2VOJA

Ternary complex of m. tuberculosis rv2780 with nad and pyruvate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
371
structure length
371
Chain Sequence
b'MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis
publication title Crystal Structures of the Mycobacterium Tuberculosis Secretory Antigen Alanine Dehydrogenase (Rv2780) in Apo and Ternary Complex Forms Captures "Open" and "Closed" Enzyme Conformations.
pubmed doi rcsb
total genus 119
structure length 371
sequence length 371
chains with identical sequence C, E
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA02
4YQYA 2B5VA 3QA9A 4RDIA 5EINA 3GDOA 3E6AA 2WMDA 1ULSA 4MVJG 3WOHA 5T5QA 3DDNA 1GUYA 4OOEA 4XGKA 4CM5A 5A9SB 7ADHA 1CQJA 5A04A 4A03A 2GGSA 5T67A 4ND4A 3RCBA 3UUWA 3ZN2A 1N7GA 3ZWMA 2FPPA 1SB9A 3GG9A 3D4NA 4RVDA 4IJWA 4DL9A 1Y1PA 1XR3A 2PZKA 1DIHA 3U4CA 1HF3A 1V3VA 2Q4BA 5C7LO 1WZIA 1RM0A 2JD0A 4IS3A 2DM6A 5EJ2A 1FF9A 3K2EA 4F46A 1OC2A 1RWBA 2CMDA 4M49A 2BLLA 3MCVA 3QWAA 1WAMA 2FR8A 3ROQA 3ZWXA 5A03A 3GMDA 4JIGA 5HRUA 4J3FA 3PPIA 2AEMA 4OXKA 3F1LA 4FC6A 5KIAA 3DO5A 1PJCA 1UZNA 1VC2A 2BF7A 5ICMA 1N5DA 1P0CA 2CF6A 5I8ZA 2VTEA 3AFNA 1E7MA 3GAZA 5KJFA 1E7RA 1G0OA 1IZ0A 4E2ZA 2B4TO 3GZNB 4E21A 2X5OA 3SXPA 1NHWA 4FJ0A 1DIBA 2JHFA 1J4AA 3LC7O 6LDHA 2VRBA 3H5AA 1N1GA 1A7KA 3INGA 3N58A 4BQPA 1JLLA 2O4UX 3V1YA 4BGVA 2P9CA 3X2FA 3PDUA 3L9XA 4GBJA 2P4HX 3WBFA 3ANLA 4KUEA 3FTNA 2UDPA 4TZKA 2OGUA 2X6TA 1P44A 1ZVMA 4E5PA 4PIVA 2O3SA 4QECA 1ISFA 3ULKA 1TI7A 1QR6A 3IS3A 3TZKA 3TOZA 4YT2A 3VZQA 1EUDA 3S2FA 1MB4A 5KKAA 1LC0A 5ES3A 4QFDA 5CG2A 4BO7A 4W9NC 2ZTUA 1HDYA 4YCAA 3G1UA 4OYRA 3H9QA 3GUCA 4URFA 1DXYA 4AJ2A 5JMWA 1E6WA 2GUGA 4IJUA 1SEVA 4TWRA 1Y5RA 5JMPA 1GAEO 2PKQP 5B12A 4UEOA 5MDHA 5TT0A 5IN4A 1QYXA 3NTQA 2FPGA 1H6DA 3DC2A 4YEDA 5FFFA 5EQFA 2FY8A 1IOLA 2I3AA 3D0OA 4MKXA 1EK6A 4DA9A 1PQUA 5EMHA 1H6BA 3DEYX 3P2YA 1UJMA 3VPXA 2PFGA 3M1LA 4BNUA 2UYYA 3JYPA 4A5OA 1GTMA 1B8PA 4BNHA 4ALMA 1P33A 5COQA 1KVTA 1DB3A 3DMTA 4ALLA 1JU9A 3GN2A 4R69A 1I30A 5L40A 1F8GA 3FNGA 2R00C 4OH1A 4IDFA 3PGXA 4BKPA 4ZQBA 4TMFA 3DBRB 3JTMA 3ZV4A 4LGVA 4OAQA 1U28A 2WM3A 5A4DA 3VPGA 4AJIA 4GWKA 1KEWA 1RKXA 4O0LA 4NJMB 4CM6A 2GN4A 2JFGA 4GPD1 2SCUA 3U62A 4BQRA 1MFPA 1HRDA 4GWGA 3ROPA 4RZIA 1ZW1A 4WCFB 2P68A 1BXZA 3KBOA 2Z5LA 1YOVA 4QO8A 2IODA 1D8AA 1KY5A 1NWHA 3DHYA 1OOEA 3NT5A 2BGKA 3D3WB 4MVJA 4FGSA 1GYRA 4XB2A 1FDSA 4XCVA 1YDEA 2D1YA 1CJCA 4I5FA 1GYQA 1RM4A 3VPHA 1ZMOA 1M67A 5JPIA 4Z0PA 2GO1A 1A9YA 2HMWA 3PIIA 4L8VA 3W1VA 3OIFA 1Q7BA 4RZHA 3JYOA 4F45A 1IHYA 2G5CA 1NBOA 1E1MA 4RF2A 1ZNQO 2ZB8A 4L4XA 4PLVA 2PGJA 3Q9NA 3WIDA 1DC3A 4W7IA 5JO9A 1SCUA 1VJ1A 2WDZA 4PRKA 2B0JA 1GU7A 2CDAA 2YDXA 3EGOA 5DDIP 5IDYA 5T8KC 2O23A 3F46A 3L9WA 2VWQA 1U2GA 2RBEA 1PL6A 3FR8A 5L4SA 1PGQA 4E13A 4ZRNA 4LMRA 4YDRA 3F1KA 1O94A 3IIEA 1XYGA 5TRTA 1JKFA 3L6EA 2AXQA 2CY0A 4RF4A 5TJHA 2ZTVA 2Q99A 5THQA 1O9BA 1ZEMA 1ZK0A 2A92A 1I10A 1LQTA 4UVGA 4M89A 1NASA 3DR3A 2FOIA 1VJ0A 2Y0EA 4CLRB 4NJOA 1WZEA 2YQ5A 4D7AA 3KYBA 1YQGA 3K96A 5U9CA 3RI3A 1V9LA 3IP3A 2PWZA 1LRKA 2PA3A 1XCBA 3DOOA 3QVSA 4BNKA 2LDXA 3VVCA 1NPDA 2CDBA 5COAA 1GQQA 3OA0A 4BO4A 3VPFA 2D2IA 4BS9A 3I1JA 3U4HA 4UUPA 2DC1A 2P9GA 2DBQA 2I5PO 3LF2A 3AI3A 2DFDA 3DXFA 3G17A 3ZGYA 4YXFA 5JFOA 2VHZA 4DVJA 4U8GA 1WPQA 5AXCA 3V1TC 2DBRA 3KRTA 5HWSA 3BAZA 1AHIA 2WE8A 3HFGA 3FD8A 4FFMA 3KHUA 1NFRA 3AUAA 4IQ8A 2UUPA 1WDKA 3OIDA 2X7HA 4XZ3A 5KVSA 3WGQA 3HN7A 2TMDA 4PGFA 1BMDA 2G17A 4XYBA 3K73O 4NU5A 3V5NA 2DFVA 3DOCA 2GN9A 3GF4A 4RL6A 4WLUA 4XIYA 4WECA 1ZSVA 4J1NA 4EYEA 5F21A 4OGWA 2UUOA 1VI2A 5CDGA 2BFPA 1K3TA 4FOOA 1CF2O 2AEJA 3C1AA 4KQXA 4Y6PA 1PZEA 1I3NA 1SNYA 2JAHA 3F4BA 1MLDA 3WNVA 4YB8A 3W8FA 3S55A 1E0DA 4M87A 1KIFA 3OJ0A 3S2IA 2B83A 1EVJA 3PP8A 4J1TA 4HP8A 3NDJA 5JCJD 1GCUA 4XYLA 1JQBA 4OKIA 5JY1A 1BVRA 2O50A 2J5RA 4PZEA 3RBVA 4TKLA 1A5ZA 1A71A 1MG0A 4YT8A 2QIOA 2LDBA 2NLOA 3RFTA 5CEEA 2GYYA 1LSUA 1KC3A 3ENNA 2JCVA 5A02A 2RHRA 4H7PA 5TF4A 3CH6A 4EUFA 5EPOA 1B0AA 4XDZA 5TT1A 2JL1A 1J49A 4I1IA 2IE0A 5CG1A 4NQZA 2P2SA 4D44A 3FCOA 5BNTA 2C54A 3ZNQA 2O2SA 2FN7A 3WJAA 4BKRA 4Q3AA 1X7DA 3PHGA 4HFJA 1PR3A 1HE5A 4CMIA 4BO5A 4W99A 4N5NA 1K89A 2WWRA 3E82A 3RQSA 3H2SA 5JC1A 2Y66A 4YJGA 3O4RA 1KVRA 1QXSA 2CVOA 2C29D 4CMBA 4ESOA 1WXDA 2WSBA 4NZ9A 1BSVA 2X0RA 1ONNA 3RWBA 1XU7A 1BG6A 3WFIA 3ROKA 1HDZA 5LCXA 2W90A 5HTOA 3ICCA 4R4JA 4AJOA 2XOXA 4WE3A 3R0IA 1U3VA 1I8TA 4EJ0A 1C0LA 1L7EA 4GSLA 2Y67A 4DQXA 4DGSA 5JC8A 3PLNA 2O3TA 1DRVA 2E82A 2VRCD 2AA3A 2Z1MA 4IINA 4BNTA 4Z9XA 3WGTA 4ID9A 1H2HA 4CV3A 1X13A 3QRWA 3ASVA 1ZUD1 5IZCC 1NQOA 5EL0A 1BW9A 2DVMA 2NQ8A 5F1KA 4CLDA 3FF4A 1HYHA 4GH5A 5A9RA 4PLPA 2ILTA 3I4FA 1AHHA 3EHEA 5JBIA 4AJJA 3PFFA 3H9JA 1GZ6A 4Y8VA 1QLJA 1YBVA 1JAXA 1RYDA 3DZJA 3VKUA 3C1TA 2X9NA 3UKOA 2GLXA 1PJLA 1WP4A 2QYTA 1P9LA 2DQ4A 3EW7A 4PVDA 2VUUA 1I3KA 4B79A 3EMKA 2JCXA 5IDXA 2BD0A 3WGGA 1Z45A 4XA8A 2JFHA 1OFGA 3JYNA 3JD3A 4IPTA 2OMEA 3I83A 3OA2A 2NV6A 1C1DA 1R0KA 3V2UA 1JWBB 5I7EA 4L4RA 3JQDA 2D5AA 4N5LA 2NTJA 1SPXA 5MGBA 5KTKA 1LLQA 4IDDA 3IDSA 4A0SA 2HK8A 4PVCA 5G0SA 1NPYA 1I3MA 3VTZA 2YW9A 5TJ9A 3UGKA 4I8XA 2EIHA 1NPTO 1M2WA 3H3FA 4R1SA 1BDBA 2GDZA 5KVVA 1TEHA 3LU1A 2Z1NA 3K8ZA 4CLOB 4PLWA 4UVIA 2BFMA 2J3IA 3ZWVA 3TL3A 2Y1DA 3JQ7A 3PQFA 2GR9A 1ISMA 3MTGA 4DWVA 4WPGA 1TLTA 1ADGA 3GRKA 1XU9A 4PLFA 1T1RA 4QEDA 5KVCA 3NJ4A 1BXKA 2OP1A 3GGOA 3KYDA 5AOVA 2GERA 3QWIA 1B15A 1Y8RA 5G0VA 2JKVA 1UR5A 4IUYA 2CDCA 1HWYA 1IE3A 3IKVA 3IUPA 2I3GA 4NFSA 3PDJA 4BNXA 3JD2A 1WDMA 1LDGA 4IQGA 1PL7A 1YE3A 4O59O 4WCFA 1RM3A 2BMAA 4Z3DA 1GV1A 2EHDA 3WGZA 3NGXA 4LISA 1B7GO 2O3JA 3BMCB 4PLCA 5JAQA 8ADHA 1QKIA 3DAFA 3GR6A 4JNKA 1ISHA 2EV9A 3OBBA 1VE9A 4R9SA 2PKQO 2UAGA 1FJHA 2OUIA 2C20A 3DBHB 2J5QA 3JYQA 4C7JA 5CDSA 1NQ5A 4NMHA 1ZSNA 4PLTA 3WS7A 3FPLA 4B4OA 3KSUA 3UF0A 2EP5A 2VYVD 1HETA 4BNIA 1OBFO 3D1LA 3GDFA 4XRRA 1VPDA 3Q2IA 2DTXA 1Y8QB 1YS4A 4BNYA 3LT0A 5CFZA 4WUVA 3QJ5A 3OJFA 1F12A 3JQGA 2ZKLA 4YAJA 3EY4A 1E3IA 3WX0A 1V3TA 2EKLA 3V2HA 4RVHA 3ZWWA 5ADHA 4R41A 4MIYA 1EBUA 3RU7A 4BKUA 4BGEA 2DT5A 1VL6A 4RPHA 4ZQFA 4DRYA 2IZZA 2Y1OA 3GG2A 3EZYA 1DFHA 5HBRA 3AUUA 4CM4A 4JJGA 3QQPA 2VNAA 3VHRA 1B14A 2FWMX 3JQCA 2CD9A 5KVQA 1MA0A 3PI7A 2VTDA 1WDLA 1SBYA 4E0BA 3RD5A 2X0NA 4GI2A 4CM7A 1EVIA 1PU2A 4UUNA 5DZSA 3WMXA 3AM3A 4DYVA 3NT2A 5JDIA 8LDHA 2YV1A 3DFZA 4RVGA 1U8XX 1A27A 1G0NA 3MJSA 3VZPA 3WG9A 4CM8A 1A4IA 4AFNA 4AICA 4H16A 4IQ0A 4IDAA 2O7SA 3W8DA 4BNLA 3ZWNA 3D3EA 4JROA 5KOIA 3LLSA 3PGJA 3OMLA 4WNCA 2YV2A 4CM9A 3LT1A 3RU9A 5HS4A 1O0SA 4IGFA 2VNSA 2VZ0A 4WLFA 3RASA 1DJNA 1QV6A 4U6QA 2FR1A 3W8EA 1NX6A 5CPBA 4WCFC 1E6EA 1HDXA 4XD2A 4OXYA 5H82A 3JD1A 2JCYA 3HQ4O 2WEKA 4CLXA 4ND3A 1MXHA 4NK4A 3AI2A 3GHYA 1ZK1A 3ZU5A 1PSDA 5DBFA 1AN9A 3A9WA 3VVBA 4KUHA 4Y98A 2C5EA 1I3LA 3LK7A 1GY8A 1YJQA 2IRWA 3P7MA 5L45A 2Q49A 3SLGA 2QZ9A 2ZTMA 4DC1A 3F5SA 3D5TA 5GY7A 1DC4A 3K31A 2R00A 3PRJA 5B4VA 1U5CA 1WMBA 3KSDO 4AVYA 3DBLB 3KXDA 4U0KA 1R6DA 3WIEA 4FCCA 3IP1A 1ZIDA 1UZMA 2I99A 4D3FA 5ITVA 4Z0HO 1ADBA 1PTJA 4YJDA 4CV2A 1H0KA 1VL0A 4RLSA 5CDYA 1I01A 4AJPA 1F17A 1H6CA 1VLLA 1WMAA 4MIEA 2ET6A 1LC3A 4RPLA 4DIFA 2ZK7A 1C0PA 1NQAO 3OICA 4Q3DA 4DBZA 3BYZA 1KS9A 1LUAA 5TQVA 3LVFO 2Y93A 2YFQA 3JQ7B 2NU7A 3RC7A 1KEPA 2X23A 2GASA 4PRLA 4A2CA 5F3RA 3MJCA 1B26A 1DSSG 1LDMA 2W2KB 2VN8A 4KTTE 3I3OA 3STHA 2QX7A 3KEQA 4IS2A 3U09A 1NVTA 1XLTA 2ZQYA 2BELA 2J3KA 3VH3A 4CMHA 1W73A 2EJWA 1UP4A 1A4UA 3MEQA 5AVOA 3WLFA 1IY8A 1T1SA 3GEMA 2EERA 5EQDA 2RH4A 3M2TA 5THKA 3W4KA 1PQWA 3RBZA 1OAAA 4HX5A 2PV7A 4YYZA 4GX0A 4G65A 4J2OA 1KVSA 2BGMA 4YRBA 5IZCA 1DBVO 2FHSA 4NR0A 4P4LA 3ZV3A 4OSPA 4F6LA 3ETEA 1DIRA 1OMOA 4YACA 3NRCA 4M86A 3WXBA 4J1SA 2YHIB 1YGYA 2RAFA 3D7LA 1NFFA 1EUCA 2BH9A 1PGOA 3DBRA 2Q1WA 3UOGA 3NTRA 4J9VA 3V8BA 2IXBA 1VL8A 1ENOA 3V1UA 1LDNA 4XEHA 2D5CA 3GPIA 1DFGA 1VKNA 3EYWA 4GKVA 1ML3A 3I9OA 4CLRA 1KOLA 3Q11A 4YAKA 1VSVA 1LU9A 1DFIA 3GC6A 3I9JA 5I9MA 3CEAA 4R3WA 2BFAA 4WOJA 5DBGA 3UCEA 3GHHA 4BGUA 1DOHA 4M54A 1U1IA 1MXFA 4J90A 4Y67A 4B3IA 4WLVA 5T64A 1P1JA 2PGDA 2VYVA 5EIOA 1YVEI 1EDZA 3W4JA 4XKJA 4OM8A 1MG5A 1SOWA 3AOEA 2ZYGA 4CQLB 2HRZA 2NQTA 2Q1UA 2G0TA 3ZI0A 2YZ7A 4ALJA 3ORFA 1S6YA 4B3JA 2D3TA 2ZB4A 1U9JA 4TKMA 3K2BA 2IEBA 1GR0A 3QIVA 5G0UA 1U2DA 3RFVA 3GAFA 4DIBA 2OZPA 4TROA 2A94A 3ST7A 3W4IA 4P8RA 2GRAA 4MDHA 1GQ2A 4BIIA 5IDWA 3IJRA 5C7IO 2XPCA 3DB2A 1KETA 4MKZA 3OH8A 2HKIA 4W82A 1TT5B 2NTVA 1V35A 3WFJA 4IGEA 4CM1A 4BNNA 1H5QA 3GNSA 4W9NA 4E2YA 1DRUA 4KQWA 4YQZA 3BHIA 4RF5A 1BVUA 3VH2A 3AM5A 4GAEA 1GPDG 4E33A 1X7HA 4OSOA 3TZHA 4CMAA 5JW6A 4OIMA 2HJSA 1EFKA 3OSUA 1R4NB 4E5MA 2AHRA 1BGVA 1L1FA 4AJ1A 1H93A 2GCGA 2JD1A 4ZU3A 1F8FA 3TQHA 4RCVA 4K9DA 4Z0TA 4CM9D 5A5EA 2ZB3A 2VOEA 3L4BA 1AUPA 2CVZA 4CODB 2PNFA 1QLHA 3HFSA 2H1SA 3UFXA 2VT3A 3FR7A 3KSZO 1X0XA 3HG7A 3M6IA 4LVCA 3RUDA 1O89A 3UCFA 3VDQA 4YAIA 1CWUA 5IDQA 1Z75A 3IAHA 2Q2VA 3OJLA 4U5QA 4WLNA 3G79A 4D0SA 2PD4A 5KJCA 4QFCA 1YDWA 3LZ6A 4MVJI 3GN1A 4J43A 4KOAA 3BMNA 4KTVE 2AMFA 3FBGA 1WVGA 4R51A 1B8UA 4CUKA 5KNLA 2WD7A 4YVFA 4NBRA 1EE2A 3R3JA 2EKPA 2GPTA 3RROA 5FF9A 1EEHA 1EQ2A 1O8CA 4UAGA 3K9QO 4TZTA 2IEDA 3VH4A 1E3JA 1ISIA 1FMCA 5TC4A 1MX3A 1NAIA 4XB1A 1HE3A 4PN3A 4WKGA 3PTZA 1M76A 3GVPA 4F6CA 3DZIA 3F3SA 4DTIA 2F00A 4EITA 3ITKA 5AXAA 3AY3A 4NNJA 4LN1A 4Q3EA 3S1LA 2PTGA 2EGHA 1P1HA 3NYWA 4PFJA 1VKOA 3VC7A 3RUIA 4E2WA 1EBFA 1NVMB 1R12A 1UAYA 2FPIA 2EP7A 4J7UA 5KJEA 3PWSA 2FZWA 3PYXA 2G82A 3HB5X 1BXGA 1GADO 4JXKA 4B7XA 1SZJG 1T4BA 3DWFA 5A3VA 4IDEA 4BOYA 1W4ZA 2W8ZA 4FFOA 4W7HA 5TS3A 4IM7A 4E3ZA 1R16A 4AL4A 2EJVA 1QSGA 2NADA 4IBOA 3WDSA 4BO1A 2HO5A 5IFLA 3EVTA 4PG5A 1NNUA 2AQ8A 3KLMX 3S8MA 3ZNNA 3ZH2A 4TRNA 3E9NA 2I9PA 4EUEA 4HXYA 2Q1SA 4A26A 3MJEA 1BTOA 3TRIA 2P91A 3B1FA 4EEXA 4RJTA 3WSVA 2FSSA 4L9RA 3AY6A 1LRJA 4I5DA 4AJLA 4L73A 1GFSA 1S7CA 1B3BA 2V6FA 1E6UA 3U4DA 1Q2XA 3E5MA 3NTOA 4BB6A 4FIZA 4FQ8A 4CMCA 4S3MA 3SC4A 3WYEA 2AQIA 4D42A 4YAGA 1C14A 3RUCA 1E7QA 1J5PA 4OL9A 4PG4A 2ZJ1A 3LDHA 5GZ3A 4IJKA 2I67A 3C8MA 1H2BA 2HMSA 4RQTA 1B3RA 3ON5A 2OXIA 5A5FA 3EZLA 1HLPA 1B16A 1HSOA 4BO9A 5CEJA 3O38A 3JQAA 4YT4A 4RVUA 3I9NA 1Q7GA 3MJVA 3RFXA 4FDAA 3CIFA 3FHLA 2ZCVA 3RVDA 4D3DA 2I65A 4FFRA 3VKVA 2EWMA 4U6SA 2B4RO 2X86A 4G81A 1E7SA 1N8KA 1UAGA 1CEQA 3ONEA 1O6ZA 4FB5A 3WMWA 2IYOA 2TMGA 3ENKA 2GN6A 3JQ6A 4E12A 2G76A 5K6AC 4BHTA 2C2YA 3DFUA 4G5HA 1L7DA 2AW5A 1YB5A 1F14A 1U4OA 1D1TA 1SOVA 3IJPA 3O26A 4GLOA 1AXEA 2V7PA 3ZCXA 3GUYA 3NGLA 1DO8A 1GZ4A 3TFQA 2NM0A 3SEFA 5I7VA 5ILOA 4N54A 1RYEA 3JQAB 3RKRA 1HDRA 4J9UE 3ANNA 2V6BA 1H9AA 3JQGB 4INAA 3QVWA 2VT2A 2C7VA 4CQLA 5FI3A 1Z74A 3L4SO 4BNGA 2Y1EA 3SC6A 5A9SA 2QYSA 3ZZNA 3H4VA 1K0UA 1Y6JA 4PZDA 4LCEA 2C59A 4Y6SA 3GGGA 2X9GA 2VYNA 4L74A 1BWSA 4BKOA 4FD3A 2NVBA 1EUZA 1LRLA 4ZQEA 5JYEA 1E7YA 1X1TA 5U4QA 3RBXA 4IJVA 3JQFA 1LEHA 5H83A 3H8VA 3BZUA 5B4UA 3RKUA 5HM8A 2ZQZA 4FN4A 3D4PA 1YH3A 3LT4A 4I5EA 3VPSA 1AXGA 4DUPA 5JO0A 4CR6A 1E3WA 4HY3A 4B8WA 4BO0A 1K6XA 4GGOA 1NAHA 1ZJZA 5GMOA 5LDHA 2PKRA 4NHEA 4IZIA 1J6UA 2V6MA 3LT2A 3PJGA 4B4VA 1ENPA 4JBIA 4BMNA 5T57A 3N7UA 3WGOA 4YRAA 4ZICA 1SO8A 3NKLA 1P1IA 4E4YA 5TNXA 1E5LA 3RUAA 1HEUA 3KV3O 3OF2A 4YBZA 5DCYA 1R4MA 3TWOA 1CETA 4RV9A 1YB4A 1XQ1A 2J3HA 3TPCA 1EMDA 1MP0A 2UV8A 1LI4A 4P4NA 3RUEA 4BNWA 1FK8A 4RQUA 2D0IA 4J6FA 1TXGA 1Z73A 1K5HA 2VUSA 3PIDA 4DLAA 3CSDA 4L75A 1XIVA 2NNLD 1P0FA 1RPNA 3JQ8A 3KYCA 3WWZA 3TN7A 1G6KA 4BNJA 2XF8A 3AOGA 4XRGA 3ADOA 5EESA 4P22A 3JCZA 3A06A 1ONOA 1U3UA 5FWNA 2C0CA 3AY7A 5AXDA 4NDNE 4CLHA 1P31A 4XQGA 4DIOA 4S1VA 1BDMA 4PLGA 5HA5A 5JCXA 4CPDA 3AJRA 1I0ZA 1PS0A 3AWDA 4FS3A 2AEFA 1I32A 3WQSB 1HLDA 1Q7CA 3Q9UA 2EW2A 3CUKA 3DOJA 1KYQA 1SEPA 4GMFA 3KEOA 1T2FA 1HZZA 3AM4A 4UEKA 5IF3A 1OI7A 3NT4A 1LDEA 4HFNA 4CMEC 2IXAA 2AG5A 5IXYA 3L6DA 4YA6A 3PYLA 4GGPA 2HMVA 4XR4A 4MINA 4N5MA 5BT9A 5A1TA 3ZHZA 4NPCA 1HDCA 4B7UA 3R1IA 3I6QA 5JYDA 1ISJA 2PLAA 2QHXA 2C82A 3WWYA 2YY7A 4JBGA 3FNEA 4J7CA 2CF5A 3TZQA 4OQZA 4RDHA 1G1AA 2FZEA 5A3JA 3AUSA 5JAZA 3HDYA 4R5HA 2PD6A 1U3WA 5BQFA 3MWEB 1WW8A 1E3WB 4MVJE 1LLUA 1VRWA 3P19A 3BA1A 3NDRA 4BNMA 1ADCA 3E03A 1E92A 4U7WA 1HDGO 2OP0A 4R54A 4Q39A 1LX6A 2VOJA 5AYVA 3ONDA 4CV0A 2V65A 3ZWOA 3Q2KA 3WYBA 1PIWA 3HSKA 1E3LA 3WJ7A 5TSDA 2XXJA 4W4TA 2I6TA 2GD1O 5G4KB 3D4OA 4KWIA 5CP8A 1AE1A 1KEUA 4CR8A 3RSHA 2NACA 3FWZA 3O03A 3FWNA 4UUOA 3DHEA 4UVDA 3C1OA 4DBVO 1R66A 5L95A 3OFSA 4XX0A 3AW9A 5AXBA 4CM3A 3HDQA 3GNTA 4N7RA 4NU6A 4Q3NA 4UEJA 1LSSA 3OQ1A 1CRWG 4ZJUA 1C1XB 1CIVA 5H81A 3JD0A 3CZMA 3INTA 1WLYA 4RLHA 4TQGA 3ZHXA 3DZFA 1IHXA 2PK3A 2JJYA 3EK2A 2CZCA 3PWKA 1IPEA 1U5AA 3H2ZA 2O7QA 1NFQA 2HK7A 4R16A 4DPLA 5IZ4A 1TT7A 5KWEA 3IL2A 2O3UA 1B8VA 1A9ZA 5I9NA 2WJPA 4B7CA 3PHHA 3TJRA 2Y1FA 5FEUA 3GFBA 3TL2A 2NTNA 3C85A 4KUGA 2W2LD 2E37A 4KP7A 2GZ2A 4MVJD 4E5KA 3CPSA 3FN4A 4NIMA 3BMOA 4D46A 3QVTA 4CMKA 4WK6A 3UCXA 1D3AA 4EGFA 1GL3A 5TX7A 2A35A 2PH5A 1LSOA 3KZVA 1ENYA 4WEQA 3QV1A 2G1UA 1M75A 4L76A 3AK4A 1PS8A 2QG4A 2ZATA 5FI5A 5TGDA 4ZHSA 2XXBA 4GMGA 6ADHA 1H94A 4JJIA 4PG8A 1U7HA 1JKJA 2HK9A 4LCJA 4WCDA 5DN9A 3UAGA 4FBGA 4BL5A 2ZJ0A 1PZFA 1ARZA 3EVNA 5GZ1A 1GPJA 1PJ4A 1UP6A 3BHMA 3JQFC 3PQDA 3PK0A 2YQ4A 4JBHA 4PLHA 1R4NA 4WOKA 3I52A 1R4MB 1ZO8A 3BXXA 4ZRMA 1QRRA 2RCYA 3HDHA 3LLVA 2BRUA 1PJSA 3BHJA 3GVIA 1HKUA 2O3RA 1K6IA 1LNQA 4GX1A 3ZWBA 5B1YA 2OO5A 1ZKMA 3VH1A 4WEOA 4GX2A 7MDHA 3RC2A 1RJWA 3HN2A 1DC5A 1UH5A 4EUHA 4M8SA 5JNLA 3A4VA 1ZSYA 3T4XA 3E18A 1P74A 5ENDA 4CMIB 1UUFA 3LC2O 3H65A 4BO6A 5L7YA 4DQUA 4YRDA 3QW2A 3CZRA 4LVUA 1KEVA 5L9AA 2VHVA 3HHPA 1LJ8A 1FXSA 3EUWA 4UVEA 3C7AA 1IYZA 1UDBA 4ND5A 1BW9B 4D41A 5JY6A 4FOSA 2QRKA 4OOFA 4YTEA 3ROMA 1IPFA 3CTMA 3PWZA 5G2OA 3TDKA 4AJKA 4DMLA 5KKCA 3PEFA 3DAPA 1YQDA 1LDYA 2VQ3A 3GEGA 3GT0A 4R3NA 1V6AA 1GEGA 1MC4A 2DBZA 3ADPA 1TT5A 1FDTA 5LDGA 1R0LA 2GZ1A 4O6VA 4QQRA 3OEWA 4CUJA 1LLDA 3O9ZA 1HZJA 3D3WA 4ZA2A 4ALIA 1XA0A 3FRJA 1YL7A 3ZW9A 1NR7A 1EFLA 2NWQA 2P5UA 4PLZA 1PJQA 3JQEA 3E8XA 5L4NA 3GVHA 4LK3A 2H63A 5GZ6A 4BO8A 1Y81A 5DOZA 4DC0A 1LA2A 3PQEA 1BHSA 4ND1A 1Q1NA 1DPGA 4XIJA 5DCWA 3CMMA 3UICA 5G4LA 1SAYA 2VHWA 4JGBA 1X14A 4AJHA 3OIGA 2GSDA 4YJFB 3NX4A 1E77A 2C2XA 1KERA 4CMEA 1I33A 3GPDG 1YL6A 2FRDA 4NI5A 5K6AA 5JDCC 4EZBA 4UVHA 3KTDA 3NUGA 3TF5A 2I76A 1LTHR 2EKQA 1Y5MA 2DBVO 3K92A 4FR5A 3MJTA 4CMGA 2P9EA 5BSGA 1WNTA 2BGLA 4J91A 3M2PA 3TZCA 4K6FA 2R6JA 2B5WA 3H9EO 3HZZA 3MJ4A 4WJZA 4D3SA 3G0OA 2AQHA 5L3ZA 2JHGA 2PZJA 1E1LA 1PS9A 4C7KA 1XQ6A 1GZ3A 2DPGA 2VHYA 3O8QA 4XR9A 5FYDA 4CR7A 3A1NA 1XDWA 4FW8A 4MIOA 3W6UA 3GZNA 1HXHA 1I2BA 1ORRA 3LF1A 1N2SA 1W0CA 3AU9A 3H6KA 1T2EA 1QYDA 4IZHA 4Y6RA 4MO2A 4MP6A 2ZIZA 1ZJYA 1GUZA 1TB4A 3S2GA 2EW8A 1R37A 4XYEA 5CEFA 2PY6A 4IMPA 3OM9A 1EVYA 1VSUA 3T7EA 3I4CA 4NFHA 4XQCA 2P5YA 3ZU4A 3BMQB 4YJGB 4GX5A 3OEYA 4OXNA 2X5JO 2Q1TA 1YXMA 5G4KA 3H9GA 3IQDB 1YONA 3ZWYA 3I9LA 4EJ6A 4E5NA 1OC4A 2VWGA 4IIVA 1YOVB 4ILKA 2Y1GA 2NVUB 4K26A 3QWFA 3U5TA 2H6EA 2X22A 1JA9A 1IZ9A 4TRRA 2D4AA 4D79A 1T2CA 3RIHA 1F0YA 4RPGA 4ALKA 3I6IA 2WTBA 2HCTA 1CQIA 2XAAA 4EBFA 4EEZA 1FDVA 4PCVA 3TFOA 4HFRA 1NQTA 3GOHA 4GL4A 5U1PA 2BI7A 2DU8A 1PGJA 3IOYA 2B69A 1QG6A 4A73A 3RJ5A 5F5NA 4DYDA 4HADA 4A10A 1C1DB 4B4WA 3GNQA 3WBBA 1YRLA 1NYTA 4CL3A 2DTEA 2C07A 3ETDA 3LQFA 3OJOA 2HJRA 5DULA 2CFCA 1ZK4A 3WNQA 4JJFA 5JDCA 1YO6A 4TVOA 4JX8A 4NBVA 2IZ0A 3DMYA 3IKTA 5I9LA 3BMOB 4X54A 3M1AA 3DZGA 2BKAA 2J5KA 4P38A 2OORA 4R68A 4ITUA 3G3EA 4NBWA 4R1TA 4XYGA 1YKFA 1ZCJA 2EG9A 1PZGA 1E7WA 3IUSA 1IULA 5BNIA 4I08A 4BMSA 1JDJA 2J6IA 4WLOA 3V2GA 2YJZA 2H5LA 2AQKA 3D64A 3WICA 5F1PA 2PD3A 1ZK2A 1PJ2A 4D0RA 3ZU3A 3H5NA 2DKNA 1HYGA 4G2NA 5G0TA 2O3QA 1NVGA 1IUKA 2B35A 4PG7A 3TSCA 1XELA 1DC6A 3DBHA 3QSGA 5CHEA 4MKRA 3PHLA 2JFFA 3CXRA 2NU8A 4DMMA 4H3VA 3GK3A 4QX6A 1KBZA 2GZ3A 4J0EA 2AG8A 3WGYA 3P2OA 2VZ8A 4I5GA 4CLEA 3E48A 4PZCA 4RPJA 5DOVA 2DLDA 1D4FA 5A05A 3T7CA 3BMNB 3X2EA 2QZZA 4FPXA 3Q6IA 1FDWA 4J4TA 4BV9A 1WWKA 3WB9A 1V8BA 1PWXA 1B2LA 1YBAA 1O5IA 2HMTA 4K28A 3ANMA 1O95A 4QXMA 4B8ZA 1ZK3A 4ZVVA 4LSMA 4Q3BA 4XYMA 1E3SA 1D1SA 2PZMA 4A27A 5L51A 1HE4A 1P1KA 4HNGA 1N9GA 2DUUA 2FR0A 3H3JA 4IY1A 4Q9NA 4GQAA 4RVSA 4CL8A 4XJTA 1P1FA 1KVQA 1N9GB 2CUKA 3PZRA 1QYVA 1JN0A 2YUTA 3L0DA 3OQBA 5J23A 2JAPA 4F3YA 2A9FA 3CKYA 4BB5A 5BSFA 3QWBA 4FC7A 4BNVA 4DPKA 2X5KO 3PLRA 2Q45A 3DZHA 1QYWA 4KDFA 5A06A 1XHLA 4KDEA 1UXGA 4U0JA 4AJEA 2Q46A 4KZPA 4WNIA 5B37A 4CLOA 1I24A 2P4QA 2Y99A 1JAYA 4KMSA 4JQCA 1E5QA 1DAPA 3F6YA 4CM4B 1X15A 3TZ6A 5IG2A 4JCOA 3EAGA 4BVAA 1ZZEA 3VOSA 2VCYA 4GLLA 1XWFA 2YDYA 1UXHA 2J3JA 1HTBA 3TOXA 2EGGA 1UP7A 3OECA 4ZN6A 4IDBA 3KVOA 2GF2A 4Z6KA 3ZU2A 3AUTA 5JXWA 1ID1A 4EI2A 5IN5A 1M6WA 3OHSX 1UZLA 1E3EA 1OZAA 3OQ6A 1PJTA 4NH4A 4MPDA 3JSAA 5CAEA 4BKQA 1P45A 3D5QA 3MOGA 3AFMA 3B1JA 2W2LA 4DLBA 3OJEA 4YWJA 4D43A 2VHXA 5ER9A 4ZQHA 4M55A 5I7FA 1DIAA 1LLCA 4LRSB 5L4LA 2AE2A 1QYCA 1ZEJA 3HNPA 1HE2A 2Q50A 4BV8A 5AQ1A 4J16A 1FDUA 3TNLA 4ND2A 3WGIA 3A28A 1W6UA 3QLJA 1KY4A 5I8WA 3VDRA 3HDJA 5T6BA 1YWGO 4A7PA 3FNHA 3U0BA 3NDIA 4JK3A 3GH3A 1GV0A 2Q3EA 5TLSA 4MP8A 1MUUA 3OP4A 4GVLA 1U8FO 3W6ZA 3PFWO 5EERA 4BGIA 3FTPA 3WLEA 3WQQA 3L4BC 2PZLA 2B36A 1Z6ZA 3HWRA 1N1EA 4BNFA 3Q3CA 3UHAA 3C3XA 5HS6A 3I9KA 1ZXBA 1IL0A 4DLLA 2W2KA 4P4GA 1MGOA 3DMTC 4NK5A 3RC9A 4QUKA 1I2ZA 5L53A 2QQ5A 2YHUA 1J0XO 1X0VA 1XKQA 3JQBA 1JVSA 1DLIA 4NG5A 1U4SA 3INRA 5JAIA 3KYDB 2Q2QA 2EEZA 4EW6A 5TIIA 9LDTA 4MVJH 5C7OO 1PJ3A 3K5PA 1EDOA 3SJUA 2DPHA 2J8ZA 1GCOA 2C7GA 4L0QA 4Z9FA 4CM8B 1H6AA 3BTVA 3B6ZA 4WGGA 2Y05A 3H7AA 3U9LA 1P1RA 1K6JA 5DF1A 3WTCA 3B20A 5C5IA 1QORA 2GN8A 2ZTLA 3AU8A 4TVBA 3L77A 2POQX 4MP3A 1BRMA 3GFGA 2IDZA 3K30A 3PHIA 1Q0LA 4JP3A 4O63O 5CDTA 5K0ZA 4R01A 3ZNOA 3BTOA 1JW9B 3MOIA 2NU9A 2CSUA 3E1KA 1HT0A 2B37A 3QE3A 4LRTB 2X9VA 4OJNA 5DCUA 1LXCA 4RVFA 1C0IA 3L6OO 4PLYA 4I9NA 1GUFA 4E31A 3ZV6A 3A14A 3LYLA 3GVCA 1ENZA 1GEEA 3BIOA 1ADFA 1VM6A 2VWHA 4WLEA 1ZMTA 4ZQGA 3T4EA 4DXHA 5BSEA 4CMJA 1DHTA 2X4GA 2WE7A 1NTOA 2Y1CA 2X58A 2BI8A 3E9MA 1HYEA 2HDHA 4YJHA 5ER6A 5F5LA 2WYWA 1EE9A 1ISGA 2PR2A 1V0JA 3BMQA 3N74A 3R6DA 4MVJP 4CQMA 4CJXA 3Q0EA 5C3MA 4YJHB 4RO0A 4II3A 3NJ8A 4IXWA 4E30A 2NUAA 2IYPA 5KJ1A 3GQVA 3MZ0A 3DZBA 3JV7A 5ICSA 3RC1A 1YQXA 1NM5A 4E5YA 3SX2A 3KB6A 1TA4A 1CDOA 3K6JA 4IDCA 2NSDA 3E9QA 1NR1A 3B70A 4JLWA 5CPFA 4GSKA 3VZSA 1LSJA 4XGIA 4OKNA 1MV8A 1GQYA 1PWZA 3QHAA 4IIUA 3RUFA 4HUJA 1BXGB 3GGPA 3NEPX 1T2DA 2JD2A 4MJLA 1E1NA 1EZ4A 2YHIA 2E6UX 1DEHA 1Z7EA 1EQUA 3I9MA 3H5RA 1UDAA 1HSZA 4M1QA 3VAZA 3BTSA 3JQ9A 3L07A 1HDOA 3ZNPA 3C24A 5C37A 1IB6A 4YR9A 2QRLA 4ONEA 2WD8A 4ZD6A 4II2A 3G49A 3R3SA 1VJTA 1C3VA 2O2YA 1C1XA 3PZBA 3P5SA 4IXTA 1LDBA 4Z3KA 3PJDA 3S2EA 4E2XA 3JYLA 2HAEA 5K9ZA 3JQ9C 1GD1O 4MVJF 2HUNA 5IJZA 4E32A 3OETA 4R9RA 2QRJA 3GMSA 4IDGA 1LQUA 1TVEA 3DBLA 3GEDA 4UREA 3SVTA 3BMCA 1XG5A 2WD7B 1T4DA 4J0FA 1I36A 4B4UA 5L7TA 5ITWA 2RH8A 1E1KA 2HU2A 1DAOA 1A7AA 2X1HA 1PZHA 3F47A 4FSHA 1Y8RB 3SJ7A 3DBVO 4HNHA 3QWHA 2X0JA 4FJ2A 3PVZA 4XQ9A 1LBEA 1W8DA 2OL4A 5DT9A 5DNAA 2HMUA 2Q2WA 1UDCA 2E49A 4OMUA 3B1KA 4N18A 2HRBA 3G1TA 5F1OA 1YL5A 4RGBA 5DP2A 2OFPA 2O48X 1Z7BA 1Y7TA 2RHCA 4NBTA 3WSWA 1X7GA 3HB4X 4NBUA 4K6CA 3IC5A 2Y0DA 2D8AA 3CINA 5L7WA 1R0SA 4LW8A 3SBOA 2W98A 4NJMA 1M66A 5IXSA 1ZFNA 2OBYA 4Z9YA 4CUZA 2CNBA 2VWPA 3KUXA 4BO2A 4JP2A 3HADA 1ZH8A 4HKTA 3CMCO 4YJFA 1XSEA 3LC1O 2HSDA 3GDGA 2EXXA 3MWDB 1Z82A 1M6HA 3KM0A 4B3HA 2WYUA 3MTJA 1Y9AA 4FFNA 2HQ1A 2NVUA 4BO3A 1D7OA 3DTYA 2I66A 4OO3A 4XDYA 3GRPA 4GKBA 3UH1A 5B4TA 1KVUA 5T8KA 3VZRA 1K2WA 3PHJA 3WTBA 1EVZA 1GDHA 4FJ1A 1A72A 3CE6A 1PR9A 3VTFA 3FBTA 3GA0A 1AGNA 1EK5A 4HFMA 5G0WA 3ZWAA 4ZGWA 1HL3A 5BSHA 3FI9A 1XGKA 4FGWA 3HJAA 5KJ6A 3ZW8A 4OQYA 3WGHA 1C0KA 1U3TA 1YB1A 3RAJA 3ZHYA 2PH3A 3GLQA 4DPMA 1QMGA 3ZHBA 2A4KA 2CVQA 3RUHA 2WYVA 4LMPA 3ICPA 4ROSA 4GVXA 9LDBA 2F1KA 1RM5A 4O1MA 1GYPA 4J1QA 4HWKA 4J7XA 4AJ4A 5I7SA 4BMVA 2W4QA 2DUWA 4HBGA 5DBIA 1PX0A 4DREA 2Y68A 3DL2A 3QVOA 2ZYDA 3ZDFA 4MOWA 4CQMB 2EF1A 4QTZA 3ETGA 4QO7A 3C7DB 4QSMA 4RPKA 2FMUA 1YBMA 4UULA 3ASUA 1U7TA 1Q0HA 2AE1A 4LSWA 1UXIA 5COBA 3ZWCA 4BNZA 4J4BA 4RF3A 3U49A 1UXJA 4R5MA 4R1NA 4YPOA 1V3UA 4UUMA 1JKIA 2OBNA 3DTTA 1Y8QA 1ZXLA 1ULUA 1T24A 4YAEA 1CYDA 2BHLA 3ZWPA 3FPCA 4CQMD 4CV1A 3SLKA 1SC6A 3GVXA 1DJQA 1UXKA 1T2AA 1I5RA 1X1EA 3KYCB 5ENVA 1DHRA 1R15A 4HV4A 4IMRA 3WR5A 4EDFA 1JVBA 2R2GA 3KO8A 1Q0QA 3PYMA 4J49A 2ZB7A 5JLAA 5BR7A 3KETA 1JTVA 3QP9A 5BNFA 3IMFA 3I5MA 4TSKA 2V6GA 4XJSA 3FSRA 4O5OA 2VZ9A 2FSVA 4R1UA 1NP3A 2NU6A 5JDIC 1PGPA 4H15A 3F5QA 1MC5A 3H9UA 3WYCA 4I9UA 1QV7A 2DAPA 3PJEA 3Q1LA 4AG3A 3FNFA 2ZYAA 4FFPA 1JWAB 1PJBA 2C5AA 3ABIA 3PJFA 3F4LA 3ONFA 2Y0CA 3DAGA 3F9IA 3QVXA 5JS6A 2Q4EA 3U3XA 3I23A 1H9BA 2IZ1A 1DDOA 2O4CA 4XGNA 5ILGA 2B4QA 4K1LA 4I9HA 2X0IA 4C4OA 3UW3A 1DLJA 2FP4A 2VUTA 3COSA 3JQ8B 4NFYA 1NHGA 2X8LA 4QT0A 4Y9DA 3ZV5A 1PGNA 1PQPA 1T25A 3JQAD 2YYYA 4W6ZA 3E5RA 1NWCA 1ONPA 4YT5A 1DIGA 3HE3A 3AI1A 4L4SA 4PG6A 5DP1A 4D45A 3DQPA 4DQVA 2E4AA 3O8QB 2ZCUA 5JCJA 1CERA 4ALNA 3AOEC 4KWHA 5IAAA 2YFHA 3KLPX 2QW8A 4J2HA 1I2CA 1PEDA 1P77A 1N92A 3KOUA 4TRJA 1P3DA 4XWYA 1KC1A 3JQBC 4EJMA 4Q3CA 1SMKA 3HUDA 3GY0A 3EC7A 3UXYA 1T26A 2BFOA 5CDUA 1QP8A 5JAMA 2UVDA 1SB8A 4E6PA 2RIRA 3PXXA 5LC1A 1MFZA 5A9TA 4AJNA 2H9IA 2OOSA 4MVJM 1PL8A 3WQRA 5KCZA 3U4IA 3EDMA 4BUCA 1F06A 1N7HA 4FFLA 2GNAA 3NAQA 2E48A 1NXQA 3DZKA 4J4HA 3JD4A 1Y9EA 2HLPA 4XQEA 5JE8A 3UVEA 2D59A 3BTUA 3DONA 4JN6B 5EN4A 3UN1A 5JSFA 3RJ9A 2VRCA 1ZBQA 2YV3A 3QY9A 3GZ4A 4OHUA 4WASA 3LSYA 2Z95A 1YJ8A 2DTDA 3DHNA 3NV9A 4RORA 4TRMA 3C7CB 1XEAA 2PGLA 3ITDA 2OHXA 1DRWA 2NVWA 2VYND
chains in the Genus database with same CATH superfamily
3U3OA 5BT8A 2GZHA 3VYUB 3EFOA 4WBNA 4QJIA 4NCJA 4EB8A 5FUMA 2CLKB 2WMDA 4HDSB 2MSEB 3A1FA 4KLAA 3U6KA 3ZJVA 5CM8B 1R2QA 4MB6A 4QHTA 1RJFA 4LJKA 5T5QA 3VU9A 2P9JA 1J8QA 3KFXA 4OUDA 3WJ1A 3N87A 3HA3A 3R0XA 1GUYA 4C6RA 4I50F 4CM5A 3DV0A 4GPEA 1KTIA 1BWRA 3CX3A 4A03A 2VKTA 5LWQA 1K3UB 2GPBA 4B33A 2D3WA 1YZYA 2OXRA 3PQ6A 4GW3A 1V4VA 4P3OA 5T67A 1TADA 5TMEA 3ZN2A 4EAAA 1LBSA 3ZWMA 3MHTA 4QARA 5B6JA 3D4NA 3FPEA 5CA0A 1NW8A 2YNMD 3WWDA 1C8KA 1NZJA 1Y1PA 1CY7A 1DIHA 2DY0A 2H85A 1T0UA 1HF3A 1NJSA 2HFJA 2PZKA 3Q5GA 1TDJA 2PMBA 3Q87B 4MGEA 5C7LO 1KJZA 2EFHB 3ZTYA 5EJ2A 1IFXA 1DINA 1W5AA 3IUBA 3SM9A 3FKSD 3R7FA 3K2EA 3MS7A 4XLLA 4F46A 2ORED 4R8KA 4JT9A 1QYIA 1RWBA 2CMDA 4PHFA 2FEOA 4M49A 2J67A 2BLLA 2RBKA 3FCYA 3RADC 2Y4NA 3U4GA 2FR8A 4QTUB 3N2LA 1X1DA 2WYIA 5HRUA 1NE2A 4QQFA 3VFDA 3PPIA 2AEMA 2RK6A 2F9LA 3NNDA 3OKFA 4QWWA 4WNYA 4E03A 1Z4LA 2WAAA 2FMHA 1XXHB 2YCBA 3DO5A 3NC4A 3OZ7A 3UQYS 1UZNA 1VC2A 1BDHA 1RKBA 1P0CA 5I8ZA 2VH2A 1URPA 3AFNA 2O0JA 4WW0A 1T36B 1IUNA 5L6MB 3L43A 5KJFA 1E7RA 1WZ2A 5CLIA 4JXXA 4JL6A 2R60A 1P7ZA 3KQLA 3ZVLA 3TLZA 2CYAA 4M9ZA 4CIDA 3ESAA 5JSYA 2WA1A 4LXTA 4WL0A 3UBTA 3DAHA 4PZLA 3SXPA 2NU8B 4FJ0A 1RI4A 4JA0A 2GEDA 2JHFA 2WZBA 3LQYA 4EECA 4A36A 5EXDA 1ZM3A 2HA6A 4I55A 2VBCA 2VRBA 5GOTA 5C1BA 1N1GA 3N58A 3CB2A 4AQDA 5LN1A 1JLLA 1N57A 2JANA 3A3YA 2VPTA 5CRIA 1IVSA 5IJAA 4BGVA 3TLJA 3ZY6A 5CB4B 1F8UA 2P9CA 2CSXA 4BIMA 4WKOA 4U39A 1BEZA 4D74A 5B36A 2P4HX 4HNRA 1WABA 1E1RD 3I2HA 3WBFA 1GCGA 5I3ZA 3ANLA 4EYSA 1P5HA 2UDPA 4TZKA 4BX8A 5L3QB 1FVXA 1X80B 1ZVMA 2B1RA 3FETA 1I4WA 4LRWA 4PIVA 2FHPA 4WESB 3ULKA 1ISFA 4RNCA 5JWOA 2IS6A 2WSLA 3R2JA 2W22A 5DGTA 3VZQA 1KJNA 3ZCTA 2HPZA 1MB4A 1GSOA 5KKAA 2Z43A 1N0WA 5JAUA 1KBQA 4OBXA 1X8KA 2ZTUA 2B1QA 4YCAA 3Q15C 3V33A 2PS9A 1ZOLA 1QCCA 2PWPA 4LRYA 4URFA 3ZK7A 4A26A 2CL6X 4OUKX 3C3KA 1BO6A 1QG2A 4AB1A 5JMWA 2VF5X 3Q8XB 1KEZA 1JIJA 4ENVA 2WM8A 2Y1KA 4TWRA 4Z9BA 2WF6A 3IDQA 4IZ6A 4ND8B 1Y5RA 4TL6A 1RXCA 2FTKE 2J9RA 3KR1A 5JWRA 5MDHA 4UEOA 3ZI7A 3ERCA 1GTL1 1ST2A 4PTZA 1GNVA 5IN4A 4AN0A 1U0GA 3SGLA 1LNZA 2GPWA 3VBEA 5JUWA 1PHPA 4URUR 2LCQA 2PZBA 5J63A 4OXXA 1VZ2A 3VJKA 4BFVA 1FSZA 4CKWA 2FPGA 3DC2A 3LUGA 1UBTS 1QHYA 1RBQA 4X95A 3VHQA 4OU5A 3ZBUA 1IOLA 1G8JA 3WAJA 4NSNA 1GDDA 5AUQA 4JJEA 3ACDA 2F3SA 1EK6A 1S3GA 4DA9A 2QJRA 2IPLA 2K87A 1UC8A 1W75A 4ZPXA 3DEYX 1DTWB 3LCJA 3PQ2A 4P3NA 3B2NA 2GUWA 4BU1A 2ZUTA 1JIQA 4IVRA 4BNUA 4LXQA 2XRZA 3SC3A 4A5OA 3SDBA 4X62B 1GTMA 1I1QB 2JFYA 2NU7B 4JAVC 4FNAA 1KVTA 1E6CA 3SX4A 2VT7A 3G2MA 4O4IF 3HVRA 1I30A 1F8GA 3C74A 1G2QA 5IP5A 1NUHA 5G3ZA 3DB1A 3GQBB 2W6ID 3C45A 3K8YA 3QBJA 4ACAA 4ZQBA 1EVEA 3S29A 1YIDA 5ALMA 1NY6A 3TW8A 2DBYA 2SECE 4FB4A 3SWWA 3E3MA 2B6NA 4KX3A 2XRMA 5CW1A 3ZV4A 3IR6A 1FS4A 3EGVA 5JZVA 2BUAA 1IBMB 1KTVA 4MS3A 5BRNA 4C30A 4B3SB 1CUBA 3VPGA 4CIWA 4TKVB 1HTWA 4GWKA 3KKZA 3ND9A 4O0LA 5IT0A 1TNDA 1ULBA 5DW0A 1XMVA 2APJA 4LF9B 2R48A 2O1XA 1HRDA 5K4HA 1OT3A 3AVQA 3SZMA 4RZIA 1ZW1A 4GZMA 2P68A 4P81A 4GOOD 2Z5LA 1UBLS 4PAMA 4PQEA 3RU3A 3M34A 2W58A 2VSQA 3RLFA 2BHSA 7YASA 1NWHA 4EB3A 4LG1A 3CA8A 3Q4GA 1UZUA 1OB2A 2VJMB 4FGSA 1FDSA 4XCVA 2D1YA 1CJCA 4H6XA 4I5FA 4NJEB 1G5QA 2GBLA 2HRCA 1MQSA 1ZMOA 3EZGA 3PA8A 1W4AA 3R3HA 3N8GA 4FEAA 4RK6A 5PGMA 2UXDB 1AA6A 2MSKA 2R1TB 2ZI7A 3PIIA 3PR2B 3HKCB 2VNIA 3OIFA 4UFPA 2GJ8A 3KJEA 3PXGA 1IHYA 1D0IA 1NBOA 3LFTA 3W06A 1E1MA 2Q3JA 1YS6A 2ZZMA 1OREA 4MDEA 2AYYA 2JIDA 1WCIB 1QH8A 2G9ZA 2XJ4A 1T36A 1DC3A 2BV3A 2X77A 2XVYA 3AZOA 1L7XA 1O77A 3CUVA 4TGLA 4U2CA 1EPUA 1C4WA 4QNMA 5EMMA 5AFSA 1X7YA 1DWPA 2HWXA 2YFYA 4BFTA 2B0JA 5H7XA 2CDAA 5BMOA 3KSAC 2WQZA 4RHCA 5ALHA 2DULA 4EA8A 3A2LA 4UKDA 3ZHCA 1I14A 3AP1A 4IDHA 4X5OA 2NPIA 2ENUA 2VTBA 3OQPA 2QAJA 1WSBA 3FR8A 1WZNA 1GPAA 3AJEA 1E18A 1P29A 3EA5A 4G56A 2D7DA 1QZZA 5TQ2A 1KI3A 3DP7A 3F1KA 3IIEA 1XYGA 4AKSA 4QBIA 2HDNB 2Z2KA 1SUDA 1WB5A 1NE7A 3VDXA 2C4TA 2V7EA 5EUQB 1VHQA 4PXSA 3PJRA 4RF4A 3B1ZA 4PO8A 2ZTVA 1NVAA 1VOTA 4P36A 3ZXIA 2XZPA 4ZJZA 1E2JA 3CEPB 1DKRA 5FOQA 5FRDA 1ZK0A 2WPNA 3T95A 4RA9B 4ECAA 1E9RA 1C7RA 4WXEA 4Y2XA 4QXQA 2QTLA 3D7SA 4OBEA 3DR3A 2FOIA 1VJ0A 2A9QA 4NJOA 1WZEA 1L5RA 2ZRFA 3HA5A 3KYBA 4WGFA 3K96A 4D7AA 4CIYA 2DXIA 1RWNA 4NZMA 3HWWA 2QPOA 4GICA 4H2DA 1H3NA 4ER0A 1LRKA 5K0GA 3DOOA 1CZOA 3QVSA 4K6MA 4Q18A 5LLDA 5IAEA 5LXTB 1O7JA 5DWVA 4PF1A 1Y8ZA 1A98A 2CDBA 1D9XA 1GQQA 2IU6A 2PM8A 2VPQA 3MMXA 3K4HA 3TBHA 1GL6A 2CEKA 4BO4A 3BWYA 4BS9A 3IALA 3U4HA 1L7QA 2WW8A 3KEFA 2DC1A 4YAWA 2J9FA 3QU2A 3NAGA 4IWXA 1EG7A 1NBHA 1SRQA 3G17A 4ES6A 4YXFA 5JFOA 1F8XA 2VHZA 2PRKA 4U8GA 1WPQA 4V0OA 3V1TC 2QAIA 2IZOA 4GNKA 5HWSA 4MTCA 3HFGA 4UEWA 3ES9A 4FFMA 4I3GA 5C53B 2ATVA 3AUAA 2UUPA 4XZ3A 3O2JA 3MERA 2VQEB 4H1VA 1NUUA 1DBRA 16PKA 4IHQA 6ADHA 3NM5A 4NU5A 2GK3A 3OX1A 1BHO1 2XE4A 4RL6A 5HUQA 2CXHA 1N7JA 5AI6A 2DR3A 3FHOA 5F21A 1A2BA 1PO7A 3O3CA 3UPDA 1VI2A 1DTWA 1A9XA 4JI2B 4WDRA 2HWUA 3P94A 4KQXA 5B58T 3B3GA 1KSJA 3L7MA 4EB6A 4ARZB 5K05A 2JAHA 4O2BA 3OIVA 4GYWA 3ZCUA 4WN9B 1MLDA 2WU3A 4EHNA 2BKUA 3FXAA 3NIBA 5HW0A 3ELYA 4B3TB 4YB8A 3W8FA 1LPBB 3S55A 4M87A 3QKSA 1G98A 4IKOA 3L8FA 4YS6A 5DNVA 1EVJA 1WHTA 3A1DA 4O25A 2V7TA 1FYVA 2R8ZA 4LJ4A 4NTZA 4WDQA 1RC1A 1ZP6A 4ZO7A 2XAUA 3RBVA 4XYLA 5KHLB 1ATZA 4TKLA 1A5ZA 1JG6A 3ZCVA 3V8NA 4C0KA 2J4FA 1A71A 3RSCA 4LY3A 4YT8A 5FI1B 2NLOA 2IV7A 4KK3A 4I4IA 3RFTA 1R0YA 3RTDA 2ZOSA 2ZWMA 3OLCX 1T2NA 4IHJF 1YB7A 2H5IA 4YAUA 1KWGA 4YRTA 1M83A 4CEHA 3G0HA 4XDZA 4LYJA 5TT1A 3LIIA 4RLQA 4A9AA 3TLEA 2H18A 3AR8A 1P2UA 4MRRA 1NXXA 2HA2A 3FCOA 3HRIA 2K4MA 2PXXA 3PFGA 4C05A 2FN7A 4JI3B 4BQOA 3QX3A 2XX3A 4TQUS 4BKRA 4IH9A 4JVMA 4MEJA 2UVPB 3EEIA 2FW9A 2HIGA 4HFJA 1PR3A 2I6QA 3BDAA 5IUJC 4HOYA 1AGYA 3A9UA 1HMPA 4IEEA 1PG0A 4BO5A 3M6VA 1XL1A 3E82A 4D9FA 1WUHS 1NLMA 1QKJA 3H2SA 3PNYA 2YYZA 4YJGA 1T6BY 3DOFA 4MAMA 1N6KA 4C4XA 1JFFA 1JPVA 5DHUA 5IEBA 1UBGA 3TK1A 4Y2PA 2Y3IA 4PZ0A 1QH1A 5DX1A 4ESOA 1WXDA 1Y6GA 3RWBA 1ONNA 3WLLA 2O8CA 3L92A 4GR4A 2QQFA 1GKYA 1VCNA 2QRGA 4M8LA 5DSTA 3DNMA 1ODFA 5CTJA 4JJKA 4EPXA 4AJOA 2XOXA 3B5EA 4DSAA 2Z9CA 4UXIA 4HNQA 3R0IA 3KUKA 1DE0A 1L7EA 2O57A 4UXHA 2Y67A 4TLBA 2O0KA 1DRVA 2Z4SA 1DAHA 8MHTA 4Z2AA 1A2OA 2Z1MA 3BT7A 4BNTA 1Q44A 2DWOA 4TTAA 3WGTA 4C3ZA 1QK5A 4CV3A 3QRWA 2B7BA 1VYTA 2HHAA 5EKUA 2B21A 1NQOA 1RFLA 4QGHA 3DMRA 2DVMA 3SQOA 4DLPA 4DUZB 1YJ5A 3EG9A 3VNBA 3LUDA 2X8WA 1U2QA 4AYTA 3NHUA 1QBGA 2ILTA 1LBTA 4PLPA 3I4FA 1AHHA 2ZIEA 3HV0A 1YKGA 5JBIA 3C4VA 3GFQA 3GEIA 4JUAA 5EKDA 3A6GA 3D7NA 4G25A 2ZETA 3U3ZA 1RYDA 1EX6A 1XZJA 2MINB 3AZPA 3IRUA 3B89A 3UKOA 2GLXA 1QFXA 1T91A 1YAJA 3C8DA 4REOA 1H4QA 3F97A 4LAFA 1M2GA 1MH1A 3EW7A 3F7NA 4FKZA 2JFXA 2VUUA 1A1SA 2AB0A 1C2TA 3EMKA 1FP4B 3K0CA 4B79A 2KMLA 2ZWAA 3GRVA 1Z45A 1DELA 1DX9A 4KYVA 1RC8A 3L8YA 2YNMA 2Q6OA 3IDOA 3WAGA 3KAQA 3Q72A 1XL0A 1CUFA 1R10A 3BXGA 4IPTA 3A1WA 3FDFA 4F4JA 4GKKB 4KWCA 2A78A 4OP1A 2VP2A 4PFKA 3OA2A 4ZT2A 4ZGGA 3JWIA 4DA4A 4KREA 1YDGA 1VHLA 3I09A 4TMZA 4B9AA 3BXOA 2D5AA 1UBJS 1XUOA 2ZJZA 3MTIA 1YRAA 3TNFA 1LLQA 2QD1A 3FF1A 2VJNA 2ORIA 2G40A 4FNMA 3N6VA 4I81A 5CVTA 4R81A 3CVVA 1G7SA 4DADA 1AUOA 2GKOA 2Q5FA 5G0SA 3JR3A 1FMTA 3QXSA 2YW9A 4KR0A 4NPHA 4JMLA 1RRVA 5F7ZA 5KAMA 2EIHA 3UGKA 1OIVA 5CM2Z 4I1OA 3VSEA 1M2WA 4R1SA 4B43A 4KG7A 4N82A 2PJRA 3LHIA 4QA9A 1JEOA 4HX2A 3MUEA 4PLWA 2K5UA 1VRCA 1N9ZA 2BFMA 2FDRA 4MV5A 3BCSA 1BGXT 4G5XA 1N0VC 3ECAA 4CCYB 5K2OA 1YACA 1K6MA 3MTGA 4WPGA 2F3UA 2E4VA 3I2YX 4KN6A 4LKRA 1MIHA 4MQEB 1LI5A 3HVHA 3P27A 3O82A 3RTAA 5KYWA 1XU9A 1E9AA 1M2OA 3MSCA 1BFDA 2OO3A 3NJ4A 2RG1A 2OP1A 4I14A 3KYDA 1PR0A 2TRSB 3QENA 1EDDA 3B1VA 2GEUA 1A96A 1TQDA 1HNNA 3HUTA 5IM4F 3C6MA 1ZQ1A 2G1KA 3ET5A 3G5TA 3AYZB 1MO5A 3P0FA 5G0VA 4DV5B 4XQ0A 1W5EA 2CDCA 4XCQA 1YB6A 2WR8A 3T54A 2Z83A 4RVOA 4CTOA 2NXWA 3CVUA 3IKVA 1SVKA 3IUPA 2I3GA 1JU4A 3KHTA 4NFSA 3JD2A 3COWA 5GIPE 4KSBA 1DX4A 1PL7A 1YE3A 3GFSA 2LBPA 4RSMA 3SMQA 2JFOA 3QEBZ 1HC7A 1I6LA 4IILA 2OXTA 2BMAA 5JJ5A 1KI1A 1AZSC 4RLFA 1GV1A 4UDOA 3BDIA 5DYYA 2ODBA 2PSHA 1SH7A 1SU8A 2HRRA 3YASA 3NGXA 1JI3A 3K0SA 1B7GO 2ZANA 4YRQA 4X3CA 1PD0A 1M1UA 3RAGA 2QN8A 1QKIA 4OP3A 2J08A 3DAFA 3R0VA 1PVOA 4R9SA 3W5AA 1VGQA 4RADA 3UTDA 4BPRA 3I4LA 4Q01A 1ZL2A 5BXYA 2ONYA 2NZ2A 3LTEA 4H59A 2J5QA 3THOA 5KNCH 5D00A 2Z5VA 3ME5A 4CDMA 3DUFB 1P80A 2J9XB 3K1TA 5C7YA 3KSUA 4II7A 1KP3A 2BHNA 1HETA 2VYVD 4P3PA 2P5TB 1M1NB 2CLCX 4L2IA 1OBFO 3MLEA 2ZZKA 3ESXA 1VPDA 3LXRA 3VPFA 2I4OA 2UVQA 3A2MA 2VVTA 1CR2A 1X39A 1YS4A 3PBKA 4H3HB 1UOQA 5AVTA 3BIJA 3TQSA 1MJNA 5IC6A 4WUVA 4PSDA 4OXRA 2XMRA 3BKWA 4YAJA 4JYZA 1Q1ZA 2YASA 1Y34E 3SZ3A 5HMLA 1V3TA 2EKLA 1E9EA 4LDZA 5ADHA 2CXRA 4R41A 1AIPA 2ZXFA 4YCJA 3FZYA 3R3YA 2WFMA 3B48A 3AZQA 1EBUA 1C3OA 3WVNA 2R68A 1QH0A 1VL6A 1AT1A 4JVOA 4O4HB 4ZQFA 4P83A 4PTLA 2IZZA 4KPUB 3VR5H 4EVQA 4UMFA 1WPXA 3EZYA 1DFHA 1EHCA 1HG1A 1UM8A 2Z2JA 2LCIA 2C78A 2VNAA 2ZT6A 3OTQA 3QQPA 3ROZA 3I6YA 4ME6A 2JLCA 2Q29A 4C4TA 1MA0A 2VTDA 4BJ6A 1MKYA 3IBSA 4E0BA 3MT8A 3COPA 3S44A 3WLMA 1ZHOA 3ZGZA 3RV4A 2WNSA 3L0YA 1MIOB 1VLJA 2OV6A 3GJYA 3STYA 4DYVA 2X9LA 4JB0A 4Y1RA 5HUJA 1XHFA 2BBOA 3DKRA 3NT2A 5IC4A 3DFZA 1XZAA 4RVGA 1JDVA 4CM8A 3VZPA 4EF4A 1UKCA 1UXOA 1VYUA 1A4IA 3OWHA 4AFNA 1KYTA 1TMKA 1J2YA 2ACKA 3EGDB 4H16A 2XYPA 3EBOA 3OT1B 2JF0A 3NWJA 4N9QA 5HQ3A 1GA4A 1IY0A 1KY2A 3LLSA 5HIJA 5KSOA 1K0FA 4JLOA 1E4YA 3TL6A 4QM6A 4QJ3A 3LT1A 1V45E 1O0SA 1H4TA 2G4CA 3ABQB 3COVA 4IGFA 3KDSE 5B7NA 2CFRA 2VZ0A 3CF4G 3FW1A 3OC6A 4U6QA 5LP6C 3FHJA 3ZXUB 2EWVA 2HGSA 3BWCA 1ZGGA 2IKQA 2ZAIA 1F6BA 3ED5A 5CPBA 3EE6A 3QMPA 3SKVA 4XD2A 1P5RA 4LJ7A 4BX3A 1HL7A 4NFLA 5H82A 4GO1A 2GVZC 2YJ4A 3E8MA 1SA0B 3P0JA 1A88A 1K8XB 2WEKA 4YJ3A 2GRUA 4C0SA 3O8OB 3R5SA 2YWDA 4MA5A 3RSGA 1DMRA 3MT7A 3CTPA 4I55F 3UK6A 4B3BA 4F4DA 1PSDA 1SHJA 5CYPA 5HF8A 5LYYA 1G8GA 5HZMA 3O47A 4DM7A 3HYRA 2GYWA 1AA9A 5DBFA 3C3PA 3VVBA 4OX9B 4KRYA 1PK9A 3KUDA 4ZO8A 1YJQA 2IRWA 1F3LA 2WBLC 4P6VF 4C20A 4ENPA 5BOSB 2Q49A 5L45A 3ECCA 2QZ9A 2ZTMA 1IK6A 1SULA 1XMJA 4MHOA 2F3QA 2R00A 2ZRDA 3PRJA 2O1EA 3GLFA 2OY0A 1P9WA 1WMBA 2H07A 2VDRB 4HN4B 3H5WA 3U0VA 1CQWA 3DBLB 3DOHA 5ITZA 1HPLA 1R6DA 4U0KA 3IP1A 2L82A 5EJAA 3BE5A 3Q8KA 1T6YA 3WKAA 4E88A 3TYXA 4N47A 4CV2A 1IZYA 1DQNA 2BZ0A 3EEQA 2IHJA 4CKBB 4L5IA 3PNLA 3N6RA 3UMRA 2NPOA 1Z4PX 4KZKA 1YRWA 3W3AH 2GCNA 1H6CA 4RPLA 4AJPA 1FNMA 4DIFA 1LC3A 1WD7A 3OM8A 4OK3A 3H2BA 4LRUA 4Q3DA 3BYZA 5A4KA 2PRYA 3ESBA 3L0IB 2BCJQ 2C03A 3HP7A 4X8HA 5TQVA 2Y93A 4CL2A 5GONB 4QJ5A 2ECKA 5EHXA 3RSLA 1C3JA 1YCGA 2NU7A 3W5VA 1SUSA 3RC7A 2JIPA 2QT1A 2X23A 3K9BA 3DTVA 2GASA 4FX2A 5EFZA 3TR6A 2FUEA 4UPEA 2C7QA 3PTLA 4OLBA 2RH5A 1LDMA 3IP7A 2FQXA 1RQ7A 2NT4A 2QX7A 4JP1A 2AOTB 4X1YA 1UJ4A 1Q3TA 1Z22A 4UBJA 4FILA 1VJGA 1II8B 4CMHA 3L84A 3IVCA 4FBMA 1A4UA 4FGLA 4XUEA 1BWQA 1IY8A 4YMVA 3HBJA 3FTQA 1Z7WA 4DDTA 3W5CA 4D9MA 1MO6A 4UTZA 5F2OA 3GRUA 4EFMA 1L4HA 2C95A 2EAUA 3DE0X 4Z86A 4ZRDA 1OLXA 3RBZA 3RIGA 3VI3B 1MOPA 2NP7A 1Q0UA 4HRVA 4GX0A 4YYZA 4LJ6A 3U16A 5LMNB 2WQ6A 3T1QA 4OMCA 2OK8A 4J2OA 1FL9A 3OJXA 4FYPA 4U7TB 4NR0A 5HQTA 3Q85A 1TFRA 4D9KA 4OSPA 4LZNA 3RFFA 4E5DA 1JEYA 2MYTA 3EEFA 1DIRA 1VPEA 4YACA 3UOWA 2NUTB 2CC2A 3NHFA 4EVRA 4O4HF 1QHIA 3QE9Y 4PC6A 1NV8A 2J5BA 3RT9A 4L7QA 2RAFA 3D7LA 1NFFA 5E6RB 2BH9A 1PGOA 2GJAA 3C3DA 3QMMA 3SIRA 4ANFA 3V8BA 1SKMA 2BBWA 4PRYA 1LDNA 3ZD8A 2D5CA 1MO3A 1HRKA 1YI0A 1WB4A 3EYWA 4M9SA 4OYLA 5AMXA 4D9EA 1ML3A 2BMDA 5EIBC 1Z25A 4MQUA 4G9GA 5FWYA 4A92A 1L7PA 2XMPA 1WU8A 3R40A 5I9MA 1EJ6A 3H3XA 1WKBA 3PQ8A 4R3WA 4NX2A 4BN0A 2WU0A 3ENWA 3ECSA 4KO8A 1MQAA 1FFXA 5DBGA 5K3DA 4L0MA 3TECE 1NU8A 4Y67A 2QX6A 1U1IA 2Z8YA 3HCNA 5LA6F 3CS3A 1SXJD 3C3JA 2PRJA 1ZDMA 1EDZA 1TUBA 3NWBA 3QUSA 4G26A 3BWMA 2J3LA 3A3OA 4GPZA 1SOWA 1OILA 2HREA 3DMGA 1E59A 1OTXA 3I76A 1FCJA 3OZRA 4ZYYA 1O6GA 4KYTA 4ZV7A 4J0HA 4MZDA 2AR0A 3ZI0A 4GE3A 1C7JA 3I9FA 5DHSA 4ALJA 1Z0UA 2ZB4A 3TEJA 4NOJA 1ZL0A 1U9JA 3FY4A 4WESA 5A62A 4HT3B 2IEBA 4K0RA 4U7GA 4AO8A 4BLPA 4B5KA 3JASA 1Z6XA 3GAFA 2WHXA 4TROA 3JZIA 1KARA 4P8RA 2GRAA 2Q1YA 3LM8A 1GR1A 1D4AA 5IWCA 1CR1A 4YHHB 5IDWA 1Z2AA 1SC1A 1NW5A 3JAMA 4C6TA 2I7DA 2W6JD 3R41A 3FGOA 4KXMA 4UU1A 3OH8A 5HKAA 1TZJA 2FZVA 3Q3VA 4ZOEA 4W82A 1YZTA 1CZLA 2XY4A 3FKQA 3KQUA 3RJZA 2IIVA 3TTUA 2GAIA 1H5QA 3GNSA 3ZLTA 1XPOA 3O0TA 2HU5A 3E5NA 4KQWA 4DNQA 4FTWA 4RF5A 1MMFB 3U44A 2GS9A 1BVUA 1SC4A 3BXZA 1THGA 1KYXA 1GPDG 3DNFA 3FPHA 3JQQA 4JV5B 3BGIA 1EFKA 1NJ2A 2RGBA 1ST3A 3OSUA 3MD0A 4W63A 1ZRHA 3RVMA 5JTUA 4XD7A 1TZBA 4HH1A 5FV4A 3TAUA 4ENQA 1F8FA 4AY3A 4K9DA 1II8A 3IA7A 3DSRA 5ETJA 2PX5A 1P19A 4CMJA 1AUPA 3NHYA 4TKVA 2CVZA 4CODB 4CHGA 2YZMA 5GJBA 3CWZA 3FR7A 2L17A 3HWSA 3UCFA 1IBCA 3NMUF 1O89A 2ZI3A 3KHSA 1CWUA 1QUFA 1Z75A 5TY0A 3VZDA 5IDQA 2Q2VA 2GF0A 1ORTA 2C2ZA 3ZXYA 3NHLA 1Q0TA 2J9ZB 4QFCA 3LZ6A 3P2MA 1UK6A 1HI9A 4X6LA 4Y2UA 2C99A 2B8TA 2VHCA 4KTVE 4JYAB 1FMFA 1WVGA 4D4LA 5ELLA 1D1PA 4CUKA 4YVFA 1DT3A 3G7SA 1Y6RA 4NXMB 2MR6A 2B2XA 3AJ9A 4HGPA 4EHAA 1UPFA 3S7ZA 1NUAA 3RROA 1Q7RA 2JLWA 3W9BA 3BK1A 2G28A 5FR2A 5LJIA 5AIAA 4L6IA 2OD7A 1EQ2A 3L04A 4C1NA 3ZDRA 5BMVF 4TZTA 3FTCA 3VH4A 1OFVA 1Q50A 1E3JA 1NC1A 2O19A 3KVNA 3CLKA 4KIWA 3V4SA 3NTUA 3SP1A 1CUHA 2RHTA 3I5AA 4MW2A 2GJ4A 3CKKA 1QNLA 4QTTB 2VQ6A 3DZIA 5FO1A 5KTOA 1PLLA 3GLIB 3W9YA 4RKWA 3PNVA 3S1LA 4C4RA 1H2YA 3VR5D 1ATIA 1BQEA 2OMKA 4PFJA 3VC7A 4F96A 2SBTA 2OCKA 1NVMB 4TT3D 4YN3A 1AB5A 1K63A 4KB5A 4ZU6X 1OWLA 3IIJA 4AY6A 3I0MA 4FFSA 2VQFB 2FZWA 4A2WA 1SPBS 5DYIA 1CNEA 1XVLA 4JEHA 4PFQA 4JXKA 4JLBA 4DUGA 2KJQA 4HZUB 3D8BA 5KYWB 1JFSA 3DWFA 5A3VA 4B0PA 4RMNA 3THYB 1HOTA 1EB9A 1FC0A 1QO0A 3HABA 2OO7A 4IHJA 4C08A 4UM7A 1U7ZA 1UADA 2QRVB 4EJSC 4I9FA 3RODA 3TIGA 5IFLA 5JAHA 3LKDA 5KAPA 1CLUA 2FMIA 3RRZA 2AI1A 1P0PA 2AQ8A 4IV0A 2BM0A 3FYSA 3QKUA 5FADA 4TRNA 4QBTA 1H0SA 1SUEA 2ZUFA 4EUEA 3GLIA 2FEMA 4RXTA 3R20A 3MJEA 4S1PA 3W1EA 4TTQA 1XLTC 2BN4A 2E2WA 1XTBA 3QFSA 1C8VB 5CBPA 3AY6A 3CC8A 3B8HA 4I5DA 3C8ZA 4HH3C 4YALA 4AJLA 1F38A 2ZAOA 4B1FA 5DFAA 5KWIA 2RGRA 1S7CA 2V6FA 3DLBA 3KB2A 1NN3A 4GXQA 1L6RA 4NBNA 3GT4A 4QLOA 4FIZA 4FQ8A 1XCPA 4KU4A 4S3MA 3SC4A 3EWIA 4B6EA 3F0TA 3RUCA 2NSHA 4B2YA 2XUKA 4PG4A 5ICGA 2ATCA 1H2BA 1WEHA 4RQAA 4KYUA 2ZB2A 4C5AA 1TJ5A 3LQ4A 4JWTA 4YI5A 3KWMA 3EZLA 1VL5A 1B16A 2XKJE 1H8HD 1YQ9A 4YT4A 1QTNA 4Z7OB 2AT1A 3I9NA 3MJVA 3I28A 3U7QB 3DBIA 3CIFA 1E9VA 3FHLA 2ZCVA 4ZJYA 4FXPA 1RTKA 4E5SA 4TZ0A 2XQFA 1IZZA 2O8BB 1O08A 1J1ZA 4FR2A 3UV6A 4MQLA 2EBFX 1CRPA 1O4VA 3PQ3A 4G81A 6ABPA 1E7SA 3HU2A 5KTYA 4MSUA 1X9GA 3DW1X 1GG8A 1P4RA 4OHXA 5DIFA 1MQ8B 3CX4A 3ENKA 3JQ6A 2ROQA 2WJIA 1CEEA 1I6WA 1UC5B 5JBNA 4B2IA 1FY2A 3D8NA 5BR8B 5HDQA 3EJWA 4G5HA 1Y7HA 2V5AA 1G3UA 1FTWA 1V5FA 2IX9A 4PIMA 2C61A 3IT3A 2V03A 1DDGA 1G2PA 5B3AA 3V7UA 4WJLA 3O9VA 3RJMA 5GTDA 4JHLA 3R9WA 3BE4A 3OFND 1U7WA 3VPDA 4WXRA 5IBPA 1U9ZA 3WLIA 1B2RA 1GZ4A 1FZQA 3BGDA 1SKYE 5BQ5A 2FPKA 2VG8A 2JEZA 3B1WA 3PRYA 1RYEA 3VR2D 4ZT5A 3MYYA 4H7DA 3ZS8A 1X94A 4M0KA 2A9OA 3DS8A 1GRQA 4PM4A 2RHWA 3JWGA 4RZ3A 4JYPA 4ZI7F 1GN9A 3QYFA 4F2HA 1J00A 2LE0A 4KCGA 5HP4A 4WAUA 2CFTA 2QL6A 2ZRMA 2IITA 3D0KA 4FMCF 5U9CA 1YDHA 4IXDA 5A9SA 2QYSA 3V6MA 3ZZNA 5CCEA 3IO5A 1K0UA 4DLZA 4PZDA 4TUYF 4CKZA 4Y6SA 5C46F 2NYAA 3GGGA 4G0MA 2AD1A 4E70A 1ZU5A 5HM6A 2X9GA 3PCTA 2ECFA 4L74A 5BNZA 1BWSA 1T9KA 3AW8A 3NWPA 2ZI6A 3GO4A 4BKOA 1EVKA 2QQGA 1SBNE 3U40A 1G60A 3HR4A 2FX5A 1JQKA 4XXHA 5IWAB 1L6IA 3FSGD 3NPMA 1WQ4A 3DFFA 4K46A 2ZZNA 5IKOA 1E1YA 3B5JA 3NHAA 2BF4A 3KQOA 1AKEA 4LIPD 1UPBA 4QYIB 4Q16A 4FN4A 5FI0B 3D4PA 1MD9A 1YH3A 3LT4A 4N3GA 1NSYA 1NL3A 1SJ9A 3U17A 2FFRA 3DD1A 4NEHB 3BL6A 1T29A 3L5KA 4U2KA 2PJZA 1RMTA 4DCMA 3GELA 3U5ZB 5CB4F 4WK4B 1AZLA 1ZJZA 4B3XA 3HJFA 3HM2A 2C9BA 4LC0A 3FOWA 1WLSA 2PKRA 4U02A 1SIUA 2Q27A 1T9AA 2ZBGA 2V6MA 1QK4A 2OCIA 2IJGX 3RG2A 4C6SA 2FPLA 2PYZA 1M2OB 4YRAA 2ASEA 1E98A 4M36A 3UHFA 2Y1LA 3LBIA 1SG0A 1WY7A 3BK2A 1RC0A 3NKLA 4BCDA 1GAJA 5DNUA 3AEZA 3C5CA 5LA6B 1X1AA 4RCZA 4G1UC 1P6XA 3TWOA 2QUJA 4RV9A 1XQ1A 1AS2A 4V1CI 2IA5A 4HQLA 4O2BB 5D3MB 1D09A 1FP4A 1LI4A 1QHEA 2JARA 2ZU0C 4J6FA 5CDHA 1TXGA 2VUSA 3U4QA 1BXRB 4PXYA 4DLAA 1JA0A 4F84A 1QIEA 2KYRA 3CSDA 2NPFA 4MUBA 1OZFA 1XIVA 1P0FA 1DZIA 2NNLD 4A3SA 3ZJUA 1IK4A 2PSJA 3MINB 4XLTA 3AOGA 5EP1A 3T0FA 1H65A 3V7NA 4BNJA 4XRGA 3SQXA 3GRFA 1LI7A 2ZYUX 3A06A 5JQGB 4UEQA 2PKEA 3AY7A 1I7PA 3H9CA 4NDNE 3P26A 5CFOA 4N39A 1EFVB 4RW0A 4S1VA 1VKRA 1BDMA 2W7TA 5FB3A 3KIPA 3E58A 3KUCA 4CPDA 1USVA 1YFLA 4JUBA 2Z8XA 1I0ZA 4KFUA 2JG3A 1ZINA 5C34B 1ZJ6A 1Q7CA 1WZCA 1E1RA 3EEBA 3IOMA 1XVIA 1NN0A 4WADA 3UUGA 2D4HA 4RZUA 3OVMA 2A0WA 4QQNA 4JLNA 1KZHA 1SEPA 2C5LA 4GMFA 5J40A 4QKQA 1Q6ZA 3AM4A 2I3DA 1NI3A 3IGFA 4UEKA 4WZ6A 5AJUA 4ARBA 1G6HA 3W2HA 1OI7A 8GPBA 2CLLB 4TLMB 4NARA 3INYA 4HFNA 4QODA 2IXAA 5JSQA 2AG5A 3U48A 1CRZA 3ZC3A 3PYLA 3I6BA 3IB3A 2OWDA 1TMOA 2NZVG 4P7KA 4D9BA 4EYQA 5J2UA 2LRHA 3AFIA 3HYLA 1Y1QA 3DVQX 2VATA 2IEZA 4KGXA 3OU7A 1B0ZA 4IH1A 1ZI9A 2I1WA 3DFIA 4IMIB 3VRHA 2QUBA 1CLEA 2A84A 2Q4TA 2FQQA 2YY7A 1FNCA 3K8OE 4JVSB 3SQMA 5ARBA 4TL8A 3W9SA 1NBAA 1Y48E 3FNEA 1J33A 4IIFA 2R7KA 5GGXA 5TPWB 3U80A 4J7CA 3FDIA 1FSGA 2JAUA 2LNDA 1VL2A 4GNRA 4IDPA 5TQ0A 2WM9B 3NUZA 1G1AA 1W0JA 5A3JA 4NV3A 3HDYA 5EE3A 4JI4B 1R5OA 1TVCA 3MWEB 3IFSA 1ANKA 5SYNA 4MVJE 1LLUA 2I4RA 1RE0A 1S4QA 3BA1A 4FZ3A 3F6RA 1UBFA 2ZBFA 1ADCA 1T35A 2BEUA 1CRQA 1HDGO 2JASA 4HRXA 4DARA 4CV0A 4EARA 5KYKA 3IESA 3Q2KA 3ADDA 2XE8A 1F2TA 4MWSA 1PT8A 5ECYA 3HSKA 2IBTA 1E3LA 4TWIA 1XJCA 4EUKA 2G8NA 1SU6A 1YZGA 2OM2A 2GD1O 3AHJA 4MW4A 4OFWA 4X1IA 3L7AA 5CP8A 5G4KB 4CR8A 4IEFB 3RYCA 3U1TA 1CUCA 3FWNA 2RAUA 3LGAA 3W5DA 3GJ5A 4HLQB 5ALJA 5LYJF 3LECA 4DBVO 4E7OA 1XYVA 3CM0A 3NI2A 4ROTA 4IW3B 3AW9A 2ZWOA 3M89A 1GOTA 2B8EA 4MR9B 4UEJA 3R5TA 1LSSA 3AFHA 4YYEA 4YRNA 3LRTA 5JARA 1QHSA 1C1XB 1CIVA 1DARA 1EK1A 5H81A 4ZJUA 1I6MA 2P79A 1MO2A 3GGSA 2HXSA 3HBNA 4TQGA 5K0CA 4HVAA 1RLMA 4YJ2A 3I9V1 4R8VA 5JH7B 4MCHA 1G16A 1BGWA 2CZCA 4EW2A 1U5AA 1RLJA 1NFQA 3KJXA 1BQ4A 3ONWA 5CJPA 4D8WA 1ZUHA 1UKEA 1YRBA 4YROA 3IL2A 2Q3FA 4DV1B 5E7QA 2DHRA 3IPXA 5DYNA 3KZNA 2BZSA 5JASA 2W37A 5CW2A 3QLVA 1L5QA 1IJKA 4RU1A 4E6EA 4Q93A 4D56A 5EJ5A 1TTTA 3BG5A 5FOVA 1GITA 3PSAA 1JQLB 4LDAA 4QRIA 3QHQA 2W2LD 3QUTA 5K3FA 5JNWA 3TBKA 4E5KA 1O6CA 1ESEA 4R9VA 3GLKA 4HSGA 4AZTA 4MKHA 3SF8B 4NZYA 4D46A 4KWTA 4DKXA 1GTSA 1RR6A 5MN6A 3QVTA 4KACA 4X84A 2G72A 4ENSA 4FYVA 4HI0E 4YR7A 1LSOA 1RE1A 2FWAA 1USIA 2JFBA 1YCFA 4WEQA 2OG1A 2XT9A 1M75A 4GBED 3SYKA 2R25B 5B7QA 4RS3A 3EMVA 5IKXA 1NOKA 1GO2A 3OZCA 3LCVB 4PG8A 3OE7A 4EG6A 5FA8A 2HK9A 4BL5A 3IAFA 2R1ZA 4QFBA 2WF5A 5AHXA 5GZ1A 1GPJA 3JALB 4BU0A 1UP6A 1Y3FE 3SDZA 1OH7A 2YQ4A 1N2OA 4IFTA 3I64A 4GU5A 3I52A 3KZ1E 1ZO8A 5BVGA 2JGMA 2VJCA 2BRUA 4CL0A 1OWOA 2MSDB 3WYGA 4JI8B 1RI2A 1N5KA 2QRNA 3TM5A 1O94D 3G5UA 4OGFA 1K6IA 1AKUA 4KO3S 3ZQJA 4PGHA 3ZS9A 2H00A 4XWGA 5BSMA 1WR8A 2QTVA 1XJWA 2A1IA 2PUJA 3A32A 3FPFA 3KPJA 3QPVA 3PL5A 4OI1A 3ZWDA 3AGQA 3EIWA 4CIXA 3SVZA 4C7MA 4K05A 4BCCA 4Q05A 1S2OA 3NXSA 4BMOB 4CNBA 3C3YA 3A4VA 4I66A 1Y1TA 4G0ZA 3SHQA 3VMMA 1UUFA 3HEBA 3LC2O 4HWOA 1IDN1 3N8DA 3TTYA 1ZN8A 2Z4RA 5LQAA 4KGZA 3QW2A 1HFKA 4LVUA 3SZGA 1A2KC 3KWFA 4LYDA 1FIUA 3SOZA 1IJEA 2Z08A 4OK5A 1E9CA 2AXNA 3GAAA 3ROMA 3TDKA 4NICA 4PS0A 3CTMA 2HD4A 3VPHA 5KKCA 2B1IA 1OWNA 1XTTA 3BS4A 3PEFA 1TC1A 3O3MB 4DNXA 3LV8A 3GEGA 5C8YB 4IP0A 1PYOA 4KI0A