1I2ZA

E. coli enoyl reductase in complex with nad and brl-12654
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
257
structure length
257
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title 1,4-Disubstituted imidazoles are potential antibacterial agents functioning as inhibitors of enoyl acyl carrier protein reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i2zA00
2G82A 1U8FO 3TF5A 4D42A 2V7PA 4NHEA 3GF4A 1B26A 4CV1A 4Y6RA 4PLHA 3RU9A 5F3RA 2VHWA 1PS8A 2H63A 5KJEA 3VDQA 5C3MA 5JCJD 4PG8A 2VOEA 7MDHA 4DREA 4M87A 2VHZA 3I52A 4D3SA 3K31A 4BNZA 1GDHA 3OEWA 4PFJA 4YAGA 1T4BA 1YBAA 1LXCA 4MVJE 3GEGA 4IJWA 2HJRA 2ZTUA 4QO8A 1HZJA 3COSA 2FWMX 1AHHA 2ZTMA 2H1SA 4RPKA 2JJYA 2Q4EA 3JQEA 1LBEA 1Q7CA 3VAZA 1Y8RB 1U4SA 4R1UA 3JQ9A 2DPHA 1T1SA 4GMFA 1WMAA 3DONA 3L9XA 2JHFA 4WLFA 2BHLA 5EQFA 1DAOA 2DUWA 2VWPA 5TT0A 1UAGA 3A14A 4MP8A 2JFHA 2PZJA 3FR8A 3DEYX 1PQUA 3MEQA 1PGOA 2O3RA 1CQJA 5A1TA 3P5SA 4YJHB 4GX5A 1QV6A 3BMQB 4MVJA 3VH1A 2G76A 1DRWA 2NADA 1PU2A 1W6UA 4RPJA 5IF3A 1HDYA 2PH5A 1GQQA 3RFXA 3D0OA 3WQSB 4F45A 3AOEC 2I6TA 3JD1A 3H9QA 1YB4A 2OL4A 3RSHA 3GNSA 1F14A 2ZTLA 1T24A 1B14A 3VTZA 4NU6A 4BMNA 4PLCA 4E30A 4NBUA 1WP4A 4RORA 2HLPA 4UEKA 5EJ2A 2YFQA 3KVOA 1TVEA 2AQKA 3I6QA 3MJCA 3JCZA 3O8QA 1EEHA 3U4IA 4N18A 3PP8A 4NR0A 4OYRA 4RZIA 4Z0TA 1P1HA 4BO2A 4ZJUA 3OJ0A 5CHEA 1ONOA 1A7AA 2PH3A 4FFLA 2CFCA 2YFHA 2WWRA 3KUXA 4TWRA 1UUFA 4BQPA 1U3WA 4E5KA 1MA0A 3G1TA 3JYPA 1GQYA 1GYRA 2EERA 4PG5A 2Z1NA 3PWKA 4Y6PA 4CLRB 3ULKA 3OECA 1I2BA 4B3JA 1GUZA 2VRBA 3F5SA 4DYDA 1LI4A 2JCVA 2FPPA 3RUAA 4FJ2A 3QQPA 4KDFA 4BO9A 1MXFA 5G4KB 2ZTVA 2P68A 1JKFA 4AICA 4FR5A 2GUGA 3CPSA 4D0RA 1I2CA 2BFAA 3WYBA 3DBLB 3PXXA 4BQRA 4BOYA 2HMVA 4EJMA 4HNGA 3KBOA 1SZJG 3GFGA 3ITDA 2RH4A 3OEYA 2AEMA 4DIOA 4M54A 3WGOA 3HNPA 2P9CA 3K96A 3DMTC 4K28A 1XIVA 5TGDA 4RVUA 3ZW8A 1Y8RA 5A04A 1OC4A 1Z6ZA 3PYXA 1NPDA 5TJ9A 4ZQFA 3UF0A 4I9UA 1HYEA 3HFSA 3PFFA 3T7EA 3ZV5A 3L6OO 4HX5A 4J16A 2JL1A 1U3UA 2GLXA 2RH8A 2WMDA 5CPBA 3M1AA 1SEVA 1Y6JA 4B7XA 1U2DA 1GPDG 3MZ0A 3JQBA 4HFRA 2VYVD 3ONEA 1PJ3A 2VQ3A 1UDAA 2J5QA 3PRJA 1NFQA 3QY9A 3K73O 4RF3A 3RASA 8ADHA 3FCOA 3W8EA 2D1YA 3OJEA 5L95A 1K6XA 5F5LA 1UJMA 4BGVA 3WSVA 1X14A 4E31A 1M2WA 1VJ1A 1YQDA 3CINA 2BH9A 4W99A 1I24A 1U28A 2QHXA 1LTHR 1UXKA 4FQ8A 2PK3A 4P22A 1U4OA 4TZKA 3UFXA 3WFIA 4D45A 4TRMA 3GGPA 5GZ1A 1Y9EA 2VRCD 2JD1A 4ZVVA 2CVZA 4E12A 4IDDA 1JAYA 3GVPA 1VRWA 3AM4A 1VL0A 2FSSA 1P1JA 2XAAA 3LLSA 1LDNA 1XEAA 1GZ4A 3BTOA 1F12A 1FDUA 5DF1A 2AHRA 3LT1A 3VOSA 3ENNA 2IZ1A 3AFNA 1KERA 1YJQA 3TJRA 4A7PA 3TWOA 2UVDA 4XYEA 4XWYA 2VYND 1WW8A 2V6FA 2DAPA 5BSGA 3G1UA 2NTNA 1ULUA 2Q1TA 4I5GA 5DOVA 1T26A 1YH3A 4NJOA 4W4TA 3ON5A 5G0VA 4N5NA 4GI2A 3PDUA 4TVOA 4BB5A 2VCYA 4NFHA 3LC7O 2PLAA 5F1KA 3WFJA 3ZU2A 4YPOA 3WYEA 3ONDA 1XQ1A 2ILTA 1BGVA 4J91A 2IEBA 3H6KA 1G0OA 4CMEC 4AJ4A 4PN3A 4EEXA 2OGUA 1C0PA 2C0CA 3K2BA 4H7PA 1R37A 3E1KA 4M49A 1RM5A 3HN2A 1X0XA 1XCBA 2D8AA 4JNKA 3WTBA 1E7WA 2IDZA 4J0FA 4E2WA 5F21A 3AI3A 3KO8A 4IXTA 4KUHA 3WDSA 1H9AA 3EMKA 3I83A 4CM1A 3EVTA 4YR9A 2O48X 3S2GA 4A27A 3L9WA 4O5OA 1YKFA 1CERA 3ANMA 4D0SA 2RIRA 4EW6A 5KCZA 3RUCA 1U7HA 1QLHA 1B8VA 4XCVA 5CDYA 3HDYA 5TJHA 1H5QA 3VPFA 2QYTA 1T2AA 2YV1A 5BSFA 3T7CA 1A71A 4CM4B 3VDRA 3IUSA 2CNBA 2C2YA 1XKQA 4L4RA 2PD4A 2HCTA 4D44A 3RBZA 1D1SA 2YHUA 1RM0A 1YB1A 5L53A 3FHLA 2JD0A 1GFSA 3PHGA 4J49A 3EGOA 5B37A 5H81A 4R3NA 3TDKA 3GN2A 4TRRA 1Y5MA 1NHWA 2VTEA 1HT0A 1KBZA 2DT5A 4N7RA 3GDGA 4ND2A 3GPDG 4O59O 4CUJA 1ZKMA 5JO0A 4OH1A 1U1IA 4CM9A 3AY6A 5JFOA 1MFPA 5TC4A 4BO5A 3F1LA 4XYLA 2I67A 3IJPA 3QP9A 5A03A 1DOHA 1W73A 4UEJA 2CDBA 4KP7A 3JQ9C 3K6JA 4P4GA 2VWHA 3Q0EA 3L0DA 3NJ4A 2W4QA 2Y1EA 2J5KA 3DDNA 1YL7A 3QJ5A 3NT4A 5CEJA 1ENOA 4JGBA 1HRDA 2G17A 4XJTA 1ISIA 4OQYA 3JSAA 4OOFA 3A28A 1PWZA 5U4QA 3WBFA 5JYDA 3E9MA 2X8LA 2UV8A 1O8CA 3WIDA 2AQIA 4AJHA 2OBNA 2HMTA 4OSPA 1NP3A 5LDGA 2B83A 4JBGA 4WJZA 5AXDA 5BNIA 4DIFA 2E48A 3KB6A 4FDAA 3WB9A 1IPFA 2D3TA 2O4UX 2O23A 3PGXA 2IEDA 1T2EA 4YT5A 4A26A 6ADHA 1QORA 3JQGB 3FN4A 3ZI0A 1ISFA 1J5PA 4IQGA 4TKLA 5JE8A 1JAXA 2HKIA 1DC4A 1JKIA 1Q0QA 3SLKA 1NAIA 2PV7A 4Z6KA 4E32A 3D7LA 4CLXA 2ZJ1A 3EDMA 4WCFB 1XWFA 1Q0HA 4EGFA 1ZK1A 3I9KA 1B2LA 2D5AA 2PY6A 4L0QA 4Z3KA 1BRMA 2CF6A 2YDYA 4CM4A 3Q9NA 1LSOA 3E18A 1R6DA 2O3TA 2GPTA 4CMKA 1O94A 3AU8A 2EJVA 1IB6A 5U9CA 1DRVA 2WYWA 1ISHA 3GEDA 3GNQA 3H5NA 4I9HA 4TVBA 1E92A 3MJEA 1DFGA 1HXHA 1JTVA 4RPHA 4BNFA 2LDBA 1NVGA 1Y7TA 4RPLA 1HTBA 1T2CA 3F47A 2VNSA 2A92A 1WZEA 4XD2A 1P0CA 1P74A 4PLPA 2X4GA 1KEWA 5COQA 3BTSA 3E8XA 2WDZA 4TSKA 1N92A 3ROPA 3DWFA 1C3VA 2ZB3A 3JQ7B 3GR6A 4JROA 2OZPA 2AE1A 3NTOA 1QKIA 2OFPA 3QRWA 1T2DA 4FGSA 4I9NA 1GQ2A 1HE5A 1OBFO 2FR0A 3TOXA 4U0JA 5FYDA 1EVIA 1LLCA 1FMCA 3JV7A 4CV3A 1Y1PA 4DQUA 4J4HA 4FPXA 3QE3A 2HMSA 5JDCA 2HRBA 3DBHB 2YZ7A 4E3ZA 1DIGA 3FRJA 4YWJA 4I5FA 3INGA 2GDZA 3MJ4A 3QWIA 2I76A 4BNJA 4DPLA 1GZ3A 4W6ZA 4TKMA 4HXYA 4I5EA 1RYDA 3VKVA 4HUJA 1HETA 3ASUA 5CP8A 3JQBC 3V5NA 4UVDA 2EF1A 3AK4A 3A9WA 4JCOA 3LQFA 4MVJD 1OOEA 5F1PA 3S2IA 5T5QA 5IXSA 4LMPA 2EKQA 1KEPA 2QRKA 3AI2A 4FFRA 2X58A 4NMHA 5AXBA 5I8ZA 5L45A 1UR5A 2C20A 3GNTA 2F00A 1FDTA 4DVJA 4ESOA 3JQGA 4GPD1 1BXZA 3DZHA 3U4HA 1EZ4A 4AG3A 3ZWBA 5CDUA 4LN1A 3MOIA 3WGHA 1DFHA 2WD7A 4ZQBA 3KYDB 3VH3A 2OO5A 4UEOA 1ID1A 4LK3A 4RVHA 5EESA 5FF9A 1DIHA 1CQIA 1FF9A 1T4DA 2GD1O 1BHSA 4CM9D 1J0XO 1G1AA 1PZEA 1IUKA 1NBOA 3CE6A 3V8BA 4YQZA 2E37A 2WYVA 1XU9A 4WCFA 4XEHA 2NACA 4CMGA 3BAZA 1XHLA 1ZVMA 3PEFA 2JAHA 1LJ8A 2RCYA 1GR0A 5EINA 4BVAA 5JC8A 4CQMA 3DZBA 2BI8A 3LDHA 3BMCB 1WDLA 2FZWA 3PIDA 4B4OA 2DTDA 1LU9A 3DOOA 1XYGA 2GYYA 4EZBA 4XDYA 1MG5A 5KNLA 2VWQA 1BDMA 2QIOA 3S2FA 3HB4X 4Y9DA 1R4NB 1V9LA 4ALMA 3TZQA 2HK7A 4TRNA 3RI3A 3KTDA 3D4PA 4GSLA 2V6BA 2BI7A 4NFYA 2EKPA 3WWZA 3ASVA 3C24A 4P4NA 5KKAA 3E9NA 4Z9FA 1G6KA 5TNXA 1LDYA 3JQ7A 1NQOA 3WNQA 1GEEA 3AOGA 1YRLA 4YT4A 3WGQA 2NTJA 3IP1A 5JS6A 3G3EA 4JJGA 5BSEA 3L4BA 4KUGA 1TI7A 2Q4BA 4A2CA 2C54A 2Y1OA 1E3JA 2QRJA 2FR1A 1JDJA 3EW7A 1NQTA 1YJ8A 3RROA 5JC1A 1VJTA 1E6EA 2VUSA 2FPGA 3WBBA 3DBHA 4WLOA 5IG2A 4WEQA 4WOKA 5A3VA 4XGNA 2Q3EA 3FNEA 4U0KA 4DQVA 5CPFA 2GN9A 1VI2A 1O5IA 2VN8A 2X9GA 4YAKA 4EUHA 3OICA 1E3SA 3GDOA 4PLGA 1CF2O 4PVDA 4WCDA 4LGVA 2C82A 1ISGA 2D4AA 9LDTA 1GUYA 3ZDFA 4R51A 1PQWA 1X7DA 3DFZA 2P4QA 4GGPA 5L3ZA 2PKRA 3D3WA 5CEEA 3VZPA 2XXBA 3PQDA 2EHDA 1P0FA 4TZTA 4AJ1A 4BNUA 1VM6A 2QW8A 3PK0A 1XGKA 4LW8A 2A35A 3ENKA 3G17A 4FIZA 2B5VA 4KTTE 5ES3A 3BYZA 4BB6A 1PEDA 3RC1A 4DL9A 2VT2A 5T8KA 5HBRA 2GZ1A 3KYDA 3RKRA 2DBQA 3FPCA 1VKNA 2UUPA 4CMHA 1GCOA 2E49A 3AFMA 5TRTA 1QLJA 3JD4A 1C0KA 4EUEA 1J6UA 1S7CA 1KEVA 1P3DA 4XRGA 3GAZA 4FFNA 5A06A 1F8FA 2W2LD 2NV6A 3I3OA 3I4FA 4Q9NA 4WPGA 1E3IA 2CF5A 3HFGA 3F4BA 2GF2A 3ZU4A 3ZW9A 1EVYA 2NU8A 1KY4A 1HDXA 5JMWA 3H5AA 1SNYA 3PHLA 4IQ0A 4MVJI 5AXCA 2WE8A 1PWXA 3I6IA 2WTBA 3BTUA 5BNTA 6LDHA 2JFFA 3DHYA 4PG7A 3H5RA 3GT0A 5DBFA 4B79A 4EITA 3QWHA 4C7KA 1E1LA 4UVEA 3RJ5A 1H9BA 3RKUA 4CV0A 3G79A 2R2GA 1IZ9A 4IBOA 1UZNA 3O8QB 4GAEA 2WD8A 3DQPA 3NT2A 1XLTA 5FI3A 4IIVA 5EQDA 1WXDA 4IJKA 2HK9A 4BV9A 4WNCA 4MJLA 1X0VA 4W9NA 5T67A 2WJPA 1MFZA 1EDZA 1V3TA 4E5NA 1FXSA 1SB9A 4ND5A 4NDNE 3FR7A 3BA1A 2Z1MA 3N74A 3DTYA 2BGKA 2Q50A 2OUIA 2OMEA 1ENPA 5ER9A 1C14A 5DCYA 4QQRA 4DMMA 4Q39A 4RZHA 1U5AA 4UUMA 5B1YA 4BO8A 4L4XA 3WQQA 4FGWA 5L7WA 1OC2A 1UP7A 4XIJA 3OQBA 3GOHA 5EL0A 4BUCA 3HDHA 5CDGA 4Q3AA 4YVFA 1EVJA 2EW2A 2ZKLA 4MVJH 3I9NA 4YAJA 4JBIA 4G2NA 5GZ3A 1K3TA 3AM5A 2PGDA 5B4UA 5ENVA 4RDIA 1SO8A 5DCUA 3GMDA 1WMBA 1NAHA 4K6CA 1ZEJA 1GYQA 3UHAA 5KVCA 2GGSA 3IUPA 4YXFA 1PJLA 4MO2A 3NX4A 4DC0A 3LLVA 1I3MA 5JDCC 1SCUA 1U3TA 4ZA2A 1A72A 4XA8A 4CMIB 4J0EA 2EKLA 2HDHA 4BKQA 1EQUA 4GBJA 1W4ZA 1GEGA 1GPJA 3Q11A 3ZWAA 2PZLA 3I9LA 2ET6A 4CM3A 5L40A 1ORRA 1N8KA 3OFSA 5JAMA 4GLOA 3C1TA 1L7EA 3NDJA 2CUKA 4CM7A 4ZN6A 3HG7A 3KSDO 1PZGA 4WLEA 2O4CA 4IS2A 4WOJA 4FJ0A 4LCEA 3Q6IA 3H8VA 4OXYA 2HJSA 3PWZA 4RF4A 5AYVA 1NWHA 3PGJA 1JWBB 3H9GA 1RPNA 5A02A 3K9QO 3ROKA 1HYHA 3S8MA 2B5WA 2EWMA 4J9VA 4IJUA 4IXWA 4FC6A 4GWKA 5I7VA 3EAGA 3NUGA 4E2XA 1ADGA 1M66A 4JK3A 2FR8A 1ML3A 4Q3BA 2B35A 3WSWA 4AJPA 5T6BA 2FZEA 1HL3A 2XOXA 4AJ2A 1M6WA 5K0ZA 4WGGA 1OFGA 2HMUA 3N7UA 4WCFC 1EFKA 4UVGA 1LDGA 2QYSA 1I01A 4AJIA 5EPOA 1VJ0A 4IGFA 1ZIDA 3NGLA 1A4IA 1WVGA 2I5PO 1V3UA 1HDCA 4EUFA 2FHSA 2YV2A 1E0DA 4K26A 3NT5A 1P45A 5ILGA 1I30A 3ZHZA 3H9EO 2D5CA 5JDIA 4LRSB 4B3HA 1R0LA 1UDCA 3RAJA 3IP3A 3TPCA 4EEZA 3RQSA 2UYYA 3UCFA 8LDHA 1RJWA 3V2GA 5ICSA 3Q1LA 4QEDA 3AU9A 2R00A 4JP2A 2D0IA 2GN6A 4C7JA 1H2BA 4HFJA 1HDRA 2P5UA 2JCXA 3WQRA 4BNLA 4E6PA 1ZMTA 2NQTA 4LISA 4IINA 1ADBA 2GO1A 4IIUA 1QV7A 3ORFA 1TB4A 5EERA 1QG6A 4UUNA 3DTTA 3HB5X 2DUUA 2QZZA 3H9JA 4PZCA 5DP1A 2V6MA 3L4BC 1VKOA 2Q99A 4QUKA 5COBA 4I1IA 1LLQA 4IM7A 3WWYA 4YT2A 5THKA 1V6AA 2EGGA 1JVSA 3NGXA 4H3VA 1DC6A 3DZJA 3OP4A 1TLTA 5HWSA 4BGEA 1Q1NA 1V3VA 4ZQEA 4CMIA 3GLQA 3OSUA 5JAZA 2DKNA 4E5YA 1NXQA 4NFSA 3FBGA 3M2TA 4R1TA 5I7FA 3A06A 1B7GO 4DRYA 4E2YA 3DB2A 4Z3DA 3F6YA 2DC1A 5IN5A 3A1NA 2O3UA 4ZHSA 3FWZA 3NKLA 3D4OA 4PG6A 5JYEA 1HE3A 3TFQA 1LX6A 2QRLA 4YJGA 1X1EA 1Y9AA 1LC0A 1AXEA 1H6BA 2CDAA 2G0TA 3WX0A 3JQAB 3ZZNA 1ZO8A 1NWCA 5A9SB 3ANLA 3GQVA 2BGMA 3V1TC 3JYNA 1LRLA 1SOVA 2HQ1A 3GG9A 1L1FA 5BR7A 4A5OA 4QSMA 5T8KC 3EZYA 3GG2A 3RBVA 1C1DB 3ROQA 2DVMA 4HBGA 2B69A 3W6ZA 1DO8A 4R41A 2NVBA 4PVCA 3IKTA 2PKQO 2C2XA 3ZNNA 3R6DA 1ZSVA 1H94A 4XB2A 2X5JO 2Y0CA 1D4FA 2BFPA 3GFBA 4CQMD 5GZ6A 4YACA 3VVCA 4AFNA 2EIHA 4R5HA 5KJ1A 1LLUA 1VL6A 1PL7A 4PLZA 2BLLA 4JP3A 4OXKA 1F8GA 2X9NA 1X1TA 5A4DA 3KYCB 2HK8A 3NJ8A 2PD6A 3GVIA 1B15A 4R1SA 1K6JA 4R69A 4EYEA 2Y1CA 2OBYA 4G5HA 3FSRA 3ADPA 1V0JA 4NK4A 4YA6A 3AY7A 1I8TA 1C0IA 2CVQA 2FPIA 1GY8A 1R4MA 3L4SO 4LRTB 1JWAB 4TMFA 3HDQA 4XQ9A 1PL8A 3VHRA 4JJFA 2IYOA 2Q2QA 3TL3A 4LCJA 3HWRA 1E7YA 2Z95A 1PJBA 3AWDA 3E5RA 1K6IA 1MX3A 4YBZA 1TT7A 4Y6SA 1EE9A 4PLTA 4W9NC 1GUFA 1Z74A 3F4LA 3JQDA 2HU2A 4MKXA 3SC4A 3TZKA 3WMWA 2J3HA 4MP6A 3H3FA 1Z7BA 2QZ9A 3TZCA 3Q9UA 4UUOA 3F1KA 4CR7A 5JW6A 2Y66A 4YAIA 4G65A 3VZSA 1KVRA 2BELA 3BMNA 3GA0A 3IOYA 1UZLA 3LT2A 2Q49A 4FJ1A 4MVJP 4ZU3A 4EJ0A 1ZFNA 3K92A 4UVIA 2AEFA 1EK6A 2GASA 3C8MA 1NM5A 1DPGA 2J3IA 3ADOA 2G1UA 4URFA 1I32A 1ZNQO 5F1OA 4A73A 5C7OO 4AL4A 5JXWA 1JU9A 5G0SA 1PGNA 3JQAA 5JCJA 2CVOA 4ID9A 5A9SA 3FI9A 3PZBA 4BGIA 3U9LA 4BO6A 3ZNOA 4CMJA 1X7HA 1EFLA 3BHJA 5KVQA 1BDBA 1N7HA 2OP1A 1SOWA 1KVUA 1N1EA 4O0LA 1PJ2A 4RV9A 1N1GA 1C1DA 3P19A 1DLJA 2IRWA 2I65A 2FSVA 3H4VA 3NDIA 1QYDA 2FOIA 3D4NA 4BHTA 2C5AA 2X23A 3K5PA 2C7GA 2C29D 2GN8A 2VZ9A 1EUCA 2C07A 3U4DA 3L77A 3W4IA 1FDSA 3F5QA 3OMLA 4H15A 1E7QA 4N54A 3ZCXA 1HSZA 5L4NA 4QFCA 3A4VA 5DZSA 1CWUA 4FC7A 4XGIA 3TN7A 2JFGA 3WLFA 4U7WA 5IDXA 2D2IA 1U5CA 4A10A 2ZQYA 1HDZA 1WDKA 2DBVO 3JD2A 3KYCA 1E6UA 3D5QA 3RC7A 1ONNA 4AVYA 4BS9A 1GAEO 5C7LO 1D3AA 2UUOA 5H82A 2JD2A 2X7HA 3NTQA 5IFLA 4W82A 4FFMA 2BKAA 4IGEA 1R16A 2VUUA 1F0YA 3F46A 3PHIA 4DYVA 2EW8A 2WD7B 4BL5A 1R15A 3WGIA 1WWKA 2ZIZA 4GVLA 1O9BA 1ZCJA 2PGLA 1TXGA 3O26A 4FD3A 3PLNA 2PFGA 4HY3A 3CUKA 4IY1A 4PGFA 4D3DA 1NR7A 3C7CB 4E33A 2FP4A 1NNUA 2NVWA 3RUFA 2P9EA 1MLDA 1ADCA 3KLPX 3I1JA 3SJUA 4XR4A 5A3JA 4CQMB 3Q3CA 4GVXA 2DTEA 4NBTA 1DJQA 1YOVA 4J1NA 4KQWA 4FW8A 4RGBA 2AQ8A 1K2WA 3CH6A 5DN9A 2O7SA 1OAAA 3FPLA 1PZFA 1A9YA 4J43A 4QECA 5JO9A 3DBRA 4S3MA 4MIYA 3L6EA 5AOVA 5ILOA 5DDIP 5COAA 5JDIC 4IDFA 4O63O 2ZYAA 2I3AA 4MINA 3L07A 3JTMA 5JBIA 1UXGA 3DAPA 4DC1A 1JN0A 1H93A 1LDMA 4IQ8A 3X2EA 2FMUA 1SEPA 2GCGA 5G0WA 5H83A 5A9TA 3QVTA 1PS0A 2Q46A 4BO4A 1KVQA 1QYWA 4R1NA 3RUHA 3HADA 4DIBA 3GDFA 2YUTA 2PKQP 2R6JA 4YJFA 4UULA 4BNMA 4IZHA 5IZCA 4IDGA 1YB5A 1CETA 1QRRA 4Q3EA 4JBHA 4GSKA 4E2ZA 4XYGA 4KWHA 1NTOA 1BVUA 3AW9A 5JAQA 2YHIB 3UW3A 4DLBA 3KETA 1SPXA 4DPKA 4PZDA 4WECA 1WAMA 2EV9A 5DOZA 5TX7A 3VH4A 2ZJ0A 3GZNB 1BW9A 4F6CA 5ICMA 3NEPX 1ENZA 3QHAA 3RFTA 2PA3A 3Q2KA 3MTJA 5FWNA 1GADO 5JY6A 5KVVA 1A4UA 4ZGWA 1HEUA 3Q2IA 3GMSA 3QWBA 5HS6A 3D5TA 3QWFA 5HA5A 5JNLA 3D3WB 4J6FA 4L74A 3F9IA 2HAEA 5L7YA 3OIGA 4ZQHA 4L73A 1DIRA 3KV3O 1W8DA 1FK8A 1UDBA 4Z9YA 5L7TA 2VYVA 2UAGA 3CIFA 3PWSA 1DXYA 4M86A 2Q45A 2Y1GA 5DP2A 2C7VA 4O1MA 1F17A 2OXIA 3TNLA 2XF8A 3QWAA 5C7IO 3BZUA 2DM6A 5DULA 3TSCA 4CMCA 1GTMA 2AW5A 3DXFA 1YBMA 4YEDA 5ITWA 4ZRMA 1AN9A 4RVGA 4UREA 5F5NA 4BNIA 3WGTA 5G4LA 3GUYA 3JYOA 1QYXA 1LRKA 3PTZA 3OBBA 1OZAA 4NQZA 5HM8A 3QIVA 2PZMA 4CQLB 1YQXA 1HLDA 2FRDA 2PZKA 4FOSA 3PHJA 1DC3A 3I9OA 5FI5A 4CLEA 3UXYA 1ZW1A 1RKXA 4U5QA 4RO0A 3VKUA 2W2KB 2Q1WA 3KOUA 3W8DA 3MCVA 3JQCA 1BVRA 1H6CA 3I9JA 3SBOA 1P9LA 5B12A 4RLSA 1KC1A 1NASA 5I7EA 4ALLA 1IHXA 3MWEB 1MGOA 2XPCA 3PJGA 1YXMA 1EK5A 3EYWA 2RHRA 4N5MA 3OJLA 4J1SA 4NH4A 2V65A 4GX1A 3DC2A 2AG8A 3K8ZA 4NG5A 4YAEA 3EK2A 2H9IA 1UP4A 4CJXA 4M1QA 3WGYA 2HSDA 3W4JA 1JA9A 3V1UA 4D46A 4YDRA 3C1AA 3LC2O 1KOLA 4H16A 1DJNA 1KS9A 3EVNA 4RPGA 4B7UA 2PWZA 2VHYA 3ETGA 4FN4A 3LF2A 4CM8A 3ZHYA 1G0NA 4W7IA 3ABIA 3BMOA 4J1QA 1R0SA 4R54A 1PS9A 2WSBA 3B1FA 2IXBA 3KSZO 4OQZA 2ZQZA 3MJVA 1QSGA 3MJSA 1PGQA 2EJWA 4KQXA 5ER6A 2YHIA 5TT1A 3H9UA 3WNVA 3WJAA 2QQ5A 5LC1A 5IAAA 4OKIA 3CMMA 1I3NA 3L6DA 1NFFA 3GZNA 4RVFA 2BD0A 1B3BA 4WEOA 2NNLD 3GAFA 3JD3A 4K1LA 1KYQA 3EUWA 3ETEA 2Q2VA 1IHYA 4GKBA 3RCBA 3S1LA 3ZWNA 4CLOA 3ZWOA 1LA2A 3FNHA 5ITVA 4OO3A 5C37A 4AJKA 2JHGA 3GVCA 2A9FA 4XKJA 4INAA 1BXGB 4CL8A 3M1LA 4TQGA 2ZB7A 5CAEA 1UXHA 4OM8A 3ZU5A 1I5RA 5T57A 3VTFA 3JQ8B 2OHXA 4ZQGA 2OP0A 1EMDA 2YJZA 4FS3A 4E21A 4R16A 1H0KA 3AI1A 3E03A 4HADA 1E5QA 2P4HX 1XSEA 4IDCA 3KZVA 5CG1A 4Y67A 3HDJA 5AVOA 2VZ0A 1A7KA 4Z0HO 2EG9A 2WEKA 3PJDA 4II3A 3SVTA 4OAQA 4PIVA 1HSOA 1N2SA 3GC6A 5IXYA 1GD1O 1XG5A 4DWVA 1IZ0A 1NVMB 1PZHA 4GX2A 3M6IA 2BFMA 4NZ9A 1E1NA 4CQLA 1Z75A 2PD3A 3OHSX 5J23A 4MP3A 5A5EA 1WLYA 4UVHA 3D1LA 1NFRA 2I9PA 3D64A 3RVDA 1XU7A 2W2KA 4KZPA 4MKRA 1R0KA 4DQXA 4BNWA 2YV3A 3T4EA 3CXRA 1NX6A 3WS7A 3LC1O 3PLRA 1EE2A 4ROSA 4ZRNA 5CFZA 5I9MA 4DBVO 1B0AA 2X5OA 3D3EA 1VC2A 2TMGA 3PPIA 4GL4A 1ZEMA 3UAGA 1W0CA 1DBVO 1Y81A 4GLLA 3KLMX 2X6TA 3RC9A 4HKTA 2G5CA 1DIBA 5IDWA 1E77A 1P1KA 2C5EA 1HKUA 4ALJA 4PLWA 2VHXA 1DEHA 4NBVA 1MC5A 3DHEA 5A9RA 1ZBQA 2Y0EA 3IS3A 4NJMA 2VT3A 5IN4A 3W1VA 3CSDA 4W7HA 1PJQA 2NQ8A 1NR1A 3QSGA 3U4CA 4E4YA 1XELA 5FFFA 3R3SA 3IDSA 2X0RA 4OKNA 1RM4A 1YDWA 4CM5A 3HUDA 3PFWO 1SC6A 3K2EA 3M2PA 1X13A 3CMCO 4KMSA 3ZWYA 3ANNA 1ONPA 2IE0A 4CPDA 2VZ8A 4IZIA 1BXGA 1N7GA 2DBRA 2I3GA 3E9QA 4M8SA 1X15A 4PRKA 1GU7A 4Z9XA 3FWNA 1QMGA 4LMRA 3JQ8A 1I0ZA 4YCAA 1R66A 4RVDA 4MKZA 1T1RA 5LCXA 4B4WA 4YQYA 4RLHA 2IZ0A 4AJNA 4RDHA 4NIMA 2B4QA 2J3KA 1HLPA 1P1FA 4QFDA 1YONA 3JQAD 4P38A 4BO0A 4YT8A 1D7OA 5C5IA 3B20A 1TT5B 4E5PA 4GQAA 1XA0A 1PL6A 2JAPA 3DOCA 3KHUA 1ZK2A 5KWEA 2DPGA 5IZCC 1PSDA 1MP0A 2NU7A 2XXJA 3DZFA 4B4VA 4YRDA 1K0UA 5TF4A 4B7CA 3GRPA 3QLJA 2AXQA 3RBXA 3IIEA 4KUEA 4MDHA 4R3WA 3WXBA 1YGYA 5GMOA 4ZD6A 1YO6A 1H6DA 4PRLA 3WGGA 3DOJA 3IL2A 4RQUA 3ZGYA 4BNHA 2RHCA 4WASA 1GL3A 1RM3A 3EHEA 2PNFA 3PIIA 4F46A 3QVXA 1B8UA 4BKOA 1E7SA 4WK6A 2Y1DA 4XB1A 4YJGB 4OHUA 1J4AA 1NHGA 1XDWA 3U3XA 1P77A 1VSUA 3H3JA 3OM9A 1UZMA 2VNAA 4U6QA 2NM0A 3VH2A 3OJFA 4F6LA 3VPGA 1O0SA 3OF2A 1PGJA 2BGLA 3OA0A 3ZN2A 5KIAA 1MXHA 1Y5RA 2AMFA 1ARZA 2B0JA 3R0IA 4HNHA 1HE4A 3RWBA 4CLDA 1EBFA 2YY7A 4DGSA 1Q2XA 2PGJA 3K30A 1U9JA 3LT0A 3DZIA 2NUAA 1UH5A 3FNGA 4L9RA 2EEZA 2DBZA 2P2SA 3GGOA 4LSWA 1A5ZA 2LDXA 1LUAA 3ZWXA 2CSUA 4ONEA 1PQPA 3UUWA 3ZWMA 1YDEA 4HP8A 5K6AA 5FEUA 3O9ZA 5JPIA 1DHRA 3ZV6A 4E0BA 2O3SA 2TMDA 4R68A 1NPTO 3DHNA 3I4CA 1BSVA 1DFIA 1ENYA 2YYYA 2GRAA 1LQTA 3DAFA 3HQ4O 2A4KA 5KOIA 5K9ZA 3PDJA 1K5HA 4CV2A 2B36A 1RYEA 4NPCA 3DFUA 1OI7A 3PYLA 4RF2A 1HE2A 3B1KA 3KEQA 3MWDB 3H2ZA 3WIEA 2H5LA 1HDOA 2WYUA 4IDBA 4ZICA 4NBRA 4WE3A 4BO3A 4CUKA 2O2SA 1R4MB 4YYZA 3SX2A 4J2OA 4J7UA 3OIDA 4M89A 1KIFA 4GMGA 5KJFA 1IPEA 4CM6A 5CG2A 1TT5A 4NK5A 4DA9A 3V2UA 1Y8QB 5IJZA 3QW2A 2HMWA 3JYQA 2Y0DA 1ZH8A 4MPDA 2WM3A 4EJ6A 4BV8A 3WTCA 3ZWVA 2IYPA 4PLVA 3HSKA 4XQEA 3OA2A 4XIYA 1RWBA 4XX0A 4FB5A 1Q0LA 1I36A 2VWGA 3DO5A 4BNGA 2CMDA 2GZ2A 1HZZA 5BNFA 1GYPA 3PJEA 4DBZA 3OIFA 2V6GA 3X2FA 3VZQA 2E82A 3PQFA 3V2HA 4YB8A 1LLDA 4BNVA 1UXJA 5THQA 1WPQA 3WR5A 1MB4A 3BMNB 1EBUA 3FNFA 3LT4A 4I08A 5EMHA 1Z45A 4BO1A 1Z73A 4DMLA 4IS3A 4DPMA 3NRCA 1YBVA 3HE3A 1O95A 2P91A 2ZATA 2BRUA 1B16A 4U6SA 3UKOA 4AJOA 3ZNQA 5HTOA 2PR2A 3T4XA 4HV4A 3AUAA 2HUNA 4BO7A 1SMKA 3DAGA 1LQUA 4YJDA 4GX0A 1ZSNA 3GN1A 1JW9B 3ZH2A 3AY3A 3IJRA 4XQCA 2GN4A 4YJHA 2YQ5A 1Q7GA 3WICA 2J8ZA 3BMQA 2ZCVA 4I5DA 3PYMA 3SLGA 1GCUA 1T25A 1AXGA 1M67A 1E1KA 1E7RA 4ALNA 3QVWA 1LEHA 1V35A 2CD9A 3W4KA 4DUPA 5JAIA 3QA9A 3PZRA 3KRTA 1VLLA 4UUPA 5CDTA 4WKGA 3BIOA 2CY0A 1P1IA 4ALIA 2DFDA 3KSUA 4QTZA 4BNXA 5KJCA 3ZWPA 3NAQA 4B8ZA 1YS4A 4IJVA 1LSUA 1AUPA 1ZJYA 3JQFA 3G49A 3IC5A 3ZHXA 4PCVA 5HRUA 4M55A 1GZ6A 1ULSA 1MUUA 1E6WA 3WG9A 4CL3A 3C85A 1QYCA 3TQHA 3U09A 5KJ6A 3BXXA 2X9VA 4JQCA 4XJSA 3ST7A 1PJSA 4CODB 2AG5A 3HJAA 4KTVE 4NU5A 1EVZA 4XDZA 3WOHA 3OQ6A 2W2LA 3GGGA 4BKUA 5MDHA 3ICPA 3LYLA 3RD5A 3UN1A 4JLWA 3GH3A 1M76A 3IMFA 4CLRA 3SEFA 3W6UA 2NU6A 2ZYDA 5I9LA 3RIHA 3EZLA 2Y68A 1D1TA 1DAPA 2CDCA 4G81A 4ND4A 2X0IA 4BNKA 1DRUA 1NPYA 3O38A 1QYVA 2IODA 3OETA 4GGOA 1YQGA 3LU1A 5I9NA 1Y8QA 2W90A 5G4KA 2AQHA 3FD8A 3BHMA 1KY5A 4J3FA 3DBLA 1Z7EA 1P33A 1XQ6A 1ZUD1 1L7DA 3TOZA 4RVSA 2VOJA 3PVZA 4K6FA 4QT0A 4WLNA 4F3YA 1YOVB 5CEFA 5DBGA 4OOEA 1BTOA 2IZZA 1PJTA 1R12A 3GHHA 4II2A 1Q7BA 4X54A 4ALKA 5T64A 1DHTA 3DBRB 1UXIA 1HYGA 3NTRA 4P8RA 3DL2A 1H6AA 2B4TO 5JSFA 2GZ3A 4D7AA 1QP8A 1CRWG 4E13A 2Y67A 2YW9A 4NNJA 3AUTA 4FFPA 5B4VA 3B6ZA 1WZIA 5TIIA 1ZK0A 3DZGA 2I66A 4PLYA 3LVFO 1BWSA 5A05A 4XQGA 1CDOA 1PR3A 3NYWA 3BHIA 4J9UE 4Q3NA 1LC3A 5DCWA 1ZZEA 1KVTA 1D8AA 1DC5A 1E3LA 3H65A 4KWIA 4FCCA 4OXNA 5G2OA 4YJFB 4ITUA 2CZCA 3IAHA 1H2HA 2VTDA 3U5TA 5TS3A 2ZCUA 3QV1A 4BNYA 2DQ4A 3WLEA 1ZSYA 1HWYA 2DLDA 2NSDA 4LSMA 1S6YA 1E5LA 5I8WA 3C3XA 4J4BA 4IDEA 1XR3A 5G0UA 4CR6A 4Q3CA 4HFMA 2A94A 4DLLA 4L8VA 4Y98A 1ISJA 3AM3A 2X0JA 1BW9B 3DBVO 1E3WB 2X5KO 3CTMA 1T2FA 2Y93A 2VUTA 4KDEA 1KVSA 3N58A 5BQFA 4U8GA 1KEUA 2EP7A 5A5FA 3R1IA 1HDGO 3SJ7A 3B70A 3JQ6A 4QO7A 1SAYA 3UH1A 2FY8A 2UDPA 1LDBA 3GVHA 1J49A 1K89A 1I3KA 1FJHA 3UCEA 2EP5A 4R9SA 3RU7A 5JCXA 4WLVA 3UCXA 4BNNA 4RQTA 5TSDA 5KVSA 1IL0A 3PQEA 5JMPA 3VZRA 5B4TA 3H7AA 4FSHA 4WLUA 4ILKA 2HO5A 2NLOA 4L4SA 4MIOA 2Q1SA 4JX8A 2JKVA 4KOAA 5DBIA 1PX0A 5GY7A 1A27A 3GK3A 3ZWWA 2B4RO 2P9GA 4DLAA 2ZB4A 3DMYA 1CEQA 3CZRA 4B4UA 1UP6A 2ZYGA 3I5MA 4OSOA 4J1TA 4Z0PA 2HRZA 3ETDA 3ZV4A 5K6AC 1DLIA 4D79A 2Y99A 4IDAA 1U3VA 3GVXA 5U1PA 4LVCA 3ZU3A 2Y05A 2DU8A 3MOGA 5HS4A 4RL6A 1ISMA 3PI7A 2SCUA 4CMAA 2GSDA 2RAFA 3HHPA 1B8PA 3TZHA 3KYBA 1BMDA 1JVBA 2R00C 5TQVA 3RUDA 1U2GA 2IXAA 3OH8A 3S2EA 3MJTA 1ZMOA 3KXDA 2OORA 1VL8A 2BF7A 2QX7A 3QVSA 4OGWA 4EDFA 1IE3A 2O7QA 5KTKA 4AJJA 1B3RA 3HZZA 4QXMA 5IDQA 4CM8B 3V1YA 4CMBA 4HWKA 3O03A 3BMOB 4D3FA 2O3JA 3ICCA 5L4SA 2POQX 1PJ4A 1NQAO 1NVTA 4S1VA 3C1OA 1KETA 3UOGA 4BMVA 5L51A 4GWGA 1E3WA 3ZWCA 2B37A 3OQ1A 2W8ZA 4R5MA 1Z82A 3U49A 5TLSA 3FTNA 1NQ5A 4CLOB 2EGHA 3C7AA 3ONFA 1P44A 3UGKA 5L9AA 3LZ6A 3TL2A 3GEMA 4L75A 4BIIA 1MG0A 4OJNA 3VPHA 4N5LA 5KKCA 1TA4A 3ZHBA 3VC7A 1X7GA 3TZ6A 1AE1A 4J2HA 1YWGO 1PTJA 5CDSA 3STHA 1C1XB 1CJCA 1VSVA 3E6AA 4PLFA 3S55A 3U62A 3WJ7A 1LSSA 4MVJF 2NTVA 3CKYA 3GY0A 4O6VA 1NYTA 4AJEA 3TFOA 3GUCA 4RCVA 1OMOA 2GR9A 4XYMA 2O2YA 2EXXA 5IZ4A 5IDYA 3SC6A 1YVEI 1LDEA 2E4AA 2C59A 3PJFA 4RF5A 3AOEA 1PR9A 9LDBA 1DIAA 1SBYA 4J4TA 3FF4A 3HN7A 2VRCA 4MIEA 4LVUA 3PHHA 1EUDA 3I23A 2BFOA 3INRA 3INTA 3VPSA 3WGZA 4PZEA 4RJTA 2H6EA 4BKPA 1PGPA 2VHVA 1ADFA 4XYBA 4C4OA 3JQFC 3KM0A 4OL9A 4UAGA 4BGUA 3I9MA 2J5RA 1M6HA 3LSYA 4MVJM 1CYDA 3R3JA 3QVOA 4BNTA 3RC2A 4A03A 1JKJA 5JY1A 4FOOA 4ND3A 2VYNA 2NVUB 2DFVA 3E5MA 4HFNA 1UAYA 4D43A 5L4LA 4K9DA 4MOWA 4CUZA 1E3EA 4P4LA 2J3JA 1MV8A 3EC7A 2OOSA 1FDVA 1VE9A 2GERA 1M75A 4OIMA 3DR3A 1SB8A 1I33A 3ITKA 5ENDA 1YE3A 3G0OA 3NV9A 4L76A 1I2ZA 3TRIA 3EY4A 1V8BA 1JQBA 1N9GB 4NJMB 4BMSA 2ZB8A 2P5YA 3VVBA 4MVJG 4JJIA 1O89A 3FTPA 3CZMA 4TROA 1YL5A 3DMTA 4J7CA 4Y8VA 5BT9A 1I10A 2BMAA 1HF3A 3BTVA 4JXKA 4R9RA 3AUUA 4TRJA 4GH5A 3VPXA 4FBGA 5EN4A 3SXPA 4BKRA 3FBTA 2YDXA 1DSSG 1ZK3A 2Q1UA 5G0TA 1I3LA 1VPDA 3WMXA 1KC3A 3O4RA 1A9ZA 3ZNPA 4EI2A 4YRBA 5I7SA 3AUSA 2X0NA 4A0SA 1EDOA 3RUEA 2W98A 1DDOA 1JLLA 3OJOA 4B8WA 1ZXLA 4CLHA 2E6UX 4QX6A 4D41A 1C1XA 2D59A 5EIOA 1MC4A 2YQ4A 3NDRA 4GKVA 4YRAA 2AEJA 4NI5A 4CR8A 1IULA 1LRJA 1WDMA 3UICA 1N5DA 1F06A 3U0BA 4AJLA 3B1JA 1BXKA 3KEOA 1GV1A 2ZK7A 3CEAA 4R01A 2GNAA 1AHIA 4FFOA 3UVEA 3GRKA 1ZJZA 3LK7A 2J6IA 4J90A 1O6ZA 1P1RA 1IYZA 4OMUA 2X22A 1E1MA 2PTGA 3P2YA 2WE7A 1U7TA 3P2OA 1YL6A 4B3IA 4XGKA 4YTEA 1QXSA 1ZXBA 3RFVA 1DB3A 1C0LA 4IPTA 2O50A 1AGNA 1ZK4A 2X86A 2NU9A 3DZKA 2DTXA 3GZ4A 3ROMA 2NVUA 2AA3A 5BSHA 3E82A 4WUVA 1CIVA 1PJCA 5AQ1A 1U8XX 1BG6A 2JCYA 1EQ2A 5MGBA 4ND1A 2Z5LA 1GV0A 7ADHA 4IMRA 2I99A 3E48A 3BMCA 3P7MA 1IOLA 3LF1A 1EUZA 4I8XA 2Q2WA 1WNTA 1IY8A 3W8FA 4Q3DA 4CMEA 4JIGA 5DNAA 2Y1FA 3MTGA 1QR6A 4PG4A 4DTIA 1R4NA 3IKVA 4XRRA 4XZ3A 1P31A 5AXAA 1N9GA 1PIWA 4XR9A 5JLAA 5DT9A 3AJRA 4EBFA 2AE2A 1FDWA 4DXHA 3RJ9A 2F1KA 1LSJA 2FN7A 2X1HA 3IQDB 1LNQA 2QG4A 5ADHA 3JYLA 2RBEA 3WYCA 2NWQA 3JD0A 4IMPA 5LDHA 4E5MA 4J7XA 4NBWA 4R4JA 3F3SA 4JN6B 1TEHA 4IUYA 3C7DB 3H2SA 4WNIA 3GPIA 3ZV3A 2O3QA 3GHYA 1E7MA 3RUIA
chains in the Genus database with same CATH superfamily
1LH0A 4I2VA 3PNVA 3TF5A 2GXAA 4HGYA 1Z2DA 4U63A 2VK4A 3MRTA 1EFPB 5AW8A 2OHVA 2PUBA 1Z9BA 4KBFA 1TYCA 2OBBA 3ZJYA 5C3MA 4QASA 5JCJD 4M4SA 1E58A 2DUMA 1JQLB 3O31A 4XD7D 4A36A 4L57A 1DV1A 3BIXA 2BHRA 1A82A 2FW7A 4UKDA 4YAGA 4XOUA 3K9LA 2XE6A 2LNDA 3KB1A 4IJWA 5JADA 5JI3E 1N78A 4L07A 3L3BA 1JHZA 4GECA 5E3JA 3RM3A 3WAJA 1NW4A 2QOEA 2HQOA 4MI3A 4RPKA 5K45A 2JJYA 5BSKA 1RLOA 4G1VA 3C4VA 1LBEA 1WF6A 1U4SA 5TARA 5IUJC 3TSOA 1FPMA 3HKDB 1XCLA 1OY1A 1AKUA 1U98A 4GMFA 4UD6A 1CDEA 5JOQA 1L3CA 2BBTA 4J03A 4KR7A 5EQFA 1K92A 1DAOA 5FTWA 1QZZA 4MICA 2ONYA 4GQBA 4EARA 5JVDA 1FUEA 5HFNA 4AY4A 5EZYA 4WH0A 3IB3A 4ZO6A 5JXGA 2IHVA 4YP9A 2JFHA 2Z2YA 4EKYA 3CLUD 3DW3X 3FR8A 2HK6A 3K7EA 5KPJA 1PTJC 1PQUA 2Y1XA 3Q7EA 1TA9A 2O3RA 1EDBA 1QK3A 1J2EA 3DOHA 3GUHA 2PCLA 2RARA 3P5SA 4GX5A 3NHUA 1QV6A 4I3FA 4M8IA 4Q03A 1WCWA 4ZOLF 2PZBA 3RH0A 1SU6A 2XUIA 4ND7A 1SVNA 1PU2A 3CLRC 1AKQA 5IF3A 1HDYA 2F3UA 1AX9A 2BISA 3ZZ1A 4D5GA 5AVTA 3D0OA 4Y2RA 1VXOA 2YKGA 3G8DA 4K9OA 3AOEC 4RZ2A 3GI1A 3ZYZA 3UOWA 2AG0A 4P0QB 1CUDA 4BC0A 1A4RA 3QBDA 1Z2NX 3L18A 4MR8B 5EE0A 1J70A 1P2TA 1U2PA 2ZT5A 4LYDA 4NU6A 4BMNA 2E87A 4PLCA 1JRLA 4NBUA 1WP4A 3C5HA 4INZA 2ZJ4A 4UM5A 5A5VA 2CVFA 3C3JA 4MB6A 1HM5A 3HCNA 4P4SA 2EFGA 2AQKA 4OYRA 1NOIA 2DWQA 2IXGA 3ICWA 1H8ED 4NR0A 4O4HF 4Z0TA 2O8CB 2WFZA 3JVEA 3OJ0A 4MXDA 2V4ZA 1A7AA 2CFCA 3FTFA 5KO2A 1P0MA 3KUXA 4TWRA 5J2UF 1N2BA 3OI7A 1E9RA 5FOQA 2ZWIA 1KIMA 1H65A 3IKJA 1SU8A 1VJDA 4R98A 1MIOB 1GA1A 5CNJA 5CHYA 5INTA 5LR6A 1GYRA 3K16A 3UJ3X 2N1BA 3FSGA 2ORYA 1QUEA 4MWSA 4CLRB 5MF6A 2XZLA 2ZVQX 2QVGA 4Y2JA 3GJ0A 4DR5B 2V6IA 4JXZA 2X42A 1P5FA 2DCMA 1HMYA 4PSVA 4WCVA 4ON9A 5AM3A 3NVKI 4OHCA 5AKLA 1XD9A 1NI4B 2FPPA 1CQWA 1H3FA 2JCVA 3EZGA 4FJ2A 4MS3A 5D2CA 3X1KA 3DMNA 2JB9A 4BO9A 4MMYB 2O0KA 4M0FA 3EPJA 2MYPA 1JMYA 3QXCA 4OGKA 1JKFA 3R0QA 3ZCQA 821PA 3K1YA 2OFWA 3CPSA 1FXWF 1MO5A 1N2HA 3NBXX 3VSDA 4BOYA 3HLTA 3GWGA 4O4IB 1QF6A 2F1IA 3KBOA 2P6MA 5P21A 1S3GA 2RH4A 3OEYA 1TK9A 1YCGA 1UWVA 2QVXX 2VHJA 3B3QA 3STYA 1QCCA 3ER6A 5DX0A 2FDRA 3KWFA 4M54A 3WGOA 4LBWA 2YWGA 3CN7A 2HB6A 2PUCA 1R6UA 3DMTC 4K28A 5FH9A 3EGCA 5IYZB 2FXVA 2GBPA 1Y8RA 1Z36A 2PX6A 4X91A 1XZ8A 5GM1A 4QQ8A 2LE0A 3A9SA 4HXEB 3RRYA 3H5WA 1GPAA 1R27A 2CD7A 2G28A 2PS3A 2P90A 3PYXA 4MK4A 1NPDA 4PPFA 5LFAA 3QXXA 1XP5A 4K0KB 1JHPA 3ZV5A 3QVUA 3SF8B 2JL1A 4LY9A 2RB4A 4KH1A 1F1JA 2M6KA 1E5XA 2GLXA 4BQFA 4X1OA 1I7DA 3LP6A 3SYRA 1ESDA 3DE3X 2GD6A 3FNQA 2YVQA 1SEVA 2P5TB 3WQBA 4YV7A 5H7XA 5I4CA 1NJSA 4KPEC 1L1QA 3MB5A 3ONEA 1QO7A 4RF3A 1SURA 2J5QA 2OM6A 1NTRA 4RELA 2Q3MA 1XLUA 3RWOA 1LTKA 5AUNB 5JISA 2VSOA 1W96A 1QRAA 3MIZA 3OJEA 2BJWA 4LDJA 1T5LA 5F5LA 1TM7E 5JWRA 3CLRD 5LP6A 1OYWA 3A6HA 1U0EA 1XTZA 3ECSA 1XFDA 4QPJC 4YY3B 3I01M 2P4SA 5ECYA 2ZSKA 1YQDA 1F6BA 5KYVA 3NNSA 1I24A 4HXGA 1G16A 1U28A 1T9GS 2HX1A 1LTHR 4P22A 4D45A 1BGXT 4QVGA 2VK1A 3GGPA 5IBPA 3HWSA 4AK9A 5GZ1A 3OE5A 1XNRB 5J4LA 2B1QA 2CVZA 1JAYA 1LV8A 1V1RB 3CYFA 3AM4A 3DP9A 4FGLA 1VL0A 3LQ1A 3E7DA 2QROA 1OU0A 4QEZA 3CCCA 3KJGA 3ND6A 4N3NA 2C2OA 1CG6A 1F4VA 2QLTA 2ZWPA 2C2BA 2AHRA 2OENG 3VOSA 4BN0A 1I6WA 3S3TA 2L0XA 4F92B 3URKA 4A7PA 1U9YA 3QBEA 1AQJA 1R1DA 3RPEA 3FTEA 2DAPA 1OREA 3G1UA 2NTNA 3RYCA 2H92A 1Z25A 3OUZA 5LQAA 5DOVA 5GTDA 4C01A 4XDGA 5KYUB 4LC1A 4N5NA 1RP7A 4CG1A 2VCYA 3EF0A 1ITZA 3LC7O 3KNZA 3EUFA 3F74A 4V24A 3WFJA 4YPOA 1U0LA 3ZXSA 4DMHA 4Z51A 5MFZA 2HPZA 2P78A 1XQ1A 4BAUA 2ILTA 3C3AA 1BGVA 1L8OA 3D8RA 2IEBA 3GFTA 3AEKA 1IEVA 2G9QA 2QRPA 2VCHA 3M49A 4TTJA 4AMBA 3SKVA 4AJ4A 4EEXA 4B3GA 3KIPA 4AUMA 3BPSA 3GJ4A 3E1KA 2WIGA 4REQB 5JZ9A 2O7RA 4GI5A 1NBIA 1TYDE 1Y3BE 3HL4A 2R9VA 4O08A 4RESA 5K3AA 2YS6A 4X1IA 3MUOA 4B83A 3WDSA 4IXTA 3KO8A 3RK0A 4YR9A 1O6GA 5MN6A 2BR5A 3T9AA 13PKA 5E0OA 2VT7A 4DHEA 3ZZTA 4EPTA 3G9UA 2XD9A 1V4VA 4WI1A 4S04A 1ZJ5A 4TV9B 4FEEA 4D0SA 2CCJA 1AQUA 2AYZA 2SKDA 1WVIA 2HNBA 4LXHA 4XCVA 1KE1A 3BJMA 5TJHA 3KT3A 2PZAA 3VPFA 4W8OA 5AKHA 1T2AA 3U13A 4LEIA 3T7CA 3SQOA 1QQ7A 1A5BB 1W5EA 3OMXA 1KK3A 3VDRA 2RC6A 3WKAA 1JR3D 2D62A 3UHPA 1OHHD 1RQNA 2X8AA 3EBPA 1UIRA 1CRQA 3UOAB 3IQFA 4L4RA 1COZA 1K4MA 2HQSA 4IICA 1C3JA 1RHMA 3SZRA 3FUTA 1D1SA 5D1HA 1CJBA 2CLHB 2PSJA 3FHLA 3GLTA 2FFAA 3GRUA 3HCWA 3SIXA 3EVDA 4AX8A 1ZVVA 3CNHA 4R3NA 1UOEA 3GFFA 1GNLA 3GN2A 3H13A 4Q01A 4TQUS 1Y5MA 1NHWA 2WBLC 1FU8A 1L5ZA 3VZCA 1PR0A 1UM9A 1WDWB 3I1FA 5SZHB 1KBZA 2DT5A 4N7RA 5CCDA 2UZ3A 3J81k 1TOAA 2FSGA 3CX6A 3N3AC 4LYYA 5JO0A 1YUMA 4GM0A 3THXA 2BR3A 4Q12A 2YVLA 4LPKA 5AW4A 1IVYA 5LXTB 5CTJA 1U7PA 4EG6A 2PH1A 5HJ7A 4BO5A 3H99A 1B8OA 2WWFA 4COOA 3IJPA 3K6RA 3BWXA 3QP9A 4XYLA 1W73A 3KLNA 4DWWA 3WV5A 1RWQA 4P98A 4OJTA 4AY6A 4TKVB 4F3RA 1QAOA 1EI9A 2C1EA 2UU9B 1US8B 4AUNA 1TAGA 4E7OA 3U16A 3JZDA 3R4VA 1QNFA 3NHJA 2VAWA 1HRDA 4JGBA 4IIJF 1SWVA 4L3OA 4RX1A 1YQTA 1OI3A 4XJTA 3FY4A 1L5HB 4HB2A 5HCIA 3ROEA 3WRXA 2V45A 3FE2A 4R1LA 1B6RA 5DSZA 4DAEA 3UENA 2HLHA 1JYSA 2VSFA 3UJHA 1SD1A 5JYDA 1E2JA 1Z29A 2VDMB 2AC7A 2OBNA 2OHHA 2ZUCA 3JZFA 1G7CA 1NP3A 4MLZA 1S96A 3ZK7A 4DADA 2UUBB 1WMDA 2ZTSA 2B8EA 4Q7EA 1Z4PX 5DTRA 1QP0A 3HCPA 2ZRHA 4UU1A 3V7YA 3O9MA 4DIFA 1ZJWA 4IXDA 3KB6A 1M2OB 3B6EA 1JG1A 1ZA2A 3HUUA 5IHPA 3R5XA 1ZW6A 3OZEA 5CFLA 3G7SA 1T2EA 2ZJFA 2QR5A 1QORA 3FWKA 8ATCA 3X1MA 5EJ5A 2EEPA 1MDBA 3W2FA 1KJ9A 1J5PA 4I5IA 3KU4A 5HKLA 5HNKA 4EIWA 1GRVA 1HT2E 4FNMA 4RGQA 2HUPA 2W2VA 5EMMA 2O2IA 1Q0QA 4YUYA 3RABA 4EH1A 1YR6A 4E32A 4IXMA 2ZJBA 1W34A 2ZJ1A 1VCOA 2WSSD 3NOXA 2BUCA 5KI6A 2HTEA 5KAMA 5T4HA 2EW1A 5H5JA 1CJKC 4G24A 4UHKA 3I9KA 5BW6B 1JR6A 3U7FB 2I9KA 1O54A 4EENA 1C4KA 5EI5A 2CF6A 3EY9A 1DX6A 3UAOA 4LPSA 4C06A 4D4KA 4HDAA 2QRVB 4EOGA 4CM4A 5K8UA 4X8OA 2AFIA 3LQQA 3DV0B 2OXRA 2UUCB 4O4LB 4ISBA 2XCUA 2AWNA 2FGKA 5A3SA 4CMKA 1BJTA 1ACLA 3PEWA 1MAWA 3GEDA 1UBTS 3GRYA 1ZGHA 4NL4H 2Q6IA 4TVBA 1KEEA 3LBAA 1R8YA 1DFGA 5AVVA 1G19A 1XMOB 4DM4A 2MINB 3W90A 1N8SA 3K1TA 2AW3A 2LDBA 1OQAA 1Y7TA 3A3KA 3N5CA 1RPJA 2VNSA 1D0SA 2CJYA 1J7JA 1P0CA 4DDKA 4R2IA 3IPLA 5COQA 2MR5A 1AV7A 1M2EA 3BTSA 3E8XA 5DO9A 3RSGA 3MYYA 4DSTA 1N92A 1P1CA 3LPLA 1G7SA 5KTPA 1ZAYA 3MBOA 1XVLA 4MA0A 1UWKA 2ZB3A 4NAUA 4NV1A 4F4HA 1Z88A 1PBNA 4JROA 1FIUA 1IN1A 2OZPA 1GUAA 3NTOA 1PO7A 3QRWA 4FGSA 1SJ9A 1TF2A 3G5LA 1OBFO 3PDCA 4PAWA 3TOXA 4C4AA 3WHLA 3EH2A 2WB4A 3BCHA 3HWWA 3L41A 3UG6A 2AKAB 3D8HA 1ZM7A 4ZMBA 1M7HA 3EFHA 1EFDN 2OHOA 5JVDF 3JV7A 4F97A 4NV0A 4ZI7A 1OLSB 2GNOA 5L3QA 2F1RA 3OX2A 2HWKA 4NQRA 2WK1A 3BREA 4E08A 2WYOA 2CXTA 3FRJA 3Q8MA 3CNQS 4YWJA 4C0SA 1REQA 3MCTA 1S1MA 1LKZA 3N0WA 4I6GA 3RIYA 3T54A 4PYMA 1KYVA 1GZ3A 1V7ZA 4W6ZA 2GPSA 5E4JA 4PV7A 1N36B 4I5EA 5AJUA 2H1OA 5CP8A 1G4AE 4CCWA 3RQIA 4UNSA 3BKXA 2QX9A 1KBOA 1FP2A 4GBED 3BN3A 3RB8A 3TG2A 1P1BA 2QU8A 2C3YA 2WJGA 3MJFA 3EG9B 4NBLA 4LMPA 4P34A 5LP6C 2QRKA 3DVSX 1Y82A 1U2RA 4WXYB 4B17A 3L05A 1WRBA 4S24A 4CQNA 4QICA 4LXTA 1Z68A 3C5VA 3DEKA 4JIMA 2C4MA 5D87A 1U28C 4ESOA 1W2GA 3JQGA 4GPD1 1HV8A 4WFKA 1Z5PA 5TMDA 4EYGA 1SZDA 4LN1A 3EGXA 1ML4A 1JE0A 1P75A 1YJAA 1I51A 2LIVA 2EBUA 2Z04A 3VU8A 2GJSA 5H3HA 3WGHA 4AZVA 4KE9A 3ADBA 2XRYA 3EEOA 1CUUA 4B76A 3KOZA 5HIJA 4HTAA 3V4PB 1G63A 1C3LA 1ID1A 4RVHA 2TYSB 4AURA 3MWKA 1XYYA 1DIHA 2R6ZA 4JUFA 5IJ0B 5IJWA 4J8PA 1JH9A 4JMPA 5IF9A 1CRLA 4MHSA 4V0QA 2W2XA 3CE6A 3HP7A 1N0WA 1NBOA 2I4TA 2Y4NA 2XMBA 3MERA 1DAEA 4YQZA 2ID4A 4WCFA 5K5EA 3VUEA 4CMGA 2IDKA 4NDZA 2GF0A 2JAHA 1F8XA 1Y6QA 2V3VA 5EINA 1L5MA 1QFXA 1E2NA 3LTNC 1DKMA 2VA8A 1QANA 3U7QA 1NKVA 1RLUA 2YL2A 4Q16A 4ZEVA 3I73A 1BFDA 3FSGD 2HSZA 3A0RB 2DUJA 3C74A 3BMCB 4JYCA 5JAPA 1IQRA 2FU5C 5C53B 2PXCA 2ZSDA 1K97A 3DLBA 3MLAA 4B6OA 4WNYA 3MSCA 1CBUA 4R9UC 1FUUA 3LVQE 1R4NB 4BFCA 1JLSA 3NIDB 3TZQA 1NUQA 4UM7A 2J0EA 2VP9A 3S81A 1VE5A 3VYRB 4X00A 1N1MA 5FFNA 1C29B 3ZGVA 1RXIA 2JFXA 4JJ4A 4JS0A 5CIQA 4CIWA 3ASVA 1KMMA 4NOJA 3ZDZB 1X1DA 4WWHA 4NBKA 1LDYA 5ALDA 4P80A 1NQOA 3U40A 3SIRA 3IAM1 2PBFA 1E2KA 4YT4A 2ZUDA 4JJGA 2CWDA 4KUGA 4M38A 4NNPA 2WJ6A 4QDZA 4G8BA 5FAKA 5KQLA 1AK2A 1EPUA 2XZPA 1ODSA 2QN3A 4DDVA 4P3KA 1JTEA 4TL8A 5JC1A 3ZQ4A 3SSOA 4PBTA 2FPGA 2OCKA 1XEWY 4EBBA 2NZJA 3DBHA 1Z06A 4LDPA 1IWBB 4WEQA 4N48A 2KI5A 1CR2A 3FNEA 4U0KA 4ECAA 4W5OA 5CPFA 1YMUA 4OQQA 1ZC4A 2VN8A 4BMDA 1BJRE 3GDOA 4AKEA 5LP6F 4HZIA 3G89A 5TEWA 1QM5A 3BAFA 1R74A 2O1XA 1F1BA 3T41A 9LDTA 5JSZB 3VKFA 4O02B 1M6NA 1D6MA 2HF9A 3E58A 5CEEA 4N01A 1ESCA 1TAQA 2XXBA 2ATCA 2DJIA 5FBHA 3L82B 3IA2A 1SK8A 4GHWA 1QVAA 4RMGA 2GPYA 1P0FA 5F73A 4BTLA 3ZLVA 5KU1A 1VM6A 1WF3A 2QUHA 3E0XA 3IP7A 2A35A 2WUVA 1J39A 1R9MA 2R6R1 4WZAB 1W5SA 4JDPA 4TMZA 3ENKA 4FIZA 3C43A 2HCJB 4KNYA 2EVWX 4P81A 5EGSA 3NUQA 3ZGLA 3BYZA 4NU8X 3FBWA 1PEDA 1Z37A 4ZYUA 5ALYA 3RC1A 1DJOA 5T8KA 4F85A 3GRVA 5K8LA 3KYDA 3JTEA 4W7SA 1XZQA 2CHFA 5ALJA 3OOWA 4FNOA 4C30A 1K7SN 4MI6A 2I6SA 4CMHA 1GCOA 2H85A 5FDFA 1QLJA 2A2ZA 1JIJA 3BCUA 1IG0A 3Q85A 4YQEA 5E6SB 2I8AA 1J6UA 4FMDB 4C29A 3WYFA 4JGGA 1W0KA 4JLOA 3T4UA 3ZWDA 1FS6A 2FEAA 2V0GA 4KYIB 4FFNA 3CG4A 4OHPA 3LY8A 1KFKB 5A06A 2XGGA 3V8PA 3WRXC 2E4VA 2NSYA 2W2LD 2Z9DA 3F5DA 2ZAOA 3I4FA 4WPGA 1TRKA 4HDKA 1CQJB 2Z6VA 4QUBA 3BL5A 3ZU4A 2YVAA 2ODQA 3CFYA 3W1EA 3G68A 4Y6GB 1FFGA 2NU8A 4G0ZA 6YASA 4WY2A 5ADUS 5JMWA 4RY9A 4I19A 4S35A 3TQIA 3PQ4A 2SKEA 3KOYA 1IB0A 2VNIA 2WNSA 2YOFA 6LDHA 2W4MA 2JLYA 3LCMA 4IO0A 5HKKD 2EJBA 2A5LA 3DHYA 2BZSA 2VBFA 3GPLA 1W35A 5K6TA 3A32A 1XNQB 3T3DA 1T4GA 3HFRA 4LV8B 1GKUB 1NZFA 3QWHA 3TXAA 4X90A 4UHBA 1E2UA 3W2EA 2QL6A 1JDBB 3RJ5A 2JI9A 3RKUA 1I4TD 2GBCA 2Y1LA 5E9JA 4BLVA 2R2GA 5AOAA 4PNPA 3O8QB 4V0OA 4O25A 2WD8A 3DQPA 3H04A 3NT2A 4G5GA 4HAYA 2R8EA 4IEIA 1G21A 2IHTA 1JDVA 2WLSA 4J0HA 2PUJA 3SXJA 3ABRB 4WZAE 3ZHOA 4DRXA 1PQ4A 2W0MA 4L2IA 4MJLA 5B30A 5AM5A 4W1RA 1RRKA 3VHQA 1AC5A 2GCNA 4MV5A 1KJ8A 3B8HA 3LYUA 3M4XA 5CM9C 3TYXA 4DKXA 2GWRA 1BMFA 1OH5A 1ZJ6A 4HH0A 1SB9A 5H9WA 5JS7A 4G1UC 1PLKA 4Q3OA 3FR7A 3A9RA 4KNVA 3GD7A 4C7OB 2Z1MA 1O77A 1AIPA 3WRYA 3ORQA 3ZD9A 5JD5A 3HJBA 3LO8A 2R7AA 3H1EA 3R0XA 4TTPA 1S3IA 4KQEA 1QYRA 4KXMA 3KKNA 1F0PA 3D6MA 1FVFA 4MH0R 4QYWA 2BVNA 3S2ZA 2OPHA 1IBLB 2PEYA 4UUMA 3T7RA 1Q17A 4BO8A 1E9EA 4L4XA 2IWHA 3WQQA 1O3YA 1X1AA 2JBAA 5L7WA 1OC2A 1AM4D 2QAGA 3F9RA 1SKUA 3GOHA 3D7KA 1KAGA 1BMQA 1V7PC 3B9QA 3WKDA 4MWCA 3RVPA 2EW2A 1SCAA 2I4NA 3W2IA 1CIJA 4YAJA 3FMOB 3QYAA 3HJUA 5GZ3A 5LMZA 5LN1A 1ZD9A 1G9XA 1KYZA 2QIPA 3AM5A 2PGDA 2NYRA 2LXNA 4MRSA 4RDIA 4AU1A 1ECBA 3VGJA 1NAHA 2AYYA 1SH7A 2YXPX 1ZEJA 1XKXA 1RJEA 2RAUA 3IUPA 3CTPA 2UYHA 5GJVC 2ICAA 1L4HA 2A5YB 4II7A 3A11A 4DC0A 4GZLA 1E2MA 1VGVA 3UPUA 5KSWB 3I30X 3KSRA 5E95A 1KO1A 4HZUB 4NE9A 1K6EA 2ZI6A 3RHZA 4FFVA 4GBJA 2KQUA 2D2XA 1EWYA 2J7PA 3GLVA 5ALOA 2ZULA 1GEGA 2WJJA 2YW2A 2H2AA 2OBFA 3EA5A 2D0OB 2IY7A 3WDKA 2YWEA 2PZLA 1I6MA 2ET6A 5L40A 1JEQA 3O3MB 2JA2A 1V5IA 5ALNA 2YHSA 1IM5A 2ZRDA 4KFTA 2WPDA 1PEYA 3V2IA 3NDJA 3OU7A 4DJEC 2CUKA 4ZN6A 2YH2A 3FXAA 1P81A 2HBRA 1PZGA 1NVKA 2O4CA 2IIPA 4J0JA 1FMLA 1SVIA 3UG7A 4IF4A 3TEMA 1U0OC 2WV7A 3JALA 1SOUA 2GPNA 2IPAB 2HJSA 3VC1A 2UZIR 3ZQJA 1WUHS 4TQ9A 1Q2UA 5A02A 4N82A 5FLKA 3K9QO 1J07A 1GDDA 1CR1A 1SHJA 2B5WA 4ZVLA 5M7EA 1YQEA 2XYGA 3CW2A 2IS4A 1Z08A 3BB4A 5I7VA 4E2XA 4Q3BA 2FR8A 1ML3A 2CW5A 2B35A 4M9QA 1R88A 4DC9A 1OLOA 2I4MA 1HL3A 1M6WA 4AF6A 4ZGBA 4U7FA 3B6MA 3IOCA 3IT3A 4X20B 2LUOA 3NBYC 2Q3LA 2O06A 3EFEA 4WCFC 1LDGA 5DEIA 3TD6A 4AJIA 5FTLA 4G0OA 2C61A 5HZHA 1CD5A 4FYIA 4C0JA 4DR7B 4LAFA 4MB0A 4C2UA 4X66B 1SIOA 2I5PO 4HDSB 4EUFA 1FYWA 2ZWAA 2YV2A 3QKSB 3KOMA 4EP1A 4RJIA 2A0KA 4U6NA 2V7UA 1E0DA 1ZRSA 5IAOA 4PU0A 1WXEA 3NT5A 2HBQA 4MSUA 1OBVA 2O2XA 3W2GA 2P75A 3L84A 4QA9A 3UC9A 1H0HA 1Z3IX 5HVNA 4X9XA 1SQFA 4B3HA 1P3JA 1FU4A 1DC8A 2C9DA 2FZCA 3RQSA 1FFHA 4BQEA 1R8SA 8LDHA 3UAYA 2XGOA 2ZDGA 4RK4A 5ICSA 1KO8A 3P0JA 1N2CA 1AA6A 3E9CA 4QEDA 4EHAA 5FPTA 2NYAA 4JP2A 4BNDB 4YRMA 3AF6A 4UEWA 2P5UA 4DQLA 3WQRA 3LWNA 2GAFA 3LTEA 1XZLA 2FRVA 1KDVA 2AVDA 2FW1A 3IIJA 5IUNC 2NQTA 1O6BA 4CIVA 5IABA 2WYHA 4JBNA 2GO1A 1M33A 1PT6A 4IIUA 3VBEA 1K3UB 2VDPB 3D3NA 1W36B 1QG6A 3BD9A 1NT4A 2D2FA 3DE0X 4Q18A 2DUUA 2EL7A 2BHSA 2ATEA 1A5AB 4M1ZA 2GZSA 1ECPA 1GTG1 1NLUA 3WK7A 4ZZ3A 3CRNA 3OZIA 4JR1A 5COBA 4C4TA 3CF2A 1WPGA 1V8ZA 4IM7A 4QJIA 4FT4A 4RSGA 2NZYA 2DFPA 2EGGA 1JVSA 2Q0XA 3NBZC 5GV7A 3WYNA 4EY6A 2N3ZA 5HWSA 3GPBA 2RK3A 2ZI3A 4CKBB 1Q1NA 3LPMA 5JWHA 1ZPDA 4DOMA 3GLQA 4FE3A 3H4MA 2D74A 5FHQA 2MSCB 3A4LA 2MOKA 4BEWA 3KKKA 4POAA 2LW7A 1OFVA 4HNRA 1EXVA 2AKEA 4BXOA 1AKTA 3L06A 4QPPA 1THMA 1OFUX 4RHTA 1YVRA 4UOQA 1PX2A 1Y9ZA 3VAAA 1UFVA 4QU9A 2Q7DA 4DRYA 4NULA 1EX7A 4DM7A 3FWPA 3DB2A 2ZSAA 4C3VA 1BJKA 3R9XA 2FG6C 2V0CA 1QGYA 5IN5A 3A1NA 2PYIA 4ZHSA 3TTUA 2DFKB 3D4OA 1NXXA 4GZMA 4DCSA 4AUKA 1HE3A 1X8XA 5FOVA 2JH9A 3TFQA 4P2BA 4EG5A 1X1EA 5ALQA 3Q6MA 3TE6A 5KJ6A 2QRMA 4Q1BA 3ZZNA 4ZT2A 3RAEC 4CT4B 1RWVA 3LXMA 4N8EA 4B2YA 3GQVA 4LOJA 4R1OA 4RD0A 4TS1A 1DAMA 3AINA 3GG9A 3HYRA 4EVQA 4HNTA 1L1FA 4CCAA 4RHYA 2C8JA 5T8KC 1L4MA 3GG2A 3ZE9A 1ETHA 5KDOA 3ZVMA 2ALJA 2WAOA 1N0IA 1OX5A 2B69A 5I01A 3G8YA 1V95A 2Y2VA 3W6ZA 4ZC1A 1Z2AA 2NVBA 4PVCA 3TGPA 1PJAA 4B2LA 3NHMA 1SXQA 1K0FA 2XBLA 2CLIB 4IH4A 3D1JA 4V0ME 4LF4B 1GFIA 4EYOA 3WGUA 1U8ZA 1UMBB 1D4FA 2X5JO 3GFBA 4MJXA 5I9BA 3HYCA 2QTCA 2Z3WA 2M9MA 4C89A 3HHEA 2H1VA 4HWGA 4DLSA 1C9NA 1M6YA 2J9YB 1T1EA 5KJ1A 1SHKA 4WNAA 1VL6A 3B6KA 4PLZA 3T7SA 2BLLA 2Q6TA 5LZ5A 1F8GA 2X9NA 4OHOA 5CT5A 5EG5A 3U3ZA 5A4DA 2OVBA 3GVIA 3G0BA 3PITA 4LVOA 5H80A 2JZOA 4HB3A 4UXJA 4EYEA 2LCQA 4FT2A 5JNUA 2QY9A 2Y1CA 4XWKA 4AWXA 4BP8A 4KREA 2O19A 4G5HA 3QEKA 1V0JA 1OYYA 3AY7A 4EF6A 2JFVA 2CUTA 1M73E 3DFIA 4JLVA 4QOEA 4AZWA 1II8B 5FUXA 5FADA 2XLCA 2P2CA 3A6ZA 3L4SO 4PX9A 1LGYA 3BD7A 4EKDA 3SXUA 1GA4A 2ETXA 3L6RA 2V1XA 1PL8A 1ZONA 3OD1A 4HWSA 1SC9A 4NZYA 3VHRA 5IT0A 4JSTA 2XEDA 3TKLA 1YZNA 4LCJA 3QNMA 5AIAA 3TL3A 2FP4B 2QLLA 4D9KA 3HWRA 2CFRA 1E7YA 2Z95A 1A95A 1PJBA 3AWDA 1MX3A 4YBZA 1JMKC 3TLCA 3T3EA 2TECE 3BGVA 2IZ5A 3UJPA 4PLTA 1CVLA 1WIWA 4Q4HA 3FYHA 5FNVA 3B48A 4MKXA 3WLIA 1LPAB 3WMWA 1NVFA 3I5UA 4Z7QB 3ICOA 4WDRA 4QZVA 3LYHA 1TYBE 1X19A 4ZYXA 1Z7BA 2HLDA 2GPAA 2QZ9A 4FYWA 3I5XA 4ZWNA 3TZCA 4NCKA 4C0AC 1RJ9B 3Q9UA 4L7QA 3W7AA 3ENQA 2HEGA 3LFHA 3WRYC 1CULC 1Z47A 4HPWA 1OV6A 2XQIA 2XUFA 3G85A 4NBNA 1KVRA 3I2FA 3IOYA 3M4NA 3P8ZA 4K8RB 1PNTA 4MVJP 5HEKA 3VOTA 3TLAA 1N5RA 3LGXA 2CHEA 5A3RA 3K92A 5J2TB 4MW0A 5K8JB 4ZO7A 2B1GA 1EIWA 1I2DA 1DINA 1EK6A 4FFDA 3OWOA 1GL9B 1TM5E 1YUBA 5DX1A 3DZCA 2P27A 3VV3A 3THWA 4GG1A 1C3EA 4O2AA 5F1OA 2V5UA 2QAGC 2IPMA 4ND8A 2C4WA 5CGQB 4ENTA 2RBGA 2XDWA 4QQNA 5G0SA 2H4XA 4KQHA 1W4BA 5KWSA 4QTTB 5A9SA 1Y9JA 3E23A 2IEZA 3OJXA 1IY1A 1XZIA 4GP6A 1BKYA 3U9LA 4BGIA 1EA5A 1M1NA 3BHJA 3CXUA 4UM9D 1UBUS 2F8LA 5LNK6 2OP1A 1SOWA 3LDUA 3DOEA 1N1EA 5A4AA 1SVMA 1DS6A 4RV9A 2OFFA 2CFOA 3LPNA 1E61A 3P19A 2IC5A 5K0JA 2J9XB 5E8JA 2ZB2A 3AIIA 1WXWA 4KXXA 1PFGA 2NVOA 2L42A 2X23A 4DJFC 1W0KD 4IFIA 2C29D 2GN8A 4YK7A 3IQWA 3Q3HA 4ZOCA 2C07A 4BDSA 3DHVA 4UHHA 2FPXA 4H15A 2HCFA 3CF4G 2C83A 1K8XB 2XHEA 4N54A 1GGMA 3QBVA 3V1NA 1D2EA 4FFBB 1AQNA 4ARCA 1R4ZA 1CWUA 4RWZA 4XGIA 3IH5A 2JFGA 3TN7A 4WRRA 1RRGA 3WLFA 3WVNA 3SWWA 3DEZA 3H8SA 4JI2B 1DQRA 2GFHA 3IAUA 2ENWA 2KYRA 1L8AA 1Y0BA 2WJWA 1NMQA 3JD2A 4E5DA 5CLGA 4ZCPA 4BS9A 2PL1A 1B00A 4CWAA 4YMTA 4GO1A 3LHSA 5C7LO 2OBXA 3SGLA 2VAVA 2YJ5A 3I61A 4KWEA 4D4MA 4JYMA 2QMHA 4Y9TA 3OZFA 3UMGA 4JUCA 2YMQA 1FTYA 5K0LA 3LLCA 4IGEA 1R16A 3IKLA 3HA2A 3AONB 2EW8A 2WD7B 4GOLD 3ISTA 3QKUA 1R15A 1ULHA 4NJEB 1WWKA 3WL8A 3W2HA 4JC5A 4W63A 1TQ8A 1ZCJA 1TXGA 2D2EA 4KR9A 2UXCB 5HTKA 1CQIB 2KM1A 3CUKA 4PGFA 3GRAA 1KJIA 1NR7A 1RQ2A 1UDXA 2HY7A 1T2NA 3C7CB 3JPYA 3N2KA 2FR8C 2X76A 1MAAA 3BFJA 3RUFA 1FX0B 4FKBA 5G3ZA 1UQUA 4Q3KA 2WTAA 3GJ7A 2RG7A 1HYQA 3IDQA 4HGNA 4HNSA 4JWTA 1XEXB 1SULA 4FBMA 5IKOA 4DCTA 5HJ5A 3GLIA 4AY2A 1LCIA 3TRFA 4AZ3B 2IYTA 2OCBA 3SN6A 3HKCB 1N57A 2JI4A 3CGGA 4J1NA 4KQWA 4O33A 4ZJYA 3UWOA 2VTKA 1S2OA 1CPYA 2AQ8A 5DN9A 1OAAA 1ADYA 1PZFA 3FPLA 4NYIR 5JO9A 9GPBA 4B6GA 3OKAA 4CN9A 3GFQA 3ZKWA 5AOVA 3FCEA 1M7GA 5CK5A 1ZCBA 5I9IA 1HOTA 4DSOA 2EZTA 2ZYAA 2I3AA 1IY0A 3TOCA 1NXOA 2OYCA 3WYGA 1A0OA 3DAPA 3TNDA 3UYLA 3WIVA 4ERXA 1LDMA 4OLJA 3CZQA 1KR2A 1SEPA 2GCGA 5G0WA 2I80A 1G42A 4RS3A 1WZ2A 3KQQA 5FOWA 4M1OA 2DHEA 3GJSA 1YCHA 4P33A 1QYWA 3PUJA 3RUHA 3HADA 4MS1A 4E09A 1TMGE 2PKQP 1YMVA 2JNWA 1GGKA 1VMDA 2WWWA 3Q7QA 3WMGA 2ECKA 1DZ3A 4RMHA 2DGDA 4YC7A 5BSTA 3G9XA 5IZCA 3EQ6A 4JI4B 4Z2AA 3UXMA 3X1XA 4DEXA 1XTJA 3CLTC 2RGCA 4YRTA 5FTNA 4GSKA 1KYYA 3KUKA 4HTFA 4GDMA 1J0EA 1QCYA 2BE7A 2YMMA 3G7NA 4EY3A 4KWHA 4TYMA 4KGZA 3AW9A 4MW2A 1K2VN 1P17A 4NECA 4R2WA 3T5DA 4BVEA 3WLAA 1SPXA 1UKCA 3K6KA 4PZDA 1GKLA 1ZGCA 3K9WA 2EV9A 2H4HA 4W5TA 3TMKA 1Y1TA 2KPOA 2PT6A 2ZJ0A 3GZNB 3DZDA 4HEJA 4P92A 3QG1A 2PA3A 4MTCA 2J7PD 4I6JA 2NUTB 1XNJA 1GADO 2NPOA 2R1TB 4L27A 4QDKA 4D26A 2AG6A 4XUCA 5TQ2B 4B85A 1JFSA 3QWBA 5I7AA 3G23A 5HS6A 3SSMA 3E9DA 2G1AA 1W4CA 2WPDD 3B1YA 4GR4A 4DY6A 4NXNB 1KDZA 3OIGA 5JR3A 3KV3O 1JECA 4WBSA 1YU6A 2A59A 1TCAA 1FK8A 5AJTA 1AN0A 1JEOA 4NCAA 1MEJA 5EJGA 3U1TA 3E7WA 1U1GA 4GUAA 4B82A 2FPLA 2KW5A 1Q1EA 3PSHA 1IM2A 2V7QA 4PYOA 4AW9A 3BZUA 2YIVX 4LX8A 1CEEA 2ZYIA 1GTMA 2EL9A 4EGSA 1Z22A 3C14C 5DBOA 3W79A 1BE0A 4ZRMA 1IN5A 1T0JB 1LBHA 3E61A 3LIPA 1LK7A 1RTTA 1YAJA 3GUYA 2B4AA 3JYOA 1QYXA 1LRKA 3KEFA 3UJDA 4NQZA 4BJ3A 1JV2B 2FWNA 2PZMA 4CQLB 5DXAA 1ZM9A 2IEAA 1HLDA 3LECA 4FOSA 2ZETA 3I9OA 3FKJA 2XDAA 4UCQA 2B0CA 4RK0A 4CLEA 4D5EA 4EGCB 3UXYA 5C46F 2OMKA 3E22A 1F8UA 2J3DA 4RO0A 1Q7TA 4DAOA 3QKTA 5DGXA 3KOUA 3W8DA 3MCVA 1LZLA 5EZSA 1YI8A 2BGRA 1S2NA 5EIBC 2A1IA 4BFXA 2ZR7A 3O74A 4RLSA 1RKVA 1N2GA 1Z63A 3HMQA 3LUDA 1OT3A 4NCHA 2C94A 4NC9A 1K3FA 4KIUA 3ZIAD 1LPBB 4UBMA 2H59A 1J20A 3NCHA 2P1DA 1GN9A 2C2GA 1RE1A 3GOQA 3OJLA 3QUTA 4IMJB 1DCFA 4GX1A 4ODIA 1PJRA 2AG8A 4D82A 1G8HA 1YQUA 4M1QA 1TRHA 1KO5A 4MCJA 4MNTA 1JA0A 4IIEA 3I8XA 3SKXA 2VJAA 4HMPA 4B33A 2AK3A 1RLJA 4D46A 4E4RA 3A4NA 1BYIA 1IY9A 1TU0A 3C1AA 3JVDA 3KHTA 3OQIB 5CU7A 3DWGA 4RPGA 3CZCA 1Q6YA 3FNRA 3SYMA 5JHGB 4FN4A 4QOSA 4QYTA 3GLFB 2GKOA 8GPBA 1G0NA 4AG6A 5FI1B 2WT9A 1IN8A 2F64A 3IDOA 3X1JA 1WEKA 4D0LB 1WZUA 1EAMA 4R54A 3QY0A 4FD2A 1PS9A 2W6ZA 2WSBA 3FZYA 3C6BA 1GNVA 2DSTA 3SFVA 4G5SA 4OHFA 1F48A 4GLFA 3CC8A 4KQXA 5ER6A 3BCSA 2QQ5A 2AVNA 3S27A 5LC1A 5IAAA 2CMKA 4GLBA 5EXPA 1I0LA 2VDRB 5I5GA 3TH5A 3RRZA 1D0IA 3QKRA 1J97A 4JZKA 3X1WA 1B3BA 2HSGA 1Z4QA 2ZJ5A 3HCBA 3JD3A 4IHJF 4JWKA 3ETEA 1IHYA 1NMYA 3DVAA 3S1LA 5B36A 4RHFA 4C4ZA 5KMGB 5L8VA 3FNHA 1NI3A 1O03A 1ZA1A 4TWAA 4UMDA 1DG3A 3IUYA 2BJHA 4XKJA 3RRJA 1M8PA 4TQGA 2G09A 2XOKA 3ZU5A 4FDTA 3L8MA 3L1JA 1S2GA 3F90A 1Z0UA 3VTFA 3TVYA 1TM2A 1DZIA 2GZHA 2YJZA 2D5BA 1BAPA 2WSIA 5CXUA 4E21A 2QTBA 4GSYA 4B6EA 2AI3A 3IDAA 2ANBA 1TM4E 4DT1A 4HNAB 4X62B 4AQDA 2I8CA 3KZVA 3QSYA 4M0DA 2I2AA 3H1FA 4F4JA 5BWMA 1XQXA 2QI9C 4UTOA 2QTWB 1A7KA 3S44A 2H2IA 5K99A 4Z0HO 2EG9A 3RT9A 2QSUA 4EA8A 4Z7NB 5BN1A 2WEKA 3BF8A 4EUNA 4NPHA 1IJBA 4OAQA 3E9RA 1OIVA 2XB9A 2J3QA 2GPJA 1GD1O 4ADSG 2XXAA 2DP4E 1WJGA 3PLAE 4MIKA 3HXKA 5KHOC 2QN6A 1ZZGA 1PZHA 1OH7A 1P7ZA 4XUDA 3GLFE 1Z75A 3OHSX 4Q9KA 3SC3A 5IC6A 5J23A 1J5EB 2XKBA 4UVHA 4LGYA 2ZRCA 3D1LA 2I9PA 1XWIA 4XLZA 5FB3A 1LNZA 1U5BB 4KZPA 4B2IA 3RK4A 5LJIA 1Z5NA 1ORIA 3R74A 5HKBA 5EIBD 2QTNA 5FP0A 2FV8A 4RCZA 3T4EA 3CXRA 3NHWA 1NX6A 5B7NA 1NSTA 4PFQA 3GAAA 3U81A 2QUZA 3JWGA 3LDAA 3QMVA 1DUVG 1B0AA 2X5OA 4XI9A 1A1VA 2DH5A 3D3EA 3SYTA