2VHYA

Crystal structure of apo l-alanine dehydrogenase from mycobacterium tuberculosis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
370
structure length
324
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVMKPGAVLVDIALFYCMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
total genus 98
structure length 324
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA02
1GV0A 3H8VA 5HRUA 3HDYA 3OP4A 4I9HA 2WWRA 4XIJA 4PIVA 5ENVA 3V5NA 3WIEA 1PJ3A 1NASA 2O2YA 3G1TA 2C7VA 4R4JA 4CM1A 3BMNB 4J4TA 4HXYA 4L74A 4ZU3A 1LEHA 3BHJA 1GYRA 3ROMA 3BMQA 2NTVA 3OHSX 5A02A 5JXWA 2BFPA 1N1GA 3D3EA 2OORA 3QW2A 1IPFA 1TB4A 3GVPA 1NR1A 2XPCA 4R1UA 2H6EA 1SEPA 2VWHA 4LK3A 1PR3A 3JQBA 3RJ9A 3WJ7A 1CQJA 3NT2A 1LTHR 1ZNQO 4BO9A 2JKVA 3R0IA 4ZD6A 2B69A 1H6BA 4Y98A 4UUPA 3CTMA 3ADPA 3JQ7A 3GPDG 2PZLA 3I9NA 2FY8A 4PZDA 4B4UA 5ILOA 2VT2A 2GRAA 3GFGA 1X7GA 3OETA 4NBWA 3ZWPA 1I01A 4FCCA 4YR9A 4Z0TA 3C1AA 4J9VA 1VRWA 1ENZA 1XG5A 3BXXA 4ONEA 5EINA 1TT5B 4DPLA 5BSEA 1NWHA 4E30A 2Y05A 3WGGA 1K0UA 4F6LA 2OP0A 4XQCA 1E3IA 4IXTA 1OAAA 2B5VA 3CEAA 4KQXA 2HLPA 3LZ6A 3WYBA 3PLRA 5JAMA 5G0UA 4D43A 3RKRA 3GA0A 3RASA 4BKQA 3A1NA 2YQ4A 4E32A 4WOJA 5JY6A 1LSJA 4B4OA 3IP1A 4IMRA 1UJMA 5ER9A 4A27A 4YAIA 4NIMA 2QRKA 4WNCA 3TJRA 3DBVO 5H81A 1Z45A 4D79A 3KLPX 4OSOA 2DU8A 2GLXA 2W2LD 2B35A 3PJDA 2ZJ1A 1RJWA 1VE9A 2D0IA 4OXYA 5DBIA 3DZFA 3IIEA 4UEOA 4C7JA 4AICA 4PLHA 4O6VA 2SCUA 2UAGA 2O3RA 1IYZA 1OOEA 3ETGA 1E3WB 3I23A 3K96A 4PG5A 2JCXA 1L1FA 3CMMA 3UH1A 2G0TA 3U3XA 5FI3A 2X5KO 5CDYA 1KS9A 1LDBA 4IQ8A 1B3RA 1QP8A 5L4SA 4R69A 1WMAA 4WLEA 3ONEA 3JQFA 2YHIB 5F1OA 4FJ0A 2CNBA 1YGYA 3WGQA 1LA2A 5A3VA 2HK9A 1HE2A 4BNWA 2DC1A 3JQGA 4J7UA 1P0FA 1IHYA 1BGVA 1C0LA 1U7TA 1YQGA 2Y67A 3CIFA 5G2OA 4E6PA 5CEFA 2GERA 3GAFA 2LDBA 5G4KB 2V6FA 2V6BA 5I7SA 3D4OA 1H93A 4ZN6A 1SNYA 1E1MA 3QVSA 4NFSA 2A35A 2PWZA 1MGOA 3AY3A 3MJSA 3HWRA 3PWKA 4P4GA 4KDFA 3AFNA 1QMGA 4KP7A 1ZSYA 1PGNA 3OJLA 3NTQA 1IOLA 1DIRA 5FEUA 3ON5A 4BNFA 4MVJP 3A06A 2VTDA 2HO5A 3OF2A 3GMSA 1HZJA 1DC4A 1ENOA 3KB6A 2QZ9A 3QIVA 3D5QA 4I5EA 2P2SA 4BO6A 3PYLA 1E0DA 4OQYA 2Q3EA 4CR8A 1B0AA 3DQPA 4P38A 3SX2A 5GZ3A 2VNAA 1QSGA 1Q0HA 4J1QA 1RM3A 3KOUA 3GG2A 4G5HA 2YY7A 1U3UA 4NHEA 4Z3DA 4AJ2A 5A9RA 4MVJM 4GMGA 2QRJA 1OBFO 3SEFA 1UUFA 4E4YA 1LQUA 4LN1A 3L0DA 4Z9FA 3O9ZA 2NVBA 1I2BA 5K6AA 3ZU3A 3ZV5A 5AXCA 2BF7A 4MVJG 2NUAA 1V0JA 3D3WB 2D5CA 3JD0A 3KLMX 2W2KA 1XLTA 2VYND 4PCVA 1DJQA 3CINA 4IDEA 3M6IA 3KYBA 1FMCA 1ZK1A 3I9LA 2OL4A 5KVVA 4WLUA 4OO3A 2B4RO 4RDHA 4LSWA 5L4LA 3BTSA 3FI9A 3RWBA 3DWFA 4BKPA 2DUUA 1LC3A 1JWBB 2BELA 1GZ4A 1VI2A 3VZQA 3DAGA 1O0SA 2OUIA 4R1NA 1GEGA 1LBEA 4XEHA 4Y6RA 3UGKA 1UP6A 3SBOA 1MXHA 4IQGA 2JFFA 3DB2A 1O89A 1Q1NA 2JL1A 3AM5A 2CDBA 3JQGB 3H9UA 4F45A 5BR7A 4CLDA 2EP7A 4PFJA 4ZRNA 4TRJA 3SC4A 5EESA 2XXBA 3GDOA 4LGVA 3DZJA 1P33A 1D4FA 1CRWG 4CMIA 5F3RA 3DBLA 1PQPA 5FI5A 3WG9A 3E5MA 3FRJA 1U3TA 3KUXA 4NBUA 4YPOA 4YEDA 4TWRA 1EUDA 1F0YA 4IJUA 5KIAA 2O3JA 4W7HA 4EJ0A 2VWGA 4TRNA 2UYYA 3JQDA 4R5MA 2ZTUA 5IZCA 3V1YA 3QWHA 1UXHA 3JYNA 5DT9A 4BS9A 1Y8RB 2D1YA 3C3XA 5HS4A 4YRDA 3TQHA 3DEYX 3KZVA 2H5LA 5IFLA 3FBGA 5ITVA 2HK8A 4MOWA 1PZFA 5TLSA 5T6BA 5F5NA 3K9QO 4UVHA 2D2IA 2OOSA 1EZ4A 3U62A 5BSHA 4JLWA 3NV9A 2CDCA 2HMVA 5DP2A 1WAMA 2RBEA 3QA9A 4GX5A 4CL3A 2FR1A 4TVBA 1DHRA 2IYPA 4N5NA 3DXFA 4IJKA 2BFMA 3EK2A 1DFHA 1JA9A 3AI2A 3QQPA 1P1JA 3K5PA 4L0QA 2X9GA 2CZCA 3RUCA 2P4QA 1LDMA 2BD0A 4YT5A 4Q9NA 4RLSA 2XF8A 3TZQA 4E5KA 1VM6A 3VOSA 2ZIZA 2C5EA 1S6YA 1NWCA 3LVFO 2FR0A 1ARZA 4BNTA 1H9BA 2DBRA 3IQDB 1ADGA 3UUWA 3JQ7B 1PSDA 4E21A 2Z1MA 4OKNA 4TQGA 1YJ8A 1V3UA 1AHIA 1Y7TA 3M1AA 1NQ5A 1YWGO 2NADA 2NWQA 5EJ2A 2ZQZA 4FN4A 4M86A 1E5QA 2VHVA 4YRBA 3IC5A 4D42A 2OP1A 2FPIA 4CMAA 1JKJA 1NTOA 4E5NA 2RCYA 2LDXA 3QVTA 1LRLA 3Q1LA 1BVRA 3UHAA 3RBXA 2X9NA 3GFBA 4RCVA 2X7HA 2GGSA 4GKBA 4ZICA 3EDMA 1YE3A 4PRLA 2IRWA 3FR8A 1EBFA 3OQBA 4U6SA 1I5RA 1UXIA 2PY6A 1KIFA 4CM8A 4ESOA 4HY3A 1NVTA 2X23A 1A7AA 2AA3A 2GNAA 3C7CB 3FPLA 3BMNA 3DHYA 5TS3A 4CMBA 1J0XO 1NAHA 1I24A 3Q9NA 1K6IA 3U4IA 5L9AA 2UUPA 2DFDA 4RVGA 4XGIA 1A4IA 4C4OA 2AQIA 3DC2A 2YV1A 3RQSA 1U4SA 3W4IA 5DULA 4FFOA 3BYZA 1ADFA 5JFOA 4KQWA 3ASUA 4OXKA 1HDGO 3BAZA 5JC1A 1CQIA 1U5AA 2W90A 1IL0A 1PZHA 3TOXA 2GPTA 1SB9A 2FHSA 2C29D 4CM6A 3MOGA 3NEPX 4G2NA 3C8MA 4J1TA 5IAAA 1B8VA 5KVSA 2ZCVA 5A5FA 3GT0A 4RPGA 5AYVA 1R66A 3WWYA 2I5PO 4TKLA 1SZJG 4PN3A 3C7DB 1TLTA 2HRBA 2TMDA 2TMGA 3WGHA 2NTNA 5EPOA 4HWKA 3IKTA 4AJ4A 4K1LA 1HXHA 3HB5X 2Z95A 4HV4A 5B1YA 1CIVA 2VUUA 4XKJA 1QRRA 3A14A 1YB5A 4UVGA 2HUNA 2P9EA 3WJAA 3TN7A 3O03A 4NDNE 4D44A 1I3LA 3PEFA 1KY4A 3ST7A 1BG6A 1M76A 1L7EA 4YT4A 4DLAA 1DBVO 2CFCA 4YACA 1M75A 3MJVA 4ITUA 3W4JA 4BNYA 1KEVA 1LDNA 3IKVA 2VT3A 2HMUA 5DCYA 3L6OO 4OHUA 1UXJA 1GZ6A 1JWAB 3INRA 3VKVA 1YOVA 1MA0A 5ICSA 2AXQA 4ALJA 3WTBA 4CM9A 4JNKA 2QQ5A 3P7MA 3PP8A 5CP8A 4YWJA 2VUTA 3U0BA 4YCAA 2X0NA 1U3WA 2J3KA 4RVUA 4CR7A 1HKUA 2A4KA 3ONFA 3GR6A 1M6HA 4TVOA 4YVFA 4YT8A 3DAPA 3O38A 5CDUA 2DFVA 1HLPA 1N2SA 4TMFA 4CM4A 1MXFA 1O94A 1MFZA 4NPCA 1A71A 5B4TA 2AW5A 1YL5A 1C1DB 1ZXLA 5T57A 4E12A 3H65A 4LMRA 3ZWVA 3V1TC 3KXDA 5IN5A 1NP3A 3QWBA 3W4KA 3U4CA 1EK5A 3HN7A 1ENPA 4LCEA 6ADHA 1EBUA 2C5AA 1NVMB 1DJNA 2Y0DA 1KVSA 2EF1A 5CFZA 4A03A 2Q49A 1BMDA 3LT2A 3PJEA 5TX7A 1GAEO 2V65A 3AM3A 3CZMA 3WGYA 4AVYA 4CMGA 2PH3A 1JQBA 3ZWYA 3F1KA 1FDTA 2VYVD 1GY8A 3DZIA 3C24A 4B79A 4KDEA 1LNQA 4QTZA 4CJXA 2VZ9A 3KYCA 4YAJA 4W7IA 1E7QA 4NR0A 1PR9A 1T2AA 1V9LA 1TA4A 1CJCA 4EGFA 5TJ9A 3GOHA 5DN9A 1Z6ZA 1UR5A 1G1AA 3KM0A 3ZWXA 3MWEB 3DAFA 5G4LA 1PJ2A 3DHEA 3AJRA 3HZZA 3VVBA 1Y9EA 5TRTA 5JE8A 2NACA 4G65A 4B3IA 4CQLB 2Y1EA 4A10A 3JQ9A 4CM7A 3VZSA 1LDYA 4DPMA 4ZRMA 5FWNA 5LC1A 4K6CA 4QT0A 4Y67A 3WICA 3QP9A 2P5UA 3GUCA 4L4SA 4RL6A 4OGWA 3AI1A 3AI3A 3WYEA 2WYWA 4LMPA 3GC6A 4KUGA 4DREA 5JDIC 1GUZA 2GN8A 2Q2VA 4XWYA 5DZSA 1ZFNA 1F17A 1R15A 4ZQBA 3U09A 2R6JA 1A9YA 2QYTA 1BWSA 1ZEMA 3ZHYA 4FFLA 4PLZA 4FC6A 1XHLA 2B83A 4BNHA 2BRUA 4IUYA 4M89A 3VVCA 4XB1A 3U4HA 4YAGA 3F4BA 2AMFA 4PLVA 4UVIA 5HWSA 1ZXBA 4NMHA 1BXGA 1J5PA 1HDRA 2EERA 1FF9A 3U49A 1Y1PA 3ZHBA 3FWZA 5AXAA 3I6IA 4PLPA 3KSZO 4CLHA 5JSFA 1NAIA 2EKQA 3IDSA 3GVXA 4II3A 1CYDA 3WTCA 5G4KA 2D5AA 3VHRA 3LLVA 2P9CA 5EQFA 4GBJA 5JY1A 1H2HA 2VTEA 1X14A 1C0KA 1IPEA 3FCOA 5A3JA 4L4RA 4MDHA 3MWDB 3QVOA 1NBOA 2X8LA 3W6UA 3ZV6A 2X0JA 4CV0A 1OFGA 2EEZA 3ANMA 3EMKA 4R1TA 5J23A 3HJAA 4IGEA 3PI7A 3S2FA 2BGLA 1ISHA 3ABIA 3QRWA 5LDGA 4B3JA 2NV6A 1BTOA 1IUKA 3QY9A 3TPCA 3GHYA 2EWMA 5L7YA 5G0SA 2BH9A 4JXKA 1ML3A 1O95A 4J91A 3ZWAA 1R4MB 4Q39A 4HNGA 3RBVA 4D41A 4W6ZA 2NU9A 4M55A 1VKOA 1EEHA 3JD1A 1R0SA 2A92A 4MVJA 3DO5A 3HFGA 1U8XX 3TDKA 5L7TA 1DIHA 1I8TA 4BNUA 3MOIA 1MG5A 1UZLA 3KBOA 1NFFA 4ZQEA 4HFRA 1UZMA 1ZJZA 4GLOA 3AUTA 2BGMA 5G0TA 4PG8A 2W8ZA 2YFQA 3LLSA 1HDXA 2JD0A 3R3JA 2F1KA 3P5SA 1PJBA 4FIZA 4PG6A 4RPJA 4E0BA 3OEWA 1QV7A 4G81A 1ZO8A 3TZCA 3WQRA 1ENYA 1U5CA 1DO8A 4CM8B 2J5QA 4R9SA 1FDWA 4LCJA 1LSUA 3LU1A 4M54A 5BSFA 2ET6A 4JN6B 1EE2A 3TSCA 4OAQA 1ZMTA 3A28A 4D7AA 1KC1A 5DNAA 3A4VA 2P9GA 3JTMA 4JQCA 4CQMA 1VSVA 1YDEA 2X58A 4XB2A 2RAFA 3NYWA 4E2XA 4R1SA 2G82A 1RYDA 3E9MA 3MCVA 2CUKA 2VHXA 2X22A 1H6AA 2GSDA 4YB8A 3UXYA 1RYEA 5IZCC 4MIOA 1E3JA 2JAPA 2WE7A 2WJPA 5LCXA 3R6DA 4JJFA 1KERA 1AUPA 1N7HA 1MV8A 3F3SA 3AU9A 1V35A 4R54A 1YJQA 2BMAA 4WASA 3KV3O 3JQ8B 4B4WA 4B3HA 1NQAO 4IGFA 3HDHA 3NX4A 1CETA 3GHHA 3ZWWA 1QV6A 1SOVA 2AHRA 4R3NA 4DBZA 2CSUA 1ADBA 5JCJD 1X1EA 3KSUA 4IPTA 1B15A 2EHDA 3BMOA 4ZQFA 3VAZA 4ZHSA 3DOCA 4AJ1A 2VRBA 2PV7A 3WB9A 3DHNA 1XU7A 1IE3A 3GDGA 1VLLA 2IE0A 1BRMA 4EYEA 3WNQA 1MFPA 1PWZA 1ISJA 2D59A 4CM5A 2J8ZA 3EVNA 1E1NA 3RC2A 4EUFA 4I9UA 5GZ6A 1SCUA 1DXYA 2X5JO 3RIHA 4YQZA 3K73O 4GX0A 3SVTA 3ZW8A 2JCVA 3GVIA 3U9LA 4FS3A 4RO0A 3HFSA 1YQXA 3GNQA 4XJSA 2HJRA 4BGUA 4QEDA 4A26A 3UKOA 5L40A 4JP3A 3O26A 4J90A 5KKAA 1QYWA 2PD3A 3HG7A 1P44A 3DTTA 3E6AA 4L9RA 4LVCA 3PHGA 4RPLA 4YJFB 2C2XA 1WVGA 3S1LA 3W8EA 2FSVA 1XWFA 3JV7A 4IMPA 4QO7A 3GN1A 4NH4A 3ZNQA 1E7WA 2O3TA 4E2WA 1EQUA 2WMDA 4E2ZA 3HDQA 3LYLA 4CUZA 4N18A 1A27A 1XYGA 1UAGA 3F1LA 1YL6A 4BO1A 1LSOA 3P2YA 1DAPA 4RDIA 4BV8A 8LDHA 2YV2A 4ZJUA 2PKQP 4HKTA 1W0CA 2YV3A 1NX6A 1ZVMA 3T7EA 3HADA 3IUSA 3MJEA 3HE3A 2EG9A 3WFJA 2JJYA 2WYVA 3UFXA 4DIFA 5JYEA 2IYOA 4XRGA 4DUPA 5KKCA 2VZ0A 2CDAA 1I10A 3JYQA 3O8QA 3HHPA 3VPGA 3CH6A 3PIIA 4ND4A 4WCFB 4Z9XA 1X1TA 1DRVA 3H5RA 5CEJA 4BNZA 4KOAA 2NVWA 2FP4A 5EMHA 4KZPA 4Z0HO 4P4LA 4UREA 5IF3A 1D3AA 1PS9A 5TIIA 4LSMA 2BLLA 1PQWA 1BXZA 1MC4A 2I3GA 3ZWMA 4RQTA 3Q3CA 2OBYA 3NDIA 4FW8A 2Q45A 4BGIA 4R16A 4RF3A 2ZTMA 3MZ0A 1DC5A 1O5IA 3JQAD 3ZHXA 1B8PA 1G6KA 3JD2A 3L9WA 4D46A 3WGZA 3B6ZA 1EFLA 2EXXA 4CLEA 4II2A 4WKGA 1ORRA 1ZKMA 1RM0A 4FGWA 4NU5A 1H9AA 1P31A 5H82A 2JD1A 3RBZA 2EJWA 1LSSA 4R5HA 3WXBA 4O1MA 2VQ3A 2YYYA 1PU2A 3I3OA 4IQ0A 1SB8A 4GVXA 1PX0A 1AXGA 1QORA 4XGNA 3TL2A 4NG5A 4NJMB 5BT9A 3HSKA 1ISIA 2Q1TA 4MP8A 3U5TA 1VJ1A 5JCXA 4O5OA 4I8XA 3UCFA 3UN1A 1QYCA 1PZGA 3B1FA 3E82A 5H83A 5JO9A 2HMSA 4YJDA 5JAZA 4DLLA 4RV9A 4CM3A 1QYDA 2G5CA 4O0LA 1JVBA 1SEVA 1QYVA 3IAHA 1QLJA 4PLGA 2B36A 4GH5A 4XDYA 4YJGA 5A03A 5B37A 4NK5A 2CF5A 2ZB8A 3NDRA 1HL3A 1IHXA 1TXGA 2FZWA 3FHLA 3QWFA 1U7HA 4S3MA 5DBFA 2ZKLA 1SBYA 2Y1CA 4U7WA 2FPPA 3I9OA 3PDJA 1I3NA 4XYEA 2B4QA 4RVFA 1AE1A 3C1OA 1VL8A 5F1PA 3ITKA 1NFQA 3SC6A 3EGOA 4BHTA 2OZPA 4FGSA 2Y1GA 4EW6A 4MKZA 4IXWA 5JMPA 2X4GA 3L6EA 5EL0A 3BA1A 4GSLA 3RUIA 3V2HA 3Q2KA 1DC6A 4H15A 4Q3NA 3VH2A 4QUKA 4FBGA 3QSGA 1K2WA 4YT2A 2C54A 5CDGA 1ZJYA 4YTEA 5CEEA 3ICCA 2GUGA 5KJCA 1AXEA 4BIIA 1E7MA 1U2DA 1EVYA 2IXBA 4J7XA 4W82A 4I9NA 5JAIA 4GWKA 3PHHA 3QWAA 4U8GA 2O3QA 1Z75A 4MPDA 3RFTA 5JAQA 3FPCA 4BNJA 1GYQA 2V6MA 3GEMA 4KWHA 1P1KA 2UVDA 3H5AA 3G3EA 1T24A 4IZIA 4JP2A 4KUEA 4CLRA 4XJTA 3GK3A 3V8BA 5ES3A 3DZGA 1U2GA 3PFWO 5IN4A 1YB4A 2DBQA 4UVEA 3JQAB 3RCBA 2CD9A 5L7WA 4BNIA 2RHCA 2Y1OA 2VWQA 1E1KA 5KVCA 1LLUA 1VL6A 3Q11A 1R37A 2BGKA 2RHRA 3DBHB 2I3AA 4IS2A 2DTDA 5COQA 1IZ9A 5C5IA 4RF5A 1A4UA 1ZUD1 3JQ8A 1BW9B 3KEQA 5IXYA 1HDCA 4IJWA 1OC4A 3E18A 1LDGA 3ORFA 4E2YA 3LSYA 1TEHA 3P19A 1G0OA 4Y6SA 3TRIA 3H5NA 4AJJA 5JO0A 2CVQA 4ALKA 2R00A 5AVOA 1E6UA 1R0LA 4R9RA 2YHIA 4GQAA 4RORA 4B4VA 2NTJA 4ALMA 4JJGA 3NTRA 1OMOA 4L75A 3X2FA 4BKUA 1PJSA 3S8MA 4FSHA 5CPBA 3E1KA 3GZNA 3EAGA 1R12A 1HF3A 1HT0A 4UUMA 3GF4A 3AOEA 1YBAA 5EQDA 3PQDA 4CQLA 3DBHA 2G17A 2JFGA 1U8FO 1TT7A 3G49A 1VSUA 4WPGA 2HU2A 4ID9A 2CMDA 3ADOA 3T7CA 4DA9A 3W8DA 2F00A 1Y81A 1Z7BA 3H3JA 3QVXA 1WPQA 2QYSA 8ADHA 2OGUA 4MP6A 1XA0A 5HBRA 2RH8A 1Z82A 3VPXA 3S2EA 2AQHA 1NPDA 1YKFA 3Q9UA 3DR3A 5G0WA 1IZ0A 1P1FA 4XR4A 4E31A 1ZSNA 3I6QA 4MKXA 2HCTA 1T1SA 5JDCA 3AOGA 1HE5A 2J6IA 5JCJA 9LDBA 3MTGA 3ZV3A 1HLDA 1GADO 3LT1A 2VUSA 3OM9A 5G0VA 4YAKA 3DDNA 4MVJH 2C07A 4FOOA 3VTFA 4NQZA 4JCOA 5JPIA 2W98A 4J0EA 3LT0A 3GPIA 2V6GA 2QHXA 3VH3A 3TZ6A 2ZYDA 1UDCA 2I9PA 3DMYA 1TVEA 1LI4A 1PWXA 3BHMA 2B37A 2ZATA 1V8BA 2O4CA 3F5QA 1HYGA 4FFNA 4AL4A 1SO8A 1B14A 1JDJA 1KVUA 4BNXA 1N8KA 2VHZA 3NUGA 1JLLA 1BW9A 4I5GA 2PA3A 2PFGA 4MKRA 1XIVA 3NJ8A 3EZYA 4BVAA 4URFA 2UDPA 3WGIA 2AEJA 2DM6A 1DC3A 3UVEA 2VRCD 4A2CA 3S55A 1ZZEA 1Y8QA 2DTXA 4XYLA 1X7DA 4Z0PA 3NJ4A 2NU7A 3GNTA 5U4QA 3ASVA 3K2BA 4E5PA 5JW6A 4R51A 4WLVA 1GUYA 4IS3A 4LISA 3KYCB 3OQ6A 4DPKA 4FFPA 1I3KA 1PS0A 1KBZA 3CXRA 1ISMA 1K6XA 4J49A 4XRRA 5TC4A 1HTBA 4IINA 3RUFA 3ZWCA 3AY6A 1YBVA 2P4HX 1V3VA 2WE8A 3WSWA 2DKNA 4MVJI 3OIGA 1KVTA 3ULKA 4EEZA 3D3WA 3F46A 4WEOA 2EGGA 3PQFA 2OMEA 2HJSA 2DTEA 2WD7A 4W9NC 1DDOA 1GL3A 4BNGA 2EV9A 3B70A 3A9WA 4B7XA 4B7CA 3D4NA 1PS8A 2Z1NA 3L9XA 5ADHA 4PLTA 3I4FA 1WMBA 3FSRA 4N5MA 1X13A 4QSMA 1OI7A 5EN4A 4IIVA 2H1SA 4CUJA 3ZNNA 3RUDA 4OMUA 1ZMOA 4YRAA 2HAEA 1I0ZA 2AG5A 3COSA 4YYZA 3CPSA 1HE4A 2R2GA 2FPGA 3LC7O 1KOLA 3UCXA 3JQBC 4A7PA 1V3TA 1TT5A 1XGKA 3D0OA 3PJFA 3SJUA 4CV3A 5A9SB 4AJOA 3PHIA 4FFRA 1BXGB 4K26A 4GI2A 5CDSA 2VHYA 3FBTA 4QX6A 1HYEA 4INAA 1AN9A 4WEQA 4CV1A 4I5DA 4CMJA 3FR7A 5L53A 4KTVE 4A5OA 1GQQA 3DZKA 5DOZA 3FD8A 3MJ4A 5JLAA 5CDTA 4J0FA 1PL8A 2CY0A 1W73A 1Z74A 2DBVO 4JX8A 3PTZA 2J3JA 3ITDA 4DXHA 5KJ6A 3DZHA 4YBZA 1X0XA 4HUJA 3GGGA 1ISGA 1U1IA 5CG2A 1EE9A 1W4ZA 1AHHA 3TF5A 3K8ZA 4BGEA 4YXFA 4NJMA 4PG4A 3DOJA 3GGOA 1XCBA 1NQTA 5JYDA 3H9JA 1RWBA 3RU9A 1WLYA 3PGJA 2GDZA 1DEHA 1R4MA 5TQVA 3L4SO 3JQCA 4TKMA 4EUEA 1ZK3A 3KYDB 1GD1O 1XKQA 3P2OA 4RJTA 3TOZA 5I8WA 3GGPA 3VTZA 1E6EA 4O59O 2VNSA 1GQYA 1I3MA 1XQ6A 3FTNA 3AFMA 4CUKA 3V2UA 5DCWA 4N54A 1GDHA 2ILTA 3D7LA 4L76A 1Y8RA 4GL4A 3L07A 5T8KC 1E5LA 5CPFA 5FYDA 4F6CA 2HMWA 4DWVA 3K92A 1LLQA 5I7EA 3KVOA 2R00C 5BNFA 1LQTA 4ALLA 2PTGA 2WDZA 2Q1WA 1H6CA 3W6ZA 1SMKA 3OA2A 5B12A 4OKIA 3RC9A 2GYYA 1E92A 1XDWA 1T4BA 2QZZA 2Z5LA 3E8XA 3VPSA 3KYDA 3Q6IA 4BKRA 1C3VA 2PZMA 4D0RA 4BO7A 4TROA 4DQVA 3GN2A 4HADA 2Y99A 1C1DA 2Q4EA 4W9NA 1ZK2A 4WLOA 4RZIA 5KCZA 2JCYA 3H9GA 3WGTA 1DRUA 1NNUA 2OFPA 2JHGA 3RD5A 2EJVA 3CKYA 2NM0A 3U4DA 2E82A 4IJVA 2I6TA 1PEDA 4MIEA 4J16A 1QLHA 3E5RA 1E7YA 4L4XA 2DBZA 1A7KA 4GAEA 4ZVVA 5A04A 3H4VA 1K6JA 4EITA 4K6FA 1Y5RA 4YQYA 4UULA 1PTJA 2OHXA 4H3VA 2H63A 4FQ8A 4D0SA 1XEAA 4TSKA 2GR9A 4M8SA 1ZK0A 4CMKA 2C59A 2ZK7A 2Q2WA 4AG3A 4MIYA 1R6DA 4H16A 3GZNB 1GPJA 3QLJA 4J2HA 5A05A 3RUEA 1YDWA 3QHAA 2JHFA 1PGJA 4YJGB 1SAYA 1XELA 2J3IA 2VOEA 1SPXA 4XA8A 4YAEA 1B7GO 1DIBA 1JAXA 1LC0A 1MP0A 1UP4A 1WZEA 1YOVB 3GDFA 3HDJA 3LT4A 3OIDA 3UW3A 3ZV4A 5C3MA 1WDMA 3K6JA 3H3FA 3SJ7A 2V7PA 1QKIA 4Y8VA 2ZYAA 3I4CA 3RJ5A 4AJPA 3Q2IA 4BO2A 3JQAA 3KSDO 1KVRA 2OXIA 2AQ8A 5KOIA 1M6WA 2JD2A 3AOEC 3S2IA 3I83A 3ZCXA 4CLOA 3E48A 2IZZA 2Q1UA 4J6FA 4QFCA 5CAEA 5KWEA 1X15A 4J3FA 4XYMA 3QJ5A 5JDIA 1KC3A 5F21A 3STHA 5C7IO 4DIOA 3IUPA 3LK7A 2DVMA 2RH4A 3Q0EA 4HFJA 3T4EA 1M2WA 9LDTA 4BKOA 3OH8A 3PIDA 4XCVA 2BI7A 4B7UA 1WP4A 1WDLA 3N58A 4P8RA 1UZNA 1XU9A 2GD1O 1F8FA 5TJHA 4XQ9A 5ENDA 2NVUA 4CMIB 2XAAA 1IULA 3PZRA 3RUAA 3E9QA 4ZGWA 4IDFA 1NXQA 1QR6A 1P1IA 2JFHA 4Y9DA 1PIWA 1V6AA 4EI2A 3RC1A 1LX6A 1A72A 3WNVA 4FJ1A 4FB5A 2GN4A 1ZH8A 1LU9A 3WLFA 3S2GA 1PJTA 3UICA 3WGOA 5A5EA 3GZ4A 3DONA 1T2FA 4XYGA 4E13A 1D8AA 4IIUA 4U0KA 3CUKA 3TFQA 4MVJD 1ZW1A 2GASA 3OJ0A 3B1JA 3OBBA 5FFFA 3MJTA 4B8ZA 1E1LA 4XIYA 3ZHZA 2X6TA 3DTYA 2I67A 3IS3A 1LRJA 1JN0A 2NSDA 1VC2A 1T26A 2O48X 3WFIA 4BNNA 4EBFA 4Z3KA 3DBRB 3NT5A 3OECA 1U4OA 3AUSA 4KUHA 3ROPA 4WCFA 2NNLD 4L73A 3FWNA 5L4NA 1UXKA 1GYPA 4RVHA 3RAJA 1HZZA 2QIOA 4BNKA 4DC0A 1RM5A 4NFYA 3PVZA 4XQEA 3GQVA 1X7HA 3NGXA 4NNJA 4AFNA 3JD3A 2Q46A 4RVSA 1T2EA 4AJIA 1T2CA 3DBRA 1CEQA 2DPGA 4XDZA 2ZB4A 1H5QA 4HX5A 2I65A 2FSSA 2VHWA 5A4DA 2ZTLA 1DOHA 1SOWA 1NPYA 3ETEA 3KETA 3BHIA 2WTBA 2ZJ0A 3GVCA 4WECA 1F12A 3AUAA 1ULSA 2E4AA 3V1UA 4DQUA 3AUUA 1KEWA 3QVWA 4Y6PA 1PL6A 2Y0CA 1GR0A 4NJOA 3ENNA 5DF1A 3F9IA 3PWSA 4RPKA 2DLDA 3V2GA 3EW7A 3LC2O 5JS6A 3VPFA 3I1JA 1LXCA 2ZCUA 2CVZA 3D5TA 3NDJA 4WK6A 3UF0A 2FWMX 4PVCA 3GNSA 2EGHA 3JQ9C 2VYNA 2Y68A 4J7CA 1E7RA 1U28A 4P4NA 4BQRA 1KYQA 1GPDG 4BOYA 1Y6JA 1BXKA 4UUOA 1PL7A 3IJPA 3TL3A 1UXGA 1KY5A 1KVQA 4WCFC 1HDYA 4HFMA 1F06A 1MB4A 5A06A 1EFKA 1VJ0A 1F14A 4TRMA 2Y1FA 3OEYA 4J1NA 4CL8A 3LF1A 2G76A 4PVDA 2BI8A 3QV1A 3KEOA 5IDYA 4AJHA 1K5HA 3ZI0A 2B4TO 3AU8A 2OO5A 2Y93A 4A73A 5IDWA 2ZYGA 1DPGA 1HEUA 3EY4A 2AE2A 1I30A 4GMFA 1ISFA 3I9KA 1KETA 3DFUA 4NZ9A 4XR9A 3HN2A 2UV8A 2I99A 5I7VA 5JDCC 3NRCA 1CERA 3BIOA 1NPTO 4LRTB 4QFDA 2ZB3A 4O63O 1IY8A 1E7SA 3E03A 3F6YA 3NAQA 4WNIA 3WIDA 4QO8A 1NHGA 4S1VA 3M1LA 1VKNA 2HKIA 3RUHA 4RQUA 3DFZA 1D1TA 5T64A 5C7OO 3L77A 1DRWA 5DOVA 5MGBA 3INTA 1M66A 3PZBA 2RIRA 3ZWBA 3CSDA 5F5LA 4XYBA 3PFFA 3TZHA 3L4BA 3C7AA 4NU6A 5BSGA 4PGFA 1GUFA 1I32A 3AM4A 2HK7A 4OL9A 1EVZA 1KEPA 4RF4A 5GMOA 2P68A 5DP1A 3ZNPA 1B16A 1PJCA 1T2DA 1O9BA 4ILKA 5IDQA 1PJLA 1B26A 4FFMA 2D4AA 2YW9A 1NHWA 4EJMA 1N1EA 1E3WA 4NFHA 1M67A 4UEKA 5ICMA 1Q7BA 3ZN2A 4DYDA 4CM9D 5K0ZA 2PKQO 2W2KB 4BNMA 1LLDA 3BTOA 4OM8A 1JKIA 1WWKA 2GF2A 3WQQA 4E5MA 3WDSA 3PPIA 3VPHA 5IJZA 4R41A 2NVUB 3VC7A 4J2OA 2DQ4A 3PHJA 4GSKA 5L45A 4FDAA 4NI5A 4EZBA 4GGOA 3B20A 6LDHA 1LLCA 3VH1A 1DHTA 1J49A 2PGDA 4U5QA 1O6ZA 5GY7A 3TZKA 3K31A 4BNVA 4UEJA 1N5DA 3JQFC 3EUWA 3DMTA 3VZRA 5I9LA 2C20A 2IODA 4YJHA 4D45A 3CZRA 2EKPA 3UCEA 4DMLA 2HSDA 2PH5A 4BMVA 4HP8A 2BFOA 3CE6A 4PZEA 5EERA 4GKVA 4ND3A 1D7OA 4GGPA 1T4DA 3BTVA 3TWOA 4BO4A 1CF2O 5TF4A 4GX2A 1Z7EA 3JQ6A 4AJEA 1R4NA 4XD2A 3RC7A 5BNIA 5ITWA 4TRRA 3F5SA 4Z6KA 5IZ4A 3PHLA 2BHLA 2QG4A 4RVDA 5TT1A 1Q7CA 1WW8A 2Y1DA 4KWIA 4H7PA 4LVUA 4EUHA 4CV2A 4AJNA 4RF2A 3ENKA 2GO1A 2O3SA 3GEGA 3SLGA 5B4VA 4KMSA 4MVJE 5BNTA 4E5YA 2HDHA 3PYMA 1ONPA 3M2TA 2FR8A 3FTPA 4IBOA 4Q3BA 2J5KA 5T5QA 1X0VA 2IEBA 1H6DA 1LRKA 4RGBA 1E77A 4CLRB 3GAZA 1EVJA 3DMTC 3RROA 2PLAA 4IDGA 2X0RA 3BMCB 3NTOA 1BVUA 1RPNA 3RKUA 4Q3DA 4FOSA 4R68A 5KNLA 3G0OA 2AG8A 1Q7GA 4DQXA 1NR7A 2FRDA 3EVTA 2E49A 2Q2QA 4R3WA 3R1IA 1T25A 1YQDA 3DL2A 5DDIP 5C37A 1PJQA 3AY7A 1EQ2A 1YXMA 1UDBA 2E37A 1Y9AA 2FOIA 3AW9A 4EEXA 3ANNA 5COBA 4BGVA 1PGPA 4JGBA 5CHEA 1B2LA 1N9GB 1L7DA 1QXSA 1MX3A 2E6UX 4M1QA 4MVJF 3ROQA 4PLWA 3RVDA 3UAGA 4PG7A 1A5ZA 2NU8A 1KEUA 1QYXA 5FF9A 3WSVA 4KTTE 2GN9A 1EUZA 1JTVA 3I9JA 2WD8A 4CQMB 5F1KA 2ZB7A 3FF4A 4FPXA 4PRKA 3LQFA 4YA6A 3W1VA 1OC2A 4LRSB 4MINA 1G0NA 3JSAA 3RFVA 2YJZA 5K9ZA 2X0IA 4IDBA 4TZTA 3ONDA 3DBLB 4MP3A 1I2CA 1I2ZA 1TI7A 4UVDA 3KHUA 4P22A 4BO3A 5CG1A 1DAOA 4ND1A 1C14A 2O7QA 1BHSA 1LJ8A 3NKLA 2PD6A 1HSOA 3ETDA 4RZHA 5HM8A 5AQ1A 4I08A 4WJZA 4ND5A 5B4UA 5K6AC 2YZ7A 4CPDA 5TGDA 1K3TA 2O23A 2C2YA 3RSHA 3MEQA 2EKLA 3O8QB 1VJTA 1UH5A 1D1SA 4BV9A 3RU7A 2YDYA 2FMUA 2POQX 3VDRA 2VN8A 1I36A 2C0CA 2JAHA 2YFHA 1R16A 4OXNA 1UP7A 1FDUA 1WDKA 1ULUA 1JU9A 5HS6A 3H9QA 3G1UA 2FN7A 2IEDA 3IP3A 3L6DA 5L3ZA 4JBGA 3X2EA 1RM4A 2PGJA 4OYRA 4M87A 1GCOA 5THKA 4BNLA 2VYVA 4Q3AA 2WM3A 5KJFA 3JQEA 1K89A 2XOXA 1H94A 1B8UA 1YRLA 1PGQA 4GX1A 5THQA 4DBVO 1EMDA 5T67A 1PQUA 4WGGA 1XSEA 3ZWNA 2I76A 4ZQGA 5T8KA 3ZU5A 1P45A 4GWGA 4WOKA 1ZSVA 4J1SA 5TSDA 1IB6A 1XR3A 1YONA 2O4UX 2WYUA 1WZIA 3HB4X 1P9LA 5AXDA 3VKUA 7ADHA 1YH3A 2HRZA 1B3BA 3BZUA 4CMCA 4E33A 4EJ6A 4WLFA 3BMOB 1N7GA 3OA0A 4HBGA 1PZEA 2NLOA 2PD4A 4OQZA 3L4BC 1DFGA 2EW8A 3SLKA 3GMDA 2FZEA 4W4TA 2BFAA 5ER6A 3H7AA 3ICPA 3ZNOA 3EC7A 1HYHA 4OIMA 3KRTA 4CLXA 1GQ2A 4IZHA 4XX0A 3EYWA 2NU6A 1GEEA 4WUVA 2PNFA 1Q0QA 5U1PA 4R01A 2X1HA 3KO8A 1VPDA 3WWZA 1HDOA 1JVSA 7MDHA 2EW2A 5IG2A 3M2PA 3WMXA 3WQSB 1HDZA 1C1XA 3C85A 3WYCA 2AEFA 5JBIA 4I1IA 3QE3A 3IL2A 1QG6A 5I8ZA 2PR2A 1ZCJA 3TFOA 1DB3A 4N7RA 4B8WA 3ROKA 1DIAA 4ND2A 2J5RA 3WBBA 4L8VA 2H9IA 1FDSA 2O7SA 4D3FA 2HQ1A 4ALNA 1C1XB 3INGA 1P77A 4A0SA 2QW8A 3SXPA 4BO0A 1FDVA 2B5WA 4CMHA 3G17A 1NM5A 4U6QA 3PLNA 5KJEA 4DVJA 2W2LA 3GRKA 4OSPA 1ID1A 4M49A 4Z9YA 2DT5A 3QWIA 5AOVA 5JNLA 2A9FA 3PGXA 2GZ2A 3C1TA 4YDRA 3BMQB 4YJHB 4F46A 5TT0A 3GLQA 3N7UA 4NBTA 1YVEI 2XXJA 3ZU2A 1HETA 3O4RA 2BKAA 4JBIA 4WLNA 5JMWA 4XGKA 3H9EO 4IDCA 4N5LA 4J43A 5ILGA 1XQ1A 4CR6A 1ONNA 1EDOA 1R4NB 4JJIA 1LUAA 2VRCA 3OJOA 1BDMA 2A94A 4HFNA 3N74A 2EIHA 1F8GA 1YB1A 4BQPA 2DPHA 1MC5A 3KTDA 2B0JA 3JYPA 4E3ZA 2QX7A 4QXMA 3W8FA 1BSVA 3JCZA 3NT4A 3PWZA 3MTJA 1JKFA 3PQEA 3GY0A 2Q50A 3JD4A 3LC1O 2W4QA 4CMEA 1ZBQA 2HMTA 1HRDA 3D1LA 3H2ZA 1H2BA 3LDHA 4CMEC 1R0KA 1J4AA 1P1RA 4CODB 2IZ0A 2DAPA 3MJCA 1WNTA 1P0CA 3K2EA 3B1KA 4IY1A 4ZA2A 3K30A 1YS4A 4F3YA 1I33A 4QECA 4K9DA 3FNGA 4IDDA 1JW9B 1MUUA 4HNHA 2IDZA 1EDZA 1MLDA 3R3SA 1GZ3A 4DIBA 2YUTA 1SC6A 4BL5A 2PK3A 3PK0A 3FNFA 2X9VA 1S7CA 1OZAA 4I5FA 5L51A 4BO8A 4WE3A 2P91A 1E3LA 3JYOA 3WLEA 1GTMA 1ONOA 3VH4A 1W8DA 4AJLA 3UOGA 5IDXA 3IMFA 3WBFA 3AWDA 2DUWA 4Q3CA 5TNXA 5BQFA 3RI3A 1U3VA 5KTKA 3PJGA 1N9GA 4DYVA 3HUDA 3VZPA 4JIGA 3CMCO 2GZ1A 4RPHA 4EDFA 3HQ4O 4NBVA 1FXSA 2E48A 3OICA 5DBGA 5A9SA 1H0KA 2PZKA 3LF2A 1HSZA 3ZZNA 3RFXA 3DZBA 1U9JA 2OBNA 2WSBA 4W99A 4X54A 1DFIA 2VOJA 4ZQHA 3H6KA 2PZJA 3GRPA 3ZW9A 3BTUA 3VDQA 2QRLA 4PLYA 2AE1A 4FR5A 4DTIA 4GVLA 3OJEA 3HNPA 2D8AA 4UUNA 1GFSA 1CWUA 2NQTA 4Q3EA 1Z73A 2YDXA 1GV1A 4OJNA 3ZH2A 5KJ1A 3EZLA 3IJRA 1PJ4A 4J9UE 5JC8A 1P1HA 4QQRA 1HE3A 1YL7A 2O50A 5COAA 1WXDA 1BDBA 4CM4B 1Q0LA 2Q1SA 5A1TA 2G1UA 1ZEJA 5KVQA 1P74A 5LDHA 2WD7B 4OH1A 1DLJA 3DOOA 3OJFA 4XQGA 3WX0A 4BMNA 3AK4A 1RKXA 2J3HA 3PXXA 2Y66A 3OFSA 4PLCA 5EIOA 1C0IA 2PGLA 1YBMA 2C7GA 2Q4BA 2VWPA 4PLFA 5L95A 4OOEA 5I9NA 3FNEA 4J4HA 4MO2A 3ZWOA 3NGLA 4K28A 4XZ3A 4DC1A 3GG9A 4DL9A 1J6UA 2NQ8A 2ZQYA 4CLOB 2YHUA 3TNLA 2GZ3A 4ROSA 2X5OA 1EUCA 2O2SA 4J4BA 4JROA 1E6WA 2ZTVA 4NK4A 4DLBA 3ZU4A 1NYTA 5HTOA 2D3TA 1DLIA 4DRYA 4OOFA 4DMMA 2IXAA 1UAYA 4GPD1 1Y8QB 3FNHA 4FC7A 1PGOA 3GEDA 3H2SA 1EK6A 1W6UA 2VZ8A 2UUOA 4BB6A 1E3EA 2GN6A 2VCYA 1UDAA 5I9MA 3PYXA 4JK3A 4AJKA 4RLHA 4MJLA 1ZIDA 5IXSA 1HWYA 3D4PA 5I7FA 3GVHA 1E3SA 2P5YA 3I52A 3I9MA 2AEMA 3WS7A 1JAYA 2CVOA 5A9TA 2O3UA 2WEKA 3D64A 1MG0A 1GCUA 3OSUA 4WCDA 1DSSG 1EVIA 5AXBA 4ALIA 5GZ1A 3ZDFA 1O8CA 3ZGYA 1DIGA 4NBRA 4D3SA 3EHEA 4TZKA 3GH3A 3WOHA 3PDUA 1NFRA 1N92A 1NQOA 4YJFA 1GU7A 1FJHA 1Y5MA 1CDOA 4BUCA 4DGSA 2I66A 4FJ2A 3GUYA 5DCUA 5C7LO 3T4XA 4IM7A 2C82A 1NVGA 4UAGA 2CF6A 4LW8A 2Q99A 2AQKA 2GCGA 3E9NA 3OMLA 4BB5A 3I5MA 4C7KA 5U9CA 2YQ5A 1P3DA 3PRJA 3OIFA 4D3DA 3WMWA 4CQMD 4PZCA 1T1RA 3G79A 5HA5A 4BMSA 1C0PA 1Q2XA 1ZK4A 1AGNA 2PKRA 1LDEA 3FN4A 2Y0EA 4FD3A 4U0JA 4BO5A 1FK8A 3F47A 4GLLA 3F4LA 3BMCA 1ADCA 3ANLA 3JYLA 1A9ZA 4IDAA 2EP5A 3WR5A 2X86A 3IOYA 5MDHA 3OQ1A 1YO6A 2IZ1A 4JBHA 1VL0A
chains in the Genus database with same CATH superfamily
1WUTA 4DG5A 3GLHA 3H8VA 4A1OA 4GXNA 3HDYA 3OP4A 1DV1A 3V5NA 4XIJA 3IAM1 4CDNA 5FLYA 1BJRE 5JMOA 2QX4A 2O2YA 5TS2A 3RNLA 2C7VA 3M34A 3FYHA 4R4JA 5JNUA 2P67A 1KBQA 2VQ6A 2WI8A 4B7ZA 5ALLA 3VNAA 4ZU3A 4KFRA 3VMFA 3BHJA 4RD6A 1IEWA 2NTVA 4QXRA 5BSWA 2HV9A 2VDPB 2ZSBA 3NI2A 2LTAA 5KOJA 1TF5A 3BE4A 3F9CA 3KEFA 5J40A 1JDPA 1TB4A 4EHKA 4RHCA 3GVPA 4HMOA 3BCUA 4YRPA 4Z4CA 4R1UA 4W8OA 1XMSA 2K2QB 1SEPA 3IUYA 1T43A 3X1KA 1WCIA 4K6HA 3RJ9A 4C4YA 5KYTA 1E1RA 1RHMA 2ZPTX 1Z6XA 2IHVA 4E6EA 5EHZA 5EXTA 2ECKA 2JRLA 1DUSA 3LHKA 4G26A 1XZGA 4GZMA 3LGXA 3N3BC 3DVRX 3EXEA 2C2KA 3ZVLA 1FFWA 3SQNA 1S5PA 3ADPA 2GJSA 3GPDG 3I9NA 2H2WA 2RGUA 2J0UA 3RS8A 3GLIA 5C8ZA 5I7HA 1ZDMA 3EQ8A 3GFGA 3OETA 2PQMA 3IIMA 3EWNA 4FCCA 2VP4A 5DGCA 5P8WA 1P2VA 2AL7A 3SEAA 1KK2A 1EA5A 5GINE 2GXAA 1CV2A 1ECLA 1GGFA 3BXXA 3HEAA 4ONEA 2B20A 4WNAB 3ZDEA 4EEKA 1NWHA 4B6QA 1G6HA 4QG3A 3TTYA 1RC1A 2Y05A 3ZXIA 3WGGA 4PPYA 5EOVA 2XGMA 3ICEA 3E9CA 1Z26A 5CHYA 4BE4A 1MAUA 1E3IA 3ZQJA 2QXYA 5CA0F 1OAAA 2B5VA 4JVOA 2BMDA 2XOEA 2Y6VA 4KIJA 5K0EA 1OD6A 2AI2A 3LZ6A 2OAEA 3S28A 1ZIPA 1YCFA 4D43A 4E32A 2IE8A 2YQ4A 2ZSFA 4WN9B 4N8EA 5BV0A 4M98A 1KYTA 4JYPA 3RWMB 3WGLA 2NXWA 4B4OA 4LPSA 3EZGA 2JKZA 4TMWA 4JA0A 5ER9A 4B31A 3SFTA 3KS9A 3TJRA 5H81A 3VR5D 1X86B 2H29A 1VMKA 3S2SA 3ZHOA 1GGVA 2EZUA 2VPYA 5KHAA 4EB8A 4OLAA 2B35A 3HYSA 4RA9A 3MGBA 1WBJB 2H65A 4GBMA 1RJWA 4TMVA 2FGJA 5CD9A 2GILA 3SZUA 1YUNA 4ZAVA 2ZAYA 4YQEA 1LF0A 4OGGA 3K94A 1J99A 2V4MA 4AICA 3FFWA 2P65A 4PLHA 3SM3A 1TCBA 4RIEA 2UAGA 1OOEA 1ZAKA 2M32A 3FCEA 2QAJA 3UT0A 4M0FA 3CMMA 3D6VA 5FI3A 4L5IA 4FW9A 1E8MA 4KSBA 2FCAA 3HYTA 3ONWA 5KTYA 1IQRA 1GGEA 4PTYA 4KQCA 2J1LA 2VO1A 3HRKA 5IC4A 4RW0A 3AINA 4DCTA 1BQ4A 5F78A 3RJMA 3JQFA 1AGYA 4R40A 4FJ0A 1YGYA 1UBJS 4PIMA 5LQNA 1UOOA 5DYTA 2DC1A 4L57A 1G5FA 4BZQA 1P0FA 1EH5A 2ZE6A 4WXPA 1BGVA 3CIFA 1L7AA 1U7TA 3FHJA 5F2NA 3DUFA 2EFHB 1A8IA 1JV2B 4EB3A 4OMDA 1AS0A 2LDBA 5G4KB 2V6FA 3K15A 5I7SA 4H3SA 1IMJA 1P2BA 2JA1A 3LGSA 3QVSA 4CCSA 4Z49A 3EIUA 1Y42X 3B6JA 4K3UA 1JPVA 3D8BA 2OENG 1QMGA 1U65A 1ZSYA 2ZJOA 3LPLA 4D8VA 3NTQA 3WXMA 1WCIB 4J0HA 4BNFA 1ZNYA 5J59A 3A06A 2I4TA 3QELB 4G5OA 4TWAA 5JNSA 3SBDA 2WMOB 3LVBA 1HZJA 1LFAA 4LOKA 4UXHA 4DCMA 1A9TA 1S3FA 4C0QC 1V16A 2B1IA 1XBTA 1ZICA 1PR4A 4EPXA 3D5QA 4HX9A 2M2IA 4I5EA 2P2SA 4QTTB 5EMKA 4BO6A 2RC6A 2W2PA 5JIBA 3KDSE 3I8OA 4C04A 3B38A 2O14A 3IIKA 4FXPA 4C3VA 2HX1A 1B0AA 4CR8A 3HWX1 1BU8A 4GU5A 3M33A 2FSIA 4MVYA 4GL2A 2XUAA 2AOXA 1YE8A 2VNAA 4H18A 3AC0A 3HR7A 3QG1A 3ZDAA 4J1QA 3EG9B 3TIXB 1RM3A 3AVTA 1KK3A 5A5GA 1FDRA 1XMJA 2PWAA 1TQ8A 3PX7A 1KPHA 2I4RA 4NHEA 1IRXA 2DPMA 3WA7A 1BA3A 2E21A 4MVJM 1LJUA 2V7VA 2QRJA 4FIDA 4B6JA 3PC6A 4F2GA 1Q3KA 1ODJA 2BKEA 3T3HA 3UFBA 2C9CA 4EVQA 1JQDA 3FUXA 4RV5A 3H6GA 3CUEF 3C3DA 1AQ6A 2PUJA 1J5XA 3IUNA 5JJ5A 1N2XA 1I2BA 2J7PD 4R2MA 3H11B 3NW9A 2BF7A 2EFYA 4MV7A 2Q3HA 3FDIA 1UKEA 1KI3A 3ADDA 1V0JA 2GD0A 3BXPA 3D3WB 3JD0A 4TUYA 3CY6A 2VYND 3U4AA 3KYJB 3TNDA 1XPRA 1HQKA 3GH1A 3R09A 3IVCA 2OL4A 1HUQA 4BEJA 2C8JA 2G06A 4MMXB 4RDHA 2OPHA 4YYEA 4V3BA 3FI9A 3U3KA 2LZ0A 3CN7A 3ZJ4A 2AUTA 1JWBB 3R5JA 1JHUA 3HL4A 1R0XA 3LFTA 1GZ4A 1VI2A 2RGYA 2Y1KA 5E6SA 1JI3A 4LXQA 621PA 5IX8A 4LS3A 3W3AD 1N3YA 1LBEA 3UGKA 3NGMA 1SN7A 4ZEXA 2BMWA 4HPWA 1S2DA 3NB0A 4TTTS 1BS1A 1L7RA 1UP6A 3DBOB 3JTEA 2VPZA 4EHDA 4BVGA 2JFNA 2VP5A 3UPDA 3DB2A 1YF3A 4KE6A 2JL1A 1K7CA 3JQGB 3W7BA 5BW8A 4X9XA 4X6UA 3OCZA 1ML4A 3DUFB 4R9NA 2GEUA 4CKYA 3K1ZA 3MT7A 1II9A 4TRJA 5KMGB 3W5CA 5JJIA 1M1YE 1Z5PA 2XXBA 2BGGA 1G18A 2ONKA 4G5FA 3DZJA 4L28A 3QX7A 3W79A 1P33A 4AURA 5ICCA 2RGRA 3K0CA 1EWQA 5F3RA 4NCNA 1NTRA 3F73A 3HHEA 3TLEA 2QRQA 4GC9A 4ZAWA 2OYRA 3FRJA 1A50B 3KUXA 5FNZA 4YPOA 1IM5A 1FYXA 2EQ5A 2P3LA 3CPEA 3CRQA 4RANA 4C0SA 3WKBA 3RC8A 2XDQB 1QM5A 2ZJ3A 3LX8A 4JX9A 1AKWA 1SQSA 4D9FA 5AW1A 1C7FA 4HS9A 3SHOA 2PS0A 3U7FB 1RAEA 5LZ5A 4QAQA 3FHTA 3HUEA 4URXR 3L5KA 1YB2A 4AN4A 4F4DA 3FSEA 4H7JA 3A2MA 3UWDA 2D1YA 1G19A 4EA7A 3AF1A 4ZYWA 4X60A 4RTPA 3DEYX 2QR3A 2FX5A 4NYJR 2P6PA 4I0WB 2RFLA 1O6CA 3NAZA 5IK2A 2YOHA 5M7EA 3O2SB 1PZFA 3WI7A 1W4RA 5TLSA 1PK9A 3K9QO 3WV4A 4L85A 2D2IA 2OOSA 4YHHB 2OHFA 2BEKA 5BSTA 1H1LA 3VBEA 2IKSA 1QG0A 1QFXA 2RHWA 2HMVA 5CNJA 2RD2A 1SRQA 4C4SA 1XQWA 1DG1G 1YRWA 1OFIA 3DPSA 2FR1A 3H87A 4HPXB 4X3PA 3VXKA 1QHNA 2IYPA 1SZDA 3FMPB 5LZ2A 1IG3A 1PG0A 2V5VA 3FRIA 3N0XA 5SY4A 1ZS9A 2BFMA 1LVGA 4GI5A 4UE6A 2FSUA 3IHKA 3O8DA 3VR2D 4ZO6A 5J2TA 2YN4A 5CUQA 1TYZA 2CZCA 3RUCA 4BPBA 2YRXA 3H9BA 4DNXA 1YAJA 1LDMA 2BZ1A 2H2GA 2XH8A 4W5OA 3EG9A 2M1ZA 1Z4MA 4XWTA 1E0JA 3VOSA 4HNTA 2HC9A 1JTFA 1S6YA 2D2XA 3AJDA 1ARZA 3EFBA 4N8SA 2X14A 4RGQA 5BOSB 3KB2A 4HYQA 4TXMA 2X1MA 3VAYA 1H9BA 3K35A 3P0IA 3PQ7A 3UUWA 4G5RA 2ZSHA 4G8DA 1FMFA 1PSDA 4E21A 1EHIA 4C2BA 4TQGA 5EXPA 3P0HA 2ZI3A 1CEYA 4RV4A 1Q3HA 1E4YA 4CCYB 2GVZC 4JWTA 3AMVA 2GJAA 4V2UA 3W2IA 2VHVA 4AO6A 3F6PA 3HJCA 3K1YA 2FPIA 3IMKA 5F1PA 2RCYA 3QVLA 2IUFA 1LRLA 2CUTA 4PPQA 4XUEA 1Z12A 3ZDXB 1BVRA 1NNSA 3LRXA 3O8BA 2X9NA 3RBXA 3UHAA 1DEOA 5JQGA 2X7HA 2JZOA 1N7IA 4JSRA 5B57C 3O84A 4ZICA 4YAFA 5IWAB 1J5EB 2IRWA 3RRZA 1KWGA 3OQBA 3A4LA 2MYNA 1NVTA 2X23A 3UGQA 1WDWB 4RJJA 1A7AA 4ON9A 3B3JA 3ZWQA 4KSCA 3TQIA 2AA3A 3NEAA 4AKEA 2YY6A 4CMBA 4ITVA 2RG7A 1UBSB 3X1ZA 3TNJA 1PD0A 1TW2A 4U2CA 2A5DA 1T5IA 5AW5A 3A1SA 2UUPA 5LDDC 4B3BA 5DW0A 1T9KA 3HB7A 2YV1A 3RQSA 1J2TA 2RK6A 5JZVA 3HKDB 1CUZA 5JHHB 5JWRA 5DULA 1Y33E 4DTCA 2DUMA 1NKVA 3MERA 1OFVA 2QP4A 1HURA 4HDKA 1XZMA 3ASUA 4OXKA 5D8DA 3UJ7A 4Z4QA 1CQIA 1NW5A 2W90A 3NOQA 1IL0A 5IAJA 3Q7RA 1SB9A 1AS3A 2C29D 3JATA 2FMFA 1CY4A 1CT9A 3C8MA 3NEPX 4JLJA 1B8VA 5TEWA 3GT0A 2GM5A 4KLRA 4BRSA 3CVVA 2I5PO 1ZA1A 2ZBPA 1WSDA 4JEUA 4PN3A 2QM7A 3O8CA 1TLTA 2HRBA 2HRQA 2TMDA 1IHOA 2EL7A 3LLCA 3AF4A 2ONZA 2HSJA 3K2IA 1U9ZA 2ZSJA 3PVCA 3I39X 3A6EA 4AJ4A 1HXHA 4F71A 3JAWB 3ZE8A 1CIVA 4XKJA 1JECA 2G9VA 1DJOA 2HCBA 4H2DA 2P9EA 1ILWA 5GJWC 3WJAA 1VG1A 3ET4A 4GYKA 2FV8A 1QJ4A 1FTWA 5HKBA 1CNEA 3KYIB 1VJ5A 1K8RA 1I3LA 4IO0A 4WX2B 2E9SA 5GVSA 5IT0A 2H1OA 4ZAYA 1B00A 1FZQA 3MW8A 1THGA 4DLAA 4G67A 2WP8J 3MJVA 1PR6A 4LBWA 4J3NA 3EGDB 4YI3A 3W4JA 4BNYA 4BWFB 3QE2A 1TMGE 1F2VA 3A1VA 3S3TA 2C77A 1O95D 2VT3A 2HMUA 2XE7A 4KBGA 1ZD2P 4NULA 4BWGA 5CFMA 4LGYA 3LECA 3L6OO 4G8JA 3VKWA 4G24A 3OAAD 4OHUA 3TD9A 2J5XA 1UXJA 1PWHA 3HVIA 4EK9A 1ZVKA 3WIOA 2I7CA 3OFJA 2H9YA 4R2KA 3DVLA 4YP5A 2ZAOA 3VKVA 2WU3A 3MINB 1QQAA 2HYIC 1ZP6A 2FUKA 4CM9A 4AS1A 4JNKA 1NF3A 3HCFA 5FR1A 3CISA 1RAIA 4YCAA 2X0NA 3OAAA 4ZEMA 3Q7QA 2W6OA 5HKKD 2J0EA 3STTA 2C9MA 1BOOA 4YVFA 3BD9A 4YT8A 5CDUA 4P3KA 1JQJC 1YRAA 3B2NA 3COJA 2JEZA 1N2SA 2NU6B 1CQPA 4TMFA 4ZVPA 3AZPA 1X87A 3CE9A 3I42A 1NW7A 5D3KA 3UJ9A 3EZNA 3L6UA 4C7VA 2JS7A 4UOEA 1A9XB 3SWWA 1C1DB 2N75A 3FOWA 5I4KA 3GRUA 2X7XA 3SQWA 2BYTA 1FCJA 1FP6A 3KXKA 1E2PA 3MTAA 1H65A 4REQB 3ZHQA 1N36B 4Q7KA 1IXKA 2YC2C 2ZDHA 1SQFA 3GA5A 2VA9A 3H1TA 4D3YA 4KXXA 3EAFA 3I0MA 4IDHA 5CURA 3KJFA 5F4ZA 3HN7A 1B2RA 1ULBA 2OCYC 3E58A 1EBUA 3OY7A 4QDZA 1OLSB 4KN6A 4Q1BA 1V4NA 1GG2A 3LT2A 1BMDA 5CFZA 4PZYA 2ZJ2A 3RVSA 5BR8B 2V65A 3BWEA 2PH3A 1JE0A 1SK8A 3OF3A 3ZWYA 3VVLA 4U7FA 1Q77A 5HIJA 5B53A 3WDMA 2XSZA 4DQKA 2WWXA 3JQRA 3G2JA 4M53A 4PM4A 1G6Q1 3ZLBA 5DTIA 3L8MA 3OZFA 3AP2A 2J48A 4KDEA 2R9VA 4W5JA 1TQ2A 5DTJA 3WIVA 4CJXA 1C2YA 1DEAA 2HBQA 1Z34A 1U0GA 3KYCA 5H3LA 4B46A 2EJBA 3WB0A 1Z2PX 3L6RA 1CJCA 1R6AA 2CXRA 3HFRA 2HIMA 1FBNA 3GOHA 5DK6A 2QTZA 2FSGA 1Y6ZA 3WYEA 4EELA 4PGAA 3PD7A 1G1AA 2QYOA 3BL8A 3DAFA 4JS0A 1SIOA 2V97A 3DHEA 1GPWB 3AJRA 4BAGA 3VVBA 3L40A 4B0PA 3HSYA 5B2ZA 2AFVA 1U28C 2FP3A 3LX6A 4FHGA 4L8YA 3ZDBA 3IEPA 1RRKA 3PDIA 4A10A 4G07A 1LDYA 1WDTA 4U1RA 1CK4A 2C1ZA 1PR5A 3DT8A 4F4CA 2JFXA 5LC1A 1FDIA 4QT0A 1TC1A 4Y67A 4JEHA 4HXEB 5JJBA 4L4SA 4OD0A 1RC0A 3HCEA 4KFSA 4OGWA 3ZOZA 2WYWA 3UJ6A 2GAOA 4IVNA 1K4KA 1Q91A 2GJKA 1X7WA 3GC6A 3EASA 4NYIQ 5F2OA 3I8SA 2HR1A 1YR6A 3HXOA 5AJXA 4HG2A 2H4XA 3LJKA 1BYIA 2R8PA 3NLLA 3EQ7A 1A9YA 1OLOA 1BWSA 1ZEMA 4L5YA 3D0QA 1M6YA 1XDSA 4FFLA 3QX3A 3RFCA 1NSFA 4BNHA 4IH9A 4PQEA 4F2HA 2Q0HA 4K81B 3F4BA 1VJDA 1UEIA 4NCHA 4J6EA 2AMFA 4H7EA 3IPCA 3S8EA 4BQSA 5A4JA 5IUKC 4OBWA 4UVIA 1BVHA 4PO9A 2J09A 1KZ6A 2PH7A 3U3RA 1J5PA 3W7AA 3ZHBA 4FHFA 5AXAA 3I6IA 2WIBA 1IIRA 2NZJA 4JODA 4NECA 2MWMA 3NASA 4HXGA 5IANA 1N2GA 4F4JA 2WB2A 5EQFA 3AEZA 2WHYA 1P0PA 1B0PA 5BW5A 2OQRA 2PCJA 3FCOA 1XALA 1NOJA 4EUHA 3P45A 2AFRA 3QVOA 4P92A 4PC3A 4ZT3A 2NOAA 3BULA 1ZI8A 1T0IA 3CLTC 3ZV6A 4CV0A 1DXQA 3BB1A 5CVDA 4JJ4A 5JD5A 5CCBA 2R1ZA 5IWCA 5J23A 1O6FA 3S2FA 3ABIA 1G8AA 1N2OA 3LUKA 4S0ZA 4MQEB 5DVZA 4B3JA 3A1EA 3M70A 4NH0A 5DLEA 1PNQA 3GHYA 2YN2A 5G0SA 4OBBA 1IN5A 4HHEA 5JFGA 4ABTA 4B6FA 2AJLI 2DR2A 1NMEA 1ZC3A 3IO3A 1NW9B 4HNGA 1H2YA 2FK7A 4GXRA 2CJYA 1QCYA 4QLOA 1K8ZB 1S2GA 5HDBB 1BMFA 4W6ZA 4AWAA 1VKOA 4DMFA 2SBTA 1YC2A 2OV8A 1DIOB 3AILA 1VKJA 2A92A 2WJJA 3DULA 3JD1A 3NTUA 3HFGA 5AK6A 4MMZB 4AIRA 2ZXUA 1J97A 2MTBA 1I8TA 2QMYA 2PUBA 2W6JA 1YJ5A 1O97C 4KPGA 2GHQA 1FVHA 4TWJA 4QSHA 1IPHA 1T9DA 4AK9A 4P7FA 4RK6A 1QQ7A 3FPHA 5IKPA 2KB0A 1UPFA 3VTAA 4DQ0A 4JKIA 4L9WA 4ZO4A 4ZT6A 4ETIA 4PG8A 1P75A 3TW4A 1J2YA 4Z7QB 1YQTA 3A3YA 4WFQA 2JPDA 1ZMXA 2F1HA 3GUZA 5DKFA 2OHGA 3EMVA 3NHKA 1SG6A 3P5SA 1K4YA 4FIZA 4U2BA 1Q7TA 1QV7A 2E3JA 2WZCA 4FBLA 2V6IA 4NZMA 4DZRA 2W48A 3WQRA 1Z06A 3F6EX 4RGYA 1DO8A 5SV2A 3B6IA 2ENUA 2C42A 2AFHA 3H16A 5IM4A 2JGIA 3I45A 1XZFA 1JHYA 4D9MA 5HZGA 4UHKA 1R0YA 4QT4A 3A04A 5DLQC 2B34A 4DQDA 3BB3A 4M54A 4D96A 5BSFA 1JLRA 4LJRA 1EE2A 1QK3A 1F8XA 4QLAA 3U19A 2K7FA 4TT3D 5DNAA 3QTBA 3JTMA 4JQCA 4O2BB 5CYPA 1YDEA 1VYHA 4E5UA 1NP6A 4HH0A 4XB2A 1C9KA 2R6FA 2EDCA 3NYWA 1F2UB 1BWRA 4R1SA 4TYYA 3E9MA 2NUAB 1EX1A 3U1TA 1U1GA 4REOA 4C6TB 1WM1A 2IHZA 4ZOBA 1W1WA 3FB1A 5ECYA 4OA8A 1H6AA 1RYEA 2WU1A 4QNRA 5IZCC 2GFIA 4MIOA 5JPDA 3SK0A 2P9TA 4JLMA 4TLDA 4BJ5A 2R87A 3OCXA 4JJFA 3V8NA 5CFPA 4NCAA 1MV8A 2FZKA 3STWA 1ZN8A 1YJQA 2BMAA 1JHMA 4RMJA 3JQ8B 1WHSB 2IUSA 3LWZA 4NAVA 4X20B 2R4QA 2IFTA 1EXWA 4FKMA 4IGFA 3UQZA 3HS3A 3FDJA 1JPUA 4B2LA 2C95A 3AR4A 1GQFA 3GHHA 1SOVA 1NBAA 3E3NA 3MCWA 4GQBA 4DCOA 1MX1A 2VJKA 2EKDA 3EEQA 2PX4A 3EG5A 2CSUA 1ADBA 4P31A 1VB5A 2DQZA 1F6BA 3LO5A 2Q6IA 1Q1BA 2KYRA 1R6BX 4ZQFA 1QG4A 3RJTA 4ZHSA 2HNBA 2PV7A 3F67A 3KELA 1W4BA 3YASA 3EXIA 2O0KA 3U7JA 4TMXA 5IXJA 1C1HA 3WNQA 2R4UA 3IJ5A 4YDSA 3QU7A 2DULA 4LOHA 4JDPA 5ERGB 4C4ZA 5BXYA 4CM5A 4GYWA 2J8ZA 1UMDA 3I2IA 1TPZA 1G7CA 5IKEA 3R76A 3S27A 5CGQB 1Y1TA 1SCUA 3E0QA 2QW0X 1A0OA 2WHRA 2XQFA 3OO1A 4PSKA 3FZQA 1QRAA 5D51S 1Y7PA 1GAQA 1RRVA 4XJSA 3A31A 1UJ5A 3EH2A 4BGUA 5KYKA 5JTUA 4WK4B 1DEXA 1DBSA 4X7RA 4YUAA 2QM0A 4RMIA 4Y18A 1L6RA 2PD3A 3HN6A 4LHXA 5DHRA 1YI1A 4NAHA 5SYAA 1VMAA 1XVLA 1EFCA 1OAOA 4RPLA 2C2XA 3KT8A 1WVGA 3GJ4A 3S1LA 5KWIA 1KXJA 1HBJA 3NEJA 4UC0A 4QO7A 3VYTB 2IOFA 1XC7A 1E7WA 5BRAA 4QA9A 2NSJA 1UK9A 3T7TA 1YA8A 4XIIA 3QNWA 5EZ6B 2VPXA 3I1IA 3T5CA 2Q0QA 3R3HA 1LSOA 3K8QA 1MORA 1TTHA 4UUAA 3TBKA 3V1TC 2YV2A 2OG2A 2ODWA 4BV8A 3T1QA 4HKTA 4JJ8A 4ZVSA 5ISMA 3T9BA 3UGJA 5M29A 4C1NA 1FFCA 2H85A 3PR3A 5FAKA 5AJVB 2P5SA 1LK7A 1MKYA 1USWA 2I29A 3HADA 3PNMA 4FVTA 4QULA 2EG9A 3KQUA 4ER3A 2EX0A 5E4JA 4LXXA 2BMVA 2AFIA 4HQ0A 2IOFK 2B1QA 2V74B 4OAOA 2F2TA 5JASA 2VZ0A 1P6UA 2NUTB 1EAYA 4CIXA 4H7DA 4C3OB 4HD8A 2QAGB 3RTEA 2QF7A 1NDUA 1O97D 1L4FA 2BOVA 1PLKA 4AQ7A 3B9QA 4JWKA 3HACA 1RE0A 3ZQ6A 2IYQA 1A04A 1N0HA 5CEJA 2OVFA 4OEHA 4JCCA 4KZPA 4K88A 1II0A 2DHEA 4P4LA 4Z0HO 3LSTA 1EXDA 1OA1A 2BR5A 5JRJA 2G28A 1F20A 2QROA 4LSMA 1IZ7A 4L22A 1PQWA 1YIOA 5HCNA 4EL0A 4YCLA 3NBXX 5KO2A 2GM4A 2ZWPA 3DQZA 1Y6RA 1M2VA 2GPWA 2R7MA 4OQNA 3MUOA 2ZWMA 3Q3CA 2VPIA 4OHPA 1Y98A 3DAYA 1DU4A 4DUGD 3UV7A 1N0IA 5KSPA 4EA8A 4CIVA 1KORA 2JIMA 4FW8A 1C41A 4MQBA 2WABA 3F71A 5ALFA 3E9YA 2XQIA 1ZM9A 1CFZA 2AV6A 5BMVA 3L4JA 2C1XA 3ILHA 2PUHA 3MZ0A 4JLAA 5JQGB 3U2QA 5B7QA 4EP1A 4X00A 4G36A 2VI5A 2HJHA 1B8PA 3QNUA 1G6KA 2QMQA 4HUQB 1EX9A 5DYIA 2FUG1 3QOFA 5IAEA 3B6ZA 3L0SA 3OUTA 2DRIA 1UBFA 3QXCA 4WKGA 5CLQA 4CLEA 2AJ8A 1ORRA 4MRMB 1RM0A 5DYYA 3E15A 2RHBA 1M0WA 4UTXA 2QD5A 2X7JA 2QZ4A 4ISCA 1VMIA 1VHDA 1QONA 2EJWA 2IYVA 5GONB 6PFKA 1C7ZA 2Q3CA 3EXAA 4MGIR 2XRZA 4WNYA 3MCUA 3IUMA 3ZCUA 5E9QA 1IUNA 1NLYA 1AXGA 3KJIA 3Q3EA 2B2XA 4URWR 1C4KA 1TM1E 2AI1A 2X40A 4XGNA 3TL2A 3ZLUA 2OC4A 4NJMB 3ZY2A 1KIMA 3Q7EA 1PDOA 1UIRA 1FS5A 3IVMA 4ZCQA 4OPMA 2UZIR 1Q12A 2B8WA 5JCXA 1N9KA 4I8XA 4XSVA 3AETA 4AX4A 2NV0A 5J2TB 2H4FA 1JDTA 5H83A 3U7EB 1OLXA 3LUAA 5JO9A 1TADA 1S9DA 3FG9A 2HMSA 4KOEC 4DAEA 5A3RA 5JAZA 5IRCD 4RV9A 3L8HA 2PUWA 5K8UA 2HHHB 4O0LA 4D3DA 4CZ2A 1Z2AA 4J76A 1L9KA 4GH5A 5CTJA 1JHVA 3HCWA 4XVUA 5A0VA 1ESNA 2BM0A 5B37A 5A03A 3RRNA 4JI7B 2VP2A 2XZDA 2ZB8A 3NDRA 4RFVA 3FHLA 2FZWA 3Q3JB 4KE8A 2FEKA 4L9SA 1VKHA 1WUYA 2A5FA 3RIGA 1SBYA 3K70C 1RJGA 4U7WA 1L4EA 4YIKA 2R8XA 1G8KA 3I9OA 1X2BA 3PDJA 3A0RB 4JLKA 1E1QD 1I3NA 5CCXA 1PR1A 2Y1WA 3TL6A 4PFKA 2Z2JA 2ZJ6A 2AVNA 1VL8A 3PIRA 1Q3TA 4XVCA 5BNZA 2B8EA 3SC6A 2EG5A 3I12A 3IDFA 2OZPA 4LCBA 4FGSA 5F33A 4BHTA 5ALOA 2YXEA 3KZXA 4R71A 4YUYA 1UFOA 3GJRA 5K03A 2QTLA 4QU8A 1Z5ZA 5EL0A 3VNRA 4FYVA 4YJ2B 1L4MA 1OB2A 3RUIA 3Q2KA 4M1ZA 2Z3ZA 4Q3NA 1KMQA 1MOQA 2A0KA 2JBHA 3HKCA 4MCJA 4QUKA 4MPPA 2ZJFA 3QSGA 2V3CC 1W1IA 4HSEA 1Q7RA 1RQ7A 5CDGA 3B7GA 1JIQA 4E70A 1RLUA 1YRYE 2HLDA 2GUGA 2XUGA 1GILA 1T0BA 3CEMA 3OESA 1EVYA 2IXBA 5EJGA 1ABBA 4G1CA 1NV8A 3EEBA 4W82A 6REQB 1XYVA 1MF7A 5JOQA 5JAIA 2QUBA 1XLVA 2WU0A 3GJ5A 4AG5A 3PUYA 5ALTA 3X1DA 1SA0B 2O1EA 4NWIA 5DASA 2A9KA 1IHDA 3BRCA 5IJWA 1L3BA 1T4MA 1YKGA 3HGTA 5IT4A 3GEMA 3FTFA 4MYTA 4DRXB 1P1KA 1PWYE 4ZC1A 3R9XA 1ELOA 3IVGA 4JP2A 4AWXA 4CLRA 3R5TA 3FMOB 2ID4A 4XJTA 3CNLA 5J4LA 4X66B 3W5UA 3E84A 4LJ9A 1M8GA 2RGGA 1U2GA 3USZA 3GCZA 1BD4A 3A6ZA 4I2VA 4GR4A 1UFKA 1D2GA 5L7WA 1VIAA 3REGA 3PI6A 1AQJA 2OO5C 3EIQA 1QG2A 2RHCA 2Y1OA 3MXTA 4ZYUA 3U4QA 3CGWA 1SCKA 1LLUA 2XCTB 4XWOA 1QHHB 3O9MA 5C31A 2ZBVA 5C1DA 5AKLA 1US8B 2QU7A 3DBHB 1Q83A 3TH5A 5C5IA 1G98A 1KI6B 3NTVA 3DMDA 4FX2A 2XZTA 2ZREA 2DWOA 2X8AA 3CRW1 4OP2A 4QVIA 2BZSA 2ZSAA 1X3SA 3DKPA 2NT4A 1S3SA 2P35A 3E18A 3THYA 4AI6A 5DNYB 4XVRA 4Q05A 2HLHA 3KAPA 1ADJA 2ATCA 2HJVA 3OZCA 3LCRA 1G0OA 4DLWA 1M2EA 3H5NA 4IOLA 5JO0A 4ZAFA 1BH2A 1G3IA 5LQJA 2JFOA 3CUYA 2PH1A 1OHHD 4HQNA 4UHFA 4RORA 4B4VA 2NTJA 3IAEA 4ALMA 3CRMA 3W5VA 1I5EA 3A8TA 3G2MA 1M2NA 3WRVA 4Y6QA 1PJSA 4BKUA 2OGTA 3UT5B 4B3RB 3EAGA 2BGRA 1P60A 1R12A 2X2OA 2ZJZA 4UUMA 2A3RA 1YBAA 1U8TA 3R8XA 2EJUA 1P8AA 4CQLA 2YRFA 4IR7A 3QKRB 4NENB 4IIGA 2YIJA 3BRQA 5BV1A 3UAYA 3PC2A 1TT7A 4AQDA 3BD8A 2FUEA 5I7OA 1NONA 1TU4A 1XDDA 3K6SB 4GZ3A 4MI6A 4U4AA 3HBLA 3HK2A 4UU1A 1TEXA 1KR2A 2CMDA 3MS7A 4YCCA 3W8DA 4ZU6X 1Z33A 3CNHA 1EKXA 2F00A 1F9AA 3BERA 3P2MA 4C0HA 2NZUG 3FGPA 1QIMA 3D8TA 1XA0A 3NNNA 1IEQA 3IO5A 3NM4A 2NQ2C 3AM1A 4EKGA 3DOFA 1Z82A 1JQ5A 4TLEA 3VPXA 1TVKB 3RIEA 5EEGA 2OD9A 4R0NA 5G0WA 1C8BA 1JNYA 3ANXA 3NYQA 4MUBA 2IUEA 4MV4A 1ZSNA 2B4YA 4NU0A 4CTNA 3R9KA 4E31A 2C1EA 3BWDD 4ZTBA 1BCRB 2J9XB 3AOGA 3BG5A 3ZCVA 2ZRGA 1CXZA 2J6IA 4YP0A 5PGMA 4C06A 3MTGA 5FUYA 5C7YA 1M8JA 1N3LA 5H0IA 5C5CA 3T5GA 3ZV3A 1IBLB 4JUDX 4KK4A 3V8RA 2Q8PA 1ANKA 2D74A 3VSEA 1EG2A 5G0VA 1YHNA 5CLJA 3DDNA 3D3KA 1OVGA 2C07A 2R47A 4G2TA 2FX3A 1G21A 5LZ9A 2H7XA 1ATZA 4P83A 3V3TA 4TZ6A 2V6GA 2QHXA 1O4WA 2VDWA 3ZJ5A 5HBGA 3ROGA 1O94C 4DDMA 3C74A 1Q14A 4JENA 5E9WA 5ED0A 5EWMA 3QF4A 1PWXA 1WP9A 4P3YA 2B37A 4RY2A 1V8BA 1PHPA 2O4CA 3ZHTA 1TTPB 1B14A 1JKMA 1P6QA 3IKMB 1NMSA 5JSUA 3MGAA 4GF5A 4RPCA 4BNXA 1JBQA 2FVYA 5KUTA 5KVAA 3SJZA 1GFWA 2BFBA 4W7SA 1LVHA 2B4AA 1U2TA 4I5GA 4DMHA 2AFIB 1Z5WA 4KXUA 4NCJA 3DEHA 4MWDA 2A9RA 3D8NA 5KINB 3G88A 1IXRC 2J87A 2UDPA 4URFA 1XO1A 4MUKA 2REQB 5K3BA 2J85A 2O5RA 1SD5A 2GBLC 3K4PA 2X4IA 5LWHA 4XYLA 1Y8QA 4L5BA 2JC3A 4NF2A 2CFSA 5JV5A 4Z0PA 2NU7A 4ND6A 1OXMA 3PX3A 1ZWLA 3DYVA 2Z4TA 4KI7A 4DSOA 3IA2A 5D5HA 3H0KA 5E2AA 3AXSA 4N0DA 1SHKA 1DZIA 1GUYA 1THMA 3OQ6A 1X3LA 2XYVA 4G0UA 3C14C 2ZIEA 4PC1A 4G9BA 3V55A 4L51A 4HC4A 1K6XA 1KK1A 3E53A 3RUFA 3AY6A 1MA3A 3DDSA 1G7RA 1V3VA 4Y2SA 5BMVB 1H0SA 2WE8A 5MF6A 2DKNA 1M2FA 5J2UA 1WULS 4DMUB 3OOYA 1JHRA 4V03A 1KVTA 3ULKA 1QIEA 4I50A 4H6PA 3D3WA 4YP1A 4ZOQI 3JQQA 4QEKA 1CUSA 3RARA 3AVWA 1VTKA 3KE8A 1U81A 3U61B 1CR4A 4B4KA 1Q16A 3CH5A 1C5KA 2DTEA 3BWYA 5KNCH 2VQFB 1CU1A 1DDOA 1F6WA 1E1CB 3NHZA 4PV7A 2XF2A 1JR6A 1MOPA 3KU4A 4B7CA 1PFGA 1TVKA 4K9OA 1KFJB 5TEVA 4RELA 1T5BA 4QYXA 3IV7A 3VOAA 1W44A 3BT7A 5DRYA 1U9IC 2PV0A 4G0MA 1ZRNA 4N5MA 4QSMA 2WNSA 2HMYB 5BSVA 4O3MA 3ZNNA 1C50A 4V39A 1E66A 1XOIA 4DCGA 3FRHA 1GAWA 5ETJA 4YRAA 5GJBA 2J3DA 1YB7A 1SVUA 5AT1A 2AG5A 3AKYA 4YYZA 5FV4A 5CB8A 1ESDA 2D0OB 1PUXA 2XKJE 3UCXA 4A7PA 1V3TA 1XGKA 3D0OA 3SJUA 4A5SA 4CV3A 1GP2A 1Z0KA 3BIXA 3OE1A 2FVXA 4WESA 5IJAA 2FP4B 3OWXA 1Z4KA 3M0EA 3RRXA 3W1WA 2R7NA 3TLJA 9GPBA 1HYEA 1AN9A 2V54A 3N5CA 3REQB 3OCCA 1NMQA 4JHXA 4PWZA 2NXEA 3TB6A 1V1MB 2FPUA 5SZIA 1HORA 2QM8A 5D87A 5DOZA 4BMZA 2A5LA 1XMIA 1ZD9A 3HZOA 2CY0A 2YRWA 3H3XA 1TC2A 4UBOA 2PS3A 4Y1EA 3IBTA 1N5KA 2FG6C 4L8LA 4YUXA 5JTTA 3DZHA 3AP3A 3THOA 2ZRCA 2PGIA 3KWFA 3C16C 4M7OA 4HUJA 2IBSA 3GGGA 4I36A 4G41A 4CIAA 2L19A 5AKKA 5CG2A 3AF6A 4R2HA 1D04A 2VBGA 3FA2A 4HCJA 3DOJA 2M6RA 1XCBA 5JYDA 2O5CA 4QXOA 1GARA 3NFYA 1WLYA 2V8OA 5EQTA 3WL3A 3L05A 1DEHA 4G25A 4LDRA 5AI0A 1EK0A 4BLRA 1V39A 3Q8WA 4LSWA 3RR2A 3L4SO 1XE3A 3T5TA 3KOOA 4DR1B 1M5RA 2HWYA 2QI9F 1L5FA 3L46A 4RESA 1E3DA 3U7QA 1W19A 4RJTA 2P2NA 2CJWB 4NL4H 4ZT5A 4AN0A 4XFKA 2PUVA 5SYNA 4P7GA 3GGPA 3EGEA 3VTZA 1ZH6A 4M76B 4UDXX 1RACA 2BRUC 3NVKI 2PKWA 4JB0A 4P84A 4NHOA 1NKTA 1I3MA 1XQ6A 2W43A 2MYTA 3GFOA 3UG7A 3AFMA 3ISJA 3TFWA 3ZDCA 2BEUB 3D8SA 2ILTA 3D7LA 1Y8RA 4G56A 1HKHA 5F1YA 1JKXA 5AOAA 3UKDA 5KNBD 5B30A 4A15A 4F6CA 3F5FA 3TSAA 2AIRA 1L7MA 4DWVA 4ZGBA 1KJNA 1T4GA 1OFHA 1B76A 4TV8F 4ALLA 1MJFA 1W48A 4KAFA 2VJYA 3U40A 5AIAA 1EFVA 4DXAA 2ZUSA 1E69A 3BDIA 5B12A 3IR5A 4LQDA 1EZZA 3RC9A 2Z5LA 2AFHE 2GCEA 4BRWA 1QHYA 2G6TA 3L1VA 3KYDA 3MSXA 1FW6A 2ZRFA 4YMUA 4BKRA 4EB6A 1XZEA 1VJGA 1K88A 3O47A 2PMBA 4ODIA 4PYQA 3TZEA 4BO7A 2FEPA 4DRZA 4DQVA 2Q4EA 3TCXB 4W9NA 1E2HA 2CJXA 2B7LA 3QU9A 5KCZA 3DOHA 4R7GA 2IZ7A 4Q24A 4US0R 3IQGX 3QE4A 4MA5A 1NNUA 1X19A 3LUGA 2OFPA 2J3EA 3I4LA 3CKYA 4BXOB 3AERB 5LA6F 1K06A 5CB4A 1QP0A 2E82A 4IJVA 3VZCA 1PEDA 1U8ZA 4FILA 1JSCA 3LHSA 3UBMA 4F8JA 3GLIE 4J16A 1CS0A 2PWPA 3E5RA 1PK8A 3HYRA 1E7YA 4Z7JA 1FBTA 4XQ0A 4CF7A 4RC9A 1HH4A 2K7ZA 4C03A 4MW6A 1HNWB 4K6FA 5HGXA 4JLBA 4YQYA 4FR0A 4UULA 2OHXA 4UPVA 2GHIA 3R4VA 2HLDD 4FQ8A 1GAXA 1YACA 2NMVA 4QNNA 5IH3A 2XMSA 1JXAA 5AJWA 4A82A 4AG3A 4BB0A 1R6DA 3REQA 2V45A 3V4ZA 3A05A 3MWKA 4H16A 4J2HA 1C4OA 3FKJA 4Q7EA 4MR7A 3QHAA 4Y2YA 2I6QA 4QRIA 3VYRB 2ECPA 3LPMA 4Y0AA 3J7TA 1RLOA 1SAYA 1TZBA 1XELA 2GM3A 2J3IA 2RKBA 1KS2A 2VOEA 3KKOA 4N82A 2R8RA 1AKQA 3Q7TA 4NP6A 5IARA 1YOVB 3OIDA 3EA0A 2OXTA 3FZGA 1QWOA 1WDMA 1AOXA 5AQEA 3S2UA 3SJ7A 2CDRA 2V7PA 1XK6A 1M1UA 4DF3A 4Y8VA 2VDRB 2UXCB 4LRYA 5BQ5A 3FNBA 1XFAA 4WI1A 4DUYB 1HE1C 4L2IB 4KFCA 4DR6B 2XE4A 4K40A 2AYZA 3JQAA 2ZRAA 1XL1A 4PC7A 3C4VA 2AQ8A 2LVBA 1L3IA 3MQ4A 4MV6A 4FHDA 4G01B 3VC2A 4JP5A 2O5EA 2X3UA 3I83A 1U8UA 3AEKB 3UA3A 2PKEA 2TECE 3WGMA 2QLTA 4KHZA 2ZOSA 4X24A 3CVOA 2I0FA 3QJ5A 2QGFA 5BOSA 2A67A 3OQJA 1KC3A 1B8OA 3IUPA 1J2RA 3KTFA 1I6MA 1ODIA 3SIXA 1GPBA 2I80A 1JDVA 3T4EA 3F7NA