1I2ZA

E. coli enoyl reductase in complex with nad and brl-12654
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i2zA00
1XDWA 4IDCA 4RPJA 2GERA 3ROPA 2CUKA 4W7HA 1MC5A 4KDEA 4U0KA 1Q7CA 4NH4A 4WLVA 1U28A 4YAEA 3AY3A 4KMSA 1CDOA 4RV9A 5T6BA 2JFHA 1PL7A 2E4AA 5TJHA 3VPXA 1KYQA 3WBBA 1DFIA 3H6KA 3X2EA 2V6GA 2CY0A 2VWHA 3BTUA 4BKOA 1KETA 5ENVA 4LW8A 3D4OA 4FOSA 2C2YA 1NHWA 2X5OA 4P4GA 4LISA 4Q3CA 5FFFA 3OJLA 3NV9A 3PDJA 3P2YA 4QFCA 5T8KA 4LCEA 4CM9A 3OA0A 1LTHR 4MKXA 1ONNA 4D41A 5ILOA 1GUFA 1LDNA 4LVUA 4UEOA 4BS9A 1GQYA 2VUTA 3JCZA 1VJ0A 4I9UA 1Y8RA 2X0JA 3Q1LA 3GPIA 4ZICA 3U5TA 3RFXA 3W4IA 4DC1A 1ADCA 1DPGA 1ULUA 2B36A 2J3IA 4GMFA 4GKVA 4I08A 2B0JA 3AU9A 3K31A 4H16A 4ALLA 5B37A 2GLXA 2VWQA 5HRUA 3ZNNA 3LU1A 1HT0A 1Q1NA 4Z9FA 3VH4A 5JC8A 3QVTA 4DMMA 4WCFA 4E2ZA 4ALIA 1PGOA 2GD1O 1KY4A 5LC1A 3K73O 2ZYAA 4CV1A 3IJPA 2Y0CA 4XYLA 1WDLA 2XXJA 1VPDA 3JQGB 1NYTA 4CUZA 2V6BA 4E31A 1FXSA 2AHRA 3I6QA 2BGLA 3F1KA 3G1TA 4OJNA 1QG6A 3LDHA 4BNYA 1XHLA 2VQ3A 2HMVA 2H6EA 1FF9A 3G17A 1PQUA 4IZHA 2FN7A 2NTJA 3AOEC 5DCWA 4B4VA 3TL2A 2Q45A 3D1LA 3KZVA 3AK4A 3OJEA 4CM4A 4MP3A 4EI2A 5FI3A 4FR5A 5KJEA 3NX4A 4OOFA 2PZKA 4RVUA 1DDOA 4XKJA 5H82A 1C0IA 4XX0A 5CDUA 4JJFA 1HYEA 5CDSA 3GFGA 5ER6A 3ROQA 3ABIA 1HSZA 4FFOA 1L7DA 1ZEMA 4FC6A 5JSFA 4CPDA 3PWKA 2X1HA 5TSDA 4CMIB 4TSKA 3PHIA 2XAAA 2GZ3A 1ZVMA 5L51A 3NAQA 3C1AA 4BNFA 4YAIA 1YL5A 3K9QO 1RM4A 1E1MA 2GASA 3H5AA 3VAZA 3I5MA 5F1KA 3ASUA 2B83A 4H3VA 2HSDA 2OORA 4WE3A 5AXCA 5JO9A 1E7YA 2V6MA 1JKIA 4WECA 4R1UA 3WGZA 4JX8A 3NGXA 1UZLA 2P9EA 2RH8A 4UUNA 3RC9A 3S1LA 4E5NA 4I5GA 4CUKA 2G76A 4TVBA 3PZBA 5G2OA 3D4PA 2DFVA 1R37A 4NK5A 3VZRA 4JCOA 1UXJA 5TRTA 3JQGA 2OP0A 1HDRA 4RLSA 4BO6A 4HP8A 5JCJD 4G2NA 1P44A 2C2XA 4XQCA 3F5QA 5JCJA 3BMCB 1X13A 3IUSA 3CH6A 4WGGA 2IZ1A 3RKRA 4Y98A 5A05A 4J2OA 3HN2A 2FSSA 3EVTA 2VT2A 2FHSA 3FNHA 3KRTA 3IMFA 1DRUA 4IZIA 3ONEA 1ZJYA 3QWBA 3RD5A 3UKOA 1LDBA 4N7RA 1A4IA 3DZHA 1PJLA 2GZ1A 5DT9A 2EKPA 1FDWA 2X23A 3KVOA 4RDIA 1DEHA 4AJ2A 1IPFA 9LDTA 5BSFA 4YPOA 1BXGB 2VRBA 4MINA 1EVZA 3WIDA 4DPKA 2RCYA 2JHFA 1LEHA 1P77A 4R41A 1Y6JA 5B1YA 1PQWA 1D8AA 1LSSA 3N58A 1LSOA 1EQ2A 4CMIA 3GUYA 3F1LA 4RO0A 2ZATA 4Q3NA 4BNIA 2O3RA 1GY8A 3EYWA 2Z5LA 2ZK7A 3HHPA 3CKYA 4WUVA 1EE2A 2Q1SA 3GN2A 2DBZA 3RBVA 2BLLA 4XD2A 1P0FA 5DP1A 3VKVA 1HKUA 1BDBA 2PK3A 3OIGA 4LK3A 1H6DA 4BHTA 1DIRA 2FY8A 4L73A 2IEBA 1H94A 4R68A 4XB2A 4KOAA 5DOVA 2VUSA 3MOGA 2GPTA 4BIIA 1CETA 4GLLA 1LQUA 3FN4A 4QFDA 3W8FA 1DHTA 5KJFA 1HDZA 2IRWA 3H2ZA 2ILTA 1LA2A 2BFPA 4NR0A 2YZ7A 2Y67A 3JYOA 2XF8A 3DMTC 1LSUA 4L8VA 2Y1GA 3W6UA 1KEPA 3BMCA 4KTTE 4M89A 4D3DA 4D3SA 3H2SA 1SB9A 2UAGA 2HJSA 2X0NA 3BA1A 4BO7A 4IMPA 3L6OO 2I99A 4TVOA 2DT5A 4D42A 2BMAA 5TQVA 3DR3A 4J1TA 4EGFA 4ND5A 4B3JA 3DZIA 5AXDA 1ZSVA 1EUDA 1QYCA 1ZW1A 5CAEA 1CEQA 3BHMA 4FBGA 2WD7B 2DPGA 3PTZA 1D7OA 1KVQA 1W8DA 1MLDA 2HAEA 2Y93A 3R1IA 2VNSA 5CEEA 3SJUA 5JW6A 2NU8A 4QSMA 3WB9A 3W4JA 4F6CA 4NU5A 4XRRA 2HJRA 1T2EA 1EVIA 1KEVA 3RJ5A 1GYPA 4N5MA 1H93A 3CINA 4YRDA 1C14A 2ZKLA 1UJMA 3PRJA 4R1SA 4EJ0A 2X7HA 2BI7A 1UXIA 2QRKA 3QVSA 2PTGA 1KIFA 4GQAA 1KVUA 2F00A 1H6CA 1VM6A 3ZZNA 3WICA 1XQ6A 4XEHA 1GPJA 1EVJA 1ZK3A 3GVCA 5BNTA 8LDHA 4PLPA 3ICPA 1G0OA 3GDOA 4OHUA 3KV3O 4HUJA 4YA6A 1X1EA 4UREA 4HBGA 5TS3A 1XELA 3D64A 3LT1A 3OF2A 2IEDA 2PD3A 5IDWA 4QTZA 5DBFA 2TMGA 5CHEA 1NX6A 3FNGA 4BB5A 1JWAB 3I9NA 5LDGA 1CWUA 3GVPA 4IY1A 4NG5A 4RGBA 3WQSB 1ZJZA 2E37A 1SCUA 3DAGA 4FFLA 2W2LD 3NUGA 3AUAA 3FNFA 1EDZA 2YJZA 1LC0A 2B4TO 4ZQFA 2J3HA 4AVYA 2PV7A 1ZK1A 4MO2A 3ZWBA 3OSUA 2O2YA 3GGPA 2NNLD 3DHYA 3UGKA 3INRA 3KUXA 1JKJA 5I9LA 2FPGA 2XPCA 3ZNOA 3TRIA 3UCEA 4D7AA 2PZMA 2BFOA 2Y1EA 2WD7A 1DBVO 2O50A 1PZGA 3IDSA 4LMRA 4LVCA 5HA5A 4BNKA 2XOXA 1V0JA 1NAIA 1UP6A 1LC3A 1OAAA 4RVHA 1KOLA 4OL9A 3U4IA 4FIZA 2CVOA 3I9LA 2EV9A 3D3EA 4NZ9A 3OQ1A 4KQXA 2BF7A 2C54A 3C85A 2VHWA 4QT0A 1LLQA 2DTXA 4YACA 2O7SA 2Q2QA 4RDHA 1QORA 5ES3A 1PZEA 4BOYA 4K6FA 2Q2VA 4XR4A 4BNUA 4FGSA 4MVJI 1QMGA 1UUFA 1H6AA 1W0CA 2NU7A 2P4QA 2QIOA 3H5RA 5L45A 2EIHA 4E5MA 2BFAA 2FOIA 2J5QA 3DQPA 3GA0A 4MIYA 5TIIA 3E9QA 4NJMB 1M6HA 1I32A 1V35A 3JD3A 5TT0A 4BKUA 3ZV5A 3AI2A 2CF6A 1U8FO 1GAEO 5F1PA 3GDGA 3QLJA 4B4WA 4GI2A 3SXPA 3GR6A 4LSMA 1SAYA 1F14A 1LBEA 3ZU5A 1C1DA 2GGSA 3WGHA 3CXRA 2I5PO 5C7LO 2W8ZA 5IF3A 5HWSA 3RKUA 1E7WA 1LLCA 4Y9DA 1YQXA 4GX5A 4XQEA 2X9GA 1GTMA 1UP7A 2J6IA 4ITUA 1P0CA 2A4KA 1KEUA 2HLPA 4YT8A 3WYEA 1C1XB 1PGNA 1B2LA 1LRLA 1O6ZA 4RPKA 1B8VA 4FOOA 1R16A 4GX1A 4I8XA 3ENKA 1PS9A 3LLSA 2WSBA 1LSJA 3T4EA 4C7JA 3DTYA 1K3TA 1E77A 4ILKA 1GDHA 1NQTA 3CE6A 4QXMA 3WJ7A 1YJQA 5BSEA 5GZ6A 5HTOA 2Y0EA 3CUKA 1HF3A 3H3JA 1HZJA 4BO1A 1Y81A 2B69A 2IDZA 3HN7A 1T2DA 1B14A 5I7FA 5BSGA 4A26A 4GGPA 2EW8A 2LDBA 3NKLA 5L53A 3MJCA 5ENDA 3OJ0A 1DXYA 1Z7EA 5GY7A 3U9LA 2NUAA 4K1LA 4YTEA 4DBVO 3IP1A 5CG1A 1BWSA 2Y0DA 3S55A 4GH5A 1NR1A 2HK9A 4CM5A 3F3SA 3RFVA 1PJCA 5H81A 3NRCA 2D0IA 5KVQA 2NVBA 4CMBA 3G1UA 3A4VA 3GC6A 1NQAO 1Z74A 4NBUA 1GFSA 1V3VA 2YDXA 4PLCA 5H83A 3ZU4A 1YKFA 3B1KA 3IQDB 5JAIA 3PDUA 3AI3A 1YGYA 5G4KA 4NJMA 3KYDA 3QQPA 5F1OA 5ILGA 2PKQO 2CF5A 2G0TA 4WOKA 1F8FA 4PG7A 1SEPA 3QVXA 3D5QA 1EZ4A 4D44A 2D59A 3H65A 3TF5A 5LDHA 3OH8A 2Q4BA 4F46A 1I5RA 3FD8A 3JYQA 5CP8A 4AJ4A 3I9OA 3LK7A 3SLGA 1MG0A 2OMEA 1PS8A 1DAOA 1NWCA 4UVDA 1GU7A 4UUPA 2NACA 4Y6RA 2Y05A 4N54A 3QVWA 1O9BA 1TXGA 1AHHA 4UEKA 2QZ9A 3EGOA 1F17A 3C7DB 3H4VA 2VUUA 3I52A 2O2SA 4BNZA 4IGEA 2CDAA 4IINA 3RIHA 1HYGA 1I30A 1PGQA 9LDBA 3TZHA 2G1UA 3GDFA 3EHEA 1UXGA 4A7PA 2Q50A 4HX5A 2BELA 3UN1A 3DBRB 4I1IA 5TNXA 1SNYA 4JBHA 4PZEA 5FWNA 1U5AA 4NU6A 4BO4A 1A5ZA 5DBGA 2FPPA 4BKRA 2JFGA 4PIVA 1PWXA 3PEFA 1GV1A 4W6ZA 2BGMA 4AJNA 4WLEA 5JMPA 5JS6A 1IY8A 3ZHYA 1I2ZA 2E48A 3GT0A 3GZ4A 3PHGA 1PR3A 1ENYA 2DU8A 3DTTA 5ITWA 1GPDG 3GEMA 2YFHA 2ZB3A 2JFFA 5L7TA 1DIGA 2FSVA 5DN9A 1AN9A 4AFNA 2A92A 2Y1FA 2W98A 4JN6B 2X22A 4A73A 4AJEA 3ZHXA 4XYGA 2OHXA 3TNLA 1GUYA 2AEMA 3UFXA 3DAPA 3L9WA 2I6TA 1SC6A 1M6WA 2AE1A 3ST7A 4II2A 1OC4A 3DMTA 5K6AA 5EQFA 1U7TA 3FI9A 2R00C 3FSRA 4BGUA 5I8WA 4CMEA 5IXYA 1CF2O 2DBQA 3VZQA 3D3WB 2EKQA 3V2UA 1JN0A 1X0XA 4RQTA 1YONA 1RM3A 3UOGA 1V6AA 3C7AA 4RL6A 3GVXA 1VSVA 5J23A 5JYEA 5EPOA 1QLJA 4NFSA 4GVXA 1SOWA 2IYOA 5DNAA 4I9NA 4IM7A 1T1SA 3LC2O 4J4TA 4Y67A 4CLOB 1T1RA 2NTVA 3TZKA 5CDYA 1VKNA 4I5DA 2WM3A 2D1YA 3WDSA 1D3AA 3HUDA 5DCYA 4A0SA 4Z3KA 4XJSA 3BTOA 5FI5A 2BI8A 3AWDA 3ZU2A 4KUGA 3PGJA 3MTGA 5I9MA 4BNJA 5U9CA 1MXFA 2I3GA 2WE8A 4MVJA 2I9PA 1JAYA 4N18A 1TT5A 3C7CB 2VHVA 4WLUA 3DBRA 5F5LA 3DZFA 5A3VA 3VTFA 5L7WA 1U3TA 1YB1A 2Y68A 3JQ9C 4U6QA 4O5OA 4WLFA 3DZGA 4A03A 4I9HA 3KYCB 2ET6A 5JMWA 3D0OA 1SZJG 4D3FA 4YR9A 3W8DA 3M1AA 3GQVA 1A9YA 1VE9A 3QSGA 4B7CA 3GAFA 3N74A 2NM0A 4WASA 2CVZA 2X86A 2ZQZA 3ENNA 1UDBA 3NT5A 1UZMA 2W4QA 3PPIA 5BT9A 1BTOA 4XQ9A 1L1FA 3TZQA 2IZ0A 3A1NA 3UVEA 2GN9A 4BNGA 3WGOA 2NV6A 3PIDA 4XWYA 5G4LA 4IJWA 3LF1A 5I9NA 3HB5X 1C0PA 3JQAB 3JQEA 1T24A 2CNBA 5B4UA 3NGLA 3TWOA 4AJHA 4D46A 2ZJ1A 1E6EA 4PVCA 3FPLA 1PL6A 3VKUA 2C20A 4J1SA 4DPMA 2Y1OA 3LT0A 3D3WA 4PLTA 3C8MA 3L4BC 3ZWPA 1DAPA 3ZWAA 1YH3A 1XWFA 3COSA 2W2KB 3LQFA 2C29D 5BNFA 4GPD1 3WQQA 1WW8A 4WOJA 3FR7A 1O8CA 1ZK4A 3M6IA 1B8PA 1E7QA 2X8LA 5JDCC 4CLOA 1VJ1A 4MOWA 3GLQA 2GZ2A 3GY0A 2WEKA 3GAZA 3JQ8B 4R3NA 4OSPA 1GD1O 4ZD6A 4FFRA 2FMUA 4M49A 2AG8A 3BMNB 3MJ4A 2SCUA 4QX6A 2J5RA 1EK5A 4NK4A 4LRTB 4DRYA 2ZQYA 3RCBA 4NBWA 3K2EA 4BKQA 4MKRA 1PGJA 4DQXA 1HLPA 3VH3A 1IB6A 1X7HA 2HRBA 4E5KA 3VH1A 3R3SA 2NTNA 4ZQEA 3F6YA 3H3FA 5I7EA 1FMCA 2C59A 3E18A 1H5QA 1U1IA 2POQX 3KYCA 4KTVE 3RWBA 3MZ0A 4IGFA 4MP8A 2PGLA 1F0YA 4BMVA 2E6UX 5I8ZA 4CLRB 3WIEA 3H7AA 5T67A 5IJZA 2QG4A 1ZK0A 2OGUA 1I0ZA 4OO3A 3RQSA 3RVDA 2EEZA 2RBEA 1NHGA 4OAQA 2X6TA 2X5KO 4CMAA 6LDHA 4E5YA 4FFMA 4N5NA 3U4CA 2O3SA 1E3WB 1YVEI 1MC4A 1PJBA 3B70A 4DYVA 1RM0A 4CV3A 2VHYA 4WLNA 1IOLA 1CIVA 3JQAD 3ONDA 4OMUA 5AQ1A 1NPYA 3OBBA 4NFYA 4TROA 5IXSA 3TL3A 3JQ6A 3U0BA 4DLLA 5DP2A 1A72A 5BQFA 4L4XA 3AU8A 3SLKA 2Y66A 3VOSA 1GADO 1ZSNA 4Q9NA 3KO8A 4FS3A 4PRKA 3JQFA 4UULA 2OL4A 2QYTA 3FTPA 3G0OA 2EW2A 3DOJA 4UVIA 3DO5A 5GZ3A 1A7KA 2UUPA 3I1JA 4YBZA 4PG4A 4NDNE 1EFLA 4ZA2A 1WDMA 3BZUA 1OC2A 3INTA 1C3VA 3GK3A 3GF4A 1QRRA 4J49A 1ZIDA 4QQRA 2IE0A 2GN6A 2EP5A 3JQ8A 3K30A 4ZQBA 4BGEA 4G81A 4DIFA 2PKQP 1MA0A 1E7SA 3BMNA 1J5PA 1YDWA 1ZMOA 4UUMA 3WJAA 4DQUA 5ITVA 4ALNA 3OEYA 3GMDA 3GFBA 3GNTA 1ZUD1 1QYXA 4HFJA 2AQHA 5A02A 1BVUA 2OZPA 3ZV6A 2WMDA 3IUPA 3RSHA 3HADA 2HO5A 4MVJF 4XYBA 2QW8A 1R12A 2H5LA 3B1FA 5DBIA 2PNFA 3PQEA 3ZI0A 1B3BA 4XB1A 1YS4A 1E1NA 1WAMA 3VPGA 5BSHA 3ETEA 3DONA 3ITDA 4FCCA 1DIHA 1G1AA 1DB3A 3ZNPA 4Z9YA 3T4XA 5B12A 1SBYA 4TRRA 1FK8A 4CR6A 4M8SA 3UF0A 2HRZA 3TOZA 1E7RA 3QY9A 2O4CA 2H1SA 4R01A 1XG5A 1Z82A 4WK6A 2CFCA 2NVUB 2C7VA 2P4HX 3LZ6A 3TZ6A 2PZLA 3TOXA 1AHIA 4YB8A 1I3MA 3MJEA 4BNXA 1E3WA 3D4NA 2GRAA 4QECA 1R0LA 4TZKA 4YVFA 3BHIA 2X4GA 4CMGA 1JAXA 1BSVA 4Y6SA 1FDUA 1QR6A 2D5CA 2HKIA 3AY7A 1NR7A 1LLUA 1GR0A 2NADA 1XSEA 2Q46A 4UVHA 4WEOA 1GQ2A 4RORA 4IIVA 3WGQA 2V65A 3PWSA 3DOOA 2DUUA 1I33A 3GZNB 4P22A 2WYVA 4BNTA 3QV1A 1BG6A 4AJKA 3WYBA 5I7VA 4OH1A 1HYHA 1R66A 4BNLA 4DWVA 3K5PA 4EZBA 5A3JA 2Z1NA 2Q4EA 1DJNA 4KZPA 4R1TA 2PA3A 3SBOA 3HQ4O 2OOSA 2JD1A 4UEJA 4DYDA 3IJRA 2EG9A 5EESA 1X7GA 3U3XA 1JU9A 3GRPA 3H9JA 4ND4A 4EW6A 5A06A 3DXFA 1Y1PA 5G0WA 3ICCA 4IDBA 5C5IA 3F46A 3H9EO 5ICMA 2A94A 2UDPA 3QVOA 2VZ9A 4IXWA 4XQGA 1ZK2A 1F12A 1E7MA 2NU9A 4ALJA 1YWGO 2AQIA 3LF2A 3U49A 5F5NA 2RAFA 1P1JA 1B16A 1JLLA 4XYEA 3GGOA 2AMFA 2NU6A 4HFRA 1X1TA 3NDRA 4UAGA 1YB5A 1JVBA 1P1HA 4FQ8A 5IN5A 1N92A 4EBFA 1T2AA 5IZCC 4UVGA 4IDEA 4OQYA 1V9LA 4OYRA 4UUOA 3F5SA 1PEDA 1XKQA 4J91A 1VKOA 1T4DA 3VDRA 1BHSA 3EMKA 1QXSA 1NFQA 1E1LA 5IDYA 2C5EA 2DVMA 4PZCA 4YT2A 4FJ2A 5JAZA 4BO3A 3WGYA 4J0EA 3GHYA 1HL3A 3MOIA 5DF1A 4L75A 3V2GA 1CRWG 3L0DA 3OJOA 4GWKA 2NVUA 1NVTA 1ZEJA 4E0BA 4NJOA 1T26A 1BXGA 4ND1A 3KLMX 3Q0EA 4AJLA 4C4OA 2HMWA 5FEUA 3WSVA 3U09A 3LT2A 3O38A 2O48X 3FR8A 4E2XA 3L6DA 3ZCXA 1U7HA 3SJ7A 4RF5A 2IYPA 2Q1WA 2XXBA 3IIEA 4G5HA 4YJDA 3RFTA 3TFQA 1QSGA 1Y5RA 3ANLA 3HWRA 3I4FA 2DQ4A 3DC2A 3GNQA 3Q11A 3GHHA 3GZNA 2JAPA 3UXYA 1HSOA 4YJGB 2HUNA 1H0KA 1YDEA 5JC1A 2RHCA 5HM8A 5IDQA 1A9ZA 3BMOB 5TF4A 4CUJA 3QIVA 1AE1A 4Z0HO 1PJ4A 5JY6A 4XDYA 1K6JA 1EK6A 4ONEA 1U9JA 4KQWA 4YJFB 3A9WA 3QW2A 5C7IO 4IPTA 1BRMA 1FDVA 3T7EA 4L0QA 2Y1DA 3JQ9A 4Q3EA 4TWRA 1UXKA 3LC1O 1A7AA 1ORRA 2IXAA 1U4OA 4YJHB 2Z1MA 1ENZA 2AW5A 2G17A 3PFFA 4YAKA 1UXHA 3MJSA 1K6XA 4Z0PA 5ADHA 1YBMA 1DC6A 3ITKA 4MVJE 4E4YA 4JROA 1A4UA 2NWQA 4AG3A 2WYUA 1A71A 4XR9A 5IN4A 2C7GA 5EERA 4RQUA 1SB8A 2W2LA 2ZIZA 3CZMA 4FDAA 4YQYA 1NQOA 4Z9XA 4Z3DA 4N5LA 2X9NA 4PLFA 3ZWXA 4NQZA 3JD2A 4PLVA 1RPNA 1UDAA 1ONOA 4MJLA 3S2FA 4BGIA 4TKLA 3R3JA 3NT2A 4IQ0A 3LT4A 5C3MA 3I9KA 5JXWA 4G65A 3I83A 1OFGA 4B79A 4NI5A 1WXDA 4RCVA 4C7KA 4S1VA 5T8KC 3M1LA 3KSUA 4ZHSA 1DC3A 1DFGA 2RH4A 1GZ3A 4BO9A 3PLRA 4B8WA 3H9UA 1H2BA 1U2DA 4OM8A 1NVGA 2D3TA 2ZJ0A 5CEJA 3EUWA 5CDTA 3JTMA 3P2OA 2FZEA 2JD0A 3ADPA 3K2BA 4XCVA 3NTOA 4RF3A 1OBFO 4PLYA 5JDCA 3B20A 2X0IA 3FNEA 1PIWA 1D1TA 1JQBA 3O8QB 4K9DA 3ZWWA 1ADFA 3RUAA 1B15A 3U4HA 4IMRA 1B7GO 4J7XA 5LCXA 4L76A 5IG2A 3QWAA 4L4RA 1CERA 4JJGA 4WCFC 4IDAA 3U4DA 3BMOA 4B8ZA 1IZ9A 4QO8A 1LRKA 1LRJA 4YJFA 3AFNA 4FGWA 2HDHA 3ZDFA 3C1TA 2AQKA 2PH3A 5L9AA 3NT4A 3M2PA 4F6LA 3JYPA 1ML3A 3AOEA 2V7PA 1PTJA 1DC5A 1SPXA 1HDOA 2VTDA 3OETA 1VC2A 4CQMD 1HETA 1Z73A 4J7UA 1X0VA 1YL7A 4FW8A 1GEEA 4QUKA 1I8TA 3GOHA 3HZZA 3WQRA 3CMCO 2FR8A 2OP1A 2CSUA 2Q99A 1PGPA 4WLOA 1SOVA 3ROKA 5L4LA 4MIEA 2GDZA 5AXBA 1ZKMA 5DDIP 1PJ3A 3AFMA 3ETDA 1G6KA 1M76A 4IS3A 4P4NA 1Y5MA 5KVSA 5CPFA 5COBA 3OFSA 3DWFA 1MB4A 1WNTA 4JGBA 3JQ7B 5EN4A 3WFJA 5TX7A 3VTZA 2DC1A 5ER9A 4Q39A 3B1JA 2YHUA 3WLEA 1P74A 3Q2KA 5L40A 4GAEA 2VN8A 4J4HA 5JAQA 4RJTA 5DOZA 3L77A 2PWZA 2PD6A 3NTQA 1F06A 1RKXA 7MDHA 2EF1A 4GBJA 1PR9A 5COQA 1HDCA 3HFSA 3RUCA 1K2WA 4JBIA 2VOJA 1ENOA 3O8QA 2UYYA 4U5QA 3A06A 1N9GB 1I2CA 1KBZA 1UDCA 4XDZA 1NVMB 4IDGA 3IOYA 3PIIA 1E6WA 3PK0A 1O89A 1NXQA 3PHJA 4R4JA 4CODB 3E03A 4DXHA 1K6IA 3C24A 3GN1A 2I3AA 4R9RA 1H6BA 3H9QA 2UVDA 1NWHA 4ALMA 3AUSA 3ON5A 2EJWA 4B7XA 4HADA 4DGSA 1ZH8A 2H9IA 1YBVA 2ZCVA 3HDJA 2HU2A 3ETGA 1E3SA 3O03A 3PZRA 4GX2A 3TQHA 1VSUA 5AOVA 6ADHA 1VL6A 5TC4A 2ZCUA 4HKTA 4IS2A 3B6ZA 3ZV4A 1NPDA 1R6DA 3RBXA 4CV0A 2O3QA 2HCTA 2OO5A 1U4SA 4J16A 5IDXA 2OFPA 3V8BA 5BR7A 1XCBA 1ISMA 1N1EA 2I67A 1XR3A 1D1SA 3EZLA 5KKAA 5U1PA 2JJYA 1VL8A 4KDFA 1C1XA 1Z45A 4IJKA 4WCDA 4CV2A 4E33A 1R4MB 4PFJA 5FYDA 4FJ1A 1DHRA 3RROA 2FZWA 4R5HA 4D79A 3CEAA 1N8KA 2J3JA 2YQ4A 4GWGA 1P3DA 3QWIA 4PRLA 4S3MA 3GMSA 4CR8A 5I7SA 4ZGWA 3FBGA 3AOGA 2B5WA 3KOUA 3JQ7A 1ZO8A 4R5MA 4JK3A 5JAMA 2UV8A 1N1GA 4CR7A 4RF2A 3OICA 3WYCA 1ISFA 1F8GA 4BUCA 4NBVA 5G0TA 2G82A 1LLDA 2QX7A 3EW7A 1GUZA 3VC7A 2GNAA 2J5KA 1KERA 4YT5A 4BVAA 4CMCA 4F3YA 1GV0A 4CQLB 1E5LA 3WGIA 5G0SA 1IZ0A 4CMJA 2PY6A 1TA4A 1J6UA 5EINA 4MKZA 1N9GA 4EUFA 1BMDA 2YW9A 3VZPA 5A9TA 2R6JA 4ND3A 1PSDA 2D5AA 4Q3BA 3WGTA 2VYVD 1LNQA 4BNMA 5KJ1A 1SO8A 4L9RA 2A35A 2J3KA 3BIOA 4CLEA 4LN1A 3IP3A 2AA3A 4OKIA 5IZCA 3NTRA 1Q7BA 3TDKA 3ULKA 5CG2A 1LDYA 1NASA 4IIUA 3H8VA 1TVEA 1I3LA 1XEAA 2IZZA 5CPBA 4QEDA 4OSOA 1O5IA 2I65A 3PQFA 4WJZA 1WPQA 5JBIA 2YYYA 4TRMA 3HNPA 1MX3A 4DUPA 1DIBA 1YQGA 4R51A 4GSKA 4U7WA 2VRCD 3RUHA 3HG7A 4EITA 2VRCA 1CQJA 3Q2IA 1X15A 3Q9UA 1B26A 2PD4A 4Z6KA 3OP4A 4XGNA 3AJRA 1KVTA 4OIMA 2EERA 4BO0A 1YBAA 1R4MA 1M75A 4TRJA 4J1QA 1HZZA 1DLIA 4EUEA 3ZW9A 1V8BA 1PQPA 5KTKA 2AG5A 4DVJA 2WDZA 2NQTA 1B3RA 1RYEA 2VYND 3I4CA 3Q6IA 2AXQA 2GSDA 2EXXA 1ENPA 3L6EA 4RPGA 1YJ8A 3MWDB 2AEFA 4O63O 5G0VA 4YXFA 1P1FA 4IDDA 5IZ4A 3SVTA 1HLDA 1Z75A 2CD9A 3DBLB 1PJTA 4GGOA 4M55A 2B4QA 2QYSA 4EJMA 3HDYA 3KSDO 1JDJA 3EC7A 4P38A 4BO2A 3E9MA 1R15A 4ZRNA 3QA9A 2QZZA 4CQLA 3OMLA 3WNVA 3FF4A 3PHHA 1GCUA 1ISJA 1I10A 2ZTMA 3NDJA 3MWEB 4U0JA 2ZTVA 3JD1A 4L4SA 1P1IA 4D45A 2YV3A 1XU7A 3ORFA 4ND2A 3WTCA 1Z7BA 3FCOA 3JV7A 1J0XO 4CLXA 1DRVA 2F1KA 4ALKA 4CM4B 4PG6A 3W8EA 1WDKA 3OJFA 5L4SA 1QP8A 1H9BA 3VDQA 3V1TC 2O23A 2IXBA 1IL0A 1IHXA 3ONFA 2GYYA 4NFHA 5KCZA 1EEHA 4JLWA 3V2HA 3KLPX 3SX2A 4ZJUA 3PYXA 4J90A 2ZB7A 1AXEA 2YY7A 4DREA 1AGNA 4OQZA 4I5EA 4TZTA 4CM9D 3JD0A 1EE9A 1PZFA 1PZHA 3QHAA 4MVJP 4FSHA 3S2GA 4P4LA 4CL3A 4J9UE 1Z6ZA 1EQUA 3WR5A 3DZJA 3MEQA 2C07A 4GX0A 1N7HA 1T2FA 3BAZA 4IUYA 4OKNA 1NAHA 5KJCA 1UZNA 1DRWA 3QRWA 3QJ5A 4YWJA 3I6IA 1N2SA 3SC4A 2VT3A 4E2WA 5IFLA 2YQ5A 2TMDA 1NBOA 3ZWMA 1P9LA 1ZZEA 1I3KA 1ZCJA 3ROMA 1K89A 3MTJA 1FJHA 1BDMA 4B3IA 5KNLA 1EVYA 4CM3A 2VCYA 1ADGA 4YRBA 4J9VA 4INAA 5CEFA 1QLHA 1QYDA 2JAHA 4M54A 1W4ZA 2FWMX 1YE3A 4GMGA 2B35A 4PLWA 1I3NA 1KY5A 1PX0A 3WOHA 2DUWA 2WYWA 3ZN2A 3DBLA 3E82A 4K6CA 5T5QA 4M86A 4QO7A 3UICA 5BNIA 3DBHB 3ZWCA 2J8ZA 4MVJG 1KVSA 3GGGA 4B4UA 3DFUA 3CTMA 4WPGA 3WXBA 2D4AA 3DHEA 1O94A 1Y7TA 5T57A 3L07A 5KIAA 1LU9A 4RVDA 4RPHA 4RLHA 2P2SA 3AUUA 3SC6A 3OIDA 3E5RA 4MPDA 2BFMA 2YDYA 1MG5A 1SMKA 4W4TA 3UCXA 5A03A 1Q2XA 2P5UA 1H2HA 2DBRA 3G79A 3JQAA 5DULA 2Q1TA 3RUIA 3WNQA 1IYZA 1LX6A 1LUAA 1TI7A 3RC2A 5A4DA 1C0LA 3GVIA 1HE5A 1O95A 3P19A 2EJVA 3V1UA 1LDGA 5THKA 3AM4A 4BNWA 4W82A 2VNAA 4PN3A 3NDIA 2HQ1A 2VHZA 2DTEA 1PL8A 3EK2A 3V1YA 5CFZA 3A28A 4LCJA 2GF2A 2WE7A 4H7PA 2W2KA 4ZQGA 4TRNA 3EZYA 1XIVA 3DZKA 3K6JA 1ID1A 2EP7A 3KSZO 3VVBA 1OZAA 3OHSX 3PWZA 2Q1UA 4UVEA 4DA9A 1I36A 4YAJA 5A9RA 4FD3A 1ZMTA 3TZCA 2A9FA 1DJQA 1MGOA 2FRDA 1FDTA 1HXHA 4BB6A 3GG9A 2PKRA 3RUEA 5GZ1A 3PJFA 1BXKA 2EHDA 1W73A 2Z95A 1VLLA 2BH9A 3AI1A 3BTVA 4CLHA 5K9ZA 1R4NB 4D0RA 3K8ZA 2WJPA 1TT7A 4TKMA 3JYLA 4EDFA 3O4RA 4X54A 2PZJA 3NJ4A 4E21A 1ARZA 4OXYA 1RJWA 4IXTA 3PYLA 2E82A 4W99A 4L74A 3WGGA 4A2CA 1B8UA 5FF9A 4RZHA 3UCFA 1DLJA 2BHLA 4NNJA 1Q0LA 2GN8A 1E0DA 5HS6A 3PP8A 2DM6A 2UUOA 3UHAA 1RYDA 4W7IA 2GCGA 1KS9A 4CLRA 1BXZA 4ZU3A 4CJXA 2JCYA 3DBHA 3OQBA 4P8RA 3JYNA 1U3VA 1IE3A 1XU9A 4R69A 1U5CA 4K26A 2P68A 1YO6A 4ROSA 4DPLA 3L9XA 4AJOA 4BO5A 3I23A 3TSCA 1MFPA 4ID9A 4PZDA 5AYVA 4ESOA 3E5MA 1WLYA 3CZRA 3CSDA 4R54A 3VZSA 1J4AA 4IJUA 2O3UA 1U2GA 3D7LA 4D0SA 5MDHA 1ADBA 3K92A 3HDHA 1TEHA 2Q3EA 4IJVA 4XA8A 4YDRA 1NFFA 4EEZA 4Q3AA 3STHA 4AJPA 3KXDA 1NPTO 4W9NC 1G0NA 2D2IA 4JNKA 1T25A 3PVZA 4GLOA 3FPCA 4B4OA 4BMNA 1D4FA 1WVGA 1E1KA 2DFDA 8ADHA 5MGBA 3IKTA 3MJVA 4KP7A 3I9MA 2IODA 3GRKA 2VZ8A 1AXGA 3E6AA 5COAA 1DC4A 1VL0A 4RPLA 1Y8QB 2BKAA 3OECA 4LSWA 1K5HA 1WZIA 2E49A 5DCUA 3DL2A 5AXAA 3WWZA 1GZ6A 2EGHA 3BXXA 1V3UA 3LYLA 3ZH2A 3RI3A 1P45A 3DEYX 7ADHA 4ZRMA 1QYWA 4BQPA 3JQDA 5EQDA 1J49A 5JLAA 4A10A 4A5OA 3ZU3A 1Y9AA 2JL1A 3KEOA 1E3EA 3QP9A 4LMPA 1ONPA 1R4NA 3WS7A 3FWNA 4HXYA 4R3WA 4ZQHA 4E2YA 2HMTA 1GQQA 1NNUA 2BGKA 2VZ0A 3QE3A 3H5NA 3ANMA 3DFZA 4E32A 2DBVO 2X58A 2EKLA 4BKPA 3JQBC 1CYDA 4JJIA 2ZB4A 3HDQA 2R00A 5TGDA 4JQCA 5JNLA 4R1NA 3C1OA 4E5PA 5KKCA 3DBVO 2QHXA 4J1NA 4JP3A 2JHGA 5K6AC 4NBRA 1EBUA 4J4BA 4R9SA 3PGXA 3EDMA 4TQGA 3GUCA 4Q3DA 4CMEC 2WTBA 4RVSA 4DIOA 1NP3A 4KUHA 4O6VA 4OOEA 3HSKA 4NHEA 3CMMA 3G3EA 3KB6A 3M2TA 1RWBA 1JWBB 3ZWOA 4DBZA 1Q7GA 1XQ1A 2CDCA 4BGVA 3ZNQA 3IAHA 1CQIA 4U6SA 4OXKA 3ZWYA 3F4BA 2GR9A 3JSAA 4AJ1A 3QWHA 1GYQA 1DFHA 5A1TA 3IL2A 3S8MA 3GEDA 5EJ2A 1I24A 2FPIA 2WD8A 4HV4A 3PYMA 3WLFA 1YB4A 1DSSG 2PR2A 4MVJM 5JDIC 4E3ZA 5CDGA 1RM5A 1Y8QA 2I76A 2FP4A 2YUTA 4PGFA 3V5NA 1T2CA 1XLTA 4JIGA 3P7MA 4O59O 1P33A 1EBFA 2EWMA 4BMSA 5ICSA 1KEWA 2X9VA 4D43A 3DAFA 2JCXA 4PCVA 1ZNQO 3N7UA 2OBYA 2PH5A 3VPSA 4CQMB 4FFNA 1E3IA 2QQ5A 2OBNA 4XIYA 1O0SA 1ULSA 1QKIA 5TT1A 3DHNA 5KVCA 4HY3A 5L3ZA 2NQ8A 3WTBA 5JY1A 4GVLA 4NMHA 4O0LA 4PVDA 3F47A 3RU9A 1UAGA 1YOVB 4CLDA 3E48A 1C1DB 1P1RA 1NFRA 3RUDA 1IPEA 3LSYA 4Y6PA 1PJSA 1KC1A 3RBZA 3S2IA 4Z0TA 1U3UA 1WWKA 3I9JA 4CM8B 1HDYA 3GVHA 1UAYA 1MV8A 3RASA 1JTVA 5A04A 4J3FA 3L4BA 4M87A 1IULA 4E12A 4J0FA 3WMWA 2VWPA 2H63A 2YHIB 3FRJA 3R0IA 1WZEA 4LRSB 3ZW8A 1TB4A 4DMLA 1EUZA 4OGWA 3LVFO 4XGIA 4ZN6A 3K96A 1ZFNA 3ZWNA 4DLAA 3WMXA 2P9GA 1FDSA 4NIMA 4XYMA 5C37A 4YQZA 1HEUA 3O26A 4KUEA 2I66A 5DZSA 4R16A 3NYWA 2B4RO 4YYZA 1PJQA 2B5VA 3KEQA 1NTOA 3OQ6A 4RVFA 3WWYA 1UP4A 4A27A 5KVVA 1EUCA 2NVWA 1ZXBA 2GO1A 1JW9B 2FR0A 4PLZA 4BV9A 1N7GA 3A14A 1QV6A 4YJGA 5F21A 4PG8A 1A27A 3DZBA 3OA2A 1VRWA 4FFPA 3TJRA 3LLVA 4MVJH 1I2BA 1PJ2A 2ZTUA 3PJDA 3AW9A 3PLNA 4JP2A 4O1MA 1MUUA 2DLDA 3NEPX 3VHRA 2YV2A 2C0CA 3INGA 4TMFA 5B4TA 5L4NA 5TLSA 1MP0A 1YQDA 2CDBA 5KWEA 1JKFA 1W6UA 1E6UA 2WWRA 3BMQB 3PQDA 3W4KA 4YJHA 4E13A 5A5FA 2NLOA 4IBOA 3PXXA 2O4UX 3RC1A 1P1KA 3PFWO 5L7YA 4CQMA 1JVSA 1XA0A 2YV1A 4AJIA 4AL4A 3KYBA 5G4KB 1CJCA 3KYDB 1HDGO 1XYGA 3VPHA 3UAGA 1IUKA 1H9AA 1T4BA 3DMYA 3LC7O 4RVGA 2R2GA 4XIJA 4EEXA 3O9ZA 3WG9A 4YCAA 1YOVA 1E3LA 1VI2A 3KHUA 2VHXA 4IDFA 1X14A 2JKVA 3D5TA 4FC7A 5IAAA 5JYDA 3AM5A 1GCOA 4B3HA 2OUIA 3ANNA 4WNIA 5HBRA 5JCXA 2LDXA 4CM8A 3HJAA 1WP4A 2Q2WA 4HFNA 4JXKA 3FWZA 2ZYDA 4GSLA 4AJJA 3KBOA 1HDXA 2Y99A 2W90A 3C3XA 4M1QA 3FHLA 4J6FA 2YHIA 2ZTLA 4ZVVA 3WSWA 3ADOA 4E6PA 1NM5A 3JQFC 3GNSA 2CMDA 1EDOA 2HK7A 1LDMA 2YFQA 5JFOA 4Y8VA 1M66A 4MIOA 1HRDA 2DPHA 3EVNA 4KWHA 3RJ9A 2PGJA 2EGGA 1EFKA 3EY4A 4URFA 1XGKA 4CMHA 3FTNA 3Q9NA 1I01A 4AICA 1L7EA 4BNVA 4RF4A 4U8GA 3ZV3A 4CM7A 5KJ6A 5AVOA 4E30A 2JCVA 3JQCA 5EL0A 4DC0A 4YRAA 2HK8A 4B7UA 4DQVA 4IQ8A 3F9IA 5EMHA 4BO8A 4J43A 5U4QA 3GEGA 2RHRA 3E9NA 4II3A 5G0UA 1QYVA 2Q49A 1BVRA 1C0KA 3EAGA 1BW9B 4EJ6A 4GKBA 4BV8A 3BMQA 3PJEA 4BL5A 4I5FA 4PLGA 3BHJA 3MJTA 2HMSA 3Q3CA 3SEFA 1X7DA 2P91A 1U3WA 1GZ4A 3TN7A 3KM0A 1VJTA 2NSDA 4J7CA 5JO0A 2DKNA 3QWFA 1PS0A 2BD0A 3ZHZA 2ZYGA 1PU2A 1HE3A 3TPCA 1YL6A 3W6ZA 1AUPA 1HE2A 2AE2A 4WKGA 2C5AA 1LI4A 1E92A 2GN4A 1N5DA 2VWGA 4BNHA 4XRGA 4DL9A 5T64A 1M67A 4YT4A 2QRJA 2PGDA 4CM1A 2QRLA 3PI7A 3R6DA 3GPDG 3RAJA 4W9NA 4XJTA 3G49A 1MXHA 3OM9A 5A9SB 2DAPA 2P9CA 1ISIA 3TFOA 4CM6A 4OXNA 3PHLA 1V3TA 2VOEA 2GUGA 1WMBA 2ZB8A 3L4SO 1UR5A 3GG2A 4FN4A 3KTDA 4HNGA 4XZ3A 2Y1CA 4HWKA 1YXMA 4DIBA 1QV7A 4HNHA 1LDEA 1GEGA 2VTEA 4JBGA 3HE3A 1TT5B 4DLBA 3NJ8A 1S6YA 3UH1A 3HB4X 4PG5A 3UW3A 4FJ0A 1UH5A 4KWIA 4WNCA 1U8XX 4IQGA 3VPFA 2X0RA 3VH2A 4EYEA 2RIRA 1OMOA 5HS4A 2JD2A 4NBTA 4MP6A 1NQ5A 3WX0A 2VYVA 1EMDA 1M2WA 1GYRA 2CVQA 1DIAA 3U62A 5B4VA 3I3OA 3ZGYA 5TJ9A 1IHYA 2AEJA 2O3JA 1P31A 3RC7A 3RUFA 1K0UA 1ZXLA 3AY6A 4K28A 3KETA 3DB2A 3ZWVA 3S2EA 3T7CA 1R0SA 3JD4A 2FR1A 2PLAA 3ZHBA 3JQBA 1WMAA 4BQRA 4XGKA 1LXCA 2CZCA 1BW9A 1TLTA 2G5CA 5GMOA 3VVCA 3F4LA 2O3TA 3W1VA 1HE4A 3UUWA 3OIFA 1YRLA 2O7QA 3HFGA 1HTBA 1KVRA 3RU7A 4CL8A 3PJGA 1R0KA 3OEWA 4J2HA 5JE8A 4H15A 1LJ8A 3IKVA 3X2FA 4YEDA 1HWYA 3DDNA 1OOEA 2P5YA 2X5JO 1Y8RB 1DOHA 3E8XA 4HFMA 1E3JA 1S7CA 1SEVA 3BYZA 1ZSYA 4F45A 3E1KA 4CMKA 1E5QA 2C82A 4NPCA 1ISGA 1MFZA 3MCVA 1JA9A 3FBTA 1ISHA 1Q0HA 2HMUA 3AUTA 5F3RA 2V6FA 4RZIA 1Y9EA 3WFIA 4BNNA 1LQTA 2VYNA 1Q0QA 5JPIA 4FPXA 5A9SA 2OXIA 3GH3A 4WCFB 2PFGA 2BRUA 4GL4A 4YAGA 3ASVA 4EUHA 1PWZA 2DTDA 3DOCA 5JDIA 2D8AA 5C7OO 5A5EA 2B37A 5L95A 4MVJD 5THQA 1ZBQA 3AM3A 3CIFA 5K0ZA 5EIOA 3P5SA 3CPSA 3H9GA 4DTIA 5KOIA 3BTSA 4MDHA 1BGVA 3IC5A 4PLHA 1KC3A 4FB5A 1OI7A 1B0AA 1GL3A 4LGVA 4WEQA 3WBFA 2AQ8A 1DO8A 3IS3A
chains in the Genus database with same CATH superfamily
3C2QA 1GNTA 1ULBA 1B8OA 1XDWA 1YJ5A 3UANA 5IABA 1K98A 1OLXB 1F48A 2CUKA 4OBWA 1RWNA 3DP9A 2XBLA 4RK7A 3AY3A 3BOSA 3FLEA 3V7WA 5TJHA 1PFQA 4K6OA 3REQB 1S89A 2ZLBA 3EMBA 4MR7B 5E0OA 5REQA 1KYQA 3R5KA 4YMLA 3EXAA 1DFIA 3H6KA 3ZX4A 3TLJA 5I4IA 2IYWA 2CY0A 4BKOA 1XUOA 1MB0A 3Q72A 5E7JA 2OZLB 3SM9A 3C3KA 4MJ3A 2HBZA 4Q3CA 3FKQA 4OHRA 4EG0A 1NF9A 2JHAA 3AR5A 2ZSDA 3G2JA 3HABA 3T3DA 3VR6A 4PNEA 2AD1A 2CJWB 4MEAA 4AX8A 4POOA 3MWFA 4I3GA 2UYCA 1LDNA 4LVUA 4Z4EA 4BS9A 1L4UA 1DKQA 3X1DA 1YZLA 5LP6F 4OX9B 2GBIA 4KIUA 4Y2VA 2XCSB 3W4IA 1GZ5A 2DB3A 1ADCA 4G01B 5SY6A 1WRBA 1AY0A 3Q1KA 1YZ3A 2UYQA 4MYTA 2GK4A 3NUQA 4OFBA 3WL4A 4I08A 4UHKA 1ZGGA 4IH1A 3GFRA 1J42A 1RCTE 4ALLA 4H16A 4MVCA 2GLXA 1H85A 4MV8A 3LPNA 3UMSA 3O90A 1U8CB 3UC5A 1Q1NA 1VG9B 1UKBA 3NBKA 4RA6B 5D00A 1WXXA 1X77A 2GCOB 5E7MA 4ICIA 3VH4A 5JC8A 2YCLA 4JYAB 1SVIA 1Z5WA 1NVXQ 2VDUE 1Z2OX 1E5VA 2PRYA 3BCUA 3QLVA 4KXWA 4BV3A 6Q21A 1DL5A 1WDLA 2H0RA 3JQGB 4HEQA 1GLGA 4MI9A 3A7EA 3R3VA 4CUZA 4PIMA 5ARBA 3FOZA 2D2FA 2GFHA 5ALYA 4LRWA 4KNWA 2R8EA 3RJZA 1CUIA 2QTNA 5CA1F 5HJEA 3F1KA 2Q5IA 3BGVA 4OJNA 2IV3A 2JKYA 2D2VA 2VDPB 2Q8NA 1MC1A 2VQ3A 4P82A 3DUWA 2H6EA 3KHTA 1YUMA 1ZOLA 3PHCA 4KFRA 3TX6A 1M1YE 3G17A 1TUEA 3SOPA 3W7AA 3W2HA 5DHFA 3QX8A 2FN7A 1E59A 3AOEC 3BFKA 3EOBI 3OUZA 5DCWA 4JAVC 1IM2A 5BUSA 1QUFA 3KZVA 4Z8YA 2EL7A 1M0SA 1BE6A 2P79A 2CN1A 3LP8A 1BCRA 4CM4A 3LLMA 4YDHB 4DWOA 5FI3A 4R2LA 2AOUA 3I42A 2GWRA 1DZ3A 1C4XA 3NYIA 3R2JA 3AI7A 4KQJA 4RVUA 5DX0A 3KLNA 1MA3A 4XX0A 4YJ3F 5LKAA 4JJFA 3W5AA 2F67A 2FR8C 3PNYA 5A71A 3MGAA 1UWCA 4MWCA 5ER6A 4OHMA 3ABIA 1HSZA 2WPDD 4X61A 4ZVSA 3U0VA 2DE0X 4RDXA 1IG0A 3H5LA 3L01A 3ZLJA 3PQ7A 1L4BA 5BWCA 1FIUA 2JANA 1S02A 1NXXA 1F0NA 2AN1A 4FIDA 3EQ9A 4KDCA 5JSFA 4IDNA 3H4IA 2X1HA 4Y2TA 5K4HA 3PHIA 1ST2A 1Z18A 2HR1A 2IOQA 5JH7B 1GGMA 2JFBA 1ACJA 2ZJ8A 5BUZA 3PDIA 4YAIA 1UFRA 1C3JA 1RM4A 3NBYC 4LZLA 4EHNA 1MEOA 3I5MA 3OIWA 2R6CA 4EGCB 3CLRC 4F1JA 3CRNA 5KDOA 1NUUA 3H4MA 2ESRA 3ONNA 5DFAA 3WGKA 3IA2A 1S1CA 3ZQJA 1O08A 4BZPA 3OLQA 1PR1A 2ZUDA 4TV8F 2VDKB 2VVTA 3GO4A 4WESB 4ZP1A 3WGZA 421PA 3RAFC 5HW0A 4ZJPA 2RH8A 3HLKA 2PS3A 3W1EA 4D2IA 5BOSA 1L1RA 2XB4A 3OLWA 5KAMA 2G76A 5A5DA 2CL6X 4F12A 3D4PA 1R37A 2AR9A 2I2CA 1AQIA 3Q7EA 2TYSB 3VO1A 5CH8A 1SG0A 3VZRA 3TR5A 1A0OA 1WKCA 3D4BA 1MBZA 5EMMA 3EPJA 3GZTB 4INZA 4MPRA 5TRTA 2CT8A 1FMLA 5CVJA 5EWLB 2WTMA 4PYOA 1S8NA 4RLSA 3UJ6A 4BO6A 1L1QA 4AF8A 2IZOA 5EIBD 2Y71A 5F78A 1ESDA 5FUBA 4KC0A 4LC9A 1UWVA 2BUAA 4URWR 4Y98A 2GJKA 2OLEA 1JB9A 4AMZA 4BFWA 3D8HA 3HN2A 2HCFA 4C0SA 1RNLA 4KODA 2P9FA 5K0EA 2FHSA 3RWMB 5LVAA 1TAGA 2H2FA 3KRTA 2AFHE 4MV6A 2CHEA 3VO8A 1B0ZA 3KR2A 2VF8A 5BOVA 3RVJA 3DV0A 1PJLA 3F2IA 1CUUA 3VYRB 4CDMA 3A7DA 1L7RA 1NLFA 1NUHA 2BPOA 4US2R 5JOQA 5ALWA 4RDIA 4CVNA 1VBKA 2GK7A 2PWBA 3ZC3A 4HN9A 1GPAA 4O8CA 2AN5A 3KE9A 9LDTA 4YPOA 5CLJA 2QL7A 3CURA 4C6TB 3WLOA 4GBGA 2FXIA 4OXQA 3K0KA 3RVNA 2RCYA 3BA6A 3EODA 4DA0A 2WTXA 4F4HA 1LPPA 3TTTA 3KWMA 1NBME 3E4CA 3O8OA 5FOXA 1Z36A 2J33A 3N58A 1MX5A 4HCJA 5GINE 1CY0A 2P6OA 4BYMA 2Q5JA 3GUYA 4MO9A 1H66A 4DARA 1RVV1 4EGQA 1DXHA 3EF0A 1BGWA 1BN6A 3NTLA 1UOQA 2MIIA 2O3RA 1MT0A 4WACA 5IVKA 4B2LA 4FI3C 2ZK7A 3HHPA 3CKYA 4WUVA 2DHEA 4OD0A 3GT7A 3NXSA 3RGWS 4DW8A 2Q1SA 3OQIB 4X97A 2FGJA 2DBZA 4ZI2A 3GDWA 2BLLA 2NO6A 3RAGA 5DP1A 4AY6A 3VKVA 1NTRA 1HKUA 1BDBA 1MV5A 1V1RB 3V4FA 1WXEA 2X6QA 2ZI6A 2DH6A 3QVJA 3UK0A 4LK3A 1H6DA 4BHTA 2FY8A 5IAEA 2IEBA 1H94A 3EEFA 3IQEA 3CLVA 1Q12A 2DRIA 1Z26A 3A27A 3MOGA 4QE3A 5CLHA 3WI7A 1V1MB 3ZQKA 1CETA 3H5IA 4GLLA 3SNKA 3MS7A 1YSCA 3F74A 4QNNA 2Z5VA 4PPQA 4F06A 3T95A 3EGDB 2ILTA 4MV7A 4Z86A 1LA2A 3B78A 3IP9A 3LW7A 2RAPA 3S5UA 2BTEA 3AGPA 1DUVG 1SCUB 4QOJA 1KJYA 1L5OA 1OTHA 3K8OE 1DAIA 4ARSA 5IS2A 3NIBA 3QU4A 2A58A 2Y1GA 3H4TA 3W6UA 1ULZA 3JARA 1D2MA 2M6LA 4D3SA 1T5HX 2RGAA 1IQUA 4R0VA 1YRQA 2PLNA 3BA1A 4XIGS 2ATXA 1IZZA 3L6OO 3UG7A 2DT5A 2Q9CA 3UJBA 5AVUA 4P3YA 4BX0A 4BFXA 4HPXB 4B3JA 3DZIA 5AXDA 1JKJB 1I4LD 4JOCA 2FPGB 2GEFA 4KLCA 4M9ZA 4EVRA 4KCGA 2IQ5A 1CVLA 3G2HA 3RPEA 2PA0A 2WD7B 2NQ2C 3PNSA 3PTZA 3TUJC 1D7OA 1KVQA 1NQUA 5CM9C 5FBKA 4EYSA 4PSUA 1YVPA 3OPQA 2AFIA 1JKMA 2PGXA 5F5XA 3DTVD 3LOUA 4JP1A 3SG0A 5JW6A 2DEUA 1JDVA 1A82A 1XAHA 4PN7A 4DCCA 3V6MA 1CY2A 3TEFA 4F6CA 1GFIA 1KQ3A 3DM9B 4M0MA 2R5NA 1LQ2A 2HJRA 4G5GA 3V4SA 1Y42X 4ABYA 4FKBA 3PXGA 5DO9A 3HXKA 2BM0A 3B13B 4Q4HA 5DW3A 3I05A 1NE7A 1BH6A 2J45A 3BCRA 2B20A 5KTNA 1C8KA 1UJMA 4QRHA 3AHDA 1UKYA 1EG2A 4GQAA 1EDDA 3VJLA 4LFBB 4IH9A 3HJBA 1YA8A 4ZV4A 1KORA 2BE9A 2F00A 3HBJA 2EU8A 3SQNA 4DA8A 4ZMSA 1VM6A 3L1JA 1ZR4A 2OT3B 2XUQA 4OQFA 1Z6PA 1W9HA 3LYAA 1WMFA 1WXFA 3CX6A 4GWLA 3RNOA 4YI5A 3GVCA 3FDFA 1RAAA 1VB3A 1KXZA 4Y1FA 2NNWB 3EARA 2WWFA 1Z2NX 3KV3O 4OHUA 4LXUA 1X1EA 1U3FA 4JVLA 2IHNA 3D64A 3T5BA 2NAFA 2ZWMA 1XCGB 5DLYA 3HI4A 3SDSA 3B9RA 1JRLA 4BQNA 4P92A 4QTZA 5DBFA 1GN9A 3NOQA 3HVJA 3CNQS 1ZA1A 3ELUA 3GU3A 1JWAB 1UXOA 2O0HA 3HVHA 4FFDA 3GJRA 4HQOA 3GVPA 5LDGA 1F2UA 3BK1A 1KZ7B 2D00A 2K87A 2E37A 2JHCA 4O29A 4B3MB 1KNQA 1YAHA 5C80A 3DAGA 2XDYA 2CMGA 1C3XA 2VHCA 5DNCA 1NN5A 4JUIA 3JRXA 5LM3A 3NU1A 1FC0A 5IKXA 1LC0A 4G84A 3REOA 2J3HA 3GOQA 1MOZA 3HP4A 3N2GA 3AR3A 1GILA 4B45A 2CB0A 1W2HA 3LECA 4FSXA 4EFDA 1SCDA 5IAGA 4ZVLA 1U2QA 3DHYA 3UGKA 2HT6A 4O2BA 2XPCA 5AK0A 4I14A 1RPZA 1RWQA 4NYIR 4WH0A 2BFOA 5TS2A 3UCEA 2X2PA 1IN6A 2Y1EA 3FE2A 2O50A 1PZGA 3IPXA 4LVCA 5LMZA 5HA5A 4BNKA 3Q0IA 1JSZA 1G7RA 3LIIA 4EJSC 1JYFA 2PRKA 1L8OA 4Y9RA 4UFOA 4P2GA 5MN5A 1MO5A 4YMGA 4K2HA 3DAYA 1GARA 3ACCA 4X95A 2JLVA 3HN6A 1N33B 2BF7A 2C54A 3C85A 3U13A 2VHWA 4UU7A 4YACA 5F9MA 5E9QA 3CKLA 4ZO6A 5IBPA 1XJ5A 3M6FA 2IU4A 1QHEA 4EP1A 1U0FA 5EZYF 3SC3A 4QOIA 5INTA 2HIHA 1XD2A 5ALHA 1KBOA 4Q9KA 1E4VA 4MVJI 4RHFA 2NU7A 3MAAC 2AJTA 2EIHA 1G20A 1X80A 1R18A 1CULC 1T6XA 3GRCA 4MIYA 3MW8A 4INOA 5BSTA 3ESBA 2FF5A 2O14A 1V35A 3A8TA 3HY6A 1WS6A 3KNZA 3PC8C 1O3YA 4OAOA 1HKHA 2ECQA 3NHPA 3ZV5A 3DDWA 2DR3A 3AI2A 2R85A 1N6NA 2CF6A 2CYBA 2VYQA 4N1AA 4TKVB 1GAEO 3DV9A 3GDGA 2WZBA 3QLJA 5F1PA 2G9VA 4GI2A 1NNSA 3GR6A 4LSMA 2DHDA 1MJ5A 1PLJA 3SXPA 4DM4A 2I71A 3IKMB 4NKRA 1U3CA 4QICA 1LBEA 4MLCA 4O4LA 1PRYA 1C1DA 2IIQA 3RABA 3ZU5A 2QUBA 3WGHA 1UBSB 2W8ZA 5PNTA 5HRAA 1JAZA 4HGRA 4LJKA 2XSZA 3FGOA 4UMDA 4GX5A 2F62A 2L69A 2X9GA 4XQEA 1UP7A 2J6IA 4ITUA 4K6MA 5ESWA 3KS9A 2A4KA 4AMGA 4EECA 2FOLA 3KJFA 1O95C 1LLFA 3QF7A 2YXPX 3CEPB 2ZRQA 3K5HA 2YWDA 1LRLA 1O6ZA 2G5TA 3LX4A 3HKDA 2IUTA 3QYPA 1XB2A 2Z9CA 4I8XA 4C6RA 4ZCTA 1KJWA 1QUEA 3J81k 1PS9A 3LLSA 2WSBA 4AYWA 1LSJA 1WQ1R 3I76A 1CZNA 4C7JA 2V1UA 2DLNA 3DTYA 1K3TA 1QZ3A 2G28A 2ZWAA 3I12A 1YJQA 4XEUA 5F2OA 3MN1A 4URXR 1PT7A 1BQEA 1NBAA 2QMQA 4C04A 5HTOA 1VKHA 1NNI1 2IS2A 1Y81A 3II6X 1UK6A 1X70A 4O4HA 5D01A 1BWRA 5G41A 2IDZA 5A1JA 3R0VA 3FUWA 1CZOA 1R4AA 4PNZA 3KEMA 4GGPA 3A2NA 2EW8A 3AHGA 4P9NA 2LDBA 4V0MA 3VVMA 3MJCA 1JFVA 1I4WA 4QTYA 3JASA 1RMTA 4RD0A 5FULA 1GPNA 4DCGA 5K6TA 3ZDBA 3TLKA 1G19A 1HLFA 2RONA 3I04A 3TD6A 2BGNA 5K8JB 4MUKA 3NXKA 4GH5A 1Z47A 4MITA 1OXBB 4AJ1A 3HXOA 3IB3A 3UFXB 5TQ2A 2B99A 5AW3A 2JGKA 3NRCA 5LMCA 2WLTA 2PT7A 5KVQA 1RQ7A 1GKKA 3A4VA 2QVYX 1UJ2A 3GC6A 4HLDA 4M4SA 4PLCA 4KXLA 5H83A 3ZU4A 4DLSA 3DL0A 3IQDB 4FLEA 1LV7A 3NHKA 4Y1RA 3AI3A 3WWEA 4C0JA 1ZAYA 1JQKA 3UJAA 3HSSA 2YFYA 3QQPA 3HO6A 5F1OA 4CF5A 4JLAA 5JCOC 2CF5A 3VNUA 1W88B 1TO6A 1X7ZA 3M5WA 4KN5A 4J3NA 4BLSA 1ZGHA 3QVXA 1ZD3A 4LQDA 1EZ4A 2W4MA 4D44A 3TF5A 1RZRA 3FRIA 2YRFA 3BSSA 3OH8A 4F46A 2FPWA 4AJ4A 4E11A 1CUDA 1AKMA 3U3KA 3M8KA 4JT8A 2VCEA 4LMBA 5FOTA 4LXTA 3OEEA 4UVDA 3ZHUA 5K3OA 5KS2A 3V6LA 4D4HA 1HBJA 3FWKA 5C1IA 3PC4A 5T6MA 4V38A 4JOBA 3U7HB 3T3PB 2A78A 1PFVA 3V1KA 1DEAA 1HO3A 4X1IA 1TXGA 5FIUA 5EUBA 4OJTA 1QH1A 3EGOA 4XCQA 1F17A 1Z0DA 4EHAA 4EEKA 3H4VA 2VUUA 1QRSA 2O2SA 4TYYA 3TNDA 2CDAA 2Z8YM 4J8PA 3U37A 2BKUA 1I30A 1TM4E 3IJEB 5B3JC 1DCKA 2JDID 3TZHA 5FUXA 3CCBA 5DKFA 4H60A 4RQBA 1WPXA 4G5RA 3EVFA 2IKQA 2XUZA 4WJLA 5FTWA 5E9WA 1R9MA 2RH5A 2QT9A 2ZJAA 4HX9A 1Z2AA 4OQLA 3UN1A 1AUXA 3PPYA 1WB6A 2AVNA 4OATA 2YINC 3A4LA 4XW2A 5H9VA 4BVEA 4LKRA 2ONCA 2V6JA 6REQA 1YQQA 1XXHE 3PEFA 3DE2X 2CUTA 4ZT3A 4FHCA 5GPBA 4NYIQ 2VT6A 5T4HA 2HSEA 2EZ8A 1VDMA 4U5XA 1KEEB 2ZYHA 1EGMB 2C4UA 3T0GA 4B0OA 1EWVA 3GZ4A 4JLJA 3QJYA 3RIYA 1YKSA 3ILHA 3GEMA 4B4DA 2PWPA 2JFFA 16PKA 1DIGA 2Z9BA 2FSVA 5DN9A 1QH8B 1G8SA 1QZUA 1ZH0A 1AN9A 2XUKA 5AKXA 1CHDA 3QX9A 2A92A 2R0QC 2WFLB 4HI0E 2X22A 1JQEA 3E5HA 4LJYA 1RXYA 1FFGA 3N8DA 2JJ2A 5BMVA 1DX6A 2IYEA 4Q19A 4JZKA 1E1RA 4S04A 1M6WA 1H0HA 5P21A 2OD7A 2ZYIA 4RFLA 2W6OA 3H87A 4II2A 5FCDA 4KPGA 2ZIUB 2ZUWA 2QXYA 1U7TA 2OV2A 3CQ9A 4S0ZA 2BW0A 3PUZA 1W2GA 1RQRA 2YJTD 3WLRA 2JAQA 3K72B 2UUAB 3ZBTA 1CZHA 2C9DA 3LTEA 4JUFA 3TQTA 1JN0A 3TYXA 2H7XA 3O4JA 4RQTA 5CNJA 1K1EA 3M4YA 2N0SA 3D2CA 5DN6A 1SXPA 1BQ4A 3AUYA 3E81A 4RAQA 2IOHA 1AIPA 3ER8A 2ZJFA 1ACMA 1QLJA 5EPOA 2BUCA 3K0FB 1CY7A 1ZOPA 1WSBA 3AIKA 1SOWA 3LWNA 4HH4A 4BP1A 4LY3A 1QLWA 2QTAA 4E09A 1YHYA 4I9NA 4RIHA 3WYFA 1RI5A 3BXEA 4Y67A 5KSWB 3VI3B 1T1RA 5IUNC 1CEXA 2WM3A 3O2NA 1SU7A 4ZEMA 1D3AA 3IXQA 4NCJA 4Z3KA 4TTIA 3H16A 1KO1A 3R3HA 2Z2JA 5D7BA 3OPYA 5J2TA 4X6UA 3C3JA 4N3GA 5FI5A 3HNRA 2BI8A 4FEEA 4JLDA 3QXCA 3AWDA 4PSDA 2A9KA 1QHFA 3ZTTA 2AJLI 3MTAA 4JASB 4YK7A 1MXFA 2O8EB 3P9SA 4G9EA 4EBBA 1TT5A 2G9ZA 2PJZA 3DBRA 2J0QA 2WJIA 3B36A 4FYPA 4HDSA 3KOWA 4OXXA 4FD2A 1U1EA 5A3VA 2H85A 4PPYA 1UBGA 2P41A 4Y6OA 5L7WA 3HBFA 1DWQA 2Z2XA 2Y68A 4V2IA 3JQ9C 1P5JA 5LOVF 4EQ6B 2WIKA 2FG7C 5BWOA 2V45A 4QAQA 2EYQA 5JMWA 4BQFA 4E2FA 1SZJG 1XV5A 2ZT6A 5ALGA 4ZVKA 4ER7A 4YR9A 1MJFA 3GQVA 1A9YA 1HUQA 2WKRA 1VE9A 1YK0A 4NENA 3R5TA 4B6PA 4BECA 4ZZ1A 3T1YB 4FGJA 5KTTA 2NM0A 4WASA 1T1JA 2H8GA 3G0DA 9GPBA 3NT5A 3OOSA 5E7IA 3VNQA 2DFTA 2HA7A 3LCJA 2W4QA 3PPIA 2BDTA 1FYVA 2HI0A 4S2UA 1E2UA 1L1FA 2IZ0A 3TZQA 4D4MA 3H2JA 4YV7A 3X44A 2ZDGA 2VS1A 4H59A 3W9SA 4H18A 4EYOA 2GN9A 2J9XB 3OZSA 2CLLB 3WGOA 3ZVMA 4IJWA 2QP4A 2H1LA 1OKKD 3FYHA 4E03A 3HB5X 3IAS6 4KVAA 5EJMA 1T24A 2CNBA 5FBHA 2C2KA 3NGLA 1DT5A 3PNPA 4HK4A 4NMWA 1GG2A 1P4AA 2I7XA 2WYIA 2VK4A 1UC4B 1OZFA 1GGNA 5JR3A 1E6EA 2P9YA 2ZI4A 3E2MA 1GTL1 2E55A 4JJEA 2GKOA 3Q8LA 1SC1A 4DV1B 1MH9A 1P7WA 5EQJB 2C20A 4HGNA 4RSMA 1GTSA 2PUGA 2BGRA 4DPMA 3L82B 5K3EA 3D3WA 4N4AA 1W5SA 2X4LA 4KMRA 3ZWPA 1OX5A 1OREA 2PT5A 3AJ9A 5HM6A 4JL6A 1X74A 3L49A 2C29D 1G6Q1 3MINB 4KIWA 3N0XA 1YQEA 3SE0A 1W52X 4GPD1 2XNSA 4UQPA 1FMTA 2F9LA 2VIIA 4RTKA 1WXHA 1OCEA 2F1RA 1YR7A 2HSJA 3T7IA 1W47A 1RTTA 1E7QA 4ZZ2A 3I2KA 3MUNA 3NQ41 5LWQA 1VJ1A 4MOWA 4HZIA 3BCHA 1GUDA 2WEKA 3LVQE 4R3NA 1M5TA 4OSPA 4HVLA 4WOBA 1VJDA 4FFRA 4GC9A 1OXXK 2DWCA 4WDRA 3DVRX 1IIRA 2SCUA 4YMWA 3MHTA 4EL5A 4QX6A 2GAOA 1EK5A 4NK4A 4LRTB 4DRYA 1MVLA 5AH0A 5FKJA 3RYIA 4G0UA 3K2EA 1AZSC 4MPJA 2JIRA 3V7YA 4PO9A 4EB3A 4MKRA 1CUCA 1PGJA 3MQ4A 2P9HA 1HLPA 3AWIA 4P31A 3VH3A 3CZAA 8GPBA 2RGRA 2QAGC 4HMPA 2QRMA 2ZBRA 2IIVA 1ORWA 1VLHA 1Z4PX 1L7XA 3E18A 2ZYVX 3L1VA 2I6FA 3FYDA 4OLHA 2POQX 2ID4A 3KYCA 3QBEA 4QGHA 3MZ0A 2JIMA 2X15A 2O8FA 1F0YA 1LK5A 4BMVA 2DPMA 3WA6A 4CLRB 3JWEA 1V5EA 5T67A 3MS2A 2R6FA 1W1WA 1I0ZA 3RQSA 2RBEA 1NHGA 1O94D 4CTMA 3L8DA 2DULA 4E5YA 1I6MA 1Y48E 2O3SA 3IMEA 5LIPA 3M4JA 4HZUB 3C5CA 4NZPA 4KHZA 5H4HA 3MQ2A 3B70A 5CA0F 5HKAA 1DKOA 3FUXA 4WLNA 1IOLA 2QN6A 1CIVA 3JQAD 1OFTA 3ZVRA 4D3YA 1Z6AA 3D5EA 1M5UA 2OOKA 3C0KA 4M99A 2HF9A 4B9EA 3CH7A 4TROA 5IXSA 3CLSC 4DLLA 3NVKI 1KJNA 4HNAB 4TQAA 1BU8A 4AS3A 3EEQA 4NVRA 1QO0D 4EJFA 1Y6GA 3VOSA 1JQAA 3E7FA 1QVRA 4JYPA 1FXUA 4Q9NA 4FS3A 3NNNA 4LRXA 4X41A 2N9UA 2XTMA 3EJWA 2GM3A 4UULA 3AVYA 5FB3A 1GSIA 1KP2A 1NQXA 4V3CA 3FTPA 3EGEA 3G0OA 2ISSD 2WG1A 1RQLA 3K0EA 1FVHA 4WXRA 4DJDC 4DV3B 3W2TA 1M3SA 4Q9IA 3OQHA 3LP5A 1YS6A 3NWJA 1A7KA 4DT1A 1G5QA 4ED9A 4F2PA 3BWYA 1Z16A 3SSAA 3S1AA 3BZUA 5NLLA 2PSSA 2J07A 1C3VA 3OZVA 3PC2A 2HSZA 1ZIDA 5C18A 2IZ7A 4OYLA 5EKDA 4G81A 4AY4A 1MA0A 5E1OA 1E7SA 1J5PA 1XDSA 1YDWA 1KMCA 1W44A 5ITVA 2WWVD 1TRHA 2JK1A 1JG3A 1VMDA 3KQQA 3GFBA 3PI6A 4FHDA 4L1KA 3DGEC 5JXHA 3V1MA 1Z8NA 1RI3A 2AQHA 3KFXA 5A02A 5J4KA 3TUZC 3N2YA 3RSHA 1M1XB 4DBLE 5AW1A 4MVJF 3R8CA 2Q8QA 4RY2A 4MUIA 4YGYA 5EPEA 1WAMA 1Z4MA 2ADFA 1LV8A 3E05A 3GLSA 1MW9X 1G1AA 2XTZA 2F3PA 3L2OB 1OU4A 1X1BA 2UZAA 1XX6A 4N12A 4ZO7A 1FYWA 4JWKA 1P2SA 2GLUA 4AD8A 3W6PA 3AF3A 4RTNA 1DJOA 2JA1A 2WWHA 1V11B 1XTIA 2HRZA 4HNQA 2Q1YA 2FF7A 3BQMB 2GETA 5FUMA 2CFCA 4OU4A 2C7VA 7ABPA 2MR5A 1V2GA 5E1MA 5LP6C 3RTGA 3SQWA 1AHIA 4KR9A 2CXTA 3EIXA 4CL2A 2CK3A 2XQVA 3BHIA 4GBMA 2X4GA 4ZOEA 5JLJA 2PLWA 5CCEA 3KQNA 4DR2B 2HXYA 5IANA 1MEEA 3OPMA 1FDUA 4LF9B 1XYYA 1QHXA 2HKIA 1JZSA 3CX8A 2FK7A 1LLUA 1GR0A 2NADA 4HNSA 4YUYA 3L4KA 3NWEA 3BXZA 1GQ2A 2AJ8A 3BM5A 3QK7A 4IZOA 3PGKA 3QF4A 3KFVA 1DBPA 4P22A 2A57A 1PF7E 2DUUA 2IXDA 2ERXA 2PUHA 4HB2A 1VE5A 4OHFA 1X1RA 3QV1A 1S2MA 4MW2A 2BFCA 4OH1A 1R66A 4BNLA 2QL5A 5A3JA 3DEIA 3BZBA 2CFOA 4HSGA 1M72A 4R1TA 3SR4A 5IYZA 2XDQA 3BH0A 4ZAXA 2B8WA 3AERA 5ALKA 2FP4B 3F98A 4OGLA 5DB4A 2AX3A 4ND4A 2R4UA 5HIIA 1UEIA 4X20B 5A06A 2H48A 4ND6A 1KZ9A 2CBGA 5AO9A 1N77A 1E2EA 1TQ8A 4JJAA 1E1CB 1JQ5A 4FNMA 3K8YA 3VXKA 2ZRCA 2D6FA 3H9EO 2GARA 3N6XA 2A94A 2IYRA 2B82A 2CHVA 3QVOA 5BNZA 1T0BA 5CLFA 2O8BB 5I51A 4DKXA 2BLNA 1SUWA 2NU9A 1NW8A 4YRJA 5IM4A 2EDCA 4FWIB 4ALJA 2VDMB 4YRFA 2CCJA 2GPJA 4DNFA 3JVVA 4IIEA 1AKQA 3CUSA 3GGOA 4F96A 2NU6A 4W9MC 4KR6A 1EAYA 4QUIA 2EFDB 4IUBS 4QU8A 2GPWA 4FQ8A 1JVBA 2H31A 5IN5A 3HEBA 3GUHA 3WBKA 1Q2UA 1H0SA 1Q14A 3CN9A 4B3DA 1SKUA 4PY2A 1CC1S 1KL7A 1LS6A 4PNPA 4GZ3A 2P2YA 3HYCA 4NLLA 3KSRA 1VKOA 5EE5B 4OLFA 4GUAA 4Y2UA 1G8AA 3EMKA 1R5NA 4TVKA 1FLVA 1CUJA 1TIPA 1ZRNA 2V5UA 1YZQA 3GMIA 1VPVA 4FHEA 1AQYA 4P7GA 5DXFA 2IF0A 3RK4A 4FJ2A 4YXWD 5JAZA 4BO3A 1JE1A 4YO8A 4JFRA 4LJ4A 3GHYA 1L5YA 1HL3A 4OQEA 1NDQA 3MOIA 4L75A 3V2GA 4MRPA 3L0DA 3MWLA 3ZOZA 4ADSG 4DSOA 2NVUA 4EY7A 4AY2A 4DCNA 1LBIA 4E0BA 4NJOA 1GZSA 2JASA 3DTVA 3ORQA 4GYKA 4O4JA 3Q0EA 2IHVA 4JC0A 5FEUA 3OVMA 2FA9A 5KU7A 3U09A 2VYFA 4MUYA 1M6VA 4YLGA 3O38A 1R64A 3HEMA 1XZEA 4E2XA 1U7HA 4OA5A 3SJ7A 2IYPA 3LYHA 1JMVA 1QSGA 3I4FA 3QX3A 2OQIA 3UEOA 3UJPA 3GNQA 4JBYA 4TS1A 1QWOA 1SHTX 2J59A 4TV9A 5CK4A 2R2AA 1TOAA 3FTCA 4MA5A 2DFPA 1U8YA 2JAPA 3TQCA 4BLOA 2G07A 2D1QA 1U0EA 3UXEA 2RHCA 1A9ZA 2F90A 3BMOB 3FB4A 4JHXA 3MT7A 5TF4A 6ABPA 1QO7A 5JY6A 4XDYA 1OJLA 1T9KA 1U9JA 2O5RA 2VZEA 4ONEA 1TTHA 3WLKX 2M1ZA 4BRWA 3QM1A 1RFGE 3QW2A 5IC4A 4A6PA 1JALA 4Y7CA 2EBHX 4QM6A 4UE6A 2IYXA 3DM5A 4L0QA 5E2BA 4JXZA 1IY9A 4M38A 4JJ4A 2AKYA 1V5WA 1A7AA 2MSDB 3H2HA 3UV7A 2QY6A 1ORRA 3AY0A 2WFAA 5DI3B 3U3JA 2HEGA 2G17A 3PFFA 4QLAA 1UXHA 2XX3A 1K6XA 3A1CA 2QTFA 2WU8A 3L0BA 1TKBA 3MJSA 5DX8A 1QHIA 1XQXA 4KX3A 1U7ZA 3HUFA 2WR8A 4EHDA 4ZZ3A 3WK4A 1SN7A 1DUIA 1P9OA 3A9TA 3VMMA 1Z0SA 5J4LA 3W5HA 1DC6A 4G85A 3RIGA 4E4YA 1ZD4A 2VDLB 3C5WP 5EJ9A 4B3TB 3GELA 3SSNA 3F96A 1SB8A 3CZMA 2ZIZA 2FZKA 3CIOA 2W2TA 3NAZA 4YQYA 2NZVG 4N5LA 2X9NA 4NABA 5J5AA 3WQHA 2NO0A 1JFRA 1VYTA 2WYHA 4NQZA 4PLVA 4H4DA 3VR5D 3KWFA 1YGPA 3AEQA 5AHXA 1FQWA 1UJ4A 2IPLA 1OTXA 2L82A 4GNKA 2VTBB 1DE0A 4TKLA 4FNOA 1V16A 3R76A 1N5JA 3COJA 3I9KA 4C76A 3ZHVA 1F6BA 5E95A 1ZJ4A 4HNUA 1J2UA 4B71A 3B7PA 2QRZA 4C7KA 4RCVA 1I1OA 1VRVA 2R1VB 3IIMA 3Q3EA 1DC3A 1DFGA 2RH4A 2WV7A 3JW8A 1FMFA 2JIZD 2OV3A 4JJ8A 3AXTA 3H9UA 4J0CA 4OAPA 3BCSA 1ZYUA 2Q3BA 2VDVE 4IJ6A 4IRXA 2ZJ0A 4L5IA 4OM8A 4ECAA 4F04A 5CDTA 1JI0A 4QU5A 2JD0A 3ZYZA 3ADPA 2RDMA 2W70A 4RF3A 2ACVA 2ZBVA 1E0JA 4OYYA 3RHZA 3NM5A 3V33A 1SPBS 3B20A 3D4IA 2NIPA 1QP4A 5DWDA 1Y6QA 2LTAA 4HAVA 4DV6B 4WW0A 3RUAA 2COEA 5ALRA 1HT3A 3OPVA 3QFTA 1HGXA 3L43A 3QKRB 1LD3A 2ODTX 1NMYA 4WOCA 1M1YA 3PJRA 1IHPA 1JZTA 1GXSA 3LG2A 1H3NA 2XMRA 4L4RA 3BSFA 5HUHA 1Z63A 4ZXPA 4ARCA 2IYVA 1BKSB 5EKXA 4B81A 4YP7A 3RRJA 2BBTA 2JJQA 3WO1A 1NY6A 1PFGA 3A58B 3FW1A 4K1XA 5HZMA 2EFYA 3SS7X 3D31A 4YJFA 2QR3A 2FDRA 4FGWA 5K0TA 2FWPA 1TLLA 1X87A 2C2HA 2P8JA 1E32A 3C1TA 3N6RA 2FZVA 3DE5X 1D0VA 2H4HA 1Y3DE 4GMKA 3M2PA 2ZROA 2QEQA 3O8DA 5C1DA 3INYA 2WD9A 4ARBA 1ZQ1A 4RTQA 1SPXA 5DNUA 2PKEA 2VTDA 4C1NA 1GNRA 1VC2A 1EFVA 1TRKA 3D59A 5ITZA 4FM9A 1CJMA 1Z73A 3OTIA 4NH0A 1QFJA 4F8YA 1B6SA 4DEYA 2BN4A 3H75A 4FW8A 1A2OA 2OAQ1 1GEEA 4L6IA 1FFCA 2NSHA 1I8TA 3GOHA 3KQYA 4XM2A 5JXJA 3B3JA 4FZJA 4EB6B 2CJXA 1J8YF 2BAGA 3M5CA 2J3QA 4TT8A 1P0MA 2CSUA 3FDZA 4X7BA 5EEGA 4HR7A 4D99A 3D6HA 1SOVA 4YLEA 1KYXA 2GDZA 2JJ8A 3WLIA 4F7DA 4QTUB 3A4YA 2UZ0A 3ETDA 3PDCA 4NZYA 1RP7A 4WKPA 4BYGA 2F48A 1FFAA 4AKIA 5B3LA 1Q19A 2PRIA 4Q03A 4Y6QA 1UJBA 2I6SA 5AR1A 1CK4A 2CCGA 2YICA 2FPXA 2TRSB 3DWFA 1MB4A 3OFSA 4MS4A 4WV3A 3RT1A 1QFZA 2N42A 4UTOA 5ALVA 1W25A 1VYUA 2YHUA 3Q2KA 1H8HD 4GAEA 3VR3D 1AB5A 3GLVA 2VN8A 4J4HA 2E7ZA 4G8DA 5JAQA 3LY5A 4HH3C 1OWNA 4K40A 5DOZA 2FRDC 1V7CA 2D74A 3TX2A 5IULC 1VE7A 3UWSA 4A0FA 3L5OA 3J7AC 1H0RA 4RMHA 1D2RA 2CVPA 1NRWA 2WB2A 2GAFA 2AV6A 2PD6A 2XMPA 5ECWA 1QP7A 1SUSA 2HXGA 2PSFA 4CFSA 1J8QA 4F8EA 1E2LA 4PR3A 2GCPA 1C50A 3NNDA 1EGQA 2OLKA 3BJRA 3CWQA 4OP2A 5D7NA 3IAXA 2IEZA 3LHKA 3O8QA 3LQRA 2PIDA 1QZXA 2FUG6 1I2CA 1UDCA 3EVGA 4MEJA 4BQQA 4XDZA 1NVMB 4G9BA 4IDGA 3CCCA 4QDTA 2R1ZA 1NKTA 1E6WA 1GSAA 3PK0A 4RNDB 2AFHA 5JALA 1O89A 3ESDA 4B74A 3OJXA 1PT6A 2C7BA 4EB0A 2HOQA 3C24A 5JI3E 3FPGA 3W34A 3IUJA 1H6BA 4R9RA 3IEMA 4I81A 5E4YA 3QOYA 5CT5A 3DZDA 2SKDA 1WD7A 1ONSA 2OENG 2ZM6B 4Z3OA 2EJWA 5EC8A 4TYWA 1ZH8A 4BLVA 1P4SA 1YUNA 2QPLA 4PHFA 1YBVA 2EX1A 1FUUA 2HU2A 2ZCVA 3HDJA 4NF2A 1C9NA 3FHJA 2ZJZA 3O03A 1N75A 2Q21A 3PKIA 3DVAA 3EASA 1VSUA 3PZRA 4GX2A 4PTZA 5TC4A 3S5JA 4HKTA 4DM3A 1EESA 3UG6A 2HJGA 4DDHA 1LW7A 3ZV4A 5CFMA 1UKZA 4MGHA 2FJUA 1IH8A 2JLXA 1E3MA 4LY6A 2C2ZA 1NBMA 2FZGA 2JCGA 2XE4A 3UK6A 4CCAA 2O3QA 5EOVA 4CV0A 2OO5A 1MAWA 3CNEA 1XFAA 1CQJB 1Z2PX 2RARA 5CB4B 5CU7A 1DZIA 4MARA 1ISSA 3M49A 1U04A 1XDUA 3BKWA 1XR3A 1D1SA 4G8JA 1SRQA 5KKAA 5U1PA 1GA1A 4A6EA 4FQ5A 3O8BA 4DLNA 3TWOA 3UB2A 4BVGA 2JDIA 2YXLA 3EVCA 4Z0NA 3HL0A 3KJEA 4LJ7A 4R5HA 3LW8A 1G4AE 4X91A 3HKCB 5CYPA 1SULA 2J3JA 2V59A 4GWGA 1P3DA 3A1VA 4DV0B 2GZRA 3WA7A 3FBGA 2B5WA 3OOWA 3ZGLA 4DMHA 2Q29A 2PUCA 3G9XA 5FL3A 3NRBA 3AO0B 5I3ZA 2J7KA 1GRCA 3LIPA 5SYMA 5TMDA 5JAMA 2JH3A 2VRWA 2UV8A 1ZNYA 2MYUA 2JGJA 1ZIXA 1Z0UA 3ESCA 4B75A 3L1KA 1QAMA 2R25B 1T1IA 1P17A 1LI7A 2QTRA 4KXYA 4FONA 2BUBA 2LR0A 4Q6BA 1OLUB 2R751 3D54D 1C9KA 2PL9A 4CIAA 4G5QA 4N47A 2O2CA 1OY1A 3HY4A 1KERA 1CJTC 3RYFA 4CMCA 4F3YA 2R8YA 1TFRA 1NVBA 1OF1A 4IXDA 1ZICA 2WT4A 4CMJA 4BEWA 4HLCA 1J6UA 1U0RA 3OKAA 2FN8A 5B6JA 2RI0A 3OM0A 2YW9A 3L05A 3VZPA 2Q07A 4HVCA 3KG2A 4UAVA 2R6JA 4MQFA 1RWMA 2IF2A 2Y77A 4ND3A 4IHKA 3OT1B 5ALEA 4Q3BA 5LUAA 2VYVD 2FEWB 1LNQA 1ML4A 4LTNA 4OQQA 1SO8A 2G8LA 2ZRAA 1VBNA 5FAXA 3SFTA 1G66A 3BWMA 5FI0B 3BB3A 2FSHA 3LD9A 1J24A 4LYYA 2QSZA 4ZYLA 3DFMA 3O8CA 1W2WB 2QX8A 2AEEA 4X1YA 2XYHA 4B2IA 3CSUA 1QB8A 5BSVA 5EVCA 2PU5A 3SICE 4BC1A 5T4EA 3T3NA 3H8VA 1JIUA 1H8ED 1I3LA 3KVVA 3DO6A 4QBIA 4RKRA 2TECE 4O2AF 2E1RA 1OILA 2VYCA 4WJZA 3H0KA 4WHMA 5JBIA 1ZM4A 5TB5A 5LA6B 4DUPA 1GZVA 1DIBA 1BD4A 3EY9A 2IPOA 2HYDA 2H17A 3CNHA 1T9GS 2XAUA 4MCJA 1YTLA 3W5UA 3CEJA 3U1BA 1ILWA 1JHPA 4EITA 2H4FA 2LIVA 3CJRA 3H04A 3Q2IA 3S7ZA 3E84A 5IMSA 1H9CA 1X15A 1UK9A 2OM2A 2TMYA 3M6MD 4I8IA 1JEAA 5LLSA 4CF6A 4AKGA 4Z6KA 1JIQA 2HWKA 2ZI7A 4OTZA 4AUNA 4I1PA 1W85B 3HR7A 1FFBA 1Y9JA 4OIMA 2QUAA 4BO0A 4Z7JA 4NBNA 3IPLA 3O94A 3WLHA 4J1QA 2YJGA 1HZZA 4B3GA 1DLIA 3GFVA 4WIAA