1I2ZA

E. coli enoyl reductase in complex with nad and brl-12654
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i2zA00
1U8FO 2XAAA 1X7HA 3NTQA 3AU9A 3H65A 4ALKA 1ENOA 4XRGA 2X9GA 3QWBA 3DZIA 2VTEA 3OECA 3H4VA 5KJ1A 3DO5A 2DT5A 3L4BC 5L45A 3EHEA 1SBYA 3IUSA 3GNQA 1MC5A 1Q2XA 3PJFA 4A27A 1PJTA 3NYWA 2OMEA 3HSKA 2I99A 4MKXA 3ZNOA 3GEGA 5FYDA 5HS6A 4E4YA 3FTPA 3TL2A 2O3TA 5T5QA 1DLIA 3GHYA 1Q0LA 1I30A 1K89A 4BB5A 4IIUA 4YACA 1VJ0A 1I33A 3JCZA 4YAKA 4WLVA 3G0OA 4DQUA 1DFHA 1E5LA 3AFNA 3LVFO 4YR9A 3LK7A 2FSVA 2NVBA 3CIFA 3FPCA 5A03A 4O59O 3Q6IA 1XQ6A 4N54A 2O3SA 4B4OA 2Y1EA 2DPGA 3ANLA 3BTOA 3NTOA 2YY7A 1CF2O 1B7GO 4KZPA 4B8WA 3WICA 5BR7A 5DBIA 2AA3A 3D5QA 4UVDA 1L7DA 3L4BA 4BNLA 2Z1MA 2Y93A 4QT0A 4IJVA 1H6AA 2Q1UA 3WTCA 4YEDA 3H2SA 4ITUA 1ML3A 1N5DA 4RVGA 2HMTA 4BNZA 1NVMB 2BFMA 4GH5A 2PD3A 3RC9A 5JE8A 2YYYA 1BW9B 1ADGA 2PZJA 4QO7A 4DUPA 1ULSA 9LDBA 3IKTA 5BSGA 1NASA 3RUFA 3MCVA 3QWIA 5KWEA 4AJKA 2NV6A 5JCXA 2TMDA 3PTZA 4R1SA 2Y1FA 1GZ6A 3ONFA 4J3FA 4CM4A 3B6ZA 2ILTA 2W4QA 1A9ZA 3EC7A 4D3FA 2NU9A 3IP3A 3WMXA 1KVQA 2AG5A 3U4IA 5MDHA 1YL7A 3WX0A 1DRWA 5FI3A 2DTXA 1SMKA 3ZHXA 1E3EA 4ZVVA 3PYLA 3KYDB 1GZ4A 2BHLA 2WMDA 2YZ7A 1GPDG 1DAPA 2ET6A 4OJNA 4C4OA 4DPKA 4BO7A 4G81A 1KEVA 2Q46A 1SOWA 2CVOA 2LDXA 3H7AA 4WK6A 4YA6A 2OP1A 3BHMA 4PLHA 4YAIA 2C7VA 3DTYA 4AJNA 4LMPA 1K6XA 4R9SA 1GEEA 4LRTB 1BG6A 2QRKA 3JQGA 3LT4A 1HT0A 3CZRA 4I9UA 4CM5A 3GH3A 1YONA 1A5ZA 2BFPA 2Q4BA 4CV1A 4RPJA 3COSA 4CLEA 1N9GA 1PWZA 2D3TA 3MZ0A 5T6BA 3HB4X 1B2LA 1N1EA 2Q50A 1C14A 4D0SA 2NQ8A 3V2GA 2AQIA 2GD1O 1K5HA 3UH1A 3TWOA 4XX0A 3HQ4O 5A9TA 1NTOA 2VZ0A 2ZTMA 3T4XA 5AXAA 2PKQP 3AUAA 2CUKA 4BNFA 1P1RA 3F1LA 1O9BA 4NDNE 4QXMA 3K73O 3P5SA 4NJOA 1I2BA 4IDBA 2I66A 3W4IA 4BO3A 1U2GA 4WLUA 3VTFA 3ZV5A 4GMGA 4DYVA 5COBA 3CMCO 3M1LA 1NAHA 3LC2O 1DC4A 3V1TC 3D5TA 4EYEA 5CG2A 1LDBA 5JS6A 2P9GA 3GGGA 2DBQA 3JQ7A 4OXNA 3JQDA 1EUDA 2F1KA 3VZQA 3WJ7A 4ALMA 1Q7BA 4CUKA 4DPMA 1O0SA 3TF5A 1GD1O 2GR9A 3GZ4A 1KC3A 2G5CA 3D4PA 4F6CA 2BELA 3P19A 1ID1A 1PX0A 2Q99A 2H9IA 4UAGA 5B12A 2UUOA 4HP8A 5J23A 2OP0A 1UUFA 4GVLA 5CEFA 2GSDA 3AW9A 4MVJP 4HNHA 5L4NA 1GY8A 3MJEA 2QX7A 4MJLA 4AJIA 2JD2A 3GZNB 3CMMA 1AUPA 1LRKA 2WE7A 3GRPA 4BNNA 3MTJA 1LUAA 3GUCA 1F8FA 4Z3KA 5A9SA 1X0XA 3RFTA 2X6TA 3G3EA 3KV3O 2BGKA 2I67A 1VSVA 5HA5A 2Y1OA 1N1GA 3E5MA 2GUGA 4UVIA 2Y0CA 1U7TA 3H9UA 4IQ0A 5FEUA 2Q2VA 2YQ5A 4XB2A 1E6UA 1GCOA 4Q3EA 4NNJA 3WTBA 2WYVA 3UHAA 5JPIA 2QRLA 2QZ9A 1RM4A 2EV9A 1T25A 5DBFA 4GL4A 2DC1A 1LSJA 4K9DA 1OZAA 4BQRA 1BDMA 1JVSA 3ORFA 5F5LA 1KVRA 1ISHA 1Y8QA 1I24A 2PH5A 4YJDA 4NPCA 3DXFA 2HUNA 2GZ1A 5KKCA 3E9QA 4J1SA 4BNJA 3RI3A 4WNIA 1SPXA 3ZNQA 2UV8A 4R54A 4DIFA 4ALIA 2B4RO 3NT4A 4XQEA 5HS4A 2VZ9A 3B1KA 4XIJA 4II3A 4X54A 4B8ZA 1F06A 3F5QA 4YTEA 3NDRA 3GDFA 2PFGA 4EJ0A 2JL1A 3JD3A 4JK3A 4YJGA 1QKIA 4DQXA 3RU9A 2C2XA 4GKVA 4DVJA 1OC4A 4HFNA 1YXMA 4NBWA 4ZU3A 3ADPA 4CLDA 4AJLA 1DBVO 1Y7TA 4KDEA 2XXJA 2J5QA 5IDXA 4YRDA 4LRSB 4DRYA 5C3MA 2C5AA 2P9CA 1GV0A 3DMTC 4FFNA 3JYNA 4PLGA 4WJZA 3D1LA 3UICA 3WQRA 1TVEA 1HXHA 3R3SA 1WPQA 1IPEA 5B4UA 3DHYA 4ZQGA 1LQTA 3D4NA 1XDWA 3PWSA 2J3IA 2FPPA 3ONEA 4BUCA 5JXWA 4D7AA 1WLYA 4E2XA 4G2NA 4UEJA 1PJ3A 2NNLD 1E1KA 3KETA 2WD7B 1JAXA 4WASA 4BKQA 2Y05A 5EN4A 2VWHA 2WYWA 2PGLA 2VHXA 4PLPA 3KSUA 2A92A 4FB5A 1DIHA 5CDGA 2H1SA 3BMNA 2H63A 1W6UA 2B5VA 4KTTE 4R3WA 4E12A 1M6HA 2P4HX 1EVZA 2RCYA 4NI5A 4DBZA 2YJZA 1VJTA 3E6AA 3RU7A 1GQYA 4WECA 5IDYA 3W1VA 5IFLA 5JY1A 4YJFA 2QW8A 4CLRA 2JCYA 3OM9A 3S2FA 2ZIZA 2PZKA 3UW3A 4BV8A 1V3VA 2VRCD 3DBRA 3ZW9A 1YB5A 2ZYDA 1CDOA 3QSGA 4I9NA 4RVHA 4B7XA 3DAFA 1RJWA 2P2SA 3UXYA 3PHIA 3GG9A 3FBGA 3FNGA 3DOJA 4B4UA 1T24A 2A94A 3KUXA 1SC6A 2B4TO 3OIGA 4JIGA 1BXGA 1LLUA 1PS0A 3WOHA 1ZNQO 1DRVA 3W8FA 3MJCA 4AJJA 4CLOA 2HK8A 3NRCA 2RHCA 5IAAA 3H9GA 1WMBA 2YDYA 2X0JA 1I3MA 2AEFA 3PQFA 5KCZA 1T2FA 3HWRA 4J1TA 1YDWA 2SCUA 5JAIA 1ZZEA 1H6CA 1V8BA 2I3AA 3QHAA 2R6JA 3WS7A 4CQMB 1V3UA 4LISA 4NG5A 3VH4A 1B3BA 1W8DA 2PV7A 3W6UA 3BIOA 2O50A 4J7XA 1A71A 2VHZA 1XKQA 4YAEA 1MUUA 3F46A 2VWGA 1VKNA 3JQAA 3KZVA 4JBGA 3ZWOA 1OI7A 1R15A 3ZWNA 3V1YA 2HMWA 3NDIA 4PG5A 4J4BA 3FPLA 1PU2A 4MP8A 1LRLA 1JDJA 3HDHA 1TT5A 4QTZA 3TZ6A 5TNXA 4Y98A 2V6FA 5JDCC 2GNAA 4PG7A 1NYTA 1HWYA 4RZHA 1EQ2A 4R16A 3V5NA 1IY8A 3DTTA 2B83A 4E5NA 1H2HA 1XLTA 4WLFA 4D3DA 4BGIA 3DFZA 4WOJA 2AQHA 1SEPA 4XQ9A 3L77A 4KQWA 1PIWA 2D2IA 5TF4A 3E03A 4CMEC 4BKRA 1U3UA 2EKQA 4K6FA 1HDZA 3OF2A 2CDAA 1GYRA 3GAFA 3ZU3A 2GO1A 1HTBA 4EZBA 1J0XO 3ETEA 4R5HA 3WMWA 3QVXA 2X5KO 4LVUA 1NAIA 4Y6RA 3PHLA 4PZCA 4XD2A 2VYVA 4E2ZA 2HCTA 5JDCA 5L3ZA 4OO3A 4RLSA 4U6SA 5JDIA 3JQ9C 1NHGA 3GY0A 4HBGA 3GMSA 5C7OO 2X9NA 3VZSA 2V6MA 1EQUA 2BFAA 3IUPA 1DB3A 1CWUA 3WGGA 3NT2A 4BNYA 4H15A 4AJHA 3WGQA 1P44A 2BD0A 3Q9UA 1LSOA 2B69A 2QRJA 1IOLA 3JQGB 4FC6A 3RKUA 1B14A 1LDMA 1R0SA 1F14A 2ZTLA 3WSVA 2FN7A 3TZHA 1UXIA 2Z95A 1QRRA 3ENKA 1YGYA 2UUPA 5AYVA 4U7WA 5B1YA 3R6DA 1P77A 4IUYA 1KVSA 4HWKA 3EW7A 5G0SA 1LQUA 4I5EA 2X1HA 2VYVD 2O4CA 3K96A 4W9NA 2Q49A 2JHGA 5ILGA 2DPHA 1PZHA 1RKXA 3ZZNA 3VDQA 2NTVA 4JXKA 3GVHA 4UEOA 4EUFA 3JD0A 4FJ0A 2FR0A 4MIYA 1VLLA 4XGIA 2C82A 1CEQA 3DBLB 1HSZA 3F4BA 1ZMTA 3DBRB 3NJ8A 4IINA 1HZZA 1XU9A 3JQFC 3QVSA 3QWAA 5C5IA 1SZJG 8LDHA 4GVXA 2Q4EA 1PZFA 4XYGA 3PGJA 3TPCA 3PVZA 5DCUA 1J4AA 3TZQA 4DGSA 4J16A 2ZK7A 3NJ4A 2OFPA 1ADFA 4TVBA 2ZCUA 4GX2A 3PI7A 4CQMA 1R66A 3ABIA 1GUFA 2WSBA 4ZQFA 1XYGA 3BMCB 1NHWA 4S3MA 1FDTA 3F6YA 3KM0A 3CXRA 2CSUA 5TX7A 4EI2A 5CP8A 4E30A 4LMRA 2Z1NA 1I2CA 3GGOA 4TZKA 3ENNA 3GOHA 3CEAA 2BMAA 2EERA 1XELA 4K1LA 3SVTA 1E1NA 3OJEA 4IS3A 4CL8A 4PLVA 2AHRA 1RPNA 4W99A 5IXYA 4B4WA 3OH8A 1VL8A 2D4AA 3R3JA 1GUZA 2AXQA 3QA9A 1HSOA 3FWZA 3EGOA 3BHJA 3DHNA 4FGSA 4FOOA 4L4XA 1QYCA 1JLLA 2NU8A 5I7FA 4MVJF 1LRJA 1PQWA 1D3AA 5GMOA 3A1NA 2C29D 1SEVA 2EJVA 5G4KB 2PNFA 3G79A 5GY7A 1JTVA 4B7UA 1GTMA 2H5LA 4ID9A 4RQUA 3DB2A 3EVTA 3UCXA 3LC7O 4L9RA 2A4KA 3UKOA 4LCJA 1U5AA 4QO8A 1YL6A 1QV6A 4BNWA 1X13A 2PY6A 4YBZA 4YQZA 1ARZA 3IIEA 2WD7A 4F3YA 3HDYA 1R4MB 3RKRA 4WLNA 1BXZA 3BHIA 3U4HA 1JKIA 4XDYA 3C8MA 5LC1A 1ZIDA 3T4EA 2DBZA 4JJFA 1VSUA 4L74A 4ND5A 4J91A 5CPFA 5HTOA 2GCGA 1IE3A 1PZEA 3I83A 1S6YA 2OL4A 1PJQA 3CH6A 4PGFA 5CHEA 1T2EA 4LK3A 1NPYA 4KMSA 1HDGO 2NM0A 4CV3A 2FRDA 1BHSA 3RJ9A 1I3LA 1AN9A 4TKLA 1EVJA 4UVHA 1NVGA 3JYQA 4JP2A 1Y5MA 2CMDA 4XQCA 1U7HA 2Q2WA 5KKAA 2B5WA 1ZEMA 4IIVA 5CPBA 1PJ4A 3V2HA 1RYDA 4DIBA 1BRMA 3C24A 4WOKA 2IZ0A 2C5EA 3PXXA 1E6WA 4CM3A 4I5GA 4HFMA 3RFXA 4IY1A 4OL9A 1W73A 3PFWO 4NBVA 4A03A 4JP3A 2GN8A 4GX1A 4B3IA 1PL7A 2HMSA 3LYLA 4HFRA 5HM8A 1YS4A 2NADA 3VPXA 4NIMA 3M2TA 2G17A 4P4LA 3DBHA 5G0VA 2VNSA 3CPSA 1JWAB 5G0UA 1H9BA 4RORA 1XA0A 2HDHA 1F12A 4H16A 4RVDA 4CM9D 3NUGA 2GF2A 4CM1A 3ZU5A 2FZWA 2X0IA 5A02A 4B7CA 4YT4A 2CF6A 2O2SA 3B70A 3FWNA 1ISIA 1A27A 3UUWA 1P0CA 4HNGA 1HF3A 5G4LA 4IGFA 3DZGA 4RVSA 5CDUA 1EDOA 3Q2KA 4CMAA 1YQDA 2VYND 3GAZA 1P1JA 1Q1NA 3SLKA 3LF1A 3EK2A 4OIMA 4OSOA 1BMDA 3H3FA 1Y8RB 1ZKMA 4JBIA 1MXFA 3AM5A 4BHTA 3AY3A 4Q3NA 3RC2A 2FR1A 3HG7A 2EKLA 2UAGA 3U62A 2GZ3A 1YBMA 1ONOA 1GL3A 1WXDA 5I8ZA 4OH1A 1DC6A 1V35A 2C07A 5A1TA 1YH3A 4W7HA 1DO8A 1B8UA 4GWKA 4XWYA 2JD0A 3OFSA 1ISFA 2R2GA 1FDUA 3U4DA 4TKMA 4K26A 4CLRB 2AG8A 4YJFB 4KUHA 3K8ZA 2X23A 1L7EA 4BO2A 3Q1LA 1HETA 3PLRA 3WLEA 4XYEA 1PGNA 3HHPA 1XQ1A 4MVJG 3ST7A 1ISMA 4KP7A 2ZB8A 1LLCA 2Q2QA 4AJEA 4CM9A 5L4LA 1LC0A 1BVUA 5TLSA 2H6EA 5FWNA 1B16A 4PRKA 2Y1GA 1V6AA 3GDGA 1QP8A 4TRNA 4E6PA 1YRLA 5JY6A 3KVOA 1ZSVA 5COAA 3IKVA 3AUUA 1C0PA 2WJPA 1O95A 3NGLA 4N18A 4WCDA 1ADBA 3KBOA 5JLAA 4E5MA 4EUHA 2OHXA 1YBVA 4URFA 5EMHA 4M55A 4GGPA 4M54A 5F5NA 2V65A 1DJNA 5IDQA 5JC8A 2J5KA 3DFUA 4ALLA 3WYCA 3RBZA 4CMIA 6LDHA 2CDCA 3AOGA 4YYZA 2GLXA 4N5NA 1ISJA 1YB4A 3ZN2A 2PKQO 1CQJA 1H6BA 1F0YA 3WNQA 4BKPA 4MVJI 3S2IA 4IZHA 4QSMA 1UP7A 3G49A 4CODB 3D3EA 1KBZA 3LT1A 1GR0A 3FHLA 4J9VA 4CR8A 3Q2IA 1NR1A 3FNFA 3PEFA 3I6IA 3DZBA 4Q3CA 3ZCXA 3ZWCA 2VTDA 3OIDA 1LX6A 3ITKA 2W2KB 3I9JA 3RBVA 5TJ9A 1AGNA 3HNPA 3U0BA 2RH8A 4IDGA 3ZDFA 2JFGA 3DL2A 4FJ2A 2FHSA 3ZWXA 1YQXA 1Y9AA 4D79A 3GVXA 1YO6A 2IODA 4RV9A 2G1UA 4KWHA 3B1JA 5CEEA 1GEGA 1ZW1A 4J7CA 3JQBA 3IAHA 4BVAA 5L7TA 1B26A 3PFFA 4GBJA 5HWSA 1IZ0A 4ZRNA 3BTSA 3RUHA 4DLAA 2EXXA 4J4TA 4RPGA 1IPFA 5G0TA 3IL2A 1N7GA 3H6KA 4ZHSA 1UAYA 4BGUA 3EDMA 4C7KA 4UULA 3VH3A 1LDGA 2AE2A 3RJ5A 4YB8A 1V0JA 2DUWA 2PTGA 3MOIA 4J0FA 3WQQA 2NVUB 1FMCA 5ITVA 3OICA 3HFSA 3AOEA 4IS2A 4RLHA 4XIYA 3U49A 3UGKA 5I9NA 5KJFA 1A72A 1VRWA 2GN6A 4XGNA 5I7EA 3TOXA 1LSUA 4BMSA 5ICSA 4RF2A 2NU7A 3HN2A 1Y5RA 4KWIA 4J7UA 3L07A 3E9NA 3GT0A 4FS3A 4E33A 4ND1A 3UFXA 3TNLA 4A73A 1MV8A 1X7DA 2XF8A 4JROA 3S55A 1T2DA 2I76A 1Z7BA 2IZZA 2QHXA 3M1AA 9LDTA 5JMPA 1XU7A 2EG9A 3IC5A 3RC1A 1JVBA 3ZWMA 4OOEA 1WP4A 4CV0A 3L6OO 3L9XA 2Y68A 1EEHA 3OBBA 1WDLA 4MIEA 5COQA 3MTGA 2QIOA 5F1PA 4Y6PA 2VWPA 2CVQA 3LU1A 3KO8A 3RSHA 3V2UA 1GDHA 4QFDA 3WG9A 5LDHA 3WWYA 4XKJA 5JAQA 4JN6B 1MGOA 1YJQA 4FSHA 2GASA 2IEBA 1GYPA 2HMUA 4TWRA 2QYSA 3ZU4A 4RPLA 1KEPA 5H81A 5KOIA 3ROKA 1SAYA 2PZLA 1DFIA 1PQUA 3KEQA 4NMHA 5JAZA 5JYDA 3QJ5A 4FFPA 1HDYA 1PQPA 1ORRA 4QX6A 2DTEA 1DSSG 1T4DA 3KYCB 1NP3A 3M2PA 4MVJE 1P1HA 2WDZA 2ZQZA 3WGHA 3DBVO 1ZXLA 3ZV4A 1EBFA 2YUTA 5BSFA 1Y9EA 2YHIA 4B3HA 1R12A 2YDXA 1C0KA 1DIBA 3H3JA 3UVEA 2HO5A 5MGBA 1JAYA 1HDOA 3ROMA 2WEKA 2AQKA 1UZLA 1T26A 5CFZA 4EUEA 3KHUA 4J2OA 4WGGA 4DL9A 2V7PA 3IMFA 4YJHB 4YXFA 1D1TA 2X86A 2VZ8A 3V8BA 2D5AA 4AL4A 1A7KA 2F00A 1UP6A 4PG8A 3GF4A 3K31A 3F3SA 3RQSA 3E9MA 4FJ1A 2R00A 4JX8A 1Y8RA 1P0FA 4UVEA 5IDWA 2AQ8A 4PIVA 3AUSA 3BMCA 3QQPA 1U3WA 1K6IA 3SEFA 1QYXA 3RD5A 4RF4A 3TDKA 3BMOB 3D7LA 1EK6A 5DOVA 1PR3A 4FGWA 3JSAA 1LDEA 5B4TA 1U1IA 4NBTA 4AJ2A 3C7CB 1HEUA 2RH4A 3PIIA 3WFJA 1H9AA 1HLDA 2ZTUA 4G5HA 3RFVA 4R1TA 2BGLA 3JYOA 1O94A 3JYPA 4O63O 2V6BA 1LDYA 2BI8A 4G65A 1L1FA 3QIVA 4I5FA 5H83A 1R16A 1Z6ZA 1DXYA 2ZB3A 1VL0A 3DBLA 1PL8A 1OBFO 4KDFA 1G6KA 3ZWVA 1HE3A 5ICMA 4FPXA 4E5PA 2IEDA 3K9QO 2O4UX 1PWXA 3D0OA 1K3TA 4FIZA 4IPTA 1IULA 4MPDA 3OHSX 5DCWA 2X22A 1Z82A 2YHUA 1QYVA 4RVUA 2NU6A 1Y6JA 1BW9A 1K2WA 3PYXA 1I0ZA 1JQBA 1D7OA 4BNIA 1B8PA 3N58A 1WNTA 3KOUA 3I6QA 3MJ4A 4HUJA 3I5MA 3L6EA 4E32A 1EUCA 1ZXBA 3GNSA 5L53A 2OBYA 4XYLA 1E7SA 4FN4A 2R00C 1I01A 1I8TA 4EDFA 2VQ3A 2WM3A 2UDPA 1X15A 1R6DA 1X1EA 3K2BA 4B79A 4WCFB 4EEXA 1LJ8A 3TOZA 4BO5A 5L9AA 1J5PA 5TT1A 1WW8A 3X2EA 1KYQA 3VH1A 4CUJA 2P5UA 4IJWA 1KS9A 3GC6A 1J6UA 4RF5A 4CR7A 3AI3A 4BMNA 2VRBA 4GQAA 2P9EA 4XYMA 1FDSA 4BL5A 5JO0A 3FI9A 5IF3A 1MB4A 3PGXA 3QP9A 4L4RA 1QSGA 2JFHA 3ETDA 3WIEA 1E3WA 3JQ9A 4Y8VA 2IXBA 5TS3A 5C7IO 1M76A 3ASUA 1QORA 3EVNA 4BNHA 1SCUA 2EGGA 4P22A 2Q1TA 4MKRA 2A35A 3MOGA 3VZPA 2Y99A 1M6WA 1I5RA 3AI2A 1PGJA 4UUNA 4EBFA 4Y9DA 5JC1A 4XR4A 3WNVA 3SJ7A 4A2CA 4BS9A 1C1DA 3QY9A 2NQTA 3CUKA 3OEWA 1GADO 1LEHA 1JKJA 2PWZA 1H94A 2G82A 1JWBB 2O2YA 2JD1A 2PLAA 3GK3A 5HRUA 5G2OA 4U0KA 4JNKA 1FF9A 1ZH8A 2DBVO 2C54A 4YT2A 1E7MA 2Q45A 5CEJA 3DDNA 5LCXA 2GGSA 5CG1A 2I3GA 3STHA 4LSWA 1ULUA 3JQBC 1Y8QB 2D0IA 3A28A 1GUYA 4NU5A 3HZZA 1MG5A 4HV4A 3GVPA 2VNAA 1LA2A 5IN4A 1O5IA 1HDRA 3G17A 2YV1A 2EGHA 3F47A 1D1SA 5T67A 3WGTA 4DA9A 4CM8A 1DHRA 4IQ8A 1NPDA 4MVJA 4FR5A 3WWZA 5KJCA 2HRBA 1NFQA 3E48A 1FK8A 2O3RA 4DMLA 1R0KA 3BZUA 4YQYA 3AY6A 4Z9XA 3AOEC 1U4SA 4AJ4A 3PPIA 2C7GA 3LDHA 3U09A 1IZ9A 3A9WA 2YFQA 4L73A 3ETGA 4L75A 3OEYA 2P5YA 3VH2A 4RDHA 5DP1A 3NEPX 3QRWA 5B37A 1MFPA 3VDRA 4ZRMA 5BSEA 1E7YA 3KXDA 4Y6SA 5ADHA 1EE9A 1ZSNA 5U1PA 1KY4A 2V6GA 4ND4A 3BAZA 3N7UA 1G0OA 5JCJD 2ZTVA 3FRJA 1UP4A 5TSDA 3JQCA 3UCFA 4I8XA 1UXGA 1V9LA 4OHUA 3G1TA 3DHEA 3NT5A 3RC7A 4RPKA 5AVOA 3LC1O 3EMKA 4PVDA 4YPOA 4NFSA 1I36A 2W98A 1IYZA 3PDJA 5DOZA 1X7GA 2W2KA 5EPOA 3WQSB 4GLOA 1DAOA 3H9EO 5KVQA 4RQTA 4WLEA 1UXJA 2VHVA 4R69A 4Z3DA 1LSSA 4D43A 4AFNA 4DYDA 4GSKA 2OBNA 3PHHA 3R0IA 4R01A 2NLOA 2BI7A 1DLJA 2FWMX 2X4GA 2D1YA 4RCVA 3NX4A 4PLTA 4BMVA 1YWGO 3FNHA 1U4OA 2FZEA 3ZWYA 2NWQA 5ER6A 4BO4A 2VYNA 3O38A 4CMJA 1U3TA 4NJMB 1S7CA 4R9RA 3PZRA 4Y67A 5DCYA 2YQ4A 4Z0TA 4MINA 4ZICA 1QG6A 4YJHA 3QWFA 3ZV6A 5AQ1A 1T1SA 2DAPA 4LCEA 4JCOA 1XHLA 1GZ3A 3MWEB 4CR6A 3VPFA 4NJMA 5BNTA 3LLSA 2JHFA 1ISGA 5KNLA 4HADA 1E6EA 2HJRA 2Y0DA 1A9YA 1ONPA 1ZK1A 1EVYA 3ONDA 4E5YA 3ZWWA 1PTJA 4M1QA 1LXCA 5ES3A 1E77A 4K28A 4MDHA 3MJTA 3PWKA 4AJ1A 1LLDA 4ZGWA 1QYDA 3K92A 4KTVE 2OGUA 2IDZA 7ADHA 2C20A 3D3WA 3VPSA 1I2ZA 2QG4A 3FF4A 3RWBA 2CFCA 1P33A 5DDIP 4J6FA 3GFGA 2BLLA 4E21A 1UXHA 4ZJUA 4Q3BA 4RO0A 3QE3A 1UXKA 1JKFA 2ZYAA 5BNIA 4GAEA 3EZLA 4P8RA 4TQGA 1Z75A 2YW9A 1M66A 1YJ8A 4JQCA 1IL0A 5THQA 4J90A 5EL0A 1SB8A 1F17A 5AXDA 3WJAA 3WYEA 4YRAA 3VZRA 4ILKA 2O23A 4BO1A 1ZJZA 4E5KA 3PRJA 4GPD1 2CY0A 1J49A 4IJUA 4OAQA 3WGZA 3GDOA 2JJYA 5IJZA 3DZFA 1XIVA 4GX5A 4DMMA 2HU2A 3AU8A 4WEQA 4I5DA 3ZGYA 4BNTA 2P91A 3CTMA 1ZK4A 3ZWPA 5JMWA 1BDBA 4NK4A 2WE8A 5EQDA 3OQBA 5L4SA 2VT2A 3P2OA 3OA2A 4XCVA 3A4VA 4IGEA 1FXSA 4WUVA 2EEZA 1UAGA 2WYUA 1BXGB 4OOFA 1FDWA 4HX5A 1H0KA 1M2WA 3W4KA 3PWZA 3HN7A 1DFGA 1Y81A 4K6CA 3ZHYA 4CQLA 2JAHA 1C1XA 2OXIA 1LU9A 4GLLA 2J6IA 3I23A 4JJGA 3PLNA 3KSDO 5A3VA 1UDCA 5JCJA 3JQ7B 1E1MA 3GMDA 5EIOA 1XR3A 4RDIA 4CUZA 1B15A 3C1TA 3OJLA 3JQ6A 5I8WA 1XSEA 2EW8A 3EYWA 4OSPA 4BKOA 4ZA2A 3AFMA 2NTJA 4IQGA 1DPGA 3LZ6A 3NDJA 3ROPA 5HBRA 4BOYA 4CMCA 3GGPA 3H2ZA 3AI1A 2W90A 1N8KA 5CDTA 3R1IA 4XJSA 3PJDA 4YVFA 4NBRA 3ITDA 1A4IA 1CIVA 2GDZA 3ICPA 5G0WA 4BIIA 3QVOA 3I9NA 1ONNA 2JAPA 1U9JA 4Z9FA 2X8LA 4J43A 3ZH2A 1VL6A 2ZYGA 4FC7A 5DZSA 2ZB7A 5G4KA 3HFGA 3SC6A 3VAZA 1NXQA 4UUMA 2OZPA 2BKAA 5CDSA 5K6AC 5I9MA 1ZK3A 3TL3A 3FR8A 3BA1A 3KLPX 1XGKA 1WAMA 4CM7A 3G1UA 4CMIB 1A4UA 4A0SA 4PN3A 4M86A 1NQAO 4EGFA 5U9CA 1O8CA 3FCOA 3JD1A 3M6IA 4DWVA 1ENZA 4FFOA 4BGEA 3WR5A 5EQFA 1F8GA 1HDXA 4CLHA 1R4MA 2QYTA 4NH4A 3E1KA 3JD4A 1Y1PA 1NPTO 3C3XA 2Y1CA 4MOWA 4YJGB 4O0LA 2P68A 1KY5A 1LC3A 5DT9A 5L40A 1AE1A 4FCCA 4A26A 1LDNA 2ZCVA 4M87A 1D4FA 3OIFA 2RBEA 4Q3AA 2DQ4A 1EMDA 1GAEO 4TSKA 1E3JA 4OQYA 2C59A 5ENDA 2HRZA 1MLDA 2FOIA 1P74A 5A04A 3S2EA 4CM4B 4N5MA 5DN9A 4TVOA 3WLFA 5EERA 1E3LA 1YB1A 3GA0A 4Z0HO 4BO8A 1T4BA 4P4GA 4LGVA 2QQ5A 4ZQEA 3GVIA 2PZMA 1LTHR 3PJGA 4LSMA 2EP7A 3P7MA 2DFVA 4R41A 3F4LA 3PK0A 2PKRA 3ZWBA 5KIAA 2DU8A 3BMNB 3QLJA 4RF3A 4EJMA 3ZHBA 4OYRA 5F1KA 4WE3A 4A10A 3LT2A 2CF5A 2CNBA 4IJKA 4B3JA 1Q0HA 1ZEJA 5DNAA 1CERA 1M67A 4OQZA 3BTVA 2VUSA 4ONEA 1JN0A 5DULA 4E0BA 4N5LA 1TT7A 2RHRA 1R4NA 2UYYA 1E7QA 2VRCA 3WFIA 4IBOA 3W8DA 2PD4A 2X58A 3O9ZA 3TZCA 1BWSA 4QEDA 2NTNA 3DBHB 1EE2A 2I9PA 4IDDA 1P1IA 3TZKA 3K2EA 1N7HA 4DTIA 1KVUA 1NQTA 4FFMA 2RAFA 4D42A 3OETA 1CYDA 5C7LO 1IHXA 2DLDA 2IXAA 1XEAA 4PVCA 3TN7A 4YAGA 2PGJA 4C7JA 3S1LA 3I9OA 2FSSA 1UR5A 2E37A 3VOSA 3GFBA 1QLJA 3AY7A 4Q39A 3V1UA 4BNXA 3OP4A 4W4TA 3D3WB 3O4RA 4TMFA 3KYBA 2X5OA 1UJMA 5IG2A 5U4QA 5IN5A 3RROA 1BGVA 1AHIA 1DHTA 3OQ6A 4LVCA 4Z6KA 3FTNA 4M8SA 3A06A 2Y67A 3ZW8A 1YOVB 3GPDG 2DVMA 4E2WA 3F1KA 5A5FA 4M49A 1K6JA 2FMUA 1HLPA 4YDRA 3U5TA 1ADCA 4UVGA 3L9WA 2OO5A 4BNKA 1AXEA 3IS3A 3E5RA 1MG0A 5AXCA 1LNQA 3DC2A 4YAJA 2E48A 1NX6A 2DM6A 3VHRA 8ADHA 4EJ6A 3F5SA 1KEWA 3O8QB 3RVDA 1EBUA 3AWDA 5IZCC 4R5MA 3ZHZA 4HKTA 1MA0A 2C0CA 1BXKA 5KVVA 4D0RA 2HJSA 1R4NB 3JTMA 4NK5A 4W7IA 1BTOA 2O3QA 3GRKA 2VWQA 3ULKA 4CMBA 6ADHA 5FFFA 1K0UA 1NWHA 3ASVA 2VN8A 2ZB4A 3DONA 2GPTA 5IZ4A 2AE1A 1AXGA 1DIRA 4D3SA 4FFRA 3WSWA 4CMEA 3W4JA 4Q3DA 2ZJ1A 2UVDA 4TRRA 4WNCA 5FI5A 2BF7A 2FPGA 2D5CA 3EZYA 1CQIA 4Q9NA 1XCBA 3FD8A 1PS9A 2BRUA 3H9QA 1XWFA 1V3TA 2O3JA 5GZ1A 1KERA 3KRTA 1KIFA 3H5RA 1GPJA 4D41A 1UZMA 3GHHA 2VT3A 4KUEA 4O1MA 4RZIA 4I08A 3ZU2A 4NZ9A 3NGXA 3DOCA 1U28A 4CL3A 4INAA 2G0TA 3RBXA 5IXSA 1M75A 4OKNA 5T64A 3JD2A 4NFHA 4KQXA 4JGBA 2Y0EA 1OC2A 4U8GA 4IDAA 4MP3A 2E4AA 4YWJA 1H5QA 2X5JO 3IJPA 5THKA 1X14A 3DMYA 5L7YA 3I1JA 1HDCA 4GWGA 3O26A 2O3UA 2PK3A 3PIDA 2EW2A 5DF1A 1ZK0A 4GGOA 3PJEA 2EIHA 2QZZA 1G0NA 4CM8B 2J3KA 5JW6A 3K30A 3ZWAA 3KB6A 4DPLA 3FN4A 3GVCA 4QECA 4CLOB 5L7WA 3IQDB 1WDKA 4IXTA 3CE6A 5KJEA 1LLQA 4ND2A 3P2YA 4WEOA 5KVCA 4ZQHA 4PZEA 3AUTA 3I9MA 1UH5A 4PLZA 1I32A 2NSDA 4EW6A 3C1OA 2B36A 2P4QA 1DDOA 2NUAA 3LLVA 4PG4A 1QR6A 2O48X 4CM6A 3GEMA 5GZ6A 5ITWA 5K6AA 1ZJYA 5L95A 2YHIB 2HAEA 3BXXA 1VI2A 4R68A 4NQZA 3I52A 4OKIA 3E8XA 1HRDA 3KSZO 3PQEA 4D45A 4RGBA 4B4VA 2Q1WA 2EKPA 5F1OA 2HK9A 3I9LA 5TT0A 4U5QA 1PL6A 4BB6A 4DQVA 5EESA 1B3RA 4D44A 3DWFA 2EF1A 5I7VA 5TJHA 3VC7A 1UZNA 5CAEA 4RPHA 5K9ZA 3BTUA 1OMOA 1D8AA 1NFFA 4WCFC 1KC1A 2G76A 5AXBA 4OM8A 1YBAA 1GU7A 4GMFA 3TFOA 2EJWA 4GX0A 1DRUA 1HE4A 4DC0A 1UDBA 1E3WB 1T2AA 2CZCA 3H8VA 5T57A 3U9LA 3U3XA 1C3VA 2AEJA 3DR3A 4J49A 1PGPA 5B4VA 2ZQYA 2O7SA 5BT9A 3H5AA 3VKUA 2VOEA 4FDAA 2OUIA 1U3VA 1C1XB 2XPCA 5TGDA 3C1AA 3E82A 4IMPA 4CQLB 3DMTA 4XJTA 5K0ZA 4PLFA 3UOGA 4TZTA 3INTA 2PA3A 3LQFA 3QVWA 2OORA 4BV9A 4GI2A 3WGOA 1ZMOA 1EZ4A 2POQX 3UN1A 4QFCA 1SB9A 1Q7GA 3X2FA 5KVSA 3SBOA 3RUEA 1LI4A 3AM4A 4O6VA 4NR0A 2Q1SA 4DIOA 3HJAA 3OSUA 4BNMA 2ZJ0A 2JCVA 1WZIA 2XXBA 4KOAA 4NBUA 3ZNNA 2FY8A 4GSLA 3I3OA 3VPHA 2VUUA 3FSRA 1PJLA 4R3NA 4CV2A 3QWHA 1U2DA 2YV3A 4TRJA 1JA9A 1PGQA 3T7CA 1P45A 4ZQBA 4ROSA 3RCBA 1TB4A 2C2YA 1R0LA 3DAGA 3NKLA 3GLQA 4IZIA 1LBEA 5IZCA 1Q7CA 1EDZA 5BSHA 1PJCA 3OJ0A 1NFRA 3INRA 2AEMA 3E18A 1I3NA 4CLXA 3ZV3A 2DKNA 1RM0A 1RWBA 2JKVA 2Z5LA 1GQQA 1I10A 4PFJA 1E0DA 3IJRA 2IZ1A 4ALNA 2HMVA 2RIRA 3PHJA 4WPGA 2TMGA 4MVJD 1YE3A 2PR2A 1R37A 4R4JA 5DBGA 5ENVA 3SX2A 1SOVA 3CKYA 3AM3A 1OOEA 1WWKA 1EFKA 2EHDA 4CQMD 3FBTA 1T2CA 4IDCA 5LDGA 3VVCA 2D8AA 3NV9A 4BGVA 3INGA 4A7PA 3GQVA 2VOJA 1NWCA 1PJ2A 3L0DA 5JYEA 3RUDA 1QLHA 4L8VA 4RL6A 2VUTA 3O03A 3TJRA 4BO6A 2I65A 2AW5A 5CDYA 1P9LA 4AJPA 2NVWA 4UREA 3DQPA 3C7AA 1KETA 2IYPA 3VPGA 5L51A 5AOVA 1B0AA 4R1NA 3AK4A 1BVRA 1XG5A 1GQ2A 1HKUA 3ADOA 4AVYA 4WCFA 4XYBA 4IMRA 3NTRA 4MP6A 1NR7A 2X9VA 5BNFA 4E31A 1ZFNA 1QYWA 3RAJA 3WGYA 3D64A 1YQGA 5EINA 4HXYA 3VVBA 4XQGA 1TEHA 1OAAA 3JQEA 3IOYA 5A3JA 4QUKA 3KYCA 3QV1A 2IE0A 1NQ5A 1Z45A 4I9HA 4J2HA 3WBBA 4WLOA 5F3RA 1CETA 3ICCA 1KVTA 1VE9A 2YV2A 2FR8A 4RVFA 1FJHA 3Q3CA 1AHHA 5T8KC 3VKVA 4Z0PA 3Q11A 4XGKA 3GEDA 1H93A 2X0NA 1X0VA 4OXYA 4XEHA 4YCAA 2VCYA 3GPIA 1TI7A 1ZCJA 1YDEA 1Z7EA 5KJ6A 4J1NA 2J3HA 1NBOA 4L4SA 3PYMA 2J3JA 3MEQA 1PS8A 5A06A 3C7DB 1TT5B 4XRRA 1VM6A 3T7EA 1E1LA 2O7QA 1BSVA 4BNUA 2B35A 4BO9A 4PRLA 4AJOA 2PH3A 4XR9A 3JQAB 1DOHA 4AG3A 1H6DA 3SXPA 1P1FA 4J0EA 1PJBA 4HY3A 3HDJA 4PLWA 4FW8A 4BQPA 2BFOA 2Y66A 3DZHA 1O6ZA 5DP2A 3BMOA 4NU6A 2HQ1A 3HB5X 4Z9YA 1HZJA 4NFYA 2IYOA 3ON5A 4J9UE 4F45A 1B8VA 2CD9A 4J4HA 1U5CA 3GUYA 3Q9NA 1ZO8A 4DXHA 3KTDA 5A05A 1WMAA 2GERA 2NVUA 4CMGA 4W6ZA 2HSDA 3OMLA 1HYHA 3KYDA 4E3ZA 4PZDA 1I3KA 3RUIA 1ENPA 4FD3A 1HL3A 2DTDA 1ZK2A 1N2SA 4ZD6A 1NNUA 1PSDA 5TIIA 2YFHA 3BMQB 3GN2A 4MVJH 4CMKA 5TQVA 3W6ZA 1X1TA 3CSDA 1Q0QA 3HDQA 4S1VA 3ROQA 2PGDA 1HE5A 2B4QA 4AICA 2W2LA 1PJSA 2CVZA 4H3VA 2D59A 2JCXA 3QW2A 4DLBA 3BMQA 2VHYA 2X0RA 3D4OA 3F9IA 3S8MA 2BH9A 4DREA 3RUCA 4CPDA 5C37A 3DZJA 5A5EA 5I9LA 4FBGA 4IDEA 3HADA 3PQDA 1PEDA 1C1DB 1E92A 2E6UX 4XDZA 4DLLA 1EFLA 2LDBA 2EP5A 3KLMX 1SNYA 3QVTA 2HKIA 4MIOA 2WWRA 4R51A 4ND3A 1E7WA 3U4CA 3I4FA 4IDFA 4ESOA 4F46A 2DUUA 4XZ3A 4A5OA 4E13A 4JLWA 3N74A 4E2YA 3GNTA 1RM5A 4M89A 3ANMA 1E5QA 3LT0A 3GN1A 3PP8A 3MJVA 4FFLA 2ZKLA 1VKOA 3WDSA 1JW9B 1VC2A 4TROA 5BQFA 3IP1A 1U8XX 2GRAA 4IXWA 4JBHA 4P38A 3RIHA 4BNVA 4RJTA 5A4DA 5I7SA 3HE3A 5H82A 1QV7A 4WKGA 1HE2A 1P1KA 3TFQA 3DOOA 2VHWA 3JQ8B 1H2BA 1IHYA 2PD6A 5F21A 4OXKA 1IUKA 1MX3A 1NVTA 2I6TA 4F6LA 3JYLA 1Z73A 3B20A 1EUZA 3BYZA 3I9KA 5A9RA 3H5NA 4ALJA 2J5RA 3TQHA 4GKBA 5JO9A 4P4NA 3B1FA 4II2A 4OGWA 3WB9A 3UCEA 4LN1A 1CRWG 1SO8A 1YL5A 2X7HA 1G1AA 3OQ1A 5GZ3A 4L0QA 2EWMA 4MO2A 1P31A 1DC3A 2J8ZA 1PR9A 1T1RA 2E82A 5ER9A 5JBIA 4QQRA 3H9JA 3I4CA 4YT8A 1PZGA 4J1QA 3CZMA 3RUAA 4I1IA 1E3SA 1GYQA 4IM7A 1DIGA 1EVIA 1N92A 7MDHA 4BO0A 3L4SO 3MWDB 3OJOA 4U6QA 1TLTA 4XA8A 1C0IA 1E3IA 1TA4A 5TC4A 3PHGA 1KOLA 3FR7A 1A7AA 2WTBA 1W0CA 3JV7A 2ZATA 1NQOA 4DC1A 1ZSYA 1VPDA 4R1UA 3HUDA 1RM3A 4MKZA 2HLPA 4PG6A 3Q0EA 3WYBA 3AJRA 3ZI0A 1CJCA 2GN4A 4UUOA 2CDBA 3UF0A 3GG2A 3RASA 4TRMA 1HYGA 3CINA 1JU9A 4UEKA 1O89A 4U0JA 1W4ZA 4L76A 3IDSA 5TRTA 1GFSA 2B37A 4PLCA 1HYEA 3W8EA 3SLGA 2NACA 5A9SB 3UAGA 1WZEA 4FOSA 1ZUD1 2B0JA 2JFFA 3GZNA 3K6JA 4PLYA 2I5PO 1ZBQA 2FP4A 3ZNPA 4MVJM 3LF2A 4HFJA 3FNEA 3WXBA 3WIDA 1YKFA 1ENYA 2Q3EA 1KEUA 1PGOA 2GYYA 4BKUA 3ANNA 1WVGA 2Y1DA 3EAGA 4O5OA 3DEYX 3VTZA 3S2GA 2OOSA 1C0LA 1DEHA 3TRIA 4OMUA 1DC5A 3JQFA 2A9FA 3KEOA 1P3DA 3OA0A 2DFDA 4N7RA 3SC4A 5ILOA 1DJQA 3EY4A 1UDAA 5EJ2A 1MP0A 4CMHA 4D46A 3NAQA 3A14A 3OJFA 5JNLA 4FQ8A 1EK5A 2HK7A 2BGMA 4JJIA 4W9NC 1QMGA 3TSCA 1MXHA 5T8KA 3PZBA 4ZN6A 4H7PA 2AMFA 1E7RA 1DIAA 3LSYA 3PDUA 4PCVA 4YT5A 2GN9A 1VJ1A 3DZKA 1FDVA 4XB1A 2WD8A 2XOXA 5JAMA 3C85A 3MJSA 3EUWA 1MFZA 2E49A 3JQAD 1GCUA 1QXSA 4LW8A 3WGIA 2W8ZA 4KUGA 3JQ8A 3O8QA 4NHEA 1IB6A 4BNGA 2GZ2A 1ZVMA 2FPIA 3DAPA 4CJXA 1NM5A 1GV1A 2IRWA 1Z74A 1TXGA 1WDMA 4YRBA 3L6DA 1MC4A 2DBRA 5KTKA 1OFGA 4EITA 5JFOA 1RYEA 5JSFA 4W82A 1N9GB 1YVEI 3SJUA 3WBFA 3K5PA 5JDIC 4EEZA 2W2LD 1YOVA 3GR6A 4UUPA 4DBVO 5FF9A
chains in the Genus database with same CATH superfamily
1X7HA 2P79A 2QG6A 2G7ZA 3AU9A 3C6XA 3JS5A 3U4QB 2ID8A 2QUJA 1ENOA 4LYYA 5FWXB 3ZHQA 1H69A 3TIGA 1VZ3A 2CJYA 1RJEA 3B53X 5C1BA 5KJ1A 2NP7A 1TIPA 4L5BA 3LX4A 4V0ME 1Q0RA 5ICCA 5L45A 3GNQA 4A27A 2HRRA 1PO7A 1Z4KA 3ZNOA 1JFTA 4N3AA 3FTPA 2ZB2A 3TL2A 5IVIA 2OORC 5AVQA 3ZXSA 1KWKA 4BB5A 3OZRA 5E4TA 4RSMA 4A36A 3L7NA 1MRSA 2KYRA 1N3BA 1I33A 1VJ0A 3ZHOA 3LGAA 4OJKA 5DM60 1A1VA 1DFHA 3D8SA 2J30A 3LK7A 3FPCA 2V97A 3CXUA 4EQ6A 2PKYX 1XQ6A 4D3XA 1YDMA 5LU8A 1T1JA 3TX6A 4JFAA 2I22A 2Y1EA 4BNUA 3ANLA 4UAJA 4ZCMA 1R0RE 2XYVA 2YY7A 2ZXFA 2BR3A 1F0PA 4B8WA 1KU0A 1JPNA 1WZCA 3SBEA 2ZYVX 3WGLA 5DBOA 5BR7A 3D5QA 1PG2A 4P32A 3FYHA 4QYIB 3N39C 4DTCA 3QEBZ 1H85A 3HCOA 4QT0A 1RWXA 4NY1A 4F1JA 3QNMA 5TPZD 1L9KA 2NYAA 4YEDA 5AK3A 2ZTSA 5JSZA 4H0CA 2RONA 2YXLA 3A1FA 4I50B 4G2TA 2HMTA 2JLYA 2PUVA 5CRIA 3UAYA 2BFMA 1HT1E 2PD3A 1Z3IX 5JCPA 3WL8A 3RVRA 4JZKA 2P8SA 4Y9UA 1OYOA 5J5CA 3W2HA 1IIRA 5IX8A 2M6LA 5DNYB 2B7BA 4BEVA 4P4UA 3RUFA 4LF5B 2VRNA 4LOIA 2VBCA 2AG1A 4YRGA 2BGUA 2PYZA 1P6QA 2XKAA 3AV0B 2HA0A 3DJYA 1W1IA 3DHWC 2FPMA 2JH8A 2PPVA 3B6ZA 3UY4A 2W4QA 2XF2A 1P8JA 4Z5XA 1DI0A 1K7YA 5EE5B 1LPOA 3U4IA 1DRWA 4GRIA 3KFVA 3KYDB 1KHTA 2QL7A 1NUAA 1Y4SA 2INGX 2RDMA 3MTEA 1GPDG 1DAPA 2ET6A 5C8YB 2QVCA 2VO1A 3THOA 1EA7A 1BKDR 1SOWA 3DNPA 3H7AA 4FDUA 3VNAA 2VF5X 2AI2A 3O1HB 5DE3A 5EIAA 4FHCA 3DTYA 4LZJA 3R7BA 1J5XA 3OT5A 2IPAB 3I76A 2EZUA 5EE1A 3U39A 1E58A 3NI2A 1BG6A 3KR1A 4LRTB 5TVKA 3CZRA 4I9UA 3IAM6 1SIUA 1XTPA 4HT3B 5INTA 4CLEA 2AYYA 2OFOA 3GIWA 2D3TA 1C8LA 3OZIA 3MIZA 3MZ0A 4KWEA 4LDNA 1N1EA 2Q50A 1FUYB 1C14A 3CLKA 2B8WA 3V2GA 4ANFA 3IBYA 1K5HA 3ZVLA 4OVKA 1K1EA 3HBAA 3S3TA 4NCKA 1VDZA 1R10A 1GZ7A 1OLUB 1OZ0A 5F33A 3TSYA 2AN5A 3OQVA 1SUPA 2VZ0A 4FGZA 3T4XA 2HU5A 5AXAA 4W5JA 4X41A 2CCGA 1VBFA 4KQCA 5FJJA 1U0JA 1E66A 5CLLA 1AQUA 3I01M 3PE3A 4DR4B 4TT3D 4P7FA 4BZQA 4AXBA 1VA4A 4YMUA 2I66A 1NBME 2X8JA 3W4IA 4WLUA 2XVZA 4UE2A 4GMGA 2I80A 3H6HA 2R1VB 1XN1A 1O6FA 2YHBA 4K03A 4IVRA 1G3UA 4O2LA 4G37A 2C4TA 2QM8A 1KDZA 1KXZA 10MHA 5CG2A 3P5BA 2W11A 4ZCPA 1ICIA 3M5PA 4Q6BA 1O58A 1U7UA 3GGGA 4AMYA 2FE1A 4R31A 3WRYC 3QE2A 1NLYA 3VZQA 4WBSA 4ALMA 1PQ4A 3L5OA 1P4AA 2R7MA 2W43A 1HL7A 4H35A 4OP2A 3DVRX 3QOXA 5FBZA 4EATA 5I8PA 2GNPA 3UEOA 1FLNA 1PX0A 2C2KA 2H9IA 3CW2A 4XPIA 3I34X 3BGVA 2YZNA 1GG2A 3C16C 3HFJA 2OP0A 4QREA 3UJDA 2A30A 5GQSA 3V8QA 3FYUB 1LW7A 1WOYA 3MGGA 3PL1A 2GD6A 4DLUA 3CLSD 2IW1A 3G23A 3AW9A 3PUWA 5IS2A 1SVNA 5C8ZA 3BZWA 3EMVA 1LI7A 3RHFA 3MJEA 4JUDX 3DVSX 4MJLA 4F12A 1RCFA 4URXR 4EFNA 5CXXA 3GZNB 3S28A 3CWZA 3IIKA 1XPRA 4L3VA 4BNNA 3GUCA 1F8FA 2YR0A 3FKQA 4EB0A 2WUEA 1X0XA 3U44B 4U63A 4OH7A 1GJRA 2I67A 3VVMA 1VSVA 5ECDA 1B42A 4NBLA 1NY6A 4IQ0A 5KYYA 1WXQA 2Q2VA 2YQ5A 3GRVA 1Y6ZA 3WTBA 4FEGA 3MXOA 1X19A 2H51A 2QRLA 4P86A 1TJYA 3ZY2A 1F6BA 2QMUA 3DMNA 4LYGA 2NZJA 1TW2A 2CW5A 1QGDA 3N2GA 2XCIA 3ZI4A 4BCCA 1RBYA 2ODBA 2DC1A 3V8PA 4BX9A 1GG9A 3ORFA 3STVA 4C4YA 1SN7A 1ZHFA 1HDIA 1C3EA 3WGNA 4URHA 4NPCA 5JBQA 4I66A 1MF7A 2HUNA 3RIMA 5ALZA 3H04A 5KKCA 4JUAA 1W93A 2A7QA 3DV0A 4WNIA 4D0LB 1SPXA 4CKZA 1D03A 5KTMA 4KXMA 2R86A 1O4WA 2ODEA 2VP4A 3VHXA 4JLKA 4CTNA 5DNCA 5AQEA 2WKWA 3LOQA 4C1NA 5DNDA 5B1HA 2P3OA 1WHSA 3DW3X 2B4RO 3MAAC 1RRVA 1S3IA 4M1TA 4X7MA 1FDIA 1T5SA 2P6PA 5I7HA 4XIJA 1A9QA 3I2GA 1EB9A 2OV4A 3PNBA 2QZSA 3CR7A 4EJ0A 4QLBA 1U7OA 3IQXA 4O0MA 1YIAA 2CB9A 3IVGA 4DQXA 2W6PA 2C2XA 2XT0A 4DVJA 2EU8A 1FU7A 2WYHA 1Q14A 4NE9A 4MJXA 2W93A 4NAUA 3BSFA 2ZUWA 2GBCA 5DFAA 4OBWA 5C1IA 4C0XA 4PO3X 1DBWA 4ZU3A 3ADPA 1GU0A 3BXGA 4QDJA 2YNMC 3T7JA 1CRPA 1ZD5A 4AJLA 1Y7TA 3UAWA 2AZXA 2W6ZA 1L4GA 5AW9A 1E0AA 3IPXA 4KXYA 2GKGA 5FNVF 3L7BA 3C5WP 1WSAA 3JYNA 3R75A 5HK9A 1E2QA 1X7ZA 1DKNA 3SVLA 5F76A 1HXHA 3R3SA 1WPQA 3PF8A 1FW8A 4PYRA 3EFOB 2FR8C 3GXBA 2Q0HA 4B2LA 4D98A 4ZQGA 2PKCA 2DKFA 2R1TB 4JQZA 4KG7A 4XOIA 1W36B 1XDWA 2I4NA 2ZYWX 3OM1A 2ODTX 2FPPA 3BK2A 3G7NA 3ONEA 4E4RA 1GR1A 1DKMA 2HEIA 3HXLA 3Q6NA 2NNLD 2A8YA 1XMVA 1E6KA 4L5IA 3H75A 4TV9A 3KFXA 3KR9A 1JAXA 2O0LA 3D4BA 1HNXB 2Y05A 3JY6A 5JH7B 1AKWA 3IBCA 5EUQB 1MX1A 3DWGA 2NZ8A 4TLAA 3BMNA 1EVKA 3EXEB 3L8CA 4KTTE 4U02A 4E12A 2Z2XA 3NVKI 4UCFA 1EVZA 3H3XA 1Q1EA 4NI5A 1R88A 5HEKA 4EMTA 2VF4X 3G0DA 4D9FA 1AKTA 4W7SA 4MLZA 2ZSIA 4NENA 1HTWA 4PPYA 1VJTA 2NU6B 4BNDA 4WECA 1MIHA 3W1VA 1APBA 1V5EA 2Q5FA 2VZEA 4P9NA 5JY1A 2JGRA 1HE1C 4L9WA 3AR3A 2PZKA 4BU0A 1ZINA 5GVRA 3SF8B 5J2UB 2YWDA 1N2CA 3LYHA 4AZVA 1V3VA 4LTMA 2ZYDA 1CDOA 4RVHA 3TQQA 1BGXT 1RAAA 2ORWA 3DAFA 1RJWA 5C80A 4RTLA 3ETNA 3PHIA 2JLUA 1W2GA 3FNGA 4F2DA 3NDBB 4WNAB 4B4UA 3HU5A 2B4TO 4JIGA 3G1WA 1YCDA 1NQUA 1YS2X 2YHAA 1IM5A 2JFYA 4K8RB 1DRVA 4PSVA 4OB6A 3SGLA 3RT9A 3DPSA 4BPBA 4MHSA 4DLZA 4EFKA 4OB8A 3ZDRA 1RE0A 2E85A 1TD1A 1WMBA 2PX8A 3BVPA 3CLRC 4UBJA 4AMUA 3GA5A 3GEBA 5EQTA 1HGXA 1SBHA 3PV0A 4M8LA 4BVHA 3PQFA 4COOA 5KSYA 3NOOA 1IB0A 1AO3A 5K0LA 1MW8X 2JIQA 4KFSA 2VLBA 3OD1A 1YDWA 1CUFA 4NH4A 1H6CA 1V8BA 1BNCA 1CZUA 3NHZA 1JFRA 3ODPA 1HLFA 1V3UA 2GAIA 3OF5A 4IF6A 4LISA 3VH4A 1B3BA 1W8DA 1V4VA 4ILEA 3W6UA 3BIOA 3D1VA 4R0VA 2EFEB 3I5UA 1UZAA 1XKQA 2PGXA 4CW7A 1QB7A 1V95A 3IRUA 2Z6AA 2Q21A 3LRPA 4O4LA 1DGQA 3LFTA 1JG7A 4JBGA 3ZWOA 1HT3A 4O4JF 1AZLA 1R15A 2HMWA 1IBCA 2HDNB 2MYUA 3FPLA 1N7IA 3LA8A 1L5GB 1MW9X 4HD8A 1DAEA 1PZXA 1SVUA 2A0KA 3S2SA 3WB0A 3LSTA 4HQNA 3RJTA 2NYRA 5JDCC 4LJ8A 1EQ2A 3BQ9A 1Z22A 4EHNA 5FOQA 3DTTA 1D4ZA 1KIAA 3HH8A 1QO0D 1E1RD 3E2PA 1JR6A 4P93A 2AQHA 1CQPA 3DXYA 3GEPA 3ND5A 2XLCA 3KQYA 3ILSA 1RWMA 5TF4A 5EIEA 5KTTA 3TW8B 1TKRA 4DR5B 2KQUA 2XRZA 2F8LA 3TI9A 3TW4A 2GX6A 4IQ4A 1HDZA 5I5EA 3EQ7A 1JU3A 2CDAA 1I7PA 2ZCJA 1NT2A 4N5DA 2YOFA 4DNFA 5JZSA 3PC3A 4QOHA 1Z34A 3UK7A 5LMZA 1UZUA 1J0XO 3UJBA 3ETEA 2X4DA 2XE8A 5LIRA 3QVXA 1ZD1A 4F5EA 2XKKA 1NAIA 1E1DA 2GARA 3AEUB 4Y6RA 1J0EA 4PZCA 1K7EB 1Q74A 4TKUA 1XZBA 4QXPA 1J07A 2HCTA 2GM5A 4DC9A 3OZTA 3QOYA 4WBNB 3T4PA 1J2RA 4RNCA 3UOAB 1NHGA 2KWIA 3OIYA 4TL8A 1YNOA 2I4LA 4G0UA 5C1PA 2Z43A 3L7AA 2EJUA 2QPAA 2X3UA 4Y3UA 2AZ4A 3BK7A 3K1TA 2V6MA 3KVYA 2WY2D 1EQUA 5C7OO 4G0VA 2XMRA 2ZT7A 4HDCA 1VIYA 1CWUA 2V7QA 4IWNA 1CUBA 3ENWA 4DF3A 2R25B 3ILYA 2FSGA 1I0IA 4H15A 13PKA 3DA8A 4CF5A 2YUIA 3Q9UA 5HGXA 3JQGB 1C9NA 1G2IA 1QX3A 4JKOA 3CF4G 4C0SA 1WRBA 4RD2A 2OLJA 5M29A 3OZDA 3VM6A 2NO4A 4RK7A 2C97A 3EIOA 3QU2A 4U7WA 5E8JA 3ISVA 3HI4A 1RWWA 2BEUA 1ZQ1A 3ROTA 4F4UA 5ED4A 4HWKA 3ESQA 4WDQA 1LQUA 2ZG6A 4DV2B 1K6MA 2X1HA 3JAKB 3PSAA 4RACA 4DLRA 2JHGA 3RV3A 3IX7A 3R76A 5HZHA 1PZHA 4LXXA 2G70A 1RD4A 4KQ1A 5FBKA 2IP4A 2HIAA 4U00A 1ULTA 2O8BB 1J1ZA 4DMRA 1G8KA 3JD0A 1VLLA 1C4XA 2C82A 1TQDA 3P2KA 2WAYA 2YJ3A 3KJIA 2XYRA 3GGDA 4S1WA 5C5IA 2A9PA 3QVSA 1ZA1A 1AT1A 3AXTA 4KLZA 3HUUA 8LDHA 3V1LA 3JATB 4FW9A 3TCKA 1G5IA 4GVXA 1I1HA 2AJDA 3M4YA 1XQWA 1PZFA 3BAFA 2P1ZA 2OUKA 1O96A 4HPWA 4MQUA 4XYGA 5ISMA 3L7LA 2VA9A 4PQGA 5FFMA 2FCAA 3JPYA 1TCVA 5C0OE 2XBMA 2ZK7A 3P9SA 2HO4A 2VQSA 2OCXA 1SHKA 2TYSB 3P9KA 4GX2A 4H17A 4KN6A 5FPQA 5BO5A 3PT5A 4IRMA 1QM5A 1B0ZA 3C3DA 4LE1A 5EKDA 1MOZA 1GUFA 2WSBA 5M3BA 5EIWA 2H29A 2M98A 2QNBA 3BMCB 4JOBA 3ZIAD 1IRIA 1A50B 3D81A 3VC1A 3WZLA 2A1TR 3EA0A 4EI2A 4UHEA 1G8MA 1QQAA 3IT1A 2J4FA 1II8B 3B6EA 1I2CA 3EAQA 3I32A 2OHGA 3PUKA 2JCGA 4RIGA 3KAQA 3RSZA 1TCUA 2GD0A 3CLHA 2VHQA 4B4DA 3IB3A 3SVTA 1PT6A 2FX2A 1N6LA 1W8IA 2LIVA 3RRBA 4DADA 5B7PA 3OTGA 3TXXA 2M1XA 1MORA 4PEVA 4BTLA 2JARA 5ALXA 2D4AA 3IV7A 4C5AA 3R3JA 1HSOA 4IRXA 3ESRA 3OM0A 3RHSA 6CHYA 3G68A 4FGSA 4RYLA 1MOQA 5I7FA 1A4XA 1JLLA 1QYCA 2FK8A 2NU8A 1TPZA 1PQWA 2PLWA 4V2UA 1D3AA 1L4NA 3HO8A 3FOAA 2C29D 3EVDA 2CL7X 3K70C 3A10A 4FUQA 5K4HA 5H68A 4B7UA 5CB4A 1TO6A 4IIDA 3WLMA 1T35A 2H5LA 4PXYA 4RQUA 1H8ED 3UCXA 3H1PA 1UM9B 1ULHA 4JP5A 1JFFB 1K88A 3MCAA 4TLLB 1U5AA 2WFZA 1QV6A 4MUKA 3UFBA 4YBZA 4YQZA 1RLUA 4ETWA 2WVGA 3IIEA 1FTWA 2W6JD 3BXFA 3H4IA 4ML3A 4QU0A 1WXXA 3T54A 3L79A 1BXZA 1J1IA 1U0HC 2HK6A 1YMUA 3BHIA 4TX1A 2B94A 1F2DA 1SG0A 2W2VA 1D9XA 2A58A 2WF5A 3HCEA 3S1AA 1JKIA 2UZ1B 4XDYA 3SQNA 4EGCB 5TY0A 2XE6A 1EU1A 2VAPA 1QFSA 1Z0DA 1S9DA 2DBZA 4HDKB 1VSUA 4L74A 2DG2A 4J91A 5FB3A 4LJSA 2HA7A 4K9RA 2NQ2C 2ZYHA 1PVVA 1IE3A 4KGDA 2BGWA 3I83A 5KYXA 1S6YA 2GETA 4G9EA 1M2HA 2OL4A 2VDNB 4PGFA 3LH5A 2QWXA 5CHEA 2MWMA 3UHJA 2XODA 4LK3A 4MTCA 2C4WA 1TCBA 1HDGO 4DE5A 4WMLA 5DNEA 1GU1A 2P1RA 3LBYA 2PSSA 2QRMA 1E32A 2P9FA 3BL5A 1EUCB 1EVJA 3IJ5A 4DCVA 5CA1B 1NVEA 4OLJA 121PA 2JZOA 1UDRA 2ZYUX 4V1CA 5F64A 5JTTA 2P11A 5K8VA 3DCIA 5EXXA 4UFPA 2WWXA 2Q3BA 3MRXA 3QLUA 1EYZA 4FYJA 4IIVA 1T9KA 5CPBA 1R0XA 3FMPB 1YRAA 1CCWA 3O92A 1NQVA 1JBQA 1G20A 3BEDA 3AF1A 4Y1RA 4C5BA 2E3JA 4CM3A 3RFXA 4XVHA 1CUXA 1G63A 4OL9A 5AOCA 3CVVA 1G18A 2GK6A 3PFWO 2FWPA 3RB8A 4X8HA 4G1EB 4JP3A 4KQJA 4GX1A 1PL7A 2SICE 2DHDA 3LYLA 2IKQA 5F9HA 1YS4A 2NADA 2X19A 3IP9A 4MYCA 3S44A 2LCFA 2IYUA 3EQ2A 4M0DA 4NIMA 4B9AA 2FDXA 4RK5A 1NY5A 3OWHA 4NXNB 1KYVA 2D3WA 3LKVA 1C2YA 4PYOA 3Q0IA 3EIEA 2VNSA 3M83A 4MI3A 5EKTA 1E2UA 4GD3Q 2Z9DA 3KAPA 4JI6B 2QL9A 3D8BA 4QDOA 1XA0A 2IVZA 3JZDA 4K05A 4MCJA 1D0IA 1NDHA 1FBTA 4CM9D 3NUGA 4CM1A 2DR0A 2X0IA 1NRJB 1O6CA 3UT5A 1JDNA 2O7VA 2IOHA 5AI4A 4HNUA 1Z12A 3FWNA 3ECAA 3GP3A 1ZJJA 1GCIA 5G4LA 5CD1A 1VGQA 3RHZA 3B85A 4MPRA 2EBWA 3QJYA 3SSAA 1Q1NA 1L8LA 1RIFA 4HH1A 2OHIA 2P78A 4OIMA 5DGHA 3K2QA 4FLMA 2P3LA 4XVCA 5C7YA 3BRSA 4JBIA 3VR3D 1R0WA 3Q7PA 5JZVA 4Q3NA 2H59A 3QVUA 3BE8A 4G5QA 2FR1A 1UBMS 1LY1A 2NT3A 5B2FA 5AW3A 3K5WA 2WM2A 3NNNA 1WMEA 4QUHA 2VEOA 3U62A 1YBMA 2GZ3A 3QLEA 4K86A 4KKVA 1YS7A 4PFQA 1P75A 1P2TA 2IDKA 1H22A 1DO8A 2PHZA 3AUJB 4LBWA 1X8JA 1KYYA 2QV7A 3ESZA 3Q85A 4L51A 2DH5A 1R27A 4XWYA 1ZLYA 2JD0A 3ADCA 1WBBA 1D2EA 3OFSA 3F74A 3NGMA 3U4DA 3UV3A 4URYR 3R6WA 4AUMA 5J59A 3CCFA 2PN1A 2CXNA 4MRSA 1L7EA 5LQSA 1OT3A 3TSZA 3I53A 1V37A 2PYIA 1KDOA 4ZZ3A 1NXPA 3HHPA 3PUYA 4Q9KA 4CM9A 4MVJG 4KP7A 2FDCA 3SJAA 3SKVA 4N6OA 1PLLA 1BEZA 2HA4A 5TLSA 1E62A 2H6EA 5FWNA 2X5XA 4GZLA 3ZLTA 2XGJA 1Y89A 5JY6A 1RWQA 1QP8A 4NOKA 4TRNA 1YRLA 1AZTA 1DKUA 4TXNA 1ZSVA 4LY6A 2VG8A 2EDAA 1G8AA 4RWEA 2J31A 1ESDA 3VI4B 1C0PA 4NDAA 4B6EA 5JMOA 1QCCA 3QM1A 1TJ4A 2C78A 4N18A 2GXSA 4A5SA 5KHOC 4S04A 3GLFA 4E5MA 4TMTA 4X6YA 4A2WA 4CF4A 1S2LA 2PEZA 5ARDA 5F5NA 2EX4A 3OPXA 5JC8A 1AQYA 2NU9B 1VIMA 2BHNA 3W9UA 2J5KA 1GQFA 4ALLA 1W5BA 2ZBEA 4TTAA 3GD7A 1UKYA 4OQNA 3LHDA 4GM0A 3VFDA 1ZHHA 1G4UR 3UM9A 3LY7A 3VGPA 4QQKA 3ZN2A 1CQJA 2OLKA 5LOVF 1KJYA 4B3RB 1F0YA 1MTOA 1LW6E 3W3AH 5JXHA 4IZHA 2C2WA 1Z39A 4LJRA 2FRXA 2H9YA 1KBZA 1T9DA 4G3XA 4J9VA 4O2BA 2ZIEA 3LIIA 4S1NA 4PO1A 3DZBA 1A2KC 4GBGA 1QP7A 1KJ9A 1W25A 2ZRQA 2ZVQX 2IC5A 4OLBA 4H1TA 1L5LA 1Z0AA 2FQ1A 1LX6A 3D6TB 3QVLA 3LDUA 4YH1A 3UJNA 1M5UA 5BORA 4Y6QA 1CQZA 2PEYA 2RJOA 4L72A 5EJ6A 1AGNA 1G5FA 4AY2A 3H19A 3LQRA 1RAGA 3F3MA 4IDGA 3ZDFA 3G59A 3T8YA 1E1YA 2C7BA 1IEWA 4IUBS 4FMDB 1KNXA 1Y9AA 3GVXA 4AKTA 3RAEC 1O9HA 4OG2A 1KA9H 4QIHA 4RV9A 4M9QA 4B9EA 2OBMA 5HZMA 5LUAA 3B1JA 5CYGA 1ZN2A 5AKXA 2ZE6A 4D9KA 1ZW1A 2D6FA 2X1VA 3TINA 5EWLB 3W5UA 3ZCUA 1IQPA 4H9GA 4NV0A 1XQVA 1XVUA 3AYXB 4LHSA 4GBJA 3SQOA 3BD6A 1GA1A 1H66A 2B9EA 2EXXA 2QP3A 1ZOSA 3N8IA 1XHEA 3OM8A 4DBLE 5KOJB 4D6YA 1G9TA 3HDGA 1A5BB 3EH2A 4UNPA 2FLWA 2JCSA 1PT8A 1O6BA 2Z09A 3BZBA 4ZHSA 4BGUA 2CWWA 4JXJA 4DT1B 4UULA 3IAEA 3VH3A 3F2VA 5IMBA 1SY7A 3KQMA 4QULA 4YB8A 4PYJA 1ZN9A 2PTGA 5B7NA 3J81k 3WQQA 1MRNA 5AKIA 1GL9B 3KXKA 3L6CA 2NVUB 1QO9A 3FTCA 3HXKA 3HFSA 3M34A 5F7OA 3ORYA 1ST3A 4C07A 5ALHA 2VA8A 2D7JA 3UGKA 5CLFA 1SOMA 4AG6A 1A72A 4KU4A 4US2R 1DZIA 2J6BA 4PHHA 2P2NA 2JAWA 4Y2PA 3SIPA 4FLEA 3C6QA 3U37A 5JISA 5ELLA 3CBGA 2GXQA 4ZT4A 4RHYA 4V39A 5EZSA 2BGTA 4LV5B 1PX2A 4Q9IA 2WHRA 1GPUA 1X7DA 2XF8A 3UFXA 3EA5A 4CFYA 4ZI2A 5HHTA 3M6LA 3VMFA 4EGJA 1ZR2A 4TYWA 4C3ZA 3WNBA 3VAAA 3IDAA 1XU7A 2BISA 2FW9A 3NTXA 2IGBA 3D0KA 3L1JA 3ZW7A 4V0LA 2ZLBA 2RKBA 1H0RA 1WP4A 1NP6A 2QGZA 3IPYA 3L6OO 1EEHA 2K87A 4MIEA 4WNYA 1VECA 3AP2A 2ASEA 3HGMA 1HC7A 1JEQA 4G36A 4OYYA 3MTGA 4PR3A 3UC5A 3AEXA 4Y6PA 2GEDA 2VWPA 3MS7A 4LX0A 2CVQA 3V2UA 1MJGA 2REQA 3LYUA 3WG9A 2JIZD 3WWYA 2GYUA 3PNKA 3BBLA 4BLOA 1MGOA 1NQXA 2GESA 4ASUD 3CVWA 2HA2A 4MVXA 2C99A 3ZJTA 2YWHA 1MB9A 3A6FA 3HCBA 1N34B 1SAYA 2FHPA 2GJ4A 1PQUA 2PZLA 4NMHA 5FLEX 5EJAA 5JYDA 4D4HA 1POWA 2I2CA 2P77A 3SR3A 2YASA 1FFEA 1K6EA 2IYZA 3NBYC 4JLNA 1LLFA 4PC6A 4S24A 1T4DA 5L3SB 3CLTC 1FFXB 4ZVOA 2JIZA 4JJAA 2OT3B 2P6MA 4TSFD 3EQ6A 3EXHC 3BHNA 1E5VA 1XRRA 3SR0A 1ZJ5A 2WDZA 2ZQZA 5I47A 4RSRA 1W6RA 4D80A 4UXHA 2GTHA 2RB5A 4E1AA 1R12A 4E3WA 2QTVB 3U3DA 1VLVA 5LB2A 3NMUF 4LVNA 2FG7C 1BH2A 5A7HA 2IS6A 4LYFA 1HDOA 3ROMA 2FW0A 4KR9A 5KTSA 1T26A 2YBEA 4P98A 3L8EA 4RS4A 4TYYA 4KH0A 1LPAB 1NBMA 1P2SA 3NHSA 4YXFA 2VZ8A 3PD1A 4JJ6A 2ZKIA 4COKA 3AC0A 2D5AA 2ZRPA 4GPZA 5CLJA 2F00A 2QTLA 4IRUB 4RH0A 1L5YA 3AW8A 5CK5A 3F3SA 5J40A 1E2KA 3RQSA 3E9MA 4G89A 4JHXA 4LF4B 1BD4A 4EY4A 2GEBA 4QGHA 1HTTA 1J09A 1P0FA 1Q20A 2FCRA 4KDRA 1AUVA 3A1TA 1OT5A 4QVGA 5IDWA 4R8LA 4Q4AB 1QIFA 4ZI5A 2RC6A 5J5AA 4CF3A 1EFHA 2QUIA 4KMOA 5LB4A 2HGZA 2PX4A 1U3WA 1VJRA 1ISSA 3JQRA 3QQPA 4M9ZA 4RF4A 5AM1A 4OFXA 1EK6A 2CXXA 2A5LA 5DOVA 1MPXA 1PR3A 2ETVA 3HA5A 1OBVA 4NBTA 3C7CB 1HEUA 2HM7A 3G2LA 4WZBE 1GOTA 2J09A 1H9AA 4G5HA 4X20A 2TMKA 4PANA 4XGRA 2CDNA 3OLZA 2XOEA 1GUBA 1O96B 1ZL2A 4FDLA 3NFYA 4OHRA 2AKAB 5JU6A 3EEYA 4NPAA 4YJ3A 2ZITA 4ND6A 4X61A 2AR9A 3SNHA 4PO8A 1MENA 2VP6A 1QHXA 1IVYA 5IM4A 5GJWC 5GADl 3IAS6 1Q16A 3ZE9A 1XCLA 2QA5A 2J46A 2ZB3A 2ZS8A 1PL8A 3I73A 4MR7B 3WLHA 4BAZA 4H1WA 1J8VA 1G6KA 5BSVA 5JALA 2AMYA 5E1OA 2YJ5A 2V9CA 2IEDA 1UC9A 2R4UA 5MN6A 2O4UX 3CUEF 5FBHA 4AY3A 4BBPA 4MLPA 5IAGA 4EG6A 4KBFA 1RHQA 2QTVA 2ZJ8A 4PR0A 1Z82A 4DIEA 2J0EA 3HKEA 2WZCA 3KXLA 5TB5A 3T99A 5CB4F 2X6RA 4ARUA 3U1BA 2J87A 3F7MA 3LX5A 3PG5A 3PYXA 3DZCA 1I0ZA 5HQJA 4JEUA 3W7BA 1C3XA 1DQSA 1K7FB 3MJHA 1UOPA 5KYUA 1PVOA 1E1RA 3HDVA 1SKBA 3NTUA 5EHNA 1MAWA 2JI4A 2CVPA 1J7KA 3MJ4A 1SU8A 2DECA 3Q3JB 1G291 2SKDA 3BH7A 4HUJA 3RAGA 2CL0X 3E1GA 3IPAA 1PK8A 3GQBA 2EF0A 4E32A 3PUIA 5CX1A 5L53A 1N2EA 2C7RA 4XLLA 2OBYA 2QR3A 5I9BA 5IJWA 1E7SA 5KB3A 3IV6A 5IJ0B 4PX9A 4B3MB 1I01A 1RYBA 3HCAA 3F67A 4RD0A 4AN1A 5KZMB 4RGQA 2WM3A 3HYSA 2PUBA 3N7AA 4KXLA 3K2BA 1P72A 1R6DA 3SZUA 2R6R1 4B79A 4A8HA 3BIFA 4EEXA 5L9AA 2GDJA 2J6HA 1RVDA 1YI1A 2Z2JA 1Y34E 1WW8A 2F64A 3MB5A 4OXQA 1JEQB 4FQ7A 4YMHA 1Y6FA 1Z2AA 2P5UA 1GTVA 1KS9A 4IJWA 2FN9A 2Z2IA 1NUHA 1JLSA 3GC6A 4I6EA 4UU1A 2JJ8A 3V1NA 4CDNA 4QDZA 4KVFA 1WVMA 4KK3A 3CTPA 1V5FA 5DIFA 4BL5A 5REQA 4HEA1 2BSXA 4JGIA 4N8SA 5AI9A 4EFDA 3NS7A 5JO0A 3QP9A 3D6NB 1QSGA 2JFHA 5ALFA 5B1SA 2D7DA 5EZYA 4PO9A 3WIEA 1ICEA 2OQVA 2Q62A 2XSZA 5AKGA 3OEED 2Q3JA 1M76A 3ASUA 5DHPA 2HBZA 3V8VA 4TWBA 1QORA 4EKYA 1RKBA 4HVCA 1QTQA 2RHBA 3F96A 5CM9C 2FZKA 2N0SA 3C5EA 3OIUA 4GE3A 3T3OA 2HSWA 4X3PA 2A35A 1KH2A 1I5RA 1D7AA 2EFDB 2VDOB 2WZBA 3AI2A 1MHPA 2QRZA 3MWGA 2GBFA 4GMHA 4JDPA 2Q5LA 3VSCA 1GPYA 1ELOA 1QHHB 2VT7A 3KJQA 2H7CA 4A2CA 1U2TA 4BS9A 1L5WA 3L18A 2NQTA 2KX7A 3OEWA 2PWZA 3AJDA 4Q0MA 5HKKA 2W00A 3NNSA 3QKSB 2X8WA 1ETUA 4CEJB 2B20A 3V48A 3P0HA 1IVSA 3TEMA 3V9PA 1ZH8A 4YT2A 3B1VA 3OTHA 2ZROA 3VU9A 3WI7A 2PL1A 2QS9A 2UZ4A 3LWZA 3NPAA 1NJSA 3DDNA 1YZTA 5FNVA 1JWLA 2GGSA 4RY8A 2VSXA 1S5PA 3FLEA 3O2QB 2PGOA 4OHPA 3TTSA 4AO6A 5DPMA 1ULUA 3N28A 5BPFA 4G86A 1GUYA 1RZ3A 1IXYA 3EDRA 4LA4A 3AB8A 3HZZA 1E2FA 2ZRMA 3MWJA 3KHSA 5IT9A 1LV7A 1MG5A 4CL2A 1C50A 1G17A 3HMKA 2YOHA 1HM5A 1IHPA 3E0QA 1KF0A 2YV1A 2EGHA 3F47A 2WAAA 4XLZA 1D1SA 2HSZA 3JAMA 2QQGA 3HACA 1AD2A 3OWOA 4GPBA 4M6WB 3WYNA 1DHRA 4CM8A 3OQPA 5JCOA 4HTFA 3RTDA 1IIBA 2Q3LA 2X1LA 4UAUA 2HRBA 1MO3A 5CFRA 3BOSA 4P0PB 3E48A 1FK8A 4RMIA 4S1TA 1R0KA 5ICEA 4YQYA 4OGKA 4ARZB 1JHUA 1QOQB 1TNDA 3AY6A 3BSWA 3CNEA 1VPVA 3BXPA 4LZAA 5H5JA 2C7GA 3LDHA 3GRZA 2Q7DA 2O9JA 4R2IA 3BT7A 4DNQA 4B3SB 2DXIA 4Q01A 2P5YA 3FUCA 1TEXA 2HOQA 5EG5A 3QRWA 5B37A 1A5SB 1MB3A 1WOMA 3LGSA 3TSAA 3O9MA 2H1HA 4ZRMA 1K08A 3HPRA 2WJVA 2WPDA 1NM5C 4B75A 4MLCA 1RQNA 1E7YA 1E2IA 3KXDA 4DJDC 5ADHA 1C7IA 3EVBA 2CNNA 1ZSNA 3KU4A 3K0FB 2VUIB 2DF8A 3P0JA 4Q16A 5ALJA 3WKBA 2IYSA 5BWNA 1DMRA 2V6GA 5BP7A 3BB3A 1CNEA 4EVRA 2VR1A 3F4KA 1Z62A 2A5GA 2ZTVA 3OIVA 2X0FA 2O8CB 1QGAA 1EVEA 1SHTX 4X94A 3UW1A 3L2OB 3KPUA 3KJXA 4UM7A 1V9LA 3USZA 4RGYA 3GLFB 3W05A 2Y0BA 1XCPA 1UK7A 4R7ZA 1N77A 4RPKA 5AVOA 3LC1O 4NFSA 1KK2A 1RXEA 3NG1A 3VNUA 2W98A 3UHOA 1JR3A 4P31A 3PDJA 1OFIA 3BGSA 2I1QA 4WFJA 5EPOA 3K70B 1NJ6A 4RQTA 2XQIA 4E5SA 1DOAA 2D1QA 2R1VA 3KL4A 3L0IB 3TTYA 1O57A 3JWEA 4DKXA 5D5PA 2NLOA 3H1AA 2BI7A 1AQLA 1LVHA 1NRIA 4EABA 2XITA 3BWCA 3FNHA 1AMUA 2FPRA 5ER6A 1T0PA 1EM8A 4Y2JA 2H5JA 4P3YA 3N86A 1H2ZA 3WJ1A 2WK1A 4MRNA 4NJMB 1JLLB 1MHTA 3MW8A 5AI5A 1JPUA 1HUQA 2H65A 1RAIA 1JB9A 3KKEA 3PZRA 4Y67A 3MMNA 2YQ4A 4RIFA 5DCYA 4D56A 3B8HA 4ENVA 2XZOA 4ABYA 3SZOA 3DVAA 3I09A 3EQ9A 3U7QA 1FYDA 2C3MA 3AZPA 5BWMA 1K2VN 4KI7A 5AW8A 2ZUUA 4JCOA 2Q3CA 2BGGA 2RGWA 4CR6A 3CWCA 3MWEB 6NULA 2HWKA 3A36A 4K5QA 3A2MA 1II8A 3CNHA 3WKEA 3C5VA 4PHFA 4YUYA 3EVEA 3PTAA 2DFNA 3ONDA 5DTIA 1MMFB 5CH3A 4F3KA 4HLDA 4WUTA 2C2OA 4GPAA 3NHAA 1FFGA 1H5UA 4XARA 1E77A 3A25A 1J8QA 3HWWA 3PFNA 4HN9A 4KO2S 2DY0A 5EMKA 1QYDA 3ZY5A 5EKSA 5SV2A 7ADHA 2IDZA 1MB2A 1RXSA 1XXHE 2C20A 3D3WA 3VPSA 5T4EA 1H3EA 2PUEA 3ZZ1A 2JCBA 5C8YA 1J8FA 3M4ZA 4B0PA 1SURA 1HV8A 1X1CA 4JC8A 3LXMA 1RWNA 4J6FA 4TN1A 4RY0A 3RSSA 1P2DA 2CJXA 3KB8A 3GFGA 4TS3A 4E21A 5C8DA 1SC3A 3IELA 4BLUA 2VK2A 3COYA 4RTSA 4MGEA 1HLGA 4HAUA 1BO6A 3BH6A 3QFRA 3WLNA 4P8RA 4UNRA 4TQGA 1Z75A 5THQA 1SK9A 1IL0A 3WJAA 1R6XA 2PMWB 4J90A 5EL0A 3AESA 3O8LA 3NOQA 1T36B 1E2BA 3TRFA 5FR1A 2O23A 4YPFA 3R6LA 3UPTA 3PRJA 4HYYA 3TUZC 4RK0A 2WAOA 5C81A 5FADA 5I3ZA 1Y8CA 4IJUA 3L7IA 4JWKA 2RK4A 3SS9X 1ID8A 3JALB 3KTAA 4QU9A 2O2DA 4AMVA 2JJYA 1QDLB 5DX1A 3AMVA 2CBGA 1OLSA 4IWYA 1KIMA 4J29A 4DMMA 3PX7A 1ONSA 1Y1QA 4I5DA 3THYA 3N0VA 1O08A 4I50A 5EYPB 3ZTWA 2M6SA 2E0IA 3SMVA 2W7TA 1IG3A 4PPGA 5JRDS 3LA6A 3TCXB 3QPDA 4OB7A 1AKNA 3DAYA 1Z16A 2C8VA 1VI6A 2HHCA 3T7SA 4NWIA 1QE3A 2HDOA 2WE8A 2VT2A 3AVXA 3OA2A 2RH5A 3A4VA 1XRNA 1WPGA 4WUVA 2EEZA 4MUJA 1IEVA 2RGDA 2WYUA 2BT4A 2PT7A 1SA0B 1VLQA 1M2WA 3ROZA 3OY2A 5KINB 3KJNA 5C52B 4WK0B 4KBYA 3VA7A 2UYOA 2PSEA 3HJRA 4DM7A 3CC8A 2XWJI 3H11A 2WYIA 4R2XA 5U4XA 4TVSA 3AG6A 5HCIA 1A2OA 3M3HA 1JQ3A 3TR5A 1LU9A 1OXTA 3JWGA 3SYKA 1R9NA 3R5SA 1COZA 1DQRA 1F9EA 3RANA 2ZDQA 3PQ8A 2V96A 4QLAA 5A3VA 3JQ7B 4G9GA 2CXPA 3RVPA 2DWUA 2KW5A 4R40A 1B15A 4CUZA 5I8WA 4KR3A 4KIJA 4BKOA 4ZA2A 1R5JA 3BUSA 5JXGA 2C1EA 1F2VA 3AFMA 1WTCA 1SCKA 3FCYA 4M38A 1FP1D 2EARA 2QX6A 2RHTA 4CMCA 4REQA 3GGPA 3AERB 3H2ZA 4JEHA 2A5FA 4F3YA 1DT5A 4EOGA 5E7QA 2W90A 3KWFA 2IDMA 3R1IA 4DABA 1J2TA 2R85A 4RNDB 2Z8XA 2GDZA 4N8EA 2P8JA 5G0WA 5BV2P 2ESRA 2MYTA 1RFGE 2JAPA 1JLMA 2Z6VA 3DOUA 5J9FA 3Q8LA 3UV6A 5FUVA 4Z9FA 2X8LA 4IXDA 1P3JA 2ZRGA 4J43A 1D4OA 4O08A 2ZYGA 3ZH2A 3ZE6A 3SF0A 2AXNA 3HFGA 3OY7A 3WDMA 5MGNA 4DR3B 3LBIA 1XZJA 5DMHA 4UUMA 1OWLA 4B80A 4RTQA 2BJWA 1Z8FA 2FE4A 3S27A 4TLCA 3DVAB 5I9MA 2PWBA 1XPOA 3FR8A 3KLPX 4IGAA 4HSGA 2QTMA 3SHTA 3W5IA 2GBPA 1UFVA 1NE7A 5I7OA 2Z98A 2RHOA 4PN3A 4QNMA 3FCSB 3LD9A 4H08A 2NO9A 3M6IA 3FCOA 3KQPA 3TNYA 4A92A 4UU7A 1E3QA 2HGSA 2ONKA 4DWVA 3F8SA 4ZT7A 5LQRA 5EXEA 4MRMB 3SZGA 3I0MA 1HDXA 4C76A 4O2AA 3KCNA 5A7GA 3VR3A 4JSYA 3EWAA 2FW1A 1QP4A 4AYTA 2Y1CA 1OX6A 1JTEA 4O0LA 5EKXA 3B2QA 1KY5A 5BSKA 5LQNA 1AE1A 1NXTA 1XFAA 1N0WA 3PNPA 4FCCA 4A26A 3ZDDA