQA 3Q8LA 2XCUA 1DOZA 2IXFA 2OHFA 1R5NA 3AHHA 1U7OA 5L51A 1UWLA 2HO5A 3TQTA 1GUZA 3K0AB 4DSUA 4LNHA 1TLTA 3QE0A 3E7DA 4UTVA 3DPUA 1JJIA 1Q1ZA 1GZ5A 1OA1A 4DV2B 3PYMA 1TPYA 2E1RA 1SPXA 4HL6A 2NUTA 4IOMA 3JV7A 1MA0A 1K8ZB 3IBGA 4P5PA 1NU8A 2BUBA 3QFHA 3PIIA 5J3JA 4XGIA 1W5AA 3EW9A 4D25A 1A8PA 1TVCA 3LDUA 4TRNA 3WGLA 1U98A 3MUOA 5E95A 2F1HA 1PFGA 2IZ1A 5IH3A 2A5JA 2CJFA 2J33A 3ZCTA 1E4EA 4ALJA 4KQ1A 1HNWB 1VHTA 1C30B 3ZKWB 4DLXA 1ST2A 5DX8A 3EASA 4R7TA 5ALYA 3J81A 1CIJA 3V2UA 4EENA 3L4BA 3NC4A 1KDRA 4FYWA 4X85A 2DHDA 1M74A 2KYRA 5F51A 4IYJA 2G6TA 3F5QA 3RASA 2BP7B 1YRHA 3MWEB 1R0ZA 4G4SP 4KHZA 1CY7A 1SG0A 2J9XB 2XUQA 4RY8A 4BAGA 4GBGA 3KOZA 2F1RA 4A27A 1V26A 3GJ7A 3ILXA 4FYKA 4K6HA 5IYZA 3O9MA 1PFUA 3JQFA 1KRWA 3GPCA 2X8JA 1KDPA 2W70A 3FROA 1K63A 1KGDA 1O6GA 1PJZA 1V48A 4LYDA 2IW1A 4NWIA 3L0DA 4NS1A 4O4JA 4MW7A 1IBCA 4AX8A 1M6VA 4W1QA 3SSOA 3A6JA 4H3HB 2RB4A 1SVMA 3B85A 1BJRE 4LAFA 1UDWA 2Z9DA 1A9SA 1KVSA 2YHBA 3VJRA 2FSPA 2R68A 4LSGA 4AN1A 1BU5A 2FSVC 1IU9A 3IESA 1EA7A 1FVOA 1M54A 1TU4A 3U26A 1FIUA 3FTFA 2WJAA 4R31A 1ZCZA 1WF6A 2ADMA 3G9TA 1Y3DE 2W6QA 2YN2A 5DISB 1X7WB 4L76A 4DMHA 2JHGA 1KC1A 1C3XA 1QFSA 4I99A 1ZJ5A 1N9ZA 1QFYA 1PBTA 2P9EA 5JCZA 2J07A 4KWHA 3VMMA 4ARCA 1OI3A 2CZCA 3X1ZA 2QX4A 2PRJA 4TV8F 2Y1OA 1JG2A 1N2CA 1T36B 2QUZA 1DP4A 2X6QA 3I9JA 3IDZA 4D43A 1AX9A 1HZZC 3BCSA 3HNOA 4KK3A 4GQIA 1OGIA 5C1BA 4F3NA 2GPNA 1IHYA 1PSZA 3RVPA 4AN4A 4RD0A 1T3LA 4NFSA 3TRDA 2WG2A 3EQ2A 2HMSA 4REQB 2H1RA 1V25A 2CFTA 5REQA 5JATA 2YFKA 4HD8A 5GINE 1WCIA 4RIIA 4L2IB 5HF5A 3PF8A 1UBMS 2F62A 5SV2A 4BRZA 2H8KA 1P62B 2R3SA 1MB2A 2DLNA 4HDAA 2X4DA 1SXJB 1AHNA 3ICPA 5D86A 5KNDA 4MUHA 3CEHA 4Q7EA 3T3PB 4MEJA 5AVQA 1SUFA 1IQ0A 1XXHE 4JJ6A 3V7WA 3OLCX 5HZMA 5A04A 1KYYA 2R751 1QRSA 1TB4A 4EGFA 2J08A 4CM4B 5CVDA 3O94A 4ZAXA 5EE1A 2XMZA 4MR9A 1X74A 5KJEA 2XUFA 2J7KA 1AGYA 2NZ8A 4LRXA 1FP4B 5DBOA 3Q3VA 4KR7A 4Q3AA 4MHSA 4L8YA 4Y6RA 2PFKA 2HJGA 5DZSA 2XKAA 2QAGB 5BR1A 2XWSA 4D26A 3K0CC 1V16A 3IEPA 4UAGA 3SYMA 5HQTA 1RT9A 2NSJA 4Y18A 2AZTA 1RC0A 3PPWA 2RBEA 4DJAA 2HLDD 1DKOA 3DBRB 1I5RA 3MB8A 2V6BA 2FR1A 4KO8A 4YMLA 2CXRA 2C9ZA 3AHEA 4L22A 4F8JA 4UDYX 2ACEA 4HNUA 4Q4JB 1EFVB 3NIGB 1DJOA 1DQPA 2FJPA 3A3KA 4DIEA 3NXSA 1T0HB 3TPCA 1NZFA 2G5GX 4HNTA 3RE1A 1Y48E 3ODGA 4K28A 1Z8FA 5IT9A 3W4KA 5BSVA 2FQ1A 2IS4A 4O2AF 4UBMA 4AJOA 4CCSA 3E7PA 3ZTYA 5IVKA 1GILA 1F60A 1KJNA 2XE7A 3NI2A 4L85A 1JZSA 2XMBA 4UU1A 4PGFA 1JA1A 5I7WA 4M1OA 1H4TA 1OV4A 1X94A 1G55A 3DZBA 3H4IA 2W58A 3HKCB 1NP7A 3JWPA 2XT0A 3UWDA 3T1HB 5EJIA 3GEMA 3C3MA 5TNXA 4UOQA 4QXRA 2GO1A 4LDZA 3KQPA 1IJFA 2GD0A 3O8LA 4O4IF 3PF9A 3F73A 1Z35A 4BZZA 1VE1A 2OHVA 2V74B 4L74A 1RZRD 1QWSA 2TMDA 5AVOA 1FF9A 5BWMA 3H42B 4Y0AA 5ES3A 4KDFA 4EHNA 2GYUA 1KK2A 2JJ1A 3JSXA 5K6AA 2C2YA 3GJTA 2FZ5A 4LY6A 1JT2A 2KJQA 3ASZA 4OK6A 5C5IA 5JNSA 3DZIA 3QKTA 2M2IA 4XIYA 3UJ6A 4JB8A 1QB7A 1VPLA 1RXYA 1AV7A 4XA8A 4Q19A 2W6PA 4L27A 1C7QA 1XVUA 1XZQA 2QTZA 4R54A 3V32A 3VNQA 3PI6A 3GXOA 1C7ZA 1KBZA 2PMEA 1SWWA 2QRVA 4L6AA 4C7JA 3HTXA 3IMCA 4NCXA 4PS0A 1RHUA 1AN0A 1Z82A 4KXWA 1KARA 2C82A 3TIIA 5A4DA 3IQFA 1H3NA 2O8VA 1F8YA 1G3UA 1HT1E 2R5WA 3NNNA 1QE3A 3GVPA 3QVMA 4GYWA 1QAQA 4ZZIA 1NSTA 5EYPB 4UULA 1TADA 4FYIA 4IHJA 4B6QA 3H99A 3V8NA 2PXXA 5C46F 4PXSA 1USKA 1FPMA 1Q83A 2HSWA 3SFVA 1E2QA 2CLHB 5CW1A 2QZJA 5G1PA 2N1BA 3EEBA 1UANA 3F49S 1UM9A 4NNJA 4A1FA 3EIEA 3RSCA 3I3SR 4AZ3A 4BBPA 4C0KA 3EWNA 3QSYA 3VNVA 5GZ6A 4BVGA 4HEA1 2PDAA 3CTPA 2OV3A 1J8MF 5E3IA 3Q11A 2ASVA 3BWBA 1FQOA 1Z6QA 4G1EB 1PL7A 4JLDA 2WYHA 3NGXA 1JXMA 4RD6A 4NV3A 5EMLA 4NI5A 5CYFA 2ZE8A 3WYDA 3B9RA 5BR4A 4AB1A 2B6HA 3KZOA 2A7QA 2VZ8A 4AS2A 1XCLA 4ZC8A 4FFOA 4UVGA 2QXUA 4MKZA 4P08A 1KOLA 3U4GA 1ESEA 1FFSA 2CZGA 4Y67A 4HWTA 1Y8RA 3ETJA 1B7GO 3PZBA 2VYCA 4UUOA 5J2TF 3TQRA 2PUEA 1IM8A 1WP9A 3EA5A 2P41A 1F2DA 2X8LA 4LI3X 4UBIA 5B2ZA 4QXPA 4I6GA 4URXR 3Q5GA 1BN7A 4YTEA 4HR7A 1T4DA 4D41A 1M83A 3G8AA 2ON6A 3BF8A 4G2TA 1F38A 5DWVA 2K7FA 3FTPA 1LKZA 1V1MA 2O0LA 3AXSA 5JNVA 1E9RA 2VPWA 3CGGA 2Q7XA 3SQNA 4C6RA 4DHWA 2QT0A 4B4DA 4Q1AA 1Y37A 1L2TA 4MSUA 5TF0A 3U3DA 3BTUA 4IEFB 2C59A 3S1SA 3R8FA 3I04A 2D8MA 2ZRJA 3OPYB 1IZ7A 2IDJA 3FVQA 4O59O 5EZ5A 2PYIA 4IJQA 5FFNA 3WSWA 3K1YA 1FP7A 2XSZD 2Z43A 1NM5C 1JW9B 1UP6A 1Y9ZA 4I9FA 2I91A 1EFHA 1CQIB 1KVUA 3GEPA 1C5KA 3R09A 1Q7TA 1T2VA 4A2QA 4OQFA 4O1IA 3M1IA 3ORHA 3ZGZA 1YDMA 3PFWO 1B2RA 2Q2VA 1O3YA 1KYQA 3BBLA 1T3SA 4ICIA 3HJRA 4X6LA 3WX0A 1MH1A 1H6CA 1PK9A 1FLDA 2OC9A 5B3JC 2X9VA 2H00A 4M98A 2IEIA 3IOBA 4PX9A 1GM5A 3OZBA 3GLFA 3QX7A 2PD4A 2YV2A 3MGAA 3PHCA 2QRHA 2NU9A 4MB0A 4Q9AA 1NVMB 2DZDA 1L3IA 2EZ8A 1CRWG 3A3NA 4TROA 5EAIA 2QN1A 5T3YA 4GZ6A 1Q7BA 2X1HA 3D59A 3C8MA 5LMUB 3D7KA 3GUHA 1DBPA 4Y9RA 4ME6A 1IPFA 2X3UA 3FI0A 1O87A 3T3MB 5BV1A 4V0KA 1ZK0A 2WWGA 3LZ6A 3T5CA 4Z5XA 2H7VA 3L8MA 1HFJA 1ZJZA 4HEA6 2WKRA 3PHHA 4PG7A 4WLUA 3SE7A 5EZ6B 3VGJA 3B5EA 2GERA 3R7NA 2YWBA 2JKYA 5TGDA 1NUTA 3LYHA 3CN9A 4GVXA 4AZTA 1U0SY 4Z4QA 3NTXA 1XLUA 1XQVA 1RADA 4NIMA 4P93A 1C3OB 4G5SA 4BNKA 1ONSA 2WMDA 2WYOA 1Z4NA 4KBGA 2B20A 2JLSA 3CRW1 5FO1A 2IF0A 1XRLA 1F3LA 3W6PA 4YUWA 4I8DA 1OSNA 4DEVA 1PYOA 1ZPDA 4YALA 5JXWA 2AG0A 2R6AA 3KXIA 1TO1E 3PDCA 4YDSA 3TAHA 2P3QA 1MGOA 1CQPA 4EG4A 3HUFA 1NWHA 6ABPA 3A14A 1E9VA 2CEKA 1FU7A 5JHGB 3GYBA 1FUUA 1L4YA 5JRZA 2C2HA 5K0TA 3D5EA 4B6JA 5IHXA 3KQMA 2I3AA 3X1KA 4A15A 4NQRA 10MHA 2NUTB 3CLUD 3ACBA 4DLZA 3H2JA 2OCKA 3O1IC 3ROTA 3ZHQA 1D2NA 3LRXA 1MC8A 1Y5LA 3N59A 1ULHA 4JV5B 2Z4RA 2P2CA 3BMOA 4EPVA 1XTBA 2RHWA 1NW7A 4MP8A 4QDUA 4QYMA 1P5JA 4BQSA 1K5DA 1N9KA 2C5GA 4B4KA 4BO7A 1FY2A 1E4EB 4NVRA 5CH5A 4BMSA 4PINA 4AG5A 4P6VF 5A2GA 3P9RA 1XZFA 3KOUA 1RVV1 2ZSIA 5JZSA 3DWFA 5DH9A 3EWSA 1RRVA 4OAQA 5E3HA 1J5PA 2YV4A 3L05A 2NZWA 3DD5A 3HDQA 1PGOA 3SEQA 1ES9A 3V4LA 5LM3A 2GM9A 3JTEA 2Q50A 3GLHE 1QG0A 3NIDB 1LK7A 5CFRA 4R0NA 3K2BA 1FPQA 4UXJA 4ZO9A 5TQJA 4B35A 5I4KA 4CV3A 5C5EA 4Q37A 3L7AA 2X77A 2X8JB 2XUOA 1EUCA 2DFPA 3GLIA 2ISQA 4O4JB 3GVIA 1AV6A 4CR6A 5K0ZA 4OJMX 4W7HA 1U5BA 2C1EA 3LGAA 4ZT2A 2GRJA 1MEJA 1YMQA 2J3KA 1L5GB 4ZIRB 3NT2A 5KQPA 2BHTA 1KI8A 1M6HA 3JWJA 2DH6A 1MTOA 4GBJA 1U1FA 3P97A 2V03A 4NESA 1DEOA 2O6LA 2FUG1 3CKMA 4I50A 1P1FA 1ZQ1A 2V58A 4K6MA 2Q7DA 1TFUA 4PSAA 4UAJA 1I1NA 2N42A 3PUWA 3CLUC 4QGBA 2C9BA 1KRHA 4TZKA 3ZWAA 2RD2A 2JFWA 1P4RA 3KLPX 2VF8A 1Q3KA 1N2CB 4ZZ0A 1Y5RA 4URWR 4AMYA 3CJTA 3OHMA 4WE3A 3K1ZA 4CBVA 3W5CA 4J2OA 2FG5A 2YVLA 1IBRA 5KTMA 2UAGA 3ZE7A 1RVDA 3IE0A 1QQ7A 3OOJA 1XK6A 2XZTA 3RH0A 3BK2A 2O05A 2PH5A 4XFJA 5REQB 3E7WA 3A6KA 1KERA 5GQSA 5FX2A 3AR2A 2FP3A 3ISJA 3T0IA 5DFAA 4QYSA 1RC1A 3MBKA 2G77B 2BMJA 3DZGA 4AY5A 1W5TA 4O8CA 1XEWX 3DE4X 3QUSA 4W1RA 4R84A 4OVKA 3S70A 3MSXA 1YL6A 2C95A 3A4MA 3PYXA 5HP4A 1U31A 4MV6A 2XF2A 1OXBB 3OUUA 2OECA 3RU3A 1JXOA 1E8NA 4MVWA 1VIDA 3BIWA 1W73A 2ZTMA 3PGKA 4PQGA 4EJMA 1T24A 4HDSA 3M3PA 5K6RA 4CF3A 4MR9B 4EMUA 4LVNA 1IN5A 5I8PA 2C4TA 1ANKA 3C41J 3DOFA 3H0CA 3R5FA 3VOBA 2RE8A 2HT1A 2WHYA 1Z4KA 1UMBB 2QVZX 1DJQA 4RFLA 5K0BA 4I3FA 4ZCQA 3F4LA 3SZUA 2CHGA 3UV6A 5DVZA 4EF5A 3VZPA 1F9EA 1RHJA 4L6IA 5IVHA 3O2SB 4D9CA 3CEJA 1MO4A 4PVDA 1EXWA 2W8ZA 4KGVA 4F7DA 4D80A 5LQMA 2B98A 4IKOA 5D7BA 3EJWA 3O7MA 3S2ZA 4PNEA 2ZRLA 3UJPA 3ND5A 4CM8A 4HWKA 2CD7A 1Y8ZA 5AHWA 4HRYA 2GLTA 4BHTA 3Q5EA 3DT9A 4LJKA 1WZCA 1YK0A 3LKZA 1EIWA 1NQAO 3INYA 3VAYA 4CETA 5EJ5A 2ODNA 2ZU0C 4IIGA 3O74A 1OR8A 5GADl 3E7XA 1GV1A 2A0XA 1M6NA 2QL9A 3WB2A 3FWKA 5EZQA 2JFBA 3ZVMA 4QHTA 3SAJA 1A71A 4BFLA 3BIJA 1CJMA 3QMMA 5LDDC 2D3TA 5G4KB 3FBTA 4B8ZA 3QI2A 1J2TA 5L3SA 1GPUA 3WLKX 1C0EA 4BE7B 3OETA 3D5QA 3L7DA 2QPLA 1D2RA 1SKBA 5I5GA 2K7ZA 4QYTA 4DR5B 2FUG6 1R9JA 5G0SA 2F3QA 4MJ3A 4QO7A 3TEJA 5KJFA 1YZUA 4JBWA 1TM3E 4RETA 3TTVA 3LVRE 2QSYA 4OY3A 1DUIA 1XLTA 4EPWA 1YVPA 2CL6X 5DMHA 4BMYA 3CZCA 2BMFA 2C7VA 1YS6A 3JYNA 1KQGA 4MCIA 2O2HA 3JYPA 1R0SA 5DIZA 2F1JA 2H1VA 4ZHSA 2P9HA 1W1UA 5J4HA 3AEYA 3COZA 5KINB 1NV8A 4IIUA 3WGOA