2VHYA

Crystal structure of apo l-alanine dehydrogenase from mycobacterium tuberculosis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
370
structure length
324
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVMKPGAVLVDIALFYCMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 98
structure length 324
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA02
3TOZA 3MJVA 4ZA2A 3HN7A 4GX2A 4I5FA 2ZTUA 1B15A 1JKFA 3TDKA 1VM6A 3IUSA 3ZWMA 3EVTA 1K6XA 5F5LA 3WQSB 5G4KA 3F47A 3KLMX 4CMCA 2B83A 5IZ4A 3ZW9A 4GSKA 3SXPA 3PGXA 3I4FA 2IZ0A 1GZ6A 1S7CA 1A27A 1HL3A 4XD2A 3F4BA 1O95A 1PJLA 4DYVA 2BLLA 3MOGA 4AJEA 2HJRA 3DOOA 4MPDA 1NNUA 1V9LA 1VRWA 5KVCA 1FDUA 3KOUA 4PLHA 4X54A 2V6FA 1SMKA 5F1OA 1FF9A 2VOJA 2VHZA 1V3VA 3W8EA 1XEAA 3FHLA 3VOSA 5JDCA 1KVQA 4R51A 3I23A 4ILKA 5F21A 4TVBA 1D1TA 1DFIA 1FDSA 3HADA 3RFXA 5A5FA 4BNMA 1A71A 1FXSA 3L0DA 5A05A 4CL3A 1ZJYA 1Y5MA 4A5OA 2HMTA 3LVFO 3WNVA 2I66A 2ZIZA 1U7HA 2W98A 3MEQA 2VRBA 3O9ZA 1MFPA 2P2SA 3K2EA 5TNXA 3A1NA 1WZIA 2VYNA 4FFOA 4PLZA 2YW9A 2O3RA 3MJTA 3QHAA 1ENZA 1GV1A 1B0AA 2X0RA 4MVJH 4OKIA 1VJ1A 3Q6IA 1DC5A 4M8SA 3QSGA 1WDMA 1NYTA 3ZNPA 5L45A 4DC0A 1T1RA 3GMSA 3VH1A 1MXFA 3LT4A 3IQDB 3K30A 3H9QA 1SOVA 2JFGA 1UXIA 1LDNA 2W8ZA 3TZCA 1P31A 2ZYGA 5JDIC 3R6DA 2EWMA 2DUUA 4F6CA 1DPGA 2DLDA 2E37A 4YBZA 4PLFA 4O1MA 1LJ8A 1MUUA 2WD8A 2LDBA 3W4IA 3FPLA 1TXGA 1XWFA 4TRNA 2AA3A 4Z0TA 3QVOA 1DIGA 4NK4A 4F45A 1ADGA 1SB9A 1XQ6A 4AICA 4BGEA 3GDGA 3TZHA 2NU6A 4YQYA 3U5TA 4FFNA 2GRAA 4M87A 4EUEA 1K2WA 4WKGA 3JQ7A 4PG7A 5K9ZA 2Y1CA 2NU8A 2GN6A 3JQGB 4N54A 3DAGA 4OH1A 1R0KA 3DZBA 3GF4A 4BNFA 1ZSVA 1KEVA 1PS9A 1ZZEA 3C1AA 2JD2A 3K5PA 2D2IA 3WGZA 4INAA 2OO5A 2AEFA 1ZBQA 5TJ9A 3ZN2A 1GU7A 3K9QO 3OFSA 3B6ZA 4Y6RA 4E12A 5IF3A 4UUMA 2P9EA 2IODA 4R1TA 4TRJA 5DCWA 4ALNA 1R4NB 3GGGA 1X0XA 1YWGO 4XQ9A 2TMDA 3OICA 5DNAA 3WB9A 5F1PA 5I7EA 1Q1NA 3I6IA 1LSUA 3A06A 4OSOA 1SZJG 4EUFA 2Y93A 2WD7B 5IXSA 1K6JA 1SC6A 2VRCA 4CM5A 2EGHA 1OBFO 3EGOA 4Q3NA 3T4EA 1G0NA 3WJ7A 3PJDA 5I9LA 3JCZA 4GH5A 5CP8A 4U0KA 4J1QA 1I30A 1SBYA 4TROA 3RUAA 1RM5A 3STHA 2ZB8A 2IYPA 5EPOA 1P1FA 2B37A 1RM0A 2CF6A 2HMWA 3IUPA 4L4XA 1RKXA 4K26A 4DTIA 1MB4A 1TT5B 1HDYA 1ZXLA 3W8FA 3FRJA 1EEHA 3E9NA 4RL6A 3LC7O 4GKBA 1ZVMA 2NLOA 3C7CB 3PI7A 4A7PA 5DP1A 4J16A 3WWZA 3ZV6A 4J7CA 3ZNQA 1PR3A 1E7QA 4BGUA 5KKAA 5L7TA 1U5CA 4IJKA 3TPCA 5BSEA 4DREA 1U3UA 2VYVD 4UAGA 4MKZA 1Q0LA 2DBZA 2JHGA 2WYWA 2VTDA 3HN2A 3ZU4A 5B12A 3KYDB 5L4SA 4XDZA 4ZHSA 1ARZA 3BMNB 1AHIA 1PGOA 4U6QA 4Q3AA 1UR5A 3GA0A 5THQA 5JLAA 3GN2A 5IN5A 4NIMA 3W1VA 3WQRA 3G17A 4FW8A 1B26A 4OJNA 4C7KA 4DPKA 3GAZA 4YRDA 4ALLA 4QO7A 4HFJA 3F4LA 3TZ6A 3OHSX 2XAAA 3ZHYA 3JQAA 3PWKA 3B1FA 3MJSA 4MDHA 2FHSA 4D46A 4MP6A 4DMMA 1YDEA 4PZEA 5TS3A 5F5NA 3ZZNA 3I6QA 2OGUA 1PS8A 1GQ2A 3GG9A 1HE4A 4NBWA 1EVZA 5ER9A 3GAFA 4NBUA 5DP2A 1XDWA 3ROPA 3UOGA 4CMHA 5L95A 4PLTA 3GOHA 4RF5A 3CZMA 4MVJF 3GG2A 3FN4A 3VDRA 3RIHA 1DDOA 1H93A 3WS7A 3MWEB 3JD4A 3EK2A 4PRKA 5IZCC 3DZKA 1DOHA 3OJFA 1SCUA 1YE3A 2ET6A 2Q50A 5DOVA 4ALIA 2X0IA 3RSHA 3RKRA 1JLLA 3A9WA 1I36A 4WCFB 5JY1A 4BKQA 4RLHA 1I33A 1LRLA 1JAXA 1ISFA 1NPTO 3DTTA 5CDYA 2EJVA 1HETA 4Q3BA 2NACA 1NP3A 3ENKA 2RHRA 1CRWG 2P5UA 3UHAA 1YDWA 3QVSA 5JO0A 2VYND 3PJGA 2Q2WA 3IC5A 3NRCA 3H6KA 3ST7A 1NHWA 1X7GA 5MDHA 1ZJZA 1MV8A 1XCBA 3VZPA 4BNNA 5BNIA 3QE3A 3FCOA 2G1UA 1GADO 1G1AA 1PZEA 2JFHA 4KQXA 4ZVVA 4OOEA 4Y8VA 3KB6A 5ICMA 2X7HA 5T8KC 4BMSA 1LC0A 5K6AC 4A26A 4D0RA 2CMDA 1JAYA 2OP1A 4MVJM 2AMFA 2B5VA 2PGDA 3WBFA 5KOIA 2YFHA 3OM9A 3L9WA 1D8AA 1JA9A 3NTOA 4FGSA 3F3SA 4W4TA 1N1EA 1Y6JA 1LSSA 4BKUA 2DBRA 1HSZA 5CEFA 2XXBA 4HV4A 2YQ5A 5GZ6A 1KOLA 4N5LA 4IJWA 5B37A 3EVNA 1ENOA 4NU5A 3DMTA 1I2CA 4BO0A 2VNAA 3MJ4A 3AWDA 3Q2KA 1L1FA 5GZ3A 3D4OA 1LDGA 3RBXA 2YHUA 5L51A 1PWZA 1Z75A 4CM3A 1VKNA 4RDIA 4YB8A 1ML3A 3R3JA 1AUPA 1BVRA 2FRDA 4YJDA 4QEDA 5JXWA 1O5IA 1FK8A 4JNKA 4J0FA 3NUGA 3OIFA 4D44A 4J91A 1PU2A 3E6AA 2GZ3A 3WBBA 3OP4A 4OXNA 1WAMA 4GGPA 2Q1SA 1A72A 2VUTA 4AJIA 2OFPA 4GWGA 3OECA 2W2LD 4GQAA 3DBRA 4R9SA 2B4TO 4Y6PA 1EK6A 2PD3A 4QTZA 1KC1A 3HFGA 4BIIA 1O0SA 1J5PA 4OM8A 4W7IA 1TA4A 3JQ7B 3NTRA 1QYCA 4R01A 4C7JA 3OSUA 1UXGA 3ITDA 1CQIA 3BTUA 1UXHA 4Y98A 1P0FA 5T64A 4QFCA 4RPLA 4GKVA 4MJLA 2ZCUA 2PZJA 4B8WA 3PHJA 4MVJD 4CLOA 2UUPA 3WMWA 1MLDA 4IZHA 2GN9A 5AXBA 5CDUA 3DQPA 1LQUA 4IMRA 1I2BA 4R54A 4GLOA 4EBFA 2Q99A 1H6CA 4XZ3A 2QHXA 2HLPA 4R1NA 1QRRA 5FYDA 4CLRA 4AVYA 2J5KA 4IJUA 1Q7CA 4JJFA 1ISHA 3HZZA 3GT0A 5G0SA 3TRIA 4BGIA 4RORA 1CEQA 1BRMA 1BSVA 3C1TA 4EI2A 4ESOA 3QQPA 4WUVA 4JROA 3UCXA 2V6BA 4CM4A 3KETA 5TSDA 1ZCJA 4WLOA 3EZYA 3WR5A 3NAQA 1VJ0A 2GDZA 3QW2A 3AU8A 3IIEA 3JQBC 1P1IA 5CAEA 1X7HA 3HDJA 3PHIA 5GZ1A 1PL7A 1UZMA 3V1UA 4IDAA 3IP3A 1RWBA 2ZKLA 4A03A 2HCTA 5IDQA 3U4DA 4L0QA 4TVOA 1LC3A 1E77A 3VZRA 3ZHZA 4WASA 5KVQA 2VQ3A 1J49A 1QV6A 4BKOA 1U3WA 3PHLA 3JV7A 3WJAA 2A35A 3ZWOA 2Y0DA 1A7KA 4LGVA 4YAGA 4MIOA 4AG3A 1U7TA 4E33A 4JGBA 1E6UA 3FI9A 1HT0A 3OJOA 4KZPA 1MG5A 2WYUA 1MFZA 2BGKA 4CUKA 3RC9A 3V5NA 1CIVA 2VHWA 1IZ0A 1A7AA 5DDIP 1WMAA 1IY8A 3WGTA 2DFVA 8LDHA 4JIGA 3JQAB 3PPIA 4XKJA 2CF5A 3D3WB 1QR6A 2YDXA 5HS6A 1I3LA 3GVCA 5L53A 1IYZA 3GC6A 2JHFA 1HEUA 4EUHA 3UICA 5BNTA 3WQQA 4C4OA 2X0NA 3JQDA 3ICCA 4QXMA 4EJ6A 4Q3EA 1NWHA 3DAFA 2EP7A 2GGSA 2X1HA 2Y99A 1FMCA 4M49A 3WOHA 4IUYA 1HDCA 3GVXA 3UW3A 4FQ8A 3PP8A 1DO8A 3ANLA 1JWAB 5AQ1A 2HDHA 3PFFA 1YRLA 1UP6A 2HK8A 3T7EA 3DEYX 1YS4A 4XB1A 1A4UA 1UXKA 4O59O 3INTA 4WEQA 5IDYA 3TL2A 1LA2A 3AOEC 2BGLA 4D0SA 2V7PA 4LCJA 3ZI0A 3PYXA 2ZB3A 1Q2XA 1TEHA 4YYZA 3FNHA 4PG8A 1H9BA 2Q45A 4NR0A 1P33A 1XA0A 4AJOA 1E7RA 2H9IA 2W2KA 1NHGA 3VVBA 3DXFA 1Z82A 4I1IA 1DEHA 1FDVA 4GX5A 4F46A 1PIWA 1H6DA 3DO5A 3I1JA 3WGHA 2SCUA 3WWYA 1P3DA 1LI4A 2D1YA 2YQ4A 3RC1A 2EKLA 3JD0A 4B7XA 1UAGA 3ASVA 4OAQA 2O4CA 4R41A 4WOJA 3ITKA 2Q1TA 2YV3A 4RVHA 4J90A 3QY9A 4NI5A 2NV6A 1I10A 4L75A 3PDUA 1F8GA 1YJQA 2QW8A 1EE9A 1CWUA 5B4VA 1RJWA 3QJ5A 1XELA 2POQX 2EP5A 4ZQEA 4CLDA 1E3EA 2TMGA 5EQDA 4PLVA 3PHHA 3BMQA 4RVFA 3PIIA 4CMJA 4IMPA 4B3HA 2X22A 3KEOA 3UUWA 3OJEA 1ZW1A 3TN7A 4A73A 4Q3CA 3B70A 4PRLA 4EZBA 1N5DA 3CXRA 3KEQA 1Y1PA 4QT0A 5G0VA 4BO1A 4DWVA 1B14A 4RO0A 2O7QA 2B36A 1HZJA 3GPIA 5A9SB 4TSKA 5BNFA 3SJUA 4XB2A 5T6BA 3JTMA 1ZK2A 2RH8A 1TT5A 1CYDA 3DFUA 5KJCA 4HADA 3KSZO 3NT2A 3C24A 1NR7A 1GQYA 2J5QA 4MVJP 4Z3KA 3M2TA 1B3BA 1DIRA 4HXYA 1C3VA 3OF2A 4PG4A 1PJ3A 3EC7A 3PJFA 3C8MA 4ID9A 3FTNA 3JD2A 1YGYA 1DAPA 3LC2O 1T4BA 1E3WB 3PWZA 4J4BA 3QVWA 4NDNE 3V2UA 4L8VA 3KHUA 3OIGA 1GUFA 3KYDA 4CM7A 1DRVA 4G81A 3KTDA 1U3TA 3EW7A 4NQZA 5EERA 2WWRA 1VL0A 1DJNA 4LMPA 1KVTA 3GVIA 4CL8A 3C1OA 4IBOA 2Z5LA 4MVJE 2BRUA 3S55A 2EV9A 4RPHA 2X5JO 3H7AA 3TOXA 1VKOA 4J1TA 4KUHA 2QQ5A 2X9GA 1CDOA 4R4JA 1VI2A 3RROA 4R1UA 3GHHA 4D7AA 1NBOA 3PVZA 1HDXA 1N9GA 2NTVA 4HBGA 2R00C 4IS2A 2FP4A 3F5QA 1R12A 1NXQA 5CG2A 1NX6A 2PR2A 5TC4A 5L7YA 4OOFA 2Z1MA 3FBTA 1ZNQO 3NKLA 1PQUA 2PV7A 4XJTA 1M2WA 2HRBA 3S8MA 4CLRB 4YAKA 4ND4A 3TQHA 5LDHA 2DTXA 2AE2A 3HHPA 1QSGA 3DZFA 1KY4A 2H1SA 4L4SA 3UVEA 2PLAA 1NM5A 4W82A 3GMDA 4XCVA 3F1LA 3UXYA 3H9GA 1R0LA 3LF2A 3A28A 2C2XA 4E0BA 2D59A 2YUTA 4CM4B 5G0TA 2P4QA 4TMFA 4O63O 3ON5A 3NGXA 1O9BA 2VT2A 2NQ8A 1C0IA 3OEWA 4GX1A 1PR9A 2UVDA 1P0CA 5T8KA 1CF2O 4OKNA 3OA0A 5KJEA 1BTOA 2Z1NA 1X13A 2HMVA 2OORA 3K96A 2JCYA 3VPXA 3D64A 1UJMA 2D4AA 1JDJA 1DHRA 2V6MA 4NJMB 4RF3A 3D4NA 4L74A 1LDYA 1KVSA 5CDSA 3ZWPA 3GY0A 4ONEA 4FJ2A 4K28A 4PVDA 4DQUA 4E31A 4FFMA 3DB2A 1HE3A 2WM3A 4O5OA 3LC1O 4XQGA 1CETA 3VTZA 4WEOA 4OXYA 3OQ1A 3B20A 3ZH2A 1Y9EA 4W7HA 2BI7A 3CUKA 5JNLA 3EUWA 1AXEA 1D1SA 1E7YA 3OEYA 1LUAA 4PLWA 2CVZA 4PN3A 3JYNA 4K6FA 4QECA 2AEMA 4B4UA 4CPDA 2B5WA 2O2YA 2ZATA 1ADFA 1W8DA 2CVQA 4RVGA 2Y67A 3KLPX 1R16A 5JE8A 1HE2A 1MX3A 1ZK4A 2AXQA 3LLSA 3TJRA 3FWNA 2GERA 2NVWA 1GYRA 3DFZA 3E9QA 2V6GA 1GYQA 4WJZA 1MA0A 5C7IO 2FSSA 1DC3A 4M89A 4CMEC 1VC2A 3X2EA 1YVEI 1YOVA 1W4ZA 3OH8A 4JP3A 5LDGA 3KO8A 5AOVA 2VWHA 1ZEJA 2BHLA 2BFOA 9LDTA 3IAHA 4G65A 5B4TA 3AY6A 4IDGA 1FDWA 4BGVA 5GY7A 1G0OA 4CMAA 4DGSA 1R0SA 1NVTA 4WOKA 1ISIA 3LSYA 5LCXA 3FD8A 4CM9D 4OYRA 1PSDA 1P74A 3ETEA 5H81A 2PK3A 2DTDA 4CM6A 2IEBA 3QWAA 1DHTA 2FPGA 3UCFA 2W2KB 5T67A 3H4VA 2AQIA 2RIRA 3A4VA 2C54A 1NQAO 4E2WA 1H9AA 3BHMA 1HKUA 3AM5A 3ZDFA 2Q46A 3WG9A 3H9UA 4BHTA 4LK3A 5HRUA 1SPXA 3W4KA 2XOXA 2PWZA 3AUAA 4AJ1A 4JBIA 4IDDA 4IIVA 1H2BA 3WYEA 4Z9FA 3RD5A 2DBQA 4S3MA 3VC7A 1BXGB 1OC2A 3Q9NA 4PZCA 4RLSA 4E5KA 4BOYA 1YB4A 4NK5A 3WXBA 3BYZA 4U0JA 2CDCA 2DAPA 5FI5A 1JW9B 3OJ0A 3ZWXA 5CPFA 1R4MA 1F14A 6ADHA 1HYGA 2HSDA 1I32A 2GNAA 2NADA 1E5LA 3Q1LA 3H8VA 3BMQB 3GRKA 3QP9A 3K8ZA 5EN4A 1E3JA 4I9UA 3RJ5A 1E7SA 4EW6A 2C5AA 2BFPA 2BI8A 3DL2A 2J8ZA 5B4UA 4XGKA 2ZTLA 3AUSA 1FDTA 2O48X 1LSOA 1TB4A 4B8ZA 4WLFA 2VZ0A 4FR5A 3UN1A 1O6ZA 3D5QA 3H2ZA 2I6TA 5C7OO 3CE6A 1LDMA 1HTBA 3R1IA 5DZSA 1QV7A 2P5YA 1T26A 2PY6A 2JCVA 1DAOA 4KDFA 3OQ6A 1GV0A 5U1PA 3E5RA 4BNHA 1P1HA 3PLRA 4K6CA 5ADHA 4CV3A 5ENDA 4R9RA 2GLXA 1LLUA 2EGGA 3IDSA 1Q7BA 3RC7A 4E6PA 2YDYA 1X1EA 2AG5A 4IDCA 1YONA 5I8ZA 3H3JA 3VPGA 2X23A 4CMKA 3G1TA 1V6AA 4AJHA 5EL0A 3GK3A 1XKQA 3NJ8A 1YJ8A 3JQ8A 2GZ2A 4J2OA 4WECA 4ZN6A 4MP3A 1PJBA 1K89A 4FC7A 8ADHA 4IM7A 4CMBA 1XYGA 4J9UE 1O94A 4N7RA 4XEHA 4YJFA 3NYWA 4BO5A 3M6IA 3M1LA 2CFCA 1GCUA 4M55A 1BGVA 2PKRA 3FBGA 4L73A 3GEDA 4BV9A 4R3NA 3KRTA 5I7FA 1ZMOA 1P1RA 2EKQA 1WP4A 3GUYA 1UXJA 4MP8A 1PGJA 3A14A 4YAEA 2CZCA 5AXDA 3V2GA 4CQMB 4DMLA 2B35A 2B0JA 1H5QA 4E2YA 2X5KO 3BZUA 2IYOA 1N9GB 4OMUA 2O3UA 5JO9A 3D3WA 2YV1A 1UDCA 4RZIA 4CR8A 2I76A 3HSKA 4BO8A 1NPDA 2AW5A 1DSSG 1M6WA 3I9KA 4CQLA 1ISGA 1SAYA 1U2DA 3BXXA 2BH9A 2JD1A 4XGIA 3VTFA 4ALMA 4JCOA 1HLDA 2C07A 3ETGA 3RUIA 2QYSA 1Z45A 4P4LA 1ID1A 2NSDA 1O89A 5BR7A 5ER6A 3RVDA 1JWBB 2GCGA 3VZSA 3S1LA 4UUPA 3S2FA 2LDXA 4A2CA 5THKA 3GZNA 3WGQA 3RU9A 3WLFA 2A92A 2FY8A 3S2IA 1CQJA 4O0LA 4MVJG 4EJMA 4IJVA 1IPEA 4IPTA 1J0XO 4PLPA 1GZ3A 5TX7A 2DC1A 4KQWA 2JAHA 2PGJA 1I3KA 5FFFA 2ZTMA 1XLTA 4DPLA 3RCBA 2VWPA 5GMOA 1KEUA 2GR9A 3DHYA 3ZV4A 1ADBA 1AHHA 5L40A 2HO5A 3E5MA 5EIOA 4BO7A 4RCVA 1EUDA 1LRJA 4OO3A 2H5LA 4PLGA 1QLJA 3ZU5A 2VUUA 4K1LA 2FMUA 3VH3A 2PFGA 4XYGA 2HK9A 2GSDA 3G49A 2HUNA 3GGPA 1DIHA 3I5MA 2UDPA 5AXAA 1JN0A 1G6KA 4XA8A 5BT9A 1HDRA 3GHYA 3NX4A 1KEWA 4FD3A 3INRA 5ES3A 3VPHA 1QYWA 3AI1A 3PEFA 2I9PA 3BA1A 4R16A 3RAJA 4XYBA 4ZJUA 5KVVA 3PYLA 4OL9A 5G0UA 4CM8B 1EBUA 3AFMA 4TZTA 1R66A 4AJ4A 4CODB 4DRYA 4WLUA 3OETA 1T2FA 2A9FA 1E6EA 2E6UX 1XIVA 3PK0A 4GBJA 4YJHA 2IRWA 4EYEA 1GAEO 1L7DA 2BKAA 4MOWA 4DBZA 5HWSA 3ONDA 4J4HA 1NVMB 1L7EA 2D0IA 2O3JA 1ZIDA 1OC4A 2FSVA 4I5EA 4Y6SA 3ZNNA 4CV1A 3KSDO 4DLBA 4XYMA 1YOVB 2IEDA 3JD3A 2QRLA 5L4LA 1ONOA 1LXCA 3FPCA 1BWSA 5EMHA 1PJ2A 4AJ2A 2X9NA 4ALKA 5KJFA 1X14A 5JS6A 4XDYA 4J7XA 1E3WA 1E7WA 3K6JA 3AJRA 2CSUA 2VRCD 2YJZA 3PXXA 3TZQA 4YXFA 4L4RA 3Q9UA 4MKXA 4A27A 3JQ9C 1D4FA 1PTJA 1ZK0A 4E2XA 4YRBA 4FBGA 4E32A 4YT8A 4CMGA 1Z73A 1SNYA 2QZZA 3INGA 3RU7A 5KJ6A 3AFNA 3F46A 3K31A 3JQFA 5AVOA 1DB3A 3NT5A 3LU1A 2Q4EA 3WICA 1DJQA 1BHSA 1HWYA 4CM1A 4OQZA 4EEZA 3ZWNA 1SEPA 1PJ4A 1E1NA 1NWCA 3SX2A 4CR6A 5IG2A 1R4MB 5H83A 2DM6A 6LDHA 1OFGA 1WWKA 1T24A 2XF8A 1ZXBA 3GFGA 3MJEA 4BNVA 5L7WA 2AQHA 5U9CA 4KMSA 2VTEA 3CEAA 4D3FA 4RV9A 1PJSA 3I52A 4IIUA 1PQWA 1ZSNA 2EHDA 4B4OA 3NDIA 4P38A 3RUFA 2C0CA 5BSHA 2OP0A 2X8LA 1V3TA 3SEFA 3NT4A 4ZQHA 3JQAD 4IINA 1Y81A 1EVIA 3RUDA 4W99A 1KETA 4MIEA 4XR9A 2ZYAA 1LDBA 2V65A 4DYDA 5TRTA 3H5RA 2EKPA 4ND5A 1KY5A 4Q39A 5A02A 1BW9A 4XWYA 3I3OA 4KWIA 4D3DA 4H3VA 1QORA 2QIOA 1N2SA 3D3EA 3AM3A 3PGJA 4XQEA 4NJMA 1KBZA 2BFAA 2R2GA 3I9LA 5DCUA 1AN9A 1GPJA 1NTOA 2JJYA 4CLHA 3JQ8B 1Z7BA 1A9ZA 1Y5RA 4B79A 3DWFA 2IXAA 5IXYA 2C82A 1PX0A 1E1MA 3H9JA 4DUPA 4XIJA 2Y1DA 4JK3A 2OUIA 4YJFB 3N74A 3PDJA 3RUEA 1JQBA 4BNTA 3ULKA 3PJEA 4CMEA 3DAPA 3NJ4A 4NFYA 3I4CA 3Q2IA 3U9LA 1DC6A 4DIOA 1DIAA 2H6EA 4LRTB 4UVDA 1LEHA 4D79A 2J5RA 3NGLA 2CVOA 1NPYA 3JYOA 4AFNA 3GDFA 5DN9A 2VN8A 5JCJA 4ZRMA 5TQVA 1BVUA 3FTPA 3UAGA 2BMAA 2E4AA 5CPBA 4UREA 4ALJA 1NFRA 4ZICA 1T2CA 4CUZA 4WLVA 5I9NA 3ZWYA 5TGDA 4DLAA 4YPOA 5JDIA 2YFQA 1M6HA 1M75A 2CDBA 3AY3A 1DIBA 3H9EO 3RI3A 4CQLB 1E1LA 5MGBA 2IZ1A 5JMWA 3GUCA 4IY1A 2HK7A 2Y1GA 2WE7A 4J6FA 4JLWA 4R1SA 4TKMA 1OI7A 5A3JA 2O3SA 2W4QA 5HTOA 1P45A 1QYVA 1NQ5A 1QKIA 2WE8A 3L77A 4OXKA 4PGFA 2ZJ1A 1N7HA 4Y9DA 2BFMA 1JVSA 1ZK3A 3GZNB 5HA5A 4H15A 4BB5A 1T2EA 4FIZA 1PL6A 4MINA 3EZLA 1E0DA 3BMOB 2XPCA 5JAIA 3RQSA 4U8GA 4A0SA 1GEEA 2VCYA 3E1KA 4J43A 4DQXA 3DOCA 2WYVA 1C1XB 4BNKA 5EESA 5KKCA 3PLNA 1YL5A 2IE0A 4JN6B 1UH5A 4BO3A 4EITA 1UP4A 4M86A 1E6WA 1EDOA 5COBA 3PQEA 2G76A 2C59A 4ZQGA 2G82A 5ENVA 3FF4A 1V8BA 3E82A 1BXGA 4HY3A 3GPDG 2ZK7A 1A9YA 4R3WA 3IJPA 5BSFA 1T1SA 3L4BC 1WDKA 1V0JA 2G5CA 1DRUA 1Z7EA 2DBVO 3UGKA 3HWRA 4NH4A 4ZQBA 2FPPA 2GPTA 4FGWA 4UUNA 5CHEA 1U9JA 5IAAA 3GH3A 4UEKA 3NDJA 3L6DA 3OBBA 4NJOA 1PZGA 3G1UA 3D0OA 4IGEA 4BO6A 3IKTA 2E82A 4HUJA 2I5PO 1B16A 4ITUA 5AXCA 3UFXA 3I9NA 4YJHB 3V8BA 1OMOA 1W6UA 4CLEA 4PVCA 2Y1OA 2B69A 1GZ4A 4Q9NA 2XXJA 2VWGA 4EDFA 4DBVO 2OMEA 3JYPA 1LLQA 2J6IA 3AUTA 4QX6A 1E92A 4JQCA 1IHYA 4D41A 4P22A 4ZD6A 3RFTA 4I5DA 1HSOA 1ZH8A 5FI3A 4FPXA 1B8PA 1MGOA 3ZW8A 1MC5A 3S2EA 3B1JA 5K0ZA 2HRZA 4LISA 1ENPA 3C7AA 3FR7A 2VT3A 3KBOA 5TLSA 1EE2A 2PTGA 5A5EA 1LNQA 4RZHA 3AK4A 3VH4A 1GUYA 3TL3A 3WIEA 1E7MA 4E5NA 1E1KA 4CMIA 1RM4A 2BF7A 1LQTA 2VZ9A 1LU9A 2X86A 3OJLA 3F9IA 4YRAA 3DBVO 3LQFA 4NZ9A 3W4JA 3ABIA 2Q1UA 1M66A 2EERA 2HAEA 3HE3A 1ZFNA 1X7DA 2HMUA 2X5OA 4B4WA 5A06A 3K2BA 3DZHA 2I65A 3KYBA 4Y67A 4YJGB 1IOLA 3HNPA 4DL9A 3KXDA 2AEJA 3WNQA 3NEPX 5IZCA 1YXMA 4CQMA 4H16A 2OZPA 1ZO8A 3BHIA 3DONA 4U6SA 1NQTA 3DZGA 3AI2A 3IKVA 3DMTC 3O8QA 2X4GA 2DVMA 4I9NA 2DFDA 2AG8A 4GMGA 1GYPA 1KVUA 3PZBA 4DQVA 5KVSA 1DLJA 4FS3A 1WNTA 3MJCA 5ILOA 4OGWA 3P2OA 4W9NC 4TRMA 4FOSA 3E8XA 1ONNA 5CDTA 4JP2A 1Q0HA 3PQDA 2DTEA 4XYEA 3VHRA 2O4UX 1BDMA 3CPSA 3UH1A 5TT1A 2C7VA 2Y1EA 3VPSA 5JAZA 2VUSA 2I99A 1J6UA 3S2GA 4G2NA 3ROQA 2X6TA 3ZWVA 4B3IA 3KM0A 4LSWA 5JAMA 3QVTA 2IZZA 4DLLA 2DUWA 2P4HX 5JPIA 2VHXA 4Q3DA 5K6AA 2ZTVA 1BW9B 5DCYA 2ZCVA 1GQQA 1KERA 1IULA 4UVIA 2B4QA 2QX7A 5A03A 2NNLD 4Z0PA 4BV8A 3ZWAA 3CH6A 2FWMX 3DBLA 1JKIA 2PNFA 5IDXA 1K6IA 3KVOA 4UVHA 1EQUA 3O4RA 3GZ4A 2NWQA 1VSUA 3SBOA 3QWBA 1NFFA 3U62A 1H0KA 2VNSA 1IZ9A 4J3FA 1YKFA 2FPIA 4BQPA 1H6BA 1DFHA 5DULA 4RPKA 4XJSA 3FWZA 5H82A 3DC2A 1N92A 1ZEMA 4M1QA 1C0PA 3HB4X 1C14A 2JL1A 3LF1A 4J4TA 1F06A 4E5MA 5G4LA 4YT2A 3WGGA 5DBFA 1FJHA 3LYLA 1LSJA 4MO2A 3WDSA 4CM8A 3DDNA 1QG6A 4N5MA 2JFFA 3ONFA 1YBAA 1X15A 5T57A 4E30A 5JW6A 4HNHA 4AJJA 3PYMA 3WGIA 1HDZA 3R3SA 2VZ8A 4XQCA 1U8FO 1Y8RB 2I3AA 2CNBA 5CDGA 2Q2VA 3PHGA 4GVLA 1GD1O 1AGNA 3GGOA 2P9GA 4GPD1 2UAGA 1PZFA 2D5AA 4BS9A 2HMSA 5COQA 5L9AA 1NVGA 1B7GO 3O38A 4J7UA 4YT5A 4ND1A 3OQBA 4KUGA 4BMNA 1GTMA 1YQDA 1KIFA 4OSPA 2G0TA 1ZK1A 3JQ9A 3WLEA 4YQZA 3B1KA 4GI2A 2C7GA 1QXSA 1D3AA 4BNLA 2NVBA 3KZVA 3OMLA 2OL4A 3I9OA 4HKTA 1PWXA 5JAQA 4NFHA 2PGLA 3ZWCA 4QO8A 4RQTA 4YACA 1E3IA 3KSUA 1PGQA 5JFOA 1V35A 2D8AA 3L07A 4GLLA 2I67A 1BG6A 2FOIA 3Q11A 1WLYA 2EXXA 2HU2A 3WTBA 3FSRA 5A9SA 3K73O 3KYCA 4BNIA 4L9RA 4E13A 3QWFA 5T5QA 1W73A 3CZRA 4RF4A 4DIFA 4BL5A 3IL2A 3GEGA 3V2HA 4BO2A 3NV9A 4FJ0A 3RKUA 3VKUA 1I5RA 5FF9A 4NU6A 4E2ZA 5C37A 3E9MA 1X0VA 2J3IA 4Z9YA 4II2A 1NQOA 1KC3A 2GYYA 1QYDA 3RFVA 2IDZA 5EINA 4YDRA 4PLYA 4DPMA 3GN1A 3LLVA 3RASA 3H5AA 2Q4BA 2Q3EA 3WMXA 4BNJA 1UDBA 1EVYA 2JKVA 1ISMA 1WW8A 4KUEA 5J23A 4ZU3A 4R69A 5I7SA 2Q2QA 4PG6A 3FNFA 4UEJA 3JQBA 4U7WA 1DC4A 4RJTA 5KJ1A 4JJIA 1ONPA 5A3VA 1F12A 1WPQA 3JQ6A 1LRKA 1RYDA 3WSWA 4BMVA 1IB6A 1MG0A 2GD1O 2OOSA 2JCXA 4ZQFA 2J3KA 1VSVA 5C3MA 4WLEA 4NG5A 4YVFA 4YAIA 1E3LA 2OXIA 3VDQA 2Y1FA 3SVTA 2YY7A 3L6OO 1T2AA 3WGOA 4A10A 1GUZA 3DZJA 3ZWWA 2ZQYA 4DA9A 3U3XA 2OBYA 3E03A 3U4CA 4AJNA 4CQMD 1HLPA 1KVRA 3N58A 1B8UA 1EUZA 3BMCA 3ONEA 2ZB4A 5A9RA 1W0CA 4KTTE 3ICPA 1LBEA 4OIMA 4BVAA 2WJPA 2EJWA 3ZWBA 3E18A 1TI7A 3SLKA 4CUJA 4WE3A 1NAIA 1NASA 4FB5A 1M67A 1Z74A 4CR7A 3MOIA 1UUFA 2QRJA 3HQ4O 3T4XA 2W2LA 3KV3O 3P2YA 5DBIA 2C29D 1F0YA 3C7DB 3NDRA 1S6YA 4BNGA 4CMIB 1NAHA 2G17A 2QZ9A 5HBRA 4LN1A 1UAYA 1ULUA 5DT9A 4YR9A 4FJ1A 4ND3A 1ZKMA 2FZEA 2UUOA 4BQRA 2R6JA 1T2DA 1AE1A 3PWSA 1U3VA 2UYYA 4MIYA 3TSCA 4MVJA 3UF0A 3CKYA 3H3FA 4QQRA 4E21A 1YBVA 3AOEA 3OA2A 1GFSA 4CLXA 2OBNA 4J1SA 4PG5A 4WCDA 5DBGA 3EAGA 1RPNA 4RGBA 3O8QB 1Y7TA 1YQXA 5ITWA 2AQ8A 3EHEA 1T25A 1HDGO 1XSEA 3DBHB 1DRWA 2EW2A 3WX0A 5L3ZA 2Y68A 1U4OA 1K3TA 2FR0A 4Z6KA 3QLJA 5B1YA 3DZIA 3QRWA 4FN4A 4GX0A 1H6AA 1PJQA 4IXTA 4ZGWA 1MC4A 1PQPA 4JXKA 1QYXA 5KIAA 3O03A 2HKIA 5I9MA 1P9LA 3E48A 3WTCA 1LDEA 1GL3A 3LDHA 4GAEA 4B3JA 1GEGA 3KUXA 1WDLA 2E48A 4UVGA 3I9MA 3BMOA 3L4BA 3QA9A 3IJRA 3GQVA 3WYBA 4IDBA 1C0KA 3ASUA 4D43A 1C1XA 4RDHA 3RUCA 5JMPA 4P8RA 3QWIA 2NTNA 2O23A 2H63A 5FWNA 5JYDA 3DBLB 1P44A 4HFRA 3BTSA 1ADCA 3RWBA 3VAZA 1R37A 1BDBA 1D7OA 2PD4A 3P5SA 1HYEA 1BMDA 3PTZA 5COAA 3IOYA 2P68A 2WSBA 4M54A 3FNEA 3G0OA 1EK5A 4NMHA 7MDHA 4HX5A 3GFBA 7ADHA 1BXKA 1SEVA 3GEMA 4KP7A 4PLCA 4RVUA 4NPCA 4ZRNA 5I7VA 3V1TC 2PA3A 3D4PA 4N18A 4BNUA 4UUOA 5G4KB 2Z95A 2GN4A 4L76A 4HP8A 3MWDB 1C1DA 1SO8A 4J1NA 1O8CA 2EF1A 3OIDA 1HRDA 4IQ0A 3WFIA 4G5HA 3DHEA 1ZSYA 1QP8A 1M76A 2NTJA 2X9VA 4WCFC 1XHLA 4CJXA 4E5YA 5BQFA 1I3NA 3ZV5A 4AJPA 2DPHA 1RYEA 5ICSA 4WLNA 1QLHA 1N8KA 5TIIA 3GNTA 1F8FA 4QSMA 3WFJA 5HS4A 2Y66A 3L6EA 1GR0A 1EVJA 4J0EA 5ILGA 3JSAA 4KTVE 2OHXA 2IXBA 1A4IA 1EQ2A 3M1AA 3AW9A 4N5NA 3VZQA 4URFA 1ZMTA 1PEDA 4D3SA 2DQ4A 5C7LO 1DXYA 3AOGA 1MP0A 2O3TA 1YBMA 5A9TA 3QV1A 3MTGA 1PJTA 5IFLA 3F5SA 2QYTA 1I3MA 2F00A 4IGFA 3CMCO 2YZ7A 1VL6A 2NVUA 4KDEA 4BKPA 3HUDA 1QMGA 3CMMA 2R00A 3PZRA 5DF1A 1R15A 1B3RA 3SC4A 3UCEA 5A4DA 4IDFA 3KYCB 3TFQA 2PKQO 3U4HA 3UKOA 3ZV3A 4PIVA 4JBHA 1EMDA 1ISJA 3DR3A 4BO9A 1C0LA 3GRPA 4IDEA 1LX6A 1YB1A 5JDCC 1SOWA 2HQ1A 3H2SA 4OHUA 4W9NA 1R6DA 3DTYA 4IQGA 2PH5A 2JD0A 4RF2A 4U5QA 3JQCA 2EEZA 1XR3A 5KCZA 1U5AA 4DVJA 4FFLA 4YJGA 2PZKA 3I83A 2J3JA 1WXDA 5HM8A 1AXGA 1XG5A 2C20A 5IN4A 4MKRA 1EFKA 1VL8A 1U4SA 4I08A 1V3UA 2GO1A 3P19A 2BD0A 5JBIA 2YHIA 4HWKA 3ENNA 4XR4A 1MXHA 4UULA 4FFRA 2NU9A 1LLCA 1PJCA 4KWHA 3U09A 1LTHR 1A5ZA 5C5IA 5TF4A 2ZJ0A 4JJGA 4LCEA 2NM0A 4LSMA 3COSA 5BSGA 1TT7A 1Q7GA 2C2YA 3ANMA 2X0JA 1J4AA 2DT5A 3WIDA 2F1KA 4BNWA 3TNLA 4E4YA 4OQYA 2AE1A 3P7MA 5JY6A 3Q0EA 3VVCA 3CIFA 2P9CA 2Q1WA 2JAPA 5EQFA 4EEXA 3GVHA 4LVUA 1DLIA 1JU9A 2ZYDA 4ND2A 3BMCB 4FFPA 5F3RA 5DOZA 3RBVA 4I5GA 4DIBA 4FC6A 4EJ0A 2VWQA 4YCAA 1XU9A 4WPGA 1Y9AA 2C5EA 1GPDG 4I8XA 4NNJA 1EZ4A 2EIHA 2FR1A 2VHYA 3JYQA 4NFSA 3V1YA 4FSHA 1K5HA 1U1IA 3I9JA 4XRRA 3JD1A 3LT2A 4IXWA 3HDQA 3VKVA 4BKRA 4E3ZA 1UZLA 3C85A 4BO4A 1P1KA 2O50A 1Y8QA 4S1VA 4AL4A 5KTKA 3BTVA 4NBTA 4IQ8A 3L9XA 3Q3CA 3ADOA 3L4SO 4UEOA 3DMYA 3IS3A 4K9DA 1CERA 2BELA 3WGYA 3RBZA 2GN8A 1PS0A 4WNCA 2GASA 3ZGYA 4E5PA 4R68A 5TT0A 4P4GA 3QWHA 1KEPA 3BHJA 3GR6A 3K92A 1E3SA 3M2PA 3U4IA 3BAZA 4B7CA 4J9VA 4PCVA 1IPFA 2YV2A 4D42A 4LRSB 2A4KA 5CFZA 1Y8RA 4TWRA 3DOJA 1E5QA 1F17A 2PZMA 5FEUA 2D5CA 5I8WA 1YB5A 3JYLA 4IS3A 3PRJA 2P91A 4R5MA 1U28A 3U0BA 2NUAA 3ZU2A 1N1GA 4BNXA 4YA6A 3ETDA 3VPFA 1VPDA 2J3HA 4TKLA 3F1KA 3W6ZA 1EFLA 2AHRA 2YYYA 3BTOA 4GL4A 1YH3A 1IHXA 3GLQA 4YAJA 3SC6A 3U49A 1VE9A 4HNGA 3PFWO 4LW8A 1CJCA 1HXHA 1ZUD1 2UV8A 1I2ZA 2O2SA 5IJZA 4WNIA 2WMDA 3WYCA 2Y0CA 2FZWA 3HFSA 3X2FA 4ROSA 1YL6A 2X58A 2B4RO 1PGPA 1WVGA 4TRRA 3EYWA 2PD6A 9LDBA 3PQFA 3D7LA 4GGOA 5JC8A 2ZB7A 4Z9XA 4NBRA 1SB8A 4PZDA 3AY7A 3GVPA 5ITVA 3HDHA 2RHCA 1GCOA 2PH3A 1GY8A 4I9HA 3CINA 3O26A 5LC1A 4Z3DA 4BB6A 1VJTA 3TF5A 4DXHA 1TVEA 4H7PA 4AJLA 4FCCA 2DKNA 3AU9A 2GUGA 4LMRA 3GDOA 2CDAA 1NR1A 3RC2A 1HYHA 4XRGA 1WMBA 3CSDA 1OAAA 3BIOA 1OOEA 3ZNOA 4Z0HO 5IDWA 1I01A 2EG9A 1B2LA 1ORRA 2O3QA 3GNQA 3QIVA 3C3XA 1KS9A 3R0IA 1C1DB 1UP7A 4MVJI 3ZCXA 4DC1A 1XGKA 1JKJA 1P77A 1KYQA 2CD9A 2Y0EA 3JQGA 2A94A 3EMKA 4F6LA 3FNGA 1XQ1A 1Q0QA 4UVEA 3ORFA 3EDMA 3CTMA 2GZ1A 3ADPA 1I8TA 1K0UA 3TZKA 4YTEA 3N7UA 1H2HA 1I0ZA 4RVDA 2DPGA 4NBVA 1YQGA 2BGMA 3PIDA 4FOOA 2W90A 1EBFA 3DHNA 3HDYA 1R4NA 1XU7A 1DBVO 3JQEA 3SJ7A 3SLGA 1PZHA 4D45A 4QUKA 1WZEA 4B7UA 1GDHA 3LZ6A 5JC1A 4CM9A 2FR8A 5A04A 1U2GA 4J49A 1IE3A 1TLTA 1EDZA 3ZHBA 4BNYA 3ANNA 4II3A 2DU8A 1HF3A 2WD7A 2GF2A 2O7SA 3LT0A 4GWKA 2NVUB 4TZKA 4PFJA 3RUHA 1H94A 2E49A 3WSVA 4XGNA 4RPJA 5JCXA 4XIYA 5CEEA 2NQTA 4QFDA 3F6YA 5EJ2A 3AM4A 3QVXA 3RJ9A 3D5TA 1OZAA 4JX8A 4YT4A 1VLLA 4B4VA 4BNZA 1I24A 4EGFA 5CEJA 3T7CA 2NU7A 2PKQP 2Q49A 1N7GA 4CV0A 4RPGA 3GNSA 3VH2A 1JVBA 3ZU3A 1LLDA 2WTBA 1ENYA 4FDAA 4J2HA 5JYEA 2VHVA 4O6VA 4YWJA 2ZQZA 2YHIB 5G2OA 3W8DA 2I3GA 1HDOA 4BUCA 2RH4A 5TJHA 1BXZA 1P1JA 3DBRB 1YL7A 3MCVA 4XX0A 3AI3A 3EY4A 1B8VA 2RAFA 2D3TA 3HJAA 2RBEA 1RM3A 1ULSA 1UZNA 2Y05A 4XYLA 3BMNA 5A1TA 3LK7A 3TWOA 5G0WA 3DBHA 4F3YA 5CG1A 1X1TA 1T4DA 1HZZA 4HFNA 3G3EA 5L4NA 3HB5X 4JBGA 5KNLA 4R5HA 4GSLA 1IUKA 4LVCA 3ROMA 3IMFA 5JSFA 1PGNA 1EUCA 2HJSA 3FR8A 2FN7A 4GVXA 2EW8A 3W6UA 2WEKA 4CLOB 3AUUA 5F1KA 3H5NA 4YEDA 4WK6A 5U4QA 1U8XX 1YO6A 3IP1A 2RCYA 3H65A 4GMFA 5JCJD 2ILTA 4TQGA 1JTVA 2CUKA 1PL8A 3ZHXA 4RQUA 3G79A 2WDZA 2QG4A 4KOAA 3HG7A 1IL0A 1NFQA 2QRKA 1Z6ZA 3D1LA 4HFMA 4NHEA 4WGGA 2VYVA 3NTQA 4RVSA 4AJKA 2VOEA 1HE5A 3JQFC 5KWEA 1UDAA 4IZIA 4WCFA 3TFOA 5AYVA 4W6ZA 3ROKA 3MTJA 1Y8QB 1DFGA 3LT1A 2AQKA 3MZ0A 2PZLA 4CV2A 2CY0A 4P4NA
chains in the Genus database with same CATH superfamily
3CWCA 3IIIA 1U3DA 3MJVA 2DLNA 4OKSA 3NIWA 4V24A 3AI7A 1NI4A 4GX2A 1EB9A 1B15A 1QHXA 1QVAA 2ZRBA 1G5TA 3F9CA 3TDKA 2RARA 3G0BA 3ZWMA 4DA6A 2CZGA 1MABA 1SH7A 2GPAA 5G4KA 3KLMX 4JC5A 4MW9A 4XPIA 1H8ED 1L5KA 5BYKA 5IZ4A 3ZW9A 3I4FA 7AT1A 3DPSA 1YHYA 4EFLA 5IRCD 1GZ6A 2XWBF 2QD3A 4EARA 4XD2A 1MVLA 4TWBA 2BFDB 3EVCA 1YFKA 3SKXA 3I2YX 2BLLA 5HHTA 3MOGA 2HJRA 1VG9B 3DFKA 4MPDA 4IWXA 1H4TA 4RMIA 1OLSA 1FDUA 3IIJA 2WU0A 1Z5PA 3KOUA 4N5DA 1E4EB 1G20E 2ZPUA 4JWTA 1EPUA 4PLHA 2ZWAA 1MJ5A 4MYCA 1N77A 4ZVOA 2I2XB 2VOJA 3BK2A 5DGHA 2ZRIA 4R2MA 4FEYA 5ETJA 5AK3A 3FHLA 3VOSA 5EJ8A 5K8JB 1QE5A 2HDNB 2RC5A 4DLXA 4KQJA 1D1TA 2FI1A 1MENA 1FDSA 4Y6LA 4OJYA 2DH6A 3OKPA 2I4TA 2DWUA 3RFXA 3RNOA 5A5FA 2JI6A 2PJDA 1JZQA 1FXSA 3ILYA 2C2OA 2CLEB 5HOEA 1IY1A 1Y4SA 2B6HA 2EGUA 4LOAA 3RSQA 3TJMA 1KEZA 4JS0A 4JLBA 5CHYA 1ETHA 5ALMA 4CL3A 1ZJYA 1Y5MA 3DLHA 3ZLJA 4JI7B 2HMTA 3WXMA 3ZD9A 1QQBA 3WAJA 1SC3A 1U7ZA 2K6GA 2Q3HA 1U7HA 4JQZA 3SQDA 4G1FA 4O02B 3MEQA 4QUGA 4RYDA 3WL5A 4ZZ3A 3S0JA 5BR8B 3QEAZ 3K2EA 5E8RA 1ZUNB 1RTKA 1T8TA 3G82C 3A1NA 3G7SA 4IVQA 2VYNA 3TXYA 4H1HA 4U5XA 1FP2A 4FFOA 3GLFE 3K9CA 4F2GA 2YW9A 4Q9HA 1ENZA 1B0AA 3JALB 4MVJH 5AW2A 1L7RA 5DGXA 1T5HX 3WMRA 3FDZA 3GEIA 4BJHB 2X42A 1SCIA 4M8SA 2NXCA 5DK6A 3JU3A 2P90A 1T1RA 3GMSA 2A6PA 3K30A 1K5GA 3H9QA 5DIFA 1A1VA 2WW8A 3GW8A 4XWKA 4LJ5A 4C4PA 3TZCA 1M6YA 2ZYGA 5JDIC 2WKQA 1QUEA 3P5BA 4WK4B 3RTGA 3AL3A 1BMQA 1DPGA 2IYYA 1N4AA 4EGSA 4YBZA 1AZWA 4PLFA 4Q5IA 2Z09A 1LJ8A 3CRMA 3HCPA 2QZJA 3V7YA 4YK7A 3W4IA 3LFUA 1XOIA 2AA3A 2DZDA 3IOMA 1OB2A 3QVOA 1DIGA 4PS1A 4F45A 3THXB 7MHTA 3OZXA 4QOFA 3UAXA 4C0BA 5JNRA 3GDGA 1D4OA 2NU6A 1M2VA 4YQYA 2NV2B 5DNVA 2QM8A 2RE8A 4EUEA 2R6FA 3JQ7A 2Q62A 2AZXA 1VKJA 1CRLA 3OF3A 7GPBA 4C87A 3T8YA 5L3SB 1KL7A 2GEUA 2R8EA 1Y5IA 3H4IA 3ZXXA 4GEKA 3OTOB 3C45A 3DZBA 4PF1A 2M1XA 3QVLA 1NG9A 1PS9A 1R9NA 3O1HB 1LZLA 1O54A 2JBHA 3C1AA 3WGZA 4INAA 2EJTA 2AEFA 1NIPA 4PYQA 1ZBQA 4N0DA 2GVDC 3C5EA 5TJ9A 4OCZA 5F33A 3KCQA 3LH5A 3PKJA 3DCJA 3BEOA 3AZOA 4R1TA 2DJIA 2FEPA 3HI4A 3PWTA 5ESDA 3UMGA 1U2ZA 3X43A 1X0XA 3HUEA 3COZA 2R87A 2VAPA 1QIMA 1U7UA 1QK4A 1YS1X 5AUOB 5I7EA 3DUFA 1KSJA 1IK6A 2H1FA 3ZXSA 4ABYA 2BKVA 1DJOA 2RG1A 5KOHB 3VRHA 1LVGA 3AETA 5DLDA 2HXGA 2R96A 4HAWA 4OSOA 4F4JA 4A2WA 1ZINA 1D7AA 1SZJG 4EUFA 2Y93A 4DJ5X 1CR1A 3DT9A 1WETA 1FMFA 3HNRA 1JE1A 1NJ1A 3HBMA 1LH0A 3M49A 4NOMA 1JFLA 1G0NA 1KAHA 1PR4A 2QAGA 1E59A 3JCZA 3AFGA 3IAEA 4P80A 1HTWA 5CMLA 4GH5A 4D6PA 5CP8A 3TLZA 1CZNA 4U0KA 5CB8A 1GG2A 2I34A 3KZXA 1YS9A 3OPNA 3PXDA 2G70A 4J1QA 3JARA 3L8HA 3MERA 3GXOA 4TROA 3EWAA 5FBQB 4JY7A 2ZB8A 3D7NA 5CH8A 3W2IA 1NXOA 2XA9A 5D85A 5TF0A 9MHTA 2FSGA 2B37A 3BDAA 5ADHA 1RKXA 2ZSAA 3D7SA 4OVKA 1HDYA 3F6CA 3JW8A 3FRJA 1EEHA 3IT1A 1VJGA 4ZKDA 1H8HA 2X6RA 4LY3A 1ZVMA 3WYNA 3P9KA 1L6RA 4ZVQA 3PI7A 4A7PA 1IN4A 5DP1A 2D1RA 3WWZA 4MCJA 4ON9A 4R2XA 3TYXA 3ZV6A 2CLHB 5IH7A 2Q3FA 3MUOA 4D9JA 2PRSA 1KBOA 4KK4A 1CUZA 4RGYA 4DREA 3JASB 4LTMA 4JC4A 3KLBA 2VTDA 3KYDB 4PC7A 4G0UA 4WN9B 9ATCA 1CHNA 2DFTA 3IJEB 3PE3A 3R4VA 2QP9X 2XA2A 4KN9S 4MV6A 4ZHSA 3WJAA 3BMNB 3EGWA 3SQNA 1FUYB 1J90A 5ALSA 3GA0A 1GPBA 4LHYA 2AC2A 4FHEA 4LY0A 4CI9A 3FSGA 1HK7A 4FONA 4QODA 3KL2A 4EPXA 3IV6A 4OJNA 4BCBA 5FTLA 1P80A 3GRCA 2DR0A 1MQ8B 4ALLA 2ISQA 5LD2B 1M0EA 4HFJA 5DWQA 4P7BA 5FPKA 4DYHA 4OK3A 4UTPA 3QYPA 3SPXA 2Z2XA 3KIPA 5T6MA 3I2FA 1MX1A 3JQAA 3PWKA 4NNOA 1I2AA 4FEAA 1THGA 5FOWA 5ALTA 5BVHB 4CKWA 2FP4B 4MP6A 3QYJA 3DO6A 2F43A 4I6GA 1VMAA 4XIYA 1RZVA 1UDRA 3AEKB 3FUXA 2OGUA 4KBFA 1U7OA 2XECA 3OZFA 4BVGA 5ER9A 1GITA 2YWGA 4NBUA 1EXWA 3MELA 5DP2A 3TSZA 3UOGA 5B3LA 5CBKA 4GZLA 5IM4F 3GOHA 4LMAA 5I7HA 4RF5A 4MVJF 4F7WA 3GG2A 3OX3A 3WZMA 1TTPB 4MGZR 3RIHA 3P32A 1KY2A 1TDJA 3EH1A 4K6KA 2OHVA 3ADKA 2VZLA 1UBLS 3HA7A 1D6JA 3BD6A 3JD4A 4MUEA 4PRKA 1BS2A 1RLJA 4U9IS 2ZYRA 5IZCC 5JMOA 2HCRA 5HQ3A 2ACVA 3OJFA 1RAAA 4J1TC 2JIPA 3QYFA 1PT7A 3KVVA 3AIIA 1DXQA 2IELA 3K0CC 4TMXA 3RKRA 3RARA 1I36A 1JPVA 3A6GA 4ERNA 3GLGA 4MMYB 3QEMA 2UXBB 1NUAA 4EOGA 2R4UA 1MC1A 1CLEA 2ZVJA 3IPRA 3ZGZA 1N6RA 1P73A 4TWAA 4N03A 1ZHOA 3ZU6A 4OHWA 5KTPA 3UENA 3QXXA 1GTRA 4U3JB 3E27A 1Y6ZA 2NACA 3BDVA 4KQCA 5JG7A 4JX9A 3D3QA 3I01M 1CRWG 2PVCA 3PE4A 4Q3KA 2DXIA 1ZH4A 3F4KA 2VYND 5JJIA 3UJ9A 3PJGA 2PSFA 1FYDA 5AVVA 2Q2WA 2H7CA 5F77A 3ZXIA 3D7KA 1RI3A 4OK5A 4UFOA 5AUNB 4LK2A 1X7GA 1B74A 3D6MA 1DQPA 5CNMA 2YN0A 4BNNA 3M5DA 3H1EA 2DR2A 3FCOA 2DWPA 2G1UA 3CURA 3R3ZA 1F2VA 1UF9A 3I8OA 2R1TB 4OOEA 1KO7A 4Y8VA 1YZQA 1IQRA 3WRYA 4DV6B 4BMSA 1LC0A 2QRVA 3RAEC 2CVPA 5IT9A 4A26A 3PNSA 1IPHA 3JR3A 3ELYA 3JZMA 1CUFA 4D0RA 2J9RA 2OCBA 3CH5A 5LB2A 2UVPB 1Z8DA 3NBAA 4MVJM 3AB7A 2OV3A 2PGDA 3WBFA 4G9EA 3UJ6A 1IVSA 2QX9A 4GPEA 1UC5B 3HS3A 2E5WA 3KEMA 3GJYA 4MYHA 5TQ2B 3W6OA 5KX5B 5CD9A 4LRXA 3NETA 2HRQA 3VI4B 4M1MA 2WOJA 3WMFA 4AUKA 5A3QA 3K20A 3EARA 4WBSA 5TMEA 1DV1A 4HH3C 2XXBA 4HV4A 2YQ5A 2QTLA 1KOLA 5J4VA 3BERA 3AV0B 2W2TA 4N5LA 5B37A 3EVNA 1L5LA 2QAIA 5GVSA 2XRYA 1E2NA 2ZFUA 2HL6A 2VNAA 1L1FA 1G3QA 1L5HA 3D4OA 4ZDJA 1D8TA 1RHMA 2NZYA 4CM3A 4MQUA 4FFBA 5KDOA 1NF9A 1DV2A 5ENZA 1ML3A 3R3JA 4YRFA 1F48A 1L5GB 3TQTA 1TZMA 3V55A 1QCDA 1N5JA 1R2QA 3OLQA 2IY8A 4WJKB 1J8YF 4Z8XA 1ODKA 3FLEA 4KSCA 3WHKA 5ICCA 1P39A 1AY0A 2GZ3A 3FOBA 3WBBA 5DM4A 3RS5A 3DKKA 4GGPA 1TRHA 5JI3E 3L7YA 4Q18A 1BKYA 3PC4A 3W0LB 4C4SA 3CZCA 2BTOA 3ED5A 3LX5A 4F6RB 3EXHB 1N6LA 1Q6ZA 1XEWY 2A1IA 2HRDA 4GQAA 3I58A 5JATA 3JWJA 4JT4A 2PYZA 3RJMA 2BI4A 4FDLA 3ZJUA 4LJ8A 5BWBA 1EK6A 3CNEA 3ZLTA 1KC1A 1QF6A 4XM2A 3EMDA 1A88A 4Q6WA 1J5PA 1L7OA 3I76A 4BIIA 2APJA 3CSUA 5HBGA 4DG8A 1GTSA 5HK8A 1NQXA 4JXXA 3WGVA 2UYCA 4AUEA 4GL2A 3CM0A 1VKHA 2ZSKA 5SY9A 1JHAA 3ITDA 2CV0A 5YASA 2R48A 1WM1A 3RDPA 5MF6A 4PYMA 1D1PA 2XOEA 3IOBA 2AIRA 5GV7A 1GPKA 4EGCB 5ISMA 1H8HD 4GGMX 2QY6A 4FLFA 4QDTA 4MJLA 2JLZA 4JYMA 4M36A 2PGIA 4S2UA 1KU6A 3GL9A 4OB6A 3TIFA 3ZZ0A 1MLDA 3ITNA 2XNCA 2GN9A 2JIMA 2P4SA 4IZHA 2QPTA 3WK5A 1BXRA 4I1UA 2W0SA 2W22A 3W5SA 2OZEA 1L5NA 1C30A 4EO7A 1HQKA 1S2NA 3A6FA 3QZUA 3OFVA 3EZ6A 4MH0R 4TYYA 4R1NA 1CF4A 2X2OA 3H17A 1NVEA 4NICA 4QYXA 2C2BA 5DTEA 3PEEA 1Q7CA 4QHYA 4WKPA 2X6QA 4KRXA 3GT0A 4OFBA 4QBFA 3FSGD 4BGIA 4BQQA 3FOFC 4Z1MA 4MW7A 4QBIA 5EUCA 4DHWA 4ESOA 1T0JB 1L3BA 3QQPA 1Y6FA 4ODIA 4CM4A 2Q5JA 1YS6A 3ZK8A 1H3FA 1YI8A 2RJ3A 4ZQCB 4IDOA 4AKGA 1ZNWA 4WLOA 5DNUA 2WT9A 2KMLA 1NI3A 4B82A 5E3HA 2FOXA 3ZHUA 1J33A 1VJ0A 3QW2A 3AU8A 3HU5A 5H9VA 2AYXA 3JQBC 2V4ZA 1G21B 4YREA 2ZI3A 2H06A 1PT6A 3HDJA 2FZCA 3PHIA 4H4EA 4DY4A 1IN8A 1V16A 1N2OA 1NVWQ 4NPAA 3QUQA 1RYNA 3WMEA 1G18A 3QLEA 1F38A 3AXSA 1MOQA 3SZUA 2X41A 5AW8A 3ZHTA 3KR9A 3GFPA 2HCTA 3O4GA 1Z6AA 2XUKA 1PTKA 1QHHB 1GQOA 4P58A 3HXPA 3ZHZA 3R6LA 4WASA 3RYCB 1DZIA 3I5AA 3RTCA 1GQRA 2G5TA 3I1FA 4X60A 3WB2A 1ZJ4A 1YZ3A 1DKMA 3AKYA 4BKOA 1U3WA 3IXQA 3JV7A 3OT1A 2IYQA 2A35A 2UYGA 3BJZA 5E95A 1UJ5A 1XKLA 1ORWA 3ET5A 4K9KA 4CCYB 4LGVA 4XUDA 5C81A 2GN1A 2Y27A 3U39A 2FG7C 3G23A 4JGBA 2F1IA 1S9HA 4N76A 2XCIA 3FI9A 4EB6A 2WZCA 2VHCA 5JBQA 1W76A 2V7GA 2C4HA 3LUBA 1MFZA 3OZAA 2ZCJA 3S27A 2VHWA 3NZEA 1JSXA 1A7AA 2GZMA 3AG6A 4XOIA 4NZNA 3EWSA 3WGTA 2BKLA 2CN1A 2DFVA 3A4MA 1TM1E 1D6MA 1F60A 4GE0A 4LZZA 1A9SA 1CNMA 4YPVA 3A10A 1WO8A 1NBAA 1GTVA 3BK7A 3GVCA 4RZQA 1Z35A 3ZGOA 2GESA 3GC6A 4BCDA 5DTMA 3HN6A 3QFCA 5BNTA 4LC9A 1AKEA 3WQQA 1UIMA 2G6BA 2I6SA 4UHDA 3FIUA 4Q3EA 3EXEB 3WOHA 1KQNA 3QJYA 4EKGA 3U7EB 3GRYA 5KNBH 1K8RA 2HW8A 3LA6A 2YXNA 2ZGVA 2RD2A 3HY4A 3Q15C 1H5NA 2X1VA 4KIJA 3KYJB 3NCTA 1H22A 3EVFA 1TO1E 3T7EA 3CT6A 1UXKA 3RRZA 5B2ZA 4TQ9A 4D0SA 2BGLA 2YVKA 2V7PA 4BBAA 4HBZA 3PYXA 2CVFA 2WP8J 3QK7A 3THYB 2B4YA 2BBWA 1CUHA 2QD5A 1NX9A 2OM6A 3EC2A 1EK0A 4JSYA 5KREA 5KYNA 2WC1A 3QEJA 5AW9A 2OZLA 3LOUA 1EHCA 2PAFA 3FFWA 5AKGA 3AKCA 3RYHB 4AJOA 1FIUA 2XBLA 2H9IA 2W2KA 3UXEA 3VVBA 1P4AA 1E1RA 3FGZA 1TCCA 1RHQA 3USES 1WA5A 4FQ7A 1Y5NA 4KE6A 1FDVA 5FR2A 4FGJA 1XC7A 4F46A 5BT8A 2YY5A 1OD6A 1N3BA 1RQ7A 3LIIA 3EFOA 2YQ4A 3KCNA 3FPSA 3WLKX 4OAQA 3NBKA 5LMUB 1YMUA 4EFDA 4HX9A 2CL7X 3LNCA 4R41A 1A77A 3UIEA 1JJVA 3ITKA 4MUHA 2YV3A 2ZRMA 1E4YA 3U7JA 2FPKA 2P9TA 3B7WA 1G38A 3QY9A 2Z83A 2FGJA 1FFWA 1FDIA 3EOBI 3P45A 2CDNA 3OPYA 2HJHA 3PDUA 3WJ1A 4F2PA 2PCJA 3F2VA 5KWVA 3K0AA 4GBED 1UPCA 3X1JA 1WZ2A 1I1NA 2VDLB 1XELA 3CV3A 3GUVA 2POQX 3EYAA 1SQSA 2I3BA 3BD7A 4KYVA 5EQDA 2XX3A 1BKSB 2F48A 4FIDA 2C9BA 4OXXA 1LQ2A 3C41J 2A5FA 3F6EX 3PIIA 2A1UB 3R20A 3ESDA 1GRQA 4A0QA 5BWLA 2NXWA 5ITZA 4ABTA 2X22A 2H1VA 3Q5GA 3H18A 2LZ0A 1K9SA 4B80A 2XI4A 3L7IA 1VSTA 3B70A 3DEAA 1J8MF 2VAWA 1XYYA 2XUHA 4UBNA 1YR2A 2J1LA 5T4BA 3Q8KA 4LKOA 3CLUD 1M83A 3VO1A 1SKQA 3AJ8A 4QT0A 5G0VA 4CG3A 3HO1A 3G0HA 3ZDQA 5J5CA 1TYBE 4D8VA 2B36A 3L1VA 3LY9A 2OPHA 1HZJA 3GPIA 4LJ6A 4TSKA 2YVQA 3E3LA 1P9RA 2NSJA 3MXTA 4HEJA 4MV1A 5NULA 1EXMA 5KDLA 5K45A 5DXAA 2FYTA 4N3GA 2I8AA 1OLXA 4XB6B 1UMCA 3HUTA 1TT5A 2FN4A 4IW3B 1RBYA 1WKCA 1CYDA 4KL8S 3VYUB 5JHHB 5KJCA 1ZGHA 3KSZO 2EHJA 2NTYC 1GU1A 3DLIA 1XVIA 3NT2A 4EG0A 2G08A 2I22A 1NR7A 2J5QA 3GFVA 4LYJA 4MVJP 4QHSA 5C3UA 3G9UA 4ZMBA 4LHZA 3OF2A 5TEVA 3IAUA 3O3OB 2P4EA 1U8CB 3R0JA 4QOJA 2AG1A 3RHSA 5A7FA 4W1SA 3W5DA 3LC2O 1E3WB 2ID9A 3PWZA 4KQ2A 2Q4OA 3QVWA 1NRJB 2VK2A 3AESB 4IL5A 4NDNE 4QLOA 2OCIA 4YQEA 2QTRA 4RV4A 4TN1A 4AX4A 2SECE 5IAEA 1JJFA 2VP0A 3L4EA 5KOYA 2BFEB 2H5JA 2VDQB 3EW7A 3MILA 3NU1A 4NQZA 4AZ3B 4JSTA 3GEBA 2X9QA 4GXTA 1HE1C 3AL2A 5BSWA 2Q8PA 4JOQA 3O21A 4KVZA 5TQJA 2EV9A 5FUBA 1DTWA 4PAMA 3H7AA 2G77B 3NP9A 1C7QA 4J1TA 4KUHA 2X9GA 5IW8A 3P20A 1VI2A 3ADDA 2OO3A 3GHHA 4JT8A 1GIAA 4MUKA 4RZUA 1E3DA 1VFNA 1V8FA 4TTTS 4YRMA 3QSYA 3R74A 1X3LA 3T9FA 5FOQA 2C5HA 2Z0MA 4PQYA 3WY9A 1O5TA 3CA8A 3LL4A 1BMTA 1R12A 1SVNA 3LBFA 1NXQA 3D7MA 3IULA 2HK6A 1P2FA 3CC8A 5JNVA 5M2QA 3FDFA 4LJLA 4MA5A 1DAMA 3UJPA 2FN3A 4DR7B 1FPMA 2B9EA 2R68A 4CCAA 4YAKA 5LZ9A 1D04A 1I7LA 2C4KA 4ND4A 3TQHA 1HKHA 5IKMA 4ARZA 2O5VA 1CUSA 5EKUA 3C5WP 3RC3A 3VX3A 3DZFA 1KY4A 1DARA 5DBOA 2WSSD 2PLAA 1XZEA 2FQXA 3GMDA 4W82A 1XRPA 4NEHB 4EFMA 1J2RA 3DM5A 5KNDA 1HNXB 5FNVA 1S1CA 3N7TA 5AUPB 3OC6A 1TVMA 1L1EA 3V8NA 4HNSA 2P4QA 2PPVA 4QUDA 4TMFA 4A2QA 3EZNA 4EJSB 4YMLA 2VT2A 4Q01A 2W83A 4IIYA 1C0IA 2C9YA 3UO8B 5KPJA 1IBCA 1F51E 4GX1A 2DUNA 2EQ5A 3IPAA 3N2KB 1OU0A 5CAEB 5BW4A 2XYVA 4OKNA 1Y80A 4QQNA 1V5WA 3BICA 3OA0A 1PEAA 2IDMA 2YC4C 1V4BA 2FPWA 2ZRLA 1VMDA 3K96A 6ABPA 1CY4A 3L7CA 7YASA 2I6GA 1CUYA 4YH1A 1OY1A 2D4AA 1JDJA 2FFBA 3I92A 3IPLA 3LT5A 4F3KA 2V6MA 1NONA 1OGJA 2YNMD 1RJFA 1OV6A 2ATCA 2H1RA 4P84A 3ZCRA 2JF0A 4ONEA 1FSSA 1YI1A 4FJ2A 1GXSB 1UWLA 5DB4A 2CXUA 1RFLA 2PXXA 3H1TA 1HE3A 4ZAVA 4HNAA 5FOSA 1TKCA 2ONYA 1DRKA 4WEOA 4GMXA 4AXXA 1SM4A 2Z8XA 3B20A 4HGQA 3G8AA 4EP1A 2HHJA 4TYQA 5JNUA 3K70B 1HC7A 2PXAA 4EY8A 2Z9CA 3R7WB 1MHPA 2V0NA 1JPUA 3IDOA 4X20A 1VIMA 3VHQA 3KELA 2OGTA 2VQSA 1OWOA 5FBZA 4B9EA 4EYGA 5LA6B 1AXEA 3F3KA 4DV2B 3MLBA 3N0VA 3OEYA 1PK8A 2ZAGA 1H4VB 5CYOA 1V1JA 2RJOA 1Y8AA 5DTQA 2Y4NA 4OHPA 4TTQA 1G64A 5BNWA 3A6EA 3U13A 1QBKC 1IY9A 5K8VA 1DADA 5LMZA 1W4BA 4BEWA 4OI0A 2CVQA 2IYZA 3AO0B 2WUWE 1BQEA 2RGXA 5JE8A 1OXXK 3SDZA 1Z88A 3LQQA 4XM1A 5D6NA 4EHKA 3H9CA 3JVIA 2DSTA 2QX8A 1YZKA 4GKKB 3VR0A 1GYRA 2Y76A 2V6GA 4WJZA 5DHTA 6NULA 4HR7A 1UBCA 1R27A 3AUXA 1QRSA 2VDVE 1UC8A 1CUBA 1VIAA 3CRVA 1YVEI 4OREX 2L2QA 4YRNA 1YOVA 1W4ZA 2E55A 2KBEA 4QDXA 5LDGA 5AESA 1FZQA 1WCIB 3EF0A 3IAHA 1FTQA 1VE5A 3AY6A 4UFPA 3JZFA 1FDWA 1MPTA 5AVRA 5GY7A 3AINA 5CBPA 2ZRKA 6GPBA 2YL2A 4G1UC 2P6NA 4GDFA 1GPMA 4FMPA 1R0SA 1NVTA 1P2SA 1ZESA 4OLJA 1SKAA 1TYZA 1TKBA 5DH9A 3VKFA 3UK6A 3O8RA 4OYRA 4HDNA 3EA0A 3TIGA 5SZHB 5MN6A 2IEBA 4CWAA 4UHHA 3D0QA 3QBVA 1SKBA 2WTAA 3DWGA 3LPCA 3UBMA 4X64B 5ALWA 4YR7A 2AQIA 1QH1B 2C94A 1TCUA 1GT91 5JRJA 1RC1A 2VH1A 4QSHA 3ZTWA 2C54A 4WBNB 4E2WA 1H9AA 3BHMA 3EULA 1G19A 1JEQA 1HKUA 2ZI7A 1SUWA 3HCDA 1QKKA 1Q95A 3H9UA 4XTCS 3L2OB 5JSUA 5GV8A 3NHUA 3R3UA 4RD3A 3W4KA 2H4XA 2GILA 2PWZA 4JUCA 1U9IA 3FH0A 3PC2A 1Q0SA 1H2BA 4IDDA 4JBIA 5HDQA 2AVDA 1MVNA 2VR1A 3CZ9A 4HUTA 4YGYA 5M5BA 4ZTZB 4KO2S 1OC2A 2ADFA 2EU8A 5E6RB 4FGKA 1DMSA 1YV9A 1YB4A 2J5BA 3CONA 4G5XA 5AKJA 4K88A 4NS4A 1N8NA 3BYZA 4U0JA 5EP1A 1E9SA 1JR3D 5H7XA 3ZWXA 2ZIUB 3ND9A 2QV7A 1R4MA 2QW1A 6ADHA 2ZJ5A 1HYGA 2YJGA 2QP3A 1G3MA 3SIWA 1E5LA 2BFBA 3Q1LA 5FD8A 1XTPA 5BPHA 3TAUA 2IYAA 3DEFA 5D5PA 4UBKA 4I9UA 3RYIB 4KE9A 3AEUB 5B4UA 3OKAA 5ED0A 1C3JA 1DO0A 1F8XA 2G4LA 5D86A 2O48X 1LSOA 2VZ0A 3W2FA 4QASA 2J31A 1FW6A 5C7OO 3VO2A 3SY8A 1MB0A 3T7JA 3SWWA 3KUDA 3CF4A 1QV7A 2P5YA 3FVRA 4J0QA 1QCZA 5EZ6B 3CLSC 3FFBA 4KDFA 5KQSA 3FPBA 3OQ6A 4KDRA 3PNVA 3AERB 4D97A 1YAHA 3E5RA 3G0IA 1JYSA 3L0YA 1P1HA 3PLRA 4UU1A 4KG7A 4Y3UA 2XB6A 1VLHA 3TUJC 4BNHA 1QQ5A 3P4UA 1JILA 2GLXA 4R9RA 1PFVA 3O8OA 2FAXA 5GJWC 4E6PA 2AG5A 1S5PA 1ONBA 1YONA 3UGTA 5BWNA 3NWBA 1OWNA 4HDSA 1J5EB 3G1TA 1K97A 2KW5A 2VT7A 4XSVA 3QV2A 5EL0A 2FB9A 2CVHA 4D74A 2GPJA 4MV8A 2I80A 3IMEA 3L5OA 4WNAB 1FNBA 2OVBA 3Q1KA 1PJBA 1UODA 4MP3A 4FC7A 1XP8A 4AY2A 3KU4A 1WSDA 3E9RA 4CMBA 1QQTA 1XYGA 2OQRA 1OH7A 4BPRA 1R5NA 5JSZB 5KNDD 4BO5A 1J00A 5EIEA 1W49A 1CP3A 1M7BA 4M55A 1FSPA 3NXSA 1H2FA 4L73A 3LZCA 1OXUA 3THOA 4DMFA 4LBYA 1XZKA 3OOWA 3SDSA 1MO6A 2CCGA 3KRTA 5DMXA 3V8MA 4M9QA 1SCJA 5I9BA 1BO6A 3R9KA 3RADC 2D7JA 3A14A 4FNOA 1C9EA 1EA5A 1XXHA 4DMLA 1JBQA 2GFHA 1W47A 5A62A 3LUKA 5M04A 2ZS8A 3GFTA 4IIGA 2V4MA 3GUZA 1N2JA 2YV1A 5M29A 2WVGA 5A1JA 1UDCA 2JGNA 4CR8A 4MPTA 2I76A 3HSKA 1MQAA 1Z12A 2KJQA 3ES9A 2NZVG 4BO8A 5I9IA 5A3RA 4AN1A 1R0ZA 3N7AA 4CQLA 1QQAA 1YIAA 2BH9A 2QJRA 4XGIA 4ALMA 1JFSA 5CLFA 1WY7A 3A6LA 1NVBA 3C3WA 3HJCA 1IJFA 4EYQA 1GKUB 3KZOA 1KA9H 4XD7A 1O03A 1Y8ZA 1J22A 4YQFA 1ZU4A 2QUJA 3JSXA 5ER6A 1BDJA 4TS4A 3RVDA 5J4HA 2GCGA 1M8JA 1UKYA 3PKIA 3S2FA 2P6UA 3RIGA 4KWCA 1KP2A 2ZT7A 3JWIA 3WGNA 2CHEA 1SCBA 2A92A 5IAGA 4D9CA 2W6ID 3GRAA 1ZM2A 1U0BB 2QRQA 1V6SA 2HOQA 3KHKA 2OC9A 1IPEA 4IJVA 4OXRA 4B7ZA 1SVSA 4D98A 1UOEA 1GZ3A 4FWTA 1BQ3A 2C0QA 5D7NA 1TGYA 1S2IA 1UDXA 1CUJA 4KQWA 4UM5A 5TX7A 2DCMA 1MIOB 1U0FA 3H9BA 3RCBA 3A6PC 2VWPA 2WRZA 5GMOA 1YZLA 1TD1A 3PL5A 1N3YA 3VSAA 4NSNA 3I6BA 1ADBA 2B3DA 2CXOA 2WM2A 1VMEA 2QJFA 3L7LA 2L0XA 4U7JA 5L40A 3PB3A 5EIOA 2JHAA 1GOTA 3JVEA 1AD2A 3BA6A 4M0MA 1LRJA 1TTHA 1TW2A 1LBIA 1ZN9A 3OOYA 3PC7A 4QBHA 3MVEA 5E7MA 1KMMA 1Z6XA 1DOZA 1Z63A 5SY6A 2FMUA 3VH3A 3KXIA 3VDNB 1CHDA 2IS2A 5F1YA 5KNCA 3OQVA 3ZBPA 2GSDA 2Q1YA 3W3ZB 2HUNA 4C14A 1X42A 1C50A 4IGAA 1OSNA 2UU9B 1UBTS 3DZ8A 3VBEA 1KI1A 2RJNA 3S81A 5BT9A 1MO4A 1HDRA 3E0QA 4FD3A 5ES3A 4B46A 3AI1A 4EHLA 2I9PA 1XDZA 1CIPA 3CXUA 3PXAA 1J7KA 1DCFA 4JJ7A 1XPJA 3OCJA 3ET4A 1NJSA 1X1AA 2QTAA 4ZJUA 1L4NA 3GJ8A 2EVWX 3KWLA 4OL9A 1CUDA 1WVIA 2D2FA 4C6RA 1A50B 2YIMA 3AFMA 3CR8A 2CGEA 4WLUA 2VTBB 1L4BA 4K9QA 1TVCA 1XIVA 4QGBA 2GXQA 1SWVA 2OYRA 3NUZA 4MVWA 1FFAA 4TTJA 1N6NA 2YRFA 3AZPA 4EYEA 1XVVA 1N2IA 1Y9JA 1CQWA 1GAEO 1L7DA 3FAZA 1IEQA 1OFVA 4CCWA 1FFCA 2TRSB 4Q4JB 5FWDA 5T4FA 1TVKA 1JE0A 3AR5A 3O95A 1GJRA 4LNHA 5HUHA 1JJIA 2CLOB 4UZEA 1DPFA 1CBUA 2O3JA 3TX6A 4D9FA 3PPXA 1OC4A 4FX5A 2YWBA 5A7HA 4Y6SA 4CV1A 2JIRA 4LJ4A 3T5AA 2XE4A 3BDIA 4PTYA 3RTDA 4I2NA 1MRSA 1VCNA 3RPEA 5L4LA 5DLYA 3FPCA 1T2NA 2QY9A 4UEQA 5EMHA 1EJ6A 2HCFA 3C6YA 2H1IA 4RL4A 5FIUA 2BEVB 2RSLA 3KDSE 1BFKA 4WY8A 1KWKA 1R0YA 2XCLA 5JZVA 4AZWA 3RREA 2C3UA 4MA0A 2PMCA 4CIBA 2GZAA 1PRYA 4DR5B 3BFJA 3Q2OA 2IBSA 3K6JA 2C5LA 2I4RA 2I7DA 1G5RA 3AJRA 2FPGB 4UE2A 4YCDA 5GONB 2OYSA 4DVGA 4MQEB 2ZREA 1EU1A 4L4RA 1SUPA 3B1ZA 4H7JA 1U9YA 5KWJA 3RB8A 2W2QA 4M8NE 1Z83A 4E2XA 1LB1B 3FBWA 2Y71A 4IIFA 4V02A 4YRBA 4KIFA 1XMVA 3A6DA 1HEYA 3DAHA 3NYRA 2W6ZA 4JQYA 3HJFA 3ZW7A 3I53A 1Q77A 1Z73A 3ELWA 1JR3E 1SNYA 1I1HA 1MBZA 3KTFA 3P0IA 1DIOB 4LYAA 4RA9A 3VV3A 4N41A 3IQXA 2GJAA 5AVOA 3EBPA 3HCWA 2JFQA 3N39C 3IR6A 4Q7JB 4F56A 1BHSA 4CM1A 1VBFA 3HYNA 5JANA 2HTEA 1WMEA 2QIPA 4KO1S 3T0FA 4CR6A 3M7IA 2JK1A 4BNDB 1TW3A 1CIJA 2ZR9A 3LO8A 4PYLA 4ASUD 5CIQA 4JL5A 1NGSA 1OFGA 1WWKA 1T24A 1E2DA 2AFIA 2YRWA 1SU7A 4BNVA 1NXPA 1KKMA 3A4NA 2REQB 5FORA 2VTEA 5K0NA 5SYMA 1SHLA 4RV9A 4D3FA 2UXCB 1W5FA 3QUBA 4UBOA 1D1QA 1R9JA 3EGIA 4IKOA 3MIIA 3NDIA 4Z9BA 4P35A 4P38A 4Q48A 3RUFA 1BDHA 3UW1A 4KNYA 2HQRA 1T5IA 1D4ZA 2C0CA 2OP0A 3F7OA 3VM6A 2YXPX 4JA2A 5BSHA 4WOCA 2CWDA 3SEFA 4L5AA 1V39A 3IT0A 2JVIA 1SQGA 3O8DA 2IPXA 4MIEA 2O2EA 1N2CE 4DW8A 1H4QA 3PA6A 1EBBA 4HN2A 1KY5A 3ZWQA 4GMKA 5JXHA 2VDPB 2ZJ6A 3GWGA 4RIHA 1IRIA 3M4YA 2HDWA 2JGFA 5F2NA 1S3SA 2DFLA 5D8DA 1EFPA 3D3EA 1N2SA 4IWNA 3AM3A 1Z7YA 4XQEA 4NJMA 2BFAA 1SVWA 4AP5A 4ECAA 1C8BA 3V7UA 4O3FA 2JLYA 3ASZA 2Y6UA 3I9LA 4QIHA 2FU5C 2IQ5A 1Z7BA 1A9ZA 4B79A 1WDWB 4C21A 4DOMA 2UUAB 1DJLA 1VYVA 1CUUA 3H87A 5IXYA 2O2IA 5D5QA 2OBMA 4KXQA 4X85A 3C87A 3DM9B 4IOJA 1RYBA 4XIJA 4YJFB 1NXSA 1JQ3A 5ESWA 4B3FX 3G8CA 2C2WA 3K5HA 5CK5A 3U3KA 2IKSA 1JMKC 2OAGA 3IVMA 3S7ZA 4JU8A 2D2VA 3OCZA 3HM9A 2BGWA 3PJEA 5HUJA 3G5MA 5IANA 3AHJA 4G1MB 3PFKA 1AKVA 1CUIA 4MQ4A 3UMBA 4RHUA 3ACDA 2O2HA 3KOZA 4LRTB 3ZDXB 1IAVA 1QF7A 1WW3A 2P9JA 2PO7A 3KPYA 4UVDA 3H11B 3FYHA 2J5RA 2WHPA 3NGLA 4U2FA 1KJZA 3AMVA 5HF8A 1L5YA 3NRBA 2ROQA 5DN9A 4LE2A 2V5VA 4GICA 5EC8A 4BYGA 2O8BA 3N8DA 4KVGA 4R8RA 4ALJA 3K6SA 4DLAA 3STXA 3ZE1B 1QE0A 1ADYA 2CDBA 2ODNA 4CEHB 5AM1A 5CJ2A 1IZ7A 3NBYC 2WF9A 2XNKA 1YI0A 4NV1A 5HNKA 1SHZA 2NNWB 5JMWA 2KWIA 2YWCA 4TKMA 2J08A 1OI7A 1TPYA 3EG9A 421PA 2XB4A 1NE7A 2W4QA 4YECA 4AMYA 5AW0A 1P45A 4K9MA 4HWOA 5HTOA 2WE8A 5JZ9A 4EX7A 4I3GA 5J47A 3H5IA 3QOXA 4OATA 2ZJ1A 1PVOA 2YUIA 1S2LA 4A6EA 5HQJA 4RQBA 1N7HA 3AF2A 1PBTA 4KSBA 4Y9DA 5CT4A 2J0SA 1R3UA 3EQ6A 1AUOA 1P9WA 1T2EA 2R7MA 2ZRFA 4WKBA 5B36A 3PT5A 2QI9C 4NJEB 1CQJB 3C1UA 4NDZA 3LO5A 1B6SA 3SDBA 1OGYA 3BF7A 3PCXA 3T9EA 3QH4A 4F1KA 3LWNA 3VDXA 1AK1A 1HI9A 1Q20A 1RPJA 3E1KA 4J43A 4S05A 3KQVA 1C8LA 5EJGA 3DOCA 3BS4A 2WYVA 4G24A 1N5RA 1TQ4A 4Z4IA 2BM9A 5EESA 3CPEA 5DYWA 4JN6B 4BJ5A 3DV0B 1DG9A 2KI5A 4EITA 2JZOA 4XLZA 4HLCA 4HEA1 5HIJA 4BFVA 3VGPA 3HBLA 5FQOA 2C5FA 1DX6A 1HQYE 2QOEA 2VNHA 1JHDA 5COBA 1YRAA 2QZSA 5DLEA 5HCNA 1QIDA 2XF2A 4ZQGA 2G82A 5ENVA 4M1YA 3CVVA 1V8BA 2OD7A 5BSUA 2OC4A 1BXGA 2H00A 4H17A 4R3WA 2B4KA 4KRGA 2ZW9A 1T1SA 1G20B 4RUKA 3ZDAA 2DBVO 4JC0A 4LJYA 1GZVA 5I4BA 2TSYB 3W7VA 2GPTA 3AUJB 4FGWA 2IOFK 4KREA 3FDJA 3W9SA 1Z22A 3GH3A 1H2RS 1PX2A 1XCJA 2OV4A 2V7XA 1V2HE 1TOAA 3HA5A 1EFVB 4OX9Y 3EJ6A 3GU3A 1N7JA 1U94A 3OTQA 5EFZA 4BP1A 4HVAA 4US1R 3FMVA 4ERXA 1M8PA 4IGEA 5K8UA 2DQKA 2CXQA 5KNDH 3IKTA 2E82A 4QOEA 3UFXA 1Q0ZA 2BM8A 4ITUA 2ZEJA 3DVRX 1RE1A 1UINA 3CU5A 4FUQA 3TLKA 1W6UA 4LXIA 4CLEA 3VKGA 3TTSA 1ABFA 2PYDA 2JFNA 4LCBA 4LTNA 4Q9NA 2R8OA 3MLAA 5DGCA 2ZVPX 4Z1OA 3JYPA 4FXOA 3M70A 4PO8A 2J6IA 3S5UA 3AUTA 4QX6A 1E92A 1E4VA 2OQ2A 2ZB2A 2H0QA 1P29A 5FL7D 5FPYA 2EFHB 1IHYA 4MW4A 1QZZA 4YMSA 1HO3A 3UXMA 3NDBB 3RFTA 3BJEA 2PZ8A 2VAMA 3FPJA 1HSOA 1ZH8A 1D2HA 2GAFA 3K2IA 4L5JA 2IC5A 3ZW8A 1A5BB 1XTZA 1GILA 4RWZA 1MC5A 1TM3E 3RK4A 3IPCA 3VU8A 5K5EA 4OBEA 1D2AA 2GHRA 3C7AA 4S0XA 4YUYA 5EJEA 1XMPA 4CI0B 2VT3A 5ERYA 5TLSA 1XPRA 2KLBA 4RZHA 1Z4OA 1L7AA 1QTIA 3L7BA 3VH4A 5TV2A 1QJ4A 3GFOA 4MZDA 3WIEA 4PRYA 1E7MA 1Q57A 1AKMA 5ICFA 4O2RA 3OAAA 2BF7A 4HDKB 5IH3A 4O4LA 1U6KA 4MYSA 3EIFA 2BH2A 3RTBA 5HQTA 1QCCA 4NLLA 3OJLA 4JSRA 2FZVA 3DL4A 3N5KA 4GU5A 4YRAA 5IC4A 4WNYA 3UBTA 4IJQA 1C7RA 5BW5A 2HAEA 2EERA 2WILA 1NXVA 1ZFNA 1X7DA 4G3XA 1VRVA 2VG8A 3G2MA 4K9LA 1T4GA