1I2ZA

E. coli enoyl reductase in complex with nad and brl-12654
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i2zA00
3RFTA 5GZ6A 5F1KA 2GGSA 1U8FO 4C4OA 4B7XA 1XR3A 2Q50A 4CL3A 2EKPA 3E8XA 1W0CA 1DO8A 3JYNA 4J7CA 1BXGA 1C0LA 4ALJA 4LRSB 2PD4A 2B5VA 3V1UA 5DF1A 5DCWA 2B35A 1ZMTA 5LC1A 3AM4A 2X9NA 1HSOA 3FNEA 1O94A 3PQEA 5DNAA 3AI2A 4RPLA 3LLSA 4IJKA 4BNWA 1R16A 2Y93A 5KVCA 3D3EA 3KEOA 3ON5A 4IXTA 4CMEC 3DHNA 1ADGA 1N9GA 3AUSA 3HB4X 4R1UA 2QX7A 2FRDA 2XOXA 3OQ6A 3WS7A 3EW7A 3OJLA 4OIMA 4J2OA 5T5QA 1VL0A 2W4QA 5KOIA 3NT2A 4N7RA 4YJHB 2W2KB 4J1SA 4HY3A 5G4LA 5HTOA 4E2ZA 2JD2A 2GN8A 4M86A 4G81A 1G0OA 1H0KA 5BNTA 1MP0A 1PGQA 3MJTA 2XXBA 1BHSA 4ZJUA 5TSDA 3W4JA 4RF5A 1JU9A 4YPOA 4R01A 2YHUA 4UUMA 4U6SA 2O3TA 1OFGA 1EVZA 3O9ZA 1PGOA 1Z6ZA 4DUPA 5COQA 4WK6A 4XX0A 1EVJA 4Q3BA 3GY0A 1W73A 4DIFA 2J5QA 1KVUA 4UVIA 3E9NA 5JXWA 3OJOA 4J43A 1R15A 4IDFA 3WG9A 2DBRA 5JY6A 3OIDA 3KM0A 1ZEMA 1FK8A 1GU7A 2VQ3A 4R1TA 4PG6A 4WEQA 1YGYA 3GUCA 3ITDA 4IS2A 5KVSA 2OORA 1X1EA 5F1OA 3VKVA 3QQPA 4O5OA 4TQGA 4CQMD 2P9GA 4BOYA 4YWJA 1GPDG 5L7WA 2FWMX 5JE8A 3JQ8B 3OEWA 2H63A 2AE2A 3T4XA 3VZQA 3NGXA 4BMVA 1ENYA 4CMIB 1Y7TA 2ZKLA 4OXKA 1SMKA 4WCFB 1JVBA 4PLGA 4XGIA 5JO9A 4BO6A 3DOOA 4DMMA 3W8EA 3ETEA 4N18A 1O0SA 1RM3A 3UHAA 5JLAA 1QP8A 3WFIA 2CVZA 3F4BA 3ZWNA 1C0PA 5DULA 5IDXA 4D43A 3RFXA 2PGJA 4YR9A 2FN7A 3ONFA 4EYEA 1ULSA 2DFVA 5L7TA 2GZ2A 5IN5A 3QWIA 3ENKA 1J4AA 4JNKA 3JQ9C 2BFAA 3SC6A 3U0BA 4AJ1A 2I5PO 3JCZA 1HTBA 4P38A 2VYVD 3LQFA 1X1TA 4BO9A 4L9RA 2WSBA 4YB8A 2C82A 4BB6A 4E32A 4LMRA 3OA0A 4GSLA 3VVBA 2W8ZA 5JCXA 2Q45A 3PJDA 3FRJA 4DBVO 4AJNA 1HWYA 5AYVA 6LDHA 4XDYA 3WGIA 3BMCA 3FCOA 3VZRA 4I5FA 1WZEA 1A9YA 3PFFA 1GAEO 3ZU3A 3NEPX 3WQSB 4RLSA 1AGNA 2VWQA 3OETA 3WWYA 5A1TA 4RPKA 5KCZA 1VSVA 2B37A 4BNXA 1Y9EA 3H3JA 4AJJA 5JS6A 2BGKA 4J1QA 2O3SA 1I01A 1V35A 2DUUA 5BQFA 3DB2A 1MV8A 4MVJP 1XQ6A 2G1UA 4I08A 3PZRA 3TJRA 1HDGO 1SOWA 3F1KA 4D41A 4BNFA 4U0JA 4GBJA 3E5MA 3IQDB 1GQ2A 2QRKA 4JJIA 2Y1EA 1X7DA 5DZSA 3AOEA 3LC7O 4CMKA 2NU7A 3O4RA 1Q0LA 1ZSYA 2ILTA 1DC4A 3HE3A 3RBVA 3W8DA 1OOEA 1IL0A 3IS3A 3WIDA 5MDHA 4Y67A 3DBRA 3GPDG 3IJPA 5TC4A 3LT0A 4OQZA 1GDHA 3ZHZA 4YACA 2VUUA 1XG5A 4CLDA 1WMAA 3I4FA 3R3SA 4FN4A 3BXXA 3COSA 3GHHA 4R5HA 3S1LA 5C7LO 4K6CA 1SBYA 1R6DA 2FR1A 3AU9A 2CF6A 4DL9A 2OMEA 4YT5A 1EDZA 2VUTA 2TMDA 3KLMX 4IJUA 1UJMA 5IZCA 1S6YA 3C24A 3UCXA 1YXMA 3ZH2A 3RFVA 4MP3A 3TF5A 4UUPA 4BV9A 1UAYA 2PR2A 1QYDA 2Y0CA 3ANMA 5B4VA 4PZEA 1AUPA 4CV1A 4L73A 4JGBA 4D0SA 1T2AA 2PKQO 3ROMA 3A4VA 5HRUA 3PDUA 4A03A 2X23A 3K31A 2RCYA 4RGBA 4PG5A 3QVTA 2VTEA 3PEFA 3G3EA 4PLYA 2ET6A 3OQBA 1KC3A 3RUIA 2B0JA 5KWEA 5G0VA 3E18A 2W90A 5JMWA 4GL4A 2WE7A 1ULUA 3BTVA 3MTJA 3GFGA 1ADFA 1MLDA 2ZTLA 4M89A 1DC3A 3FD8A 2YQ5A 1L7EA 3GMDA 4F3YA 4H3VA 1ML3A 2RHRA 2OBYA 3V2GA 2WE8A 4MVJG 1EFKA 3WR5A 4WLEA 1B26A 1E6EA 2B4QA 5TT1A 4HP8A 1MGOA 1JKFA 2IEDA 4PLTA 4L76A 1E7WA 1JKJA 2HAEA 4BGEA 1W6UA 3DZHA 3CZMA 3H9GA 1TT5A 3OJ0A 3BMNB 1WW8A 3WGOA 3WYBA 3FNHA 4D3SA 2VN8A 4MO2A 1E7RA 2R2GA 4EUEA 1WXDA 3NV9A 4AJEA 5I7FA 4TVOA 4KOAA 4FBGA 3G17A 4WASA 5G0WA 1DPGA 1Q2XA 1Y9AA 3MJ4A 1BDMA 5F5LA 5CDYA 2Q2QA 5BNIA 5MGBA 4PLPA 2Q1UA 2H5LA 4Q3CA 4W4TA 4BKUA 1DRVA 4FJ0A 4W7HA 4J91A 4JBIA 5A3VA 2ZYAA 4E12A 4Q9NA 4DQVA 2FPPA 1TEHA 1MA0A 1GFSA 3UCEA 1ORRA 4CM4B 1MFPA 1HETA 1PQWA 2EXXA 5H81A 4FOOA 3RU9A 5H82A 4B3IA 4I9HA 1KYQA 5ILGA 1I8TA 3JQ6A 4YJDA 4UVEA 1LDMA 4JJFA 5TRTA 3TSCA 3IIEA 3QE3A 3I9MA 3L77A 1ID1A 1GY8A 4HX5A 4YQZA 4ZGWA 4YVFA 1JWAB 3AJRA 3HJAA 3O8QA 4LVCA 1B0AA 2DKNA 3DMYA 3H9UA 2VRBA 3O38A 3ZV3A 5B4UA 2PK3A 2GD1O 3BMOA 4XB1A 3PQDA 4Z9XA 3FHLA 3ONDA 3D5QA 2NSDA 1HDXA 3X2EA 3O8QB 4B79A 1RM4A 1P31A 1U1IA 3U62A 3WLEA 4TKMA 4YT8A 4FFMA 1QR6A 1V6AA 1NQAO 4CR6A 1YB5A 2WEKA 4BO8A 4LMPA 1LDNA 3DBHA 4XYLA 3F47A 2JFFA 2G0TA 2X7HA 3INRA 2VYVA 4W6ZA 1RM5A 5ES3A 3I5MA 2EW2A 3HDYA 1U3TA 3VHRA 1NPDA 1H6CA 2NVUB 1E1MA 3QHAA 1DFHA 1A7KA 5CG2A 2JCYA 1ISJA 2DU8A 4D3DA 3GF4A 1ENOA 3FTNA 1K2WA 3H5NA 4PG7A 1CF2O 2F1KA 3T7CA 1P45A 4KWIA 1A5ZA 3M2PA 1YQXA 3G49A 3CUKA 2Y66A 2VZ8A 4YJGB 3IOYA 4Z3DA 4B4OA 4YEDA 1Z45A 1SCUA 1T1SA 1YQDA 1YVEI 3EZYA 3ZWMA 1U5AA 3DZFA 5JMPA 3TRIA 5EJ2A 2FPGA 1ONOA 2JKVA 3FN4A 5DBIA 4UUOA 4E30A 4RVHA 3PWSA 3ICCA 1L1FA 1U3WA 5AXCA 4YT2A 5FYDA 1K6IA 2EP5A 3GG2A 4HFRA 4FJ2A 1JAYA 1HDZA 1VM6A 3ZWAA 4MP8A 1KERA 4CMIA 3I83A 4URFA 4JBGA 1NASA 3MJVA 3VH1A 3AI3A 2BKAA 1HYGA 3DDNA 4R51A 4U7WA 1I3LA 3SX2A 1ADCA 1TI7A 4GGOA 4PLCA 4GMFA 4NK5A 3LF1A 3BZUA 2RHCA 4KWHA 3KYCA 2E49A 3C1OA 1FDSA 2BRUA 4D46A 4NBRA 3VTFA 1FF9A 3VPXA 4YAKA 3WYCA 2OO5A 2YHIB 3L9XA 1GTMA 1X14A 3AM5A 2FMUA 3JQAD 5JDIC 3LZ6A 4UAGA 3FNFA 4GMGA 4DGSA 5K6AC 1BRMA 3M1LA 3EGOA 3PHJA 4M54A 4Q3AA 5EMHA 3VH2A 3OA2A 4RPJA 3GRKA 2I65A 1HE5A 4NBTA 3RKUA 4AJKA 3IDSA 3BA1A 4HFNA 2HSDA 3H5AA 4E5MA 1IUKA 4BUCA 4YCAA 1E7MA 4E4YA 1D3AA 3KOUA 5IDYA 3AM3A 3E03A 4RPGA 4BS9A 4LCJA 3L6DA 5EQDA 1PS9A 2HLPA 2PY6A 4WGGA 1IE3A 2YDYA 1IOLA 3MWDB 4J1NA 4NJMB 3UKOA 1KVQA 3ST7A 4PLWA 2BI8A 5CP8A 4DLLA 4KDEA 1ISFA 1RYDA 1BG6A 2H1SA 4Y6RA 1ZVMA 4RF4A 2EW8A 1QYVA 3CEAA 1HE4A 3ZU2A 4BO4A 1Y1PA 2ZJ1A 3RI3A 1U7HA 1UDCA 2A94A 1F8FA 3HNPA 1Z82A 3JQEA 4NNJA 4MPDA 4BMNA 3JQAB 1RKXA 4KTTE 4FCCA 5TGDA 4YJGA 1JQBA 5CFZA 3DZBA 1H6BA 2BH9A 2JD1A 1C1DA 4GVLA 1P74A 2VHXA 4BB5A 2J5RA 4RF3A 5FI3A 1JAXA 1R0LA 4Z9YA 3TOXA 5KVQA 5TX7A 4B3HA 5A9RA 1GQYA 2FSSA 4QQRA 2EGGA 4PVDA 1NQTA 3UH1A 1QRRA 1LLDA 4LRTB 3V5NA 1Y5RA 2YFHA 1LDYA 2CZCA 1ZH8A 3NGLA 4J2HA 1E7YA 4PCVA 2O2SA 4EW6A 1B8PA 3HN7A 5CAEA 4NIMA 4FW8A 1ZK3A 1SOVA 1WVGA 3JQ8A 3ONEA 3WWZA 1O6ZA 1QV6A 2PTGA 5JSFA 2P9CA 4BHTA 2HMSA 1HL3A 1HE2A 1KEVA 3OEYA 2P5UA 4INAA 2Z5LA 1KY4A 1WZIA 3DL2A 4E2XA 2GYYA 4DIBA 3GK3A 1HEUA 2YHIA 3FF4A 2NTNA 1QLHA 4X54A 3LT1A 2B4RO 2G82A 1DEHA 1P44A 2O3QA 2DTXA 5CHEA 4CUZA 1DHRA 3ZCXA 5BSFA 1B8VA 2Q4EA 2VWHA 3UW3A 3I9LA 2AQ8A 4YRBA 3KVOA 1IZ9A 1EK5A 2HK8A 4W9NA 4FB5A 5JFOA 1N5DA 1T1RA 3RVDA 4KDFA 4IUYA 1JVSA 3HN2A 3KXDA 1E92A 1DC5A 4AICA 2PA3A 1LEHA 4NBUA 1I10A 1V3VA 2CSUA 4PGFA 5FFFA 3WGTA 1SEVA 1YL7A 5A06A 5G4KA 1PTJA 2D5AA 5G2OA 4GGPA 2YV3A 2X5KO 3W4IA 2DBQA 2G5CA 2O48X 4BNJA 2SCUA 1V3TA 4Z0HO 2VHVA 4DMLA 1DIGA 2X9VA 2Q99A 4S1VA 3HUDA 4ZVVA 4XQGA 1KOLA 2YZ7A 4WECA 4RPHA 1MB4A 4YXFA 4HXYA 3RASA 4W7IA 5LDHA 2EP7A 3RU7A 1DC6A 4YAEA 3IUPA 3C7AA 2OFPA 3OECA 4GPD1 4WKGA 3QJ5A 3K9QO 1GV1A 3SLKA 1N1EA 3KSZO 1HZZA 1EQUA 3HFSA 3STHA 1W8DA 3H7AA 4J90A 4YAJA 1ZKMA 2UVDA 4ND2A 4QFDA 5A5EA 2JCXA 2QQ5A 3R0IA 3S55A 1UXJA 3L6EA 3M1AA 1KBZA 3TWOA 4WCDA 3D4NA 2BFOA 1JA9A 3LYLA 4CPDA 1I5RA 2BHLA 4O59O 3C7CB 2VHYA 1PX0A 1CETA 3AUUA 1Z7EA 3F46A 1UZMA 1DSSG 3JQFA 1JW9B 4A0SA 2GZ1A 3PYLA 4XGNA 3S2GA 1PL8A 1BTOA 1FXSA 2I66A 3ORFA 5U1PA 3D64A 5B4TA 1M2WA 3K5PA 4CQLB 4TKLA 4K1LA 4BO0A 1T4DA 1UR5A 1G1AA 1T2CA 3GOHA 3U9LA 2VRCA 3VAZA 1EZ4A 1HYHA 4AJLA 1H9AA 4QTZA 3HG7A 4EDFA 2X86A 3LDHA 3QA9A 4QT0A 2RIRA 4N5MA 2BF7A 1PR3A 4K9DA 4PLZA 3GGPA 4N5NA 3K8ZA 5DBFA 4CM9A 4NI5A 3I9OA 4D79A 3ZV6A 2WD7B 1FMCA 1U4OA 3BHJA 1QORA 1HYEA 1C0IA 1VE9A 3PGXA 3H9JA 4FS3A 4WLVA 2EERA 1P0CA 3G0OA 4OXYA 4IGFA 1P77A 3HADA 2Y67A 1DRUA 3JD2A 4EGFA 1I2ZA 5KJFA 1ZCJA 4UEOA 1NR1A 3RD5A 3Q2IA 5HS6A 3TPCA 4CV0A 1UDBA 4Z6KA 4GSKA 3VPSA 4CLHA 4G65A 4Y8VA 3DBRB 3QRWA 1NYTA 3FPLA 3ROKA 3PZBA 4L4SA 5ER9A 2OP1A 4WCFC 1VRWA 1M67A 4AL4A 5JAQA 3IJRA 1TLTA 3ZNQA 3L6OO 2IE0A 2HK9A 5T67A 4P22A 1NTOA 1YOVB 3I6QA 5GZ1A 3WB9A 4PZCA 3K2BA 4CLEA 3RROA 2GR9A 5DP2A 1PU2A 1E6WA 1X15A 2X9GA 2XF8A 4XQEA 1BXGB 1QYXA 1EBUA 3D3WB 4XA8A 3P7MA 3UN1A 5A5FA 1SC6A 4PVCA 3GNSA 1YWGO 1F17A 4WNCA 3JQ7B 4WEOA 5COBA 3PWZA 3E1KA 3U3XA 4AJPA 3UF0A 1YQGA 5BNFA 1UXHA 3ZU4A 3DHYA 4CQLA 4I5GA 1ZNQO 3ZHBA 1KY5A 3OICA 3PHLA 3X2FA 3N74A 4TROA 4MVJM 1WDMA 4R16A 1DJNA 2DT5A 3CINA 3GR6A 4ILKA 1I24A 2W2KA 3H9QA 1HRDA 3AFNA 3V1TC 3K73O 4KUEA 1YBVA 2C5EA 1VL6A 1ZK0A 4CM8A 1KEWA 4MIEA 1VI2A 3EHEA 3JYOA 4RVSA 4P4LA 5I9MA 5IF3A 2Y0EA 4KUHA 2Y1GA 4YT4A 5ICSA 1A72A 5C3MA 2DPGA 5I7VA 2B69A 2JFHA 1KC1A 4HNHA 1BWSA 4JQCA 2W98A 4P8RA 4J4BA 2O4UX 4CMJA 2V6BA 3S8MA 3K6JA 2PD6A 2OBNA 3IP1A 4Y98A 5FI5A 1YL5A 1F06A 4Y6SA 4ZRNA 3N58A 5ER6A 5TJHA 2X0NA 4CR7A 5JBIA 5U9CA 1BW9B 3D4PA 3WBBA 4H16A 4DQUA 2ZTUA 3LLVA 4W9NC 2E37A 3JQBA 5F21A 2ZATA 4WOKA 3OHSX 2BI7A 1ZEJA 1B15A 5IG2A 3HFGA 4GWGA 3Q9UA 1J49A 1MFZA 4XYGA 3RKRA 2J5KA 4DVJA 2YFQA 3LT4A 1UZLA 3TFOA 4MDHA 3PDJA 4KQWA 4KUGA 1IZ0A 4CLOA 5L9AA 3WJAA 4C7JA 1HT0A 2W2LA 1U9JA 3DTYA 4KTVE 4NFHA 1OMOA 1T2EA 5ADHA 3RAJA 1YRLA 3Q6IA 7ADHA 1ZSVA 3Q1LA 1MX3A 3DOCA 1XDWA 1SAYA 3QP9A 5B37A 1NQ5A 3D0OA 1U2GA 3LSYA 1Y8RB 3BHMA 5C5IA 2PH5A 2VCYA 1Q7BA 4YRDA 3F9IA 4N5LA 4EJMA 3D1LA 4EEXA 2I3AA 1HKUA 4IIVA 3UGKA 2Y68A 4MKXA 4CQMB 2YW9A 3NT4A 2Z1NA 4OO3A 2GZ3A 4L74A 2I6TA 4DXHA 5TT0A 2NTVA 3F3SA 4NZ9A 2AHRA 4B4WA 4XCVA 2C2YA 5EINA 3TNLA 3VOSA 2Y05A 3FNGA 3H5RA 2VOJA 3ZV5A 2PD3A 4BNYA 3JYLA 5L7YA 3QW2A 4DC1A 2WTBA 4NG5A 1IPFA 3VC7A 4IIUA 3BTOA 1U3VA 4HWKA 2Q4BA 4FFPA 4XJTA 4ZQEA 5JY1A 1LNQA 1H2BA 4IQ8A 2J6IA 4IQGA 1XHLA 2ZQYA 3L4BA 5HWSA 3PRJA 3B1JA 3F6YA 1YKFA 3QSGA 4BO2A 1MUUA 2D59A 3U4DA 2EF1A 3DQPA 3E9MA 2O50A 3BMOB 1YE3A 2DFDA 1MC4A 1UDAA 2UV8A 3E5RA 5CPFA 1NBOA 1ZK4A 2EIHA 2PKRA 4H7PA 4JCOA 4HUJA 5A9SA 4BKRA 1D1SA 1IB6A 1XYGA 4TZKA 1C1XB 1D7OA 2ZYDA 5LDGA 1JKIA 3LU1A 4QECA 2ZCVA 4J4HA 4BQPA 4JK3A 1DB3A 4ZD6A 3U09A 1M6HA 4J49A 3SC4A 1AN9A 1TB4A 1U3UA 5DOZA 4DYVA 5IDWA 1CDOA 4XGKA 3GVCA 3WYEA 2WM3A 1VKOA 5B12A 4E6PA 1GUFA 3CPSA 4R9SA 4DPKA 3BMNA 1YJ8A 4QO7A 3WXBA 3BMQA 1A71A 1EUDA 4EI2A 2VOEA 4GX0A 4TRJA 3UCFA 3UVEA 3JSAA 4RJTA 3ROPA 4BNNA 4CMHA 2RH8A 3WNQA 2ZYGA 3ADPA 5DBGA 4B8WA 1O95A 1Y8QB 3SLGA 2IODA 4G5HA 2CVQA 1LA2A 1SPXA 4Z3KA 1YBAA 2NVBA 1B3BA 2GERA 2X4GA 2OZPA 2WDZA 1A4UA 5ENDA 4B4VA 3AU8A 4DQXA 1KIFA 5A9TA 3WMXA 3OJEA 2Q1TA 3G79A 3GG9A 4CLXA 3L07A 5F3RA 5L40A 1ONNA 4DA9A 5JPIA 2DC1A 4IJVA 2QYSA 4EZBA 3TN7A 5FF9A 4FGSA 3GZNB 5C7OO 1HLDA 3F4LA 3JQ7A 1T2FA 3A14A 3EVTA 1UZNA 3F1LA 2WYVA 3AY6A 2PZKA 4NK4A 4J9VA 2AQHA 1EUZA 2D8AA 1PJLA 3CH6A 3ZW8A 2O3JA 4FPXA 5KKCA 4J0EA 3WOHA 5A05A 4R68A 2DPHA 1NQOA 5JDIA 3DZGA 4RZHA 3C7DB 3P5SA 3VPGA 3NAQA 1LLCA 1F12A 1NFQA 4IZHA 4WPGA 2XAAA 1HSZA 3ITKA 3I52A 1RYEA 4MVJE 1IULA 3S2EA 2GPTA 2HU2A 2VNAA 3VPHA 3RC9A 5BSHA 4OSPA 1YB1A 5J23A 1E3WA 4RZIA 2FZEA 1EVIA 2JAHA 3RBXA 1I2BA 4R3NA 1ENZA 2BLLA 1DAOA 4ZA2A 3TZ6A 3KTDA 2IXAA 5TS3A 2YY7A 1E7QA 5K0ZA 3PJFA 3R1IA 4RO0A 3ENNA 3D4OA 3OH8A 3QVXA 1LSUA 1LRLA 1XU7A 4PFJA 3CXRA 4E3ZA 4RQUA 1VL8A 3EAGA 4D44A 1LSJA 3GLQA 1RJWA 3GNTA 3EC7A 5CEFA 4KP7A 1VJTA 2DLDA 2ZB4A 3SEFA 1HDRA 3ZZNA 1CRWG 2FOIA 2EGHA 3JQGA 4DC0A 3U49A 4FDAA 3ZWCA 2HKIA 1FDVA 4GLOA 4U0KA 4XR9A 3A1NA 4BO1A 3E82A 1K89A 3NTRA 1K6XA 1IHYA 2TMGA 3VKUA 1IPEA 2DQ4A 4H15A 4AJ4A 4XRGA 4BNGA 1U7TA 4GWKA 5JC1A 1CERA 3OBBA 3DEYX 2I9PA 2C7VA 3V2UA 4QFCA 4GI2A 4B7UA 3TZKA 5A4DA 5L53A 1KVRA 1MXHA 2FP4A 2JHFA 2O3RA 2PGDA 3A28A 2IXBA 3CSDA 3KYCB 3D3WA 3GZNA 4TRMA 3ZNPA 2RH4A 4CM7A 1ZW1A 2GN6A 3W8FA 1K3TA 2NWQA 2Z95A 4HFMA 2J3IA 1C3VA 4MVJF 3OM9A 3OIGA 1I3KA 4IDBA 3K30A 3K96A 4MKRA 4XYEA 4CM6A 1QG6A 3AWDA 3ETGA 4WLFA 1Q7GA 1E3EA 2PWZA 3G1TA 3LC1O 4JIGA 3RBZA 3V1YA 2QHXA 3IAHA 4GQAA 2AG5A 1QSGA 2YQ4A 4BKQA 3TZQA 2QIOA 3KO8A 2A9FA 3PGJA 4I5EA 1I36A 2PZMA 1PGJA 5THKA 4N54A 4ND3A 5F5NA 4R9RA 2PKQP 1N8KA 4DLAA 3ASUA 3PHIA 3JQAA 5JCJA 5G4KB 2JAPA 3WGYA 3QWFA 1R0KA 3H6KA 5F1PA 4AJ2A 4BNZA 1DFGA 1ZMOA 1X13A 1R66A 3MJEA 1NFFA 3NDRA 4BIIA 4QUKA 3H2SA 3RQSA 4P4GA 4BNUA 3RUFA 1V0JA 4MP6A 3WTBA 4XYMA 1MC5A 2WD7A 3WFJA 1UP4A 3MOIA 3MOGA 1O89A 1OI7A 3CE6A 3GEMA 2HMVA 4B8ZA 3NYWA 2P2SA 2PZJA 4FSHA 4JX8A 1PJBA 4GX2A 3RCBA 2EHDA 3ZNOA 2CY0A 3UFXA 4E2WA 5BR7A 4ESOA 5EESA 4FOSA 3TL3A 4R5MA 1P1RA 4C7KA 3IKTA 4PRLA 5KKAA 3MEQA 1E77A 2ZTMA 4XIYA 4ALIA 3E6AA 4RVUA 3Q11A 3GGGA 5JAMA 3U5TA 1GYQA 1U2DA 2WWRA 2A92A 1I32A 4LISA 2V6MA 4KQXA 4O0LA 1V3UA 3AY3A 4JLWA 5IXYA 1PS0A 1P1JA 2ZCUA 4OQYA 5L95A 3ICPA 3WX0A 5G0UA 3C85A 2HMUA 1MG0A 3T7EA 4GVXA 1N9GB 1EMDA 1LU9A 3ULKA 4ND4A 4IDCA 2C54A 2V65A 5AQ1A 1WDLA 3GEGA 4IMRA 3UOGA 3NTOA 1CQJA 4ND5A 4L0QA 1PJ2A 5JNLA 4WLNA 3ZWPA 5JYEA 1NHGA 5JDCA 2A35A 4XD2A 2FHSA 4E5KA 5A04A 1A7AA 1F14A 1EUCA 1DDOA 1BDBA 3ZWYA 1DRWA 3I3OA 4LW8A 1E3SA 3VH3A 3VTZA 4J7XA 3Q2KA 4DPMA 4LSMA 1GZ6A 4HFJA 4U6QA 4YJHA 2AA3A 5JCJD 1LRKA 2IZZA 4RDIA 3FPCA 3TOZA 1H5QA 2B4TO 1N92A 4DREA 1NXQA 4ZQHA 4J0FA 1QMGA 1DAPA 3UAGA 1J5PA 3B20A 3DFUA 3GUYA 4K6FA 4YA6A 5A9SB 1K6JA 1EEHA 4XJSA 2YV1A 4ZRMA 1CWUA 2C5AA 4U5QA 1N7GA 1YO6A 1GCOA 5JO0A 2ZB7A 5EERA 2BGLA 3DWFA 3KB6A 4CM5A 4DLBA 4CLRA 3DR3A 1SNYA 2HO5A 3QVOA 5DCUA 4OOFA 3MWEB 4UVHA 3P2YA 2BGMA 1DXYA 3M6IA 1NAIA 3H2ZA 4BO5A 5I7EA 2X0IA 3OIFA 2P91A 3GA0A 4JN6B 1LXCA 1J6UA 5I8WA 2GN9A 1P33A 2DUWA 1HLPA 2X5JO 1WPQA 3JQ9A 4TRNA 1PS8A 4ZU3A 3WGGA 4WLUA 1AXEA 3ZNNA 4IQ0A 3GRPA 2CFCA 4XKJA 5ICMA 1AXGA 4KZPA 1GV0A 3QVWA 4O6VA 1I30A 1I2CA 3JQFC 4PN3A 3IC5A 1D4FA 1HZJA 2J8ZA 1SO8A 2FY8A 1LDEA 3D5TA 1UAGA 1N1GA 4L4RA 1ISHA 1LBEA 4XB2A 1VPDA 1NAHA 2AMFA 5L3ZA 3RIHA 1NM5A 4E31A 3VVCA 4J3FA 2HDHA 4JJGA 2GNAA 8LDHA 4ZQFA 4MJLA 3HQ4O 3WJ7A 1EVYA 2NNLD 3JTMA 1B8UA 1GEEA 3C1AA 4F6LA 4YAIA 2DAPA 3T4EA 3TQHA 1GR0A 1UXKA 1R4NA 2R00A 2HJSA 2QYTA 5I9NA 4XWYA 3PIIA 2X0RA 4OM8A 1LRJA 3KHUA 4M8SA 1GUYA 4TRRA 3FI9A 5GY7A 1NHWA 2J3KA 1LJ8A 1T24A 4Q3EA 4NU5A 2O7QA 2GLXA 4AFNA 3DBHB 1FDUA 1X7GA 3PVZA 1TT7A 3RJ9A 5L51A 3OSUA 4FFOA 1XEAA 3DTTA 3W6UA 1VJ1A 1BW9A 1Q0HA 4ZQBA 3DMTA 3UUWA 1YONA 2OGUA 4XEHA 4YJFA 2VNSA 1LQUA 3ZDFA 4CJXA 2CDBA 3OJFA 3L0DA 3PYMA 1NR7A 4NDNE 4TZTA 3P2OA 3PFWO 4I9NA 4NFSA 3NUGA 4CMBA 2FR0A 4CM3A 2HMWA 5TIIA 3KETA 1EBFA 5DP1A 2NVUA 4IM7A 2P68A 3S2IA 1Z74A 3HB5X 4IINA 4Z9FA 2D2IA 4IDAA 1UP7A 2J3JA 2X1HA 3SJUA 5BSGA 5C37A 4ALLA 5DCYA 2CNBA 2D4AA 1E7SA 1H6DA 1ZIDA 2JCVA 1E3IA 3GVHA 2B83A 2Q46A 1GADO 3GQVA 2C59A 1CEQA 4QO8A 1P1FA 4OOEA 3KYDB 4BNKA 4BGUA 4IMPA 3AY7A 2P4HX 2WD8A 2QZ9A 4CV2A 4CL8A 4PZDA 4YQYA 3QV1A 4FQ8A 5THQA 4FFLA 4E33A 2EWMA 1YOVA 4PLVA 1KEPA 1EE9A 1HDYA 4RVGA 2GRAA 5BT9A 2EKLA 3QWAA 1YS4A 1ZFNA 3AFMA 5IN4A 4IY1A 1DBVO 1ZK2A 1M66A 3BHIA 1R4NB 3MZ0A 3ZW9A 5AXAA 3WICA 1PJ4A 4BGIA 2OUIA 1LQTA 3K92A 1RM0A 4R54A 3INGA 4RVFA 2OL4A 1PZHA 3HZZA 3ROQA 1LDGA 2IYPA 4EUHA 8ADHA 1WAMA 2X58A 3U4CA 1P9LA 1ENPA 1PWZA 2QW8A 5IFLA 4NBVA 1JDJA 2EJWA 4BO3A 2J3HA 4MOWA 5KJCA 2V6GA 4JROA 4CMEA 1UH5A 4M87A 4RQTA 5GZ3A 2UUOA 4WNIA 4PIVA 4A27A 4RCVA 3M2TA 1C1XA 1Y6JA 1ZBQA 2AEMA 5AXBA 1U8XX 3BMCB 1UXGA 1KVTA 1DJQA 3GDGA 1XELA 3BTUA 1LTHR 1N7HA 4DRYA 2ZB8A 4RORA 3RWBA 2WJPA 4FC6A 3JYQA 4M1QA 1OBFO 2UAGA 1Q0QA 4GKVA 4Y6PA 5T8KA 2CDAA 2V7PA 1EQ2A 1CQIA 3NDIA 2GCGA 3I9NA 5B1YA 5HS4A 4D3FA 4UEKA 3MJCA 3KBOA 1E3WB 2HCTA 3NJ4A 5CDTA 5HBRA 3GGOA 3L4BC 1SZJG 4NHEA 4DWVA 3PJEA 3CTMA 4D7AA 1DLIA 3OF2A 4MIOA 3WTCA 5ILOA 1NNUA 1T26A 1OC2A 2VUSA 3ASVA 3PPIA 1H94A 3NTQA 3HHPA 4CQMA 1X7HA 1PJCA 1WWKA 1RWBA 3NDJA 4CUKA 4EJ0A 4B7CA 4DYDA 1PJQA 4TVBA 2PGLA 2DM6A 4BNMA 3ABIA 3JD0A 3JQGB 1E0DA 1Y8RA 3FBGA 1DFIA 1B3RA 1NVGA 4A5OA 1M75A 1GZ3A 2AQKA 5GMOA 2PV7A 1PL6A 1PJ3A 3PYXA 4ND1A 4AJIA 4BNLA 5C7IO 4MKZA 1E5LA 1H6AA 1Y81A 2WMDA 3QLJA 2BMAA 3CIFA 1AE1A 1R12A 2C20A 5I9LA 5TQVA 3DBLB 3QVSA 4K28A 4E0BA 4PG8A 4II2A 5T8KC 5L4SA 3EY4A 3CZRA 3I4CA 4ZN6A 4UVDA 4LN1A 3ETDA 3A06A 3VZPA 4CMCA 5JC8A 1MG5A 5DN9A 1PJSA 1O5IA 5I7SA 2Q49A 1ONPA 3GZ4A 2NV6A 4O63O 1GEGA 5COAA 3BTSA 3AI1A 1UP6A 1SB9A 3DHEA 1HF3A 1TA4A 3I9JA 5CEEA 3JQBC 4CM8B 5HA5A 3AK4A 3K2EA 4A10A 4R4JA 2NQ8A 2X0JA 5KJEA 3JQCA 3GMSA 4EBFA 1KEUA 4EITA 1E6UA 1XIVA 1H93A 4XZ3A 1WLYA 3GAZA 3KZVA 2NM0A 1LSSA 1PWXA 4E5NA 5A3JA 2Q1WA 5ITVA 2I67A 3JV7A 3KLPX 3DC2A 3WDSA 2D3TA 3TZHA 4GLLA 2DBVO 1NPTO 1DIHA 3GPIA 3JD3A 3H3FA 4NBWA 1ISMA 4LVUA 1Q1NA 4YRAA 1BMDA 4Z0PA 2IRWA 5FEUA 2E6UX 3MJSA 4TSKA 1LC0A 3U4IA 3UXYA 1A27A 1YH3A 4WJZA 6ADHA 1XA0A 3EMKA 4R41A 3VDQA 4CLOB 4B4UA 2DTDA 3ZHXA 4OH1A 2VYND 4LCEA 3H4VA 4NMHA 4QX6A 4BV8A 3B1FA 2Y1DA 1D8AA 3KYBA 4E13A 3EVNA 1Z73A 4TMFA 4MVJA 3I6IA 1OC4A 4FC7A 3WGQA 3GN1A 4Y9DA 4OSOA 3B6ZA 3RUDA 1VSUA 1LSOA 1DOHA 3DAPA 3HDHA 4A7PA 1D1TA 1I3NA 1ZO8A 4YTEA 2DVMA 3LT2A 1PZGA 1NX6A 5DT9A 4I1IA 2Q2VA 5TF4A 4OJNA 4R1NA 4FFNA 4GKBA 3F5SA 2CF5A 3PTZA 3KV3O 3C1TA 3FR8A 4IGEA 1H9BA 4QXMA 4BGVA 4AG3A 2RBEA 2FPIA 1ADBA 3AUAA 1B16A 3JD1A 3OQ1A 3QIVA 4BVAA 5KJ1A 4ITUA 1LDBA 3H65A 9LDBA 1UXIA 1K5HA 2NQTA 2AQIA 2X6TA 3BYZA 3GVXA 3JD4A 5DOVA 5AVOA 2FZWA 1V9LA 1ZK1A 3ZWWA 4EUFA 3IL2A 1PSDA 4BNIA 1J0XO 2ZTVA 3RC1A 4ZHSA 1NWCA 3OMLA 4JP2A 1I3MA 1E5QA 3W1VA 1B7GO 3PJGA 1BSVA 5IDQA 2ZIZA 5LCXA 5KIAA 3RSHA 2POQX 1A4IA 1FDWA 2QG4A 1GYRA 4E2YA 2B5WA 2HK7A 4IJWA 4LGVA 2GASA 3SVTA 4OKIA 4WE3A 1I0ZA 2NADA 1P0FA 3B70A 2X8LA 3B1KA 3LK7A 1YDWA 3L4SO 3H8VA 5JAZA 2EV9A 3WSWA 3PLNA 2ZQZA 2RAFA 1LUAA 2BD0A 2A4KA 4AJOA 3DFZA 1E3JA 5U4QA 2AEJA 4A73A 4F45A 1C0KA 2VRCD 1O9BA 2JHGA 2F00A 1ZSNA 3HSKA 2NLOA 1PJTA 3V8BA 1BXZA 4UREA 1BGVA 1DIBA 3IMFA 3OP4A 4NH4A 1B14A 1QYWA 1XCBA 4RDHA 3F5QA 4TWRA 1BVRA 3D7LA 3BIOA 1ARZA 4A26A 7MDHA 3CKYA 1PQPA 1EDOA 2Q3EA 2O4CA 2C0CA 4RLHA 2W2LD 5FWNA 4ROSA 3TDKA 1EFLA 1QXSA 1WNTA 2BELA 3QWHA 1WDKA 1BXKA 1SB8A 2HMTA 3LC2O 1PR9A 1P3DA 1KS9A 1NWHA 2VHWA 1GL3A 2O23A 3FR7A 5L4NA 4YAGA 2UYYA 4M49A 5ENVA 2IDZA 4ALMA 1OAAA 4CMAA 5BSEA 1XLTA 4IPTA 2IZ1A 3GNQA 3NRCA 1B2LA 4J9UE 1CIVA 5DDIP 1IYZA 1YJQA 1PQUA 5EL0A 1ZZEA 1Z7BA 4LSWA 3U4HA 3HDJA 5KNLA 2O2YA 1GQQA 2R00C 2HRZA 3UICA 3JYPA 5EQFA 3SXPA 2E48A 2HJRA 1NPYA 2FSVA 3GEDA 3NX4A 1AHHA 1MXFA 2EEZA 3FSRA 3WQRA 3VPFA 2O7SA 3ZWOA 4FJ1A 3DXFA 2GDZA 4CM9D 4L8VA 3EYWA 4OMUA 3E9QA 5A03A 2H6EA 1ZJZA 3W4KA 3C8MA 2JL1A 3NJ8A 4D45A 4P4NA 4MINA 2QRLA 2DTEA 2FR8A 2CMDA 3E48A 5G0TA 3SJ7A 1H2HA 4OYRA 4BL5A 4DBZA 4UVGA 3PHHA 1A9ZA 1BVUA 2LDXA 4HADA 2EKQA 2PH3A 4HNGA 3Q0EA 3ZWVA 2ZK7A 4XIJA 4MIYA 4OL9A 3EZLA 3RUEA 1O8CA 3WLFA 1M6WA 1U4SA 5IAAA 4D42A 1U5CA 5K9ZA 1FJHA 1GYPA 1OZAA 3AUTA 4CR8A 2UDPA 5IZ4A 2GSDA 3A9WA 4CLRB 4E5YA 1PZEA 2NTJA 2QRJA 4CMGA 1TT5B 2YJZA 2AE1A 4CODB 5TNXA 3PP8A 2XXJA 1LX6A 2CD9A 3PIDA 5EN4A 3GN2A 9LDTA 2Y1FA 5IXSA 2X5OA 3GT0A 2YUTA 2OHXA 3ZU5A 4IS3A 5G0SA 4L75A 4CUJA 4JXKA 4MVJD 3DZIA 1C14A 2I99A 3R6DA 1UUFA 1VC2A 3Q3CA 2Q1SA 4BKPA 4Z0TA 4UUNA 2ZJ0A 3NKLA 4NQZA 1P1KA 2GO1A 4IDEA 5CDSA 4DIOA 1LLQA 5CDUA 2VHZA 1T4BA 3WIEA 2I3GA 1ZXLA 4HKTA 1ZJYA 5IJZA 4IXWA 5AXDA 1W4ZA 4WOJA 1T25A 3FWZA 4MVJI 4ALNA 3IKVA 4RL6A 2NU9A 2WYUA 1E1NA 1X0XA 1JN0A 4S3MA 3RJ5A 4F46A 2IZ0A 4R69A 4BO7A 3RC7A 3ANNA 1GCUA 3ZI0A 1T2DA 3RUCA 2D5CA 1XGKA 4AVYA 1RPNA 4LK3A 1HE3A 3DZJA 5L4LA 3EDMA 2PZLA 1YL6A 2C2XA 3JQDA 1JLLA 1IHXA 1XQ1A 2AW5A 1DIAA 4K26A 5EIOA 1S7CA 5CEJA 2HUNA 4NR0A 2DBZA 3VDRA 1P1HA 4DPLA 3WBFA 1M76A 3GHYA 3I23A 5AOVA 5EPOA 3L9WA 4BQRA 2EJVA 1Y5MA 3DONA 3HWRA 1AHIA 4MVJH 1U28A 4PLFA 1DLJA 2YV2A 4I9UA 4WUVA 3V2HA 4R3WA 2LDBA 1ZUD1 4OAQA 4ONEA 3FBTA 1NVMB 4JP3A 3GVPA 4OKNA 2OXIA 5CPBA 4II3A 2X22A 4QSMA 4E21A 3DBVO 3BAZA 2GF2A 5K6AA 5L45A 3EK2A 3KYDA 3O03A 4I5DA 3SBOA 1VJ0A 1KETA 1NFRA 3GH3A 3KSUA 3BMQB 4J1TA 1CJCA 2O3UA 4E5PA 1CYDA 3IP3A 2NU6A 4R1SA 5A02A 5CDGA 4Q39A 1LC3A 1XU9A 4BNTA 3TL2A 4ZICA 2VYNA 4XDZA 5IZCC 4D0RA 3IUSA 1FDTA 1QV7A 3G1UA 4AJHA 3DBLA 4FR5A 3ZGYA 1PL7A 2JD0A 1KVSA 4UEJA 1PGNA 3ZHYA 1XKQA 1ZXBA 2BFMA 1F0YA 1F8GA 1WMBA 1X0VA 4ID9A 4XQCA 4XQ9A 1JWBB 3QY9A 2VWPA 1R0SA 5TJ9A 3AOEC 3RC2A 1GUZA 4ALKA 3INTA 4IBOA 1PZFA 2XPCA 2G76A 3ADOA 3LVFO 1ISIA 1LLUA 2G17A 4IDDA 1QLJA 5HM8A 2Y99A 3MCVA 3GDOA 4M55A 3FTPA 1ISGA 2P5YA 4GX1A 2R6JA 4NJMA 3W6ZA 2VT3A 3GAFA 4RF2A 3H9EO 4XR4A 4ZQGA 4BMSA 5JYDA 2EG9A 1K0UA 4BNHA 3DZKA 2CDCA 4PRKA 4PG4A 2JFGA 2WYWA 1G6KA 1G0NA 2Z1MA 4YJFB 1VKNA 4FGWA 3PXXA 2CUKA 2AEFA 2P9EA 2QZZA 3ZWBA 2Y1OA 4IDGA 3GVIA 4FIZA 3WSVA 1EE2A 2Y1CA 2Y0DA 3Q9NA 2D1YA 4J16A 4WLOA 1Q7CA 4RV9A 1VLLA 3WQQA 5KJ6A 1PGPA 5T57A 3KRTA 4BNVA 1GD1O 2B36A 2NACA 3ZV4A 3R3JA 2YDXA 3VZSA 4UULA 4Q3DA 1E1LA 3DAFA 1Y8QA 3PLRA 2C29D 3RUAA 4HBGA 2VWGA 3N7UA 4XYBA 1XSEA 3DO5A 4RVDA 1PIWA 2GN4A 1XWFA 1E3LA 4GH5A 3AOGA 3PQFA 1Z75A 4EEZA 4F6CA 2VZ9A 2AXQA 3TZCA 1TXGA 2C7GA 3KUXA 4JBHA 3KEQA 2VT2A 4WCFA 1HXHA 3OFSA 4BKOA 4YBZA 1SEPA 2HQ1A 1V8BA 4A2CA 4G2NA 2OOSA 3RUHA 3VH4A 2YYYA 1R4MB 5ITWA 5JW6A 5TLSA 2JJYA 4EJ6A 4OGWA 5JDCC 3WNVA 3O26A 3DAGA 2PFGA 2PLAA 4J7UA 3I1JA 2AG8A 3PHGA 3MTGA 1L7DA 3CMMA 3S2FA 3GC6A 3PWKA 3GDFA 4GX5A 4U8GA 4NPCA 1HDCA 3I9KA 5T64A 3QWBA 4W82A 2OP0A 2P4QA 3GFBA 5H83A 1TVEA 5CG1A 1DHTA 2C07A 5T6BA 1GZ4A 1GPJA 3LF2A 2CVOA 1QKIA 2IYOA 2NU8A 1LI4A 3EUWA 4NFYA 3KSDO 1HDOA 3WGZA 5KVVA 4KMSA 4W99A 4J4TA 1YB4A 4OHUA 1P1IA 4J6FA 3NT5A 3P19A 4YDRA 4B3JA 2I76A 3TFQA 4GAEA 1EK6A 2D0IA 2NVWA 2E4AA 2Q2WA 3FWNA 1I33A 3ZN2A 4YYZA 2E82A 2HRBA 4FD3A 3WGHA 1IY8A 3PK0A 2IEBA 3C3XA 5I8ZA 4Q3NA 1DIRA 4OXNA 1PEDA 4QEDA 4O1MA 1WP4A 4IZIA 3DOJA 4HV4A 3HDQA 4I8XA 3DMTC 1YDEA 3ANLA 1R37A 5KTKA 2GUGA 1E1KA 1NVTA 4L4XA 4CV3A 2NUAA 3CMCO 3PI7A 4PLHA 3ZWXA 1C1DB 2ZB3A 2BFPA 2VZ0A 1N2SA 1YBMA 4NJOA 1NP3A 1R4MA 4FFRA 3AW9A 1QYCA 4CM4A 1JTVA 4DTIA 2VTDA 2PNFA 2V6FA 2H9IA 4XRRA 3WMWA 4NU6A 2UUPA 4CM1A 5JAIA
chains in the Genus database with same CATH superfamily
5F1KA 2E9SA 4MS4A 2VSYA 3PD7A 4AKTA 1OX6A 3MB8A 5JASA 2ZUDA 4Z4IA 5SV2A 4I1VA 1IZYA 1DXOA 3BGIA 3GJ0A 1DO8A 1BXGA 2NSJA 2ZAOA 3ZCPA 2BSXA 5ELMA 1U81A 3PXEA 2VEOA 4BMDA 2VP3A 2OZLB 5LC1A 1E8MA 3DBIA 4K05A 1HSOA 5M3BA 4BYGA 4ETMA 1N75A 3PQEA 1VLJA 3AI2A 4PBRA 3LLSA 1SXJE 2IPAB 4LDAA 4RPLA 5HW0A 2NX2A 1K3UB 2EARA 3R24A 1R16A 2Y93A 4H08A 4J2TA 5JOQA 1L7BA 1B73A 2GZSA 1VE3A 1RW4A 3K1YA 2YINC 5ALRA 1AKVA 1N9GA 2XVYA 4ZGGA 2QX8A 2CV1A 1ZNWA 2QX7A 2IKQA 3AEZA 3OQ6A 2XR1A 3EW7A 1RWVA 3OJLA 2CMFA 3Q7EA 4OIMA 4U63A 1SCDA 2IHUA 4RADA 1IRXA 4GM1A 4M9UA 1I1NA 1AGPA 2HU7A 1FYVA 3TSZA 3VI4B 3WKDA 5DYNA 4C5AA 1M72A 4KNVA 2CWWA 3F6RA 4PQGA 5E6UA 2PSDA 3E27A 4M86A 4FGLA 4G86A 1N4AA 1O6CA 1MMFB 3C6ZA 4FLMA 1EUCB 1PGQA 1TUGA 3BJIC 4FR0A 2FJPA 2R8YA 2Y92A 3MJTA 3SYTA 3BXPA 1TIBA 3DDSA 1BHSA 1Y1QA 3HL0A 2XRFA 4U6NA 5EKXA 4RF5A 3VR3D 3UXHA 1YI0A 2QVXX 2IU6A 3NFYA 1R4AA 4KB5A 3I05A 4FFWA 2VR1A 4TT8A 2RK3A 3CZ4A 4QM6A 3OTHA 1XHFA 2H85A 4NENB 1ZD9A 2YCBA 1Z6ZA 3SDZA 3I2KA 2G83A 2I33A 2O07A 4FE7A 2GA9A 1R6XA 4XX0A 5JEDA 5KTYA 1E6KA 3GY0A 3AM1A 1I1HA 5GQSA 3CRRA 2J5QA 2E4WA 2Z9CA 3NVMB 2BFEA 1VKJA 2DR3A 3D6NB 2AXNA 3GFSA 1J7JA 3GEIA 3E9NA 1CUUA 1SCIA 2HHCA 2Q5QA 1KAMA 4YGYA 4JI4B 3GAMA 1R15A 4IDFA 1JDBC 2JI7A 3V48A 1G1MA 4YCLA 1KH2A 2OSBA 4RGQA 4R1TA 4DCMA 2P0AA 3FGPA 4Y2RA 3T95A 4E46A 3PFHA 4QARA 2FMIA 4LJ6A 4G5RA 1KFBB 3ITDA 4HZUA 1Y3IA 4IS2A 2OORA 1U6KA 4Y9SA 5H9VA 3JR7A 3T5BA 3MCWA 3VKVA 5A4MS 2HD4A 2P9GA 4I55A 4BOYA 3VZDA 5L7WA 1KI6A 2FWMX 3OOEA 2JGNA 1NOKA 5ED4A 3T4XA 1Z4MA 3VZQA 1YA8A 3QPCA 2YMQA 1GILA 3OEED 2ZKLA 4OXKA 2REBA 1PZNA 4WCFB 5JO9A 2UYQA 3A3KA 3W8EA 4MI1A 4JQZA 1O0SA 2PPLA 2WJAA 3GCXA 2GCOB 5I5EA 1WXQA 3FSGA 3G8BA 3H11B 3HV2A 5JLAA 1ANKA 4CCYA 4GRDA 5TQ0A 3ZWNA 1C0PA 1BE6A 1IJKA 2F67A 2I29A 5DULA 3RRFA 5KHOC 3D6JA 3SHQA 3RFXA 3G0GA 3V6MA 3HVRA 2PGJA 3BF7A 2JC3A 1BFUA 1CT9A 1K4KA 1QP0A 1X80A 2GZ2A 1ODLA 1XZPA 1EK1A 1YIDA 2RHJA 3I01A 3QKSA 1KMMA 4L8GA 4RIFA 3VR6H 4BLTA 1MENA 4EARA 3FMIA 3SC6A 2NTYC 2OMKA 3QU5A 3T7RA 4AJ1A 5BP7A 4J76A 2CNNA 3OESA 1Q1QA 1CD5A 1NNLA 1P80A 1X86B 1X1TA 1GZDA 1D2NA 1YHZA 2FHPA 2H1RA 2ZJ7A 4TQUS 2RHDA 2WSBA 3SK0A 3EUAA 2R5FA 3BD7A 2P4UA 1DKMA 1DXQA 2WU8A 3CRNA 4IX1A 1ZI6A 3QITA 3HFJA 4LMRA 4LMBA 5JADA 4KFSA 1BRTA 3KPUA 3NIFB 4F5DA 4HAOA 3PCXA 2AFIA 1VECA 1TEZA 2IV3A 2OLJA 1ICEA 2WSIA 1SIUA 2UXDB 4CT0A 4GZMA 1IN8A 2V3WA 3IVRA 3CF6R 1HWYA 2BFBB 4EUNA 3VDMA 3NHUA 2WF7A 3ZBTA 1MC8A 3RS4A 1W87A 3ILHA 1N3BA 4JIMA 4C2TA 3DXYA 3BMCA 1M7GA 3B1YA 1BXRA 5ESWA 3W79A 5IHPA 4B87A 4FZ5A 4M0FA 1RBMA 4JOCA 4C20A 3NEPX 4PFQA 2KYRA 1E9DA 4RLSA 3SMVA 2VWQA 3E9EA 3E3NA 1D6SA 1DAGA 2XLCA 4BNXA 5GONA 1QWOA 1WCIB 2J4CA 2R44A 1E1CA 3H3JA 3JS5A 4IH9A 2MINB 4LDZA 2CCJA 5FLYA 5PGMA 4X5OA 3L8CA 2C58A 3N0WA 4HRXA 4EY6A 4B6JA 1I01A 1ZAYA 621PA 5HX7A 1XQ6A 2C31A 3REGA 2VJPA 3TJRA 1KEEB 3LO5A 2Y77A 5J4HA 5L40A 3MJFA 2A0WA 1TVCA 4DB4A 3GJ3A 3SYKA 1I4WA 1CRPA 1F6WA 1KNQA 3E7DA 1M74A 1DKRA 1YQEA 2RGWA 4JJIA 3EPRA 4NE9A 3AOEA 4Q3OA 1X1AA 4TOIA 3O4RA 5IEJA 4ZTBA 4JVOA 4XLLA 1BQ3A 4E5UA 2Z04A 5JSQA 5MDHA 4Y67A 4FP9A 3DBRA 3DAYA 3IJPA 2QK4A 1OLUA 4GP9A 1KR2A 1ULBA 1GDHA 1W25A 2IE8A 3K0BA 1XKXA 3A3NA 1XKLA 3OEEA 3PUXA 4YMLA 3S1SA 1JB1A 1WMAA 3R3SA 3QEBZ 4WBNB 3K6RA 3AUFA 1H69A 5AI4A 4PZAA 1SBYA 2WF5A 2FR1A 3IQEA 3AZQA 3N70A 2NYUA 2WUVA 1EGAA 1FTNA 1G5IA 1NOIA 2YZNA 1JIIA 2WM9B 5IZCA 2NYRA 3PC4A 3HKCA 4PGGA 5DHTA 3LPAA 5T4EA 3ZH2A 3T9AA 4LXGA 1LTKA 4HNAB 4UUPA 4BV9A 4C0LA 1U7ZA 4O3MA 4YASA 1VRVA 4D0SA 3LVRE 1GGEA 1AUPA 4GT1A 5DIFA 4CV1A 3LWZA 5JZBA 3BREA 3C3CA 4JLUA 4H7KA 1H4QA 3DHVA 1R6BX 4GXTA 4W8OA 4FXOA 3VX3A 1K5DA 3MIIA 4RY2A 4K5QA 3KT0A 4YRZA 2WUEA 2FF7A 4RGBA 2AYXA 2RGXA 3L1JA 4G1EB 5AHWA 4PHHA 2M6RA 5JRJA 3O4VA 1G8YA 3GRFA 1KC3A 3EGXB 2C77A 2B0JA 5KYYA 2Z5GA 1SC1A 3ESDA 3BF8A 3CIOA 1ETUA 5E6SA 3B3GA 1JDNA 4IDQA 2DP4E 2FW7A 4FE3A 3I32A 2BJVA 1ULUA 1LV8A 2PUHA 2O9JA 3N2GB 1G7RA 1KJNA 5IXJA 4QVIA 3CKLA 2C2KA 4J8PA 1ADFA 2ZTLA 1EXDA 3HMKA 2G72A 1MR3F 4UBNA 3K4QA 4LAFA 2PLFA 4A8JC 2WT4A 3IHTA 4RJKA 2IPOA 4BX3A 3OCYA 1G3MA 1QH8A 3LTNC 5DHRA 2BFWA 3WR5A 1YZ3A 3T41A 3X1MA 5I7UA 1E6EA 4HP8A 3PLAE 1I5EA 3TEJA 1MGOA 4P81A 5CYPA 4DV5B 3TR6A 3WY9A 1E7WA 1JKJA 2CKDA 3NKVA 4L57A 4ZIRA 1W6UA 3DZHA 1KDOA 3DV9A 3H9GA 5AOBA 5EMMA 4COKA 5LLDA 3OE7D 3WGOA 4RK7A 1BD3A 1TJPB 3MWFA 4JKIA 1UZUA 4EUEA 3UA4A 3PSAA 1XUOA 4FBGA 3ZJTA 2VS1A 3G17A 1KMHA 5E9JA 4MGYR 3GYGA 5DM1A 3LXXA 3TUIC 4UM7A 1YAHA 1DTSA 2F1OA 5AM4A 1N5OX 4DNFA 2G0AA 3C45A 3HGMA 5A3VA 3H42B 1NDHA 3T3OA 1NUQA 1S2DA 4EF4A 1KI8A 5A0VA 5CCBA 3U7QA 1P72A 2J3QA 2ZR0A 4BVJA 5HG0A 1LI7A 1GFSA 1W85A 2EDCA 3HUFA 2I80A 1W2WB 4M53A 4CM4B 1UMBA 4BAGA 4BMPB 2XMBA 3HZOA 5KC8A 4BCBA 4KLAA 5H82A 2QUZA 5DTIA 2XTZA 1Z17A 3ZXUB 1YR9A 4E09A 1QIIA 3ESCA 1EWRA 3A05A 2E4ZA 4UUAA 4UVEA 4YJDA 3UWMA 3FOWA 4ZVLA 5TRTA 1Z5VA 4E22A 3IIEA 3QE3A 3I9MA 1G9SA 3L77A 3UOWA 3FYTA 3T5GA 4HYYA 5D8DA 4TL7A 3SM9A 2QDKA 5E1MA 4YVFA 1KDZA 5BUZA 4LC0A 2G1AA 2AGVA 1JNXX 3W3AD 1FFDA 1G8JA 2YWRA 2GJ8A 4JD5A 1AMNA 3B51X 3ELWA 3ZV3A 5KDLA 5HFNA 1MIOA 4TKUB 3FHLA 2JA1A 2JGKA 3OD5A 4E07A 3VA7A 1W4BA 1KYZA 1MOSA 1V16A 3IPYA 4X1YB 3TTXA 4YECA 2WR8A 3MWLA 3O8QB 3ZV7A 5BR4A 4L5BA 1W9MA 1D6MA 1ZWKA 4TKMA 4L02A 4CR6A 1NQAO 1CHDA 2ZITA 3STTA 1OLSB 2D13A 2R4QA 1EI9A 1GRRA 3GELA 1T8SA 3GJSA 2AJTA 2NUBA 1U2SA 1IBMB 1XTVA 3INRA 5FULA 4W6ZA 5EUCA 4G1UC 4HEHA 3U40A 1K75A 1QKJA 2KS6A 1KO5A 2C84A 4UU8A 2WT9A 2YWCA 1H6CA 4EZIA 2IHYA 2XB4A 3QBTA 4PWYA 3QHAA 1XQVA 1DFHA 1S3IA 1A7KA 3FG9A 3L49A 3IFSA 4E70A 4IVQA 1K2WA 2CXQA 3M6WA 1KMCA 2F1KA 3T1NA 5BN4A 2WTAA 4R7GA 3A26A 4KWIA 1W93A 4PQEA 5FUBA 3UUFA 3M2PA 3ZHUA 2Y66A 2FE4A 3C41J 1EX1A 2G9VA 3H2YA 3IOYA 1EVEA 1R7RA 3L43A 3CNOA 2Z3ZA 3G5MA 1Z45A 2F3PA 4FOLA 4PZLA 1T1SA 4BFLA 4QNNA 5DM4A 1XZEA 3ZWMA 1U5AA 3D7RA 2LVBA 3DZFA 2X13A 1XMSA 5JMPA 1UEJA 4IJQA 2WWXA 5EJ2A 5ESRA 2EBUA 3BFJA 1H2ZA 1A4XA 2JKVA 3FN4A 1T8YA 3G5AA 1W9HA 3EXHC 3O9MA 4UUOA 1M0TA 5DBIA 4XOUA 5GGXA 3VJMA 4E30A 4M22A 5CIYA 3HM9A 3IA7A 4NEHB 4QELA 1QZ3A 2O8FB 3SQDA 2H5JA 4HLUA 2OFXA 1TTPB 1U3WA 5DBHX 3TRJA 3UMYA 1JIXA 3ZY3A 1ESCA 1P7WA 3QYPA 4CE6A 4FJ2A 1JAYA 3KUCA 2GZRA 2A9RA 3KIPA 1JFSA 4LOJA 4YALA 1U7PA 4CKCB 2P75A 3H8WA 3MJVA 3AI3A 1HYGA 3DDNA 4R51A 3X1DA 2DWCA 2H7CA 3W5IA 1L7RA 3CO5A 1K4MA 5C34B 2BGRA 5HHTA 4ABTA 1TI7A 2DCMA 4IJMA 2PT5A 2ZM6B 2JG3A 1QTIA 2RHCA 3FPHA 2XECA 5K3DA 1Y6FA 2CDNA 4YUVA 2P4EA 4DOMA 2G9ZA 3C1OA 4NSNA 1FDSA 2BRUA 5FBKA 2D1RA 1TCUA 4GUAA 3HABA 3T1OA 1XOIA 2QRVA 3VR0A 1RBYA 1YIAA 1LBQA 1JS1X 2UZ1A 4R6WA 3VPXA 4YAKA 3K94A 5MF6A 2YNMD 1N78A 3L9XA 3QFCA 1V4VA 1X14A 4DBLE 4S0XA 4Z53A 4MGZR 4ZCMA 1F60A 3ESYA 5K6AC 3EGOA 5JSZB 4X60A 5C52B 1AH2A 1ND6A 3ZWQA 1Q84A 1WZUA 4NMLA 3C3JA 2GRJA 4K2AA 2R5NA 3HYTA 1NUAA 3C16C 1QX3A 5AP9A 1BE8A 1WXWA 5F9HA 3C15C 4JVNA 3AEKB 1W581 3A4MA 3FVQA 3RANA 2C96A 1WABA 4PQRA 3BA1A 4DV7B 1E3TA 4D26A 1I9GA 4WACA 4BUCA 4L5CA 4GP7A 3QV2A 2XE8A 3IEUA 5AKEA 4BS9A 3L6DA 2HO4A 1E9RA 4Q18A 3NHLA 1FRQA 4JCCA 3MW8A 2LIPA 2C4VA 4A92A 1J06A 3ESRA 3ST7A 3ND5A 4PLWA 4RQBA 1TRHA 2IUUA 2YJGA 1P19A 1OW3B 1MB0A 2QU7A 2PM8A 2Q3HA 3KJEA 5EWJA 1SVIA 2BEVA 4X24A 4B75A 1LBHA 1Z0SA 3HU3A 4DE5A 2H57A 2EW8A 1QYVA 4FYMA 4KG7A 1Y1PA 2HM7A 1FE8A 1U7HA 1UDCA 4E4RA 5K2MA 3QLUC 1M6NA 4NDAA 1VGVA 1IJEA 2J5BA 1G8FA 4C0QC 4OLBA 1YHNA 4N5HX 1Q0PA 5EJ8A 4KTTE 4P86A 2ZT7A 5H70A 2JLVA 2FXIA 4GI7A 3IVAA 5CFZA 4JC5A 4ETWA 3DZBA 4PS0A 1U9IC 2WU1A 2QAIA 4OXRA 4RK1A 4B3TB 2J5RA 4EHIA 5FI3A 3MT7A 5C5DA 1TO2E 3JXEA 4URZR 2PBZA 5KVQA 3JVDA 4KQ9A 3RLFA 4ES6A 3ORRA 5CFLA 2FSSA 1OXTA 4JEUA 5JWRA 5LPNA 1YC5A 1CFJA 2PYZA 1AQIA 4QYXA 3T7DA 1AA6A 4OLAA 1XPOA 4MUHA 1V45E 1FDIA 5LJIA 2P1ZA 2HYIC 1C4WA 1LLDA 2F62A 4LRTB 3UEOA 4HS4A 2RGDA 2WQ6A 3V5NA 4IFBA 1K3FA 2MDTA 1LH0A 4J2HA 1E7YA 1Z6TA 2UVPA 5F5XA 2ZIUB 3TE6A 1PW5A 4J29A 4XD7D 4B35A 5LBUA 2XOKD 3L6BA 3ONEA 2ZB2A 5JSFA 2B61A 1IXRC 4BHTA 2HMSA 2WD9A 2PSSA 2QAGC 2O2CA 1XMQB 4KXVA 1B6TA 2O7NA 2Z5LA 4QGBA 3PA6A 3R3XA 4W7SA 3DT6A 2NO9A 4ETIA 5AKLA 1YNSA 4YRJA 4GPTA 1TFRA 2AR7A 2HQOA 1TJYA 3RTDA 4UXHA 5JNUA 3R40A 1HEUA 1JDSA 4EP1A 4TXHA 3KQYA 4B2PA 3G5TA 1TUEA 4DV1B 1YVRA 3CG0A 1XVTA 3LQ4A 2LKCA 5KWVA 2B4RO 2GARA 1CY4A 4BAUA 2IKSA 3C8DA 1GLVA 3FYHA 2PV0A 5IULC 2DTXA 4RKQA 5CHEA 3ZCXA 5BSFA 1DE0A 2QUBA 1JSXA 2R8RA 3UW3A 5LFAA 2O54A 4BJ5A 2AQ8A 2WZBA 2WW8A 3SNHA 3U3OA 4MVYA 2Q8QA 1A50B 1E6CA 4QAJA 3KXDA 2ZUFA 4HEJA 1CF9A 1T1EA 3MSXA 1EZ1A 4N0EA 4MUXA 4R83A 4WW0A 4ZXFA 2WWWA 4QUBA 4Q3KA 2P69A 1F20A 1V3VA 4YRIA 4V03A 1GITA 5DXJA 3WGTA 4RM3A 1YL7A 4DAOA 5EXPA 4EABA 4XFKA 4CF3A 4UTPA 1BYUA 1W4LA 2QTBA 3C8HA 1JI3A 1PTJA 5EJAA 5B58C 2ZXUA 3USZA 1E2QA 2IHVA 1RI5A 3W4IA 1RLMA 2YV3A 3I09A 4JT9A 2G5CA 4PCLA 1SCUB 1E5VA 1JHQA 2I6SA 4DA7A 1UBUS 2VJQA 2ZBDA 3HUDA 4M0KA 4TUYA 1KOLA 4C3UA 4ZAZA 1IBCA 2Q2OA 3UNXA 5JALA 2XWPA 2DG2A 2VRWA 4RPHA 1OWNA 4HXYA 4W7IA 2EP7A 2ZSKA 3RU7A 3E05A 3BA6A 3WAGA 1TM1E 4RAOA 4YAEA 5FO1A 2I4LA 4C4TA 4DHEA 2GBFA 3LVBA 1O5TA 2Z57A 4NYJQ 4Q00A 1GV1A 4R1QA 3UWSA 1EQUA 3QUQA 1VG0B 1TUBB 5DYIA 2WHRA 1UBCA 2ZRJA 4A36A 4YAJA 2UVDA 2FTKE 2HA6A 4ND2A 5A5EA 1NZFA 4IIXA 4KH0A 1OBCA 1BHQ1 2FOXA 4IH4A 3M1AA 3S55A 3K6KA 2OCIA 4N3AA 2DFNA 2IHNA 1H1DA 3E2PA 4JJZA 1H0RA 2GZMA 3IPLA 4XLTA 2VHYA 1H2WA 1WSDA 2HIAA 2ONYA 3ABQB 3UKDA 4A6EA 1JLMA 4D9GA 2D1FA 3A4NA 1CUYA 3F46A 3TFWA 5KAMA 1DSSG 3TM4A 1MF7A 1SVLA 5EE5B 3WIUA 4DLSA 2J0VA 4XGNA 4ZHQB 4RSMA 2BGTA 1XWIA 4F6RA 1H1TA 3D64A 4KVGA 1M2WA 3K5PA 2FJ0A 5B3JC 4X1KA 4BO0A 1T4DA 4ZEWA 3I6BA 1T2CA 3EWAA 3U9LA 2IIQA 3DJFA 3PQ8A 4S2EA 5AD1A 1EZ4A 2JFPA 3SZMA 3QVGB 1DP4A 2WJIA 5AKZA 1H9AA 4AJLA 2C5HA 3HR7A 5LQMA 2CK3A 1NT4A 5EIBD 3U3MA 3PR1A 5TQ2A 3EMVA 1HT2E 1P5FA 1TAQA 2V5AA 3HKBA 3HV0A 4H27A 4LYJA 4QJ5A 3OUUA 2F43A 4N5NA 2GJ9A 3R76A 3V7WA 3VBEA 4FX2A 3MFQA 4UW9A 3JWPA 4EQ6A 3E2MA 4GI5A 4EJSA 4LI3X 4C7VA 1N3YA 4D79A 4DXDA 3ZV6A 4P31A 4JLMA 1FMCA 2FPUA 2GJSA 3NHWA 3IAM1 3BHJA 3VPDA 3NNSA 4RD1A 2SCUB 4BVHA 3S8YA 3CLSD 1G8KA 1Y89A 4UU1A 5DB4A 1X7XB 4ZJZA 2XGOA 3UT5A 1L7NA 3Q1KA 2JLUA 2ZRGA 2AV6A 4YXWD 3G0CA 1GZ5A 1DRUA 1Y3BE 3FIUA 3I73A 1RKUA 4HDQB 3S1AA 4HEQA 5KJFA 5KNDH 2A9QA 1SFRA 1FU4A 1U0TA 4G4SP 2OV2A 1NR1A 2WYOA 2FRVA 3JASA 4BCCA 3ICQB 1D2EA 1JHAA 1U2EA 4Q4AB 5HS6A 1OTYA 1UDBA 1C8VB 2PGNA 5C8YF 5AW4A 1G4AE 1KZYC 1OB2A 4F06A 2IH4A 3TIIA 2CBZA 4ZO4A 3NEAA 3ROKA 2PGAA 3O1HB 1NR5A 5KNCH 3IV9A 3G2NA 5ER9A 1L5KA 3C6XA 1YACA 1OASA 1NVXQ 3AFIA 5J4VA 1TLTA 3IQXA 2EF0A 1CDEA 3SXJA 2A3RA 1UKAA 4NEQA 1O96B 2KSQA 4XJVA 4U7HA 3ZHQA 1CE8A 2CLSA 1QK4A 1RWPA 5CA0B 1QZUA 1YZHA 2SKCA 5C8YB 1BS9A 1YRWA 4CLEA 1PTKA 2G1KA 2I22A 3RYIB 2XF8A 1IAQA 4K8RB 2W6JA 4NRDA 1DX9A 1BXGB 3C6KA 3DVQX 2OBMA 5FPKA 3IMKA 3B5JA 4I2VA 3VVMA 4W5NA 3P7MA 3SFVA 3UN1A 1SC6A 1YC2A 1ZD1A 4WOCA 4BMYA 4KYIB 3JQ7B 2G7MC 2ZYHA 4NCAA 5EJMA 1M1YB 2XRMA 1WS6A 1AZWA 1FX0A 3E1KA 4KHZA 4PSAA 1YQGA 4LZPA 2VK1A 1PHRA 4GECA 4Q1CA 5BNFA 3DHYA 3G8AA 3ZU4A 4HVCA 1AZSC 1TTTA 4CQLA 2D1SA 2FKNA 3MQ2A 1ZNQO 4IG4A 4RZ2A 4BB9A 2HJ9A 3GLIE 2BFBA 1KYXA 2OYCA 2XZPA 3W90A 2R86A 1T9GS 4ZVSA 1MHTA 3N74A 3HBAA 3WGUA 2MTBA 3TRDA 1WDMA 4UQLA 4R16A 2DT5A 2ZANA 2DUJA 3C97A 3LBYA 1I24A 3P4XA 3IVXA 4GPBA 5E6UB 4ZPXA 3V1TC 4OQFA 1S8FA 2C5EA 2YIVX 1C9JA 1U99A 1Z7GA 3ILSA 4ZO6A 5H0IA 4MIEA 3KB1A 5I9MA 1H85A 4F38A 4TTQA 4R8VA 5KDDA 1NNEA 4UUQA 4FZJA 2Y1GA 4X1IB 5H4GA 1XKTA 2IF2A 4G0ZA 4ZGBA 2DPGA 1BCRB 1BWSA 1G6HA 2W98A 3B9RA 5BYBA 4ZK2A 1PJRA 4P84A 4MLPA 4Q0MA 2FDXA 1SCQA 2WWHA 2XE4A 4CMJA 5K05A 1NXTA 3A6ZA 1EK2A 2OBNA 3C5CA 4Y98A 3RYHA 5FWXA 4Z7NB 1RYYA 1YL5A 5D7NA 4TTTS 2FZLA 3CX7A 1YVPA 1XVIA 2QLJA 2X0NA 3CRW1 1GPLA 2VXYA 2JVJA 4DQUA 1VKHA 4ZCSA 3AL2A 2ANCA 3A9RA 3DLAA 1EFTA 1QK5A 3RYFB 1SPBS 2QM0A 3UXMA 4CRWB 1DO0A 1B0PA 3QFHA 4IOLA 2B6HA 2BI7A 5G1NA 4AZTA 4HAYA 4XYGA 3Q9UA 4JI3B 2WU0A 2H4FA 1J0BA 1BKYA 2HCJB 3LT4A 5FLXA 4RABA 4ZARA 3GRVA 3ZKAA 3GGJA 5L9AA 4JC0A 1BH6A 3CSUA 1U63A 1BDIA 3UA3A 1U80A 1HT0A 1U9JA 3DCYA 3ZWKA 1FTGA 3CLVA 3Q6IA 7ADHA 4LTDA 2VPZA 2NO4A 2W8BA 3O2JA 1W7AA 3BM5A 1SAYA 3IUJA 4G01B 1ULAA 2Q3LA 3D0OA 1GKIA 5D86A 4QM7A 1Y8RB 4CG1A 4N82A 3HCEA 5C5IA 3EXG2 2JNWA 3FETA 3ETCA 4RIIA 3D1LA 3BWVA 3M3DA 2Y68A 5BWOA 4EHJA 2I0FA 3CURA 3NT4A 3C8UA 2H54A 2DPLA 2FVXA 2I6TA 5TT0A 4FFBB 4B4WA 3MCUA 4MRMA 3LUBA 5EINA 2HBYA 2Y05A 3THXB 3GQBB 5ALEA 2FP4B 2VOJA 1QHHB 3COYA 1R10A 2QZPA 3MM4A 1IXYA 3JYLA 5L7YA 3L8HA 4DLWA 2LW7A 3QW2A 4MRNA 4MYHA 2WTBA 3G6KA 2XQKA 1FTSA 3LV8A 4P9NA 3I45A 3JQRA 2Q4RA 4I7EA 2Q4BA 2W7TA 1KQFA 4HQOA 5TVKA 3E7PA 4IQ8A 3O8RA 3ZGXA 3SBXA 1T91A 1XHLA 2W0SA 3KKKA 1E5DA 3L4BA 3NTXA 3Q3IA 4PYJA 1TAUA 2G5TA 2R9VA 1H2XA 1YKFA 3B6EA 4DCJA 1MUUA 1IFXA 2HA5A 421PA 3FTQA 2EF1A 3HCDA 1OYVA 3I64A 3DQPA 4G5QA 4RKEA 5DTRA 3U4DA 3RHFA 3T3EA 5IKEA 4FYIA 3GPCA 4UJ3A 1MJ5A 3L1VA 2DFDA 3LUGA 3KTFA 5LMNB 1QG4A 4GQIA 1P2FA 1EGHA 1GARA 3FHOA 1QRTA 2B7LA 2X15A 5IK2A 1S1CA 3ODGA 2QSJA 5JJLA 1T1IA 3DE6X 1Z2DA 1DC8A 2J5XA 1D1SA 1IB6A 3ELUA 4PIMA 4WFIA 5CM9C 2NXEA 1D7OA 5ALOA 4Z49A 1DCTA 4NYIR 3RARA 3QEAZ 1I1QB 5K4HA 3CW8X 5AKGA 3O91A 4BQPA 1ND5A 3SGLA 1L5FA 3G8DA 4G2TA 1DB3A 1SBQA 2B98A 1NVUQ 2CHEA 3FOBA 3SC4A 1AN9A 3CZAA 3WYDA 1P4AA 3TIXB 2G4CA 2ZWAA 3F7OA 4XGKA 2WM3A 3HDVA 1VKOA 1I6LA 4PXSA 5B12A 1SG6A 3CPSA 4DMRA 2V1UA 3KHKA 4R9SA 4DPKA 3N8DA 4FOTA 4GE3A 2QMYA 5B7PA 2PUGA 5F2NA 4WXPA 3BMQA 1UANA 1PEKE 3SYMA 4TRJA 1DKLA 3U44A 1DKUA 4H7HA 4I6JA 4UOZA 3JSAA 1X9IA 1P6UA 3HFRA 3Q2OA 4RJTA 4WV3A 1E62A 4J3JA 1I13A 1VBFA 4QYMA 4W6QA 3WNQA 5MHTA 2C2WA 4AF6A 4WMLA 2BKXA 1DQYA 2BW0A 3DYIA 1J23A 1Y8QB 3NEYA 4B6EA 2Z8XA 5C8VA 3MUNA 1XRLA 2NVBA 1B3BA 3KDAA 1YR6A 2X4GA 1R00A 1QX4A 5BUCA 5ENDA 3QNUA 1IHPA 4GOMD 1MEJA 1QFYA 2B82A 3UJ3X 1Z83A 3G79A 1YS6A 1PJZA 1A5AB 2OCGA 1MAAA 3OQOA 4OA5A 4IYJA 5IYZB 4MAMA 5A3RA 3PIRA 1AKTA 1KORA 1N5IA 3L8DA 4DLPA 4FVTA 3JARA 3EVTA 3F1LA 4K2HA 4RHTA 4YO8A 1RC8A 1D4ZA 5KNDD 4NK4A 5KX5F 2OBXA 2ZE5A 5DRYA 1EUZA 3AHDA 3I9V6 4JYPA 2NO6A 4L9AA 1RACA 2FFRA 3OU7A 4BFVA 2VSOA 2PZBA 4KK4A 4L6CA 2F4VB 1N2HA 2BV3A 5HIKA 1CS0B 2F8SA 2OAQ1 5JNWA 3DMHA 1NQOA 1AS2A 2ZUSA 2FLKA 4FWIB 2KHZA 3E3LA 1PLKA 4KQ1A 2ZPTX 4JFRA 4LRQA 4Y6LA 1E99A 1Z2NX 5J40A 5BQPA 3WGKA 3NAQA 2XHZA 4HDAA 3KS9A 1LLCA 4KFTA 1TYAE 1NFQA 4IZHA 4HDOB 2XAAA 5AVRA 3ITKA 4Q24A 5JECA 2EC5A 2ZAGA 2VNAA 2R6DA 2VTBB 1NBMD 2QUJA 5BSHA 3U3DA 1TU4A 5HF6A 1E3WA 4RZIA 5E2AA 2LCQA 2VATA 2VC2B 4KRYA 2BLLA 1N3IA 4ZA2A 2JLZA 3K0FB 3KTDA 4R0NA 2CXSA 3S2ZA 2XKKA 4RXTA 2A5DA 2YY7A 1E7QA 2YWHA 5K0ZA 1XZDA 3AJEA 2OWEA 3PJFA 4K6OA 3U7RA 4JXZA 1UKVY 4D8YA 3D4OA 4OXXA 3KOYA 1LRLA 2ID4A 4LQCA 1CR0A 4WY2A 3UUGA 1BDHA 3MBIA 4LJAA 2XUZA 1NBIA 4QHSA 4RQUA 2XBMA 1CJTC 3EZ9A 4ESEA 3IVCA 1RJWA 3VM6A 1PI3A 4K1XA 2IXFA 3GNTA 3QPDA 5J1TB 5CEFA 3UYLA 4KP7A 4PYKA 2BHTA 4LFBB 2PN1A 1F3LA 3FVVA 3L7OA 1YD7A 3GD5A 2EGHA 3JQGA 3L84A 4DC0A 4AP5A 4GLOA 1U2DC 4XR9A 4BFCA 1SWWA 3PL1A 2CLIB 3KYJB 3EPKA 2ID7A 3SXUB 3IPXA 3C5EA 2P9FA 4OJMX 3WIVA 2DQ4A 2NIPA 2OV3A 4BNGA 1U7TA 4GWKA 2J9GA 1CERA 2YH2A 3CLKA 4BVKA 4MR8A 2JLSA 2C7VA 1N6PA 2UZ1B 3PF8A 1KTIA 4P4SA 2BGIA 4QFCA 1XNHA 5BVHB 3IALA 1M8JA 1F2DA 2C9OA 4M9XA 4BLUA 5ALIA 4DCSA 4IWXA 4HDNA 4O2BA 4I4TB 3GV0A 1AK2A 3U4GA 3W2HA 4ED9A 5A4DA 2O3RA 2JHFA 5CAEB 3D3WA 4JQOA 1KZHA 1GAQA 2O6HA 3GZNA 3WLPA 2VKQA 2EJTA 2YBDA 2GWRA 3H11A 1JJAA 2FLVA 1UIRA 4HFMA 4RELA 1TIPA 2FETA 4ARCA 1XL0A 1BIFA 1L8XA 4IAOA 5FTWA 3HS3A 4D0GA 1I3KA 4XVUA 1U90A 3LX8A 3K96A 3C3BA 4MKRA 4WLFA 4PSDA 1WQ1R 1HFJA 3VYSB 1LJLA 2KLBA 2NG1A 5IM4A 2BBWA 4YI3A 5K7SA 1PBTA 5D5HA 2B4YA 3H2JA 5A4IS 4QASA 1OXKB 2A9FA 1H5UA 3NI2A 4I5EA 4AN4A 4C6SA 1PFQA 2P0EA 3T52A 4C87A 1HNWB 1KOJA 3IEXA 2F3RA 3Q7SA 3M7IA 4R9RA 5F5NA 2PKQP 3IHWA 1J7KA 2V74B 5BWNA 5K6RA 2PGXA 2ZSHA 5EZ6B 4KXXA 5G4KB 2DBYA 3B7WA 4MQUA 3P4YA 2WIFA 5AW7A 4BNZA 1YAJA 4YH1A 4AJ2A 4B43A 1DFGA 2Q5CA 1EDDA 2MINA 2JI9A 3MJEA 4POAA 5ALYA 1G5PA 3WMEA 2WJWA 3C3AA 3WTBA 3M89A 1TECE 3T3HA 1TC2A 1TQ8A 3RK0A 1UP4A 4G1CA 4UHJA 5LD2B 3AHHA 2Q9AA 3RRMA 3MOGA 1Q77A 1OI7A 1E0KA 5AW2A 2Z09A 1PNTA 2JJ1A 4BQQA 2ZRMA 3HA2A 2HMVA 2WIGA 1OHHD 3I0ZA 4KKVA 4B8ZA 2BE7A 2H1IA 3EGDA 2P5SA 1CZOA 2W37A 2OM2A 3GFTA 3FUUA 1PJBA 3N2KA 5E0KB 1RWWA 4MEJA 5A7GA 5HUHA 1W36C 2ZCJA 2CEKA 1CUEA 4E2WA 2WJYA 4ESOA 1AF7A 4DCOA 2AI1A 1G8PA 2VHEA 1YI1A 5EESA 5DK6A 4B3GA 3MOSA 1SH7A 2WLSA 2QZSA 3MPOA 3MRTA 4RETA 3BIJA 1JEEA 1P1RA 4URVR 4PRLA 1I7QB 1JQDA 2FCAA 2ZTMA 5AHRA 2V98A 3E58A 5AHKA 4YX9A 4NCKA 5C32A 2FN4A 2BMFA 3FRHA 2I7TA 3FW1A 3GEBA 1WHSA 1U2DA 3S7ZA 2WWRA 3IO3A 3ZHSA 1OYYA 1YS1X 5FQOA 4KQXA 4UCFA 3CX4A 4A6XA 1V3UA 4D02A 3SF8B 3ASYA 5L95A 2ZCUA 1KHTA 4EYKA 2Z3VA 3LBAA 4B4DA 3I2GA 1O8BA 3EJ6A 3C85A 2HMUA 3EN0A 4RX1A 1Z6GA 1EJBA 1KJ8A 1MU0A 3ZD6A 2MMGA 4EI9A 3CPHA 1EMDA 1LU9A 4ND4A 5AQ1A 2V65A 5DMXA 4DR6B 2R97A 1OWPA 3T1YB 4WKOA 2QTCA 3UOGA 5J63A 1PEAA 1QCZA 4RSHA 4CNBA 2ID9A 3HYCA 3IRVA 1PV4A 1F51E 4WLNA 1GTZA 3Q6NA 4HH4A 3ZWPA 1PK9A 2A35A 1OXVA 1EINA 1FFCA 1UKCA 4ZALA 5A04A 3AG5A 1F14A 2FR8C 3L7NA 3N6VA 1DTEA 3NP7A 4AJ9A 1DDOA 4E1VA 4R0MA 2NU8B 4I2NA 2XB8A 1CKEA 1G16A 4C3OB 3N2GA 2SICE 2J3DA 5EIEA 4BRUA 4Q1DA 4CYMA 1E4YA 2X8BA 2YXDA 4YJHA 2Z83A 1KJZA 2YV5A 5JCJD 1ZVVA 2A67A 3ISTA 1AB5A 3D4IA 2QGNA 2QROA 3ABSB 1Q91A 1VHLA 4MVWA 3IBSA 4QTTB 4NYJR 4HPXB 1U9IA 4Y0VA 1U31A 3GL9A 1RE0A 2HL6A 4H60A 1IQPA 4YA6A 4N47A 4E2FA 4M9ZA 5DM0A 4XQ0A 3TKLA 3OTOB 2IEIA 2R7LA 4XJSA 2YV1A 4ZRMA 2O2XA 4DMUB 1D0IA 1SOMA 2XJ4A 4F12A 2UVQA 3KTAA 2CYAA 5J2TB 1HE8B 2P7IA 5JO0A 2BGLA 3DWFA 1YUBA 2MOKA 3C6YA 5E6RB 4QU0A 4EY8A 1J90A 1WF6A 221PA 3HBLA 5DCUA 5E2IA 2PS3A 3UK1A 4OOFA 13PKA 3E0XA 3MWEB 3P2YA 2C8KA 3VTAA 4BO5A 2QSZA 1NAIA 2FSFA 2XT6A 4JC4A 5F7JA 4NV1A 4ZPJA 2VF2A 5I7EA 2C7BA 2J1LA 3E53A 3GYBA 1K2VN 1R74A 1FUEA 3GA0A 3QEOA 1ES9A 1V96A 1ZD8A 5I8WA 2DUWA 1JJIA 1R27A 2VSNA 1WPQA 2J46A 3EVGA 5E7MA 1PS8A 3CRZA 4KLRA 4NC9A 3KALA 3WGGA 4BLSA 4DCVA 4B6RA 3STXA 4NMWA 2BR5A 4X9XA 3M6MD 4WADA 1WDTA 1UMBB 2CFCA 5ICMA 1AXGA 4LXHA 2GO7A 1GV0A 3HKEA 3QVWA 2VK4A 3JQFC 1SKUA 1GVNB 3D9QX 2VJAA 3Q7IA 4PN3A 4UQPA 1HZJA 3TZBA 1HPLA 2WAYA 2DRIA 5IAKA 2BGNA 5HTKA 4B7ZA 2B1JA 1UAGA 1XDZA 1XPRA 2WMYA 1M54A 1JEDA 3CO0S 4Z4FA 3K15A 2QI9C 3T0FA 1ISHA 5L3VA 1LBEA 1D2CA 3IJEB 1NAHA 5ARDA 4PINA 1NW6A 3NXSA 3HKDB 3RIHA 1NM5A 5K0GA 2Y4OA 4J3FA 4RJIA 1E2PA 1LBTA 2PL1A 5LQJA 2C9DA 3HQ4O 4LHXA 5DTJA 4F9GA 5C80A 4ZQIA 1GFWA 2AJ8A 1PNVA 1WRBA 4YAIA 2DAPA 4M83A 1D6NA 3KWFA 3TQHA 3COZA 3JATA 1R4NA 2VP2A 2R00A 1ZLYA 2FUCA 2Q6TA 3DCNA 3FNRA 5CBKA 2QYTA 1USUA 1NIPA 1J1IA 1ATZA 2HC9A 1G7CA 4OM8A 2PRJA 1OT3A 1FLAA 4MYDA 3LOPA 1WD5A 3HCNA 5TQ2B 1FMFA 5GY7A 1NHWA 2DWOA 1UJ2A 2J3KA 1KZ9A 3E9DA 2FV8A 3MWKA 1G3UA 2ATXA 1QS0A 1X7XA 3A1VA 4JWKA 4Q3EA 3OMWA 3TJZA 2GLXA 4JB3A 4AFNA 5HRCA 2OV4A 4K9KA 3R5JA 1V8DA 3RBAA 4QICA 4M37A 1K7CA 1Y7IA 3RJ9A 4UBKA 3K9FC 3W34A 3N86A 1T8RA 3GRAA 3W6UA 4LF8B 1K66A 2BTEA 1Q0HA 2BDTA 3WSTA 5EFZA 2GEKA 4XEHA 4XPIA 1VL1A 2VNSA 3ZDFA 3BK7A 4URXR 4L3OA 3PYMA 3L0DA 4D4KA 1T1GA 4QPJC 4P98A 3R0VA 1T3LA 4NDNE 4TZTA 5ALWA 3VZBA 2RI1A 5EGSA 1HC7A 5IEBA 2ACEA 2WFLB 2HH9A 3MJRA 3NUGA 4CMBA 2CHGA 3L1IA 1XAHA 1TMGE 2P9HA 1E5XA 3NHMA 4IM7A 4K9NA 5DP1A 3TNDA 4AN1A 4YV2A 1DRKA 1Z0AA 1QU2A 2L82A 4IINA 1M9NA 4R8RA 2Z9BA 3L6RA 1UP7A 2J3JA 4HDSB 4M8LA 1CU1A 3SJUA 1QFSA 3TLGB 4ALLA 3VNVA 4JMLA 1EA7A 1RXYA 3C3KA