2VHYA

Crystal structure of apo l-alanine dehydrogenase from mycobacterium tuberculosis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
370
structure length
324
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVMKPGAVLVDIALFYCMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 98
structure length 324
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhyA02
4M54A 3QWHA 2X6TA 3HFGA 3HDYA 3FR8A 2NU9A 5AYVA 2IEDA 2GUGA 1KVTA 3QY9A 2JJYA 2Y1OA 4DXHA 4RCVA 1X0XA 1YQGA 4L0QA 1FDSA 4BNIA 1RKXA 3HDJA 4WEQA 1A4UA 2EJVA 1B3RA 2X7HA 3T7CA 4YWJA 1HZZA 3LQFA 4IDEA 3DZFA 4A27A 5DF1A 1NX6A 3KYDA 1VL6A 2YUTA 4FFLA 5JNLA 4RQUA 2X9VA 4QQRA 4OM8A 3VZQA 3TQHA 5A3JA 4W7HA 4FJ2A 1XG5A 3ASUA 4LVUA 1YDEA 4BGUA 2AG5A 4PLYA 3IUPA 5TX7A 1OC4A 4I5FA 3EW7A 3H3JA 5DP2A 1UZMA 4D3SA 4G2NA 4BL5A 5TT1A 1Z7EA 1IYZA 1T1RA 2JCXA 3I9NA 4H3VA 3VDRA 4LVCA 5A1TA 4YJDA 3RFTA 1D3AA 1A71A 2X5JO 2AQ8A 3AOGA 3JQ6A 2W90A 5AXBA 4TZKA 1UXHA 4OXKA 3WOHA 1DIRA 3VZPA 3GEMA 3IC5A 3GUYA 2VUUA 1OI7A 1TB4A 3HNPA 1E6WA 5BQFA 3H3FA 4IXTA 3ZGYA 4DBVO 1ADFA 5IXYA 1ZH8A 1MP0A 4J1NA 4AFNA 3WTCA 2ZK7A 5CEJA 4YJFB 1LLQA 1R66A 4CMEA 4D3FA 1XGKA 2Y1CA 3A28A 1KERA 1QG6A 1MB4A 1TT5B 3QP9A 1P1HA 3PEFA 2H6EA 3JSAA 3OICA 3O38A 3ZV3A 5DBIA 3FN4A 2PGJA 1PJLA 3D7LA 2WWRA 3W8FA 2BI8A 4CQMD 3D1LA 1CIVA 5CEFA 3GPDG 4G65A 4UUNA 1UXIA 4FFNA 4BGVA 1P0FA 4R01A 2X22A 1PZHA 2NTVA 1EQ2A 1NAIA 1NVGA 4F6LA 3BTUA 1K0UA 1NWHA 4WK6A 5TQVA 1PGPA 4HFNA 3F3SA 1DDOA 3QLJA 5L4NA 4DPKA 1E6UA 1PTJA 1WZEA 4IDBA 1JTVA 4KUGA 4BNZA 5EN4A 4P4LA 1HDOA 5IZCA 1JKFA 4OOFA 3RD5A 4ZQBA 5JE8A 1VJ0A 2GO1A 2OBNA 3FPLA 4P4NA 5MDHA 2DPHA 3GAFA 5B12A 1SZJG 2A94A 4GKBA 3HDQA 4UEJA 5CPBA 4CR7A 4J0FA 4MKRA 5JAMA 1NNUA 1EZ4A 3P2OA 4GVXA 1LBEA 3LLVA 2BMAA 1Y7TA 5MGBA 2D0IA 4J4BA 4RVUA 1SEVA 2CDBA 3PGJA 1LRLA 1H6AA 2WYUA 1E3SA 4Q9NA 2VNSA 1FK8A 1I01A 4E32A 4L76A 3LDHA 3ITKA 4RVGA 3VTZA 4WASA 3ROQA 2IXAA 2NUAA 2AEFA 4GWKA 3DL2A 2DBZA 4KTTE 5ER6A 4FB5A 4R5MA 3PHIA 2NADA 1WDLA 3M6IA 4MP6A 1Y8RA 2B4TO 1JKIA 4DRYA 1G6KA 1C0LA 1ZXLA 2BI7A 2GN6A 3BMOA 3PYLA 4N5LA 4B3HA 1ORRA 1LA2A 2CVQA 2HJSA 3D4PA 3M1LA 4BO0A 4FIZA 2YHIA 2GERA 4CM9D 3O8QB 3VOSA 2NTNA 1PEDA 4A2CA 4EI2A 5TS3A 5ICMA 3MWDB 4E5KA 1XLTA 4WLFA 2X5KO 4UVEA 4AJEA 3PQEA 2B4RO 3TZKA 5IJZA 2BH9A 4FGSA 1EBUA 4IQ0A 4UVGA 5HS4A 3W8EA 1TA4A 1JKJA 4O59O 3CKYA 2QZZA 3H2SA 3PDJA 4R41A 4F45A 3HUDA 1HLPA 5I8ZA 3RROA 4YJGA 2RAFA 3I9OA 3NTOA 5GZ1A 1J6UA 2ZB7A 5HM8A 1A27A 1BXGB 3S55A 1PL7A 2GZ3A 3PLNA 5BNTA 2D5CA 1WW8A 1YVEI 3GMSA 4PZEA 1NBOA 3L0DA 1CF2O 5JO9A 4XQCA 4XB2A 1BRMA 1ONPA 4X54A 3NDJA 3TL2A 5AVOA 4L74A 4R9RA 3VKUA 4CLHA 2D4AA 4O6VA 4J0EA 3NDRA 2UDPA 1QXSA 5BSGA 3RQSA 4KQXA 5CDTA 2FR1A 1EMDA 5U9CA 1QR6A 4QFDA 4IJVA 3NUGA 1E7MA 3K9QO 5AXCA 3ZU3A 5FWNA 4G5HA 3PXXA 3QWIA 1LSOA 1QYDA 4O63O 5TLSA 3AY3A 1RM4A 1UDBA 2R00A 3I1JA 1YQDA 4JBGA 1PQPA 3G17A 1GL3A 4L4SA 4OOEA 2AE1A 4CPDA 4E0BA 4MIOA 2XPCA 2YDXA 3JD1A 4EJ0A 4LW8A 5K0ZA 3DBRB 3C3XA 2X8LA 3U09A 4J6FA 1IOLA 3S2IA 1U9JA 1L1FA 1SMKA 2QX7A 3X2EA 2UUPA 4GLOA 4FOOA 3LK7A 2X1HA 2WJPA 5JMWA 2X0RA 3CMCO 4WCFA 4U7WA 5JYDA 1P1JA 3V1YA 1H2HA 4OO3A 5HBRA 1P45A 5TNXA 1DLJA 4Z9YA 3U62A 2W2KB 3D3WA 1LSUA 3GGOA 1H5QA 1E3WA 2ZQZA 3UW3A 1AHIA 1OFGA 3AI1A 4A03A 3A9WA 1W4ZA 4J2OA 3WSVA 1X14A 5ICSA 3CSDA 1EVZA 1KIFA 1MA0A 4LSMA 1UAGA 1U28A 3HHPA 3QVSA 4JQCA 2EW2A 2YFQA 4OHUA 3UKOA 4RVFA 1UZNA 2X0JA 1IPEA 2DUWA 3S2GA 1LDBA 3VPFA 4Q3AA 3ZHXA 3WGGA 3WMWA 5BSFA 1X7GA 2XXBA 3ZWOA 1I3NA 4W7IA 5HA5A 3IP3A 4Z0HO 4B4UA 2B83A 4XGIA 3DOOA 3GMDA 1DIAA 4KUEA 5A03A 2FR8A 3SJ7A 4BO7A 4DIOA 3LF1A 1XWFA 2BFPA 3O03A 4XJSA 3VKVA 4YT8A 3GOHA 5THKA 2CFCA 2R2GA 3ZWAA 2PD3A 4PG6A 3VH3A 2P5YA 5JAZA 2NQTA 2Q1WA 4UUOA 3QRWA 1L7EA 3OJ0A 2D2IA 4AJLA 1JVSA 2Q50A 3PTZA 4XYMA 3U4CA 4EUHA 2JHFA 2WDZA 2C5AA 4RO0A 4ZQFA 5KJ6A 4XIJA 1ENPA 1KVSA 1K6IA 1XU7A 3B70A 4UVDA 5DULA 4DUPA 3BXXA 4E4YA 5H82A 3ZNPA 2CUKA 3S2EA 2IRWA 1P9LA 3GNSA 3F46A 1ULSA 3JQGB 5ENDA 1YDWA 3ZWXA 4MP8A 4BNVA 3K5PA 1T26A 2WM3A 5KVCA 2UAGA 4RPJA 4BOYA 4RPKA 5I7FA 3OA0A 4YT5A 1O9BA 2O2YA 1YB4A 2G1UA 2Y0CA 4WKGA 1JLLA 3MJ4A 1R16A 1IB6A 3MJTA 2VTEA 3PFFA 5KOIA 2G76A 2EP5A 3H9GA 3ICPA 3JYLA 5DOVA 4GGPA 5L3ZA 4YEDA 1FF9A 1DC4A 1O95A 1W73A 1N2SA 2HK8A 4UEOA 1SEPA 3RUEA 3IAHA 4D42A 3ZV6A 5L53A 1FDVA 3K73O 5H83A 1LX6A 3SC6A 1FDTA 3DOJA 1F0YA 4ZJUA 2RCYA 2OBYA 2RIRA 4J3FA 3RC2A 2GRAA 4CMEC 2O50A 5JCJD 1D7OA 1JU9A 4XCVA 2AE2A 3LSYA 3T4EA 1QORA 4TQGA 2AEJA 3EZLA 3TOXA 4BHTA 4CQMA 3KB6A 2W8ZA 1Y5MA 4FR5A 5A4DA 2JAHA 4ND4A 3H9QA 4PGFA 3R3JA 4NFSA 5A9TA 5G0TA 2R6JA 2VYND 1XEAA 3PRJA 2W2LD 4TRRA 2TMGA 4MJLA 2NVUA 4B7UA 4HXYA 3LLSA 4LCJA 4R5HA 1U1IA 3BIOA 3GGGA 4BGIA 3W6UA 1Y9AA 1F14A 1QYWA 3ZHZA 2AQKA 2B37A 4CLXA 2QRJA 1ISHA 3ETDA 3RIHA 2V7PA 4JXKA 3C8MA 4CM5A 2HDHA 4YT4A 5IZCC 5A9SB 4K6CA 5FF9A 3WGYA 3HB4X 1V3VA 1VL0A 2J3IA 1ZIDA 4OXNA 4WOKA 4E2YA 3W1VA 5TT0A 1UAYA 5IF3A 1KC3A 1Y1PA 4D3DA 4Y67A 2GYYA 2HUNA 5AQ1A 1ENOA 4YQZA 4GLLA 1RYDA 3SLGA 4E13A 5A5EA 4I5EA 1I8TA 2BGMA 1E0DA 1H6BA 3BTSA 1LLUA 3BAZA 5FI3A 4OKIA 1V6AA 3AJRA 2ILTA 4XJTA 4OGWA 4MPDA 1KEPA 2Q46A 2HRZA 2OL4A 5JC8A 4K9DA 2AMFA 3E9QA 5COAA 3G49A 3BMNA 5TC4A 3U3XA 4TKMA 5ITVA 2DBQA 2TMDA 1JAXA 4M89A 4WECA 2UVDA 3FPCA 4W9NA 4PZCA 3EY4A 3GDFA 1VL8A 4CM9A 3AK4A 3AOEA 4BUCA 4B8WA 3ZW9A 1PQUA 4R68A 3W4JA 5KIAA 1KYQA 3NYWA 2VYVD 4FW8A 4IDCA 4CMKA 1DAOA 2C29D 2Q2QA 5L9AA 3TZHA 4HADA 5FFFA 4NFYA 4W4TA 5GMOA 1DEHA 1GV1A 4P22A 2B5WA 3LYLA 1IE3A 4A7PA 3NGXA 2WTBA 2FWMX 1DLIA 4XGNA 3F4LA 3R6DA 3W4KA 2X9GA 2EW8A 3JCZA 4KZPA 1GTMA 1R4NA 2Q1SA 3H2ZA 3KYCA 4JJIA 4J43A 4DMLA 2E48A 4GPD1 3KRTA 3H9UA 5B4VA 4R1TA 4YJHA 4OQYA 3DTYA 2VHXA 4WEOA 2V6BA 3DBHA 3JQCA 2O3RA 5DN9A 4O1MA 2ZB3A 1DJNA 1LXCA 2QYSA 4ALJA 3RBVA 3OIGA 1LLCA 3LT2A 3N7UA 4QX6A 1U8FO 4NFHA 4HNGA 2DBRA 1YB5A 4QEDA 1MLDA 4CR6A 3WBBA 1GEEA 1E5QA 2O4CA 3O9ZA 3H4VA 3M2TA 3SXPA 3ZH2A 3JQDA 1SOVA 1AXEA 5GY7A 4UUPA 3GVHA 1U7HA 1BW9B 3OHSX 2W4QA 1NHGA 1R4MB 5L95A 1E1KA 3H65A 1MFPA 2HMVA 3JYQA 1QRRA 3L6EA 4CQLB 4L9RA 4Z9XA 1WMAA 2R00C 5CG1A 4Y9DA 1XDWA 5CPFA 5DBFA 4EJMA 4TRJA 3U49A 3KEOA 4GWGA 1T4DA 4Z0TA 2OXIA 2DKNA 3WX0A 4PLVA 2JCVA 4E2ZA 5T8KA 5EQDA 4OQZA 1DHTA 1JA9A 2PA3A 3L07A 3F47A 5ER9A 2O4UX 3JD4A 4WCFC 3EDMA 1YL5A 4IDGA 3NAQA 1BG6A 1E7SA 5I9LA 1E7RA 4BQRA 1P1IA 4MVJI 1N9GB 3ONDA 1W6UA 3FI9A 4CLEA 2Q2WA 4BMNA 1IULA 3LF2A 3W8DA 1RM5A 3UVEA 4IMPA 1T24A 2YDYA 3WFIA 3IQDB 1IHYA 3NJ8A 5KWEA 4FFMA 1E77A 2GPTA 2YV3A 4JN6B 3RC9A 3O26A 3OM9A 3DZHA 3PVZA 1HKUA 2HO5A 3G3EA 1QYVA 4TMFA 2E37A 4OH1A 3ZNOA 1FXSA 1YRLA 4W6ZA 1QSGA 2D3TA 2Y67A 3I9MA 3JQAB 3OJFA 5IFLA 1UR5A 1N92A 4WE3A 4WLOA 4CLDA 3GVXA 1HYEA 1SNYA 2GZ2A 1JN0A 2ZYDA 1B0AA 3Q2IA 1PR3A 2IODA 4MIYA 5B4UA 2LDBA 2A92A 2C82A 3NV9A 3IOYA 3NJ4A 1U2GA 2P9GA 5B4TA 4NHEA 1U3TA 2BD0A 4DYDA 4JJGA 4KP7A 3FCOA 4URFA 2X23A 5COBA 2H5LA 3C24A 4CM4A 1LUAA 5LDHA 1TEHA 4Y98A 4FSHA 3H7AA 3Q2KA 5JMPA 3OJOA 5CFZA 3WWYA 4PG7A 1LC3A 2E4AA 2V6MA 1E3LA 4FC6A 3AI2A 2VWGA 1GFSA 1YE3A 4BNMA 1JWBB 2BHLA 3UCFA 1DRUA 1MXHA 1YB1A 3OIFA 4DQVA 5I9MA 1H6CA 3UH1A 1KEVA 3QIVA 2Q2VA 4P8RA 4BO6A 2WMDA 5G4KB 2V6FA 5ILGA 4YAKA 1BDMA 4LMRA 2NSDA 1VLLA 4R69A 1U5CA 3OP4A 3NT5A 2I76A 5KJCA 2VN8A 2ZTVA 1PWZA 3KLPX 5G0UA 3FBTA 3DQPA 3F6YA 1MG0A 4Z9FA 2YJZA 4QT0A 1F17A 3B1KA 2IEBA 5J23A 3RUDA 1LQUA 3ZWNA 4DLBA 1T2DA 2OGUA 3D4OA 3KO8A 4U5QA 1UP4A 2VNAA 1O8CA 3A06A 3ZHBA 2JCYA 1Y5RA 2YV2A 4ZU3A 3UUWA 1PS9A 3ZWPA 1E7YA 4OYRA 3SJUA 4PVCA 3HN2A 1E6EA 5HS6A 4D0RA 4CV1A 2I67A 2C2XA 4BNFA 3WGIA 3I6IA 4LSWA 2F00A 1ZW1A 4YR9A 4RZHA 5JCJA 1N1GA 1YWGO 4A26A 1I30A 4MKXA 2BELA 3JD3A 2A35A 2FSVA 2HCTA 1I2CA 5DDIP 2IDZA 4JBIA 1ZK2A 5I7SA 2DTXA 4DC1A 2VYNA 2YFHA 3I9KA 3RFVA 2DTDA 2JL1A 2W2LA 3F9IA 5TF4A 1LC0A 3NEPX 4N54A 1XSEA 1H6DA 5L4LA 5IAAA 1HYGA 3OF2A 2QHXA 2Y99A 4MVJP 4DIFA 1OZAA 4L75A 1QP8A 5BNIA 3AUUA 4TKLA 1U4SA 4J7UA 1O94A 4NBTA 2DVMA 4YVFA 3JTMA 1N1EA 3PWKA 5F3RA 3UOGA 4BO9A 4YQYA 3LVFO 5DCUA 3BMQB 3K2EA 4FS3A 1E1LA 1MGOA 2D59A 4LGVA 1NHWA 4NG5A 2AHRA 5AXDA 5IG2A 4QUKA 5JY6A 3KYBA 1I2BA 4EZBA 2VHWA 3MCVA 3STHA 4DIBA 4BB6A 3WDSA 2Q3EA 2FPPA 3LC2O 3PK0A 4QECA 2Y1DA 3FNFA 2PH5A 5T57A 2CMDA 2I9PA 1PJBA 3ONFA 5K9ZA 4J7CA 3IJPA 3K6JA 3A14A 3BTVA 3RUCA 5CDGA 5ADHA 4FGWA 1LEHA 4IGEA 1NFQA 1RWBA 3MOGA 4NK5A 4B4WA 2Y0DA 1NFFA 2DC1A 4J1SA 2VQ3A 4M8SA 4Y6RA 1LRJA 5B37A 3ZW8A 1X7HA 4ZQGA 2DUUA 3KSUA 1GQYA 6ADHA 1MFZA 2EKQA 4CV0A 3VHRA 1RJWA 3D3EA 4YAEA 4AG3A 5LC1A 2GGSA 4W9NC 3SBOA 2I99A 1ISJA 3PZBA 3AOEC 4N18A 2YQ5A 3VVCA 1ML3A 4MP3A 3RJ9A 1O0SA 4OJNA 4YJFA 4OIMA 2OZPA 4PCVA 1RM3A 1TT5A 2VYVA 4M1QA 3I4CA 4D7AA 4CR8A 4MINA 1K6XA 2EKLA 5JYEA 4LK3A 5EERA 1OMOA 5L7TA 4CMJA 3FRJA 2GLXA 1NPYA 3UCEA 3ZWMA 4CM8B 4HNHA 1XHLA 2DTEA 4RDIA 3AUAA 4XGKA 4PRLA 3INTA 5T5QA 4CLRB 4E6PA 3K96A 4YAIA 1LLDA 1PSDA 4KOAA 3SLKA 4CL8A 4EEZA 3LT4A 4DWVA 4MKZA 2O3UA 4DREA 3A1NA 4EBFA 3O4RA 4L4XA 4JLWA 1Y8RB 4XKJA 3CUKA 3BHIA 1WNTA 3PQDA 1R0SA 3R0IA 4J7XA 2BF7A 1ZVMA 3F5SA 3PI7A 1Y9EA 3OJLA 3TFOA 1KEWA 3G1UA 1KY4A 3TF5A 1DO8A 1SO8A 3P7MA 4HUJA 1HE2A 1PWXA 3BTOA 3VAZA 1QLHA 4E5PA 2O23A 1OOEA 1CYDA 3KV3O 1WXDA 4FD3A 5JW6A 1EQUA 1HTBA 2PWZA 3DZJA 1PJSA 4J2HA 5GZ6A 3CTMA 3PWZA 3LZ6A 1C0IA 2PNFA 1GQQA 2HKIA 1JVBA 1AGNA 3NDIA 3WICA 2C2YA 2PTGA 2VUTA 4R1SA 1PGJA 3RKRA 4NBRA 3ZNQA 3B1JA 3EZYA 4YRDA 3U0BA 3VPXA 2RHRA 3CEAA 2OUIA 3KHUA 1PJTA 4RGBA 1SAYA 1B16A 4NBUA 5T64A 4JBHA 3IUSA 1EK6A 1ZJYA 4U0JA 5G0VA 3GAZA 3DOCA 1P1KA 4EDFA 4JP2A 3IL2A 5T8KC 4E3ZA 3WQSB 3MTGA 3WBFA 1FDUA 4DPMA 1IZ9A 3ITDA 3O8QA 1YL6A 1R37A 1P74A 3WSWA 4D79A 1N7HA 2HSDA 3D5TA 4R16A 5JDIA 1PGOA 5A3VA 4PG4A 2FR0A 2J5KA 2YHUA 3JV7A 3V8BA 2GD1O 1CQJA 4NIMA 3F5QA 1H2BA 3L4SO 4C7JA 4P4GA 4G81A 2X4GA 4XQGA 4BNWA 4K1LA 2Y68A 4LRTB 9LDTA 1BXGA 1H93A 4MIEA 4XYEA 3B1FA 1GYQA 3JQ7B 3TN7A 5KVVA 1KY5A 4MVJG 1OAAA 1H9BA 3PWSA 4PLTA 4IIUA 4IS3A 4BO5A 3WJ7A 2DFDA 2HQ1A 2YQ4A 4DYVA 2FPGA 5TRTA 1VM6A 4ALKA 3Q11A 4H16A 3L4BA 1Y81A 1H9AA 3KVOA 2NQ8A 5IXSA 5C7LO 3DHYA 1P44A 3Q9NA 3QVXA 1DHRA 2CVZA 2VOJA 1NM5A 1ADBA 4GSKA 2PKQP 3T7EA 4YDRA 3TDKA 1X1EA 4JK3A 4PLWA 2X9NA 4RF4A 3W6ZA 2WD7B 4RORA 5G0WA 4GMGA 2J8ZA 5FYDA 1BGVA 1LSSA 3TRIA 3ZWYA 2CNBA 2IZ0A 1M67A 4XDYA 1GY8A 3RVDA 3GEGA 1LDMA 3JYOA 1DOHA 1YS4A 1UUFA 4UUMA 2J5QA 1P1FA 4MVJA 3ST7A 1DAPA 2CF5A 1VRWA 3DBRA 4ESOA 5HTOA 1JAYA 3HG7A 3AW9A 3OFSA 3JQ9A 1MC5A 2BGKA 4GMFA 3GK3A 5IDYA 1PL8A 3OA2A 3H6KA 1F12A 5ES3A 3TWOA 4XR9A 1BMDA 3K8ZA 1SB9A 4KWIA 4ZICA 4XZ3A 2CDCA 3RUIA 2X0NA 3CMMA 1P3DA 3GA0A 2W2KA 3JYNA 1ZK4A 3OEWA 3MOIA 4B7XA 2AQHA 1S7CA 3L9XA 3AU8A 4FPXA 4PVDA 5BR7A 4GVLA 4INAA 5F1KA 4M86A 1Q0HA 4ALIA 3ENKA 2AEMA 4DLAA 1C0PA 5TSDA 2X0IA 4H7PA 3WLFA 1DIGA 1NQOA 3JQAD 4BNLA 2G82A 5JO0A 3NTQA 3HJAA 4YBZA 5EMHA 3FBGA 3WJAA 4E5YA 4XA8A 1IZ0A 4BV8A 3HADA 4AJNA 5JAIA 3X2FA 5DOZA 3DFUA 1DC3A 4U6QA 1XR3A 2EXXA 3BMCB 1WDMA 5A06A 4IZIA 4NJMB 3ZNNA 2UUOA 4UVHA 1SPXA 4AJ1A 2JAPA 1HZJA 1LJ8A 1PJCA 1PQWA 1C14A 5COQA 5A9RA 3G79A 4K6FA 4YPOA 1X13A 4QSMA 4AJPA 1E7WA 3NT4A 1DBVO 3E5MA 4RDHA 3RJ5A 1ADCA 1XIVA 4Z6KA 3QJ5A 3ZU2A 1HSOA 4TRMA 2VUSA 3EC7A 1PGQA 3I9LA 2A9FA 5IDWA 3OEYA 2G5CA 3UF0A 3Q9UA 1HDYA 2PZMA 4F3YA 1I3LA 3BA1A 2Z1NA 2P68A 5T6BA 1XYGA 4NI5A 4FQ8A 5KJFA 2BFAA 4S3MA 4RJTA 1DPGA 2SCUA 3GY0A 1HF3A 4R1UA 5EESA 4BO4A 5ILOA 1Q7BA 2E49A 3SC4A 3H9EO 8LDHA 3GRKA 3GFBA 3AUTA 2P9EA 4RV9A 4CMIA 3P2YA 3JQFA 1SOWA 3JQGA 2DQ4A 3TL3A 1J5PA 1YOVB 1NQTA 1PU2A 2EJWA 3U5TA 1A72A 3WS7A 1U7TA 5EINA 2VZ0A 1FDWA 1DB3A 5L7YA 1U4OA 1UXKA 3DO5A 2GASA 1EK5A 3ZI0A 1A7KA 2E82A 1GZ6A 2FHSA 3ABIA 1O5IA 1LDYA 3OETA 1HDGO 1AN9A 2EHDA 2FZWA 2RH8A 1V9LA 4ND3A 2NNLD 2VT3A 1B8PA 3MWEB 5KTKA 1UJMA 4L73A 4YACA 4AJOA 1YO6A 3DXFA 3KXDA 4P38A 3GF4A 2JFHA 1IY8A 5CG2A 1EE9A 2J3KA 3G1TA 4GQAA 4A10A 4CM3A 3KBOA 1KC1A 1XA0A 1ZZEA 4I9NA 4WOJA 1UP6A 3P5SA 4QXMA 1H0KA 2QZ9A 1R6DA 2Z5LA 3FWNA 4BNJA 4HV4A 2WE7A 2GN4A 3HDHA 5A04A 4RVHA 1HT0A 4W99A 4IJKA 4TROA 3V1TC 4BKUA 1NQ5A 4JCOA 1HSZA 2O3JA 3CIFA 4BKOA 4YA6A 4E2XA 1KS9A 2VRBA 3ANNA 7ADHA 2RBEA 1Y8QB 3E9NA 1VJTA 3AY7A 1ULUA 3RBXA 3WIDA 3JQ8B 5EQFA 5B1YA 1WLYA 2QIOA 1E1NA 5EJ2A 1TXGA 2ZQYA 1P33A 1PL6A 2ZYGA 3BZUA 4KDEA 1OBFO 3HE3A 4ONEA 2Y93A 4J16A 3DONA 2OFPA 4HFJA 5A9SA 4IGFA 3E5RA 5C7IO 1ARZA 1YQXA 4FJ0A 5TGDA 2EGHA 4J4TA 1S6YA 5THQA 4CM7A 1K89A 4IDFA 5G2OA 5EL0A 3E03A 1QMGA 4ALNA 1I33A 3QVWA 4NZ9A 1OC2A 2BRUA 4KWHA 4NNJA 1LI4A 3TZCA 3C7CB 3ZHYA 3VPHA 4YAJA 2PY6A 2CF6A 1KBZA 1GUYA 3CZRA 1EEHA 1NPDA 2J3HA 4ROSA 3H5AA 4FDAA 4OKNA 1Q0QA 4TSKA 3EHEA 3PHJA 3RKUA 4ILKA 4NJOA 3DZIA 2P4HX 4WPGA 5IN4A 3GC6A 2B69A 2DPGA 2O7SA 3ANMA 1I0ZA 4FCCA 3DR3A 2EKPA 4HP8A 2VT2A 3L77A 4I08A 2CD9A 1P77A 2DM6A 1GPDG 1WZIA 5JDIC 3K92A 2DT5A 4U0KA 2GDZA 3CZMA 4RF5A 4BO2A 5L40A 2XXJA 1NAHA 2HMWA 3NRCA 1P0CA 1YH3A 2ZJ1A 4AJKA 1VE9A 1QKIA 3GDGA 4WLEA 4LISA 2AXQA 4D41A 2VZ8A 1DIHA 1TI7A 4EYEA 2IZ1A 1EFLA 5A5FA 3WQQA 1CERA 4OSPA 3K31A 4IDDA 3B20A 3DBLB 3PIDA 1GPJA 4UEKA 3ROKA 1I5RA 2V6GA 5G0SA 3WLEA 1NPTO 1Q1NA 5DCWA 2DFVA 3ROPA 4BKRA 3Q6IA 3GEDA 2GR9A 1G1AA 4ZRNA 3DMYA 1EE2A 2PR2A 3GVPA 3L4BC 4FOSA 4AJ4A 2VWHA 1Z6ZA 4JJFA 4XYBA 4TWRA 2Q45A 4WLVA 4DL9A 2Q4BA 4J90A 1KVQA 1BW9A 3ZWVA 4M49A 3WR5A 4K28A 2YY7A 1V35A 3PPIA 1G0OA 3VPSA 4BNUA 1LDNA 4CQLA 4HX5A 5KJEA 2CZCA 3MJCA 1XQ6A 1XELA 2O3QA 3EAGA 3WYCA 4DBZA 4ZN6A 4B7CA 5TJHA 4EEXA 5F1OA 3AFNA 3DZBA 5KVSA 2EGGA 4B3IA 5K6AA 1GADO 3AY6A 1YJ8A 3EVNA 3GNQA 2PFGA 1C1XB 1C0KA 3W4IA 4JX8A 5BNFA 2P4QA 3JQ9C 3VTFA 5DCYA 2P2SA 4MVJM 1C1DB 2YYYA 4K26A 2Y1FA 3RUHA 2FP4A 2QG4A 4NBWA 3GDOA 4UULA 1Q2XA 4J49A 1N9GA 3DHEA 3PIIA 4N5NA 4WCDA 4ZGWA 4C4OA 4CMAA 3QVOA 4IPTA 1ENZA 4KUHA 1HXHA 3D5QA 3DEYX 4GGOA 2IYOA 3SX2A 1VI2A 3DWFA 3MJVA 3PJFA 5TIIA 2Y05A 2PZKA 5F1PA 5TJ9A 2J6IA 3TZ6A 2VRCD 4TZTA 2I65A 4DTIA 1A7AA 2QRKA 3JQAA 2ZATA 1DJQA 1EUCA 4RVDA 4O5OA 4J1TA 2JHGA 4TVOA 1W0CA 2VWPA 3GFGA 3ICCA 3G0OA 4ZQEA 3D4NA 3GZNB 5JSFA 1UH5A 2FRDA 4NDNE 1IUKA 4J1QA 5JS6A 3DFZA 3FD8A 3FHLA 1AUPA 4AJJA 1E3EA 4B8ZA 4QO7A 2NACA 3VZRA 3D64A 2WSBA 3ULKA 4KTVE 2ZKLA 3GRPA 1WDKA 2WE8A 3RUAA 3SVTA 1ADGA 5AXAA 3FR7A 3U9LA 2PGDA 3INRA 4MVJE 3HQ4O 3UHAA 4EUFA 4Z0PA 4PIVA 1ZSYA 1GYPA 3A4VA 4EJ6A 1CJCA 3DAPA 2BGLA 3I52A 5A05A 2O48X 1LRKA 4XRGA 3PQFA 2YZ7A 4YB8A 4ZHSA 1K2WA 3F1LA 3DAGA 4GL4A 4GKVA 3OQBA 1K3TA 3OSUA 4AICA 3FNHA 4D43A 3QV1A 4CMCA 2D8AA 4TRNA 4JNKA 1YXMA 1ENYA 3KYDB 3E8XA 4MOWA 4DA9A 5FEUA 1BXZA 4MDHA 2H63A 3E6AA 4AJIA 3QSGA 1TLTA 2B36A 3RI3A 1EDOA 4YRAA 5CDUA 4M87A 3JQFC 8ADHA 5G4KA 3HWRA 3AM4A 1NFRA 4IDAA 1QLJA 2Q99A 4UREA 4WUVA 1J49A 1NYTA 1XQ1A 2WEKA 3GGPA 3FNEA 4WGGA 1E92A 3K2BA 2H9IA 1WVGA 5BSEA 2JD2A 3KETA 3C7DB 3WXBA 4EW6A 1M6HA 2PZJA 5DZSA 3RASA 5IDQA 3EGOA 1LDGA 3FSRA 5CDYA 2OHXA 1WP4A 1Z74A 1GYRA 4ND2A 4BGEA 4H15A 3T4XA 3JD0A 1CEQA 5JXWA 4BQPA 2G17A 4IJUA 1GAEO 4NU5A 3I9JA 4GX2A 2C07A 3KLMX 5AOVA 1GD1O 3Q0EA 4CJXA 1ZK3A 1A9YA 4D45A 3IDSA 1IHXA 1F8GA 3WGTA 2NVWA 1B7GO 4J91A 4RLHA 5LDGA 3BYZA 4CM6A 1TVEA 4J9UE 4IMRA 3E9MA 4EGFA 1V3UA 2D5AA 1I3KA 1Z73A 4RLSA 3WGHA 1C3VA 3GHHA 3PYXA 5I7VA 3DBVO 3N58A 2B5VA 1ZEJA 5U1PA 1DFHA 4PLFA 2GN9A 4LMPA 2NU6A 4L4RA 1KVUA 4U6SA 1VKOA 1ZEMA 3HB5X 2XF8A 3WGQA 1EUDA 2C5EA 3OH8A 4AJ2A 4DLLA 4L8VA 1HRDA 3M1AA 1ZSVA 3BMQA 2EG9A 2ZTLA 2QW8A 3RFXA 5L51A 3RSHA 1L7DA 1U3VA 1X1TA 4ALMA 3E82A 2NU8A 3WIEA 3IIEA 2IXBA 1T2EA 4RPLA 1QYCA 3VH1A 2XOXA 4Z3KA 1U2DA 1BTOA 3QW2A 3EVTA 2QYTA 2GNAA 4I9HA 4A0SA 4I5DA 4ALLA 4BKPA 4E33A 3U4DA 1NQAO 5EPOA 3KZVA 3QHAA 3KM0A 3ZU5A 3TJRA 3NT2A 5JDCA 2VZ9A 2BFOA 1ZCJA 1DC5A 3GVCA 4YCAA 4MO2A 4GX0A 2PD6A 3OIDA 5CDSA 3GNTA 3ANLA 3I5MA 4WLUA 1UDCA 5KJ1A 1MUUA 3B6ZA 4D46A 1VKNA 1I10A 2O2SA 1B3BA 3AUSA 4KMSA 3IKVA 1WMBA 3GN1A 4XR4A 3PHLA 1Z45A 1WWKA 1UXJA 5DBGA 1T2CA 4NK4A 1FMCA 3RUFA 1ZBQA 3BMOB 5DT9A 1QV6A 1YJQA 2EERA 4M55A 4WNCA 2YHIB 3HFSA 1YL7A 3MTJA 5JAQA 5CP8A 4DMMA 1LU9A 3DMTA 3QWAA 4PLCA 5I7EA 1EDZA 2HMTA 3H5RA 1I3MA 1PR9A 4BO3A 4HKTA 4R9SA 4CM8A 1NXQA 1B2LA 1YONA 4BMSA 1EVIA 1ISIA 1X7DA 5BT9A 3VC7A 4CLRA 1GUFA 1HLDA 3NKLA 3TPCA 5JFOA 1GUZA 4E31A 3OECA 3C85A 1B14A 1PS8A 4FFOA 3EYWA 4RQTA 4YJGB 1LDEA 3RU9A 4BS9A 1GDHA 2HMUA 4D44A 7MDHA 4KDFA 4XYLA 2OP0A 2Q1UA 2ZYAA 3U4HA 3CH6A 1E1MA 4MVJH 1GZ3A 1TT7A 4Q3DA 2ZIZA 1R0LA 4E30A 3PHGA 1B26A 1ZMOA 3IJRA 3E48A 4NMHA 4PFJA 1LTHR 2VHYA 4XQ9A 3C1OA 4XD2A 1KETA 3KSDO 3IMFA 3ZU4A 3DTTA 3UICA 2I66A 4BMVA 2ET6A 4DQUA 4FFRA 2Y66A 3PHHA 5A02A 5CHEA 3GG9A 4WJZA 3LT0A 3ZV5A 3MJEA 3TOZA 2B35A 3VH4A 4HFRA 1ZO8A 4CUKA 1DXYA 4Q3CA 2ZB8A 3FF4A 3QWFA 2JD0A 1ISGA 4TVBA 3OJEA 3WG9A 3WGZA 5ITWA 4BKQA 4EITA 1ISMA 3V1UA 3VPGA 5U4QA 1GZ4A 1K6JA 2V65A 2AQIA 5K6AC 2FPIA 1UZLA 3JQBA 1SC6A 1X15A 2NVBA 2PKQO 3L6OO 4IM7A 4PLGA 1MG5A 4XDZA 3SEFA 5CEEA 4LCEA 1JDJA 4HWKA 4W82A 2C7VA 5KNLA 3WMXA 1E3JA 5C37A 1DRWA 5KKCA 1V8BA 5C3MA 3FTNA 4WCFB 3ADOA 2NTJA 3JYPA 1CWUA 4FBGA 2I3GA 2W98A 4OL9A 2FMUA 2YW9A 1DSSG 3AWDA 2PH3A 2F1KA 1AHHA 2J5RA 3D3WB 1DFGA 3Q1LA 2VRCA 3GT0A 1E3WB 4II2A 1NASA 1MX3A 3K30A 4CM1A 4ND1A 4D0SA 3UAGA 2H1SA 2IYPA 2O7QA 1N5DA 4I5GA 4IS2A 4IQ8A 2PD4A 4DC0A 2ZTMA 3WGOA 2VWQA 1GCOA 3JQ7A 4JP3A 5H81A 2X58A 5G4LA 5FI5A 1AE1A 1Z75A 3DHNA 3UXYA 3QVTA 4AVYA 2DBVO 4MVJF 4YAGA 1BVUA 3DC2A 3I3OA 4NQZA 4YXFA 3I4FA 2FZEA 2C54A 1PZFA 2VOEA 1U5AA 1AXGA 1PJ3A 2DAPA 2O3TA 4JGBA 3QE3A 4NU6A 1GV0A 1PGNA 4Q3EA 1JW9B 4PG8A 1HETA 4BNKA 2Q4EA 4WLNA 3ORFA 3QQPA 1GQ2A 3F4BA 2NWQA 4B3JA 4IY1A 1U3WA 4E5NA 5LCXA 1U8XX 2AW5A 1Z82A 3PFWO 3ZN2A 2WD7A 1HDCA 1HWYA 4BNHA 1HL3A 1D4FA 3Q3CA 4R3WA 4E5MA 1VC2A 1PJ2A 2O3SA 2VHVA 2A4KA 3AU9A 1ISFA 1PX0A 4FJ1A 4CUZA 3V5NA 4ZVVA 1HDZA 2EIHA 4I9UA 2Q1TA 2Q49A 1VJ1A 4CODB 3TZQA 1N7GA 3UGKA 4BIIA 1W8DA 4XX0A 4CLOB 3JD2A 1R0KA 4GX5A 3TSCA 3ASVA 1MXFA 2BKAA 1UXGA 4DVJA 5ENVA 4ZQHA 1SBYA 5HWSA 1V3TA 1KEUA 2UV8A 4NBVA 2VHZA 1A9ZA 1F06A 3BHJA 2QQ5A 4GAEA 1FJHA 1HE4A 3V2UA 1T25A 4R1NA 2E6UX 1NP3A 2GF2A 1PJQA 1HEUA 3MJSA 4IXWA 2Y1GA 3ENNA 4PZDA 1RM0A 2NU7A 4A5OA 1I36A 1UDAA 3N74A 2EWMA 1BXKA 2JFFA 3E18A 4FFPA 4II3A 4UVIA 3GN2A 3UN1A 4CMIB 2NV6A 2CVOA 4WNIA 1QV7A 4EUEA 3IS3A 1JWAB 3BMCA 1YKFA 4NJMA 2YV1A 4JROA 2Y0EA 5JLAA 1YBMA 3JQEA 4XIYA 4FC7A 2BFMA 1CRWG 1H94A 4HFMA 4I1IA 3VH2A 2P91A 1ONOA 4GH5A 3RU7A 2HLPA 4CQMB 3R1IA 1B8VA 1HDXA 3IKTA 4QTZA 4CV2A 1ZXBA 4C7KA 3V2HA 4A73A 1D8AA 1BVRA 2C7GA 4R4JA 3KEQA 5T67A 1PIWA 2NVUB 4PLZA 3GZ4A 3OQ6A 3S8MA 1Q0LA 5HRUA 4NPCA 3ADPA 3ZCXA 5DNAA 3CE6A 3GR6A 1EVYA 1BSVA 1GCUA 5GZ3A 1D1TA 3C1AA 4BO1A 4BNGA 3AM5A 5F5NA 4S1VA 3H9JA 3WNVA 1HE5A 2B4QA 2POQX 2UYYA 5DP1A 1EUZA 3ROMA 1O89A 3WQRA 1GU7A 3GPIA 4DPLA 1VSVA 3ETEA 1Z7BA 3HSKA 4J9VA 1I24A 4NR0A 1BWSA 3F1KA 1T2AA 1G0NA 3LC1O 4XWYA 2P9CA 1YOVA 1KOLA 4BNXA 3PGXA 2PKRA 5IN5A 1LQTA 5JDCC 3ZWWA 3PJDA 3ZWBA 2C20A 4GSLA 2EV9A 4KQWA 1DFIA 3UFXA 2EEZA 2EF1A 4IZHA 2GZ1A 4I8XA 4IBOA 3WYBA 4CV3A 4R54A 3ZWCA 1KVRA 4ID9A 3OMLA 1WAMA 4PN3A 3BMNB 4OSOA 3H5NA 3C1TA 2HK7A 3PZRA 4PRKA 4HY3A 5F21A 5I9NA 1VSUA 3ZDFA 1DRVA 1CQIA 4CMHA 3DMTC 4BVAA 2Y1EA 1N8KA 3R3SA 3WB9A 1HE3A 1M6WA 3I6QA 3S1LA 4YRBA 4XEHA 3AFMA 3PDUA 2OOSA 2J3JA 4YYZA 4LN1A 3DAFA 1YBVA 4YT2A 1Y8QA 4RF2A 1E3IA 1A5ZA 1HYHA 3L9WA 4E21A 3ZV4A 2VTDA 3LT1A 1K5HA 1NR7A 1DIBA 3JQ8A 1BDBA 1R4NB 1B15A 3KYCB 1LNQA 1I32A 4PLPA 2P5UA 3INGA 2G0TA 1A4IA 1LSJA 1ZNQO 2RHCA 3OBBA 4YJHB 1U3UA 3GVIA 4RPGA 2FY8A 1EFKA 1XCBA 4LRSB 4PG5A 4N5MA 3UCXA 3TNLA 5C5IA 3DBHB 4F6CA 2AG8A 3VZSA 4QFCA 1ZMTA 1F8FA 4RVSA 1ID1A 4E2WA 2JFGA 3PP8A 4XB1A 1EBFA 3GG2A 4ITUA 1ZKMA 2GCGA 3ONEA 4Z3DA 5C7OO 1T1SA 4IUYA 1PZEA 3FTPA 5KCZA 1R12A 1E7QA 1J4AA 5EIOA 4Y8VA 2DU8A 3MZ0A 3KOUA 5CAEA 3HN7A 4FN4A 1SB8A 2HU2A 3AM3A 2ZB4A 4RZIA 4ZA2A 2PGLA 1YGYA 2WYVA 3DDNA 1ZFNA 3L6DA 5F5LA 2PK3A 4CLOA 4U8GA 1XKQA 1VPDA 5KKAA 3JQBC 1BHSA 1CETA 1XU9A 3KUXA 1NVTA 4JIGA 4RPHA 2Z1MA 1ZSNA 5IDXA 4ZRMA 4GBJA 5JPIA 4Q3NA 4Y6SA 1D1SA 4IJWA 5BSHA 2X5OA 1IPFA 1NWCA 3M2PA 1J0XO 3WWZA 2XAAA 2WD8A 1MV8A 3VDQA 3GH3A 4O0LA 3OQ1A 3EUWA 3ETGA 2BLLA 2GN8A 3RAJA 3CINA 3D0OA 4Q39A 2ZCVA 3WYEA 3LU1A 3CPSA 3KTDA 3P19A 2AA3A 3FWZA 3VVBA 5KVQA 4GI2A 1R4MA 3DB2A 3RC7A 3H8VA 4Y6PA 3ON5A 2CDAA 1R15A 3RWBA 3GQVA 2FOIA 4XYGA 3RBZA 1ONNA 9LDBA 2ZJ0A 3AI3A 4R3NA 5JY1A 3GLQA 2OO5A 3DBLA 5L4SA 4DQXA 3I23A 2HRBA 2IE0A 3PLRA 3GHYA 3I83A 1DC6A 2RH4A 1ZK0A 4ND5A 1Q7GA 1PJ4A 1SCUA 4CL3A 2LDXA 1E5LA 3U4IA 1T4BA 2PV7A 3DZGA 4YTEA 2GSDA 1O6ZA 2JD1A 4BNTA 4DGSA 5I8WA 4IINA 1YBAA 4CM4B 1B8UA 3NGLA 1RPNA 1PZGA 1NVMB 4BO8A 2PZLA 1NR1A 1P31A 1ZJZA 4QO8A 4CMGA 4RL6A 4BNYA 2VCYA 2PLAA 1V0JA 1T2FA 4CMBA 4E12A 2DLDA 2CY0A 1GR0A 2B0JA 3V2GA 2OMEA 2FN7A 4IQGA 3COSA 2NLOA 1ZK1A 4Q3BA 3CXRA 4GX1A 4XQEA 5JCXA 1ZUD1 3E1KA 4CUJA 3PYMA 4UAGA 1P1RA 3RC1A 2HMSA 1CDOA 1GEGA 2WYWA 3WTBA 4BNNA 1C1XA 3HZZA 1EVJA 2IZZA 3WFJA 2C59A 2ZCUA 2ZTUA 2CSUA 2Z95A 1C1DA 5IZ4A 1MC4A 1QYXA 2OORA 4RF3A 1HDRA 1Y6JA 1M76A 4BB5A 1NTOA 1Q7CA 3EMKA 1PS0A 3LC7O 3IP1A 4N7RA 3NTRA 1M75A 4BV9A 3C7AA 3ZZNA 2JKVA 2QRLA 1RYEA 2HK9A 2I3AA 3FNGA 3GUCA 3NX4A 1M66A 4OMUA 3RCBA 2X86A 3PJGA 4NH4A 3S2FA 3TFQA 2C0CA 4AJHA 2OP1A 4OXYA 4PLHA 2D1YA 4B4VA 3MEQA 5L7WA 2EP7A 1I2ZA 2NM0A 1IL0A 3PJEA 4MVJD 3BHMA 2I5PO 2HJRA 4B79A 3GZNA 1M2WA 3KSZO 4F46A 4HBGA 6LDHA 1UP7A 3QWBA 4ZD6A 2FSSA 3WNQA 3EK2A 4IIVA 4R51A 2I6TA 5L45A 5JC1A 3QA9A 4OAQA 5JBIA 4J4HA 1WPQA 4AL4A 1JQBA 1X0VA 4XRRA 4B4OA 2HAEA 3DZKA
chains in the Genus database with same CATH superfamily
5K0GA 1ZPDA 1KIMA 1Q3KA 4BC0A 3HDYA 2AWOA 2NU9A 2RHBA 2IBTA 2GUGA 3LWDA 1SC9A 6NULA 2MTBA 4TYQA 1X0XA 4L0QA 1ZQ9A 3R9WA 3RR2A 1PNTA 3H19A 3OPXA 2HJHA 4X41A 4WEQA 2HLDA 4HAYA 5AW0A 3SIWA 2X77A 4Q6BA 3TLGA 4D9GA 1YU6A 3KD3A 5MHTA 2XB9A 4LYDA 1NDUA 2GX6A 1HZZA 2CXPA 1KPHA 2PANA 4HDKB 4IDEA 4PC7A 5DTIA 4A27A 5EP3A 4HEJA 4OHWA 4IFBA 3ROEA 3T41A 1SRQA 4B2YA 4FFLA 4F8YA 5JNLA 3NKFA 3WYFA 5ALVA 4XUCA 3KQUA 4LJAA 4OM8A 2IH4A 3EASA 3P20A 5DWQA 5A3JA 1JKMA 2H7CA 4BGUA 2XDQA 4BWGA 1QHXA 3N2GB 4MV6A 2GH1A 3HUEA 2JRLA 1OC4A 1QQTA 2G70A 2HF9A 4I5FA 1RC0A 5AKLA 2NZVG 2PX6A 1POXA 5DP2A 4AYTA 4M99A 1UZMA 2AXEA 4DCMA 1OGYA 1Z7EA 1IYZA 1FFBA 2JCXA 2NPOA 3I9NA 4PFSA 3VDRA 4AIRA 2X0FA 5A1TA 4B3SB 2E2WA 4JLBA 4OBBA 3H2BA 4MAFA 1QIFA 3D7KA 1D3AA 1A71A 2JVKA 3BEOA 4TZKA 2X76A 5DXFA 3WOHA 4M1ZA 4RWZA 1ECGA 1V95A 3GEMA 2AG1A 2PT9A 2V97A 3GUYA 2VUUA 1JNYA 3FLBA 1OI7A 1JPNA 4LSGA 5TDHA 2C77A 3HXKA 1VLJA 3H3FA 3MLBA 1G41A 2E9SA 2L0XA 1G5PA 3LWBA 4R2IA 4DEXA 4YQEA 1ADFA 4E14A 1ZH8A 5J4VA 3QENA 4QATA 2O0MA 4CXMA 4YJFB 1LLQA 4C3OB 4NBNA 1R66A 4D3FA 3ROTA 3RH0A 3C3WA 1QG6A 1MB4A 3QP9A 3OX3A 4IMJB 1IY9A 2X13A 3R9XB 4IYJA 2SBTA 1NZJA 5IUJC 3JVVA 3OICA 3VR3A 4LVNA 2NXNA 1QOQB 2JF0A 3ZV3A 2B98A 3NXSA 1AS3A 3H3XA 1ZUNB 3QXGA 4KR7A 1C2YA 1CIVA 1T8SA 2YJ6A 3HV2A 4FBLA 4MJXA 3SQWA 5CEFA 4G65A 2QX8A 3QM1A 2FAXA 4BGVA 4NENB 5BYBA 3A4MA 5DIFA 4ZK2A 1CIPA 4Q1BA 2X22A 1PZHA 3ROGA 3CSSA 1EQ2A 1N0WA 1NVGA 1Z15A 3QI2A 4AZWA 3BTUA 5CLFA 1K0UA 3N6VA 4WK6A 5JD4A 1QH0A 3SGLA 1CUFA 3GLIE 3OO1A 1FRVA 5D51S 2CEKA 3UB2A 4IDBA 5AVWA 4GYKA 5D3MA 1RHUA 1ZITA 3ZV7A 1HDOA 4FMBB 1BN7A 3OP1A 4ERXA 1AG9A 1JKFA 1LCIA 1W85B 4OOFA 2BGRA 4O4HF 2ZBEA 2AJDA 4QOEA 1GCAA 1U9YA 3CW2A 3QVKA 4ZQBA 1BDHA 2FPKA 5JE8A 3L1HA 3BQNB 3GQBA 3FPLA 2OBNA 4I4CA 2DWOA 2ZVQX 3GAFA 4RZ2A 3WGMA 5MDHA 3AKDA 5LQMA 3HDQA 3R24A 2O6HA 4PS1A 5DISB 5LP6A 5JAMA 1NNUA 2F1OA 3P2OA 5B7NA 1LBEA 1MVNA 3LLVA 1RWWA 5MGBA 1N3YA 2C8LA 2Q8QA 3HSSA 4MUKA 4ZP1A 1SEVA 4W8GA 3PGJA 4DR6B 4JAVC 4KCGA 1KEEB 2J4CA 3GJZA 3O92A 1QHHA 5I8PA 3SFTA 3N0XA 3WLMA 4CDGA 5HKLA 2HCJB 4G8DA 1HBJA 4X00A 4G84A 4DJEC 2IXAA 2NUAA 1VGRA 2XIQA 3G6KA 3QNWA 4C05A 4BMCA 4BVKA 5ER6A 1FVHA 1ZVVA 4FB5A 3I2GA 2PLNA 3R7WA 4C43A 3NOQA 3IAUA 4IW3B 4B6JA 1BOFA 4ISBA 4Q9AA 2B4TO 1JKIA 2BDUA 2H31A 3AY0A 3GUHA 4KRGA 4NWIA 1ZXLA 2BI7A 3BMOA 4MSUA 4O3MA 4PONA 5EJAA 4H6VA 1YQ9A 2V55B 4HQLA 5BO5A 3IPYA 2HJSA 2AC4A 3M1LA 2H08A 2YHIA 4FIZA 4HQKA 4TV8A 1TOAA 3F5MA 1P72A 5REQA 2HF2A 3VOSA 1YNOA 5TS3A 5ICMA 2WHRA 3MWDB 4E5KA 3HJGA 2AFVA 3GZJA 5BVGB 1O7JA 2JAOA 5F3WB 4H18A 1A7UA 4IOJA 5KOHA 3W2TA 3LSTA 2PVSA 1EBUA 1GSIA 1VPLA 1GZ5A 2QRMA 5DWVA 3J7AC 1T6XA 1NW8A 1W5FA 3BE8A 3MWJA 3MQFA 5JASA 1E2KA 1QUEA 1CQJB 2BTQA 3CKYA 4TV9F 3Q88A 1UK9A 4F45A 3HUDA 1HLPA 3R8FA 1O2DA 1K68A 2HQBA 4UHHA 3MN1A 2RAFA 5HJ5A 4ZXFA 4GRAA 2CC2A 4HLQB 4QTTB 3UENA 3BSSA 5HMLA 1VJ5A 2WF9A 1TQHA 2ZB7A 1NLUA 4GF5A 4OP3A 4C21A 1E61A 2BFEA 3BGWA 3P52A 1BGWA 2OTCA 4NCXA 1ABBA 3UWOA 3LYAA 2PO7A 3RGWS 1V71A 3A9SA 3AUFA 4ITRC 1YVEI 2VHCA 2HN9A 4PZEA 3V32A 3HKBB 4XQCA 3GRYA 3OEED 1OFUX 3IO5A 5KSYA 1RKBA 4X54A 3TL2A 5AVOA 1FFHA 1PFQA 2D4AA 2PX2A 3GWZA 4J0EA 1VE7A 2EX0A 1KJYA 1M1NA 4O6VA 4QDUA 3RANA 3TEMA 2QBYA 3T15A 3QBEA 2RCNA 3VPDA 5DI3B 4ER5A 4QJBA 1E7MA 1TFRA 3T6KA 3K9QO 4MROA 4NYJQ 4A36A 3ZY5A 1PQ4A 3ECAA 4MQEB 5GQSA 2BKLA 3M3HA 2X0DA 3K71B 3J81A 4O63O 1WZ2A 3TVTA 1EPUA 2CB0A 2DFNA 2V7TA 4UBIA 1UDBA 1RJFA 2CLMB 4QASA 1Z2OX 5HK8A 1KSJA 3KVVA 3D6UA 1PQPA 5KYUB 3AC0A 4KSCA 4QU5A 1QH8B 3L79A 1Y6GA 1QH1B 4CPDA 4IJ6A 4DV1B 2JGRA 3HJTA 4UBJA 4ZREA 3FFTA 5H3LA 5HIMA 1TQDA 4JQSA 2FX5A 3W78A 5C53B 3ZBTA 3AT1A 3DBRB 2C57A 1TUGA 6GPBA 2ESRA 5B1IA 4I1PA 3NM5A 3X2EA 4QU8A 2UUPA 3PDHA 4K0KB 1G9XA 1ZXXA 3DKVA 2QM0A 5IKOA 3CSUA 2WJPA 1LFDB 2XE6A 3G8AA 1CKEA 3C3MA 3OEHA 3DB1A 5DRTA 3KL4A 4X6UA 3SM9A 1PSWA 1FTSA 1Z0JA 3NB0A 3DG9A 4PC2A 3AI7A 3K8OE 1Z13A 3FCEA 1SQ6A 3B3JA 3PGKA 1WW2A 3PNMA 4IUCS 4IIFA 4MYHA 2E1RA 4NOMA 4EPRA 5EZ6B 5JVDA 3V1NA 1ZM7A 4QRDA 5EHGA 3X1YA 2IBMA 5HKKD 1SC1A 2WTXA 2ZQZA 1WS6A 2NO7A 1U5BA 2CLEB 3A9WA 2A58A 4K9MA 2WV9A 3DGEC 1C3LA 4G6ZA 4BATA 2JJ8A 1SZPA 1UAGA 2WTEA 3L7OA 1U28A 2IPXA 2ZJ3A 2WMYA 1N78A 3HTXA 3ZC3A 3PGMA 1XALA 3FROA 4U7PB 1OJLA 1IY1A 1U7ZA 1IPEA 3S2GA 1BQ4A 1LDBA 4K9KA 1PEAA 3OZXA 1AHPA 5DW0A 3WGGA 3F3MA 2XXBA 1I3NA 3AF5A 2W42A 1ZM4A 5ALFA 1NJ2A 4L2IA 1H23A 2HBYA 3I6BA 3IP3A 2EDAA 3P0FA 5TMDA 3DLHA 2QLJA 3L7CA 4V03A 4WZBB 4DADA 5F9FA 1EDEA 3IEUA 2ZSKA 4AZVA 2WFLA 1U31A 2Y27A 3O03A 1G38A 2YWJA 4KHZA 4XJSA 1N36B 1DELA 2M2IA 1H69A 1NVAA 2R2GA 3HKDA 1Z07A 2FQWA 1PW7A 3VH3A 4D4JA 4LF8B 2R9VA 3SQXA 1SCJA 5AD1A 3IOCA 3CH5A 1CR1A 3K9GA 2RGCA 4MCAA 3QRWA 1GPMA 2AJTA 1NF9A 3L43A 1ZX1A 2NNWB 4AQ7A 3V4FA 4QDKA 3QMWA 4TLBA 4D4GA 5LZ7A 1WB5A 2FSVC 3EBLA 1KRXA 5D2CA 4LS3A 3GELA 2QRHA 3BJEA 4YMWA 1KVSA 3T9BA 5ADWA 3D6MA 2VBCA 5J3JA 4KO8A 4QTXA 1U6JA 3O2SB 3DTNA 2ANCA 3MT9A 1T2UA 3IA7A 5BOVA 4XCQA 2YN4A 3O93A 3WGJA 2JZOA 1ZD3A 2CUKA 2Z3VA 4HQNA 1P9LA 3GNSA 1MTZA 1ULSA 4P34A 4PTZA 3RYHB 4UNPA 4BNVA 5IUKC 4AI6A 2HXGA 3KB2A 1E2GA 3KIPA 1OWMA 4RPJA 4ZI5A 4MX8A 3TEJA 5I7FA 3C3DA 1UJ4A 3QKWA 4I6JA 1UKCA 1PUXA 2IU0A 3HYCA 2WMNB 3KQYA 1JLLA 1IB6A 1W96A 2CFTA 3CNLA 3MJTA 4GPZA 1DP4A 1T6BY 1TTTA 4GC5A 2G76A 4LBWA 2ZBQA 2I8CA 3H9GA 3EVEA 4MQ6A 1PF7E 1CE8A 2KPOA 1Z08A 2ZYVX 3FYDA 4GGPA 1FF9A 3JY6A 4IF6A 4O4JF 2HK8A 4QQFA 4LDJA 3FOZA 3AVYA 1E20A 2CXQA 3MWFA 2J0SA 4KFCA 3RKSA 1Z6TA 3IAHA 4LTNA 1X6VA 3L46A 3OPQA 5D00A 3CUSA 3G9XA 3GOQA 3KR0A 4QDTA 4WX2B 5AK3A 1K6EA 4ED9A 4ZAZA 2H4HA 4EY3A 5LZ8A 1JFFB 1W4CA 2V5AA 3H2YA 5HNKA 2Q1XA 3DOJA 3QUTA 3AP2A 3HB1A 2XMCA 2RIRA 2HLHA 4EA6A 3AR9A 2FJUA 2G6BA 2GCPA 1IWPB 2FSGA 2R25B 2PLFA 2OAGA 3D5EA 1PV2A 3HYNA 2AE2A 3KEGA 1WEKA 4OMDA 2NYUA 1OFIA 2WICA 3T4EA 1QP0A 2BSAA 2A9OA 4MWSA 1FEZA 4L4ZA 4JUIA 3SXUA 1SOMA 2W8ZA 4ESVA 2NP7A 2XDAA 4TMZA 4BNDB 3VR0A 1MJHA 3Q3EA 1MIHA 4WOBA 4CEIB 1TVKB 1Z4NA 2NW6A 2CN1A 2R6JA 3OESA 2E18A 2VH1A 4DILA 4DWWA 4M22A 4UAUA 2W2LD 4FMDB 4Y2XA 2LCFA 5H9VA 4KQCA 4HZUA 2XZTA 1XXHA 4LCJA 1Q12A 4BGIA 1Y9AA 3HKCA 2B8EA 3ZHZA 1CK4A 3OO0A 3K0FB 1IQ0A 1U3DA 3T54A 4DMGA 2HIGA 5BRJA 1O6FA 2P2GA 2W71A 3ETDA 3F7OA 2CSXA 1O94D 4JXKA 3C8MA 3ODPA 2QMYA 5A9SB 3K70C 5FF9A 4QBTA 1Y6FA 2ZBGA 4R6WA 2ZUWA 3GFOA 2FK8A 4YP5A 3R7FA 4B2LA 4ERNA 4LOAA 1ZIDA 1N2BA 4U9HS 4OXNA 4WOKA 4CFYA 4E2YA 5H02A 1UJ6A 2XEDA 1UAYA 4O02B 1XMVA 1KC3A 3H97A 5AKJA 4ZFNA 5JJCA 2ZIUB 2IV3A 3RYFB 4D3DA 2DGDA 2HUNA 1CZLA 4N82A 2H4WA 1I7SB 1MQSA 2IOHA 3HY6A 2IDKA 3IAM6 4KGZA 5A5EA 4X93A 4PQGA 5MN4A 4TUYF 1I8TA 2BGMA 4CIWA 1Q7RA 1D03A 4NMWA 3E1GA 3K9CA 4OQMA 5FI3A 4D92A 1SVOA 2HFKA 2NTYC 1J5EB 4LQ4A 2Q46A 2GXAA 5EKSA 1NMXA 2I2XB 1JQJC 1YI8A 3TGWA 1M2HA 4YRQA 2FLKA 5CFMA 4BP3A 4EY4A 1DUSA 2R4TA 1JAXA 1NQXA 2UVDA 2TRSB 3FPCA 4PZCA 4QVIA 5BNWA 1EA7A 2P69A 4Y7CA 3ZE2B 1U1CA 4ZZ0A 3HS3A 3SS9X 2CW5A 2HBQA 1GP2A 3NBAA 2G1JA 3QOXA 5JXIA 1JEJA 5KYXB 1LX7A 2GBCA 4TM7A 2HC9A 4TGLA 4FW8A 5C9ZA 1DAOA 2I6QA 2OV4A 1E6MA 1F3LA 4U2DA 1HA3A 2DECA 4CT4B 3PXAA 2GT1A 5FFFA 2Q5FA 4Y9RA 3LYLA 4KQHA 2JPDA 1B0UA 3NGXA 4A7PA 2CLHB 2J1LA 4AY3A 1R8JA 4EG5A 2X9GA 3IVCA 4YXWD 4KZPA 2GN2A 2OE2A 3JCZA 4XW2A 2CV0A 1R4NA 1P4AA 1U9IC 3GBVA 2PSSA 4KEAA 4DMLA 2BEUB 2VUIB 2H06A 3GARA 3KRTA 3NBQA 1AQ6A 1GDDA 3RVNA 1ZD8A 3H9UA 3UC9A 1X1AA 4R1TA 3P9KA 4GQIA 4V3BA 2IQ5A 4DLVA 2GVZC 2OK8A 3DMGA 1Z0KA 4QGHA 1SRRA 4D9HA 2I54A 5SYMA 5GPBA 1PT7A 1SXJE 5ITZB 4ETMA 2WU4A 5DN9A 1MB0A 2QXYA 4O1MA 3DEKA 3OEEA 2A8YA 1OXUA 3ZGZA 4MDEA 4G0ZA 1C8LA 1LLCA 1OH5A 5CB4F 4NFHA 3D7MA 2YJ4A 1MLDA 2H1VA 1XMIA 4CR6A 3BA6A 3A31A 2CMKA 1GEEA 2I4IA 3STVA 3EGEA 3PUKA 3SXPA 4CF6A 5ALOA 3JQDA 4KODA 1AXEA 4YV1A 2DE0X 1FSGA 1U7HA 2XDWA 1UKBA 1BW9B 1JU4A 2I6XA 4IQ4A 5A5GA 2W4QA 3KVYA 3KKOA 3M4XA 4KWEA 1TJ4A 1UKAA 4DCNA 4RD3A 4P0QB 1ETUA 1DTEA 1OV6A 1P5FA 1WMAA 2R00C 1A8HA 3CVJA 3EGIA 3EIXA 4N0PA 4FFBA 4JLOA 1QCYA 2CNDA 3I2IA 4WY5A 5CPFA 2ZXUA 1DKRA 5DPMA 1MGPA 1Y4UA 5K45A 1RYBA 1E3TA 1J09A 1G5TA 4OAPA 2H51A 5IJXA 3KTAB 1I5OA 2OXIA 3KD2A 3LTNC 1K88A 5C32A 2FW0A 3F2IA 1L7NA 1I6WA 4KO4S 2RK6A 2XA9A 2R6CA 3NAGA 4HYYA 4O8ZA 4E2ZA 4F1JA 1BAPA 2O1WA 1Z4OA 3BMXA 4YX9A 4HXGA 2F17A 2VUHB 2PA3A 4TTSA 4F6RB 3L07A 2YIDA 5EKDA 3COYA 1EFUA 4BKMA 2X2OA 3BCRA 1YL5A 3OQPA 1E3MA 2H00A 1SUEA 3E22A 4MVJI 3ONDA 3HBFA 1ID8A 3SS7X 4CLEA 3JPYA 3A6PC 4JJAA 3LF2A 3UVEA 5HKKA 3EG5A 2YDYA 3GD7A 1VIYA 3IQDB 3CNBA 1IHYA 1NRXA 1IXRC 1WPGA 1CF9A 4Q7KA 1WP9A 2YV3A 3D2CA 4DF3A 3I8XA 4G23A 4L5AA 3O26A 2ISQA 3JASA 4FYPA 2BGIA 4TMFA 1QYVA 5CIYA 1UC9A 2QT9A 4FM9A 1KRWA 2JH8A 2D3TA 3SCZA 2E21A 3CO0S 4UU7A 2XXAB 4CLDA 2DR2A 4M1EA 1L5HB 1HYEA 3JATB 3CUTA 1NYRA 5ED0A 2CCKA 3NVAA 3OE7A 3Q72A 4DVGA 1HL7A 4QLAA 4EFMA 1B0AA 1GDTA 2HU7A 1BH6A 3PFKA 1PR3A 4P3PA 4ZGBA 3QYJA 4KKVA 4R2HA 3FNIA 5B7QA 1K9SA 2C82A 4MIKA 1QHGA 3IOYA 3NJ4A 1U2GA 3PXBA 1I2MA 4LXTA 4PINA 2P9GA 5F7ZA 3T3EA 3UBMA 2VAMA 3D4BA 4HAWA 3C24A 2W6ZA 2DRIA 5HTKA 1YDFA 1LUAA 4R2XA 4Y98A 3ED5A 3PJRA 1BN6A 4V0RA 1YUBA 2AOTB 1JBEA 5KQLA 1P4JA 1XAHA 3ISJA 4OTZA 4KN9S 1E18A 5FA5A 3WWYA 3LNCA 3LBHA 2WQ7A 3SSAA 1RQRA 3PA6A 3TNFA 3ZS9A 1E3LA 3L3BA 2C7QA 1G20B 4AS2A 2W37A 1QVZA 4V1CA 4YUYA 3G2OA 4BTLA 4G8BA 4RVOA 2GCOA 2REQA 1FU8A 4FEYA 3NIDB 3W34A 2WF8A 4WK0B 5KAPA 1WM1A 2F43B 2Q62A 1Z22A 2V1UA 1NDHA 1YB1A 3WI7A 1NUAA 1ND5A 4ZALA 1H6CA 4Y18A 5KX5F 2O8VA 5CFPA 4P8RA 4JSRA 5CD1A 2ODWA 3I8SA 3QEAZ 4KKXB 4I9GA 5G3ZA 1CRZA 2WMDA 2CFOA 1FS5A 5G4KB 3ZXYA 1Z8FA 4YAKA 4KLAA 5CB8A 1E9RA 5CDFA 2XMSA 4HRVA 2W8BA 3B3FA 3H2HA 4I6EA 3AIIA 2DFKB 1WO8A 5IW8A 2ZTVA 3PHBE 5EJ4A 5JTTA 1PWZA 3CLKA 1J9EA 2FFRA 3MGCA 3NAZA 1MG0A 5CH8A 1XQ9A 1YVPA 1RCFA 5CNIA 3HL4A 2IEBA 2AN5A 2BEVA 2W4IA 3JWEA 1LQUA 4K9SA 4RZUA 5J4HA 4OHYA 2CLOB 4DJ5X 4MV8A 2L42A 1R6VA 3KO8A 2XMGA 5BSWA 3DZ8A 1QVVA 4U5QA 2GHRA 3KTFA 3MQ2A 1O95C 1VDZA 4TL9A 3ZHBA 3CWCA 1YRBA 4CE6A 4V2UA 1ECPA 1PS9A 3TCXB 1Y82A 1K6MA 4KE6A 5LN1A 4JODA 4OYRA 4G36A 2WSYB 4NABA 2GCIA 3V6MA 5KQGA 4M0DA 3SJUA 3HN2A 5HS6A 5F7XA 4B9AA 2CFIA 2FW1A 5CXSA 4BNFA 4LSWA 4HNRA 5LYJB 2OCPA 1J0EA 1N1GA 1QONA 2GPNA 4MKXA 1KXJA 4P3XA 2C42A 4YFVA 2BVNA 3GRZA 3HV0A 3THYB 2HCTA 5ISMA 1MO5A 1QE5A 5DW3A 4CKBA 1W2GA 4HGNA 1KFKB 2CJXA 5JROA 3CCFA 4UQLA 1EK0A 2FEPA 4ZC8A 3UQZA 3U40A 2Q9UA 2VK1A 1L5VA 2JHCA 4DC1A 3DTVB 3DQQA 4BZQA 2H0AA 3EWNA 3I9KA 2W2LA 2C2BA 3F9IA 3HCAA 2PRKA 3PUVA 4EY5A 5IAAA 5BQOA 1ZVKA 3ORHA 2QHXA 4IDQA 4ITVA 3RS0A 2MR5A 1OZAA 1QP8A 1CEXA 4DNQA 4N3GA 2AC7A 2NU6B 1P6XA 4QTYA 5CUQA 8AT1A 4D25A 3SVLA 1U4SA 1O94A 2XYVA 4JQZA 4QOIA 3THOA 1GAJA 1HTWA 1KMNA 3VUEA 2XLBA 3NHYA 3JTMA 3K09A 3TL6A 1FQJA 1Z2NX 4FMPA 1N1EA 3AYZB 3PWKA 1XCOA 2QTFA 3LVFO 4MLDA 4F7WA 2HBZA 4LDAA 3GH1A 1E1LA 1MGOA 4N9WA 1TK2A 2COKA 3DE6X 1U3GA 1V16B 3DNMA 2AHRA 3M5DA 1D7AA 2RIPA 4NG5A 3KYBA 5K1ZA 3TB4A 1CRPA 4EZBA 3EXFB 5EE0A 4CTKA 4EB3A 1M2JA 1QG2A 2E1PA 3MCVA 3CR8A 4Q1AA 1HT2E 1WPXA 4LGMA 2VJMA 2C9DA 3WDSA 3FCXA 2FPPA 1NN5A 4QECA 2ZRAA 2Y1DA 5KWJA 1YAHA 2CMDA 2I9PA 3NBMA 4MV7A 3NORA 4F86A 1SC3A 1QPGA 5M34A 3G2NA 4J7CA 4BMXA 2HBRA 3C14C 2GHTA 1QQBA 3RJMA 2XUHA 1P8JA 4QELA 1DDGA 1Y5NA 4C7VA 4FGWA 1LEHA 3RYCA 3B1VA 1G291 1WSBA 2B21A 3MOGA 4NX2A 4B4WA 2PJUA 3PPYA 2VQ3A 3E81A 4J1SA 4M8SA 5HCUA 4MAMA 4DDMA 1LRJA 5E8JA 2NPIA 2G8LA 3B6KA 1GQYA 1MFZA 1ODSA 2EZUA 5K3BA 3VHRA 5L3SA 5LC1A 2GGSA 2GNPA 5F98A 3SBOA 3ZXXA 5ERXA 2OENG 1P39A 2I99A 5LUAA 4N18A 1OAKA 1DTWB 2HY7A 4A82A 3R0XA 1TTHA 4XAQA 4UDOA 4XLLA 4JEHA 3UT0A 2WIFA 4Z99A 4OJNA 5KHLB 2AJBA 4KR9A 1MHPA 2ZOSA 1RM3A 4I55F 3TQOA 2H65A 3EDCA 1N5IA 1PVDA 2CHUA 1OMOA 3B53X 2BONA 4PSUA 4CMJA 4KAJA 4JT4A 5HVNA 1YCDA 2MHCA 1J8YF 1NPYA 3BWMA 1PNQA 4NL4H 4CM8B 4DJDC 2B0CA 3O4GA 3OPNA 4EG0A 3C7TA 4B8YA 4HAIA 3ISVA 3LYUA 4QLOA 4YXWA 5T5QA 2VZEA 3SLKA 4ZI7B 2R96A 1HRKA 3C2QA 1MPXA 4N3NA 1DBSA 2O3UA 4YRMA 1OU0A 2SICE 3AG5A 2MOKA 1HDIA 2XODA 2FOXA 3A1NA 5BV8A 5IVPA 4ZAGA 1EWYA 2Z6UA 4YAOA 1QTRA 3USZA 3DQZA 4ENTA 3GCZA 1T1EA 3PQDA 3VU0A 3F73A 4ETIA 1VPEA 2OQRA 1GN8A 4GG1A 1L7OA 5KNCH 3NHKA 1GSAA 2ZRIA 3TFOA 1X77A 1RHRA 1CJSA 421PA 1KY4A 5FUMA 3WKCA 1T9AA 5HGJA 5DTMA 4H7DA 1UPCA 4OM7A 1QZXA 4HUJA 1HE2A 1PWXA 4HUQA 1WB9A 1I1QB 3VAZA 1QLHA 2PX3A 3TTXA 1CYDA 3MHTA 4HC4A 4NAUA 4QBIA 3ZIUA 1U9CA 5K8JB 2EL9A 1CCWA 3DZJA 3H1EA 1EFCA 3D1JA 1MORA 2ZBUA 3DPUA 4LZPA 4MJ7A 2C9CA 4UQPA 4W5HA 4YN3A 1XXLA 2A84A 2ZRFA 4CKYA 3EHDA 4FZRA 5DLYA 4HSGA 2Q5QA 3SOPA 3ZZMA 2FCRA 3NDIA 1MOZA 1RWVA 1UFKA 2GAFA 3I2YX 1MJ5A 3EH1A 4Y1GA 5I9TA 5JQWA 4ZC1A 3U1VA 3VPXA 5B1DA 3GJTA 4MLZA 3F9CA 3AVTA 3I9FA 3KHUA 1PJTA 1U0NA 1SAYA 3UB3A 1O96A 3V8RA 5T64A 1G5HA 4ZCMA 4I81A 3QX9A 4YI3A 3IUSA 5IPFA 4G5OA 1ZJYA 2C8KA 4R0NA 3GAZA 5EJGA 4HCJA 3DOCA 5EJ9A 2R8EA 2V6IA 3IL2A 4NYJR 1N2OA 1L7QA 4X6LA 5T8KC 3FPHA 4W5RA 2P2NA 2I2WA 1SXQA 4B2IA 1FDUA 3GJ5A 2NO6A 4MB6A 1IZ9A 3KNZA 2ZT7A 4MPJA 4PYRA 4BE9A 3KQNA 3IT2A 4TV9A 3RIYA 1V11A 3A6ZA 4E51A 4R8LA 3U13A 1TM4E 4A6DA 4RH1A 1KXZA 3CF6R 4P83A 1G3MA 3CGWA 1WTAA 1MF7A 3DL0A 1XZIA 2XUIA 4I50F 3IBFA 3WLHA 3II6X 4OH7A 1TPYA 2D1QA 2OO3A 4ZVUA 4DSUA 3F5QA 1H2BA 4EG8A 3VR6H 4IXNA 2ZM5A 2ERCA 2ZRMA 1A77A 4PZUA 5LNK1 4JJKA 4G81A 4MQMA 5DGIA 1QX4A 1W49A 2JFQA 5J2TB 2IE8A 1MVLA 4B3TB 1LB1B 4AZTA 3RRBA 4ZKDA 2UXDB 4K1LA 2J9RA 1JJVA 3OTWA 3P26A 4GPTA 4LK2A 4LRTB 1A95A 2NYVA 2IZOA 3BD8A 1A9RA 3TIVA 3UQYS 3B1FA 5KVVA 1U2EA 3G8CA 4G9BA 3T35A 4V0QA 4OJTA 4MVJG 4MA4A 5B57C 1XJWA 1KSGA 2V8BA 4IIUA 1GLGA 1NJSA 3H4IA 4TT3D 3GX1A 4HDMA 4V0ME 2YL2A 2GEVA 4YJ3F 5DYWA 4PAWA 2BMFA 2HQ1A 1E8NA 1VRVA 1XRNA 2C4HA 2FPGA 3ANYB 2ISSD 1VM6A 2WK1A 3LQKA 1CUVA 1JSRA 1R0BA 4RW0A 5DMXA 1VPWA 3KQVA 3L4BA 1AQYA 3Q6NA 2AVNA 4MB0A 3TGPA 4X84A 1RYYA 3OU7A 5C7LO 3Q9NA 5E6SB 3M4ZA 1W88A 1MR3F 3SZRA 3L8CA 1SBCA 4R9UC 4GSKA 1ADBA 2EJTA 1FSSA 3T7EA 4JI0B 5BMVF 4RTRA 3LDUA 3R0JA 1X1EA 4JK3A 4PLWA 3S27A 4URYR 1CUDA 2ID7A 3C6ZA 4MW4A 1X7ZB 4GMGA 4BNYA 3TIXB 2HRCA 4UOQA 5CLGA 1LSSA 1OT5A 3F6PA 1AUVA 1M67A 3OX4A 4FNOA 3RM3A 5HUHA 5AW1A 1Q14A 1LDMA 4N6GA 3KVRA 5C2JB 3M81A 5EJFA 1DBWA 1N5LA 2J3LA 2H4XA 1DEAA 1M6VB 3D3QA 3IP9A 4XUEA 3ST7A 4PPNA 5GOZA 2PT7A 4ESOA 4CG2A 4A15A 4ZPXA 3R5TA 3ZVKA 1YDMA 4GBGA 3H42B 4YUXA 1L5LA 1R0WA 4QEZA 4EUSA 2BGKA 2GSWA 1ZI6A 2OXTA 4JB0A 3OA2A 1H85A 1P80A 2I8AA 4BVEA 2X3FA 1F12A 4D74A 3K8ZA 1A8SA 1SB9A 4YRCA 2IYEA 2CDCA 4JJ6A 1PW5A 4XWAA 3RUIA 2QLFA 2J5XA 1RXWA 3IP7A 1TC1A 3DR5A 2ZR7A 2ZI7A 4R1PA 3JYNA 1EDBA 3OCZA 5LU9A 4B7XA 5JNWA 1RJGA 2XGOA 1DKNA 4PVDA 5JZOA 3I0MA 2VJQA 4GP7A 3S40A 4INAA 4NZZA 1F2UA 2EL7A 3TSOA 2P3QA 2HTFA 4Q4DA 2AEMA 2GB4A 4HRAA 4JELA 4O4LF 4H7PA 3WO1A 3WLFA 2NU7B 1DIGA 2I0FA 5EIWA 3DP7A 4LBYA 3WV4A 2RBKA 2VP5A 2XCIA 3A8TA 4EH1A 1CRLA 1YIAA 4X7PA 3WJAA 1JB9A 2K87A 3DOIA 2FMKA 4BV8A 5DHAA 1J07A 1ZP6A 2AS0A 3DFUA 5DOZA 3TQIA 2GM5A 2QTGA 2PMEA 5JZ9A 3ZI4A 3QELA 3FBWA 5A06A 4XWGA 2UUOA 3JWHA 1P9WA 4LHZA 5HEKA 3V8EA 1HZJA 1ZNZA 2M9MA 5KS2A 1NKTA 2W6MA 4GT1A 1M34B 3ZOKA 3M49A 2XRYA 3CZ9A 3NCHA 1N6LA 3BBPA 3UA4A 4MGIR 4OHPA 1X13A 4OJYA 2QKYA 3LOPA 3O8DA 4DUGA 3E5MA 4Z6KA 1R6XA 3HXQA 4NNPA 1GGEA 3CLSC 2AN3A 1HSOA 3BXPA 4LXUA 4DJFC 4S1TA 1PGQA 1T4MA 4U9IS 5BQXA 2D0DA 3Q5GA 2IGBA 2VP3A 2G5CA 1RI1A 2UYGA 2X14A 4LDZA 1HDYA 5JZSA 1HEIA 4F3YA 4M3NA 2GF0A 3BA1A 2C5HA 2Z1NA 2P68A 3A6FA 4FQ8A 2OCDA 2BFAA 3MNFA 5KJFA 1DPGA 3UUFA 1CVIA 1OBOA 3EA5A 5EESA 3BB4A 1Y42X 5ILOA 4UM8B 5AKYA 3DF7A 1ORIA 3KXPA 3Q3VA 2E49A 1YBFA 3QF4B 4Q7LA 1R8SA 3I92A 3DWIA 1T36A 4HEHA 3M3PA 2UXCB 4LXXA 1E94E 3BJZA 4QU0A 4RV9A 2IITA 3RADC 3C6XA 5FJIA 4CMIA 4GOLD 1QU3A 3V7UA 1PT6A 5E38A 4ENWA 1DMRA 4FXPA 2XZLA 1GL9B 4O4JA 3WRXC 3IOEA 4FCWA 9MHTA 1U7TA 5EINA 5A2QA 4R71A 3TG2A 2PGNA 4RZXA 3HR7A 3KAKA 4TVKA 1U2TA 3IJ5A 3LDGA 1U2PA 3HI6A 3UFXB 4N65A 2PV0A 3OETA 2OGTA 4GR9A 1YRQA 4EG4A 3NBKA 4D96A 4LXIA 4R98A 3PFGA 4MYUA 1V9LA 4PYQA 4ZT2A 2MCFA 3SICE 2P1ZA 1YJCA 2GJ9A 4LC0A 4JYBA 4MUYA 3E05A 4LX8A 2W2TA 2WAYA 3U9SA 3KXDA 2QLNA 2PWPA 2DPYA 1NZDA 3GF4A 2EHJA 2JFHA 1Q16A 3N05A 5CG2A 4ZVRA 1SIUA 1IJFA 4PBSA 3BPSA 1H5NA 2H1LA 4CM3A 3D7RA 5LOVB 3K9LA 1ABEA 4WOJA 3U4QB 1Z26A 1UP6A 3QEMA 2WTAA 3MJHA 1R6DA 5CW2A 4ZEVA 4R2KA 1FQWA 2GLUA 2O8FB 3BL5A 2YXPX 3A2NA 2ZU0C 3VO2A 7ABPA 1KYTA 4Q3OA 3IULA 3EFOB 1NQ5A 2P11A 2EFJA 2FA9A 5M3BA 1PT8A 3CIFA 5U4XA 4BKOA 3P2IA 5A5DA 2BDTA 4DRXA 3R0VA 1KS9A 2NIPA 2W2OA 4GZ3A 7ADHA 3RHSA 1F7VA 5A4KA 3X1XA 3GLGB 1FNSA 5FBHA 4KLNA 3LI2A 1RCUA 2OCLA 1L5MA 3QJGA 3QTBA 3VA7A 5IM4F 1GXSB 4H0NA 2P62A 5AKIA 4M2LA 4F4FA 1CVRA 1TRHA 4MWDA 1I80A 4D0LB 1TXGA 3AEQA 3REGA 2ZYGA 4HQ0A 5CLJA 4KDEA 4COKA 3VZCA 2W6NA 4QGSA 2EFGA 1IJBA 1KYIA 1FUIA 4J16A 5GIPE 2OFPA 1A5TA 4Q1FA 1YUNA 5HQTA 1YQXA 4GKKB 5TGDA 3C3JA 2JCSA 2E5WA 4FTWA 5A3RA 2QZJA 1JE1A 4TUYA 5CBKA 3KPWA 4DMUB 4B84A 3G68A 5G2OA 5EIBD 5D87A 4HAOA 4OUDB 3RIGA 3SKYA 4X66B 3WOVA 3EZXA 1I33A 3QVWA 4NZ9A 4ALNA 3PDIB 1H8HD 4JLVA 1OC2A 3CW9A 5CX1B 3CVUA 1U98A 1LI4A 4J6EA 3RVMA 4WAUA 2GK7A 2IJGX 3IO3A 3QX7A 2HV8A 1VLMA 4EX7A 1J8MF 3TE7A 3CZRA 1EEHA 4HZIA 5CAEB 2H0RA 4G5YA 3AB3A 2QY9A 2C3UA 1VA4A 5ARCA 1E9EA 4ROSA 3H5AA 4KI0A 3DT9A 2H18A 1XEWX 5HPYB 1QG4A 2YN0A 2G0AA 4TSKA 3C6MA 3EHEA 4M8LA 1M2KA 2IV2X 4EI9A 4MQFB 3CLRC 3EXG2 4ILKA 3P0HA 3AUXA 3CRRA 3UNXA 4RK7A 1GRNA 2E3JA 1BX1A 3EB9A 1T10A 3SNHA 2FWAA 3ANMA 4XH9B 1I0ZA 3L8ZA 2XNDA 3IEVA 3WHLA 3LH5A 3B36A 3KSBC 3QYPA 1ZD4A 2ZBPA 4E07A 1RPJA 1PNOA 2VRNA 5JJKA 2CHVA 2VJOA 2DT5A 4OI2A 1X1SA 2I1VB 1VSTA 2XD9A 3CZMA 4TXJA 4IGKA 2IZ6A 4W6QA 2ZJ6A 3IPCA 4L1KA 6PFKA 3LM8A 1TYZA 4QHSA 2EDCA 2HJ9A 3CRZA 3PUXA 3FMFA 4QWMA 5F77A 3QKIA 4UTNA 4X3CA 1ZL2A 1CZOA 4DV5B 1JEYA 1BQ3A 1KSHA 3KZMA 2ZJ1A 1YR2A 3GDGA 4WLEA 3A3YA 5EMLA 4U7DA 1XAJA 2OYRA 2AXQA 1C3JA 1FX0B 5M2QA 5CB4A 3FWHA 3ZXUB 4KXMA 2MIIA 4JI5B 1WZNA 2IZ1A 4EP1A 1MO2A 4EYEA 1DEKA 5A5FA 3RG2A 4DGQA 2EJUA 4YCNA 3B20A 3B12A 4TT3A 2Q7DA 4DCCA 2ZJ2A 1I5RA 4UOZA 4KPYA 4KV7A 4ZT7A 3EISA 1Q1NA 1ZVQA 2YVUA 4BKRA 3Q6IA 2P35A 3F90A 4H1WA 4JKIA 1SK9A 1Z0ZA 3JPWA 3DS8A 3V48A 1EE2A 5CK4A 4FOSA 3DA8A 1ZU4A 1Z6ZA 1XZKA 4XYBA 4S0XA 4GRDA 1ORHA 4DL9A 2QVZX 2Q4BA 3JWGA 4J90A 4LYJA 2ALJA 3WQHA 3MILA 4B35A 4PCAA 2ZM6B 1OZ0A 2Q27A 3WR5A 1PNRA 3PPIA 4A5SA 1I94B 1G0OA 3VPSA 1UOPA 4BNUA 1NM5C 3CZPA 5DNEA 2H17A 3RSOA 3DMHA 4I4TF 3TOVA 1CX9B 1VCNA 3NONA 3RTDA 4WBNF 1XQ6A 2O3QA 5JIBA 3OZAA 2XTZA 3KB8A 2WJVA 3JALA 4RJIA 4ZN6A 2IHUA 4LBZA 1CZNA 1P9RA 3CF4A 5DK4A 4EEXA 5F1OA 5F2EA 3AFNA 2O2ZA 3TBHA 3VU9A 4XTRA 4OQPA 4C2AA 4OAOA 4DNOA 5KVSA 4Z9AA 1BYUA 2C3MA 4D9IA 1GADO 1L1RA 2H1RA 4ZIRB 1U0HC 3A70A 1C1XB 4BJ5A 1V1JA 3EQZA 2OCBA 4JX8A 3P4XA 2A9KA 2P4QA 4Y7DA 1WX1A 5DGTA 2Z6QA 5AMXA 3D3NA 5CH5A 4N47A 1FLNA 2JGDA 2YYYA 5JAUA 2HIHA 1C9NA 2Y1FA 2FP4A 4V39A 2XVYA 3JR3A 2J30A 4ZODA 2VDQB 4Y0NA 3BDIA 3JZMA 3OQIB 2WVGA 4LHVA 3AF4A 3UH0A 1OKKD 1TGYA 3DEJA 2QTTA 3FDZA 3FZQA 4N5NA 2XNCA 5E4FA 1Z39A 5HG0A 4RK6A 4YASA 5JQGB 4JLAA 4C4OA 3EEYA 5DJ5A 2COEA 1BHJA 3G6WA 1YUMA 1CQWA 3QNMA 3D5QA 3DEYX 1IRXA 1K8XB 3AL0C 2K4MA 2WSLA 2ZXFA 3E3LA 3O2QB 5J2UA 2Y05A 4C5BA 1Z7WA 1FFAA 4INZA 4DTIA 3IBGA 4PYJA 1M0SA 1E2EA 1E0AA 3M34A 4EJSC 2JLSA 1JTEA 1X7XA 3N2NA 4RVDA 4KXFB 4TVOA 4XB6B 4DC9A 5BXQC 2G67A 2V7UA 3ICCA 3G0OA 4R8RA 3C3BA 4ZQEA 1U8TA 3OOJA 3LD9A 2HB6A 2IW1A 1TZJA 3AJAA 3DUFA 2H57A 4H7IA 3UT5B 1FYVA 3I6ZA 5EKTA 2XF2A 4PEVA 1YIOA