1I2ZA

E. coli enoyl reductase in complex with nad and brl-12654
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
molecule tags Oxidoreductase
source organism Escherichia coli
publication title 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI).
pubmed doi rcsb
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i2zA00
3ENNA 1YKFA 2GRAA 2VHXA 5JYDA 2PH5A 2FR8A 3JQ6A 4YJFA 4Q39A 3NDJA 3ADOA 2NTNA 1RJWA 4D46A 1PWZA 3WICA 1SMKA 4NBWA 5DBIA 1ADBA 3C3XA 4PFJA 3BA1A 8ADHA 1I10A 2PA3A 4WLOA 1DSSG 3N7UA 4WCFB 2PGDA 1GL3A 3WDSA 3ZGYA 4IJUA 2EEZA 1FMCA 1X15A 2PD6A 1E6WA 4EI2A 2QRLA 4PLZA 3V2HA 1C0PA 3HQ4O 4KUHA 4O6VA 1RYEA 4L75A 1TA4A 1NPYA 2VUUA 2I3AA 3JD3A 3LC7O 1C1DB 3ASVA 3O26A 3OBBA 3VPHA 4IPTA 2VUSA 3FI9A 5TJHA 3D1LA 3MWDB 3ZW9A 4CM5A 4DBZA 2O23A 4FFPA 1O6ZA 3I4CA 3IMFA 4J2OA 3UF0A 3MJSA 1GR0A 2HJSA 2P9CA 1YL7A 2QHXA 6LDHA 4G2NA 2VT3A 6ADHA 1CRWG 2X7HA 3H6KA 4WPGA 4XQ9A 3CE6A 1LQTA 5KWEA 4GQAA 4JIGA 2EG9A 4ZGWA 4AICA 4W4TA 3IP1A 1JLLA 4RL6A 1GEGA 2WYWA 3TDKA 4BNGA 4EDFA 4BUCA 1GTMA 1ZO8A 4TMFA 1TLTA 3NJ8A 1TEHA 5EQDA 3DR3A 2BMAA 4OXNA 1PZFA 2GNAA 1H6BA 3AWDA 1N1GA 1HXHA 4L4SA 3RKRA 5EIOA 3JYPA 4TRJA 2QZ9A 3FF4A 1M2WA 1PZHA 3DMYA 3H9JA 4R69A 1IZ0A 2O4UX 2VOEA 2ZJ0A 5IDWA 3FTPA 2BGKA 4ALLA 3BMCA 2V6GA 2PLAA 5I7EA 2E82A 4I1IA 1EFKA 1MB4A 1PGQA 4GX1A 3AOGA 2B69A 1QORA 1BXGA 1IULA 1I2ZA 4BNIA 1O0SA 4MVJA 4OYRA 4A5OA 1TB4A 3CZMA 4ND1A 2YJZA 4WK6A 5I8ZA 1ZH8A 4A7PA 4W6ZA 5BSGA 5LDGA 3L4BC 3W8DA 1Y5MA 1IY8A 2CNBA 3B20A 3GPIA 5J23A 3E9MA 3GVCA 4DQUA 3Q0EA 4DLAA 1R0KA 4ND3A 3JYQA 2GN8A 4HWKA 4CLRB 1F0YA 4K6CA 4WLNA 1GDHA 4QFDA 3BMNB 2CFCA 4KZPA 5IXSA 2W8ZA 2YUTA 4PLYA 5CP8A 1XEAA 4IIVA 1EDZA 4BKRA 1B3BA 4R16A 3K8ZA 5COQA 1CJCA 3DFZA 3JYLA 4HY3A 4INAA 1LSOA 4PZEA 1DHTA 4LMPA 3OMLA 4GH5A 4XKJA 5IZ4A 2PY6A 4CJXA 2VCYA 3DTYA 1B8VA 1QKIA 4BNLA 3IJPA 2B36A 3PWSA 4MVJG 4HADA 3I9LA 1PJ4A 4PGFA 2X58A 3BAZA 4CMEA 4CR8A 3W6UA 3F4LA 3BYZA 4MDHA 1ZK4A 2ZB3A 3ROQA 3QY9A 4D3FA 4UEJA 4C7KA 3PGXA 4KUEA 3JQBC 5FFFA 2XAAA 1MG5A 1ONOA 4D44A 2P5YA 1GUYA 3DHYA 5T67A 1F17A 1PJLA 2ZCVA 3GT0A 4DRYA 3TPCA 4IZHA 2EWMA 3H9UA 3GC6A 2BGMA 4YVFA 4RVHA 2YDXA 3GZ4A 4ESOA 2YY7A 4IQ8A 2BF7A 3RI3A 2QRKA 2VNSA 1DLIA 1OC2A 1XWFA 2VYNA 2QG4A 4F3YA 4WLUA 3P2YA 4MKRA 1M75A 3H4VA 3AM5A 1U4OA 2NLOA 3ST7A 1K89A 3A14A 4XDYA 4BO8A 3OFSA 1E7RA 4YJHB 5KKAA 3DONA 2X6TA 4PG5A 4BNZA 4E0BA 1BW9B 3CIFA 2PGLA 1XU9A 3BHIA 3PQDA 5L3ZA 4HFNA 5JNLA 2X0NA 4CM6A 1N7GA 1HZZA 1B3RA 3E18A 2P4HX 4U6QA 1E1NA 4JX8A 1ZEMA 3LLVA 1LLCA 2WTBA 3AUAA 4YRBA 4MVJD 3F5SA 4IMPA 3O38A 1NAHA 3OIGA 3AI2A 2NADA 4M86A 1HETA 4CM9A 5IN5A 4E33A 4WOJA 3WTBA 3MOGA 4OGWA 1EZ4A 5H83A 4HBGA 1GFSA 4CQMD 1S7CA 3GUCA 5ITWA 4F45A 2Y1DA 3M1AA 4OAQA 1V3VA 2J3KA 1C1XA 3RFXA 2ZYDA 4W7HA 4XJSA 2GF2A 4HFJA 1PQPA 2BFOA 4RLHA 2WD7A 2OGUA 3SEFA 3E48A 4OQYA 4EW6A 3EW7A 1HE5A 4WKGA 4EJMA 5L53A 3G49A 1IB6A 4C4OA 1I0ZA 1YDWA 1C14A 3VDQA 3WLEA 4MVJE 4DPMA 3ITDA 1FJHA 1KVQA 3BMOB 4LVUA 3ICCA 4J4TA 3LF2A 3RU7A 5IXYA 1OI7A 3FBGA 2D5AA 4B7CA 1T26A 1DJQA 3UN1A 4BQPA 1LDYA 4HXYA 2VWPA 2DBVO 4WASA 4FS3A 3L07A 3AUSA 2IYOA 4YQZA 3UCFA 2Y0EA 5BNIA 4GMFA 4PVDA 4JBGA 1Z75A 4DIFA 2YHIB 4CM8A 2JD2A 4R1NA 8LDHA 3WYBA 4GGOA 4CMGA 2EXXA 1H94A 4IZIA 2PNFA 2UUOA 1E7MA 2HMSA 2XF8A 4AFNA 2CF6A 2DU8A 2OOSA 3GAZA 2Z5LA 2PTGA 3N58A 4RCVA 2IZ0A 1ZVMA 3GZNB 2EP7A 1P1HA 3WGOA 3C7AA 3KYBA 3UFXA 2GLXA 2OBNA 1U1IA 4UVEA 1EUDA 1LRKA 3ZU3A 4ZJUA 1YL6A 2OBYA 3TFOA 1T4BA 1WDMA 4KQXA 1B0AA 3PI7A 4LCJA 5JAQA 1HT0A 3F46A 3PHIA 1SNYA 2EIHA 1MA0A 1BXZA 3KO8A 4J91A 3DFUA 4YRDA 1VSUA 3OM9A 3NGXA 5F5LA 3X2FA 1V35A 5L95A 3I9NA 4NFSA 1QYDA 3DBRA 4B3JA 3RBZA 3GGPA 4ZQHA 4CM3A 3ZWYA 5AXDA 1I24A 1UXHA 3NV9A 4CLDA 2NNLD 3BMOA 4RJTA 2C7VA 1HE2A 3U49A 4YAGA 3GNQA 2RHCA 4AJNA 1AXGA 4O0LA 1R0SA 4TZKA 3LSYA 1EBUA 1RYDA 3RAJA 2OORA 3WFIA 4TRRA 3V1TC 1PQUA 1E7SA 4E2YA 5TRTA 2X4GA 5TLSA 5EQFA 4MOWA 2AE2A 2VOJA 1LDEA 3WB9A 3QVTA 1ONPA 2X9NA 1I2BA 1JKJA 2DTDA 2GYYA 2QW8A 4BIIA 4OH1A 5JC1A 1T2AA 1Z7EA 4D43A 2A35A 3ROKA 4BNHA 2DBQA 3GVHA 3HADA 2I3GA 1X1TA 3B1KA 3L9WA 4BNNA 1WDKA 3C1OA 4KDEA 1GCOA 3R3SA 4L76A 2ZYAA 1B26A 4WECA 3JQ7A 3S2GA 1ADFA 2E48A 1ENOA 1G1AA 3GVPA 3PWZA 4CMAA 1EE9A 4DTIA 2AG5A 1ENYA 2CSUA 2R2GA 3PWKA 1E77A 3B1JA 5THQA 4CLOB 3PRJA 4P38A 3CINA 1K6JA 3ZWVA 4TRNA 2IE0A 5H82A 4BGEA 3TZ6A 3I9MA 1T25A 4QUKA 3KXDA 4BNKA 1OAAA 1XU7A 5G0UA 2D8AA 1YVEI 4NFHA 4BO1A 3DZHA 2ZK7A 3GAFA 2YFQA 4AJ4A 4W7IA 3Q3CA 1R16A 2JCVA 5AXBA 2VRCD 2X0JA 4BO7A 3LF1A 3AI3A 2C5AA 2X23A 1H6DA 4BKOA 4GI2A 2CUKA 3I1JA 2E49A 5L40A 3G1TA 1H5QA 3TZHA 3ZHXA 3EC7A 2JAHA 3H8VA 4IDEA 3DOOA 3A06A 1I32A 1VKNA 1VPDA 3UICA 1MV8A 2W2KB 3D7LA 5ITVA 3HHPA 2C82A 4MVJF 3O4RA 1KY4A 3FCOA 3T7CA 1JKFA 5JXWA 4DIBA 1J0XO 3I23A 2W90A 3BHMA 2BFPA 4K9DA 4L4RA 4JN6B 4AVYA 2V6BA 2NQTA 4TSKA 2DUUA 4B4VA 4KUGA 3D3WB 1Q0LA 5HA5A 2NQ8A 4ONEA 2OZPA 1P45A 1U7TA 4DWVA 4CODB 4E5YA 4EUEA 5A05A 4CM4A 4DGSA 3ZWOA 1BG6A 1Y1PA 3WX0A 1SOWA 5CPBA 3ZHZA 4OXKA 3GMSA 1E3WB 4BV9A 4WNCA 4AJ1A 4BVAA 4I9UA 1X1EA 1MXHA 2NWQA 1R4NB 1WPQA 4J43A 2HCTA 3F5QA 5CAEA 1LA2A 1LRJA 3WYCA 4DC1A 4E32A 1U3VA 2H6EA 1EFLA 4BB6A 5BR7A 1U3TA 5JDCC 4CM4B 3JYNA 2BRUA 3E8XA 3KYDA 3RROA 3CH6A 1SO8A 3ONDA 3HDQA 1EVJA 2GUGA 1DHRA 1F8GA 5GZ1A 1MP0A 5DNAA 3U9LA 1ONNA 3FWZA 1KIFA 3UHAA 4A2CA 2V6MA 2Y93A 4PLWA 4B4UA 4CLOA 3CTMA 4NZ9A 1EVZA 3GG2A 4IJVA 2EF1A 1YJ8A 4DMLA 2J8ZA 4CLXA 1D8AA 4Y9DA 4CUZA 3ENKA 4EZBA 3KZVA 3OH8A 4BO6A 4A27A 1YH3A 3U5TA 1ZFNA 1P9LA 1BRMA 2A9FA 3T7EA 3QQPA 5JC8A 1M67A 1A7KA 3NAQA 1E3LA 3JQFA 1X7GA 1ISMA 1MUUA 3NT4A 5F1PA 1N8KA 4U5QA 3F3SA 3INRA 3EUWA 3QVOA 2A4KA 1FK8A 3FNFA 1X0VA 2FRDA 4AJEA 1P1RA 4UEOA 1AHHA 5B4VA 4IQ0A 2B4QA 2C7GA 4CV1A 3PTZA 1HE3A 4CPDA 4KWIA 2GSDA 4JXKA 2J3IA 3JQCA 3ZWCA 1V0JA 1VC2A 1E3SA 5DDIP 5ES3A 4YRAA 4QO8A 3RKUA 3NTQA 3K2BA 4E4YA 1LEHA 1Y6JA 1NWHA 1ML3A 2DTXA 2XPCA 3PYMA 2NVBA 3RCBA 1X13A 3OQBA 3JTMA 3QVWA 1YBVA 1HE4A 1GYPA 1QRRA 1Q7GA 5HS6A 1K0UA 3E6AA 2IRWA 4YPOA 4YAKA 5C7OO 1NYTA 3FHLA 3ZNNA 1JKIA 4KOAA 2YYYA 3V2UA 1D1SA 4E2XA 3EVTA 2X1HA 4MJLA 3CSDA 1ZJYA 2LDXA 3JQBA 2P91A 4S3MA 3ZV5A 1ZIDA 4NJMA 5HWSA 1FXSA 3HUDA 4ILKA 3F1LA 1UP7A 1RPNA 2DFVA 1U28A 2VYND 4BV8A 4GSLA 4A73A 4BO0A 4G81A 5DT9A 4CMIB 2ZB8A 1PGPA 2FSSA 4UUOA 1YBMA 4FC6A 3AY3A 5H81A 1JWAB 3JQ8B 5EESA 3DXFA 1G6KA 5AVOA 2IZZA 3VZQA 4BNFA 1U8FO 5I7VA 1EK5A 3KYDB 3QIVA 4HX5A 4D45A 2CMDA 9LDBA 3WYEA 5EMHA 3F9IA 4JJGA 4BOYA 1NQTA 4J3FA 1DRUA 4L4XA 1EQ2A 4OO3A 2ZKLA 4BKUA 5CEFA 5IDXA 3WGIA 3WGQA 5B1YA 1VLLA 2IXBA 4Q3BA 3WIDA 4CM9D 1LXCA 1HF3A 1A4UA 3MCVA 2RCYA 1KEUA 1T24A 2H1SA 4NDNE 4Z9FA 2J5RA 3ZN2A 4R1SA 1PR3A 1QYVA 3PHHA 2Y68A 4L74A 4M89A 3IL2A 1CWUA 1X7DA 2BI7A 3ZWWA 4OMUA 1W4ZA 4LRTB 1NP3A 1GZ3A 3D5TA 5DP1A 4XR4A 4Y6SA 3DDNA 3E82A 4R41A 1R0LA 1A71A 5U1PA 3K2EA 3RWBA 2AHRA 2EW2A 1ISHA 1M6HA 3D3WA 5A04A 3MEQA 1X14A 1DJNA 1C0LA 3AM4A 3GRPA 4GX0A 5F1OA 3TQHA 4IDFA 4HNGA 1LI4A 2ZCUA 2PFGA 4MP3A 4ND2A 3COSA 3AFNA 4UAGA 4XQCA 4J0FA 4XZ3A 1DIBA 1N92A 3ROPA 2FMUA 2NUAA 3D64A 1JDJA 2EJVA 2W98A 1V9LA 1KBZA 2JFHA 2VQ3A 1JQBA 2Y0DA 3JQ8A 5G0WA 3GEDA 3V2GA 4O59O 1ENZA 2JCXA 1EE2A 2PD4A 4RVUA 4TZTA 1NFRA 4H16A 1HYGA 4F46A 3VTZA 3WLFA 2HO5A 2I67A 3NYWA 3VZRA 3FRJA 3WMWA 5T5QA 4TKMA 3U3XA 2O3UA 1KEVA 3D4NA 2UDPA 1YB4A 2GZ1A 3FNEA 1T1RA 1XG5A 3AFMA 1ARZA 4R9SA 1GD1O 4IGEA 1NHWA 1PJCA 3JQAB 2FPPA 2X9VA 5B37A 4PLGA 1Z7BA 3ZWPA 1I5RA 5B12A 1DDOA 1XGKA 4FJ1A 4Z0TA 3FD8A 1JAXA 4A10A 4U8GA 1J6UA 2GERA 1I3NA 1PJBA 4DA9A 4P8RA 3U0BA 4E6PA 4WCFC 4EBFA 3LC2O 2JFGA 4MKZA 3A1NA 4LGVA 4RZIA 2ZB7A 3EMKA 1E1KA 3M1LA 5C3MA 2J6IA 2VT2A 3L77A 1F8FA 3LC1O 1WDLA 3NGLA 4P4LA 4GWKA 1J4AA 2JFFA 3SJUA 3JD0A 3NUGA 4KTTE 2FHSA 1BXKA 3AOEA 3D5QA 3WGTA 2VNAA 5LCXA 4CQMA 1EK6A 1SZJG 2GPTA 2Q45A 1PJ3A 4ZICA 2O3SA 3QLJA 3HG7A 2YV1A 3IIEA 3OICA 4J4BA 1UZNA 1PS8A 1HLDA 5CPFA 5TJ9A 5IN4A 4NBUA 1UDCA 4J49A 1H6CA 3IJRA 1MC4A 3PHGA 4LVCA 5C37A 3PHJA 3DBLA 5JS6A 1IL0A 2PWZA 3KLPX 4FDAA 3TNLA 1T2DA 4EYEA 1HDXA 1BVRA 1LSSA 4MIYA 4U0JA 2CF5A 4M49A 3H9QA 3P2OA 3HDHA 4RV9A 4R51A 3IUPA 2QX7A 3S2FA 3GA0A 4WLVA 4RDIA 1P3DA 5JDIA 4YEDA 1PJ2A 2GN6A 3RC1A 4CM7A 4NU6A 1H0KA 1MGOA 4UREA 3GF4A 1YB1A 2AEFA 1ZMOA 4AJPA 1GPDG 4YYZA 1NAIA 5I7FA 5BSHA 3G3EA 2FR1A 4CV2A 1E1LA 1LX6A 4OOFA 1ADGA 1LC3A 1VSVA 2VRCA 4B4WA 1R15A 2H63A 2I9PA 4A0SA 1ZK0A 1I3MA 5KVVA 1NXQA 2DQ4A 4IJWA 4MPDA 4QT0A 3C7CB 4DLBA 1U2GA 3UUWA 3OA2A 1N5DA 4E21A 4E30A 1SBYA 3RUIA 3PJGA 2GDZA 4L8VA 2P9GA 1O95A 1LDGA 2HKIA 4QO7A 4DYDA 3ON5A 4BNWA 2DPHA 1N2SA 3DMTC 3OQ1A 4LMRA 4R01A 4D7AA 2DAPA 4GLOA 7ADHA 4NK5A 2FSVA 2FPGA 5FI3A 3JQEA 5T8KA 1PJTA 1P1KA 3KBOA 3MWEB 3PQEA 4TVBA 4DQXA 1XDWA 2W4QA 2CVQA 3NKLA 3DZIA 4JROA 1HDCA 2ZATA 4BMSA 4M54A 1Y8QB 3OJEA 5ADHA 1XHLA 3PIIA 2HLPA 1HDYA 4YAEA 1OOEA 4IS3A 3ZWNA 1W0CA 3ADPA 1BWSA 2Y66A 3GUYA 3RSHA 5G0VA 4FGWA 3UVEA 3GZNA 5A06A 4J90A 4B7UA 4EEXA 2OHXA 4A26A 1A27A 4EUFA 3G79A 3BMNA 3RUFA 1IZ9A 3HFSA 4OSPA 1NFQA 2CZCA 1NVGA 4ZRMA 3BTVA 2NSDA 5A02A 1HTBA 5KNLA 4CM1A 4N5NA 4CQMB 2IDZA 1I36A 3LDHA 4BNTA 4LISA 3QWBA 5L45A 4YT2A 1L7EA 5K6AA 1UR5A 4CL3A 3RU9A 1B15A 1KEWA 2G76A 1YOVB 2NU8A 1ULUA 3G17A 3WFJA 1WVGA 3U09A 1B8UA 1EVIA 2BLLA 3DL2A 4W9NC 3FR7A 1BDBA 3B70A 4DIOA 2GR9A 3H3JA 1SEPA 5IDYA 1A7AA 4Q3CA 1ZK3A 1NPDA 4ROSA 3KSDO 5JCJA 3OQ6A 5DN9A 5L7TA 1GUFA 3QW2A 3NRCA 4E5PA 1VL6A 3AW9A 1CEQA 3WJAA 1MX3A 4UEKA 4RVGA 4RF4A 2PKRA 4I9NA 3O9ZA 2Z95A 4JBIA 1KVTA 4N18A 3HN2A 1E0DA 4RQUA 4ZVVA 1DFHA 1AGNA 3OJLA 5ENDA 2QYSA 5FWNA 1CQIA 4GBJA 3R0IA 2HQ1A 3Q6IA 3GGOA 1NFFA 1WLYA 4FCCA 3ETGA 1DIAA 5DCWA 1B14A 4ZHSA 2LDBA 4GPD1 1ZMTA 2JJYA 2X5OA 1AN9A 1A5ZA 3KSZO 4WJZA 1LLDA 3GFGA 3JQ9C 4CMJA 3QJ5A 2RAFA 3GG9A 4DBVO 3GLQA 3DBHA 3CZRA 4B8ZA 3EZYA 2ZB4A 4KMSA 2QIOA 2CY0A 1VRWA 3TJRA 3JQ9A 1KY5A 2GGSA 3DZBA 2UAGA 3EVNA 3S1LA 4XQGA 3CKYA 2D1YA 1GEEA 3BMQB 4I08A 1VL0A 1YRLA 4A03A 2BELA 1I8TA 1PGJA 4NBTA 3L6OO 1M66A 3KV3O 4PLPA 3VHRA 1CERA 5KJ1A 3HN7A 3L9XA 4U0KA 3WXBA 1NNUA 3WSVA 1H2BA 4CV0A 5L4SA 3VKVA 4B4OA 1K2WA 2RIRA 4QECA 2CVZA 1ZK2A 4GSKA 2Q1TA 4J4HA 4N5LA 3QVXA 4J6FA 4CR7A 1DIGA 1YWGO 1DO8A 2C20A 4YJDA 3SLGA 1CDOA 2OP0A 5EERA 4IDGA 3T4XA 4IS2A 4J1TA 1HEUA 2GASA 3DQPA 4PLTA 2OXIA 1QLJA 3F47A 3HDYA 3VPFA 5JYEA 5KOIA 3W6ZA 1IHXA 2C59A 4XJTA 1SC6A 2PD3A 1ZSVA 5HM8A 5TX7A 2EJWA 1KVUA 4ZU3A 1DRWA 1T1SA 1ZBQA 4I8XA 1Y8RB 3I83A 5JPIA 1C3VA 3U4DA 4OKIA 1WMAA 1E3EA 4GKBA 1E6UA 4J1NA 2RH8A 1P44A 2DVMA 4D3SA 4I9HA 5JY1A 5JAZA 5KVSA 3ASUA 4PG4A 4CL8A 2C0CA 2DBRA 4NK4A 4XCVA 4PZDA 5A1TA 3RVDA 3AY7A 3IQDB 2PZKA 4IMRA 3NT2A 4UVDA 3SLKA 2POQX 2WE7A 2YHIA 4CM8B 4HP8A 4OHUA 5T64A 3P7MA 4Y98A 1PL6A 4RPHA 1A4IA 3KSUA 4DVJA 1Y9EA 1NWCA 1KC1A 2Q1SA 1V3TA 5U9CA 5KJEA 4QSMA 1E5QA 3GEGA 3WGGA 4AL4A 3G0OA 3WNVA 4YJFB 4IQGA 2R00C 1TT5A 1U4SA 5DCUA 3GRKA 3GVXA 5A4DA 1P1JA 5DOVA 1VJ0A 1YO6A 2EW8A 5JMWA 1TXGA 1IUKA 1MC5A 1XQ6A 1UDBA 2NU9A 5HTOA 3Q2IA 3VTFA 4ZQBA 3ULKA 4CMIA 4H7PA 1C1DA 1CF2O 4JJIA 3L4BA 2VWQA 2OMEA 4E12A 2ILTA 2X22A 2NVUA 2OO5A 3CXRA 4RPJA 4QQRA 1YOVA 4Q3DA 3RBVA 1DIRA 1K6IA 5B4UA 2WDZA 1HKUA 2X8LA 1BVUA 1LTHR 3HZZA 3M2PA 4ZA2A 4CUJA 5GMOA 1H2HA 1DC3A 4BL5A 3GVIA 3LT1A 4E3ZA 2Y1CA 1X0XA 5DP2A 1FF9A 2UYYA 2D3TA 2PH3A 5A9TA 1GYRA 2AQ8A 4R68A 2VYVD 4WLEA 1G0NA 1F14A 4P4GA 3E5RA 4LK3A 2Q49A 2HK9A 4B3IA 2EERA 2G17A 2ZJ1A 4YR9A 3F6YA 1YS4A 1MLDA 2JKVA 4PRKA 1C0KA 3JSAA 1V6AA 1I2CA 3FPLA 4XIJA 3OSUA 4RO0A 2EHDA 4NHEA 1PGOA 2CVOA 3LK7A 3ZWBA 3SVTA 4DXHA 3ONFA 4J2HA 4Y6RA 3ETDA 4CMCA 2Q4EA 1IE3A 5IZCA 1SB9A 2BFMA 1XQ1A 2Z1NA 4I5DA 5AYVA 2XOXA 1M76A 3QV1A 3JCZA 3WWYA 1AXEA 2HMUA 1GU7A 2E6UX 1VL8A 1RM5A 5JBIA 2DPGA 1VKOA 2FZWA 3OJOA 5JCXA 1Z45A 5KKCA 4DLLA 3C1TA 2P4QA 2HUNA 3WWZA 1H93A 4BGIA 2HSDA 3GH3A 5A9RA 5KIAA 1BXGB 1Y81A 2FN7A 5CDYA 1WAMA 4U7WA 2YQ4A 4QX6A 3QA9A 3TWOA 1NR7A 3E9QA 1NQAO 4K28A 3A4VA 3VVBA 1Y7TA 2WSBA 3M6IA 3KRTA 4IIUA 2HRZA 5JMPA 3MJEA 1GPJA 2Q4BA 1DIHA 4YAIA 3U4IA 1KOLA 2P5UA 4R5MA 3DBLB 3TF5A 9LDTA 3PFFA 5A9SA 4Z3KA 3LQFA 3ZWMA 1HWYA 3GDFA 3KB6A 5C7IO 1A72A 5GY7A 1NVMB 4GVXA 1PJSA 3TFQA 5IG2A 1BSVA 2OUIA 5TGDA 3BMQA 4IDAA 2PR2A 2O48X 3IAHA 2NV6A 4RVSA 1L7DA 2VTEA 1QP8A 3NDRA 3H65A 3WGHA 5G0TA 5I9LA 4AG3A 4OSOA 2XXBA 1S6YA 4Z6KA 1EUZA 2C2YA 4O1MA 1GQQA 4XB2A 5TF4A 1NQOA 4R1TA 1NPTO 5HRUA 3TZKA 1O94A 5IJZA 1ADCA 1ZSNA 2UVDA 1UAGA 2FP4A 1DRVA 4JNKA 4XR9A 1GY8A 1VJTA 2JHGA 2DC1A 4JP3A 2IODA 1TT7A 4HFRA 5ER9A 2ZTMA 3RD5A 1YQDA 2C5EA 3RUDA 3GN1A 4NPCA 1TVEA 4BS9A 5ILGA 4B3HA 1P0FA 3ZU4A 2NACA 1IPFA 4GWGA 4RGBA 4I5EA 3G1UA 3Q2KA 1LDBA 3H2ZA 5IAAA 4YA6A 4OOEA 1ISIA 3DOCA 1KC3A 1SEVA 1E5LA 5DULA 3DBHB 5K0ZA 3ZWAA 2Q1UA 1Z6ZA 2AG8A 3QWHA 4KWHA 3SC6A 1AHIA 4RPKA 3ITKA 3AM3A 3ZW8A 4AJKA 1UJMA 3JQAA 4WNIA 1ZCJA 5ICMA 2Y0CA 3QWIA 4GGPA 3W4JA 1OBFO 1OFGA 3RFVA 4BO9A 3AUTA 3C1AA 3B1FA 4NFYA 4CR6A 4IM7A 4HV4A 1SAYA 4PLHA 4M55A 1U5CA 1IYZA 1SPXA 5FI5A 5AXCA 3UAGA 4YCAA 4DL9A 3MTJA 1O8CA 3PDJA 1YQXA 5JO9A 3MTGA 5AOVA 2W2KA 2IEDA 1FDSA 4YJGB 4IJKA 4K1LA 3ANLA 4ZD6A 3TOZA 5IFLA 3RBXA 3RQSA 2IYPA 1JN0A 3AOEC 1WMBA 3ANNA 3WQSB 4ALNA 3BXXA 4EUHA 1DC6A 3BHJA 3MZ0A 2NTJA 3JQ7B 4W99A 1F12A 4R5HA 4GVLA 4QXMA 3WQQA 4ZQGA 4YACA 4E5MA 1C1XB 4ALKA 1Q2XA 4OQZA 4NJOA 3HDJA 1E7QA 2PKQO 3Q9UA 3L4SO 4JJFA 3KUXA 4XWYA 5CG2A 4OXYA 3PYXA 4GLLA 5JCJD 1WP4A 1M6WA 3FWNA 3O03A 4XIYA 5COBA 1IPEA 4DPKA 1ZUD1 1ZJZA 3WG9A 3GK3A 3FSRA 3PP8A 1NM5A 3ZDFA 2JAPA 2D0IA 4Y8VA 2B0JA 3DTTA 5CHEA 1KETA 4OM8A 3MOIA 3UGKA 1JAYA 1Z73A 2Q50A 4KDFA 4NG5A 1PWXA 4L9RA 4CQLA 2AW5A 1CETA 1UAYA 3DWFA 1PTJA 1WW8A 2CDCA 4FOSA 3DZGA 3JD1A 5HBRA 1UUFA 4FN4A 3OJFA 2O3JA 4EITA 4TROA 4X54A 4FD3A 1DAPA 4H3VA 1XELA 4FIZA 3MJVA 3PLRA 2C54A 3FPCA 3K92A 1HDRA 3DB2A 1U3UA 5CG1A 1U3WA 5EINA 1ZW1A 4CLEA 2BFAA 1GUZA 1LLQA 2WMDA 2B4RO 4LCEA 3TL2A 2GZ2A 1GYQA 3PGJA 4DQVA 1Q0HA 4AJ2A 3GGGA 3TZCA 4HKTA 4O5OA 2B4TO 4R9RA 3TRIA 2O7SA 4XGIA 2Y05A 2X0IA 2TMDA 3UH1A 1ZZEA 4FFOA 2ZTVA 3WMXA 4R54A 3CMMA 2W2LA 3QWFA 2E4AA 3K96A 4PCVA 4J7XA 4XDZA 3OETA 4BO4A 4YQYA 4RQTA 7MDHA 1D7OA 3PIDA 4ZQEA 3AY6A 4LSWA 2R6JA 5EN4A 4G5HA 5LC1A 1I3LA 2P68A 3HE3A 1Q1NA 5L51A 2WE8A 1GAEO 2W2LD 4HFMA 4MIEA 5G4KA 2G0TA 4JBHA 3I52A 5G4LA 3L0DA 2BKAA 1N1EA 4I5FA 3IC5A 3RC7A 2JD1A 2GN9A 3S2IA 3I9KA 4IDBA 1VJ1A 3QHAA 1WZEA 1P74A 3FR8A 3GN2A 2Y67A 3QVSA 4F6LA 1J5PA 4NBVA 2AEMA 3C7DB 2X0RA 3INTA 3MJCA 4NNJA 4XA8A 2HMVA 3VH3A 4M1QA 3VKUA 3GDGA 3QE3A 4D3DA 4L0QA 5JY6A 2DT5A 3PLNA 3ZI0A 4MVJM 3RJ9A 4D42A 3H7AA 1FDVA 4IY1A 4RDHA 1UP4A 2X5KO 3E5MA 3JQGA 3U4CA 2VZ8A 2HK8A 3VH4A 2PZLA 5EJ2A 1SCUA 4CV3A 1RWBA 1E6EA 1RM0A 1XR3A 2A94A 1RKXA 4FSHA 3H5NA 2PK3A 1H6AA 1DLJA 2GZ3A 3BIOA 1PJQA 2F1KA 2HJRA 1HDZA 1OMOA 1XLTA 2O4CA 4CQLB 3PHLA 4GX5A 2V7PA 1JWBB 1R12A 1V3UA 3ZWXA 5GZ3A 3BZUA 4RORA 3ZNPA 5KTKA 5G0SA 3S2EA 3WSWA 4ALMA 4ZN6A 1DOHA 1OZAA 1Y8RA 1BW9A 2ZTUA 2CD9A 3VH2A 4PVCA 4YBZA 1DXYA 3GEMA 3WR5A 2AQIA 4P4NA 2Q2WA 2JHFA 3DEYX 2FPIA 4BNUA 2QQ5A 1VM6A 5JLAA 1BTOA 5BNFA 1UXKA 3TOXA 5A3JA 2AQHA 4D41A 3DBVO 3GDOA 5L9AA 3HSKA 1MFZA 4XEHA 1GADO 4PLFA 1E7WA 4WE3A 4PG8A 5KVCA 3NEPX 2I66A 3OA0A 4QEDA 5F5NA 4WUVA 3OIFA 2QYTA 2RH4A 3ROMA 2ZQZA 4K6FA 3CMCO 4BMNA 4MVJI 3H2SA 3JD2A 1HSZA 1T2CA 1D3AA 4YAJA 1R4MB 3I9JA 3PQFA 4JGBA 2DLDA 3JQDA 2HMWA 3ZNOA 2YQ5A 1NVTA 3I5MA 4FFRA 1G0OA 1ZXBA 2GN4A 3KEQA 1ZK1A 3NTOA 4R3WA 1E92A 2X86A 3DAGA 2YV3A 4OJNA 1RM4A 1W6UA 4FFMA 4H15A 4N7RA 3C85A 3ZU2A 1YONA 3PK0A 1NQ5A 3V8BA 5TT0A 1XIVA 4MO2A 3GNTA 4TQGA 4OKNA 5T57A 2AA3A 3IOYA 2B37A 2C07A 3PJDA 4E2ZA 5CFZA 5U4QA 3EY4A 3AK4A 1P77A 4XQEA 1NBOA 2UUPA 3EZLA 2I99A 4IDCA 4YB8A 3JV7A 2Y1GA 1SOVA 4NR0A 4UVGA 4ZQFA 3GQVA 3WNQA 1BMDA 4Z0PA 4YDRA 1XA0A 1EEHA 2QZZA 4I5GA 3ONEA 4J9VA 4AJJA 4Z9XA 2IEBA 1ZNQO 4II3A 2O2SA 4PG7A 3HNPA 3K5PA 4S1VA 4BB5A 3GMDA 1UZMA 3C8MA 2P9EA 3PYLA 2I5PO 3VPGA 3Q1LA 2GO1A 5BSEA 1A9ZA 3ZV6A 1E3WA 1UZLA 1EMDA 5KJ6A 4ID9A 3GHHA 4XYGA 1R4MA 2WJPA 1JVBA 1EVYA 4PZCA 4LN1A 4RZHA 4U6SA 5BSFA 1GV1A 3LVFO 4Y67A 1F06A 3IKTA 3H5AA 3D4OA 3AJRA 1QLHA 3VPXA 4NI5A 1YGYA 2DTEA 4GMGA 1EDOA 1K6XA 3RIHA 1PZEA 3QP9A 1H9AA 1LLUA 5ER6A 2Q1WA 2D4AA 1HDGO 3HFGA 1GCUA 2BI8A 1FDUA 4E2WA 2D59A 4FC7A 2Y1OA 4FFLA 3VOSA 5I9MA 3GY0A 1EQUA 3LT2A 4UULA 4YJHA 3RC2A 5A9SB 2I65A 3R1IA 3KYCB 4ITUA 1B7GO 5AXAA 1IOLA 4FJ0A 4FR5A 1ZXLA 5L7YA 4II2A 4YT8A 3LT4A 3FN4A 3U62A 1XYGA 2Z1MA 3R6DA 2BHLA 3B6ZA 4BGUA 2Q2QA 4UUNA 3IS3A 1R6DA 1UDAA 3EHEA 1HSOA 4J0EA 4YT5A 5CDSA 4IGFA 3NJ4A 5T6BA 3ZV3A 2YW9A 3TN7A 4K26A 4O63O 5COAA 1O5IA 5IF3A 1VI2A 3CEAA 4LW8A 3TL3A 1PS0A 4B7XA 5L4LA 3AU9A 4BNXA 3AU8A 1PU2A 3U4HA 2VWGA 3K30A 2WWRA 3VZPA 4YXFA 1KEPA 3TSCA 1E1MA 4CMHA 1P1FA 4B8WA 3H9GA 1DB3A 1KYQA 1WNTA 2A92A 1A9YA 2B83A 5JFOA 3EK2A 3MJTA 4FOOA 3AI1A 1QYXA 1NR1A 1BDMA 2QRJA 3KEOA 5BT9A 4PN3A 4D0SA 1N9GB 2PGJA 4NJMB 1PL8A 3OF2A 5THKA 2HRBA 2PZJA 1GV0A 3D4PA 1U9JA 4EEZA 2NVUB 1YE3A 2VHZA 1LSUA 3EAGA 3T4EA 1LBEA 1KERA 1GZ6A 4RLSA 4CMEC 4R4JA 5AQ1A 5FF9A 2PZMA 4AJOA 5K9ZA 1ENPA 4OL9A 3LYLA 3NDIA 2B35A 1YBAA 4TRMA 2SCUA 3TZQA 5L4NA 1XKQA 4UUMA 3WGYA 3ICPA 4YTEA 2HU2A 4XGKA 3SX2A 4J9UE 1JTVA 1TT5B 1GQ2A 2EKQA 1LNQA 4WLFA 4FJ2A 2ZQYA 5FEUA 4WEQA 4W82A 4ND5A 1T2EA 2FWMX 3RFTA 3WTCA 4E5NA 1QMGA 2V6FA 2Y1EA 5BNTA 3ABIA 2VTDA 1PEDA 4N5MA 5A03A 2FOIA 2EGHA 2WEKA 5GZ6A 2R00A 3VDRA 1LDMA 4YWJA 5LDHA 1N7HA 1LJ8A 5TSDA 1I01A 3JYOA 3W1VA 1HYHA 3ZU5A 2PKQP 3A28A 3E03A 5KVQA 3VPSA 2V65A 3IUSA 2J3HA 4YJGA 2OP1A 2J3JA 4BMVA 1JU9A 3C24A 2UV8A 2ZIZA 4XB1A 2H5LA 1JA9A 3SXPA 1Z74A 4Z3DA 4BNVA 4E13A 3P19A 2G5CA 4FBGA 2WM3A 3P5SA 3L6EA 4KQWA 3GFBA 3W4IA 1HZJA 2AEJA 2VHYA 2J5KA 3WJ7A 5DBFA 2D5CA 5I9NA 1QV7A 1FDWA 2P2SA 3DZJA 3KHUA 1EBFA 4R1UA 1CYDA 5JDIC 1YXMA 3WBBA 3RC9A 5MDHA 4D79A 2OL4A 4RF2A 3RUEA 3LT0A 2VZ0A 2DKNA 4BHTA 1V8BA 3KM0A 3EGOA 2HAEA 3ZZNA 2HK7A 1PR9A 3DZKA 3DZFA 2DM6A 5DCYA 4Q3AA 1YDEA 3MJ4A 3KETA 3I6IA 1Q0QA 1PIWA 3ZH2A 1LDNA 4D0RA 2B5WA 1B8PA 2CDBA 3PZBA 5JO0A 2O50A 1LRLA 2VWHA 5TIIA 5JW6A 3PZRA 1CQJA 2JL1A 5F21A 5ILOA 3M2TA 1UP6A 1MFPA 3O8QA 1I30A 3PJEA 1E7YA 3DMTA 4MP8A 3ZV4A 2OFPA 3DHEA 1PGNA 2O3TA 3QSGA 3EYWA 5EPOA 4MKXA 5T8KC 4BGVA 4UUPA 1AUPA 4NIMA 3KVOA 4TWRA 5JE8A 3OEWA 4L73A 3ZNQA 3UXYA 3RUHA 2E37A 1O9BA 1Y8QA 4DMMA 2C29D 1ISGA 1Z82A 4XRGA 3S55A 2VUTA 3BMCB 2NTVA 2NM0A 4XYLA 5F3RA 1Y5RA 5I7SA 4CUKA 4DPLA 2C2XA 1ID1A 2O3QA 5L7WA 4FB5A 2EKLA 4ND4A 1NX6A 4PIVA 4BKPA 5FYDA 4RF5A 3ZHBA 4JQCA 5IDQA 1LC0A 3V5NA 1H9BA 1DAOA 1HRDA 1I3KA 1NASA 2IXAA 3N74A 2EKPA 4DC0A 3GNSA 3VC7A 4J16A 4RF3A 1Y9AA 3FTNA 3A9WA 3X2EA 1ISFA 2EP5A 2DFDA 2XXJA 3I4FA 4TKLA 4MP6A 4XGNA 4EGFA 3JQGB 2VZ9A 1X7HA 3DOJA 4HNHA 2BGLA 3DAFA 3WBFA 4BO3A 2NU7A 3RJ5A 3OIDA 2Q3EA 3VVCA 3PVZA 4IUYA 4IXTA 4J1SA 4E5KA 4W9NA 1WWKA 4JP2A 4MVJH 4FPXA 3IKVA 3D0OA 4CLRA 1N9GA 2O3RA 3IDSA 4C7JA 4FGSA 3W8EA 4N54A 4RPLA 4IDDA 1IHYA 2YV2A 1R4NA 2AE1A 5CDTA 3DC2A 4QTZA 1PZGA 3LLSA 3PJFA 1UXJA 3ETEA 4NBRA 4PG6A 5A5FA 2NVWA 1W73A 3FNHA 1B16A 3GHYA 4BNYA 5KJFA 1WZIA 4R3NA 5ENVA 4EJ6A 1ZEJA 2VHVA 1DFGA 3AUUA 5TNXA 3VH1A 3K6JA 1LQUA 1WXDA 4IXWA 3DBRB 4UVIA 1P1IA 3STHA 2EV9A 2ET6A 1MXFA 2VYVA 3KOUA 4F6CA 1ULSA 4BNMA 2Q46A 2PV7A 2WYVA 1DC4A 1PQWA 3GPDG 4Q3EA 2BH9A 1JW9B 4YT4A 3F1KA 1DFIA 1P0CA 2YHUA 4DUPA 5MGBA 5TC4A 3KTDA 4Z0HO 5C7LO 2DUWA 2ZTLA 4WCFA 3UKOA 4RPGA 1C0IA 1E3JA 1UXGA 3ZCXA 4EJ0A 3INGA 3K73O 3NX4A 4JK3A 1DC5A 1MG0A 4XYBA 5G4KB 3I3OA 1UXIA 1KVRA 3FBTA 2F00A 4XYEA 5G2OA 2O7QA 1RM3A 3WS7A 4M87A 2VN8A 4B79A 1K5HA 1TI7A 1GZ4A 4WGGA 4GX2A 4FFNA 4WOKA 1ISJA 1PS9A 1QR6A 4NH4A 3RUAA 4BKQA 3BTUA 2BD0A 3LZ6A 2WD8A 1QSGA 3CUKA 4RVDA 4TVOA 1D1TA 1YL5A 5K6AC 3CPSA 1PX0A 1DPGA 2J5QA 2HDHA 5C5IA 1BHSA 1KVSA 4AJHA 2O2YA 3BTOA 2H9IA 3WOHA 4PLVA 3WQRA 5HS4A 1R37A 1HLPA 2FR0A 2GCGA 2JD0A 3D3EA 3Q11A 1XCBA 3HB4X 4FQ8A 1GQYA 3UCXA 2G1UA 4BO2A 5DZSA 3DO5A 4BNJA 1DEHA 2WD7B 2X5JO 3HJAA 3VZSA 3I6QA 1QYWA 5CDGA 1PL7A 4NMHA 1KS9A 3UCEA 1Q7CA 1CIVA 1HL3A 3H5RA 3W8FA 1AE1A 2TMGA 3K31A 1LUAA 4ALJA 3F4BA 1EUCA 4GKVA 1U7HA 3HB5X 4FW8A 2VHWA 3RASA 1W8DA 3OECA 4BQRA 3SJ7A 4CMKA 2AMFA 4XRRA 5TT1A 2YZ7A 4UVHA 3H3FA 3HWRA 3IP3A 4XX0A 1VE9A 3QWAA 4NU5A 4IINA 3UW3A 3KLMX 2Y1FA 3L6DA 4AJLA 4CMBA 4Q3NA 4MINA 3DHNA 2B5VA 2RHRA 2FY8A 4URFA 1QV6A 1T4DA 1LSJA 2JCYA 2DBZA 2YFHA 4OIMA 1YQGA 1U5AA 3PEFA 3SBOA 4Z9YA 4PRLA 3NTRA 4PLCA 4Y6PA 4IBOA 1NTOA 3OJ0A 3JQFC 2FZEA 2Q99A 4M8SA 4J7UA 2RBEA 1QYCA 2IZ1A 1LU9A 2G82A 3H9EO 4G65A 4DREA 4RVFA 3OHSX 1BGVA 1D4FA 3V1YA 4BO5A 1XSEA 4Q9NA 4KP7A 4J7CA 2D2IA 2AXQA 4MIOA 3ANMA 1UH5A 1U2DA 3ZHYA 1T2FA 3R3JA 3K9QO 3OEYA 1DBVO 5EL0A 1PSDA 4KTVE 5DF1A 1J49A 2HMTA 3JQAD 5A5EA 3FNGA 1QXSA 4GL4A 3RUCA 5KCZA 3PXXA 3OP4A 2Y99A 5DOZA 1ZSYA 5CEJA 2VRBA 3BTSA 3EDMA 4DYVA 1L1FA 3UOGA 3QRWA 2CDAA 5JAIA 3GOHA 1B2LA 5I8WA 5CDUA 3DAPA 3JD4A 2I6TA 3NT5A 3PDUA 3V1UA 4NQZA 5A3VA 3WIEA 3VAZA 4XYMA 5BQFA 3O8QB 3I9OA 1R66A 3E9NA 4HUJA 4P22A 5B4TA 4WCDA 4AJIA 4E31A 5JAMA 3GR6A 2Q2VA 3LU1A 3SC4A 5JSFA 4MVJP 3PPIA 4J1QA 3WGZA 5ICSA 5CEEA 1ORRA 5IZCC 1ZKMA 5TQVA 1FDTA 2I76A 1QG6A 1K3TA 3E1KA 2NU6A 3ORFA 4JLWA 1YB5A 3S8MA 1I33A 1U8XX 4JCOA 4LRSB 3Q9NA 4GAEA 4ALIA 5TS3A 5F1KA 1Q7BA 1JVSA 3PFWO 4QFCA 2GD1O 5DBGA 4CLHA 1OC4A 5JDCA 1P31A 2ZYGA 4ZRNA 1NHGA 4XD2A 2YDYA 1E3IA 5KJCA 3W4KA 2EGGA 1HYEA 4WEOA 1SB8A 4LSMA 2X9GA 1O89A 1YJQA 1HDOA 3KYCA 2WYUA 2AQKA 1P33A
chains in the Genus database with same CATH superfamily
3LUPA 1VPEA 1RQ2A 1YKFA 2GRAA 2VHXA 2XUFA 3JQ6A 1Z4LA 3FNRA 3EPKA 2B3TA 3OEHA 3H6GA 1ST2A 3PC7A 2A1UB 3KQOA 2XJ4A 3NHUA 1SVKA 5A6SA 1GTZA 3H11B 5LP6B 3T3HA 1RJWA 2WC1A 1ZIXA 2VDKB 3HB1A 2PXXA 4D46A 4DG5A 1BFKA 2KLBA 2WZBA 1Z88A 4OH7A 3N2NA 1KAHA 4ZI5A 3FPBA 1J0CA 3JZIA 1WKCA 1TIKA 5DBEX 4WZBB 1OASA 2AK2A 1JQEA 5IT9A 4WCFB 3TLZA 1CY7A 1YCGA 1XN1A 3ZGYA 2QX8A 3NW9A 4IJUA 2PD6A 3GL9A 4GD3Q 1E6WA 3V7NA 1DQSA 4QDJA 4HQOA 4PLZA 4P7GA 5FFNA 1KSHA 3V2HA 4CGZA 4TLMB 4KUHA 4HWGA 4DVGA 3D2AA 1SG6A 5D00A 3TSZA 2BGIA 1DX9A 4BJ5A 4HGRA 3PC2A 4PIMA 4RYLA 2BE9A 4YXWA 4P7BA 2QUZA 2XTNA 2IYQA 3MWDB 3OZAA 1E79D 2O23A 4CM5A 1O6ZA 5EIAA 5KPJA 3G88A 3OY2A 4LEIA 1HR0B 3CLVA 1EJ6A 1KORA 2V59A 1E2BA 5IS2A 2D7CA 3EOZA 3DULA 2WUGA 5TMBA 2XVAA 4DJEC 3E61A 3GFVA 1XFDA 2WNIA 1KAEA 3EHDA 3T3GA 2NTYC 4QBHA 1CRWG 4UASA 4QYTA 3NDPA 3H6KA 3QU2A 1R27A 4Q15A 2GF9A 1JBEA 1RR6A 3CE6A 4HZUB 4R7ZA 5KWEA 2OCYC 4GQAA 3LO8A 3OQHA 1JLLA 3EIHA 3TDKA 3HSYA 2YJ4A 1QQ7A 4BUCA 4O4HB 1ZO8A 1Q7RA 2NZ8A 3R5FA 3C98A 1AO0A 4NZPA 5D3KA 1NN0A 3EVGA 1PZFA 2GVZC 2CEAA 2RH5A 4EI7A 1UL1X 4AG6A 1JIVA 1VYVA 1T8TA 1ZL0A 5BQ3A 3WK9A 4PR3A 3W9YA 4IIHA 2WBLC 3JYPA 2J3MA 1M2OA 1NSFA 2AD1A 1A9QA 1UKZA 2PL9A 3EIFA 4K03A 3GUUA 1LW7A 1ZDMA 4X8OA 1YDGA 2HHCA 3P9CA 4V2UA 4ENUA 2ZVPX 3H9JA 5BYKA 3ADBA 2VOEA 2CB9A 2ZJ0A 2ODBA 4KL8S 2ZJ4A 5TMDA 4ALLA 3BMCA 3X0DA 1UOPA 4RHUA 2E82A 1MB4A 1PGQA 1QP0A 4WXPA 2XBLA 2TMKA 4RVNA 1BXGA 1BN7A 1NXXA 2QDKA 2ZPAA 3DG9A 1WS6A 4JBXA 4OYRA 3V6MA 4BNIA 1XLVA 4YPFA 1TB4A 3CZMA 4EO7A 2YJZA 1XA4A 1UC8A 4P3OA 2N1MA 4A7PA 1IHUA 1QIEA 2DCUA 4M2LA 4OAPA 5FOSA 2Q6VA 5K0CA 2HA5A 4GRAA 1Q84A 3V4VB 1N2CB 5I9BA 2HNKA 1JHZA 1DDGA 4I36A 2GHTA 4ND3A 2ZUVA 4OXQA 3JYQA 2KPOA 4CXMA 4AB1A 5AM4A 1ZBDA 5FUQA 3BMNB 3WGLA 3C6BA 1Z5ZA 3IERA 2EBUA 4PLYA 4WY5A 5GADl 1XXHA 4MA4A 4QRHA 3UFXA 2FLWA 1HTWA 2WI8A 1EDZA 1CHNA 1N2BA 1ADYA 1PDWA 3P4YA 4U4AA 3S5JA 5DXFA 2MYTA 5COQA 4R2MA 1BOFA 2H31A 3DFZA 1LPAB 2QLBA 4HY3A 5IU6A 2WTAA 3GWZA 1J8MF 1LSOA 4JQYA 4PZEA 5I7WA 3IIMA 3OTWA 4RM2A 3FZEA 2D06A 3IAM6 4LX8A 3QI2A 4M9XA 4BXOB 1NJ1A 4GH5A 3C15C 1DADA 2CNOA 4K8OA 4P58A 4XKJA 3QMPA 4IJ6A 2VCYA 1M1NB 4CJXA 5ICEA 5KHLB 4LYJA 2GTHA 4V0KA 4FP9A 4DR6B 4UKDA 4DQKA 5EJ7A 4DCCA 2P2GA 4BLTA 3PPWA 2APJA 2QAGA 3FIJA 4IHJA 4PC2A 1ZK4A 1SCDA 3SE0A 2PVPA 3BH7A 2BEUB 2WF7A 3R24A 3R8CA 5LQDA 2BH2A 3U7QB 3UT5A 3NBAA 4P3KA 1P9NA 2F64A 2JFZA 2PL3A 3PGXA 3PE3A 3TKLA 3ZGLA 4O4JA 4C0AC 3MXTA 3ZYZA 5T67A 3PXBA 3ZE2B 1F17A 1PJLA 3TLCA 5J4VA 1MAUA 4GIBA 3GT0A 5HJ7A 4XM0A 4F56A 3VKFA 2PGIA 3E35A 3CF4G 2YDXA 4YI3A 1AQLA 5CD9A 4IQ8A 3PNBA 3IBGA 4L8LA 1GZUA 2PEZA 2I0FA 5IKPA 5HJ2A 1CUHA 1JYSA 1OC2A 1U3DA 1H3FA 1UT5A 1WNFA 2ECQA 1SKUA 2QG4A 5F4BA 4F3YA 1U7DA 4KGDA 3GLGB 1HL7A 4MKRA 1M75A 1FNNA 3ESZA 2R8ZA 4GYJA 4OREX 3JALA 4JJAA 5IJXA 2AJBA 4XDYA 1M8FA 3OFSA 1E7RA 4HOYA 4JJ8A 3DONA 4Z4GA 1A2BA 3TZBA 1VG0B 4E0BA 3VVMA 1G1MA 4W5JA 1ZH2A 1M3SA 1Z7GA 2RGNA 2X0NA 3P9ZA 5H9WA 3CZ5A 3N28A 2P4HX 4X20A 5IARA 5LLSA 3TW6A 2IA5A 4TMTA 3OLXA 1TGYA 1LS1A 1XMJA 3BRWD 5K0FA 3Q3HA 2A33A 4IMPA 4Z49A 4QOGA 5I7HA 3OIGA 2C04A 2NADA 5BUCA 5CVEA 3H5TA 4R9NA 1P5JA 3KOOA 4JY7A 5F76A 4CQMD 5H83A 3D0QA 4W7SA 3GUCA 1X7YB 4IL5A 3PD1A 2HREA 3PT5A 4HYTA 1IK4A 5CK4A 3VZCA 3WL5A 4F45A 1H4QA 3RS4A 2Y1DA 3L7KA 3DDSA 4M1EA 2FMTA 1JKJB 4E03A 4JUBA 3P4XA 3KSAC 1K08A 4N9QA 5ARBA 3UK7A 2IZ6A 5B7NA 1PR4A 2LKCA 3SEFA 4EPYA 1JR3A 4MKIA 1BU8A 1ZN2A 1PRYA 1IJBA 2XUQA 2PL5A 4EB0A 4EJMA 3VDQA 4DCPA 1RWVA 3A1DA 3FVRA 2MSLA 1BXRB 3ITDA 1EFVA 1QH8A 4D1YA 3K5WA 4LRYA 5CBKA 3EQZA 2ZJ2A 5LQKA 2IHJA 4YCMA 1UT8A 3TCXB 2JI6A 1T26A 2OFFA 2V7VA 4CI0B 1P0PA 3D6NB 3TVDA 2ZAYA 1XYYA 4WASA 4N3NA 4YQZA 2UUBB 1RQXA 3FSJX 5BNIA 3DWEX 1TM3E 3FFTA 1XQVA 2CE2X 3C43A 4G8DA 4J0JA 1FYVA 2ATEA 3NAGA 4JVLA 4PNZA 2XA2A 5JVDB 3TSAA 3OOEA 4R1NA 2FSVC 1KA9H 3HLYA 1H94A 1YULA 4R2JA 5BQPA 3DE6X 3DCIA 4KQMA 4Z9BA 3KPWA 2C5BA 3GAZA 2OOSA 3LWBA 4FMDB 4FX5A 1YHZA 5EMJA 4CHGA 1NBAA 3C3KA 5FUYA 3IEIA 2C5GA 2TRSB 3NRJA 4MULA 5CT8A 1JHDA 4QM6A 3HFRA 5H3CA 5JS7A 3K94A 2DH6A 1CJSA 1EB9A 2JGKA 3A2MA 1LRKA 4KQ2A 4PYIA 4UVEA 3RYIA 4N5DA 4O4IA 2C98A 3ZU3A 4C6HA 4KVGA 4B2LA 1M34B 4ZJUA 4X66B 1ZA1A 2P3OA 3TFOA 2ZBUA 5LOVB 3FCXA 3MB8A 4CFSA 1B0AA 2KJQA 4FUQA 4EKIA 1HT0A 3U0VA 2CNWA 3BICA 3EJWA 3WRXA 1QRSA 1BGWA 1W35A 3CT4A 3RNOA 1R6VA 1FDIA 4EBBA 5F64A 2CXNA 1VSUA 4GR9A 1CEXA 3OLWA 1V35A 2VNJA 3HYCA 3RLFA 5H16A 3AINA 3DBRA 4B3JA 3RM3A 1Y8ZA 2H1HA 3PEVA 4CM3A 4B3SB 4PYOA 3ZWYA 1M8GA 3VYUB 2Q9AA 4QVGA 1I24A 2OCDA 1UXHA 3I2IA 3BC1A 3N0TA 4KYUA 4CLDA 5I7OA 4C4YA 2NNLD 4FQ5A 1IVSA 4LXYA 4EG4A 4RJTA 1HE2A 1R0XA 1TZ2A 1J25A 4N7MA 5EMNA 1NRJB 3P0FA 2N47A 3U49A 5DYTA 2Q29A 2V9ZA 4L8YA 4YAGA 2ZUFA 5KMGA 2RHCA 3AR5A 3C3EA 3M9LA 4EECA 1J33A 3ZD6A 4X20B 4QGSA 3QF7A 2QGNA 2OUKA 2RGGA 2B7LA 4TZKA 2YMPA 5ALUA 1BMQA 5K8LA 2V3CC 1RYDA 1EFCA 1XTPA 1Z8DA 5DE3A 2MCFA 4TRRA 3M4YA 3V1TC 2PUDA 1BXRA 2ZRKA 1L3CA 2WW8A 3WLOA 2C3OA 1QB8A 4QDTA 5TRTA 4L27A 1K7EB 3ZHYA 3DEKA 4QOSA 5EQFA 4F2WA 5DKFA 2AE2A 2VOJA 2A8YA 1HOTA 3SS8A 3FSEA 5B30A 4TWAA 1XQXA 1JKJA 2CCGA 3K6RA 2GYYA 2AMLA 4WADA 4OH1A 3EUEA 5ITZA 3DGFC 4MW2A 2B2CA 2YWXA 1PJZA 4AN1A 3BWDD 4BNHA 2DBQA 1YA8A 3IDFA 2I3GA 5JTTA 3K1AA 4CU2A 1WDKA 4L76A 3S2GA 1DTWA 2FK7A 2WFLA 2BUCA 2F9FA 1OAOC 1IJFA 1E2KA 2E48A 1ENOA 2IYLD 2SECE 2ZZKA 1JHMA 3GVPA 3MBOA 4I4LA 5JH7A 1W0KA 4MHSA 3QEAZ 3ZVNA 3IT3A 2AG5A 2BLNA 4LJ6A 1QDEA 2OESA 4BLUA 2GILA 4E5VA 4CFZA 1TPZA 2GBLC 2I2BA 4G09A 1K6JA 2GPAA 3EW9A 3U19A 1RRMA 4UHCA 4NQRA 3LY5A 3RYIB 4PRZA 5IP5A 3C5WP 4KO8A 3AJ8A 1QIKA 1C80A 4DNXA 4TKVA 2VHQA 4DR5B 4KRXA 2JVJA 2UYOA 3VOTA 3WHLA 1N77A 3NOQA 5G0UA 4MUEA 1N6IA 2VQ6A 2C4TA 1JQLB 2P6NA 4RYDA 4NFHA 1H2EA 4AJ4A 2ZK7A 3O3MB 4W7IA 4D26A 2O8EB 3Q3CA 2JCVA 5AXBA 4BO7A 2X0JA 4Q9IA 2X23A 3EZXA 1H6DA 5DLDA 3W2FA 4AUMA 4BKOA 3PITA 2CUKA 3I1JA 3VPAA 4GLBA 5B6PA 3TZHA 3ZHXA 2H3HA 4HZIA 1FSGA 3F96A 3OZBA 5IBQA 4IDEA 5TQ2B 3DOOA 5AICA 4G5OA 1D9ZA 3A06A 1VKNA 1FTNA 4G1EB 3UICA 4WXMA 1U0OC 4YV2A 3D7LA 4RJ2A 3OFKA 2MTBA 1EU1A 2C82A 2YRXA 5ITVA 2QSJA 1JBQA 5CX1A 4HB0A 4YMIA 3URMA 1E9VA 4G26A 2YFKA 2IIPA 2ZIAA 3MCZA 5DW3A 3SQXA 5BSHA 4R83A 5J5VA 2BI4A 1UPBA 4NBLA 4RENA 1V9CA 1RBMA 3V1NA 1TQDA 4UHEA 2XUAA 3I23A 3THWA 3U7RA 1FBTA 2VZEA 2BFPA 5IK2A 5I3ZA 4L4RA 4ZANA 5FT9A 3GPCA 3ZHSA 2XODA 4QSHA 1BS2A 1DUIA 1G21A 2E9SA 2QVGA 3U3MA 4WTOA 4TSKA 2GRUA 4MV9A 4Y7DA 4H7DA 4KPGA 1ESNA 3GA5A 5DV9A 1XNHA 3IAS6 1E58A 4UHKA 2OZPA 1N4AA 1I3CA 1U0BB 3IQIX 4DWVA 1QKJA 3DHWC 2ZSBA 1AS2A 3FJOA 3MSXA 1WZ2A 3TIVA 4HB3A 2L69A 1Y1PA 4X84A 1SOWA 5CPBA 1QVAA 3ZHZA 4GDFA 5CYPA 1D0VA 2XUKA 4EVQA 5M7EA 1MENA 2HR1A 3GMSA 3K9WA 4PAQA 4L8GA 4WNCA 2ZWVA 3ME5A 2E89A 3JQQA 4LVOA 3RRJA 3SZ3A 3WRYA 3UJNA 2I4NA 4I46A 4DE5A 1MXHA 1YUMA 2NPIA 4OUDB 1VCMA 3SKXA 4E5UA 1YVDA 2BE7A 2JFYA 4GRDA 4K3VA 4CW7A 3AF3A 5KYGA 1YRYE 3X43A 2O14A 4DNFA 2ID7A 4WBNF 3F5QA 3FG9A 2C2ZA 1YS1X 3UYLA 1LRJA 4S1TA 3QJYA 5C9ZA 1MJ5A 3FWKA 3WYCA 4YMVA 2Q2NA 1AS3A 3FDXA 4BB6A 1U3TA 1XPOA 2O7NA 1N3BA 1VMEA 4ML3A 4YMUA 1GSAA 1QGZA 4FDTA 3CLTC 3RROA 3AVYA 4LDRA 1H23A 4FGLA 2P9QA 1G8PA 3AR4A 4PQYA 4XD7D 1SC9A 3TIGA 4D8YA 1F8GA 1GLNA 4FGZA 4HRAA 5ECDA 4C0WA 5BQXA 5IAJA 1GPUA 3LV8A 2BEVA 1OFVA 2XR1A 4JLSA 3W77A 1R74A 5CXXA 1UMDB 2IYRA 2IS1A 4WRRA 2V6MA 2X5NA 1QH8B 4URVR 5EZQA 4B4UA 4P0TA 3ZHUA 3CVOA 1YJ8A 3NHLA 3B13B 4TT8A 4DMLA 2A88A 2CL6X 5T41A 4AYTA 3NZEA 4EZBA 2ZUBA 3ENKA 4C6TB 3NRBA 1TGVA 3OH8A 3D7NA 4FOPA 3BE8A 4TMVA 4Z0NA 4A27A 1AZSC 4DAEA 4FDVA 3U5TA 2RGWA 5KS2A 1K4MA 4PBSA 3JQFA 3VTKA 1X7GA 3LK6A 1ISMA 1T3GA 2OO5C 4W5WA 3NT4A 2X0EA 3HVJA 4U5QA 1OR8A 3F3SA 5DXJA 3S29A 3INRA 3BD9A 2EATA 1YRBA 2JLRA 3OQIA 1EPUA 3MJHA 3EVEA 5FHQA 4GOOD 4JWKA 3UOWA 3N2YA 1N5RA 2JHCA 4UEOA 3OC6A 4PAOA 3ENVA 3PFHA 4IQ0A 1N6LA 3A0UA 1NY6A 3VC2A 1Q74A 2VP5A 1WQ4A 4HYQA 4AMVA 4NZOA 1SWWA 1H05A 1HE3A 3LCVB 1Y1QA 3OG9A 3PTZA 3W79A 4CPDA 5I48A 4JXKA 2J3IA 4CIAA 2F8SA 1UOEA 3JQCA 2I4RA 4IWXA 2ZAIA 2XBMA 2B1RA 2GH1A 4WNAB 1L1EA 3U7FB 3V8NA 5ES3A 1W36C 5JXHA 3TQQA 2VNKA 4UU1A 3K2BA 3U9SA 4E4YA 1LEHA 1Y6JA 4R1LA 1ML3A 4RWEA 5IWCA 1AKWA 4DIMA 3EARA 4IP0A 4N6OA 4UNSA 3OQBA 3ZOZA 1NQVA 3VYRB 1YBVA 1WE2A 3F6EX 3MJRA 1XI2A 4I14A 1FTGA 1GYPA 4OHPA 3PWTA 4B5LA 1F20A 4I2VA 1Q7GA 2G04A 2WICA 3KFLA 4Y2TA 3TLKA 3VHLB 4CL0A 2IRWA 4CF5A 4YAKA 3TNDA 1R0ZA 2QQEA 3ZE1B 4QULA 4B87A 1IN1A 3VR3D 2XOKD 4XWAA 3AETA 3H5IA 2NAFA 4G89A 2QMZA 3J81A 2VUIB 2WZDA 1ZJYA 2J4CA 3D8HA 4P4SB 2P91A 1BU5A 1CZHA 2BONA 4HNQA 1L5HB 4V1CB 5EZ6B 2A0XA 4GI5A 2AOUB 4L5IA 2EAUA 4BX0A 1ZESA 2BEUA 2C9OA 2FPSA 2QN3A 3FVTA 3HCDA 3IR6A 4KLRA 4UHJA 1HYQA 2C0QA 4BV8A 4XFDA 4A73A 4ARCA 5DT9A 5IF9A 1RSZA 1WUJS 1RABA 1A04A 2FSSA 3O6VA 4OBXA 1YBMA 4WOCA 1A8UA 5E0OA 1NLYA 2CHUA 2V7QD 2EDCA 1IFXA 5EESA 5IH7A 3R0JA 3LUAA 3LRPA 1W4LA 4J0DA 5HK8A 3W9SA 3ZXSA 4M1YA 1SOMA 3DQZA 4HMQA 4MAAA 4XD7A 4JYZA 2UYQA 2IZZA 4BNFA 1KI4A 3VJMA 4HX5A 4D45A 5KNCH 3CGGA 1NMZA 1A9PA 2HQRA 3WYEA 1SIOA 1KRHA 1HC7A 2X4IA 2YV4A 4EG6A 2V54A 1ICEA 1NQTA 5AVZA 2IOFK 2I4TA 1P4GA 2ZSIA 1J0BA 2ZKLA 2OSVA 4Y9TA 1PQ4A 1MD9A 1TCUA 4QNRA 2OO7A 4I7EA 1BO6A 3MWYW 3A70A 4NBNA 4CM9D 3Q9LA 3FGNA 1ZGBA 4LXUA 4D8TA 1A4UA 1KEUA 2P0EA 4GEKA 4TSFD 1H3EA 1J1ZA 1P9OA 2HV9A 2WP8J 3O73A 3TLGA 1QYVA 2Y68A 4KQ6A 1SOUA 2UZIR 3TYXA 4FLEA 1NNLA 4X3CA 3TAHA 4XH9B 5TPZD 1X7DA 2BR3A 1KZ9A 5AJWA 2EP8A 4S1NA 2YZGA 3RAFC 4R0VA 1TVKA 1W4ZA 5BN3A 4HZGA 1GZ3A 2PLWA 4XARA 5EVJA 1U7XA 3LXRA 3VYVA 4ISCA 4KBYA 4D9KA 4XR4A 3FZQA 1AA9A 2H7XA 2QI9C 3DDNA 3KR9A 3K6SB 1E1CB 4R41A 3K2EA 4TUYA 1E1QD 1GZHB 4D97A 2ZDHA 1GTL1 3EZ6A 3G85A 3L41A 4OLFA 3ND6A 1X14A 1K6EA 3EFBA 4G37A 3N2EA 1U0LA 4PHTA 4ZVOA 3U1BA 4BCCA 4EI9A 3ZDBA 1RHRA 3WISA 2VNIA 1Z6TA 1FCJA 5TDHA 3DD5A 4J0FA 2PDAA 3EF1A 4G56A 2NUAA 4UUBA 3ELBA 1JDJA 2ID8A 1YTLA 1KBZA 2C95A 2QM8A 2JFHA 2Z5FA 1JQBA 1XHFA 1VI5A 3D7MA 4TUYF 1TM7E 5G0WA 1ENZA 2C9ZA 4WFIA 2PD4A 1QV9A 3L0SA 4RVUA 4FSDA 3SSAA 2CUTA 5FQNA 4FSXA 3PNSA 2X41A 5J5CA 1XXHB 5TQ0B 3WLFA 1EHYA 1KFCB 3V7YA 5JRDS 3VSDA 1LPBB 3UIEA 3ZCSA 1WXQA 3CCBA 3FRJA 3ZD9A 4OP3A 4F5EA 4JUFA 2QLTA 4TKMA 2CDNA 3BJZA 3C48A 1CK4A 4E88A 3CRZA 1CF9A 2GZ1A 2HBQA 4FHGA 1T1RA 2UZAA 4UXIA 1XXHE 1EUDB 4P53A 4R9SA 2F59A 1GD1O 2DSNA 4IGEA 5A4AA 4YASA 2HDWA 1AZTA 1SKQA 1XJWA 2D00A 2QB5A 2RIPA 4PLGA 1C7ZA 1I5RA 5B37A 5B12A 5ISMA 3H1TA 3WK7A 1C7QA 4K9SA 1T4CB 1ZD8A 2Z2JA 3FD8A 3OCUA 1E2HA 4HK4A 3X3HA 4EG7A 4LWQA 1L4MA 2H8GA 4A10A 3WFJA 1J6UA 2GERA 1I3NA 2OHJA 3REFA 1N5IA 3K9FC 2WKSA 3DHVA 4P8RA 4EO4A 2E4WA 3O74A 3VBCA 4A4DA 3EPJA 4LGVA 3QPCA 5BORA 3M1LA 3LDGA 5C3MA 3F8SA 4QXQA 1UJ6A 1DQPA 3GFTA 1WDLA 3NGLA 4GWKA 2C5SA 3OZEA 5H4HA 4OL0A 2J3EA 1YACA 1YK1A 4EY4A 3K15A 1SUDA 2PSHA 1L4KA 1N6RA 4QPNA 3D5QA 4JA2A 1M0TA 3K8QA 1NXVA 3L8MA 4KW7A 2GPTA 3HYNA 2Q45A 2JK1A 2W2VA 2O3SA 3U44B 3HG7A 2YV1A 3IIEA 3SJCA 2X2PA 1UZNA 4BP8A 1DXQA 1HLDA 3CX4A 1ODLA 1YR2A 1SUEA 4HEJA 3FTDA 4P2BA 5HK9A 4DHWA 1NSTA 5DNDA 5C37A 3ETJA 3C7KA 1CR0A 2ZVQX 4NKRA 4F1WA 2PWZA 5HQ3B 4LV5B 2ZBQA 2OCPA 1HDXA 1BVRA 1EZ1A 5K2OA 1RHJA 3RANA 2JH3A 2VUHB 3U3DA 2NXJA 3H9QA 3KJIA 1EP3B 3WLQA 3AIOA 4F5YA 2JGLA 3HDHA 4R51A 1IBMB 2QX7A 2G67A 3S2FA 3GA0A 4OQDA 2VJMB 2IV3A 1P3DA 3OF5A 4M0LA 3ASYA 3RC1A 4MDFA 4OHWA 3HH8A 1LK0A 1M7GA 2XSZA 3DTVD 4OQEA 3ZCUA 5ADUS 3CNEA 5IMBA 3AHIA 1SVMA 1QIJA 4KI7A 3GF4A 3PLAE 1ACMA 1JMKC 1YB1A 2AEFA 2UVQA 3COYA 3KUDA 3HXOA 2IXEA 3UJDA 1XLTC 5FWYB 1FRFS 2B1JA 5BN5B 3OX1A 4P86A 3T5DA 1DE0A 1E4OA 4YYZA 2NUTB 3AV3A 4CV2A 2YQZA 1E1LA 1LX6A 5D1HA 1ADGA 1LC3A 3TTWA 4B09A 5ICCA 4YGYA 5IMSA 1C9DB 3BD7A 2QD4A 2H63A 2I9PA 2YYSA 3G2KA 4RZQA 5AP9A 3JRXA 1PHRA 2R8EA 4IVRA 1W581 4NL4H 4PSKA 2X0FA 3WLJA 1EA5A 1KSFX 1SIBE 4INOA 1C2YA 3V42A 3UUWA 5JD5A 1GITA 4L6IA 4AS1A 4E21A 1BE0A 4O4IF 4PNPA 2Z43A 3RUIA 4L8VA 2GDZA 3SY8A 5H3HA 4DV1B 1RDFA 3SYTA 3V80A 2Z9CA 4DYDA 1T0PA 2JRCA 3NHJA 3ZJVA 4BNWA 2CHFA 2DPHA 4LMRA 4D7AA 1ZIYA 1SUSA 3STTA 1OH7A 3NUQA 3DCYA 4Q3OA 1U02A 3I2FA 3V1MA 3X1WA 3SN6A 3WIVA 1HBJA 2G77B 3ZDCA 3KBOA 4NZYA 3IXMA 4PTYA 3KSBC 4WOBA 2OHOA 5CLLA 3KQWA 3DVAB 1J5EB 4Q12A 5HG0A 4B76A 3DP7A 3I2KA 2B8WA 2PJDA 1FNSA 4N0DA 3WV5A 3EH1A 4F21A 1HDCA 2ZATA 3LOPA 3GFFA 4IO1A 4LTDA 1L7OA 5E6SA 5K0NA 1Y4UA 4BMSA 1Y8QB 2NYVA 3CZCA 3OJEA 4MZDA 5TEVA 3PIIA 1G5TA 1QZ3A 2YVQA 4GZ5A 4EHAA 2HIHA 2AXNA 4GMDA 3ZWNA 2FZKA 2R6CA 3ADPA 5EFOA 4CGYA 3JASA 4UMFA 4U7DA 3JAKB 2HK6A 1XTRA 1C4KA 3PGMA 4FGWA 4DR7B 3HCCA 5HW0A 2CJPA 3JZFA 4QELA 2Y2VA 4B7UA 5JQGF 4H1WA 3NP9A 1L5LA 4MUGA 1RP7A 3AR6A 4ZO4A 3ESYA 1QQ6A 5FFMA 3QKRB 2Q27A 2OHXA 4IF4A 5J3JA 1DAEA 4EUFA 4QTTB 3MCUA 1SH7A 1ACJA 1FFDA 4KVZA 1IZ9A 2PBZA 2VQSA 1QQAA 1X42A 4YMHA 1NFQA 3E0QA 2CZCA 1GSHA 2ORVA 1XVIA 2NSDA 4X1KB 1GKKA 5EIXA 3ISJA 4ZOEA 2NG1A 3Q7QA 4LZLA 4ZI7F 5LXTA 3U7IA 1MEJA 1I36A 1PT9A 2MSWA 3LDHA 3NHRA 2A57A 3NBZC 4C3ZA 2W83A 3HL4A 2PUBA 1TKBA 2ZDQA 4RGQA 1UR5A 2H00A 3E7DA 4M9ZA 4EKEA 3QPVA 1HMYA 1V8OA 2PH1A 1KEWA 2G76A 3OUUA 1YOVB 4I1SA 1XRLA 3EXFA 4MWCA 3V8PA 3KJGA 3P9SA 3G0CA 3H2JA 3AF4A 2R7LA 2PBLA 5CCXA 1LPPA 3CG0A 3CUYA 3HC7A 1NMYA 5D51S 1PFYA 4Q3CA 1ZK3A 1PAUA 1GDDA 1JDPA 3DFFA 4WK2B 4Y0AA 5KYUB 4DA8A 3KQPA 3OQ6A 4LJSA 5DN9A 3JATB 3QU5A 1R3DA 4OBBA 4K40A 4M9UA 4V38A 3UOAB 3FUXA 5A4FS 3GEHA 3JARB 5JDIA 2ZROA 4NCHA 1R1DA 6GPBA 1Y3CE 3O9ZA 2Z95A 1I4OA 3OWXA 2LCFA 1KVTA 3B89A 1TPYA 3HN2A 4JBIA 3IDOA 4N18A 5HGJA 3W2GA 2AMJA 5KB3A 2J9RA 6NULA 1AGNA 3UAVA 1Z2AA 1JFLA 2MINA 5AW8A 3GZTB 3OJLA 1XJ0A 4AD8A 1CQIA 2O2DA 4GBJA 5DSZA 3NIBA 5AJTA 5IVHA 3EWAA 2Q9BA 2VI5A 5H4GA 3GGOA 1JEQA 3VNSA 3ETGA 4B43A 2BTOA 3ELUA 3S81A 4KR3A 1C1YA 1THTA 1B14A 1TW2A 2JJYA 3RIEA 2OGZA 1AN9A 4AF8A 1XMXA 3KKMA 4JYPA 2OXTA 3TRDA 2WLTA 3B85A 3ZE6A 2DR3A 2WD9A 4IJQA 4RMHA 2IPNA 5TR9A 1HA3A 1T43A 3I34X 2W7TA 3MN1A 4MRNA 2RAFA 4BZWA 1JG1A 1P2BA 3CZRA 1EINA 1RJFA 3DBHA 3EZYA 2ZB4A 5DXAA 1YD7A 5EE9A 2CY0A 1XU4A 1PR5A 3ESXA 4MW7A 1QJ4A 3DMGA 1O96A 2C4NA 3SICE 2GGSA 1Z62A 3DZBA 4RFSA 3AKCA 3EGIA 3CKYA 2WJZB 3AEUA 2PUAA 3IV7A 5ALGA 4OPMA 5BR1A 2VSYA 4C6SA 1PV2A 4U7JA 4RV4A 1IQUA 2WRZA 2FVXA 5LXTB 2BELA 5BUQA 1JR2A 2IELA 3CLUD 3TCKA 1PF7E 2EDAA 4H6XA 2PG3A 2PQ0A 1KO7A 3LHFA 4LBWA 2JHPA 1CERA 4PLPA 4YRCA 5AIAA 3T8YA 4F7DA 4XGRA 2VHCA 2VDUE 4MS3B 5BSRA 3WXBA 1XPJA 5KMGB 1NNUA 1Y6ZA 1RKQA 2XD9A 2RHLA 4KQCA 2ZSFA 3DZDA 4OJYA 3NVDA 3RT7A 5JNWA 2IW3A 3N2GA 1U5BA 4CV0A 2Q3MA 1P5HA 2AYXA 1K2WA 2FGKA 1ZK2A 4GSKA 4OLJA 4LZOA 3WYFA 5AK0A 2YJ3A 1YWGO 1DO8A 2C20A 4WK0B 3OUTA 5AW9A 1XEWX 1CDOA 4J1TA 4PO1A 4Y2YA 3O8RA 3ZJTA 3ITNA 4P3YA 1VBFA 1WV0A 1NMXA 3ZWQA 3OM8A 1P60A 4ZCLA 3FYHA 5KYKA 3T35A 2C59A 2YASA 1B1AA 3VO9A 4MMYB 4IDQA 3KCNA 1T1SA 4X6UA 4RBNA 1J7KA 2Q5JA 4HS9A 4BRUA 4BLRA 1F2UB 3I83A 3IEUA 3CLSD 3L6RA 4KAAA 1VYTA 3QA3E 2ZSDA 4GKBA 4LVNA 3EIOA 1INLA 1L8LA 2AN1A 4Y2XA 1GDTA 4NMWA 2BRUC 2B61A 1CQIB 5LZ8A 1ZXXA 2XADA 2H1IA 5KVSA 1UQTA 2ATXA 2IGTA 3O8OA 4LWOA 4PZDA 4R6WA 4XCVA 2ECPA 3RVDA 1P4HA 4EB8A 5B6IA 3O8LA 4IMRA 1E2JA 3NT2A 4JLVA 1U2QA 4NNPA 4E1VA 1EFDN 4URWR 5AVUA 5T64A 1TAHA 1UPCA 2JARA 2Q5LA 4P33A 4KX5A 4JC0A 1A4IA 4DVJA 1JTEA 4H35A 1NWCA 3I9V6 4RK1A 5CDHA 3DT8A 5JS8A 1R64A 2R48A 1PLLA 4IFIA 1ZM7A 2ZJZA 3BEDA 4KIJA 1O0CA 3FAZA 2PUGA 3MRXA 4LJLA 3QVVA 5HKOA 3QGMA 3UJ8A 2R00C 1TT5A 1OZHA 1U4SA 1KQGA 4MEAA 3V8VA 4H3KB 3GJ4A 2LIPA 2R6ZA 4JIMA 1FLNA 3DTNA 1GXSA 1SBNE 4IDPA 1P1JA 4OATA 5HVNA 3NAMA 4EGCB 5AMXA 1VJ0A 2EW8A 3ORSA 4JFAA 3SU8A 3PGLA 3RW9A 2R1ZA 1IUKA 1TEVA 2FV8A 2NU9A 3O4GA 4C76A 4KXYA 4D6XA 3NNSA 4ZQBA 3DBOB 4XTCS 1TA0A 4CMIA 4EHNA 1C1DA 3OHMA 1BDIA 1DWPA 3CZQA 1T0IA 2H2FA 1QGYA 3DOEA 1MAVA 4G86A 2PKXA 5FOUA 4AZWA 1GRCA 4EYGA 2BDEA 2WAYA 3EYAA 4RD2A 5FNVB 1FYWA 1LWNA 3KAPA 5IKMA 5DCLA 2XMBA 2X22A 1KF0A 3COPA 5KZMB 2QRGA 3WK8A 1IXYA 4AY6A 2ST1A 5EIBC 3ZWKA 5INTA 3VYWA 5K8VA 1RHUA 5CFQA 1F6DA 1UQUA 4Q3DA 1KRXA 1KU6A 3GXOA 4UQPA 4X8LA 2PUVA 2DR2A 2X8LA 1BVUA 1LTHR 3HZZA 3M2PA 3M81A 3QNUA 4IOMA 2HW8A 1E9AA 4QUEA 3SZOA 1H2HA 3FFWA 1N6PA 3WMEA 1D6NA 1X0XA 3NQ41 1XYVA 2VPQA 4PXYA 3F67A 3BCSA 1R10A 3K72B 3N05A 5DGIA 2AQ8A 3A3YA 5T4HA 3KQQA 5LYJA 1PT7A 4KPYA 3ERCA 3AWIA 4G5XA 1E60A 1GGNA 1F14A 2ZXFA 3E5RA 5FWAA 421PA 1OCEA 2EERA 2HXGA 2BFBB 1USUA 2ZJ1A 3AJAA 3GRUA 3QUCA 4JJ7A 4CIXA 1YS4A 3BFKA 4YR9A 2XB8A 1ETUA 3AKDA 4GM4A 1I2CA 1HRKA 2PGNA 3LO5A 4C0SA 4D3ZA 3KQUA 1PGOA 3LK7A 3IQGX 5J4KA 3KKLA 3SYRA 5F2KA 4DXDA 1EFAA 4IIGA 4DXHA 3S3TA 5FADA 3ZXXA 2CXOA 2Q4EA 1PR0A 1IE3A 1KJWA 1QTNA 5AYVA 2ZSJA 1EI9A 2CLCX 1M76A 3RV4A 3JCZA 4QTYA 1AXEA 1Y42X 2GLTA 2XTMA 4G0PA 5ANRB 2OC9A 2DPGA 3G7SA 2IEAA 4BEJA 5KNCA 1VKOA 5DIZA 2OYCA 5CRIA 1PD0A 3VI3B 1PG5A 1SRQA 3N59A 5BUSA 2A5DA 1K27A 3CRMA 4ECAA 4OCZA 4DLLA 3C1TA 1QUEA 4FYMA 2P4QA 4JLUA 4OI1A 1MF7A 2HUNA 4N5HX 3ZZMA 1DBWA 2D2EA 3B6IA 3R9XB 4NH0A 3LX5A 5A9RA 1BXGB 4XI9A 3F3YA 5EIBD 3L8CA 1Y3HA 4U7WA 4A91A 3AYZB 3BE5A 3QA9A 5LMNB 3TWOA 1CJKC 3U80A 5LFAA 5FWXB 2NXNA 1NQAO 3HB9A 5KOYA 1YNOA 2EQAA 3DW1X 4RK5A 5K8UA 3QBDA 4BQSA 4QPJC 2E4UA 3SNKA 3VVBA 2WSBA 5CDFA 1JA1A 4G8CA 5JMPA 1ZGGA 4H31A 3MJEA 1GPJA 1M2OB 1DIHA 4PX3A 3ZE7A 3VUFA 2P5UA 4YIKA 1OZGA 2AFRA 3QVMA 2H59A 2C57A 3MLEA 1G42A 2EFCB 5K0GA 4X45A 3R0XA 5AK4A 5E4FA 5A9SA 1ZZGA 4Z3KA 4W1PA 2F55A 4PSVA 4XVHA 4IV8A 1W30A 2GAOA 3JR3A 3RYHA 1Z2NX 4GVXA 3QLUC 1F8XA 1NVVR 3H86A 4LBVA 1BSVA 4KVFA 2BFEB 2KX7A 2IBMA 3K20A 1ZI8A 3RIGA 4DLSA 1GAWA 2BZGA 3RARA 1APBA 4W6QA 1EWQA 3H65A 2CBZA 3O82A 1NUUA 2P62A 2WMNB 1YMQA 1PEKE 3W5JA 4FZ3A 1O2DA 4O1MA 4XB2A 1NQOA 4R1TA 4R8RA 5HRUA 4G1CA 3TZKA 2O6HA 1O94A 4RHFA 5IJZA 5KCMA 1QCCA 1UAGA 1P39A 1Y5NA 3COWA 4LZJA 2CFRA 2DC1A 2DX7A 3ONWA 1TT7A 5EP2A 5ELMA 1CQJB 2PSSA 5ER9A 1OX4B 2OHVA 4KO1S 3U31A 3WVNA 2C5EA 5FV4A 1JKXA 2X1VA 1O97D 4MW9A 3D1VA 2CNWD 4UZFA 3UB2A 3ZQJA 5A3RA 2WUFA 1BRTA 2FN9A 3K1TA 4WX2B 1P0FA 4RLFA 4GWGA 1A5TA 3EH2A 4OHZA 3FKQA 1NV9A 1G9XA 4S35A 4ZI3A 1G291 4RSHA 5B58C 3QFRA 2WHXA 2G63A 1SBCA 1UPXA 3CN7A 1DWQA 1XFAA 3MHPA 4O0MA 5K0ZA 4QUDA 2UKDA 4LYEA 3QWHA 4KWHA 4DGQA 3RF6A 3BQ9A 3SC6A 2XUGA 3ESRA 4KO4S 5GP1A 3QPUA 1SGWA 3BIWA 4P9NA 4RK0A 2Q9CA 2R8PA 3H3XA 4Q7EA 3ZW8A 4CT0A 1R3UA 4QLAA 1VMAA 1JG4A 3P9KA 2FWNA 3C5HA 3MMNA 2IQ5A 3QWIA 3U3JA 1O6BA 5CGZA 3RFVA 3SIRA 1JLRA 5HE9A 3W9UA 4BO9A 4CR6A 1AF4A 1ECPA 2CXUA 1G8GA 4KN8A 3DDOA 5J58A 2WTMA 2ORIA 4M55A 2JLXA 1OKKA 4XDHA 3BXHA 1IYZA 4JDPA 5AXCA 3T4UA 2VCHA 5BW6B 3MTJA 3TVTA 3U16A 1O8CA 1WEKA 3QIAA 4L5JA 1Z4OA 1XKTA 1Z18A 4DBLC 3M7IA 3H11A 3LPCA 3DEFA 5JO9A 4J0GA 3EG9B 2OBXA 1ZOLA 2W2KA 2XVZA 3VXKA 4EABA 1N2JA 1GFIA 1BFDA 5HF8A 3BE6A 2W2QA 3ZY3A 4IFBA 1NR5A 4WCVA 3RQSA 2C5FA 2IYPA 3ANNA 3O8DA 1W48A 1ZH0A 1VSTA 3HDGA 3FCCA 3UMSA 4QEKA 2Q8PA 1N2CA 2FLKA 1RC1A 3NWEA 4GVLA 3RREA 1YS2X 2CBXA 4V39A 2VF8A 1M6EX 4BATA 4A5SA 3WNCA 4YRKA 4ALKA 4HPJB 1O77A 2W8BB 3L84A 3GT4A 4X63A 1NBWB 4D4LA 3E22B 2XMQA 2VHUA 3N8DA 1Z5OA 4G67A 1U04A 2E55A 1TECE 4GLLA 1JT2A 5JCJD 5CA0F 2ZKIA 1WP4A 1U3CA 1N6KA 2HGZA 4ZCIA 3O03A 3C5CA 1IPEA 1ZUD1 5CDFE 3PQ8A 2BFDA 2YMLA 3FLAA 1K63A 3NM5A 1JQDA 3GK3A 3UB4A 3THYB 3AGQA 2Q5QA 3O83A 2A1TR 4KBGA 2WPDD 2JAPA 2ANBA 2D0IA 3DTTA 5K4AA 1KETA 2VP6A 5K3SA 2D4HA 4DUGA 1ORDA 1AGYA 2R7MA 3NIFB 1JAYA 3JS5A 4UNRA 2Q5EA 3QYFA 1ZKDA 5K7SA 1EZZA 4KHPB 2HU7A 2CDCA 2OBLA 3ZHRA 3DZGA 1H8EA 2NZJA 2BM8A 4LIPD 3EASA 3MQFA 3OJFA 4U2DA 3LUCA 1S2DA 1X9GA 3RSQA 1DAPA 4KPUB 3Q72A