2VOJA

Ternary complex of m. tuberculosis rv2780 with nad and pyruvate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Crystal Structures of the Mycobacterium Tuberculosis Secretory Antigen Alanine Dehydrogenase (Rv2780) in Apo and Ternary Complex Forms Captures "Open" and "Closed" Enzyme Conformations.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 119
structure length 371
sequence length 371
chains with identical sequence C, E
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA02
1ZSVA 3EZLA 4IDGA 5L4LA 3ENNA 1NPTO 3DBRB 5COAA 3WYEA 3NT4A 3PI7A 4R68A 3BHIA 4MVJH 2Q50A 4MKZA 5DDIP 3QP9A 1ARZA 1SPXA 4HADA 4TRRA 5JBIA 1UDCA 4CMEA 4ZGWA 1M76A 1XYGA 3AU9A 2V6BA 2D4AA 1O8CA 1T25A 3Q11A 4XJTA 3WGYA 2I3GA 3RUFA 1NM5A 4ALLA 1YWGO 1ISJA 1QYXA 3DHNA 4FJ1A 2CDAA 2BD0A 1Q1NA 3KUXA 1NFFA 4NNJA 1PGPA 4YJHA 5A9SA 5C5IA 2BKAA 3VZPA 4YXFA 1P1KA 3V2HA 1H2HA 3DBLA 2CFCA 2XOXA 5A06A 2CVOA 1MLDA 2EV9A 3FHLA 4B79A 1X1TA 3ITKA 3ZWMA 2PV7A 4HFMA 3GUYA 2BF7A 1CEQA 1GDHA 4B3IA 5IDXA 4FJ0A 4PLTA 3U09A 4YB8A 1NP3A 5DBIA 1TXGA 3W4JA 4J7UA 2JHGA 1HLDA 3IJRA 5IZCC 5IDYA 3D5QA 4L9RA 1P0FA 5KKAA 5DOZA 1HYGA 3S55A 2NTNA 4C4OA 1VC2A 2FR1A 3RC9A 4JBIA 1X7DA 4TSKA 1VL6A 2Q2VA 3HQ4O 3JD2A 4J4BA 1XLTA 4E5MA 3RSHA 5JDIA 3ETGA 4MINA 1UH5A 3F6YA 4LVCA 2YZ7A 1BGVA 5ER6A 3DZHA 4YJFA 3TZKA 3N74A 3Q3CA 4UULA 1N1EA 4CM8B 1YGYA 2X0JA 3VVBA 1BDMA 2VHVA 1I0ZA 4GGOA 4FC7A 4UVDA 4PN3A 4B7UA 1HXHA 1E1LA 1HDRA 3DXFA 4QO7A 3PK0A 2JD2A 1S6YA 1O9BA 4LW8A 3O8QB 3NJ8A 3Q0EA 2JAHA 1ZK3A 5IN5A 1XGKA 4RPJA 4OOEA 3HADA 3MTJA 2AG5A 1DHRA 4YAKA 2JJYA 1XIVA 3AW9A 4R1NA 3E9MA 3AUSA 4II2A 4DLAA 4Y98A 3EGOA 3LF2A 2QQ5A 3TSCA 2HU2A 1PQWA 1YB5A 4CLDA 2A94A 2PZMA 2LDXA 3WIEA 1PZEA 1ENOA 3H6KA 1HDOA 1KVQA 4D45A 3ZV3A 1WAMA 2IODA 4YRDA 1EBUA 2Q1WA 3B1JA 1CQIA 3JQ8A 4MVJI 1H2BA 3GGOA 5CAEA 4E5YA 4P22A 1T24A 2ZB4A 1YVEI 1P9LA 1P1HA 4OO3A 5KJEA 2Q99A 3HHPA 4NFHA 4D41A 1HZZA 2EHDA 5EERA 4UUNA 1QLJA 2VN8A 2QRLA 4M54A 2X4GA 4A2CA 1V8BA 2GGSA 4XDYA 4DC0A 3B1KA 3GFBA 1UXKA 2PKRA 3IKVA 1JVSA 1VSUA 3OP4A 2Q1TA 4K26A 4BQPA 2XXJA 1VE9A 1YONA 1CQJA 3PGXA 2YUTA 1V6AA 4OQZA 4A0SA 5I7SA 5CG2A 3I9JA 2GYYA 5A9RA 3UVEA 4DPLA 3PQFA 5JDIC 2YJZA 5JAZA 1HTBA 3DQPA 3RBVA 4J43A 4K28A 2AA3A 2DVMA 1F8FA 3BIOA 3BXXA 4BMVA 2V6MA 4J90A 4LSWA 1V35A 2J6IA 5HRUA 1LSUA 4HXYA 4NHEA 3V1YA 1JU9A 2XAAA 3UAGA 2I76A 4YR9A 3IC5A 4FFLA 5F1OA 3H2SA 3VH1A 2POQX 5EIOA 1GPJA 3H4VA 4KDFA 4ONEA 1V3VA 2FP4A 1RJWA 5I9MA 3KEOA 4D44A 4OYRA 3DOCA 5DCYA 1DXYA 4IGFA 3GRPA 4TKLA 3K5PA 2EXXA 4RVDA 3C1TA 1LJ8A 2Z5LA 3DOOA 3F1LA 1I24A 1VL0A 2H5LA 3I9OA 1KEVA 2CUKA 4WLNA 3TDKA 3L4BA 4C7JA 1PR3A 2X23A 1KY5A 3P2YA 4GX5A 4IDDA 3GC6A 5K6AC 1E3EA 5HTOA 3OJ0A 2EJVA 3H7AA 4BKPA 4YT8A 3F5SA 3MWEB 3RUEA 2FSSA 1NQAO 4WCFB 5THQA 2Y1GA 1FK8A 3D64A 4WOKA 3EVNA 3PP8A 5G0SA 4UUMA 2ZQYA 2GR9A 3PIDA 4J49A 4E2XA 1H0KA 3PLNA 2CZCA 2PD4A 2VRCD 3FPCA 3I9MA 4CV0A 3LT0A 2EKPA 3EZYA 4BOYA 2DUUA 1DC6A 3BZUA 2VWQA 1QV6A 1R4NA 5DT9A 3ZHZA 3C1AA 4IDEA 4TMFA 5A04A 1YB1A 1RWBA 4ZN6A 3DZIA 2OL4A 3RKRA 1T2DA 5G2OA 3WWYA 2WM3A 1LXCA 1FDTA 2GN8A 5AQ1A 5I8WA 2Y1FA 1K89A 3P5SA 1DAPA 4CM7A 4HBGA 4I9HA 3GVPA 4OXNA 5IXSA 2PWZA 4BB6A 4XQ9A 5AXDA 2NU8A 4MJLA 2A9FA 3LC1O 4TRNA 1YDEA 4J9VA 1PGOA 4JROA 1PJLA 5ITWA 5KKCA 1C1DB 1C1XB 3MZ0A 4NI5A 1Z75A 4J0FA 2NQTA 4WEQA 2GRAA 3ZWWA 2HLPA 5B4UA 2RAFA 1GZ6A 2HJRA 1H94A 3G1TA 4BNMA 4YQYA 2VQ3A 2CVZA 2Z95A 4FOSA 1NVGA 1DAOA 2GZ1A 3G0OA 3GNSA 3PQEA 3GEMA 4KQXA 5JC8A 3L4BC 4INAA 4XR9A 4BV8A 1LLQA 2HMTA 3PHIA 3TPCA 2CY0A 4R41A 4PLVA 3MJSA 3PFFA 4CL8A 1QORA 3GHYA 4IJWA 1Y8QA 2BMAA 1CWUA 4O6VA 4CLRA 3AUUA 3RIHA 1A7KA 1B15A 2JD0A 1IPFA 2AG8A 4CMJA 4Q3NA 3W8FA 1D1TA 4GLOA 3IL2A 2JHFA 4IZHA 4N5MA 1H6AA 2Q1SA 2GCGA 1QYWA 2WYUA 2WD8A 3VC7A 3O26A 2R2GA 4RV9A 2FR0A 4LGVA 4KOAA 3C3XA 5JC1A 2O2SA 1GADO 4DYVA 1PJQA 2JAPA 2YHUA 4YAJA 2G0TA 4B4OA 1O89A 3CH6A 1FMCA 4CV3A 3WGOA 2PK3A 3L9XA 3OSUA 4C7KA 1FJHA 3KTDA 4QFCA 4Z9XA 5BR7A 1U3WA 3T7CA 3G1UA 4EUFA 1PWZA 2QW8A 3P19A 2P2SA 1N5DA 3K96A 3CTMA 2QHXA 2P9GA 3VZQA 4ND3A 3FTNA 2PD3A 4FDAA 4MIEA 4M49A 1WPQA 3BMCB 2QYTA 1YB4A 5T6BA 3KM0A 4WNIA 1WDKA 2BGLA 3UHAA 1KVRA 3GN2A 4W4TA 4Q3AA 1OAAA 4XJSA 1DLJA 1P1FA 2B35A 3WIDA 3OJFA 5CFZA 2G76A 1XG5A 1HF3A 1Z74A 2WDZA 2ZQZA 2PFGA 3DWFA 5KVCA 3ABIA 1YQXA 1ZVMA 3ZCXA 3K31A 3FTPA 4WE3A 1Y9AA 1PQPA 1T4BA 1MXHA 3OH8A 4U7WA 3JQFC 2CVQA 2HMSA 2AQKA 4HV4A 4MVJD 1Q0HA 3I6IA 3HFSA 4AJPA 1U5AA 4J1QA 4RDHA 4DRYA 4L75A 3TZCA 1P31A 3RAJA 6ADHA 2OMEA 3VPSA 2DTDA 4CUKA 3LYLA 4NR0A 1F12A 1MXFA 1WXDA 2D3TA 3JYLA 4MVJM 4B7XA 4YA6A 2CDBA 4L73A 4GX1A 2O48X 3EUWA 4GSLA 5ENDA 4FS3A 5JDCA 4CM6A 2QRJA 2EGGA 1X0VA 3A06A 3QQPA 4G2NA 4F3YA 3UGKA 3OIFA 3PPIA 2Q4EA 1LQTA 3JQAD 3FR7A 4BS9A 5G4LA 3MOIA 5DBGA 2D2IA 1ISGA 2DT5A 5CDSA 1G0OA 2IZZA 1OZAA 3C1OA 4L4SA 4CQMB 3E6AA 1SO8A 3PTZA 4PFJA 3NTRA 3LU1A 4CM5A 5KVQA 3ORFA 5L7TA 4DC1A 4GH5A 2W8ZA 3HN7A 4JN6B 2AQ8A 3QWAA 1F17A 1ZMOA 2PGJA 2Q2QA 5CDTA 5CDGA 3NX4A 1R4MA 2C54A 4O63O 1W8DA 1DIGA 4GVLA 3GMSA 1LSOA 1U2GA 1ULUA 2VZ8A 1LU9A 4BVAA 8LDHA 1SNYA 1TT5B 2DPHA 3RFXA 2GSDA 1CF2O 5G0UA 3ADPA 1U9JA 4KUHA 3WS7A 5HM8A 2VHXA 1AUPA 1VI2A 3AM3A 3MJEA 1XHLA 5DCWA 3OA2A 4UUOA 1P0CA 1YL7A 4RF3A 2TMGA 1DJQA 1QG6A 1PJ3A 4JNKA 3ZN2A 1WWKA 2BRUA 3FBTA 4RLHA 5IN4A 1T26A 1L7EA 2EWMA 4BNNA 4PLWA 4D46A 1EVZA 4Q9NA 3WQQA 5L51A 1QR6A 2H6EA 3K8ZA 1R15A 5CEFA 3IIEA 4J7XA 2Y05A 3CINA 4Z9FA 3VOSA 2VUSA 5A4DA 3AFNA 2UUPA 4W7IA 2Y66A 4FIZA 4H15A 1BMDA 3JD4A 1ONNA 3DMYA 4Y6RA 4YVFA 1VL8A 1JVBA 4RZIA 3ZWBA 1OI7A 1PJTA 1LBEA 1ZKMA 4WK6A 3TL2A 5TC4A 5JDCC 3NUGA 2DUWA 2X5KO 3H5NA 4XYMA 3WLEA 4UEKA 3BMNA 5CDYA 1LLCA 2ZCUA 4CL3A 4EI2A 4BNKA 4EEXA 2VT3A 1LDNA 1ZJZA 2DBRA 3PWKA 1K5HA 1ISHA 1YS4A 3K92A 4GSKA 4NK4A 1CYDA 4NBRA 2G5CA 5I9LA 2FR8A 2AEFA 3HB5X 3NDRA 1HRDA 3NT5A 1BXGB 2BFMA 4QECA 1T2EA 4ND2A 1AHHA 4CMAA 4GQAA 4DIBA 1E3WB 4ITUA 1GUZA 3HE3A 3MJ4A 3ASUA 1UZMA 4W82A 5T8KA 4NFSA 4BKQA 1E7YA 1E1KA 3IMFA 2WD7B 3R3SA 4QT0A 4CMKA 4RQTA 1N9GA 3DZJA 3WMXA 4X54A 2FPIA 1DRWA 1JWAB 2UAGA 3QWHA 4E31A 2NM0A 1B2LA 1X7GA 4R1UA 1VM6A 2IYPA 3AJRA 4ESOA 5BSFA 4BKUA 4J91A 1LUAA 3C7AA 3W4KA 4ROSA 2JL1A 1BVUA 3PJDA 4PVDA 1WZIA 5B4VA 5TSDA 1T1SA 3ZU2A 3TOXA 1H6DA 3IP3A 3PWSA 2O7QA 4DPMA 5F5LA 4M86A 4WUVA 5HBRA 2FHSA 4NJMA 1MG0A 2EP5A 2FWMX 1VJ1A 3L77A 4RVGA 2A35A 4Y6PA 2VT2A 4CLOA 1PJ4A 3C85A 4F6CA 3KZVA 3QVXA 1D4FA 2YYYA 1QMGA 3WSVA 5EQDA 4D3FA 1F8GA 1UP7A 2DTEA 2ZYGA 3G79A 4D3SA 3AY6A 5CG1A 4G65A 1SCUA 1GZ3A 1PJSA 1WLYA 4Q3BA 1TLTA 1WVGA 3FRJA 4CLXA 3U5TA 4IUYA 3OETA 4IQ0A 4BIIA 1MV8A 4U8GA 4GAEA 3ZI0A 1KVSA 1EBFA 2UYYA 1GTMA 4MVJP 4B4VA 2IZ0A 3BMOA 3GOHA 2C7GA 1IE3A 3HDYA 1U28A 3E82A 1UP6A 3DZBA 2EW2A 3DEYX 2X5JO 1GFSA 4YJHB 5A9SB 1LRKA 1LLDA 2WE8A 3WMWA 4CJXA 1XR3A 3VDRA 1B16A 4WASA 4XX0A 3ZHBA 4CV2A 2X8LA 3VH4A 3F5QA 1Q7CA 3DBLB 4JIGA 1IUKA 1KVTA 3ZGYA 1JKJA 2IDZA 4GWKA 1PL7A 2IYOA 2J5KA 5T8KC 3JSAA 3KYCA 5EESA 3KYDA 1NNUA 1NVTA 1X13A 1IHXA 1NR7A 2AMFA 1P45A 1YJ8A 1SOVA 2GZ3A 4PLYA 1ENPA 5KCZA 4OIMA 4FQ8A 4KMSA 3EAGA 4KP7A 5AXBA 1EFLA 5A9TA 1B8UA 1B14A 4J3FA 3UUWA 3I1JA 5L3ZA 3RD5A 1OMOA 1JAYA 2IRWA 4XWYA 3ANLA 4R3WA 3LF1A 3AK4A 3WFIA 3R6DA 8ADHA 4D43A 2WE7A 1MB4A 1I01A 4UREA 3ROMA 1ADBA 1HE3A 2BELA 4AJOA 4YJFB 2BI7A 4FCCA 4IDAA 4M8SA 4D0SA 2VWGA 3M6IA 1LRJA 4EJ0A 4NMHA 3QSGA 3UCXA 4A73A 4AJLA 4Y67A 3RVDA 5I7EA 4J4HA 2UVDA 1Y8RA 4E12A 4PCVA 3SXPA 2ZJ1A 4O5OA 3GA0A 3GT0A 4ZICA 1IULA 1RKXA 3CMCO 2O50A 3JTMA 4NJOA 4S3MA 3ZWNA 5KVVA 4XA8A 1VPDA 3WGTA 4XQEA 3VKVA 5JS6A 4PG7A 1ENYA 1ZEJA 4YQZA 1NQ5A 3FNHA 5L53A 1M2WA 3VPFA 1XSEA 2O3SA 4FOOA 3TJRA 3RFVA 1AE1A 2B4RO 2HK8A 2HJSA 5AVOA 2J8ZA 4LISA 1B0AA 2Y1CA 4OSOA 5DN9A 4JXKA 4R51A 3FN4A 4KQWA 1DRUA 1GYRA 1R66A 4U0JA 2GPTA 4BGVA 3AOEA 2ZCVA 3Q9NA 4UVHA 2WWRA 4WLOA 3E9QA 3HDQA 1M66A 3HZZA 1MFZA 1Z73A 3GG9A 3K73O 4AICA 4E0BA 1UP4A 3ASVA 5KTKA 4D79A 2NLOA 1HETA 3GY0A 2CF6A 4EYEA 2GASA 1Y5RA 2BFAA 5FWNA 4OL9A 2OXIA 4QFDA 3GVHA 4H3VA 2YHIA 4IBOA 3DBHA 1M6HA 1EMDA 3ZHYA 3LDHA 4L4XA 2X0NA 4CM4A 3TWOA 5A3JA 2HAEA 1E3IA 1GY8A 2BGKA 1GCOA 4OOFA 4BNIA 4PLHA 4RO0A 1QXSA 3OQ1A 3JQ7A 4P4GA 1FF9A 5JFOA 1YO6A 1EVJA 1JWBB 3H9EO 4Q39A 4UEJA 5TJ9A 3QE3A 3ZWAA 3RWBA 4JX8A 1LC3A 3C7CB 4IINA 4JQCA 1Y6JA 4ALJA 4CR7A 1A27A 2RIRA 3VZRA 2NTVA 1SB8A 1VJ0A 2OP1A 3V2UA 4WGGA 4U0KA 4DBZA 4F45A 3WLFA 2GDZA 3MJCA 4N5NA 4BGEA 2XF8A 3EK2A 1SEVA 3AFMA 4UVGA 5L45A 1YH3A 2G1UA 4YJDA 3DZFA 4IXTA 3P2OA 3KO8A 5BNFA 3IUPA 3PYXA 1DB3A 4NDNE 5TRTA 4B3JA 5KJ1A 4NG5A 4YAEA 3UW3A 1CERA 1WP4A 4O59O 2PKQO 1E5QA 3WQRA 1LQUA 2FZWA 4E3ZA 1UAYA 3SLKA 1E3JA 1DPGA 4JJIA 4U6QA 5JY6A 3K2BA 5A3VA 1UXIA 2UDPA 3AOEC 3COSA 1KYQA 3AUTA 3BHJA 2BI8A 1QKIA 2X22A 3D3WA 1GUYA 4I08A 3H5RA 3GAFA 2PZLA 3GMDA 2VRCA 4AJ1A 3OA0A 1E7MA 3HWRA 3SJUA 1ISFA 3WBBA 4BMSA 1NFRA 4BB5A 4RLSA 2PGDA 3A1NA 4YRAA 1A72A 3ANMA 2LDBA 4NH4A 5ES3A 3CIFA 4NK5A 1RYDA 5BQFA 4BNYA 4EITA 3FD8A 3O38A 4EZBA 4NPCA 3WQSB 3NRCA 1K2WA 1R4NB 3DO5A 5JW6A 4WLVA 3SJ7A 1BDBA 2P9CA 4BL5A 5IAAA 5K6AA 2JFFA 2C2XA 2NVUA 4DBVO 1H6BA 3GUCA 2E48A 4DIOA 4QX6A 3GRKA 1HDCA 4UUPA 4E21A 2JFHA 4I9UA 1MA0A 4PLZA 4DIFA 2PKQP 1C0LA 2Z1NA 3SX2A 1DC5A 1ZK4A 3ZH2A 5GY7A 5DBFA 3V5NA 3JQEA 2H63A 3OIDA 3WWZA 4Q3DA 4BO6A 4CMBA 4DLLA 1QV7A 2CDCA 2DM6A 1GQ2A 4Z0PA 2EEZA 1NPYA 4WEOA 3DZKA 5L7YA 1A9ZA 1G1AA 4E32A 2GLXA 4BNTA 4IDCA 4J1NA 3GDFA 1GU7A 3FBGA 3E18A 4BV9A 4R01A 4AJEA 2VNAA 4LMRA 1EVIA 1Z45A 3JQ6A 4IMRA 3WGGA 4FJ2A 3HFGA 5BNTA 3I52A 1A9YA 2HK7A 4LSMA 3T7EA 2C29D 3IP1A 1YL5A 1E77A 3F47A 1KEPA 3GPIA 2AQHA 4BNLA 1Y8QB 4CLRB 3OQ6A 3A28A 2HMVA 2B37A 1ADFA 1CIVA 4WCDA 4GPD1 1ZSYA 2D5AA 1Z82A 4DUPA 4HNGA 5JPIA 3QWBA 5DNAA 5A5EA 2X6TA 3AM4A 2GF2A 3Q2IA 4IDFA 2C82A 2QX7A 1QYDA 4E4YA 1IL0A 4S1VA 1OC2A 4E2YA 3AOGA 5JAIA 1DOHA 1NYTA 2X7HA 1PSDA 3GZ4A 3RUCA 1LSSA 1ADGA 1BXZA 2E49A 4IJKA 4BO0A 1X14A 3E03A 3QVSA 3ROQA 4IS3A 1NWHA 2VYVA 3GDOA 4WNCA 4O1MA 4HX5A 1U4OA 2J3KA 1EVYA 3L4SO 3GDGA 3ZZNA 2HQ1A 1JQBA 3CKYA 5U4QA 5LDHA 4FBGA 2OBYA 4NU6A 3JYOA 4EJ6A 3TFOA 3LSYA 3BTSA 1UR5A 1CETA 4BO7A 3VTFA 4CUZA 3DTTA 2ZKLA 1I10A 3ETEA 1M67A 1ADCA 1KEUA 4LCJA 2YV3A 3QRWA 1SBYA 4D42A 4BNUA 5GMOA 4Q3EA 4MVJA 4NFYA 1J6UA 4OAQA 5G4KA 4YAIA 4IZIA 3DC2A 5EQFA 4OHUA 3HDJA 4URFA 5H81A 4AJNA 4N18A 2HSDA 1JN0A 4J0EA 1XELA 2OO5A 3CPSA 5G0TA 1YXMA 4E13A 2TMDA 1AGNA 2FOIA 5TQVA 5CPFA 2W90A 5LCXA 2QG4A 3UCEA 3VAZA 5HWSA 5TLSA 3ZU5A 3VPHA 3X2FA 2NADA 3UF0A 5L9AA 3G17A 1F14A 4UVEA 3ON5A 1DFHA 2Q1UA 4J2HA 1J0XO 2DBQA 4XCVA 3KSUA 2C2YA 5AXAA 2I3AA 3JQAA 5JE8A 3ZU4A 3FWZA 3U4CA 3AWDA 1YBMA 1KVUA 1ZK1A 2X58A 1E7RA 4H7PA 4LRTB 4LVUA 3SC6A 3ZV6A 4HFRA 1AXEA 5T5QA 5ER9A 1LA2A 1TA4A 4M89A 5FF9A 3JQFA 4HY3A 2C0CA 4OMUA 1J49A 5U1PA 1HE5A 3PVZA 2YY7A 1GEEA 1DIBA 4A5OA 2EGHA 3FNFA 3EC7A 4L74A 3QW2A 3LK7A 3I23A 1GYQA 4DTIA 2HCTA 2DFDA 2V7PA 4TRJA 4AJJA 2WJPA 2Y1OA 4ZQFA 3WB9A 1IYZA 3WYCA 4GBJA 1YQGA 4IXWA 3TN7A 1AXGA 1R4MB 3N58A 5B37A 5ICMA 1NQOA 1HDGO 2NV6A 3HUDA 2XXBA 4BNZA 1I2ZA 1ZK2A 4YYZA 3DAGA 5H82A 3I4FA 2A92A 3PXXA 3KLPX 1XKQA 1NR1A 4BGIA 2Y93A 3OHSX 2VHWA 3WJAA 3MOGA 5ADHA 5ILGA 1AHIA 1EK5A 4NZ9A 3D4PA 4ALNA 2IE0A 5A1TA 3LT1A 2FRDA 1P33A 3NAQA 4WOJA 4WECA 1J5PA 4P4LA 3GNQA 4Z9YA 4ZRNA 1GPDG 3V8BA 2E4AA 1NQTA 1B8PA 2I67A 3GQVA 4PVCA 2VYVD 2Y1EA 4U6SA 1U8FO 2ZK7A 1U7TA 3UXYA 3N7UA 2OUIA 2I65A 4D7AA 1YBVA 2NWQA 2VUTA 1K0UA 4ZHSA 5HS6A 4W6ZA 1LDGA 3PZBA 5JCXA 4J2OA 2HRBA 2VWPA 4QQRA 1R6DA 1OBFO 3O4RA 2DLDA 3BMNB 5BSHA 1N8KA 2Z1MA 4RF2A 1IZ9A 3RQSA 4ZVVA 3JYPA 3OJEA 4RJTA 1VKOA 1HL3A 1XU7A 1PQUA 1W4ZA 1LTHR 1JKFA 3NV9A 4JCOA 3UICA 2ZTLA 4FFPA 4GKVA 3K2EA 1M6WA 4XB2A 3V1UA 5C7IO 2B36A 1H93A 2F1KA 1E3LA 4Y6SA 5TIIA 4LK3A 4CM3A 4UEOA 4YCAA 3VVCA 2P9EA 1N9GB 4GMFA 3D4NA 1ONOA 2Q2WA 4HFNA 4JP2A 2ZJ0A 2O4CA 1DJNA 2YDYA 1MGOA 3SC4A 3AUAA 1N92A 1R0KA 2VUUA 2HK9A 2GO1A 3SBOA 4I5EA 2W2KA 3WGIA 3FPLA 2PGLA 1C0KA 1ZEMA 4DYDA 1DO8A 5CEJA 4ZD6A 1QRRA 1HE4A 1UXJA 4R9RA 1EFKA 1T2AA 4NJMB 4YJGB 1GZ4A 4J4TA 1MC4A 2RH8A 4BO4A 4CLOB 2AEMA 1PL6A 3PJEA 1DSSG 4CM9D 1KC3A 5AYVA 4CMGA 3M2TA 1EE2A 2NUAA 4BNFA 2ZYAA 3E48A 5AXCA 1YJQA 1ZH8A 3JQ9A 4HUJA 3DONA 5U9CA 4R5HA 1UUFA 1NX6A 4OH1A 1GQYA 2R6JA 3EY4A 1JW9B 3GZNB 2NSDA 3BMOB 4FFNA 1TEHA 4WLEA 4WCFC 4CM1A 4NBUA 3AI1A 4CMIB 3JD1A 1ZSNA 4QEDA 1E7SA 1I33A 3JYQA 3ICPA 4ND5A 3V2GA 2Q45A 2YFHA 2WTBA 3L9WA 3OECA 5JXWA 2Y0CA 3LZ6A 3KYCB 3KYDB 4R1TA 2I99A 4M55A 2FSVA 2W98A 3I9KA 5HA5A 1K6IA 2BLLA 3OJOA 2OP0A 4KZPA 2E82A 4KTVE 5G0VA 1H9AA 5EJ2A 2CF5A 1DC3A 2H9IA 5GZ1A 4RL6A 1GV1A 4FSHA 4YEDA 4ALMA 5MDHA 2RHCA 2O3UA 5T67A 3LVFO 1D1SA 1J4AA 5TF4A 3QJ5A 2EKLA 4J1TA 3PFWO 4Y8VA 5DOVA 1BW9A 2HMUA 2HKIA 2Y67A 3MJVA 1ZW1A 1MUUA 4WJZA 7ADHA 3RI3A 1L7DA 1LSJA 1U8XX 1DIRA 1Z6ZA 5TT0A 1ENZA 2DC1A 3KHUA 4OKIA 4A7PA 3TZQA 4IY1A 5FI3A 4TQGA 1HEUA 4DQXA 1NFQA 3GVIA 1VRWA 1SOWA 5CP8A 3OQBA 1A7AA 3I9LA 3JQ9C 2JCVA 2PR2A 3PRJA 1Y8RB 4DLBA 1W6UA 2W4QA 3LLSA 3NEPX 2ZATA 3TOZA 9LDTA 3LLVA 3S2EA 3AU8A 1I2CA 4DVJA 3CSDA 1BRMA 4GGPA 2FPPA 4YRBA 2AQIA 2O3RA 2RHRA 4IPTA 1PEDA 5BT9A 4CLHA 4PLPA 4WLFA 3G3EA 2PA3A 3DHEA 1FDUA 5A05A 3CZMA 3S8MA 1E3SA 2VYND 3DB2A 4YT2A 5LDGA 4PG8A 4CQMA 3IQDB 3AM5A 2CD9A 5F21A 2ZB7A 3ITDA 5DP2A 1SB9A 2EF1A 1GR0A 4FGWA 1I2BA 1TVEA 3D7LA 3PWZA 3ZNQA 5JY1A 3KVOA 1I3NA 1XCBA 4PLGA 4B3HA 2EG9A 2YV1A 4GVXA 3BTUA 1LRLA 3QWIA 2RH4A 2ZTMA 3NTOA 1KOLA 4DMLA 5KVSA 4M87A 1VLLA 4ND4A 4MO2A 1ZMTA 1ZK0A 2ZTUA 4UVIA 3L07A 4QSMA 4TKMA 2D5CA 3WX0A 5IZ4A 4R69A 4BNHA 4EW6A 1JLLA 4MIOA 4DQUA 2YHIB 3JQGA 3DBHB 4EGFA 4FFRA 1T1RA 4CM4B 3F9IA 4Z0TA 1CJCA 2DAPA 3D5TA 2NU9A 1X15A 3PHHA 1SEPA 4GMGA 1Z7BA 4GI2A 3KOUA 2BFPA 4BO3A 2P4QA 1BVRA 4R3NA 5GZ6A 3VH2A 1X1EA 4NU5A 5F5NA 1PGJA 2QZZA 3VH3A 1K3TA 1M75A 4AL4A 3RUAA 1R37A 5A03A 2B83A 2VHYA 3FSRA 3JYNA 1RM3A 3VTZA 1YOVA 1GUFA 4BNJA 3E5RA 3W8EA 4E2WA 5JAMA 3TRIA 4J1SA 3EMKA 4B7CA 1EE9A 1XEAA 5IG2A 1PZGA 2B4TO 3NTQA 4P4NA 3K30A 3VZSA 2C7VA 2RBEA 3E9NA 1GCUA 3NYWA 3PDJA 2Q4BA 4MKXA 1N2SA 2EW8A 3AI2A 3BMQA 4AJKA 1X0XA 2AE1A 3K6JA 2PY6A 3E1KA 1PS9A 2J3IA 2SCUA 2B5WA 1W0CA 2YDXA 4IS2A 4XYGA 3W6UA 3TFQA 4BNXA 5F1PA 3SVTA 2YQ4A 3IS3A 4IM7A 1QLHA 1L1FA 1NAHA 1ZBQA 4DPKA 3DFUA 1YKFA 1HT0A 2VTDA 1JTVA 1LC0A 4KTTE 4J9UE 4KUEA 3GF4A 2A4KA 1DHTA 3NDIA 4P38A 1DIAA 4B4WA 1UXHA 2GN6A 3D3WB 1DIHA 1EDZA 2G17A 4N7RA 4XYLA 4W99A 4RPKA 3F3SA 4BO5A 2YFQA 5IJZA 1EEHA 3QVOA 1N1GA 1V3UA 3UCFA 3CUKA 3GR6A 2BFOA 2Y0DA 1NVMB 3MTGA 3L6OO 3VKUA 3QIVA 1ZNQO 4Z0HO 3IDSA 4XZ3A 1CRWG 3HDHA 4CPDA 1SAYA 3W6ZA 5L7WA 1BXKA 5TGDA 5ITVA 2X5OA 1KERA 3DR3A 4MVJF 4CQMD 1MG5A 1NTOA 2I66A 5DCUA 3I6QA 2NVUB 2P91A 3JQ8B 4DA9A 3MJTA 1DBVO 3ZWVA 1O0SA 2I6TA 5COQA 3QA9A 3RC1A 2WMDA 5CDUA 4RF4A 4M1QA 1R12A 4R5MA 1WDLA 3JCZA 1T2FA 1U3TA 5FFFA 2EJWA 3KYBA 4JGBA 3Q2KA 2GERA 3CXRA 1KBZA 4II3A 4XEHA 3EW7A 3DMTA 4B4UA 3ETDA 1ID1A 3JQBA 3GHHA 4J7CA 4PZDA 3ZWCA 1HWYA 4RPGA 4E30A 4IJVA 2EKQA 5ILOA 2JCYA 1DEHA 2H1SA 1NWCA 1LDYA 3VHRA 3PJGA 3W4IA 1E6UA 1Q0QA 2FN7A 2Q3EA 2IXAA 3R1IA 4TVBA 4FFOA 1DRVA 5DULA 5BSGA 3IAHA 3QHAA 4NIMA 4HNHA 2GNAA 2DQ4A 4MIYA 3D1LA 4GLLA 2AW5A 3ONEA 1GAEO 1PIWA 4PLFA 1PU2A 2PTGA 3B6ZA 3H5AA 1EZ4A 3B1FA 1UZNA 1AN9A 4MVJE 1H6CA 3U0BA 3RASA 2PZKA 1Q7BA 4TZKA 1KEWA 3BTVA 1H5QA 4ID9A 5TJHA 4FB5A 1Q2XA 4XDZA 1UAGA 2OZPA 3WOHA 4BKRA 3H65A 3F46A 4BNGA 2GD1O 2NNLD 2CMDA 3HG7A 3KB6A 3NT2A 2ZYDA 4YT5A 4CQLA 2ET6A 1PGNA 1FXSA 3WR5A 4E2ZA 2VHZA 4HP8A 4RCVA 2X9GA 1MX3A 3P7MA 3S2FA 3OIGA 5EMHA 4D0RA 3U62A 3KSZO 2Y0EA 1E1MA 2DBVO 5IF3A 3H9JA 5DF1A 4HFJA 3TZHA 2CSUA 4CLEA 2VCYA 3H9UA 2VZ9A 2Q46A 3INGA 4GL4A 2HO5A 4XD2A 3DMTC 2X9NA 3TQHA 1U3UA 4B8WA 4FC6A 4AJHA 3JQBC 2C59A 4L8VA 1OOEA 3S1LA 4OGWA 4Z3KA 4QUKA 1SMKA 4AG3A 4CMEC 5G4KB 1I32A 3H8VA 4CMHA 1PJ2A 4CUJA 2F00A 4PG5A 4R9SA 4XGKA 2I5PO 4ZA2A 3DHYA 4WPGA 3H9QA 1KIFA 1TI7A 3KEQA 3SLGA 1E1NA 3MCVA 1JKIA 5FI5A 3TNLA 4YT4A 4XR4A 4N54A 3DAFA 1GEGA 4JJGA 4PRKA 4ZQHA 2VRBA 2JFGA 2NTJA 2O3QA 3DBRA 3KXDA 3KLMX 4MP6A 5COBA 2YQ5A 4I5FA 1Z7EA 3JQAB 4NBWA 3DAPA 1O95A 2DKNA 4BNVA 3D4OA 5LC1A 1SC6A 4PGFA 1N7GA 5K0ZA 1I3KA 3GEGA 1IZ0A 2GN9A 2HDHA 3S2IA 1C0PA 4BO2A 1ZIDA 1TT7A 3FR8A 3OM9A 3FWNA 3Q9UA 3WBFA 3HSKA 1S7CA 2V65A 1YBAA 3ZNOA 3ZV5A 5EL0A 2Y68A 3W8DA 3AY3A 3FNEA 3RU9A 4RVUA 2V6GA 1T2CA 3VDQA 2Y99A 4RORA 2O3JA 1Y81A 5KJFA 2R00A 1TB4A 3GGGA 3OBBA 1C0IA 1VJTA 2G82A 4GX2A 2V6FA 3KV3O 5F1KA 3RBXA 4GWGA 3U49A 1EDOA 5CHEA 4IJUA 4XRGA 4CR6A 1PZFA 3D3EA 3L6EA 1EK6A 2OORA 1HDZA 1VKNA 2O2YA 3H3JA 5AOVA 1E5LA 1PZHA 1UDAA 4QXMA 5C3MA 4NQZA 3INTA 1NHWA 3O9ZA 5A02A 3ZWPA 5BNIA 4FR5A 3WXBA 4YACA 3JV7A 2X0RA 5T64A 1DDOA 3FF4A 3RFTA 3E8XA 3T4EA 4I5GA 1OFGA 5JMWA 1I5RA 1UJMA 4YBZA 3ZNPA 4G5HA 3WYBA 1T4DA 3JD3A 4QTZA 1NAIA 4OM8A 3RUDA 4E6PA 4CM8A 1I36A 5GZ3A 3B20A 3CZRA 4OXYA 4DREA 2VZ0A 3DBVO 1LNQA 2GUGA 2J5RA 2Q49A 3HNPA 3M1LA 5KIAA 2YV2A 4BO1A 4ZJUA 3O8QA 4A26A 2QIOA 3IOYA 1U4SA 3KRTA 4AJ2A 3ZW8A 2FZEA 3QY9A 4LCEA 4E5KA 4YDRA 1LEHA 3GVCA 1B7GO 1KC1A 2O23A 2O3TA 1ML3A 4PRLA 2OGUA 4O0LA 1Q7GA 1XDWA 4TWRA 3T4XA 4RVSA 3IUSA 3WGQA 4I9NA 3D0OA 1HZJA 5JMPA 2I9PA 2P5YA 2X86A 2R00C 4Y9DA 4JLWA 4IMPA 2FMUA 4A10A 2JCXA 3R0IA 1HE2A 1LI4A 1YE3A 3ENKA 4KWIA 3GG2A 2Y1DA 1P1RA 3U9LA 2X9VA 4YWJA 1MC5A 5TNXA 3RUHA 2DU8A 3JQCA 5C7LO 5TX7A 1A4IA 4JP3A 5K9ZA 4JBGA 1E7QA 2W2KB 1GYPA 4RGBA 4JK3A 3WTCA 4QO8A 1PWXA 1ZUD1 3PQDA 5CPBA 3DOJA 1QSGA 3SEFA 4PG4A 1B3BA 3ROPA 3WDSA 1U7HA 1UXGA 2AE2A 4G81A 5JO9A 3PHLA 2XPCA 3AY7A 4CM9A 2J3JA 1GV0A 2UV8A 5T57A 4OQYA 1WNTA 2D1YA 1ONPA 3I4CA 4KWHA 5ICSA 4XKJA 2HMWA 1Y7TA 1NBOA 5J23A 3MWDB 2HUNA 5G0WA 4FGSA 4I8XA 3U3XA 1CDOA 4OKNA 5JCJA 3ONDA 5THKA 3NJ4A 2BGMA 3I3OA 4AFNA 3GGPA 4W9NA 4IQ8A 1K6JA 3ZDFA 4BHTA 1ZJYA 1OC4A 1V0JA 1ZXBA 3PLRA 3BHMA 5L95A 3LQFA 3RUIA 1EUDA 1RYEA 2RCYA 5MGBA 2B0JA 3VPGA 3LT4A 3TZ6A 4E5PA 4CR8A 3BYZA 6LDHA 1HKUA 4RQUA 2ZB8A 4FD3A 3EVTA 1VSVA 1BSVA 1KY4A 4IGEA 4EEZA 3NGLA 2OBNA 3LC2O 3ANNA 3IKTA 3I9NA 2W2LA 4TROA 4F6LA 4YAGA 3M1AA 2DBZA 4LRSB 1PGQA 5F3RA 3PHJA 1NASA 3GVXA 3I5MA 4EJMA 1A4UA 2IEBA 5JSFA 2E37A 2J3HA 2VWHA 4IQGA 3WSWA 3INRA 4WCFA 3B70A 3FCOA 3ZWXA 1F0YA 4XIYA 4MPDA 4MKRA 4RVFA 1R0LA 3OMLA 3MEQA 7MDHA 5JNLA 3DZGA 3ROKA 3OFSA 1G6KA 3RCBA 5KJ6A 2AXQA 4JBHA 2AHRA 4DQVA 3E5MA 4CMCA 1HSZA 1YDWA 3ZU3A 2WEKA 3OEYA 3DL2A 1BW9B 4ZQEA 5L40A 3PIIA 1IB6A 3RC2A 3ZWOA 3FNGA 3RBZA 4TZTA 2D8AA 1X7HA 2DTXA 3RJ5A 1RM0A 2VTEA 3OEWA 1MP0A 4GKBA 3O03A 4CV1A 2GN4A 1XU9A 2NACA 3X2EA 4PLCA 3W1VA 5I7FA 2IEDA 1HDYA 1ULSA 9LDBA 4Z6KA 2YW9A 3ZV4A 2QYSA 4W9NC 5EPOA 2EP7A 1IOLA 3ICCA 1C1DA 1C1XA 3Q6IA 4LN1A 4FPXA 1BHSA 1W73A 2VYNA 2WYVA 1U3VA 3BTOA 1ZZEA 1P74A 3EHEA 2QZ9A 3OJLA 3QVTA 4J16A 3KBOA 1A71A 3KSDO 4MDHA 4B8ZA 4XYEA 2C20A 2GZ2A 1P3DA 1PS8A 5KJCA 1XWFA 4GX0A 3QLJA 2NU6A 3EDMA 3GFGA 3RU7A 3HB4X 2D0IA 4ALKA 4D3DA 4OJNA 1FDVA 1HYEA 3UFXA 1NXQA 3JQDA 5L4NA 5JCJD 3GK3A 3DDNA 3VPXA 1BWSA 4EBFA 3CMMA 5IDQA 2B69A 3ULKA 2BHLA 1PJCA 1GD1O 3PHGA 4KDEA 1ZO8A 4F46A 2PZJA 1WW8A 3JQGB 4YPOA 2VOEA 3HN2A 3U4DA 5IDWA 1RPNA 1R16A 2X0IA 1WDMA 4AVYA 4IIUA 3TL3A 2PLAA 1IHYA 3RROA 4N5LA 3GNTA 3A4VA 5I8ZA 2OOSA 3L6DA 2PH5A 4MP3A 2W2LD 3GN1A 3BAZA 4R54A 1P44A 1ZFNA 3PYLA 4FW8A 1GL3A 1PR9A 4BO9A 2DPGA 1P1IA 1EUZA 4HKTA 4XQGA 3U4IA 1H9BA 4BGUA 1UDBA 3Q1LA 1GQQA 3BMCA 4ILKA 4R16A 1YOVB 5EN4A 4OSPA 3A14A 4BO8A 1O5IA 3GH3A 3STHA 4EUEA 4K6FA 5JO0A 1I8TA 3OICA 1QYCA 1XA0A 5KOIA 1I3LA 2NVBA 3R3JA 3H3FA 5DZSA 3F4LA 4PIVA 3ZNNA 4BUCA 4W7HA 4WKGA 4NBVA 1Y9EA 2OHXA 4BQRA 5IXYA 5B1YA 3WJ7A 1JA9A 1QP8A 2NQ8A 2PH3A 3BMQB 4MVJG 3UKOA 1EQ2A 1ORRA 1BTOA 3ZHXA 1WMAA 1PX0A 4P8RA 1I3MA 1F06A 3F1KA 1LDEA 3ST7A 2C07A 4MOWA 3WNQA 1KETA 3UN1A 5FYDA 4L0QA 4L4RA 1A5ZA 4CODB 2FY8A 2JD1A 4ALIA 3LT2A 4IIVA 5TS3A 5B4TA 2PNFA 3DFZA 4K6CA 1LDBA 1JDJA 3ZWYA 3H2ZA 2ZIZA 2D59A 1MFPA 1V9LA 3CE6A 3UOGA 3EYWA 4XGIA 3H9GA 4ZQGA 5JYEA 1PTJA 3CEAA 1RM4A 2J5QA 5A5FA 3NKLA 1U5CA 2X1HA 4AJIA 1LLUA 1DC4A 3GLQA 2P68A 1E7WA 4R4JA 3QVWA 3WGZA 2HRZA 1B3RA 3PDUA 1U2DA 2B5VA 5L4SA 1E6EA 1O94A 4TRMA 4E33A 1ISIA 4PG6A 3NGXA 2FPGA 4A27A 2E6UX 4XYBA 5HS4A 1E0DA 4BMNA 2IXBA 4RPLA 4YJGA 1B8VA 4FN4A 4ZU3A 4XB1A 4XQCA 1HSOA 2DFVA 1DFGA 5JYDA 3WNVA 4L76A 1BG6A 1U1IA 1TT5A 3DTYA 3TF5A 4R1SA 3ONFA 3M2PA 3RKUA 1PL8A 3PEFA 4NBTA 1XQ1A 3PGJA 1YL6A 3F4BA 1EUCA 4RVHA 1P1JA 4OXKA 4KUGA 2O7SA 1DLIA 1WZEA 2P5UA 2WYWA 1V3TA 3FI9A 3S2GA 4ZRMA 5C37A 1IPEA 2UUOA 5FEUA 3GPDG 1YRLA 3GZNA 2ZTVA 2OFPA 4XRRA 5H83A 3LC7O 2VOJA 1NPDA 3WFJA 1YQDA 3AI3A 1RM5A 2C5AA 3A9WA 1PJBA 4HWKA 4MP8A 4E5NA 4RDIA 1D7OA 3JQ7B 2BH9A 1UZLA 4CMIA 5JLAA 4A03A 4Q3CA 3WG9A 1XQ6A 3I83A 3QV1A 4FFMA 1DFIA 1D3AA 1KS9A 1FDSA 4UAGA 2C5EA 2WSBA 1NHGA 4I5DA 5ENVA 5KNLA 3UH1A 1D8AA 3IJPA 5I9NA 2PD6A 4JJFA 2AEJA 5TT1A 4YTEA 2CNBA 1P77A 2ILTA 5EINA 2O4UX 3PYMA 3RC7A 4AJ4A 4DGSA 3KETA 1E6WA 4ZQBA 2B4QA 4K1LA 4PZEA 4DXHA 3GEDA 4BKOA 4EUHA 5KWEA 3PJFA 1Y5MA 1FDWA 1B26A 4DL9A 1Q0LA 5IFLA 3WGHA 3G49A 1JAXA 2IZ1A 4H16A 4RPHA 1BXGA 4CQLB 3V1TC 2NU7A 3WTBA 2P4HX 3C8MA 4DMMA 4EDFA 4PZCA 1E3WA 2QRKA 2EIHA 1Y1PA 1ZXLA 3RJ9A 3JD0A 3ZW9A 3U4HA 2WD7A 4TVOA 3GAZA 4XGNA 4ND1A 3WICA 1LX6A 1WMBA 2ZB3A 4BNWA 1PS0A 5I7VA 5CEEA 3C24A 3C7DB 5C7OO 1EQUA 4DWVA 1R0SA 1ISMA 5IZCA 4K9DA 2NVWA 1K6XA 3OF2A 3L0DA 3HJAA 5BSEA 4RZHA 4I1IA 3BA1A 1HYHA 1SZJG 1LDMA 4WLUA 1I30A 3PZRA 1G0NA 1ZCJA 2EERA 5B12A 1E92A 3NDJA 1N7HA 1HDXA 1O6ZA 1QYVA 4LMPA 4Z3DA 3K9QO 4XIJA 1HLPA 5JAQA 5DP1A 4IDBA 1C14A 1IY8A 1C3VA 4U5QA 3ADOA 4RF5A 2VNSA 4J6FA 3QWFA 2JKVA
chains in the Genus database with same CATH superfamily
5HZKA 2HF9A 3HDTA 3ZWQA 3ENNA 1NPTO 3DBRB 1RBMA 2C2BA 3PFNA 5T41A 1NXSA 2OVBA 4QVIA 4CG3A 4QLBA 1T34A 3PEVA 1S8FA 1UK8A 2Q50A 5D3QA 2G1PA 1AD2A 2B2XA 3BD7A 3IILA 1ARZA 4HADA 2XQGA 4TRRA 1RW4A 3QUTA 4AP9A 4ERXA 1X3SA 2QRNA 1UDCA 2ZR0A 1M76A 1XYGA 4E7PA 3AU9A 1AO3A 2FMKA 2PQ0A 2CLLB 4MQFB 2OPBA 4R0VA 2V6BA 3WGYA 2IHBA 2PX6A 1TRKA 5ENZA 2EX4A 4Q66C 3KAKA 3RUFA 1H5UA 3HKDB 3F2VA 5CA0A 1BCSB 3WZLA 2NVOA 1T1JA 3LHKA 3SJZA 2O5EA 1X70A 1J99A 5ALWA 2ZBFA 4NNJA 4YJHA 5CAEA 1ZMBA 4ESHA 1EP3B 2VXYA 3P0RA 3VZPA 3AESA 2OGWA 2ZU6A 4N0DA 4ZJYA 1AS3A 2E0IA 4E88A 3E2MA 2B8EA 2XOXA 4MR7B 2CVOA 2ISSD 4V2UA 2G77B 5D85A 3LBAA 3VX4A 2CL5A 1MLDA 2EV9A 3D54D 5B1HA 3L8GA 5CAEB 1TTTA 1R6VA 1PHRA 5CHYA 4K9RA 5CVTA 3GUYA 4KK3A 1MB3A 2BF7A 5FOSA 2RGRA 3FJYA 1PLLA 3AHGA 2XTZA 4QBKA 1O4VA 1O0BA 5AW4A 3NEYA 4ZU6X 3U80A 3KSAC 5HM6A 1E9AA 3ZBTA 4D5GA 3PKZA 1V1RB 3ANYB 3B6MA 3D5QA 3K0FA 1YR2A 1ZUNA 2F1HA 4AS2A 3HEMA 3LX4A 2K2QB 2YCLA 2RG1A 4HAIA 4RFSB 4EFNA 4GPBA 2RK3A 2AJTA 4RTQA 4FK8A 1WEKA 2KI5A 2O7NA 1PP4A 2WF7A 2ZRLA 2ODPA 3E9YA 2XIJA 1Y42X 4Y1GA 4J4BA 2RD2A 4H77A 3T9FA 2MSNA 1X8LA 5IZCC 5JDIA 2Y0PA 3CLUC 3ZOKA 5KPDA 5FYQA 3IEMA 2CJYA 4YRIA 2YZ7A 4KITB 5FO0A 4P4SB 3EGCA 2IITA 4CIDA 1RYNA 4EABA 3LWNA 3LKDA 1Y98A 3UG6A 3G9TA 4GBED 4JEMA 4CEIB 4MRVA 1MEOA 1YGYA 3VVBA 4BMPB 3G2NA 1X8JA 4FC7A 2YBEA 5JNRA 4PN3A 1HXHA 2HRRA 2LIVA 2QVCA 3T9BA 3DXFA 3NAZA 3IAS6 1XF1A 2VDRB 3D8RA 4HDNB 4X3OA 5K0LA 1IEWA 1Z47A 2YIVX 1MO4A 4WHMA 4O3MA 2OILA 2ZYRA 4N5HX 4WRRA 1NOIA 1KRHA 1DRJA 2NO4A 3F90A 4QDUA 2TMYA 3ONVA 4JI8B 4BLQA 1XDDA 3AHJA 1BU8A 3R7DA 3T1VA 3VPBA 3ZY5A 5JAUA 2AG5A 2I03A 4HWPA 3PV0A 5SZJA 4YAKA 2XYHA 3MS2A 3B78A 4JBXA 4R1NA 4M0CA 1QUEA 1VSTA 3BG5A 3L06A 3BD6A 4JQYA 4MR9B 3RJZA 4DLAA 5J58A 2UXDB 2CNNA 4HS4A 3LF2A 4MLPA 3TSCA 1MC1A 1QIFA 3WISA 5JSUA 1R8QA 1PNQA 2ORIA 4HZUB 2QTZA 2GFQA 3RHFA 3VYRB 3WIEA 3UH0A 2WVGA 1XHFA 1PZEA 1Z2DA 2ZYHA 1KVQA 4F56A 1JLRA 4HTFB 1WAMA 3WO1A 1RI5A 3CW2A 3ED1A 1REQB 1D2NA 1RLIA 2NTYC 3JQ8A 2YC2C 2CLKB 3GLVA 4P22A 5BQOA 3EHDA 3P0IA 4J2TA 4IIJF 3PEYA 4KHZA 4OJKA 1YVEI 4I19A 5J2UF 5AKZA 3PSHA 5BVHB 2PG3A 1OT5A 2I2BA 3AETA 5KJEA 1Z4OA 3GB9A 3MUNA 1R0WA 4RJKA 3A3KA 3NYIA 3IAUA 1ABFA 1A8UA 2EHDA 4GE0A 1I80A 2C3OA 2ZROA 5CCBA 1GZVA 2VN8A 1FFGA 4M54A 4MROA 4DC0A 3B1KA 1E0AA 2R7MA 1UPAA 2PKRA 4OD0A 5BV2P 1ZNZA 1JVSA 4M7PA 5GV7A 3BZBA 1UFQA 3N2ZB 3ABSB 4YWHA 5IBRA 3UJ8A 5I7SA 4X92A 4ZCSA 1EGHA 1JX6A 4RU1A 2BOVA 3UVEA 4LQDA 4YCDA 3KXPA 1GPH1 1Z2NX 3OC0A 5FULA 3RBVA 2AG0A 1G16A 4V0KA 2XWQA 1KJJA 1Y37A 1OQAA 3SDSA 4F2PA 3BXXA 2F48A 4BMVA 3D5EA 4WZBE 1L5VA 4M9UA 4XSVA 4HD8A 2VBGA 1VBMA 1K8XB 4NHEA 5LIPA 3VHXB 3QNWA 1EESA 1FS6A 1F0PA 3DE5X 1ZS9A 3IRUA 4BVBA 4CGYA 2DFPA 3DAHA 4X9XA 4BXOA 1ECPA 2F9LA 1QHIA 2R25B 3LY9A 1UPTA 1V3VA 2FP4A 4KDFA 5JUWA 5I4KA 2PRKA 3A7DA 4DYHA 4KX5A 2VSXA 1KJNA 1RCUA 4OYRA 1ZRHA 4CVNA 1A4XA 1T1GA 1YAJA 1Z5PA 3W6PA 5KX5A 1C8VB 1EUDB 3A32A 3CLRC 1EX7A 3R6LA 1OCEA 3AEYA 1LNSA 3ZOZA 2XXAA 5EVJA 4JMLA 1LJ8A 1DV1A 3F1LA 1EXDA 3LW7A 1I24A 2DSNA 1XA4A 4P7FA 1M34B 3I9OA 4R2XA 4LXHA 3TDKA 4IXDA 3RANA 4G9BA 2PRJA 3KVNA 4QM7A 2C4NA 4JVNA 4C7JA 1TVKA 3AERB 4RIGA 1PR3A 4AY5A 3ABZA 4TS1A 1Z63A 3VDXA 4Y9SA 3H8WA 1UKCA 2LBPA 2P79A 2WIFA 3ACDA 5HTOA 2Q5CA 2WU8A 1VLVA 4BKPA 1C3LA 1W19A 1SUSA 2VJDA 2DERA 3LLMA 1KMHA 3F49S 1US8B 1SIWA 1YV9A 2Y1GA 2VBCA 2QYOA 3CPHA 3T3HA 1Z28A 4KE9A 4WOKA 1B6TA 2QAGA 3PP8A 4QXAA 5G0SA 3RYIA 3T5MA 4RNDB 5AUPB 2GN0A 2ZQYA 3DHVA 3HUFA 4J49A 5ALIA 3RIGA 1YR9A 5EHXA 5TPZA 2P27A 3KQNA 1KFJB 1GWNA 2VNHA 3FPCA 4CG0A 5JD4A 3LPMA 1SPBS 3NWOA 4RQAA 3AXTA 1EU1A 2C31A 4GLBA 1UWKA 3PFCA 2DPLA 3OCYA 1CZNA 2I6QA 3BREA 3EVEA 4Z4QA 2P35A 4DMHA 4J03A 3K2QA 1P6XA 1DXQA 2RH5A 4LECA 4TMFA 3R9IA 3RK4A 3ZHZA 5A04A 1O97C 1WB6A 2E4VA 3PI6A 4QSHA 1GPUA 2JEYA 2JI9A 4W1PA 3DZIA 3RKRA 2GD6A 1E6MA 3AG5A 5G2OA 2J7PA 5IYZF 1LXCA 2GN8A 3TTXA 2ZE5A 1QC5A 2CXNA 2Y1FA 3N8HA 3P5SA 4Y6QA 1G9XA 3HNOA 5TQ2B 2CVPA 2QBYB 3P9SA 2B1GA 2H48A 3WMGA 1VBFA 4ZP1A 2PWZA 4BB6A 1NIPA 1PYDA 3R20A 4O33A 2YOFA 4MJLA 2A9FA 1XVIA 1GQOA 4J9VA 1YQ9A 3SIRA 4BVFA 1U0OC 2FSIA 1STOA 4NYIQ 5ITWA 4D56A 4HVLA 2JBHA 5E0KB 4GUDA 1D4AA 4J0FA 4BAGA 1GT91 2C5LA 3OTHA 5G40A 4QGSA 2AN5A 4FXOA 3KCQA 1H94A 3BHNA 1G4AE 4ZVKA 2BDUA 2VQ3A 1P5JA 2CVZA 4OI1A 1XD8A 2YINC 4PO3X 1J1IA 1DAOA 3BRWD 4KQXA 1FEZA 5EGNA 3AVTA 4EKYA 3L4BC 4PPGA 2R7LA 3PA8A 4BFCA 3C5CA 4BV8A 2HMTA 4DJ5X 2CY0A 1S5PA 1YS6A 2G71A 2PANA 3IMCA 4O2RA 4PLVA 3TD6A 4CL8A 1YT5A 5A7FA 2E89A 3BXGA 4DM4A 4LE0A 1Y8QA 4O6VA 3CIOA 2EARA 2XGOA 3QU4A 3AUUA 3QG5A 3VNRA 4YPVA 9GPBA 1A7KA 1EJ2A 5HFJA 4OQXA 4DRXB 1RQ2A 5AJTA 4BVLA 5BPFA 3C5WP 5KQMA 5E7MA 3IL2A 2JHFA 1S2MA 2UYHA 1F60A 2Q1SA 4C30A 5HVNA 2F55A 3VC7A 2BFCA 2Q5JA 4OU4A 2R2GA 3P71T 4OATA 3EJ6A 2R97A 3C3XA 3IULA 3NVMB 2BF4A 3PA6A 1FU4A 1N3BA 2EQ5A 3TLMA 5KNBD 2JAPA 2YHUA 3C8HA 3G23A 2J7KA 4TV9F 3ES9A 2F43B 3WGOA 1PUXA 3S0JA 3HVHA 1E2HA 4CI0B 2WA1A 3KTDA 1U8CB 5F35A 2NZ8A 4O4JB 3G1UA 1YRQA 2W6ZA 4LOIA 5CT5A 1QG2A 3RVNA 5FR2A 5LOVF 4RA6B 4E11A 1PWZA 3GARA 4NE2A 4F3NA 5IAGA 1N5DA 4A6EA 3TGPA 5D3ZA 3NDPA 4KWEA 1PVOA 2J33A 4AZ0A 4LWQA 4U00A 4M49A 2BAGA 2YZGA 1CUHA 1YB4A 5T6BA 1YFZA 2PX5A 1WDKA 2BGLA 3UHAA 1GAJA 1KVRA 3GN2A 3VNUA 1OAAA 2FSGA 3WIDA 4TUYA 4ZC1A 1Z5WA 2HA0A 5B6JA 1HF3A 1V4NA 3FGNA 3IPYA 3I61A 2PVSA 3DWFA 5KVCA 3KU4A 1ICIA 4Z2YA 4H6WA 2IU0A 3ZCXA 3AR8A 3K31A 1C8KA 1Y9AA 1ZA2A 2RHBA 6PFKA 5HK8A 3HI6A 2CVQA 2B25A 2RSLA 2BDEA 2JRCA 3H2GA 3IAM6 1D2GA 4QLAA 4F1WA 1U5AA 1J07A 2GZRA 4J1QA 2PWAA 4OQFA 4RDHA 1T8YA 2C9YA 3JRNA 2XB6A 2PZGA 3EVBA 1M8FA 1JQ3A 2P67A 4EPTA 4JELA 2OMEA 3VPSA 4FHGA 1XZ8A 3LYLA 4G0MA 2CLOB 1T8UA 3TTTA 1MXFA 1ZGZA 1OXMA 2J7PD 4FCWA 2J9ZB 1QRSA 3OD1A 1KI6B 4CMHA 3GT3A 4NCKA 1Q3HA 3M6UA 1YCGA 4GX1A 4ITRC 4QOSA 1WCIA 3COWA 3VO1A 5ENDA 1XCPA 4K9KA 5BV7A 4LOAA 4BASA 4QASA 3T94A 2C9BA 3PC7A 4MV3A 4KSYA 1JAZA 1X0VA 3BXOA 4G2NA 4GFDA 2A58A 3UGKA 3WL7A 1H1LB 1WQ1R 2Q4EA 3EPJA 4DQLA 2L19A 5ETJA 2QMOA 4KSBA 3BDAA 3QVJA 5IK2D 4OHRA 3L41A 2OHOA 4RY0A 4CQMB 2V74B 2PXAA 3NTRA 4X20A 1MB0A 4M9ZA 4YV0A 5L7TA 4DC1A 2J07A 4GH5A 1WABA 2VJKA 4JUBA 3RGWS 1N2CB 2FRDC 3QOWA 4P35A 1EK0A 1TYAE 2CLCX 1VQ1A 3FE2A 4JKYA 3ZVMA 1A8QA 3LQYA 5PNTA 3PGMA 2BGWA 4WZAA 5JNVA 1B93A 1CY0A 5FWXB 3PKJA 2YKGA 3HU3A 1I3CA 3NX4A 2ZVDA 5AI9A 1CULC 1P72A 4WBNF 1WF6A 2WF5A 4R83A 4U02A 3GMSA 1LSOA 1ULUA 2I4LA 1KI9A 3H1GA 4WW0A 3FRHA 5D3KA 5DNVA 3UHJA 2DPHA 4GQBA 2ACWA 3VV2A 3NWPA 3MBIA 4KPUB 4RSGA 1TYZA 1X2EA 3TQIA 5G0UA 3T95A 4KUHA 4DBLC 5HM8A 5EKUA 1QAMA 1AUPA 1XZAA 3AM3A 3LUCA 4TS3A 5DCWA 3WQHA 1TUBA 5JECA 4G0ZA 1BO6A 3V1LA 4UUOA 3DOHA 1RYYA 5DEOA 4DA0A 1T5OA 5BV8A 5K0SA 3INYA 3K0HA 2X1MA 4UHCA 2BRUA 4TT3A 1OA0A 1P9NA 1YKGA 2QA5A 3EGDA 2C3PA 3HYLA 5M34A 1TAQA 4BNNA 1PD1A 4D46A 2B8TA 5ALLA 5CA0F 4FYJA 2WIJA 4RABA 4UFNA 3D1JA 5HZGA 2FZ5A 4UQPA 3UJBA 3IIEA 5CEFA 5KMGA 2XLBA 2JFUA 2ZRDA 3VOSA 2FPUA 2VUSA 4L8FA 2WJ6A 4PC3A 4V3BA 4CEHA 4NG4A 4ZO9A 3DMYA 3GV0A 4YVFA 1QK4A 1YSCA 4LHVA 1IBMB 3A9VA 4AZTA 3ZWBA 1NQVA 1OI7A 3GLRA 1ZKMA 3ZJ5A 1RHKA 1D0SA 1LK0A 1Z0UA 4DCJA 2VAVA 1RI3A 4LDAA 2WZQA 1PBTA 1UM9B 3G68A 5JDCC 2CV1A 1TA0A 2X5KO 3U16A 1J8VA 4FUQA 5FBZA 1MVNA 5CT9A 4L78A 1Z7YA 3P2JA 4MRAA 1Z56C 3U3JA 3OLYA 4EEXA 1LDNA 1THMA 3EULA 3ZWKA 3WHPA 1YZUA 3RODA 2BYTA 4DWVA 4NBRA 1D9ZA 1XNJA 1CJVC 1YIOA 2G5CA 2GF0A 3L7IA 3L84A 4Q7MB 4TTTS 4Z53A 1ODLA 2BFMA 3IV6A 3Q5GA 2X8JA 3L1JA 3VAAA 3ZVKA 2P65A 3CUWA 3P0HA 4NQRA 3T5GA 3BERA 5DTEA 3O4FA 5A7HA 1GUZA 3MJ4A 4ZYWA 5DNDA 1UZMA 2CLIB 2M32A 2HV8A 3LNCA 1OLSA 3EEIA 1S2NA 1T36A 4NFSA 4W82A 5T8KA 3QE2A 4M0DA 1E7YA 1QQBA 4UXJA 3ZLTA 3R3XA 3HJFA 4X41A 1D5WA 3VNAA 1FY2A 2C2HA 1N9GA 4YDHB 4MUAA 2PX3A 1MX9A 2B20A 2GTHA 5HK9A 4DUZB 1TZCA 1NG9A 3K0EA 3IJEB 1JWAB 3NOQA 2WHYA 1C7JA 3QWHA 3KZMA 3QKIA 4A82A 2NM0A 5KTNA 5LVAA 1EDDA 2PMCA 3BL5A 3NBKA 1B2LA 4DQKA 4FKBA 3SXJA 4DV1B 4ESOA 2GZSA 4BKUA 2H1FA 4FEEA 4J91A 1LUAA 1NN5A 2Q7XA 4QUGA 2IOYA 3QPUA 4ACBA 1NBMD 1P0QA 4ROSA 4XSGA 2O2JA 4F6RB 3DL0A 2DHQA 4WA7A 3RADC 3PJDA 4DIUA 3G2QA 1SG0A 1KAEA 1QTRA 1VIAA 3E9EA 4DS3A 1N32B 1I6WA 1BEUB 2H52A 2AF4C 2IUYA 1N5MA 1PWYE 1WMSA 3CU5A 3TOXA 1H6DA 1LBQA 3PWSA 2O7QA 4DPMA 5CDHA 1U99A 1VZ2A 3R9WA 1H69A 4IZOA 2FHSA 5HBRA 1KYYA 2EP5A 2FWMX 4IHJB 2GNPA 1VJ1A 2A35A 2VT2A 1JJIA 4XLTA 5AI0A 1PJ4A 3C85A 3JVDA 3KZVA 3TNJA 4AT1A 4F6CA 3QVXA 1OAOC 4GUAA 2DE0X 1HLFA 3JZMA 4L7QA 2YYYA 1F8XA 4QYXA 3AVWA 1RRGA 5EQDA 3ZDAA 2DTEA 2ZYGA 1SVNA 3P5BA 4L5IA 4PZPA 4ZXPA 3SS8A 5CG1A 3FTEA 4G65A 1SCUA 4YUZA 1WLYA 4RVCA 1PJAA 3BEDA 2H07A 3JQQA 1K4KA 2GESA 2AK3A 2NXCA 1AG9A 2IYYA 3KHKA 3UC5A 2BEVB 4F92B 4YMGA 5JNTA 4BIIA 1MV8A 3E61A 2C1XA 4GP7A 2FTKE 4UNQA 2J9XB 3EEQA 1RWVA 3L43A 5J2TA 2J0VA 2E18A 4GM1A 3IJ5A 4ER0A 4BVEA 1WQ4A 3HDYA 3QIAA 4KYUA 1OJLA 3E82A 5ICCA 1K4MA 1UP6A 2AR7A 3A04A 3K53A 2X5JO 4XWOA 3NVAA 4CTNA 1LRKA 5BUQA 1TW2A 4CJXA 1AS2A 1XR3A 2FR8C 3RHTA 3VDRA 3ZHBA 4AMBA 2X8LA 1TMOA 2R6CA 3HCEA 2NW6A 3LPNA 3DBLB 2Y1XA 2OE2A 3M6MD 4G5FA 2HPAA 2G80A 3ZGYA 2OECA 1G8KA 2PDAA 2J30A 4CIWA 3QUCA 4DLUA 2J5KA 1ZR2A 3VR3A 2CNLA 5CM8B 3KYCA 4RHYA 3HC7A 2P9JA 4LJAA 1N0WA 2ZYTX 1NVTA 2CNKA 4D81A 1IHXA 3VSBA 4BCDA 1ENPA 1CUFA 4RIEA 5EJFA 5KCZA 4OIMA 4PCAA 1UBRS 1WXHA 4FQ8A 4E1BA 3B38A 1MIHA 1ZKDA 1EVQA 3O2NA 3IPAA 1U94A 3IDAA 5A9TA 4DSAA 1B8UA 1B14A 2G07A 4ZDIA 1Z8FA 5BN5A 4PSKA 5L3SB 4CKBA 2VTKA 3RD5A 1OMOA 3W9YA 1JAYA 2IRWA 4RXMA 4XWYA 5A7GA 1WXGA 4N0EA 1HDIA 4H6PA 4BMDA 2CJPA 2D00A 3KIPA 3RAGA 3WFIA 1E3TA 3I3SR 3GFTA 3JAKA 4IIEA 5KX5F 1NRXA 3KDSE 3LAWA 2X7XA 2GEVA 2QVXX 4RY8A 3RQIA 4CKEA 4D43A 1Z0AA 3AKCA 1ADBA 1RQGA 3DKIA 1LPNA 3EPRA 3HCFA 3CNQS 4J0HA 1DX4A 4M8SA 4UUAA 5HDQA 1HURA 1U7DA 4ZXFA 1LY1A 4B0OA 1XZIA 3G85A 2ZRQA 1I4TD 1TPZA 2WIBA 2VF8A 3M6IA 4JC0A 3TTVA 3PEEA 4C29A 1EFUA 1MO6A 3F6CA 3QSGA 1TEXA 4J8PA 4P32A 4KOEC 5G1OA 4ZI3A 2I2FA 2HC9A 4KIFA 3FDXA 4LY6A 2YVQA 3NI2A 5I7EA 1V1MB 4FHZA 2YMQA 1EXVA 2VF2A 3EBLA 1LPSA 5KHLB 3U19A 4IDHA 3EBPA 5KAPA 5K8JB 4E12A 2YFYA 2FA9A 4PCVA 2VQSA 2WJ3A 3GA0A 3GT0A 4PYLA 3VPAA 2R4QA 4TKUA 1DG9A 2A5LA 1RKXA 2GARA 4CF3A 2BMFA 2O50A 1JQDA 4S3MA 5K6TA 5DM4A 4DT1B 2I54A 2Z4SA 1T0BA 1U9ZA 4XA8A 1VPDA 2WUFA 4YIKA 4B73A 6REQA 5KVVA 2E5LB 1E4EA 1II0A 4XQEA 1V4VA 5AVVA 2QTFA 5JS6A 1ENYA 3OCCA 3W2GA 4GT1A 3FNHA 4UDYX 4QPJC 3VPFA 1P75A 1J42A 2I6SA 1XSEA 3GJQA 1V9CA 1O9HA 2ODWA 3FF1A 2FK7A 4KXQA 2J8ZA 1DQYA 2QJRA 2Y1CA 2ID7A 2FETA 1PEAA 2UZ1A 3AHCA 3MCAA 3A1UA 3CLTC 4JXKA 4C5BA 4HAZA 4INJA 3RF7A 3W8NA 3D6TB 2FEKA 2CFTA 2GPTA 1RYZA 5FD8A 2OC4A 3P2KA 1M8GA 5BSUA 4BGVA 4C2BA 2WWRA 5HBGA 1FPQA 3E9QA 4BJ3A 4UMFA 3RRMA 3K73O 4ARZA 3KQQA 3GG9A 3ID6C 2Z5FA 3JAMA 1H66A 4QVGA 4OA8A 3WE7A 4B4VA 3WYAA 2HREA 2P9HA 2V7QD 4KN5A 3VRHA 1VYUA 4B85A 4WXEA 2CF6A 2GASA 4XSHA 2OQRA 1NW8A 3Q7QA 5FWNA 5EWJA 2W2XA 3DD1A 3LG2A 5L6MB 3GVHA 4H3VA 1KOJA 3DBHA 1RMYA 1EMDA 2O5RA 2HY7A 3TWOA 2AOUA 2ID9A 3AR9A 4WKBA 2D2FA 3T5CA 3IXQA 2IYXA 4NZZA 4K46A 4YRFA 1GY8A 1S7GA 2GD0A 3G13A 421PA 2MDTA 3K9GA 4BNIA 2OB2A 5E9WA 1FFAA 1JZTA 1HNWB 3FUUA 4QPPA 4UHBA 4P4GA 5KVAA 2EZTA 1ONSA 1EVJA 4HDSB 1JWBB 1LTQA 2PJZA 3H9EO 2CYBA 3HNRA 2ZT6A 5EHIA 3VU9B 5KTYA 4LNUB 2FMIA 1YB2A 3WYGA 5L3VA 3I9V6 4JX8A 4IINA 2ZULA 5HMLA 1NBAA 4EUKA 1A27A 3NAGA 4EKDA 4Q1DA 4K3VA 1PK9A 1SB8A 3O95A 3DTVB 1L1EA 4DBZA 1KA9H 2PZ8A 2R8PA 3LUFA 1W88B 2J3EA 5HIMA 3SDBA 5J63A 2AC7A 2VS1A 3MJCA 5L3QA 2OHVA 4FNMA 5BSMA 4UM9B 4MEAA 1FQOA 1SEVA 2IIQA 3AFMA 2G1UA 1SVLA 2EWVA 1JHRA 2A33A 3PC3A 4UNIA 5IC5A 4EUNA 2ZSIA 3FCYA 3ZG6A 4URHA 3G2MA 5BNFA 5K3CA 1W0KD 1TJ4A 3IKLA 4NDNE 4PQRA 1KARA 4IV5A 4YAEA 2FZGA 3UW3A 1O5OA 1SK9A 1D2HA 1ZCAA 2ZR8A 3JVVA 3KKQA 2CB9A 4O59O 4REQA 3VZCA 5CJJA 2CV2A 3UJ6A 1M7HA 2VDWB 4YLGA 3T54A 4WN3A 4E3ZA 2Z4TA 3SLKA 4U3JB 1AK1A 1MX5A 1RXUA 4Q19A 4KN9S 2IOFK 3K8YA 1VFPA 5A3VA 4RS3A 1RPJA 2QU7A 4L3WA 5ARCA 3QZUA 1JR3E 1GQFA 3AOEC 3COSA 2H11A 3AUTA 4Y2HA 3D43A 4YAUA 4URZR 1A50B 3GFPA 2D7DA 2BI8A 3D3WA 1GUYA 3UAYA 3TW0A 2WJVA 3GMDA 2C94A 2VRCA 4AJ1A 4DUGA 3E1GA 1SVWA 2H1VA 3BCHA 1YDHA 3HWRA 3DT8A 4FYYA 4RZ3A 2YVLA 3WBBA 4RLSA 1L9KA 3A1NA 4G5SA 3TRDA 3LI2A 3M3HA 3P2MA 4DWJA 2LDBA 4NK5A 2L18A 4QUHA 4UFPA 5IT5A 4TUYF 1PK8A 3DTNA 1DIOB 4TMKA 4B44A 3HXLA 1F6DA 3FD8A 4RNCA 1WZCA 5HG0A 3PUHA 4MR8B 4NPCA 2GEDA 2GK4A 2OR3A 1K2WA 3OCVA 1R4NB 5JW6A 1FUKA 2P9CA 4JZYA 2YRXA 3QOYA 2NVUA 3TIVA 1SQ0A 3QVMA 3GUCA 1SXJE 3WNZA 4DIOA 3Q8LA 5CGQB 5FH9A 1ZONA 3I2IA 2J4FA 4HN2A 4PLZA 4KO1S 3H97A 3LPCA 4DXAA 1DC5A 4ZYUA 4UQLA 2PZBA 5EYPA 3HK2A 3JZFA 1VCHA 3MMPA 3MOSA 3CX4A 2G9NA 3UWSA 2QR5A 3WWZA 2JGEA 2NU8B 5AW0A 2FLKA 1L4HA 3HVRA 2KPOA 4Z0PA 4B2YA 3C3DA 5KINB 3HRIA 4DILA 1E5XA 1A7UA 4JYCA 2HU8A 3ORSA 1UOQA 4MPPA 5AH0A 5LOVB 2ZM6B 1T9ZA 3ISJA 2YZNA 2EL9A 3O31A 4X8MA 1DOAA 2O52A 4BV9A 4TYPA 2ZUCA 4JUAA 2BTQA 2HSZA 4O4LA 4RZQA 4EF4A 2MYNA 4LZZA 2YOGA 4NBSA 4G5YA 2O54A 4W1RA 1CP3A 2WG1A 3HFGA 4RV4A 4JFRA 5LP1A 4U5XA 2JHCA 4D4JA 4LOKA 5E7IA 1VBKA 2WDPA 3EJWA 3GI1A 1YL5A 3T15A 1J09A 1E77A 3TR5A 2IHVA 1Y80A 4CDRA 5IH3A 2W2PA 1EHYA 3RVQA 2AFHA 3OQ6A 5JSKA 3L7YA 4NATA 4KQ2A 3ZE1B 4I3FA 1NXTA 4J94A 2WTEA 2FEMA 1RJFA 3INNA 4GPD1 5BSRA 3SIXA 3WQBA 1ZSYA 3ESCA 1ZH4A 2W6MA 4L8GA 3CFYA 3B5JA 5JPIA 2D2EA 1ZBDA 1O08A 1XWIA 3OX1A 2X6TA 1VMKA 1JB9A 2C2WA 2GF2A 2JVIA 1MU0A 1FMLA 1P4RA 1L4UA 2MINB 2P9QA 2QX7A 1U3GA 3GIDA 3RT7A 3H19A 4WCVA 1K8YB 1ST3A 4II7A 1OC2A 4UBOA 4GZ6A 4E2YA 1JSCA 3BB4A 2PH7A 1KZ4A 4ARUA 1GG5A 2X7HA 1PSDA 1FRVA 3GZ4A 3RUCA 4B8YA 1LSSA 3EGXB 1DQZA 5CA1A 1V48A 3K0KA 2E49A 3D7NA 1IU9A 4FMPA 5K99A 4IJKA 3E03A 1PT7A 2C03A 2IYLD 3HYSA 4J75A 2ZT5A 4P3PA 4YUAA 1AB6A 3GDOA 1WU8A 4HX5A 1M8KA 4MWCA 1U4OA 4Y0VA 5EZ5A 2HQ1A 2FW0A 4I4TA 4KGDA 5LDHA 1M7GA 1TYDE 1PN3A 4FBGA 4WBSA 3NQ41 1COZA 4EJ6A 5JEDA 4Z3OA 5HR5A 1RTTA 5EJ7A 1CETA 1YRHA 1H8ED 1I7LA 3VTFA 1S4QA 5B5SA 4I1YA 3PDIB 4GOND 4P86A 3DC7A 4DUGD 3ZKAA 4QLOA 3PF9A 2P4UA 1P62B 4X1YA 1ADCA 4LCJA 3K6SB 4F3KA 2CW5A 5GMOA 4Q3EA 5EXXA 4M98A 1ESZA 1UBGA 1J6UA 1W35A 4OAQA 3HGTA 3RR2A 3V8MA 4EG1A 1NONA 4YAIA 1U0TA 4QICA 1DDIA 1E60A 1NY5A 4IDOA 5H81A 3LBFA 3DE1X 2EZ4A 4UD6A 5HQTA 2O06A 1UEIA 1USVA 4DDWA 1LD3A 5G0TA 5C8YA 1NC1A 1AGNA 1CIJA 3D2AA 1GARA 1JXQA 5FRDA 3AR4A 3GGCA 4UAVA 3CF4G 2NADA 3UF0A 5L9AA 3R7BA 3RSZA 4EGCB 4MV1A 2QUHA 3FGPA 2XRMA 4TZ0A 1DFHA 3Q87B 4J2HA 4XCVA 5ALFA 5EFZA 2AX3A 2M1ZA 2R1TA 3JQAA 3BH7A 5JE8A 4G9EA 3OY2A 4F60A 2GB4A 3U4CA 1KVUA 4LVOA 2X58A 3VC3A 3SC6A 4FMCB 4HLQB 4L0MA 4CFZA 4HFRA 2P69A 4GP6A 1AXEA 2W0SA 4RELA 2RGUA 4AYWA 4M89A 3Q6NA 4XXHA 4C2TA 4F5WA 4LRQA 1J49A 4NSNA 5IANA 1Z5GA 3PVZA 5CB6A 3R6GA 5BR1A 1K8RA 3LUJA 2FDRA 1GEEA 1NW7A 2CL0X 4KH0A 2PAAA 3FNFA 1OYWA 5KB3A 5AK0A 1HBJA 2MR5A 3OZFA 3R0ZA 4RW0A 1E1RA 2IQIA 2Y1OA 2PXHA 3TGLA 1SR8A 4G1VA 1ZJWA 2AZ4A 2OXEA 1TO6A 4LSZA 3V8VA 1KY2A 1XMIA 3CSUA 1AOXA 1NQOA 4HXGA 4ILEA 3HUDA 2Z3WA 5B37A 2XXBA 4GDMA 3UJ9A 1CJUC 2GHQA 5E6SB 1L7PA 3OTWA 4FI3F 3I4FA 5H82A 4YQEA 3R7WA 3ZHOA 5EWMA 4B6PA 2A92A 5JI2E 4D82A 1O6FA 3QY0A 4ISBA 4QQ8A 4UCWA 1XMOB 4DEYA 1HEIA 4RANA 1NR1A 4GEGA 5HKAA 3KQMA 3PXEA 5FP0A 1A1SA 2VHWA 1H65A 4LUCA 4MV7A 1NA5A 4EAAA 2VBFA 5ADHA 1CT9A 3EZXA 2F59A 3D4PA 5E6UB 4ALNA 5DM60 2V03A 5A1TA 4MDEA 2FRDA 5J2TF 1EX1A 2VUIB 3HJGA 3H17A 4FLFA 2OK8A 3ABOB 3USZA 4CCWA 3RVKA 2WJGA 3HBLA 4WECA 1J5PA 4ZWNA 4RKQA 4EO9A 4HQFA 2NUTA 2VQ6A 3ZCQA 2A8YA 2P2DA 4P3YA 5KQGA 2DPYA 3EODA 1CS0B 4TV8A 5C31A 2IXDA 5LQDA 1PR1A 4ZO6A 4FONA 3O8DA 5IUJC 1QRTA 1THZA 3HFRA 5EIBC 2H8GA 5FUVA 3V33A 2ZK7A 3W2HA 3CT4A 5HKKD 3EPPA 4D7AA 2B9VA 4I5IA 1YBVA 1VIYA 2NWQA 4EKEA 4EP1A 4G0UA 4JGIA 4ZHSA 1DARA 4W6ZA 4D25A 2WF6A 5DISB 3MPOA 2AUTA 3ZHSA 3PZBA 4G89A 5JCXA 1ATIA 2CLFB 2YUIA 4P3OA 4QQRA 5EWLA 3TEMA 4F7WA 3UO8B 3W0LB 2G7ZA 4MULA 1H4TA 4H1UA 4X63A 3RB8A 3UT5A 1WXWA 1T8PA 4ZVVA 2BMJA 2ACEA 3C74A 4RJTA 3T7AA 1IJEA 5DBHX 4G4SP 3UYKA 1IMOA 3GLFE 1I7DA 3E15A 4PGMA 5E8JA 1NGSA 2JS7A 2XUQA 1FJXA 2XCRB 3O8NA 2ZTLA 3DF9A 4GKVA 4OHFA 4GQIA 4KKVA 1P73A 2QK4A 3V1UA 4UTRA 1SELA 4M7RA 4NCHA 2JAOA 1V8DA 1NNLA 4MGIR 4LK3A 2JEOA 2QENA 4CM3A 3VKHA 4XD7A 4JOQA 4YRLA 5HUHA 4IOLA 3VVCA 5FNVA 5BT8A 4LZWA 3PNBA 2GNOA 4R81A 2FPIB 2ZJ0A 1JEAA 4OXXA 3K71B 2O4CA 2RHWA 3UA4A 4IRMA 3LX8A 1E79D 4D80A 4TS9A 1L5GB 3HL0A 3DVSX 5DRTA 3ROZA 4KREA 3SBDA 2VUUA 4H1VA 2C00A 3ZE2B 3K0AB 1M74A 3SBOA 1Q7EA 3B3JA 3PGA1 4I5EA 4ZCMA 3WGIA 4QDZA 2F62A 1PVVA 2ZFUA 4FLMA 1ZEMA 3G2JA 1KI3A 2C77A 1M8JA 2GQ0A 1FP4B 1QRRA 2RK4A 5FXMA 4G01B 1UXJA 4R9RA 4RHCA 4Q4DA 2PUFA 1W4CA 2YZ2A 1T2AA 2R7AA 4W5TA 2QZPA 4E70A 2VO1A 1J70A 4INPA 4NJMB 3V42A 2PUEA 1OXSC 4ARCA 2RH8A 1Y4UA 4D6YA 1T6NA 3NNDA 2JF0A 4CLOB 3CLSC 1DSSG 4D9JA 1IWPB 1ZCBA 2W22A 3BOSA 5AYVA 3NHAA 3KKMA 3WJ1A 1EE2A 4IF4A 4HYTA 4R0NA 3B48A 4AG5A 4BNFA 3LECA 3E48A 1ZM3A 3C39A 1YJQA 1ZH8A 5AXCA 3S7ZA 4D9BA 4QGBA 3DONA 1AA9A 3LUAA 5CFOA 3NBFA 1NX6A 2G9UA 3QHPA 1L5WA 1LKZA 4WNAA 1JW9B 2AW3A 1KE2A 3KHSA 2E6KA 2NSDA 1M0WA 3RVMA 1CR0A 4N0MA 2JGDB 4D3YA 1TEHA 5HILA 2RB4A 2VP9A 4WLEA 4OI0A 2H2GA 1YTLA 4CMIB 1WB4A 4ZZIA 2BFEB 4ED9A 2PZAA 4KX3A 1I33A 1HTTA 2IZ7A 1L5YA 3ICPA 4MQEB 2HIMA 1UZUA 1OAOA 2AB0A 2Q45A 2EC5A 3C98A 1JBKA 2IJGX 1QGDA 3C45A 5EY5B 1BWPA 2UYCA 1FTSA 5D51S 1V2HE 3I2JA 1JAIA 2WZCA 3WMFA 3W9SA 4YUXA 3D02A 2YS7A 3F67A 2PIAA 2H92A 2QSZA 3M83A 3X0DA 1PEKE 1SBQA 1XBTA 2WT8A 4QPNA 4DAEA 1T9HA 4R1TA 2I99A 5A6SB 2JFOA 3HB1A 3OQOA 2PJDA 1AGPA 1UFKA 5CYPA 2QTVA 1QE3A 2ZUEA 2JBAA 1V8PA 3I01M 1RWPA 3KUDA 1QPBA 3I0NA 1JHVA 4I6EA 3OJOA 5GJWC 2XOEA 4DCVA 5C8XA 1WSDA 4P93A 2ZUUA 1A04A 3IT0A 3MIZA 2AR9A 1WE2A 3P9NA 2NXJA 2GHTA 3MERA 3N9IA 5HOEA 3DDWA 5KSPA 2R4UA 2SICE 3R4VA 1YASA 3R4CA 2ZANA 2DFTA 3L49A 4RL6A 4YEDA 4ETIA 1D5CA 2FZ4A 2R0QC 3OAAA 4DR1B 3LLCA 1XZEA 2QTMA 1XZFA 1J4AA 1IJKA 3CISA 3TLAA 2WZDA 3R9XB 1OWNA 1GIAA 2E4YA 2H57A 3DQQA 1BW9A 3KR0A 3L8CA 1TAUA 2HMUA 2HKIA 2VPZA 2YXBA 2FKAA 1MAAA 1XKXA 2KE5A 1R3DA 1B6RA 5DGXA 4F2GA 3K0SA 4ZC8A 3I2FA 2MMGA 3K1JA 1K7CA 4CIVA 1X7XA 1M2KA 2DQKA 4V0RA 4A7PA 4XD7D 1RXEA 3H05A 3R5KA 4ZCIA 3EWAA 3F8SA 1HEUA 4PY2A 3GVIA 1A82A 2D6FA 3U0VA 1GPNA 2D1RA 2EGUA 1AZLA 3JQ9C 1Z39A 3FHCB 1Y8RB 4DLBA 5CCXA 3KOYA 3E3NA 2WA2A 3SNHA 4Q7EA 3COJA 3A6LA 4IFTA 4ZKEA 3CG0A 3BS4A 4M0KA 1G63A 3K5WA 4NP6A 2QLJA 1I2CA 1TA9A 3ILSA 2YV5A 4JLKA 5EMMA 3S2EA 3ZVLA 5IHPA 4RKRA 4ML3A 5TEWA 4IDNA 5H8WA 2FW9A 1EIWA 1NNI1 2AQIA 2O3RA 1TFRA 3CRMA 3COPA 4IPTA 4QU0A 3VMMA 1N0IA 5ALMA 4WLFA 1QZTA 3REQB 4CF7A 3OZUA 3S8MA 1E3SA 4PPQA 4PG8A 1Z4MA 1SHZA 2YIMA 4KIJA 3TAHA 1DO2A 2XYVA 2ZB7A 2H8KA 3RAEC 3WA7A 4GKAA 5DP2A 1IEXA 2ZDHA 3NU1A 1T35A 2QS9A 4GR9A 4N3NA 4IG4A 3ZNQA 3GLTA 1KO8A 1I3NA 2FSVC 3W1EA 4OHKA 3LDGA 3IEKA 2P0EA 3CH4B 3L7LA 4L0CA 4DJAA 2L82A 3BTUA 3K4QA 1XCJA 2ZTMA 3CN7A 1DX6A 3E9CA 4DLWA 2Z43A 4M87A 3OBIA 4DW8A 5KVSA 3ZWDA 5BORA 2Y71A 2ZTUA 1VBNA 3UZUA 2UVPA 4FYPA 4P82A 1RJGA 3G2KA 1JDUA 2ZSJA 3L07A 2F8LA 4XVRA 2FNAA 4EHDA 2AZXA 2D5CA 2JH8A 5EXTA 1ELOA 2W5UA 2C0QA 4EVQA 5EEGA 4S1TA 1WCXA 1NBEA 1SH7A 1ZIPA 3IAAA 1TKBA 5BWCA 2GEUA 2YHIB 3JQGA 4WIAA 5AJYA 3GUZA 5E3HA 4M8IA 4CM4B 1OX4A 4IO1A 2ZI4A 2DAPA 4YBRA 4LJKA 5AI4A 2G0AA 3SJBA 1VPTA 2CJXA 4ZOAA 2NU9A 3A1WA 1SEPA 1L4FA 1XEWY 5C8DA 4I1PA 1HQCA 2BFPA 3X1JA 1BVRA 2EX0A 3VH2A 1X1EA 3KVRA 5C8ZA 1C3EA 1Z6TA 2QZZA 1P5HA 5BURA 1RYHA 1KZGB 1QH8A 1K3TA