2VOJA

Ternary complex of m. tuberculosis rv2780 with nad and pyruvate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
publication title Crystal Structures of the Mycobacterium Tuberculosis Secretory Antigen Alanine Dehydrogenase (Rv2780) in Apo and Ternary Complex Forms Captures "Open" and "Closed" Enzyme Conformations.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 119
structure length 371
sequence length 371
chains with identical sequence C, E
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vojA02
2QRLA 1NBOA 4DWVA 4CUJA 2AE1A 2X22A 3JQEA 3OETA 3PRJA 2JAPA 4GLLA 1P1JA 1JDJA 3FN4A 4WLVA 2Y0DA 5JBIA 4YTEA 2UYYA 5T5QA 3S2EA 3BMOB 3W8FA 4IZHA 4M87A 5EQDA 3OA0A 4GBJA 4B7CA 5A9SA 1ZMOA 3FF4A 1M2WA 4P38A 5CEFA 1GEGA 3GT0A 4R01A 4J6FA 5CHEA 1UZLA 1LA2A 1LSUA 2Y0EA 3K92A 5B1YA 5CP8A 1EK5A 2BLLA 1PZHA 1KY4A 3KRTA 3E9NA 5BNFA 2GZ1A 4FBGA 4BNZA 4WLOA 2P9GA 3IUSA 4NU6A 2OGUA 5DBIA 2UVDA 3K96A 4AJ1A 1F12A 4OSPA 3ENKA 1XU9A 4K26A 5BSGA 4H7PA 4D42A 2Y05A 1IPEA 2I6TA 3LT4A 4JK3A 3VAZA 4MP8A 4Y8VA 4KZPA 1Y1PA 5A1TA 3LT2A 3HN7A 4R9RA 4CQMB 4D79A 3F1KA 4IMPA 5F5NA 2WYWA 4BNIA 2YJZA 2I76A 5U4QA 2I9PA 5JY6A 5I7VA 5L4NA 1QRRA 2BGLA 3UCFA 1U4OA 2W2LD 3PHGA 1I8TA 1NPTO 4BMNA 4MVJH 1A71A 4F3YA 4Z9XA 3BMQA 1UJMA 3I52A 3VZSA 5THKA 1IUKA 3I9OA 4MJLA 2C7VA 4J2OA 1TT5A 2PKQO 4CLOA 4EUFA 3JQ8B 4XX0A 1P77A 4K1LA 3V8BA 2WMDA 1NP3A 4QTZA 1PGPA 4CLEA 3GUCA 3H3FA 3R1IA 2BI7A 3IL2A 3IKTA 2GRAA 3BMNA 3ZU5A 4R69A 3T4XA 1DOHA 4RF2A 3GDOA 3VDRA 2B4RO 3CZMA 3DBHA 3F4BA 3FCOA 5EERA 4IJUA 4BKUA 3VPHA 3JQAD 1VL6A 1H6AA 1ADFA 4L74A 4YWJA 3KYDA 4NU5A 3U4HA 4CM9A 1P31A 2OP1A 4PLVA 5HM8A 1DIGA 1XCBA 1GTMA 3LLVA 4OAQA 3VKVA 5BNTA 3KYCB 3DHEA 5C7IO 4B4VA 1MLDA 4RVDA 4R1TA 4ZRNA 1U2GA 2OZPA 5JO9A 2VYND 4R51A 4YXFA 1Z75A 4MIYA 1ORRA 3RASA 2X9GA 1LXCA 3L4BC 1TEHA 3BMOA 2AG5A 4AJKA 2YFHA 4MIOA 2AW5A 5LC1A 1UXGA 1PZEA 2ZTLA 3BTUA 3NYWA 4YAKA 5IXYA 4IMRA 3WG9A 2EP7A 4WLFA 3NKLA 3CEAA 3QSGA 3ZU2A 3PQFA 3ZW8A 1I3KA 4ND5A 5K0ZA 4XD2A 5TT0A 2DPHA 3R3SA 1V0JA 4IDDA 1Y9EA 5DNAA 4H3VA 3HE3A 4DC0A 5AXDA 3D4PA 4UVDA 1CQJA 2WSBA 3QVTA 5JPIA 1U3TA 3AJRA 3GH3A 1X0XA 2RHCA 3GN1A 3AY3A 1Q0HA 4OH1A 3IJPA 3GGPA 4CQMA 4W82A 1LLUA 3WIEA 4RL6A 2PGJA 5CDSA 1X14A 4E32A 4R1SA 4CV1A 1DRWA 3NV9A 3KBOA 4IXWA 1JA9A 4J1SA 1C0KA 1YB1A 2BFAA 3Q0EA 3JQAB 2P68A 1LDMA 4EJ6A 4L8VA 1AHHA 2HJRA 4BIIA 1DBVO 3JQBC 5AYVA 1DPGA 1OAAA 2J5RA 1IL0A 1EE9A 3DZGA 3I83A 4PVCA 1XU7A 3EZLA 5IFLA 3U4IA 2DBRA 4J3FA 3JQ8A 3M1AA 3H9QA 5DF1A 3EW7A 4L73A 1HEUA 4BNLA 1O94A 4BO4A 3NT2A 3BTOA 4GPD1 4RQTA 5JAQA 1ZW1A 3C7AA 2OOSA 4XA8A 2C2YA 2GSDA 1UH5A 2P91A 2W8ZA 1NVTA 3NTOA 5TS3A 2AHRA 4XDZA 3D4OA 1DHTA 4TVOA 4N7RA 4B8ZA 3RROA 3VTZA 1P45A 2VT2A 3E5MA 2WEKA 2C20A 4IJVA 8LDHA 3QRWA 2PA3A 4QECA 1DSSG 1ZJZA 1E92A 3TZHA 3KHUA 4JLWA 4XJTA 4XQGA 4DC1A 1E0DA 4QO8A 1T1RA 5B4UA 1PGQA 1T4DA 3KYCA 1UXKA 3INGA 4MKXA 1GL3A 1R4NB 2AQ8A 2E49A 1KYQA 2Q50A 4RVFA 4J49A 1YGYA 4P4LA 2HMVA 1HETA 3GDGA 5L45A 4K9DA 4F46A 1OC4A 3JQFA 5DDIP 3OIDA 1Y8QB 2HMTA 1U7TA 2A9FA 3OBBA 4GGOA 4CMAA 4JJFA 1MFZA 2QQ5A 1LJ8A 5I7EA 2Q3EA 1MUUA 4XR4A 2RCYA 5BSEA 2EP5A 4RORA 2FPPA 4WKGA 1KBZA 3E9MA 2PZKA 4YQYA 2W2LA 4PLYA 1GAEO 4ZD6A 4XB2A 1I2BA 2I3GA 3JD0A 4R1NA 4B7UA 4TRMA 1F0YA 2YQ4A 4ND3A 2AQKA 2C82A 1WXDA 2R00C 4PFJA 4J9UE 4BNMA 3X2EA 1O5IA 1DDOA 2DTDA 3A1NA 4J7UA 1NQOA 3IUPA 1Y5MA 3OQBA 3P7MA 3DBRB 4Y67A 3COSA 4IXTA 4D44A 4DIFA 5JY1A 3BTSA 1LEHA 2DU8A 2QYTA 3DOCA 3BMCB 2ZQYA 4FSHA 3PHLA 1JWBB 1BGVA 5EMHA 1YBMA 2GCGA 2H5LA 2GN9A 2HO5A 3QE3A 1HLPA 3UKOA 5T67A 2JKVA 4OIMA 1P1IA 1DIRA 4PLGA 2BKAA 4DBVO 1LRLA 3K5PA 4PZEA 4DMLA 4A73A 5MDHA 3GQVA 2G1UA 3JQAA 2POQX 4IDAA 5DBFA 3WBBA 5IJZA 2V65A 1UXIA 3IDSA 3TWOA 3FD8A 5A4DA 4ZQHA 4UAGA 3HN2A 1U7HA 3VDQA 4O0LA 1HZZA 4N5NA 3WYEA 1GADO 3I9LA 4CM1A 1HDZA 1HDYA 4M89A 3VH4A 4BO8A 1U3WA 3ETDA 4E5YA 3WWZA 4E13A 4BNVA 3QVSA 3EGOA 2E37A 2VYNA 1ZSNA 2VQ3A 3MOIA 5TNXA 2IEDA 4ZJUA 2VWHA 4CM5A 2JHFA 3F5SA 4CMJA 4IZIA 1Z7EA 3U3XA 3CMMA 5BSFA 4W99A 3W4KA 1EDZA 3OH8A 4BQPA 4AFNA 4FOSA 2GGSA 4M86A 4M1QA 4E31A 3U4DA 4JBIA 4GGPA 4J0FA 3RSHA 3LC7O 1KVSA 3VPSA 4DA9A 2DT5A 1YE3A 1R4NA 5F1KA 5COAA 3I9JA 4NPCA 4Q9NA 3WSVA 1H6DA 4Q3CA 3VPGA 3U9LA 4B3IA 2C29D 5F1OA 3TRIA 1M76A 2OFPA 3PXXA 3WGHA 1Y8QA 1OMOA 4N5MA 4HBGA 1BHSA 1OBFO 3PHHA 1V3TA 5L4SA 4XR9A 3AUUA 4RZIA 1HSZA 4YBZA 4CM3A 2UUOA 2Y93A 1EUDA 4R4JA 3WIDA 3G49A 1ADCA 3WQSB 1ENZA 4IDGA 4WPGA 1QKIA 3TFOA 1UXJA 3EHEA 4NFYA 3RUEA 1XG5A 3V2HA 2DVMA 1HXHA 1R4MB 3HADA 4GMFA 2ZJ0A 2EEZA 1YJ8A 1PGOA 1N1EA 1PJQA 3G79A 1B7GO 5ENVA 4BO0A 4CM4B 4DQVA 1YDWA 3JD2A 4WNCA 4YJHB 4DPLA 5KJFA 3DBRA 3TFQA 5K9ZA 1DAPA 4LVCA 1ZK3A 1ULUA 2Q46A 2BELA 3BMCA 3PQDA 4E5MA 1R15A 1IZ0A 3LF1A 5KCZA 1HWYA 4INAA 1SC6A 4MKRA 5JDIA 3Q3CA 4C4OA 4J90A 3KSUA 2NNLD 5HA5A 4J4TA 1NX6A 1GCOA 4LN1A 5U9CA 3MJ4A 3UVEA 2A92A 2IDZA 7MDHA 1R0LA 5KJ6A 3H6KA 2CNBA 3KSDO 1D7OA 3RC2A 4NK4A 3WBFA 5A3JA 1JU9A 1QYVA 1HDOA 1Z45A 2Y67A 4EYEA 5JCJD 5KVVA 2WYVA 4W7IA 3UGKA 3RC7A 4B79A 4BS9A 3GK3A 4OOFA 3LQFA 1YB4A 1WZIA 1RYDA 1TB4A 1MFPA 4ALLA 3SC6A 3PYMA 3ZH2A 2GF2A 4HFMA 2VWPA 4XIYA 1GZ6A 5JMWA 2G0TA 1UP6A 4FJ1A 4QQRA 3C3XA 2I3AA 1MX3A 5A02A 2YUTA 4TRRA 1KEPA 1X0VA 4B3HA 1KC1A 4KTTE 3QHAA 3WYBA 3FBGA 1R16A 3QV1A 3RUIA 2Y1DA 1V3VA 4PLCA 4DTIA 1AXEA 4DPMA 3CUKA 1BDBA 2IXBA 1X13A 4GAEA 4AICA 1Q0LA 2GO1A 3E82A 2YFQA 2JHGA 5JSFA 4YR9A 1JKIA 1ZK0A 2PD4A 3SC4A 1AHIA 3V1TC 1ZK4A 2X4GA 4BGIA 2HQ1A 3GDFA 4PLPA 3H7AA 1E7QA 2O50A 4L0QA 3ZWVA 2Q49A 1C1XB 3WGIA 3VH3A 4PG8A 4NK5A 1XA0A 2QG4A 2RH8A 1AUPA 4Z0TA 3W6UA 4DYDA 2WWRA 2Q1UA 3JQDA 4IJKA 3PDUA 1EQ2A 1N92A 1FDVA 1M6WA 2XPCA 3DB2A 2E6UX 4AVYA 3F3SA 4PLHA 4GWGA 1R4MA 2Y1OA 4R9SA 4PLWA 4CM4A 1NAHA 4YJHA 4XYLA 3ZNOA 5DP2A 3H9EO 1J5PA 4U6SA 1NNUA 4FFOA 1AGNA 4OO3A 4CMCA 1E3EA 4MVJM 4RGBA 4F6LA 1NPYA 4OYRA 2DBVO 4BNTA 5B12A 5ITVA 1TXGA 4E3ZA 2X8LA 2H6EA 3ZDFA 4YAJA 3AY7A 3RFVA 5A5FA 1O9BA 1BVUA 3D3EA 3H65A 3QWAA 4D3FA 2SCUA 4TROA 3WSWA 4IINA 1YQXA 1E3WB 1NHGA 3QVWA 3W6ZA 3I6QA 3WMWA 3E1KA 3IIEA 3WQRA 3ROMA 1P1KA 1GCUA 4CMBA 4DUPA 3I9NA 4D7AA 2X5JO 4M54A 4J1TA 5EL0A 4YJDA 2NUAA 1NR7A 1UZMA 3DZHA 1P33A 5I8ZA 5THQA 1K5HA 4I5EA 3VZQA 1HF3A 1ZEMA 3EUWA 2VN8A 3PLNA 4Q3AA 3LK7A 1PWZA 1GUFA 8ADHA 4MVJI 4IIUA 5JAMA 4J16A 3PLRA 2I99A 3OECA 1WLYA 1PL8A 1EDOA 2GN6A 1U3VA 1A5ZA 1EUCA 3KUXA 1EUZA 1PU2A 3EK2A 1A72A 1LSOA 3NEPX 2X0JA 4J2HA 1T26A 4XGIA 2VUUA 3PWSA 2D1YA 2WD8A 3IKVA 3HDQA 5FWNA 1FDWA 1ML3A 3Q2KA 1PJLA 3MZ0A 3ANNA 4CR6A 1ZNQO 3I9MA 3HDYA 3MJVA 1MA0A 3SEFA 1YL5A 2R6JA 2FN7A 2TMGA 3I9KA 4AJIA 4WASA 2ZTVA 1XDWA 2O3SA 1GYPA 3L07A 5L9AA 1C1XA 3K2EA 3X2FA 2JL1A 5COBA 2NU6A 4OGWA 4URFA 3IQDB 1WDMA 3VHRA 2DQ4A 1WMBA 4ZA2A 1RWBA 1IE3A 3ST7A 4I5DA 1Q7GA 4YAEA 4FPXA 1E6WA 3D1LA 3LDHA 1X1EA 4XRGA 5AXCA 3GG9A 2YV2A 4M55A 1JW9B 4BKQA 1WDLA 2XXJA 2YV3A 4Y6SA 5GMOA 5JCJA 5ILOA 1PZGA 2X9NA 2EXXA 3RJ9A 1I10A 3VPXA 3GFGA 2VTDA 2C07A 5H81A 3F4LA 3JQFC 3FTNA 1D3AA 3O38A 3U62A 4A0SA 2C2XA 4AJNA 4RLSA 4UVIA 5A03A 3RFXA 1LLDA 2GD1O 4J91A 3RUDA 1VL0A 1J0XO 4M49A 4UUOA 2JAHA 1PJCA 1E3WA 2DFDA 2D4AA 4IQ8A 4YJGA 4ZQEA 5T64A 4I8XA 5GZ3A 3GPDG 3U0BA 5ADHA 1PTJA 5IDXA 1GEEA 3SLKA 2P5UA 3D5TA 3F46A 1E7RA 2GN8A 4II2A 1B26A 3A28A 4RF5A 3HB4X 3ZHXA 5BQFA 4P4GA 3IP3A 4F6CA 1SB9A 1NFFA 2C5AA 4JROA 4M8SA 1R66A 4RCVA 2EIHA 3TJRA 4BGUA 4TZTA 4RLHA 1BMDA 2OL4A 3A06A 4NBWA 4YRDA 4A27A 1TI7A 3AY6A 2FMUA 1RM5A 1A7AA 3GG2A 4CMEA 2Y66A 3MTJA 4TSKA 2VOEA 1E1LA 1OC2A 1YOVB 1J49A 2UUPA 3C85A 3OJEA 4I9HA 3RFTA 3ZWPA 3ICCA 1EQUA 3KV3O 2ZYAA 3RWBA 5CDUA 1R12A 4A2CA 4AL4A 4CJXA 4XYGA 3FPCA 2ZK7A 4ILKA 4U8GA 1Z82A 3DZBA 2O4UX 1NPDA 2Q2VA 1EMDA 4I5GA 3ZW9A 1FXSA 5DCYA 4BHTA 3R0IA 1JN0A 2AEJA 3S2FA 3WNVA 3GN2A 4TRNA 4ALKA 3D7LA 1CDOA 1UP7A 3JV7A 1E6EA 4LRTB 4RQUA 1EZ4A 3RI3A 3B6ZA 3JYPA 3TZKA 3GPIA 4JP2A 4CV0A 5KNLA 4Y6RA 2IZ0A 5TF4A 4GX1A 1KVQA 2X6TA 4MOWA 4E5NA 4JGBA 1B3BA 1XQ6A 3WS7A 2F1KA 3OEYA 1NASA 1QLHA 3CTMA 3AUTA 1LQUA 1WPQA 3LVFO 2VNSA 2ZB3A 3FBTA 2EERA 4TKMA 4DLBA 4RJTA 1E6UA 5JC1A 3Q9NA 3DQPA 4C7JA 4WNIA 4UUPA 4FGWA 1GUZA 5T8KA 1KEWA 1H2BA 2NSDA 3QWIA 4FFRA 4NG5A 3RCBA 5KJ1A 2B69A 2HUNA 4RDHA 2EGHA 4G81A 2O3JA 1NQAO 1VL8A 2PV7A 2FY8A 4JJGA 3ZWAA 2O23A 1YB5A 1SMKA 4YDRA 1P44A 1K2WA 1R37A 2XAAA 4TQGA 3BA1A 1W73A 2B4TO 4ZICA 3RAJA 1NAIA 4XZ3A 2DFVA 3PGXA 3MJCA 3GFBA 3G1UA 4E12A 3NJ4A 2PZMA 3ONEA 2PGLA 1NVMB 5KKAA 5LCXA 5JDIC 2J3KA 4CLHA 5LDGA 2HKIA 4QFCA 1CYDA 1DB3A 1GV1A 3GNQA 1ZIDA 5DP1A 3SLGA 4GVLA 1Q0QA 3ULKA 5KOIA 2WJPA 3H2ZA 5L3ZA 4PG4A 3DHYA 3ZNPA 3RQSA 3QJ5A 5JO0A 1WP4A 1ZVMA 4FQ8A 1YOVA 2FOIA 1JKFA 4N18A 2CVOA 1GQYA 3M1LA 4NI5A 3DZFA 1QMGA 2CF5A 1HLDA 1BXKA 1L1FA 3FPLA 4CV2A 2NLOA 3RU9A 2VZ8A 1E7MA 1KC3A 3VC7A 1XIVA 1ZSVA 2GERA 4JIGA 5JLAA 2PWZA 2BI8A 3TPCA 1E5QA 1NFQA 4L9RA 4Q3NA 3VPFA 1XKQA 5TRTA 3ASVA 3PPIA 4YT8A 1I36A 2FR8A 2ZIZA 2D59A 4B4UA 1M6HA 3NGXA 1NR1A 1FJHA 4FJ2A 5CAEA 4G65A 1DJQA 1K3TA 4N5LA 1P0FA 1DHRA 1EFLA 1P74A 3ENNA 2IODA 5JYEA 4OJNA 3LSYA 3BHMA 4AJJA 1GZ3A 4YA6A 4NNJA 1ISIA 2B37A 4UEOA 4LMPA 3PHJA 4Q3EA 3TDKA 3PHIA 2CY0A 5IXSA 2NACA 2OO5A 4GI2A 4R1UA 3MEQA 4FIZA 1MGOA 1K6JA 1QV6A 1IY8A 4PVDA 4TVBA 3AUSA 5DOZA 4FFPA 1HE5A 1M75A 2QZZA 3EAGA 4ZRMA 5T57A 1BVRA 3PJEA 1O6ZA 2JCXA 4Z9YA 1Y6JA 4BNFA 4YYZA 1P1HA 3BHJA 1LRKA 2FWMX 1ZK2A 3HZZA 2DBQA 4HV4A 2Y1GA 5I9MA 1KIFA 4D45A 3KEQA 4Z6KA 4II3A 1NWHA 5DOVA 1LI4A 1HL3A 5I8WA 1H5QA 1PGJA 1B14A 1FDUA 3I3OA 3S2IA 4W6ZA 3GLQA 1WAMA 1X1TA 1RPNA 4J7CA 3ASUA 3PIIA 2CDCA 4LVUA 4RF3A 5IDWA 5EJ2A 1MB4A 1QXSA 4I08A 1YBVA 4GX2A 3ONFA 5JE8A 4PRLA 3RU7A 3GMDA 3TOZA 3L9WA 2O7SA 4XJSA 2B35A 4FCCA 1VI2A 4JNKA 1EBUA 3AU8A 3ANMA 5JC8A 5TGDA 3KB6A 3A9WA 3ROQA 1NXQA 3DL2A 3GMSA 1I3LA 2HU2A 1VKOA 5ES3A 1GQ2A 2IZZA 1HE2A 1B8UA 3OM9A 3LF2A 1FDSA 4IUYA 3JCZA 4GL4A 2P2SA 2BRUA 5FEUA 3PIDA 1SPXA 3ICPA 4GSLA 2BGMA 2C59A 1O95A 1UDCA 3O8QB 1KS9A 4U6QA 3BAZA 1CETA 2DC1A 1UXHA 5B4VA 1ZSYA 1C0LA 1FK8A 2WM3A 1Y7TA 4ZQBA 1N7HA 1T2DA 4RVGA 1WNTA 4EJMA 3E9QA 5L7YA 2E48A 3OSUA 1IPFA 2VWQA 3SJ7A 3QP9A 3WR5A 1YONA 3WFIA 3ZNQA 3SBOA 4CL3A 4BNNA 3JYNA 4GX0A 5JNLA 3QW2A 1XYGA 3JYQA 3GEGA 2OBYA 3UOGA 2V6GA 4I9UA 2A35A 2YY7A 2HDHA 1Y9AA 4JX8A 1S6YA 3DFZA 2W98A 1T25A 1SEPA 1ZUD1 2OMEA 4KOAA 4U7WA 4RO0A 3VTFA 3I23A 4A26A 1VJ1A 1LLCA 3B20A 2AMFA 1ISGA 3DOJA 3AI3A 3AM4A 4PG6A 4UEJA 3ZNNA 1CRWG 3PGJA 1LC3A 4LRSB 4BNKA 5BR7A 1ZKMA 3FWZA 4OQYA 1MG0A 1Z73A 3M2PA 4CM7A 1YJQA 4JCOA 4CLDA 2X9VA 4ZGWA 4HFJA 1LLQA 3ZWXA 3PFWO 1E3IA 1UAGA 3Q6IA 2VYVD 1ZK1A 3OMLA 2X23A 4CMHA 1P9LA 2V6BA 2FRDA 4MDHA 1PJTA 4RZHA 3ZWBA 1IHYA 4YRAA 2VCYA 2HK8A 1B0AA 2W4QA 2E82A 5C5IA 2FR1A 3K30A 4BNXA 3Q11A 3RIHA 1X7GA 1L7DA 3STHA 5F21A 2BF7A 3W1VA 2DPGA 1DO8A 3KVOA 5GZ6A 2GZ2A 3MOGA 1LDBA 2J3HA 3GVCA 5FF9A 3B1JA 4OMUA 2D3TA 4CL8A 2NM0A 4TRJA 3UHAA 1P3DA 2DBZA 3H5NA 4K6CA 4XIJA 1U8FO 4BVAA 3WOHA 3DZIA 4CM6A 5MGBA 4DREA 2TMDA 3OA2A 3W8DA 1VKNA 1DXYA 1DC3A 1ZH8A 3O8QA 2VZ9A 2Q2QA 4E2YA 3KETA 3FNGA 3GGGA 2WDZA 1XSEA 2BFMA 1A4UA 2EW2A 1I32A 1YKFA 5I7SA 2NTNA 3AOGA 4Y98A 4U0KA 1SZJG 3CH6A 3DFUA 3IJRA 3CSDA 4E5KA 4E5PA 2HJSA 1MC5A 5CEEA 5KVSA 1QYWA 1ZFNA 3WTBA 1PWXA 5DCUA 3G3EA 3S55A 1YL6A 4XGNA 1PR9A 5A9RA 4WEQA 3O9ZA 3GVIA 3DAPA 2AQIA 1EBFA 1DLIA 2ZYGA 5HS6A 3GNSA 3DC2A 3ITKA 3C7CB 5F5LA 4AJPA 2EJVA 2IRWA 4DYVA 4GH5A 4W9NA 5KVCA 3K9QO 2IEBA 2DTEA 2X5KO 4X54A 1DIAA 3K8ZA 3PJDA 4D43A 2GNAA 1C3VA 3PZRA 3JQGA 1JLLA 1NYTA 3RBVA 5G0UA 3NDRA 1IHXA 4BKPA 3WGOA 1H6CA 4GKVA 4PGFA 1V9LA 5GY7A 4A7PA 3CE6A 4MO2A 3B1KA 3FNFA 4WCDA 3ROPA 3L6EA 2HMWA 1LBEA 2FHSA 3G17A 3ORFA 1E7WA 2Q2WA 1CF2O 1MV8A 1U4SA 1FDTA 2Q4EA 4UVGA 3UH1A 5T8KC 4QO7A 3V1UA 1GFSA 1QP8A 4NBTA 1T2CA 3SX2A 4UREA 3UICA 1HTBA 4J4HA 3KO8A 1IULA 2G17A 4WLEA 1YQGA 1UAYA 2G76A 4K6FA 2Q1SA 4PLZA 3BZUA 4KDFA 4Y6PA 3U09A 3PVZA 1CJCA 3ZU3A 3F6YA 3OHSX 1J4AA 2PZLA 3N7UA 3MWEB 3KSZO 1H0KA 2ET6A 1QYDA 4BO7A 1OI7A 4CV3A 5BSHA 1TLTA 2Z95A 4H15A 1AN9A 1ENYA 4AJEA 1SCUA 2X0RA 5CPFA 2EKLA 2J5QA 4B4WA 3JD1A 5JAIA 3GR6A 4TZKA 1DJNA 1L7EA 4DL9A 3TSCA 1N5DA 1YL7A 3P2YA 2R2GA 1A9YA 3LT0A 1T4BA 4O59O 4OQZA 4UVEA 5IZCA 1D4FA 2GASA 4E30A 3IAHA 1PIWA 5TQVA 3PK0A 1GZ4A 4NHEA 4CQLB 1B8PA 4ALMA 4NBRA 2LDBA 3T4EA 3E8XA 1H2HA 3JQ9A 2H63A 3G0OA 1RYEA 5G0TA 4BB6A 1I24A 3QY9A 2PLAA 4IS2A 3ON5A 1BXGB 4IJWA 4KDEA 2Z1MA 3W4IA 3RUFA 2IYPA 3EY4A 2Y68A 4FDAA 2VYVA 4U0JA 3GVHA 3ZV3A 1YWGO 3RJ5A 2CF6A 2QRKA 3CZRA 4N54A 2VNAA 4NJMB 2X7HA 5JAZA 1IZ9A 3L6OO 4BL5A 3DO5A 3C1OA 3OQ1A 4MVJD 3DZKA 4J9VA 3MJTA 1PR3A 2YDXA 1RKXA 4JBHA 5EN4A 3HNPA 4YJGB 1KEUA 4XKJA 3FR7A 4BNGA 4ZN6A 3Q9UA 3KEOA 2D5CA 1SO8A 1XELA 2JFHA 3HFSA 1VJTA 4HNHA 3ZGYA 3CPSA 1E1MA 2HRZA 4KWIA 4XCVA 1K89A 1JVSA 3GGOA 2VTEA 3CKYA 2FPIA 5AXBA 2VZ0A 5T6BA 2O3RA 1RM0A 4AJHA 4E21A 1A9ZA 1SAYA 4XGKA 1B2LA 3AI2A 5C7OO 3GZNB 4E2WA 4YAGA 3E5RA 4ALNA 1H6BA 4MVJP 1HRDA 3PZBA 4E4YA 1QLJA 2A4KA 4IBOA 3VZRA 2B5VA 1G6KA 1UR5A 2NU8A 2ZYDA 3ABIA 3NT5A 1YO6A 4B4OA 3QLJA 1U3UA 4BGVA 4DQXA 4YAIA 4F45A 4RPKA 2YHIB 2HMSA 2P5YA 2DUWA 1O89A 1HSOA 5IZ4A 2NV6A 1NQTA 2EW8A 1ISMA 4D0RA 4GSKA 3QQPA 4YB8A 4XRRA 1I2CA 3I4FA 5B37A 3R3JA 2CSUA 5CFZA 1LNQA 1C0IA 1WWKA 3IC5A 3WDSA 4C7KA 5L7WA 1IYZA 2HK9A 2JJYA 5C3MA 5TSDA 4DPKA 4BNJA 5B4TA 2IZ1A 1PQUA 2DLDA 1C0PA 1Y81A 3RBZA 1UP4A 4KTVE 4YCAA 5ICMA 1BXZA 4WLUA 3JQ7B 3QWHA 4BO9A 1Y5RA 4CQLA 4OL9A 1LC0A 5A04A 1PS9A 3B1FA 4DMMA 1Q2XA 3ZI0A 4JQCA 4YACA 3WGGA 4B8WA 3DAGA 2NADA 2PFGA 1BXGA 1IB6A 5G0SA 3RC1A 1RJWA 1ZXBA 4S1VA 4J1NA 1AXGA 3EC7A 3EVTA 2A94A 4I5FA 1ZMTA 3DBVO 2UV8A 3OJFA 4D3DA 2D2IA 4NJMA 3UF0A 4ROSA 1EFKA 4LMRA 1BWSA 5AOVA 3DMYA 3SXPA 4DLAA 5KJCA 5J23A 1M66A 3FR8A 5ILGA 2G82A 1E77A 2PR2A 3GAFA 3H2SA 3ZU4A 1BRMA 3ZCXA 5I9LA 2PD6A 2HLPA 2JD2A 4EUHA 1LTHR 2O4CA 1VPDA 1DIHA 2OXIA 1H9AA 1M67A 1LX6A 1U9JA 1O8CA 3NGLA 4HFNA 1ENPA 1DC4A 4PCVA 1B16A 3D5QA 3GC6A 1HKUA 5IAAA 2EF1A 5IG2A 4FFMA 2BFPA 4ZQGA 1JAYA 2NVWA 4E6PA 3Q2IA 1MXFA 4ZHSA 4ND4A 2B0JA 1PQWA 1BDMA 3MJSA 4GWKA 4OKIA 4EI2A 3JQ6A 4BV9A 4WOKA 3GZNA 3EDMA 3H5AA 4MPDA 2I66A 1PX0A 3VVBA 1OZAA 3NX4A 3WICA 3WJAA 2WE8A 1NWCA 1EVYA 3SVTA 3BTVA 1K6XA 3QWFA 4AJ4A 1I01A 4FC6A 5K6AA 1V35A 2O3TA 3BXXA 2YHIA 2PKQP 1U8XX 2CFCA 4WCFB 2VHVA 3RD5A 1LDNA 1DC6A 5H83A 3SJUA 1X15A 3ETGA 3UCEA 4DVJA 4BGEA 4HNGA 3FSRA 3UFXA 3S8MA 1CEQA 1QR6A 5CDYA 2GPTA 2HSDA 3AU9A 3UN1A 5HRUA 4J7XA 5CEJA 2XF8A 3MTGA 4JBGA 4JJIA 4JXKA 1T2FA 1VC2A 9LDBA 3D0OA 1SBYA 1Q7CA 3PI7A 1FMCA 2CZCA 5CDGA 3W8EA 3PP8A 5L40A 2AE2A 3JQ7A 2ZJ1A 2AEFA 1DFHA 3IP1A 3ZV4A 4JN6B 1PJ4A 1QYXA 3BIOA 1W0CA 3DDNA 3UXYA 3DR3A 9LDTA 5HTOA 1QSGA 2Z5LA 4IM7A 4CLRB 1JAXA 2Y0CA 3D3WB 4R3NA 1U2DA 3WTCA 3TZCA 3H9GA 2VRCD 4HADA 1ONNA 1RM4A 4OXYA 4OSOA 2EWMA 1SEVA 3KXDA 3RVDA 4HX5A 1YVEI 4WE3A 2VHXA 3ONDA 2H9IA 4L4XA 1K6IA 4OXKA 4DGSA 4LCEA 1U28A 3DBLB 2BH9A 5L4LA 1KVUA 2I67A 1DAOA 1QORA 4I1IA 4YVFA 4DQUA 2V7PA 1VM6A 4YT5A 1WMAA 3TL3A 2Q1WA 4CR8A 4RF4A 5ITWA 5AXAA 2Y1FA 1KEVA 4NR0A 2FP4A 2V6FA 2UDPA 2JCYA 4MP3A 2PK3A 5HS4A 2NQTA 1D1TA 4P8RA 4KP7A 2XOXA 4BB5A 4RVHA 3DXFA 1T24A 2XXBA 4QFDA 1PQPA 4NMHA 4IDBA 3DMTA 3FI9A 2GYYA 3QIVA 4W9NC 3GUYA 5I9NA 4KMSA 1ZXLA 4QSMA 4GKBA 1EVJA 1VSUA 2OORA 4BV8A 3AOEA 3PJGA 4NH4A 2PNFA 3ROKA 7ADHA 3KZVA 3A4VA 3P2OA 1O0SA 3BHIA 3WFJA 1NM5A 3D4NA 5ICSA 5JFOA 2QIOA 1DLJA 5DBGA 3WXBA 3H9JA 2IYOA 1H9BA 2CDBA 2O3UA 4EW6A 5ER9A 3PDJA 4R54A 1NHWA 4WCFA 3KM0A 6ADHA 3I5MA 1YH3A 3TF5A 2HK7A 4BNYA 4Y9DA 1KOLA 3VKUA 4HP8A 3ZZNA 1I33A 1PSDA 1EVZA 1PJ3A 2FSSA 1N2SA 1GV0A 1PL6A 3DTTA 3NUGA 1PL7A 2UAGA 3DEYX 1CQIA 3FHLA 3O26A 1JVBA 1A27A 2BGKA 3ETEA 1YS4A 4W4TA 1AE1A 2NTVA 3OP4A 1HE4A 4O63O 1G0NA 1NVGA 3RC9A 4MIEA 3WLFA 2B5WA 3LU1A 3ANLA 2O2SA 3TOXA 4IGEA 1KVTA 5TJ9A 4BNUA 4CLRA 1UUFA 1F8GA 2CUKA 4J0EA 1SB8A 1DFIA 3D3WA 4ZU3A 2OP0A 4BMSA 1Z74A 1B8VA 1VE9A 4G2NA 3AUAA 4D41A 1N8KA 4NQZA 1PZFA 3EZYA 3V2UA 4J1QA 3ZWMA 2NU7A 4CUKA 4QEDA 3U4CA 2YV1A 4MINA 5TT1A 4PLFA 2B4QA 2C5EA 2NU9A 4CMIB 4ESOA 3DBLA 5JW6A 4IDEA 5IZCC 1LQTA 2CVZA 2IE0A 2VHWA 1ISHA 3HQ4O 3LLSA 4EEZA 5ER6A 1GU7A 5JS6A 4R5MA 4Z3KA 3VH1A 3T7EA 1ARZA 3VVCA 3JQ9C 4BKRA 2W90A 5JYDA 4NBUA 2P4QA 1H94A 4Q3BA 3ADOA 2Q1TA 3I1JA 3TQHA 5EIOA 1XWFA 1DEHA 1H93A 4HXYA 2QYSA 4P22A 1TT7A 3T7CA 1SOWA 3AK4A 2X86A 3HJAA 4CPDA 2Q99A 3G1TA 1LRJA 1ZO8A 2X0IA 2ZTMA 3H4VA 4MVJF 5AVOA 3RKUA 3WGQA 3E6AA 3KLPX 4RPJA 2QX7A 5DN9A 5A5EA 4EZBA 4D0SA 1G1AA 2VUTA 5DULA 5FFFA 1KERA 4UUMA 1V8BA 3PQEA 3IMFA 1WDKA 1QV7A 1GUYA 1CWUA 1ZJYA 4ND2A 1DC5A 5TJHA 4RPLA 4HWKA 5IN4A 1MG5A 1P0CA 2NWQA 3ITDA 3O03A 5G2OA 2F00A 4NFSA 4S3MA 3VOSA 2HAEA 1GYRA 2AQHA 3JD3A 4PRKA 2DTXA 5C7LO 3DZJA 2VRCA 3OIGA 3AM3A 1PJSA 5F1PA 4E2ZA 4XYEA 4E0BA 4R41A 1GQQA 3RKRA 4CLXA 3UCXA 5TLSA 1N9GB 1PS0A 3WWYA 4DRYA 3DAFA 4KQXA 1GDHA 2JFGA 3WJ7A 4R68A 5KJEA 4K28A 3K73O 4EEXA 2X58A 1X7DA 1J6UA 4WJZA 1PGNA 4CMGA 1I3NA 4QUKA 5KWEA 5L95A 4FS3A 4KUHA 1LDYA 2C7GA 5G0VA 1ENOA 4W7HA 1Y8RB 2EHDA 3AWDA 4A03A 4FB5A 3LT1A 1LSJA 2AEMA 2FSVA 1Z6ZA 1I5RA 5DZSA 4E33A 4WLNA 1PJ2A 3MWDB 4U5QA 4YPOA 2C0CA 5FI3A 4CMIA 2J3JA 3L6DA 4FW8A 5IN5A 5ENDA 5CDTA 2DUUA 1BTOA 3JQGB 3FRJA 2AXQA 4QXMA 1Q7BA 3GEDA 3LC1O 3WX0A 2J6IA 4LISA 4BQRA 2J8ZA 1D1SA 2YW9A 3P5SA 3QWBA 4RV9A 4IDCA 4MVJE 1LUAA 2WE7A 5JDCA 1E1NA 1HZJA 5JCXA 1NQ5A 1W4ZA 1HYGA 4PG5A 3U49A 5TC4A 3UW3A 3GZ4A 4HY3A 3E03A 4KUGA 1ONPA 4R16A 5H82A 4BMVA 3NDJA 1KVRA 4AJ2A 1OOEA 2VUSA 4L4RA 3GOHA 3L0DA 4RVSA 5TX7A 2GZ3A 4BO3A 4A5OA 4UULA 1E5LA 1W6UA 1ID1A 2E4AA 3GRPA 3N74A 2ZATA 4IQ0A 1HDRA 2JD1A 2GN4A 3EYWA 5EQFA 1JQBA 1F17A 3PTZA 4ALIA 4A10A 1ZBQA 2DKNA 2NTJA 4BO2A 1LDGA 3INRA 3PWZA 3RUHA 4ALJA 4BNWA 4BNHA 4NFHA 4JP3A 3IS3A 1UDBA 3V1YA 1ZZEA 1GD1O 5A3VA 2ZQZA 3B70A 3U5TA 3K2BA 4L75A 4BUCA 1WVGA 3FNEA 5KIAA 3A14A 5DT9A 3WNQA 2Y1EA 3GA0A 3GHYA 4FOOA 1N1GA 3DWFA 2I65A 4J43A 2PGDA 4J4BA 1CERA 1T1SA 1N9GA 3W4JA 4FFLA 3UUWA 4CMEC 5BT9A 3WGTA 1B3RA 3TN7A 4OM8A 1KETA 1P1RA 5K6AC 5IF3A 4IDFA 5JMPA 3BYZA 5GZ1A 2QW8A 2RH4A 1VRWA 3AW9A 3HDHA 4FD3A 4PIVA 3S2GA 5JXWA 2D5AA 1QYCA 1V3UA 1E3SA 4RVUA 2GLXA 4IPTA 1Y8RA 2GR9A 4FGSA 4L4SA 1TA4A 4HUJA 4DIBA 4PG7A 4EUEA 1T2AA 1R6DA 1V6AA 2BHLA 4LSMA 3HFGA 2VHZA 3S1LA 4BO6A 2EV9A 3OJOA 5LDHA 1BSVA 1K0UA 5BNIA 1D8AA 1MXHA 1U5AA 2X5OA 4NJOA 3JD4A 5G4KB 3FTPA 1LDEA 4FC7A 5FI5A 4UEKA 5KKCA 3OEWA 1XR3A 4NZ9A 1FF9A 2EKPA 1HT0A 5L7TA 4IS3A 3OJ0A 2ILTA 5HBRA 2VRBA 3K6JA 3KTDA 5G4LA 3AI1A 3GY0A 4RPGA 4WEOA 3F1LA 4FR5A 4CM8B 3NAQA 4GMGA 1BW9B 1HDXA 4FFNA 4KQWA 4PZCA 1NTOA 3RBXA 4ZVVA 3H9UA 3O4RA 1G0OA 3D64A 2Z1NA 4DXHA 2RIRA 4EBFA 4H16A 1E7SA 2YQ5A 4GQAA 4OOEA 2DM6A 5EINA 1ONOA 3QVOA 5FYDA 1F8FA 4MP6A 4O1MA 4PLTA 3TNLA 4CODB 3OICA 1XHLA 4Q39A 3KYBA 4R3WA 4KUEA 3JQCA 3L4BA 1I3MA 1XGKA 2OBNA 3DMTC 1A7KA 1HYEA 3NRCA 3QVXA 3MCVA 3EVNA 4EGFA 1C14A 4HKTA 4XEHA 3WLEA 4EITA 3OIFA 2P9CA 3KLMX 3P19A 1S7CA 2O2YA 3AOEC 3AFMA 1XQ1A 2G5CA 3I6IA 2X1HA 5EESA 5A06A 4ID9A 2YHUA 3AM5A 5C37A 2ZTUA 2ZCVA 4LW8A 2YYYA 5IDQA 4EDFA 4Z0PA 1T2EA 3HDJA 3VH2A 1U5CA 5TIIA 3OF2A 1Z7BA 4KWHA 4QT0A 1I30A 3L9XA 3K31A 4E2XA 3GNTA 4WCFC 1ISFA 5COQA 3LYLA 1E3JA 2BD0A 3ZV6A 2I5PO 2FR0A 3MJEA 2PH5A 4XQCA 3FNHA 3NDIA 1ZCJA 2C54A 3HG7A 3ZWCA 2RBEA 3CINA 3PEFA 2FZWA 3GF4A 3ZV5A 1KY5A 4Z9FA 1XEAA 2O48X 4QX6A 2CVQA 1PEDA 1C1DB 2IXAA 2PY6A 3GRKA 3E48A 3V2GA 3ZWWA 4UVHA 3ZWOA 1UZNA 5L51A 1YXMA 3C8MA 3JQBA 5G4KA 3ZHBA 1Q1NA 2CMDA 4PZDA 3M6IA 4CR7A 1YDEA 2AG8A 1GPDG 1HE3A 3CMCO 3CXRA 1BG6A 2B83A 2BMAA 2HRBA 5CG1A 1JKJA 1VJ0A 3GVPA 4Q3DA 3HUDA 2WD7B 4XWYA 4YJFB 1DRUA 4RPHA 1LSSA 2FZEA 2QZ9A 4CMKA 4TMFA 1U1IA 4YT4A 4I9NA 4CM8A 1PJBA 2QHXA 3F9IA 3KOUA 1BW9A 2RHRA 3N58A 4XDYA 3ZHYA 2CDAA 2H1SA 2ZKLA 4RDIA 3WYCA 1HDCA 2ZB8A 3DOOA 1SOVA 5KTKA 4LSWA 4O6VA 3HSKA 5AQ1A 1W8DA 1DFGA 3NTQA 2NVUB 3C24A 2PKRA 1E7YA 2HMUA 3PFFA 1SNYA 4XB1A 1GR0A 4HFRA 3C7DB 1XLTA 4YT2A 2V6MA 2PH3A 2VHYA 2ZCUA 3RUCA 2Y1CA 1LU9A 1DIBA 2GUGA 4B7XA 4WUVA 3L77A 3H5RA 3OQ6A 2W2KB 3TL2A 1HDGO 3OFSA 2ZB4A 3TZ6A 5KVQA 4BOYA 4B3JA 2PZJA 2Y99A 2RAFA 1YBAA 3NJ8A 3Q1LA 3NT4A 3ZWNA 1ADBA 4WGGA 4AJOA 5F3RA 3PYXA 4XYMA 3I4CA 1MC4A 3RUAA 4G5HA 2QRJA 2R00A 1VLLA 5DCWA 4Z0HO 2CD9A 4BKOA 3F47A 1A4IA 4OXNA 4YRBA 4P4NA 1QG6A 2OUIA 1VSVA 3F5QA 3DHNA 5L53A 1CIVA 3HWRA 2VWGA 4GVXA 5G0WA 1EVIA 1GY8A 4OHUA 4ONEA 4UUNA 4BO1A 4XQEA 4TWRA 3ZHZA 2D0IA 4NIMA 3VZPA 4DIOA 3AFNA 3JSAA 1PS8A 5A9SB 4O5OA 4CUZA 2O7QA 3INTA 1YQDA 2AA3A 4GX5A 3PWKA 4CM9D 3DONA 1DRVA 1C1DA 1GYQA 4ND1A 4PN3A 4BO5A 1MP0A 1JWAB 1UDAA 4TKLA 2EJWA 1WW8A 2YZ7A 3CIFA 1ZEJA 2ZB7A 5A9TA 4FN4A 1WZEA 1GPJA 1N7GA 3GEMA 3JYOA 4FJ0A 4MKZA 3R6DA 5U1PA 1NFRA 3E18A 6LDHA 2WTBA 3OJLA 2VOJA 4L76A 3H8VA 1OFGA 1EK6A 1R0KA 1ISJA 4LK3A 3L4SO 3WGYA 1IOLA 3HB5X 2O3QA 1X7HA 2BFOA 2PD3A 2WD7A 3EMKA 4IGFA 4OKNA 4YJFA 3WB9A 3DTYA 2FPGA 3LZ6A 2HCTA 4IQGA 4IY1A 1F06A 2JFFA 3WQQA 2NQ8A 3PJFA 3LC2O 3GAZA 4XYBA 3IOYA 1E1KA 3GHHA 2VT3A 1JTVA 3QA9A 1TVEA 4Z3DA 1I0ZA 3BMQB 3C1TA 5IDYA 4ITUA 1EEHA 3ZWYA 1TT5B 4D3SA 1HYHA 2WYUA 2NVUA 1R0SA 4LCJA 4CLOB 1I2ZA 3ADPA 2Q45A 3M2TA 4AJLA 2J5KA 4XQ9A 2LDXA 2EKQA 4CQMD 5JDCC 1EE2A 3GVXA 4GLOA 4YQZA 1ULSA 4EJ0A 1YRLA 5HWSA 2JCVA 3PYLA 3WGZA 4IIVA 3BMNB 4R5HA 4WK6A 3JTMA 4DLLA 2P9EA 3JYLA 1B15A 1E3LA 2P4HX 5CPBA 5CG2A 2GDZA 3WMXA 2PTGA 2W2KA 1ADGA 2B36A 4MVJG 3H3JA 3DBHB 3TZQA 4NDNE 2EG9A 1F14A 4YEDA 2J3IA 2JD0A 5I7FA 2D8AA 3KYDB 2EGGA 2NVBA 1P1FA 3C1AA 5EPOA 3UAGA 4D46A 4NBVA 4DBZA 5A05A 2OHXA 4AG3A 4ZQFA 4LGVA 4WOJA 3HHPA 4MVJA 3ZN2A 2YDYA 1RM3A 2DAPA 2X0NA 3FWNA 3NTRA 3V5NA 2Q4BA 4WECA
chains in the Genus database with same CATH superfamily
4EVSA 3FH0A 1XA4A 2ZPTX 4C4AA 5CVTA 1AK1A 4GLLA 2X22A 2JAPA 1GGEA 5TF0A 5E3IA 4IF6A 1YFZA 2BGNA 4OHWA 2UYYA 1SXJA 4H4CA 5T5QA 3S2EA 4XWKA 4M87A 4G24A 4OJMX 5EQDA 5IABA 1G38A 4GBJA 4LZNA 2LIVA 3AKCA 1SVNA 2I34A 1GQRA 1JDSA 1IEQA 1M2WA 1GEGA 3GT0A 5CHEA 4J6FA 1WEKA 4N41A 3RT1A 1SKUA 2Y0EA 5B1YA 4IDHA 5FPTA 1MAAA 2JFWA 2AC4A 1T8WA 3G59A 3QH4A 1MAVA 1K9VF 3M34A 1UXOA 5D86A 5JSZA 1F1BA 2P9GA 4U3JB 1A4XA 3V6MA 4NU6A 2IFTA 3P2KA 4AG6A 4IKOA 1JILA 2VJMA 4AJ1A 2I2AA 2VHCA 4HPWA 2EC5A 1V16B 2WUDA 4TTSA 4ZCRA 2C57A 4LF4B 1CCWA 1IPEA 3LT4A 3VAZA 4INOA 3ILYA 1POWA 3VR5H 5KNBA 3CRNA 1W0JA 1AKNA 4R9RA 4D79A 3F1KA 2H4FA 3ICWA 2WYWA 5IT4A 2ZWOA 3HY3A 3TMYA 4DMCA 5U4QA 1DAKA 2KHZA 1PVVA 5IULC 1FBTA 3ER6A 1F2VA 1QRRA 3C97A 5JY6A 3SHVA 1U4OA 5HIAA 2JAWA 1KO4A 3ILXA 2VEDA 4ARIA 3HJFA 2QVLA 1B8NA 1MX5A 1G1MA 3BB4A 3R24A 2RJ3A 4EG6A 1QTIA 1OPRA 3BMQA 2D6FA 1SUIA 5THKA 3I9OA 5DKFA 3ZHQA 3NI2A 4RMIA 4KPEC 4DR5B 3SS8A 1Z08A 3GUUA 2AFHE 4RD2A 3SYMA 1U8ZA 4M0PA 4EUFA 3RTAA 4GL2A 4DV2B 2BEWA 3TQTA 3AQ4A 3F6SA 3KB1A 2YJGA 4TN5A 1NP3A 1KA9H 3BFXA 4OHKA 3AZPA 1R0WA 3WNDA 4UM9B 1QC5A 2B92A 3LAWA 5CTAA 2HSZA 1RQLA 2GRAA 1A1SA 4R69A 4PO1A 3V3TA 5BQ5A 1DOHA 4OHZA 3PPYA 4OPMA 3CZMA 3L7YA 3L7KA 4A5SA 3DBHA 5BWBA 1F9EA 1VL6A 1H6AA 3MGAA 3QELB 2QTTA 2AZXA 2FW1A 2Q9UA 5TMDA 3KYDA 3W0LB 1H22A 1P31A 1J8MF 3D2LA 4DDTA 3D6VA 3MD9A 5BSVA 2GK7A 3VUEA 4PLVA 5HM8A 3CM0A 4UZSA 3W2FA 1DIGA 1I1QB 2X8JA 2X8AA 4OAQA 2HDWA 1SK8A 5A5VA 3EWSA 2ZT5A 1K0FA 4ZKDA 5FL3A 3KQUA 4B4VA 1COWA 1MLDA 2I4LA 1AOXA 3BCUA 2OSBA 4RVDA 5BO5A 3LPMA 1EWVA 1U2GA 2J1LA 4IFEA 5JO9A 4EY5A 1Z75A 3RASA 4OUDB 2X9GA 3VR2A 5JBNA 1W88A 1LXCA 3BMOA 4JT8A 3BKXA 1H66A 1BVHA 2WTXA 1Q1AA 3B7WA 2QRHA 2UZ1B 3W77A 3ZY5A 4D25A 3L0PA 3WG9A 2EP7A 3NR2A 3BGSA 1R5BA 3GJRA 3L49A 2W58A 1Q92A 2YBDA 4MMZB 4WY8A 4ND5A 2VDWB 1ETUA 2DPHA 5K3AA 4Y1RA 5D3KA 1V0JA 3K6SB 1DKPA 5ELXA 2W83A 1XCLA 4BRSA 4QTUB 1M7BA 4BN0A 5AXDA 1CQJA 2F1OA 3D43A 3BFKA 3OE7A 4MR9B 4OHBA 1M8FA 3DEJA 3GN1A 5EE3A 1TCUA 3KJEA 1G18A 3AY3A 3HBFA 4FLMA 3VO9A 5EHXA 3SZ3A 1PZNA 3PNVA 3RTEA 1VLMA 1FUEA 1LTQA 3I64A 3KKEA 4CQMA 3NMUF 4DCCA 1R0XA 4E32A 4WNAA 3NV9A 3KBOA 121PA 1NBWB 3OZEA 4C4RA 1C0KA 3RM3A 5JALA 4WW0A 3HKBB 1E1CB 1L7AA 4DY4A 3U7HB 3SFVA 3VNBA 1LDMA 4I8IA 4DS3A 1X38A 5DEIA 5EG5A 2IYXA 4KO2S 1YZNA 5HQTA 1G8MA 3PXBA 2XJ4A 1OAAA 2J5RA 4ZCSA 3K32A 4RSMA 1XU7A 5IFLA 3LC0A 1BA3A 8ABPA 5FTKA 1OAOA 2DBRA 1CJMA 2C0PA 3B7GA 3H9QA 2PXXA 3LXRA 3M1AA 3MCZA 5FTJA 4L73A 2K7FA 3K8YA 1O94A 4TT8A 1ZESA 4O29A 1MQ8B 1TYDE 2J3EA 5K8JB 4RQTA 4PTZA 5JAQA 1CE8B 3HB0A 1L3BA 1ODKA 1VBFA 2C2YA 2JB9A 3NTOA 4QBKA 3NOVA 2H4YA 5B5SA 4LA4A 4LGYA 1K75A 1LPSA 1EXVA 2VH2A 3B5EA 3AYZB 2AN3A 4PX3A 3O5AA 4TVOA 5KYXB 2BTEA 3QXHA 1YNSA 3RAFC 1DBWA 3BHNA 3FHCB 2O7RA 8LDHA 5I4KA 2BEVA 2FFJA 3QRWA 4GYYA 3UJNA 1I9GA 3VRHA 3HVUA 3NDPA 2BHNA 1ZJZA 2VUHB 1E92A 3N7AA 3DZCA 1AKWA 5FUYA 2IYVA 3W04A 2XOEA 3D31A 3FYUB 3P4UA 2HIGA 2O5VA 1PGQA 3KYCA 1UXKA 4AS2A 4B85A 4V02A 1X7WA 2BM8A 3O4FA 1ZGCA 2CYCA 2Z8YA 5AJZA 4WIAA 1KYQA 3JWHA 4PZPA 2FJ0A 1MVOA 3WYAA 4J49A 1ZN8A 1XAJA 4P4LA 1U8EA 4F3CA 1WUHS 3CX6A 4KL8S 5J4YA 4DV3B 2LW7A 3QUCA 3MVEA 4F46A 2O8NA 4RKWA 1Y8QB 1LZLA 1NV9A 1FP4B 1ULAA 2A9FA 2HMTA 2YWEA 3D81A 4GGOA 4JNCA 3QE2A 2CJPA 3L5KA 2MMGA 2IP4A 4RNCA 4Z8YA 2FZLA 1JAZA 2VK4A 2WMYA 2XA1A 3DZ8A 1I3CA 1RWWA 3JVDA 4RFSA 3F8SA 1QJCA 1VHJA 2ZT7A 1XD2B 4YQYA 2CHFA 1GAEO 5CCBA 3U1TA 1JB9A 2I3GA 1Y4ZA 2W8BA 4CGYA 1VJ5A 4K5QA 5CXUA 2C82A 1C9DB 2XYRA 1Q0RA 2ZVDA 2R00C 3JWPA 3N2KB 3PVCA 3QA3E 4CT0A 5B6JA 4X62B 1O5IA 2O54A 2DTDA 3UAYA 2E87A 3IUPA 3P7MA 3OQBA 4A2PA 2PJZA 4BNDA 2PJRA 1PFGA 3IESA 3NRBA 1KR2A 2AMLA 5KOJA 5AJWA 5AR1A 4B6GA 2DU8A 1UJCA 4PYMA 2QU7A 2ZQYA 3Q9SA 1KPHA 4R0NA 3PHLA 2Q3FA 4FNMA 4Z9AA 5EMHA 1YS2X 2AUMA 5B2EA 2GN9A 3HUTA 3CLTD 5IBPA 3C5HA 3C5VA 3CW2A 3K5PA 5MDHA 4JC4A 1DXOA 3KZMA 2VK2A 3OHMA 13PKA 2HXYA 3JQAA 4INZA 2P0EA 2POQX 3CX3A 5DBFA 3SIWA 5B53A 1W85B 4B3DA 3TWOA 5AMXA 2BBSA 4ZQHA 3QENA 4E5VA 2QVBA 3WV5A 1U7HA 4GMHA 1HZZA 4U9UA 4XOIA 1RI2A 3R8FA 2WHPA 3F78A 1HDZA 1V8ZA 1NT2A 3UATA 1RC8A 2IWRA 1UBSB 1TZBA 4G0QA 4M53A 4BDSA 4D0GA 3MMNA 2VYNA 1ZSNA 2XB6A 4N7MA 5FUXA 3MOIA 2H1CA 2IEDA 1Z56C 4ZJUA 4CM5A 1IWBB 3IH5A 3MINB 9MHTA 2IYAA 3RWMB 1JPUA 5SZKB 3W4KA 5I4CA 4FHEA 3H9CA 3OH8A 4UFNA 5NLLA 5HVNA 1WXIA 4FOSA 2GGSA 1FDOA 1NXXA 5DPMA 4H4EA 4M1QA 4D9GA 1AF7A 2WHYA 3PG5A 1TUEA 1SU8A 4YCJA 4JBXA 1OHHD 1PHRA 3PQ5A 2JPDA 3K8QA 1NKSA 2CWWA 4JJ8A 4O2AA 5J5VA 1CP2A 3QUSA 3U26A 1M5RA 3LQ4A 1YE3A 1R4NA 1US8B 1H8HD 1A88A 3TLGA 3WRYA 2IPLA 2JCSA 3R0QA 3TRIA 2I2WA 1NW5A 3PXXA 1WIWA 1XZDA 5BW5A 2CXRA 4MGEA 1OTHA 5DRYA 4R8MA 5EUCA 2YZMA 4PHTA 3ESBA 1KMHB 4E1VA 4KSCA 4YV2A 1V3TA 1QAOA 1OA1A 1P9RA 2A3RA 4XR9A 3AUUA 4FCTA 2H16A 4YDQA 3GBVA 2CKDA 2NUTA 1XE3A 1ENZA 4WPGA 2RG1A 1UXJA 3EHEA 3ZIAD 4ARBA 2HO4A 3PBKA 4XWOA 3TLYA 4NJEB 3SQDA 5CDFA 3PJRA 5D8DA 4JKOA 3K5WA 1G5PA 3OQOA 3HB7A 2WF9A 4EPWA 4Z2AA 4GMFA 3OWOA 3GLFE 5CIYA 2A86A 1Q0TA 2ZUTA 5JOQA 4QOEA 1KK1A 1PGOA 3SX0A 4BO0A 5ENVA 3RRNA 3DBRA 4KQFA 1X7ZA 4C2TA 3AZOA 4HXGA 2PANA 4LVCA 4L95C 4XJXA 4BVEA 4UTVA 2ZROA 1U7WA 2Q46A 2BELA 3BMCA 1UFRA 3GJ3A 2B98A 4FZJA 4E5MA 2O8CA 3PR3A 4W1SA 1IZ0A 4YCBA 3UK2A 5IKEA 4WECA 1HWYA 3CRQA 3IT2A 4INAA 4MKRA 5KCZA 3LBAA 3O82A 5E6SB 2K7ZA 1GO2A 1A82A 4KYVA 3KXKA 1NX6A 3GMTA 2WB4A 3L7JA 3SBEA 2HB6A 3B6KA 2A92A 1BCRA 1Y3IA 1DT5A 2C84A 2DECA 2P2ZA 4NP6A 4R6WA 2ONYA 4KR9A 1FTYA 2CNBA 3EVCA 3KJFA 1AUOA 3KSDO 4OIFA 3RC2A 4YHHB 5MHTA 1YK0A 3WBFA 4G1BA 3FOWA 1B42A 3S28A 5K2MA 3RHTA 1DWQA 4MVCA 3WLLA 1DBRA 1PLLA 3HI6A 1CRLA 4ZI3A 4W7IA 3U0VA 1AQNA 3HO1A 4B79A 3N8DA 4ZU6X 3U3OA 1WZIA 4AX8A 1RYDA 1E2LA 621PA 1UBMS 1REQB 4NABA 5CH3A 1MFPA 4YI5A 3VKGA 1TC2A 3OTWA 3OAAA 3PYMA 3ZH2A 3IA2A 2GF2A 1IHDA 2VWPA 4ZVPA 3HEMA 1JDTA 4XXHA 1CZKA 2WSYB 3DC7A 3NHJA 2WNHA 1Z36A 3G8CA 4M76B 4BJ3A 4QQRA 3ZCQA 3OMWA 4HC4A 4UJ5A 5AW6A 1DP4A 4MUEA 1QVAA 4BGDA 4TRRA 4DNQA 1J0EA 3AJEA 2C77A 2HCJB 1TKRA 4S24A 3SX4A 3RYCA 3DXZA 3OEED 3ZWQA 2JGLA 4BX9A 3QV1A 3OT5A 4KITB 5CU7A 3TLZA 1D8TA 5C3UA 5FO0A 2Q8NA 3K0CC 3CUKA 4L02A 4OXXA 3N1UA 2IXBA 4B75A 1X13A 2EX1A 3BB1A 3PQ8A 1HH4A 1Q12A 2EIXA 4K2HA 3E82A 4Q82A 2JHGA 3EQ7A 1DMRA 4FTWA 1ZK0A 3MSCA 3R3UA 3UV7A 4Q9IA 5CBPB 2EKDA 2K6GA 2XY4A 3ITNA 3HCCA 4QPDA 2J31A 4P1ZA 1ZK4A 3IIJA 3V1TC 3CR8A 3GDFA 3M9LA 4L5IA 4F3NA 5AESA 3UB3A 5DX0A 4L0QA 4F92B 3T9CA 1UPCA 2BGIA 3GFVA 3VH3A 4DWJA 4EI8A 5K99A 4N8SA 2JAQA 5AK4A 1E5TA 3TSWA 3WOVA 2PUGA 1LBSA 4M1EA 3N76A 4O02B 3W6UA 1TZKA 3MRSA 3DFIA 2Q1UA 4LC0A 2WWFA 4UM8B 3PUIA 1EQ2A 1GPBA 3IX7A 1N92A 5E3HA 3A2KA 4NXNB 3ND8A 4FNGA 5BXYA 3RSFA 2R86A 2O2ZA 2ZRQA 4PLHA 1NXVA 4AS1A 2XV1A 2Y1OA 3FWKA 2CXHA 3ZZUA 4BDTA 4FHGA 4BMYA 5CA1B 2CLEB 2VCEA 5DVZA 4REOA 5FUBA 4GDFA 5D85A 3M8KA 4JP5A 4XYLA 1C30B 1PJ8A 1VCNA 3IUBA 3HC7A 1M34A 1C0EA 4RY8A 4B0PA 2ECQA 1E3EA 1QDLB 1J1IA 2EFEB 3DDZX 3TIIA 1GPMA 3QYJA 1TXGA 4MWBA 3VU3A 2IYZA 2Z4TA 1YI1A 1EVQA 3TEMA 4E3ZA 2IV7A 3BILA 3FRHA 4LE2A 1JMKC 3AY7A 3ZDFA 5A5FA 1IMJA 1IM2A 1X80A 1IY0A 1JXQA 2ZIVB 2QE6A 1AU9A 1BVUA 3TRDA 3WHIA 4D3FA 3H99A 1AS3A 2OK7A 2SCUA 1IXYA 1RXUA 3WSWA 4IINA 2I78A 2WTNA 1AV7A 4GUDA 1KEZA 3KZ1E 3QVWA 3WMWA 4CG0A 4I5IA 3IIEA 1P2GA 3UWMA 4CMBA 4DUPA 2JLXA 1QFJA 2OXFA 3I9NA 4LBWA 3SY8A 1J07A 4MS1A 1MZPA 4IGAA 4J1TA 2RGBA 4I19A 1V37A 4KXMA 2ZZKA 1YZVA 4QE3A 2D0PB 2JRLA 2E4WA 3GJ4A 4N5DA 4MYDA 4DDWA 1YZTA 2PKWA 1CLUA 4DG9A 1K5HA 1FRQA 1L8OA 2I4TA 4I9FA 1DUSA 3AF5A 1HF3A 1ZEMA 2X3YA 2VN8A 2W6IA 2A3NA 1QVVA 3I8XA 4CHTA 4NVRA 3UAOA 3X43A 3RT9A 1IM8A 1KY3A 2I99A 2KB0A 1WLYA 1G59A 1IHPA 1M54A 5KOYA 4DARA 1R00A 3LVQE 4KEAA 4QFMA 4QYSA 2J7PD 4H7EA 1A72A 3DV9A 4IFIA 3NEPX 3GT3A 2FPKA 4NAUA 1K4KA 3IO3A 4G36A 4J0JA 2HPHA 4JSYA 2D1TA 2FDXA 5LM3A 2IZ7A 3QPWA 4UMEA 4IIEA 2AMVA 1F6WA 1WUIS 3Q2KA 1PG0A 1PJLA 1PK7A 1EFTA 1BWQA 1RRGA 2G36A 2BGRA 2R4QA 3IT3A 3R9KA 5HBGA 4Z49A 4LYFA 3F8TA 3MJVA 3TQFA 1EK2A 3CJQA 4JGIA 1YL5A 2TMGA 521PA 4BBZA 2Y27A 2X2PA 1SQGA 4U00A 4DHEA 4KREA 4RSHA 3T3IA 1H4VB 3BWCA 3NBQA 1IJBA 1K4MA 3PC4A 5L9AA 1ZH4A 2AVNA 2A0FA 3X2FA 1E1QA 1EM8B 2KQUA 3PITA 5COBA 3KL2A 1TIKA 5H7XA 4L7QA 4L8GA 1IG0A 4URFA 4OFZA 1WDMA 3HB1A 4JLKA 3JASA 4KQ1A 2GD0A 1V1MB 2ID8A 3ND9A 5KQGA 3HPQA 3R23A 2BONA 4I5DA 2QTMA 4YAEA 4OI1A 3NIDB 5FWXB 2VTKA 3D1LA 5EJEA 3DQZA 3ESCA 5AXCA 3W90A 2YV2A 4ODIA 5JXIA 1L6RA 3KJQA 1JLKA 4IHKA 2QQ0A 3TSYA 1AQLA 3KIPA 1XZKA 1T9DA 1PBNA 1VP3A 3LPNA 5GMOA 3EXHC 2WMNB 4REQA 2HIHA 1H8EA 1TVKB 3EXFB 4HJXA 4AY3A 3UQYS 2A5JA 3B3QA 1P7YA 3QOFA 4HH4A 2I4OA 2VTDA 1EX7A 3FE2A 5H81A 4CF5A 5DSTA 1RYFA 3O38A 4LYAA 3H18A 3LRXA 3T0IA 3OX4A 3U62A 1P9OA 3BE8A 1UCFA 4RLSA 4UVIA 3VR0A 2O5EA 4K6GA 1KQOA 1MR3F 1G6Q1 2VHQA 1LLDA 1K66A 1Z2NX 1S8OA 1ECPA 4UUOA 4EUKA 1ICIA 2V5VA 4A6EA 2FMKA 4AY4A 2ENUA 3OLYA 2F2TA 3ZJ5A 1E3WA 2DFDA 4HGNA 5BVGB 1ZM2A 1U11A 4I8XA 4O4IA 5DSXA 5ADHA 3NVKI 5ESRA 3SLKA 1N2GA 1E7RA 4QPPA 2GN8A 4II2A 1B26A 2FW8A 4JY7A 2CLMB 3ZHXA 4PWZA 4MKFA 4EECA 3T15A 2JIMA 3GYBA 1GOTA 3KPJA 3WIBA 1CR0A 5BQFA 1PFYA 4KX3A 4OFXA 1QGOA 3EY9A 4Y0NA 4OSEA 4D9NA 1Y3BE 4LBZA 1L4BA 3ZIUA 5IFKA 2BF4A 1R66A 2FK8A 3EGWA 3P4YA 4M8SA 4RCVA 1M2VA 3GU3A 4YDSA 1P29A 1II0A 4BBJA 3P9YA 4Y6LA 2C9MA 2FMHA 2QQGA 2YVUA 4IGIA 5K01A 1AKEA 4A27A 5CFRA 4FQ7A 1Z28A 4NBWA 3EQ2A 1H2EA 2FG5A 4RW0A 4J0DA 4HNTA 4ZTUB 1RFGE 3RVOA 1J8FA 4S0XA 2RGCA 4CMEA 4HDNA 1OC2A 3D0KA 1E62A 1UFOA 3MMXA 4MQEA 3K0EA 3O9VA 4ID3A 3KV3O 1X7YA 4X1KB 4EY4A 5J58A 1A5AB 3RWBA 4HRVA 1YIAA 3JPYA 3I1IA 5TVGA 1CZLA 3BK7A 4XYGA 2SBTA 1NBEA 1EI9A 4CJXA 3VX3A 5HKAA 1CUGA 3GLIA 4G26A 1Z82A 1ESMA 5B6PA 1ZD3A 3OJXA 2GBGA 1XA3A 2Q2VA 3DVSX 1KI3A 4IHQA 1NQWA 5F2OA 2VDJA 4QLAA 4E5UA 2B61A 3UHFA 2Q6LA 4L5AA 3LLUA 4RGVA 4HVCA 2JLCA 5AOBA 1Z2EA 4TRNA 4MH0R 3D7LA 2H57A 3JV7A 3QEMB 4GECA 5CTJA 2H48A 4LRTB 1QO7A 3TAHA 3AUFA 5C35A 1RQGA 1EZ4A 5E6UA 3RI3A 1JHRA 2IUTA 3C2QA 1NW9B 3D0QA 3IHWA 3PD1A 4XGRA 3DE6X 2N47A 1M1NA 3BIXA 5KJ6A 4I55A 4GX1A 4IH4A 4R1MA 4ROTA 1JJAA 1BS1A 1FNBA 2X6TA 4JGBA 3CVUA 1VKHA 4I3FA 1P7PA 4LF8B 5CLHA 4D82A 4X94A 3AUTA 3VSBA 1WPQA 1YHNA 4DLTA 5GIPE 2VNSA 1BEUB 4OYLA 3QNMA 2EERA 1LD3A 2R751 2UYOA 4R8RA 4TKMA 2E5FA 3Q9NA 3DQPA 2XDQB 1R3DA 3DKRA 4P82A 1KJ9A 4TXHA 4AO8A 4FGWA 4ARSA 1KEWA 4KE9A 1H2BA 1CF9A 2NSDA 1E18A 4FI3F 1VKJA 3SZUA 1OLUA 2B69A 4Y3UA 1AGPA 5IT5A 4Z7OB 4G81A 4AI6A 1NQAO 2PV7A 1HR0B 1N7IA 2YINC 3GBSA 1B00A 1N0IA 2O23A 4JJGA 4LHSA 1YB5A 1SMKA 4TS1A 5HMLA 3SZGA 2FUKA 3TJZA 3UK0A 4J2TA 4F85A 1RZUA 4EB3A 2GT1A 3U7EB 1Y3CE 1ZONA 3V7YA 2C5LA 2O8FB 2K2WA 2CNLA 1L7VC 2I2CA 2LNDA 3RIMA 4XZ3A 3R3VA 4ZYTA 3CNLA 4I2NA 4P3KA 5BV0A 3G1UA 1GKKA 2PZMA 1C7QA 3ONEA 4E08A 4EYOA 1OXKB 3BGOS 5DSZA 3U2QA 1NVMB 4N9WA 4PU0A 5LCXA 4LPSA 4XM2A 4CLHA 2YICA 4EHHA 1CYDA 4IVQA 2AFVA 4CQJA 4BMDA 3I6YA 1HK7A 4GVLA 2VPPA 3FB1A 1ZKDA 2M6RA 3NC1C 1OI2A 5L3ZA 3I6BA 1LS1A 2B1GA 2IPAB 3ZXSA 5JO0A 1WP4A 1Q74A 3N7TA 3GELA 1G3UA 1YOVA 2J6BA 4Q9DA 2QSYA 3W3ZB 1CUBA 1GQYA 3M1LA 2CBZA 4G0VA 2IW3A 1JU4A 3DVRX 3PQ3A 3K15A 2WYIA 1UMCB 2CLCX 2CF5A 2QM0A 1JEDA 3IURA 3EH2A 5TEWA 4YWHA 1MZVA 3FPLA 4QA9A 4RACA 3SHQA 2KYRA 2NLOA 3GT4A 4NC9A 1GTL1 3RU9A 4EL5A 2VZ8A 1QX3A 4ON9A 1WUTA 1QJ4A 4PE5B 3ENQA 5K20A 3HKEA 4PFSA 1W30A 1HE8B 5IX8A 2J32A 2QE7D 5FL7A 2GERA 4JIGA 4WOPA 5KMGB 1TE2A 2I8AA 2IEZA 2PWZA 5IAKA 2GBIA 4A0FA 3PXEA 4MA4A 2OV4A 4J07A 5K8LA 2WTMA 4MW5A 3KWJA 4YLGA 3VC1A 2HHHB 4GPAA 3SYRA 3NEJA 1IY9A 1SWWA 2AF3C 2FR8A 2R48A 2D59A 2IP1A 2PMKA 2ZIZA 4FX2A 3NGXA 4O4IF 4A8JC 1NR1A 4FJ2A 5DW3A 4EHNA 4LHVA 1RI5A 1DJQA 1FRZA 1E9SA 1K3TA 1DHRA 2I55A 4KXWA 5CYGA 1VZ3A 1XALA 2DCUA 3ENNA 3LCUA 4OJNA 5EIHA 2D0DA 3SF0A 4ZAGA 2AR0A 2RHGB 3BHMA 3IR6A 2A0UA 4YA6A 3LK6A 2B37A 3WJ1A 1LI7A 4OHXA 2RH9B 1RWOA 4C05A 2CY0A 3H16A 4DLSA 2NACA 1IIBA 2XNHA 4R1UA 3IT1A 4RXTA 1WHTB 2VT7A 4TVBA 3KOXA 2AJTA 1T3ZA 5EZ6B 5I45A 4BAGA 2QZZA 1XWWA 2D2FA 5T57A 1BVRA 4QBHA 3PJEA 3WLKX 2JCXA 1WQ1R 4ZT4A 4KC0A 1AUQA 4YYZA 2BH2A 1LNSA 4QU5A 1JJVA 1X8XA 3BHJA 4LVNA 1ZL0A 2CE7A 3I2HA 3RS8A 2JFUA 2WJJA 3F3KA 2Z08A 2HBZA 3ONVA 2ZUCA 3QFFA 5KYYB 5EXTA 5CR9A 4D45A 4Z6KA 4FDUA 1HT2E 4QUAA 4WBSA 4KSBA 5DOVA 2VP3A 3DG9A 3WZMA 5I8WA 1PGJA 3GP5A 3D6TB 3NB0A 3EGDA 3QMWA 4D98A 4IVRA 1ZRNA 2SNIE 1JHDA 3FIUA 4W6ZA 3DXYA 3R44A 3RV3A 4EY3A 1WAMA 3OQJA 4ZVRA 2WJVA 1RPNA 3O4GA 3PIIA 2JZNA 2CDCA 2VTVA 1KU6A 3NH9A 4TL7A 2QD3A 1H2RS 1OKKD 1W9HA 2XVAA 2ZVPX 4D8UA 5L3VA 2P3LA 1CUSA 2YJ4A 2Z98A 5AK6A 2YCBA 1CUAA 3ODPA 3Q7TA 4PRLA 5JE8A 1ZWKA 5M3BA 3TI7A 2IOYA 3BZBA 1OX4B 3GZJA 3TOZA 3OZUA 3QFSA 1N3IA 2ZREA 3HABA 2G67A 4I55F 1XZQA 3LH5A 3UJHA 3JS5A 1EBUA 3SC3A 1SJ9A 3ANMA 4E2FA 5JC8A 1IXRC 2QTVA 1WQ3A 2OD2A 2XE8A 1TJ4A 4QDTA 4NARA 4QYIB 2BAGA 3BC1A 3R40A 3SC2A 4QBIA 3ROQA 4BMZA 5DX1A 1NXQA 3DL2A 3GMSA 1D2EA 2IZZA 4E70A 3DR5A 1T0JB 3L41A 3OM9A 4RLQA 4BVHA 3STVA 5BN5A 4IUYA 2O8DB 2B30A 2V7VA 1DTWA 2ZE5A 1QGUB 3L0OA 1FXUA 5FNVB 4JEIA 4IKEA 5SZIA 1ELOA 3QEOA 1WE2A 3PNSA 4PQRA 2OVFA 1FFWA 3NW9A 4DADA 1W49A 1UXHA 2WFZA 1XF9A 2GPSA 3R6TA 4M37A 2WM3A 5HEKA 2F8LA 1N7HA 2VAVA 2QORA 2W42A 5L7YA 2VWQA 2OZLB 3I58A 5EWLB 5KI6A 2ZUVA 1IG3A 3TLKA 5AHKA 5TY0A 3SU8A 3EXG2 3DEAA 2GXSA 1SR8A 1SKMA 4FP9A 1ZN2A 3JYNA 2WF6A 3G0CA 2J6CA 3JZAA 3QTBA 4Q3OA 2WFAA 3NTLA 4YPFA 3D8TA 3JYQA 4MW6A 3R9XA 2JH8A 2REXB 3DWGA 1W76A 4FLEA 2V6GA 4I9UA 2RHJA 1RVDA 4X6XA 1OB2A 1BMTA 3JATA 5THXA 3R7NA 3X1KA 4OB6A 2A35A 2R7MA 2ZANA 4FEAA 4M1TA 4ZJZA 2YY7A 1AMOA 5BR1A 1ZJ5A 4HDKB 1MJHA 3GA7A 2IDMA 4JX8A 2W98A 5G41A 1SEPA 2OMEA 4U7WA 3VTFA 4RWEA 2XIJA 3GD5A 3WK5A 5AM5A 5DM60 4BECA 4EPRA 1G8FA 2HFJA 1UFVA 4Y2VA 3S8YA 1OYOA 3CISA 1F8XA 1FFXA 3CWQA 5J40A 2QAGB 4LDNA 4OQMA 1T3SA 2IZ5A 2X40A 4XCXA 1ISGA 4PNZA 4QIHA 1NE7A 3ZNNA 1LC3A 4WKCA 3TNDA 4ARZA 1MG0A 3Q3JB 3DUFB 3L7AA 1V6SA 3LLCA 5F4BA 2QRVA 1YS7A 4AUEA 3FA2A 4JCOA 4CLDA 2PGOA 2MYNA 4JA0A 1B73A 4TTTS 4WZBE 3I2YX 3W06A 4C01A 1ZQ1A 3HVIA 2X9VA 5H8WA 3FKQA 2Q07A 3ZWXA 4FHDA 3M7IA 2A4MA 3Q6IA 3D8HA 3IVXA 3THXB 2X76A 1E2UA 3Q7IA 4CMHA 2V8BA 4FHZA 4FZRA 4NV1A 3IAS6 3RBAA 5AUOB 4Z86A 4YRAA 4YCNA 4PHGA 5K0BA 4LX0A 5J43A 1N7JA 1SCBA 3SYKA 1YRWA 2E82A 2FR1A 2HSEA 5EI5A 4BNXA 1RQRA 2E5WA 1L7DA 3STHA 2YKGA 3VJRA 5B64A 2WHXA 3E22B 3A31A 4DIMA 2I62A 4P5PA 5FOVA 1E2JA 5G02A 2QKYA 4YYEA 4D4GA 2GZ2A 1M3SA 3GVCA 3EVZA 4G84A 2BCGY 2D3TA 5CGZA 4DFDA 4KXVA 4EFMA 2B34A 2H4XA 2QN6A 3H5NA 5FP0A 3KFLA 3PDWA 3LPLA 4U7FA 4AROA 4H35A 1D1PA 1XEFA 8AT1A 3ZVMA 4KQKA 1U8FO 4HZUB 3WKBA 3DZIA 1Z33A 2QM8A 3TXAA 2DR2A 1CW2B 1VKNA 5JADA 4DEYA 1NNEA 2Q2QA 4E2YA 4EMUA 4ZK2A 1AB5A 5FFMA 5H9WA 4W8OA 1E89A 2GH1A 2WDZA 2YJ3A 4KFRA 3MJHA 3HCWA 4GPEA 4WKNA 4YJ3F 5I7SA 2Z2IA 3P0FA 3DNFA 4QG7A 1YCFA 2ZETA 3KOYA 3OZCA 1SZJG 2RFLA 3CSDA 4W7SA 3AF1A 3UPDA 3BE6A 5KVSA 4QHTA 1QYWA 1T4MA 3WK4A 4F91B 3L92A 2YOGA 3JR3A 4IIHA 3WTBA 4RIFA 3DXXA 1PJAA 1NKVA 3VDXA 3RTGA 4QGHA 2OQRA 4FS8A 5A9RA 2EEPA 1SC9A 2ZWAA 2E18A 3NO4A 3R0VA 1GTZA 3EMDA 4G8CA 4R98A 2BOVA 2GVDC 2O7VA 4HI0E 3ETCA 2BBWA 2GUWA 5FYQA 1BFKA 4EA9A 3ITKA 2CXNA 4H7KA 3C7CB 4AJPA 3PX7A 4MI1A 3GEHA 2Q5LA 3T7KA 2FG6C 4GH5A 1WCIA 1G9XA 2A1UB 5G3YA 2YUIA 2XZOA 3MT9A 1ZUWA 2ES4A 1VLJA 1TEXA 3K8ZA 4RAOA 3PJDA 3LGXA 5GINE 5MN5A 3PZRA 2NT3A 4NBNA 1OZFA 5ALZA 4ENQA 1JLLA 2ZM5A 1ZAYA 2RC6A 5K0JA 1NYTA 4G0XA 3AZQA 1FTGA 1M2GA 4Y6OA 3NDRA 3AF3A 3PC8C 4QNNA 4QOHA 2ZDQA 3URMA 5KTRA 1YBHA 4JI2B 4PY2A 3UXEA 1NVVR 1PNVA 1KO1A 2EX0A 3OQPA 4CWAA 4GE0A 4O4HF 3Q2OA 2NUAB 4NULA 1AGRA 4ABYA 4UATA 5C32A 4WCDA 3B1KA 3KAKA 1UC9A 2QM3A 2X5XA 1LBEA 3Q5DA 3ZC3A 2FHSA 4G5QA 2QGFA 3KQWA 2IYLD 4QPNA 5BWLA 2EFHB 5H0IA 5KTMA 1FDTA 1HDEA 3ZV7A 4JIMA 4WFKA 4UVGA 3ZVRA 4OGGA 5T8KC 2VTBA 1GFSA 1QP8A 4NQRA 1T2CA 4QG3A 3EVEA 4UREA 3FYSA 5LKRA 1W44A 3UICA 2OAEA 2QENA 4J4HA 5ALFA 5B1DA 5MN4A 4KV7A 2AW3A 4MR8B 2ZSFA 3W2IA 4WLEA 1YQGA 1XN1A 1NXTA 1PJZA 3R5HA 2OM6A 1L5YA 1DCKA 4K6FA 2Q1SA 3A1WA 2VQEB 2NU8B 1OXXK 2ACVA 3OFKA 2FETA 3NBAA 2IBTA 1FA9A 3M82A 4YCLA 3ZU3A 2OCLA 2G3YA 3F6YA 2PCLA 2PZLA 1QS0B 2A30A 3MWEB 5E1DA 5BRNA 4ZZ3A 1KHHA 2XIQA 2HNKA 4ZANA 4DSTA 3A0RB 1BYUA 1KDZA 3AGPA 1OI7A 4CV3A 5F9HA 2ACEA 1AHPA 3RVKA 1TLTA 3C41J 1MABB 2C00A 5REQA 1JE1A 4FKZA 5EZYB 2DWPA 1KZ1A 4GZMA 3JD1A 1Y34E 1W4CA 4TZKA 4AWAA 2D1RA 3AETA 1N5OX 4DMHA 4H3KB 4UXIA 3SK0A 3HO8A 3TSCA 3EZGA 1L7MA 2HNBA 1A9YA 3LT0A 3WIVA 6GPBA 1Z4LA 5IU6A 2QRMA 1QIEA 3LDUA 1D6SA 1BRTA 1A8QA 5T4BA 4E30A 1U5BB 3IAHA 3HKDA 3A3NA 1PIWA 2XTNA 3UT6A 2J08A 3PK0A 1L8QA 2KE5A 4HH0A 3UMVA 3UJ8A 1NW3A 3QBEA 1NJ5A 4ALMA 1D5WA 3QKRA 4RKYA 5EMJA 5DBEX 3T4UA 2QUBA 4EJSC 2XGJA 1BH2A 1ZWLA 3G0OA 2OSVA 5DO9A 1ND6A 2Q21A 1LCIA 1I24A 1V7ZA 3AIMA 3PT5A 4LX8A 2BFBB 4RSGA 3ON5A 2VFAA 1SCQA 1T9GS 4OU4A 1VYHA 3RUFA 1PG5A 2D3WA 3EY4A 3KT0A 4MQBA 5AT1A 2DOKA 3VHXB 4BVFA 2PXAA 4B87A 1FQWA 2AI3A 3KT8A 2VYVA 4WMLA 5HFNA 4RCYA 1Q50A 3RSLA 4UM7A 2JJ2D 4JJ4A 3W05A 3WYDA 3CZRA 3NWBA 1T34A 1P75A 3IUMA 1Z5GA 3X1ZA 5ALQA 2ZRMA 2Y8EA 4DJJA 1JHMA 1FBNA 1QFMA 1XPOA 3BGVA 2AB0A 2OQIA 1CDDA 3DTVB 4J9VA 4P54A 4UU8A 5B36A 5H4GA 1M1XB 2B25A 3MS4A 3ABSB 2HPAA 5JVDB 1TYAE 1SUSA 1TRKA 3HRIA 4YJGB 4DILA 1SD2A 4K9LA 1N6PA 1F5SA 4MJ3A 5HM6A 3C6KA 1KKUA 2BR4A 2D5CA 3BWVA 1N5JA 1OHHA 4EY6A 5EQJB 1P72A 1R8JA 1VSQA 2BKEA 3OOSA 2FXIA 3KQTA 3SDZA 4YAKA 1RLIA 1F0PA 3V8PA 4HNHA 4AXXA 4P0PB 1POXA 4JJ6A 1CEYA 5E38A 3BGWA 1FYVA 3H5TA 3BVPA 5DHSA 2GEJA 3JZDA 2P8JA 2BM1A 2V8OA 3GGOA 2EBFX 3CKYA 4MYRA 4N1AA 5SYNA 5T6BA 4JUCA 1AV6A 3AX6A 1TQ8A 3JVVA 1AHNA 3NFYA 4XGKA 1W46A 5I7WA 4G4SO 1ATIA 2NZWA 3QBVA 5KDOA 3E5RA 1XNGA 5FLKA 4GDMA 1CQZA 4DG8A 5LJLA 1A9XA 4ACBA 3H87A 2AH5A 1P1CA 2VP9A 4IBOA 3CF4G 1QFSA 2I1LA 2ZBDA 2MOKA 1UJ5A 4HWTA 4YAIA 4B4OA 4DQXA 4BGVA 4F45A 4TVSA 1NSYA 3NU1A 3IPYA 5HJEA 1MX9A 4HAUA 3DVAB 4MS4B 5CX4A 1C3OB 5DIFA 3RUPA 3WQHA 2EJTA 4HMQA 4LNAA 3ZCSA 4MGZR 4NENB 1UKCA 2JVIA 2ODPA 2P77A 3CF4A 3QXSA 4MARA 2PX0A 3I4FA 4R6XA 3T9DA 3A2MA 3R3JA 2VBCA 3KQPA 3EGVA 2VDQB 4B44A 1LNQA 2XR1A 5T6MA 2LCQA 1T5TA 1NF9A 1P9NA 1WWKA 5L7WA 1ABEA 2ZBQA 1ZNYA 1S8FA 3OY2A 5FHRA 2XYQA 1JECA 4CKWB 5B4TA 1PQUA 1NF2A 2DLDA 4UOZA 3O3MB 2YIDA 3T61A 3SSAA 4RE6A 4L6IA 4QTXA 5HRCA 3NNNA 2QN3A 1JDBB 2WHEA 4BO9A 4EZIA 3V34A 5E6RA 2A7QA 2PKCA 2YWGA 2GHQA 3O74A 3VDMA 1GRVA 1LC0A 3H2HA 3OKFA 1Q1BA 1PQYA 2VDUE 4JOCA 5K1ZA 5A04A 3ZI0A 1KSGA 3WGGA 5KTPA 1RYMA 1W5AA 3ZBTA 4EB0A 1WBDA 2NADA 3HO6A 3GJ7A 2PLFA 3Q0TA 3ZGNA 1JG7A 4ZGBA 1QGDA 4LZWA 1ZXBA 4KGZA 4S1VA 1GVHA 4YRFA 3ENWA 3PUVA 1L8XA 1O96A 3RS3A 2A94A 2AYZA 5GGXA 1ZMTA 3DBVO 3DVQX 2P9QA 4P4SA 4BZQA 2Z6UA 1JU3A 1VL5A 1VI5A 2HMAA 4D3DA 1I94B 4MW9A 3KZKA 3UF0A 4ROSA 2H51A 3MQ4A 5ECYA 1DKUA 1M5TA 1VBMA 5AOVA 4AP6A 3U61B 1ZG3A 2WU4A 3FR8A 2DT8A 1E77A 2G82A 3GAFA 3AC0A 1LKZA 3ZU4A 1Z5UA 4EA8A 5I9LA 1T5DX 2V74B 2HLPA 5E0KB 4RTMA 4RIGA 2ZAOA 1UBLS 1S02A 1ESEA 2H1HA 3C45A 3KUDA 4GPIB 4EUHA 5IS2A 2O4CA 5U4XA 1VPDA 1RTKA 3L8FA 5K3SA 2G4VA 3AHFA 3L0CA 2H4HA 1CP3A 2BP7A 1O8CA 3OCYA 4QREA 3NGLA 4FX5A 4ZCTA 4PCVA 1DC4A 3UHOA 3IOEA 3IP7A 2FJUA 1V8FA 2OB2A 3NHKA 3RSOA 4DY6A 1Z4KA 5I3ZA 2EF1A 3SG0A 4M7OA 3FHJA 2BFPA 2I7XA 4KXUA 4LYJA 1JAYA 4E6PA 4XWWA 4DJFC 3W1WA 3WRXA 3K0AB 2VDKB 2XYVA 5EGSA 2J0QA 2EFDB 4B80A 2HWKA 3MIIA 1KZHA 3JQ6A 4BV9A 2V58A 3NHMA 3GZNA 4FMCF 1JSRA 4MPDA 3GARA 1PX0A 4OB8A 3NX4A 4LNUA 4YRLA 5CX1A 1SVLA