2I3DA

Crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
b'PEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Atu1826
publication title Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 71
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i3dA00
1DU4A 1XZIA 4K6HA 2YH2A 2WILA 1XRMA 1JMKC 1U65A 1XQVA 3EQ9A 5HFAA 4B0OA 3F8SA 3FCYA 5JAOA 1ZJ4A 2ES4A 1ZGBA 1OXMA 4KE6A 1XRNA 4H7IA 1JU3A 5CT4A 2BFNA 5ALSA 3C8DA 3ESCA 1YSCA 3L1HA 2WU3A 4DLNA 4FHZA 3CCCA 2WG1A 4FOLA 4EY5A 4OB8A 4EY7A 2PVSA 5AKZA 4LHEA 1ZJ5A 1A8UA 4IH9A 4YX9A 3C6XA 3KSRA 4X71A 4ZREA 4B9AA 1FSSA 3O4JA 3BXPA 5CT6A 1H23A 3QM1A 5K3FB 4PF1A 5DYTA 3H2JA 3FNBA 4CFSA 4C87A 3NOXA 1MJ5A 5EHNA 5LZ7A 1XQWA 3SC2A 5D7BA 3EQ7A 3D0KA 1L7AA 4A23A 2XMDA 2JEZA 3GELA 5ALHA 3H18A 5DNWA 2ORYA 4PW0A 1FFEA 5ALKA 2WFLA 4IH1A 1HDEA 4ARAA 5DTJA 4BBZA 1TIBA 1CUIA 1J1IA 3QH4A 4MYDA 2R11A 5HK9A 2H7CA 1XLUA 1QIDA 1JU4A 1QLWA 1J2EA 1ODTC 3TJMA 4CCYA 4DYHA 4BZWA 3A6ZA 3NUZA 2CMFA 3BF8A 1VLQA 4UBMA 1W75A 3Q8WA 3FSGA 1B6GA 2WIGA 1ETHA 4YASA 1BRTA 3HABA 4E11A 3WYNA 3LLCA 5LP1A 5AJHA 2W22A 1A7UA 3HEAA 2DQZA 3I28A 2WG2A 3GBSA 4K2AA 4C89A 4TPKA 3G0IA 3G02A 3W9UA 4Q05A 2OQVA 4EUSA 1CUDA 2J3QA 1R50A 4X85A 3E1GA 4LYDA 1LZLA 1WB6A 1DX6A 2RHWA 1T2NA 4KE9A 4I4CA 1LPBB 4EY8A 3D2BA 4QEKA 5JAHA 3ILSA 4ZGBA 1Y7IA 5CH5A 3BIXA 4NMWA 1IMJA 4V2IA 4BAGA 5ALXA 2ZYHA 2DHCA 5AM3A 2JF0A 2XUJA 3BWXA 3JYHA 4B82A 2QJWA 1SCKA 2HU5A 4I3FA 1XZCA 2O2HA 4KAFA 4BCBA 3H2IA 2HIHA 4Y2SA 3WZLA 3WI7A 4M0MA 1R88A 3DDUA 3AINA 2Y2VA 1WB4A 3HACA 1K5PA 3KWFA 4KE8A 3I1IA 5A6VA 1D07A 1CUUA 3FBWA 1X2EA 2DHEA 1XRRA 4DIUA 2WQZA 5AKJA 4J0IA 3D5EA 4JH0A 4F21A 2AJBA 3DKRA 1QO7A 5IH7A 3QMMA 5IVHA 2BUBA 1CQZA 3M83A 1JT2A 1HKHA 1DQYA 4C6HA 2X5XA 5FRDA 1IUNA 1EI9A 1X70A 4AMYA 4B84A 5LZ2A 3R40A 1Q0ZA 1RP1A 4UUQA 3STVA 2OGSA 1ZD4A 5ALZA 1ACLA 4AZ0A 1ZD5A 3YASA 1VE7A 2QT9A 1ACJA 1YCDA 3WIOA 4BE4A 1DWQA 2C5FA 4Y2VA 1W1IA 1UK9A 4G9EA 4JUIA 4WY5A 1R4ZA 2HA3A 1E66A 4AQDA 4Q3LA 3O4GA 4KACA 3PUIA 2Z3ZA 3PFBA 1EA5A 4U2EA 2Q0XA 2Y6UA 1RYYA 1EDBA 1JMYA 1L7QA 1R9NA 3M3DA 1T4MA 1R3DA 1CLEA 3CN7A 3FYUC 4AMZA 3G0CA 3BE8A 3FCXA 2QKYA 4UBIA 4CIAA 4H7JA 4JYMA 5ALLA 1UK7A 4B81A 1N8SA 5A7HA 1QFMA 4KRYA 4W1SA 5AOCA 4C88A 2BUAA 1I6WA 1YR2A 1MTZA 2X76A 4UFPA 1TCCA 1AX9A 4UPDA 3ICWA 4IHAA 5CT5A 1QIFA 3E3AA 5AKEA 1EHYA 3FYUA 3ANSA 4DTCA 2CEKA 1R1DA 1BCSA 5HF9A 3QITA 2WLSA 1YB7A 1FFAA 5I7UA 2XLCA 2XMGA 5ALGA 2HHAA 5ESRA 4H7DA 1E3QA 3UUEA 4DMFA 3WJ2A 5T4BA 1XZFA 4QDUA 5AI5A 1EINA 2FJ0A 3GUUA 1EB9A 4W9RA 4AO8A 2ROQA 3C6YA 3F97A 4N8DA 2B20A 5AI8A 1XROA 1LPSA 1MX5A 5AICA 5FPQA 1QZ3A 1QO9A 1E8DA 2XUPA 4J0CA 2G4LA 3V1LA 3Q0TA 2VJDA 3WWEA 1F0NA 1ZGCA 3KOOA 1ZIYA 5BWCA 3EQ8A 1HLGA 1CUVA 3RARA 2ACEA 5JAUA 2XQFA 3STYA 1W76A 3IB3A 1QIIA 3P2MA 4PSCA 3I6ZA 1UKAA 3QZUA 5AI9A 3WZMA 2ZJFA 3PE6A 2BGNA 2HADA 4DNPA 2QTBA 4Y7DA 5I9IA 2JGFA 5JYCA 4YPVA 1LPNA 1BE0A 2VJBA 5DWDA 3G9TA 3WK5A 2JGEA 4LKOA 1VA5A 1LLFA 4FFVA 4QLOA 4D9JA 4C01A 2OAGA 4BAUA 3FLBA 3S2ZA 1C7IA 2AJLI 3X3HA 3C5VA 4N5HX 4HAIA 1XRQA 2C7BA 1IZ8A 4FNMA 3WLAA 4B6GA 4Y2JA 2VEOA 5AKHA 2PPLA 4BZZA 2PM8A 3ICVA 1CUXA 3K6KA 4FLFA 4AO6A 1ZOIA 1MPXA 1YASA 4BVJA 4DGQA 3FAKA 5SYMA 5AOAA 2D5LA 4X7BA 3L1IA 5K3CA 4U2GA 1VXOA 5C8VA 3UUFA 4JNCA 1AKNA 1VA4A 5JZ9A 3O4HA 1JKMA 7YASA 2H1IA 1SCIA 3RKSA 1CVLA 5KREA 1ZI6A 3C5WP 1DQZA 1H2ZA 1DT3A 2XMBA 3QBJA 5CT9A 5DNVA 4KRXA 4OU4A 5EHZA 3QPAA 4MQMA 3RM3A 4BP9A 1NU6A 4ZI5A 4FTWA 2OLEA 1R9MA 3WKCA 1CUSA 4AN1A 5E4TA 3ZLUA 1O6GA 5CRIA 5JZSA 1UOQA 1Z68A 3DQZA 2GBIA 5D3KA 1AURA 2XUHA 2EEPA 1MNQA 2WUFA 3W9BA 1GPNA 4XWGA 2XUGA 2ZSIA 4RNCA 5HF8A 3C6BA 1CUAA 2EDCA 2WM2A 2HA7A 2E3JA 4KR0A 1Y7HA 2OG1A 3H2KA 4NZZA 1LZKA 2XUIA 4U2FA 2WKWA 2WFZA 2DR0A 1JJFA 2LIPA 1J07A 4MEBA 2ZYIA 3VISA 1EVEA 5CXUA 2FJPA 1AGYA 4DM7A 3HI4A 2XUDA 3VJLA 3I2JA 5A71A 1WPRA 2ZJ6A 3I1YA 3IBTA 5AKKA 6YASA 1YAHA 4J0GA 1EK1A 3HJUA 4X93A 2V98A 1XZAA 4FLEA 3KWJA 1JJBA 1CEXA 1LPMA 1OILA 2I78A 4OYLA 1XZJA 1C4XA 1F0PA 1F8UA 2ACKA 4J0JA 4CI9A 2PL5A 4JYPA 4CG1A 2IIVA 3FYTA 3S8YA 1BS9A 2XLBA 3TRDA 5ALRA 3DEAA 2OPHA 2I3ZA 3BDIA 4FBMA 3T52A 2HA5A 5K3DA 5HCUA 3VJMA 3A2LA 4W1QA 3MUNA 2ZYRA 5CBKA 1AC5A 4BP8A 3WL8A 4MWTA 4U2CA 2CKMA 3WWPA 1BN7A 5K5EA 4BE9A 5AM4A 3OC0A 1MU0A 2Z8XA 1CUJA 4NVRA 1BROA 2GBCA 5CURA 4P08A 3I2IA 3G0DA 3FSGD 2DSNA 3H1AA 5T4EA 2Z5GA 1AQLA 1O6FA 5EIHA 3F9CA 5AI0A 5AK3A 4N5IX 4EHBA 2O7VA 5K3EA 3U0VA 1PJAA 4Q3KA 4QLAA 1CUGA 1C7JA 3O95A 3ZLTA 2AJDA 1E5TA 3WKAA 2VF2A 5HQ3A 1CUBA 2RIPA 1CQWA 5BOVA 2WUGA 4OYYA 2JGIA 4L3WA 1IUPA 1WHTA 2C4HA 5JARA 2OCLA 4AXBA 2O7RA 1UK8A 3OURA 2GZSA 3WWDA 4X95A 4LXGA 4IH4A 3AIOA 3FOBA 2OGZA 1VJ5A 4Y2XA 2WTMA 2C0PA 5AKXA 5A2GA 4PO3X 4X92A 3MGAA 1B41A 3V1KA 3HYSA 5ALVA 1HBJA 4GEGA 3DOHA 4QWWA 2GYVA 3G9UA 5ALNA 5JADA 1P0IA 3E0XA 2EDAA 5A7GA 3I2HA 3ZLVA 5C8XA 1WOMA 5ALQA 2ONCA 5FKJA 1IZ7A 1EK2A 5FLKA 3OM8A 2G5PA 2PX6A 5CT8A 1YA8A 4G4JA 3V9AA 5E2IA 5A7FA 4ROTA 3WKEA 5HF5A 1EDEA 3DS8A 4MXDA 3VDXA 4HXFB 3H2HA 4B85A 3ZWQA 4A5SA 1CUHA 2I03A 4GBGA 5DYWA 5ALUA 4OB6A 5FUMA 5EGNA 5ALMA 2OCIA 3BDVA 3I6YA 1MNAA 4E14A 3ED1A 4H0CA 2HM7A 5EHXA 2CUTA 1FFDA 1CUEA 3PDCA 4WJLA 1XZEA 1E8NA 3DLTA 4HS9A 4H7HA 4QDOA 1LPPA 4AB1A 1GXSA 5LZ9A 3U1TA 2VA9A 3HLKA 4BCCA 5HKBA 2WUDA 3O9VA 1XLVA 4W1RA 5AOBA 1GPKA 3HSSA 4W1PA 1LBSA 3R41A 5SYNA 1Q0RA 4N8SA 1XKLA 2VJCA 3HRHA 1XZMA 1H2WA 3SWWA 3IUNA 2P8SA 3KD2A 4DNQA 4BTLA 2WHPA 2XUKA 2ZVDA 4FFWA 2ZSHA 4OCZA 2PUHA 4X3CA 2GYUA 2H7XA 2WU4A 4JEIA 4O08A 4QDXA 1LNSA 1IVYA 4Q3OA 4UHEA 2JGMA 4HRXA 1LPAB 4L9AA 3D59A 5K3BA 1UFOA 1E8MA 4KAAA 4BAZA 3O4IA 2PSJA 5JD5A 1F6WA 4KYVA 2XMZA 5FDFA 5ALYA 5FPPA 4OPMA 5EIEA 5LLSA 1IUOA 1XRLA 4KAJA 1S8OA 2QUBA 1N1MA 4G8BA 2QZPA 3AJAA 3BJMA 1WHSA 1JJIA 1WM1A 4INZA 1FFBA 4CCWA 5K3FA 1DINA 4WCVA 2FX5A 4G8CA 1TKRA 4HXGA 4IQ4A 4UBLA 1QE3A 3W05A 3FLAA 5LKRA 5AK6A 5CTAA 2QXTA 1QIEA 3O0DA 4UHCA 5DJ5A 2VTVA 1P0PA 3H1BA 1UT6A 5AO9A 5JASA 1H22A 2RHTA 3AZPA 1UKCA 3IURA 5JALA 3WKDA 1CUYA 1NX9A 3WA7A 1DTEA 3F98A 3R3YA 3I2KA 4H7EA 5H3HA 4EY4A 4W63A 3R3VA 3DCNA 4EB0A 1LGYA 3HC7A 3JW8A 3QMWA 1FJ2A 4KE7A 3A2MA 4NS4A 3W2TA 1QOZA 4XX1A 2O2IA 1EXWA 4H7FA 4XJVA 3A70A 4UFNA 4DMCA 5AH0A 2V97A 1CFJA 5DYYA 5IVIA 3O9MA 1VOTA 3GROA 4MJ3A 5D6OA 4H18A 1MT3A 1TK3A 3ESAA 2BGRA 2BUCA 1XQYA 2I3DA 3ZI7A 2WFLB 3M81A 4MWSA 1FFCA 1SCQA 4K5QA 2VQ6A 4M0FA 1XZGA 2XQGA 2DHDA 2ZJ7A 1MX9A 4CCYB 4BC1A 2QRUA 5F4ZA 4G4IA 4DMHA 4ZRDA 1LBTA 4HXEB 3WJ1A 3R3XA 4UHHA 4WY8A 2WIKA 1X2BA 2H9YA 1ZI9A 3I6MA 4B80A 1YS1X 1QIGA 2UZ0A 4P9NA 4J3JA 5JATA 2HU7A 4X91A 2JGKA 5DNUA 1VZ2A 4UFOA 3VVLA 1TAHA 5AI6A 2QXUA 4PV7A 1TRHA 5JD4A 3GFFA 5I8PA 4IO0A 4K6KA 4WDQA 4P92A 4X6XA 1ORWA 2C58A 3DYIA 5IVDA 4EBBA 5AKIA 3BIWA 2QVBA 4N8EA 4RGYA 2G5TA 1YA4A 2WTNA 4J7AA 1QIKA 2DFPA 1CIJA 1K4YA 3A2NA 3NGMA 4TVKA 2RI6A 3VVMA 4BYMA 5CXXA 3C87A 1QIJA 2DQYA 3LIIA 2XMQA 1BU8A 3R3ZA 5ALOA 1P0QA 1UOOA 1QIMA 4H7KA 3D4LA 4LXIA 2HA0A 5IKXA 4FNGA 5FOQA 4BATA 2XI4A 1G4HA 3G0BA 4C4YA 2CBGA 4LIPD 4MEAA 4QE3A 3HXKA 3H04A 2BJHA 1Y37A 1UXOA 3WK4A 4UBOA 2PSEA 4G1FA 1ODCA 2HRRA 1L7RA 5J3JA 1BN6A 5AKGA 2WIDA 1Q83A 5JD6A 4GW3A 2OCGA 5HKAA 2RGUA 4QDZA 3PI6A 4K6GA 5ALJA 3CXUA 1MAAA 1XZHA 5AIAA 5CH3A 1W4LA 3VKFA 2XMRA 1JFRA 1VXRA 5ALEA 4RPCA 4EY6A 4PSUA 3DL7A 2XB6A 2XQKA 3R3WA 3OOSA 1XQXA 1GQRA 3B12A 4G4GA 4X90A 4ARBA 1MAHA 4DSAA 5HZGA 3SK0A 3TGLA 2PBLA 3EBLA 1SOMA 4GLBA 3WQHA 3LIPA 1DT5A 4ETWA 1U4NA 3I2FA 2WIFA 3FLEA 4HVTA 5T4HA 2XT0A 1QONA 2IX9A 2XE4A 3IA2A 4Q1VA 4C4ZA 3IDAA 4E46A 2BAGA 1WPXA 2FUKA 4UBJA 2CZQA 4QNNA 3DJYA 4H77A 2BCEA 1EB8A 3PICA 4X00A 1VZ3A 2VSQA 2QS9A 3HZOA 4KEAA 1XKTA 5LZ4A 3G7NA 1EDDA 5C8ZA 4UBNA 1QFSA 5JZBA 2QOEA 3FYUB 2YYSA 2WJ3A 3L1JA 2XUFA 5JAPA 1QTRA 4F0JA 3C70A 1UOPA 2OQIA 2GBFA 3CCBA 3PUHA 1YB6A 3BJRA 1MN6A 3H19A 2G63A 5FP0A 2HU8A 3KDAA 2H7YA 4TGLA 5HFNA 3OPMA 1AUOA 2OAEA 1CUFA 5AKLA 2OCKA 4DMKA 5ALFA 3QMVA 1EH5A 1GT6A 4AX4A 4XIIA 3PF9A 1A8QA 4Y2YA 2HA4A 2AJ8A 3D2CA 1ZI8A 4GI1A 5K3AA 4BDTA 1KEZA 3SX4A 3H0CA 3G0GA 1PV1A 2OGTA 4I19A 1UK6A 5BWBA 3DOIA 3V48A 2J4FA 2XUQA 2XQIA 4U2BA 2QJRA 3ZPXA 3OG9A 4AN0A 3IIIA 4A16A 4GWLA 5DTIA 1UZAA 2HA2A 5AHXA 3E4DA 5LYYA 2XUAA 1TCBA 1CUCA 3NWOA 5ISMA 1THGA 2XMCA 3D7RA 4B0PA 3QYJA 3WK9A 3N0TA 2B4KA 4OUKX 2CB9A 5AM2A 1LPOA 1CRLA 4BRZA 5EHQA 2R8BA 2Y1KA 4CIBA 2VATA 3WWOA 4PQEA 3V1MA 2C0QA 4YK7A 1BCRA 4HRYA 5LIPA 2JBWA 3C45A 4QDTA 3MVEA 1NU8A 1JI3A 3C6ZA 5HF6A 2QUAA 5IVKA 5YASA 4X6YA 2VT7A 4G8DA 4ZWNA 3OTQA 3JWEA 5CMLA 3G9XA 4J0HA 3H17A 3DL4A 4AO7A 4ZV9A 1WCYA 1XRPA 1KU6A 2VAVA 4X6UA 3WA6A 2WJ4A 3M82A 3WK8A 4BVLA 3D2AA 3RK4A 1CV2A 3T4UA 3CN9A 3AIMA 3V1NA 1OCEA 4EA6A 5ALPA 3F96A 2PSFA 2J4CA 1QTIA 3ESBA 3DYVA 3DD5A 2GYWA 1J06A 5EIAA 4FLMA 1K63A 1U8EA 2WG0A 1CR6A 2YXPX 5AP9A 4WFKA 3K9BA 4M0EA 1XZKA 2IITA 5DLPA 4GDMA 1WB5A 1N5MA 2QR5A 5AM1A 4P93A 4HTAA 4Q82A 1USWA 3WL7A 1PFQA 1KU0A 4WFJA 2J3DA 4BRSA 3QPCA 3C43A 3DKKA 4DSZA 5CW2A 1BEZA 4E15A 3WYDA 1ZICA 2OXEA 5FXMA 1VE6A 3G9ZA 5AM5A 5HK8A 1A8SA 1QJ4A 4Y2TA 4GHWA 1G66A 2JGLA 3H2GA 2VT6A 5LKAA 2PU5A 3PFCA 2XUOA 1YS2X 3STXA 3BL8A 3D3NA 3IUQA 4PSDA 2AJCA 4PNZA 2ECFA 3WK6A 5LZ8A 4QZVA 5AI4A 3EF3A 2HDWA 3LCRA 3RLIA 4OD0A 5C7YA 4G5XA 1GZ7A 1XZLA 2JGJA 4FMPA 3BF7A 2GBGA 4ZXFA 1EVQA 1HPLA 4KJXA 1W52X 2ZYSA 3N2ZB 3IULA 5D3ZA 2PKYX 3PF8A 4WDRA 4ZV7A 1YAJA 1H2XA 2XDWA 3WMRA 3EIOA 3STWA 3WL5A 3LS2A 1GGVA 3IUJA 5AKYA 4QA9A 2Y2UA 4J0KA 3FVRA 1HQDA 4DNOA 5A62A 2YASA 3IVMA 3AIKA 1HL7A 4MQLA 1CUZA 1QGED 4MYSA 4J0DA 1XLWA 1K8QA 1M33A 5JIBA 3AUKA 3GA7A 1DWOA 2DCMA 1DX4A 2Y6VA 1XFDA 2PUJA 2QMQA 1MO2A 1H2YA 3WKBA 4UBKA 5KWJA 1RWQA 4OU5A 2RAUA 2VAXA 4BTVA 2RONA 4B83A 5C81A 3ANTA 2HL6A 1K6EA 1ZD3A 4LXHA 3ZV7A 1ZD2P 4UHBA 4X97A 4B9EA 4DNFA 5E4YA 5BV7A 5E4JA 4Z49A 3ESDA 4GXNA 5FV4A 2BKLA 1P0MA 1G42A 1W6RA 3K2IA 2WUEA 1ISPA 1ORVA 3AFIA 3DNMA 4F60A 2W6CX 4BCDA 1TCAA 4L0CA 4CG2A 2HRQA 4RE5A 1GKKA 2WJ6A 4H35A 3G8YA 1ZIXA 2Z3WA 1N5RA 3FWHA 3WK7A 4Y2UA 3STTA 2HFJA 2JEYA 4UHDA 4UHFA 5HQ3B 4C4XA 4GECA 3C8HA 4Y2RA 3B5EA 5ALDA 3WIBA 3FVTA 3AZOA 2X8BA 1CUWA 2GZRA 2V96A 5EFZA 3W06A 1THTA 5JANA 3W04A 4S0XA 2AXEA 1GKLA 1TQHA 2B9VA 4ITVA 5T4FA 5EI5A 4FDMA 3UMJA 2K2QB 1G5FA 3LP5A 4RE6A 4BC0A 1UKBA 2PU7A 5AIBA 1XZBA 2CJPA 1ODSA 3VJKA 4Q34A 4BB0A 1MX1A 2JIDA 4QWMA 1E89A 3QPDA 2XMSA 2QM0A 2WSLA 4LYEA 4G9GA 2WHQA 4HZGA 1A88A 1SFRA 5ALIA 4WFIA 2HA6A 3MUOA 4FWBA 1EX9A 5AK4A 2Z8ZA 4CG3A 1GPLA 1BEEA 3AZQA 2HFKA 1GQSA 2O2GA 5KWIA 2VJAA 3AILA 4FKBA 2PSHA 5ALTA 4B7ZA 2D0DA 5CH8A 2B61A 4U2DA 2WHRA 4AZ3A 3B3QA 5ALWA 2C5GA 4Y9SA 3R0VA 1CPYA 4BDSA 4OSEA 4XVCA 4BVKA 1Q84A 2WIJA 3IUMA 4L72A 3GZJA 1XZDA 3WWCA 4X94A 1UWCA 2XQJA 4OB7A 5AM0A 3TEJA 1AZWA 5LZ5A 1AMNA 4F5ZA 4Y2PA 5AK5A 1DWPA 4EZIA 1SC9A 2WFMA 1QIHA 4FBLA 3STUA 3I2GA 1U2EA 3KXPA 3VXKA 3R3UA 2NW6A 3F67A 4Y2QA 5KBYA 3QVMA 2V9ZA 3WL6A 4J03A 1VKHA 2PSDA 2WHPB
chains in the Genus database with same CATH superfamily
1V71A 3BRSA 3OZSA 1M6HA 3PPWA 1NRIA 1Y5MA 1M75A 4MYRA 4IM7A 3A6HA 2ZCUA 2WILA 1CZRA 1XRMA 2DCUA 5FBLB 3T3IA 3ZKWA 2BM1A 1GZ5A 5A0TA 4LGCA 2VAWA 2VT3A 4S3MA 1XRNA 4B5KA 4C08A 2QY6A 1JU3A 5CT4A 3D3WA 1U8YA 4B46A 1BX0A 1ZK4A 1Q14A 1PS9A 2C8VA 3M8KA 1KZ7B 5E9WA 1UMCA 2HF7A 2GCNA 2J9XB 3C8DA 2VDWB 3F1KA 4KC0A 3H75A 2FZVA 4UASA 2ZBVA 5SICE 4C21A 3JQGB 2WU3A 1GTL1 4ZT4A 5KO2A 1N6RA 4CDRA 4MB0A 1UKYA 2EKDA 2OCBA 4FB4A 2VO1A 3JQQA 2BKAA 1WU7A 3HCCA 2WG1A 5EIBC 1YTLA 1QFJA 1ZMRA 4OI4A 2AWOA 3K8OE 3T7TA 3TLAA 1D1PA 1K6JA 1KAGA 4EY5A 1ZAKA 1GPJA 2ZI7A 3EUAA 1RSZA 1J97A 2HKIA 4D41A 1UC8A 5B7QA 2VXYA 5J4KA 1A8UA 1DBWA 2MSCB 1BOFA 2QRZA 1XBTA 3FMPB 2W2LA 2W58A 3RS4A 4A8JC 4WECA 3PXAA 1VMAA 1IBSA 2D6FA 3A14A 2F1KA 3A6LA 1V7QA 3IMEA 3T7DA 5KVAA 3KJGA 4ZJZA 1EFVA 1M34B 2PGJA 2PA0A 3KQWA 3O4JA 3R4CA 1RHKA 4KPUB 2QRNA 1LI7A 4KGXA 3BXPA 4RULA 2HCJB 3BWBA 5KVQA 4TT3D 4GGOA 1GA6A 4WUVA 4J8PA 4F5EA 1KQOA 4G3XA 2ADFA 4UAJA 3J7TA 3FNBA 3H4MA 3RD5A 1VPDA 2HCTA 4CFSA 3NOXA 5A1TA 1VC2A 3WWZA 1MJ5A 4FW9A 4RIEA 3DMRA 1BOOA 3N6XA 4AJEA 5EHNA 5LZ7A 1ONPA 5B4UA 1XQWA 3DFZA 3SHFA 1H3NA 5EHGA 3P7MA 3EQ7A 3C3AA 1JE0A 3HB1A 1VPTA 4CKEB 3E9MA 5H82A 5BSTA 5LKAA 2I8CA 1QR6A 3ABZA 2ZSDA 1HNNA 2A2ZA 2JEZA 3HWRA 1OD6A 2P9JA 3LECA 3IALA 3ONVA 4LXTA 5LQAA 1JQEA 1LV8A 4UNSA 5DNWA 4X1KA 4LISA 4QU9A 4YJ2F 3CLUD 2CDAA 4UU0A 3OCYA 3S5JA 2I7DA 3W2EA 3RRMA 1VG9B 5ALKA 1CZUA 4I8IA 2WFLA 4DCVA 4RYDA 3OIGA 4PQRA 1CUIA 4MW4A 1J1IA 1VL0A 4EBFA 3JQFC 4Q9JA 5HK9A 4FEGA 2H7CA 5FTWA 5A4JA 3PDUA 4REMA 2QU8A 5MN4A 1I2AA 4GVLA 1C2TA 1DIOB 1CBUA 1N9GB 1JU4A 1Z16A 2HDNB 2R7LA 1Y9DA 3KFXA 1DUIA 5IDVA 1J2EA 3DZ8A 4YJ2A 4V2UA 1QBGA 4TL8A 3ZQ6A 3AKZA 4BZWA 3C1UA 3D6HA 1M1NB 3EFOB 4DR1B 1VLQA 2WP8J 3AHFA 4GLJA 5JE8A 1Z0FA 1QE5A 3Q8WA 3WJ7A 2GVNA 1B6GA 1OLXB 3DW3X 1MG0A 1BRTA 1EUCB 2JCGA 3ZY4A 4E4YA 3LT1A 2APJA 1Y6FA 5JWRA 2N1BA 5K0FA 5DULA 4BNUA 3VYSB 2POCA 1CW2B 2C54A 2RG7A 3NWBA 2DQZA 1NWCA 2VSYA 5CYFA 2ZULA 1SKUA 2WG2A 2OA0A 2IU4A 3KRTA 4N01A 2Q5JA 1HNXB 1ZJ6A 2CL0X 5JPCA 3H0KA 4CR8A 4B74A 4YUWA 3LWBA 4DG9A 4TPKA 2GSDA 2M6KA 3G0IA 3I9OA 4DR6B 2XD4A 3NYRA 2PXCA 1GNLA 1Z5WA 2VZLA 3E1SA 1HFEL 1TC2A 1XD2B 2AR9A 2ECQA 3BOSA 3QA3E 1LDGA 2YS7A 3CZQA 4IZ6A 1COWD 2PT6A 3JQFA 2P2SA 1Z39A 3IVXA 2VYND 4EUSA 4F3CA 3URMA 3FMIA 1CUDA 2FN3A 4QJ4A 2C2ZA 4AAYA 3UJCA 2YNMD 1L4KA 4OYHA 3DAOA 1MB2A 4S35A 1J0BA 1VI5A 1WZNA 3S28A 4TT8A 5KHOC 4LYDA 1WUTA 1QSGA 3RNLA 3UJBA 1WB6A 4RELA 1XLTA 3ORHA 4UDXX 3EVTA 4RS4A 2XF8A 2GHIA 1HKUA 2WSSA 2VSFA 2D13A 1LPBB 1UH5A 1KZ4A 4MQ6A 3GYGA 4PRZA 5LA6B 1B74A 3P27A 5IJWA 1P2SA 1R5NA 3KAQA 4CUZA 5BUSA 3NFYA 3D2BA 2IQIA 2XW6A 4BPBA 4D3DA 1GSAA 4IFIA 3ILSA 4PX5A 1ISJA 1ECCA 1PLKA 1Q15A 3NNNA 3O7MA 4XPIA 3SCZA 1IEXA 2ASVA 5FPHA 3IHKA 2FNAA 3TQTA 1WXWA 3BRWD 3GUYA 1T2CA 4BAGA 4DYDA 4RK5A 1Z7WA 2KM1A 4NCXA 4EGCB 4EJ6A 3A6KA 3HSYA 3L6CA 3NNDA 4ZYYA 3TRIA 3AUYA 3EXEB 1XU7A 3BA1A 4LBWA 2P2ZA 2D1QA 4OFXA 2O8VA 2OV2A 4RSHA 5ITZB 1QNLA 3CINA 1JFVA 2D7JA 4RU1A 2V3CC 3IDQA 4YEDA 4ILKA 1E2BA 3BWXA 3HBMA 2FETA 1PT5A 3BTSA 4B82A 1B2LA 1M6VA 3OA2A 4L0QA 5FJJA 3ENNA 2O2HA 4OHXA 3TE6A 1KSJA 1D2RA 3EA5A 4OK3A 1KFJB 3PQFA 4JITA 3O3CA 3PA6A 2QSUA 1GZSA 1GARA 1NTRA 4Y2SA 4IDCA 2B6NA 4GMFA 1U5BB 1WIWA 2ATIA 1ZGAA 3DFFA 3IAXA 5DHPA 4ZVUA 3WISA 4R9SA 5KX5B 1HXHA 2RHCA 4YT4A 1QGOA 1YL6A 2QV7A 3DDUA 4ND1A 5M04A 4QYXA 4UVEA 2FE4A 4DADA 4B3TB 1FX0A 4FHGA 4WV3A 3CIFA 1GYQA 3FGPA 1K5HA 4C03A 2AB0A 3RFTA 5AUQA 1L1EA 4DREA 3OE7A 1G5TA 3KWFA 4ODIA 2LKDA 1TVKB 3MTQA 2J09A 3I1IA 2H0RA 4GC5A 5AXAA 1CJKC 2P30A 2YL2A 3ZCVA 5HOEA 1G6KA 4WK2B 1Z5VA 4L02A 1T24A 1D07A 1M2GA 1RZ3A 3COPA 5F2EA 2OSVA 1QWSA 2QD3A 2RAFA 2YIJA 4XASA 4ZV4A 2ORIA 1X2EA 3GZNA 3PPYA 5BY2A 1A4RA 4YC7A 1DMSA 3T3MB 4J0IA 4MVYA 3H65A 2JJ8A 3ROMA 3GLGA 4KFRA 2ZR9A 3HVIA 3SZMA 3I9KA 5K03A 3L7NA 1P5ZB 4R8LA 5JYEA 4JFAA 1UDBA 3PLNA 4L08A 2QY9A 3LKVA 2ZKLA 4FOOA 1DAOA 2ZBDA 2GK6A 2IF2A 4RLHA 3A9RA 2B5WA 4BNMA 3GX1A 3PEYA 2X5XA 1IUNA 1Q91A 2Y1LA 2O0LA 3OUUA 3DHYA 1M7GA 3FNEA 1RP1A 1ZMXA 1NW7A 3EGXB 2A3RA 3CW8X 4IYRA 5E8RA 1Z0JA 4EFDA 1XU9A 2D8AA 2LWIA 3EFBA 5BXYA 2OGSA 4YCSA 4CLOA 4BFYA 3TSAA 1XXHB 3B78A 2CFIA 4JXKA 1NVAA 5JCJA 2DKFA 3E9EA 4JSYA 3FZYA 5TRTA 1JS1X 2ORED 5EJ4A 1E9BA 2C3UA 2P6MA 4HDAA 5JHHB 1VE7A 2H2AA 1ACJA 4NYMR 4UD6A 3Q10A 1YCDA 4YJGB 5SZJA 2EZUA 4BO6A 5MGBA 4XYMA 3E27A 1SU4A 3V4OA 2AI2A 4XLZA 5IEBA 1U2DA 4Q18A 3DL0A 1SHKA 2WYVA 4NARA 1PJQA 3CKMA 2CL5A 2YWFA 3CLRC 1GWNA 1SXJD 1CERA 1W1IA 2GZ2A 2I6XA 2GBPA 4FWIB 4NBUA 1SPXA 2J9FB 2NZUG 3HO1A 1JEYA 4PZZA 2PS1A 3BEOA 1J0CA 3R44A 3RSGA 4BE7B 4EUKA 2BKVA 3I76A 1YHYA 1BD4A 3BCHA 3PHGA 4NLLA 3VNBA 1STOA 1R4ZA 2DTDA 4E2ZA 3F6EX 5K6AC 4ARUA 2A5YB 1PNVA 4HTFA 3EW7A 1JTEA 4KACA 3PUIA 4TWBA 3GRFA 3IHWA 2XA9A 4C2TA 2AUNA 2E5LB 1AHIA 1SG0A 3TLGB 1G8AA 4RO0A 1U9ZA 2A30A 1YKGA 2R5NA 4POAA 4CDMA 1RYYA 4ZMRA 2DQKA 1Z34A 2QX8A 3I53A 2ZZMA 2H9IA 4OJMX 2B9EA 4IUDS 1V11B 1RBQA 2ON6A 3GGSA 2FGKA 1HG0A 3BE8A 4FU0A 5JNRA 3KKZA 5DOZA 5J5VA 5IHPA 3L7AA 4KQMA 4DR2B 2HQBA 3GLIB 3MRTA 1Y1RA 3OT4A 2ZBPA 4C0HA 4QVIA 3EVZA 4JLOA 4R1LA 2X0KA 3NM5A 5KNCA 2BKUA 4DDWA 5IABA 3N8HA 4Y8VA 2R3SA 3NT5A 4QFMA 3VA7A 4JEHA 2BEUA 1PZFA 2ZSJA 2JNWA 5EIWA 3CVWA 3DZCA 3E53A 5ALLA 5A4DA 1N8SA 3CO0S 3IJ5A 2I65A 2V55B 3OI7A 2CUNA 4JENA 3RUFA 3UCXA 5A7HA 3OFVA 5DHFA 1B93A 3AW8A 4R1TA 5E7IA 3IAHA 1QFMA 1IULA 1YK0A 1HO3A 2EIHA 4P82A 3HB5X 4OGFA 4DM4A 5DFAA 3PC7A 4A0RA 3ANLA 2BUAA 4NF2A 3C3BA 1SUPA 3AMVA 4KU4A 1QDEA 3DEKA 1AU9A 4Z9YA 3P0EA 2BL4A 2IBMA 4YUYA 4X7RA 2A4KA 2BJVA 2X76A 4G23A 4CQMB 5JYDA 1XU4A 2A1UA 2CXOA 3MQ2A 3K8ZA 4D57A 2Z8YA 3FVQA 1C9KA 2JLYA 5K0ZA 1NQXA 3ICWA 1IPHA 3O3MB 3PKJA 5AUNB 5C7OO 4ITUA 3GOQA 4ARZA 4LVOA 2RC6A 1Y3BE 1N32B 3B1KA 3ANSA 2OHHA 2IHBA 4QUGA 3BH0A 1OWPA 3LUBA 4EX6A 4EMBA 2JS7A 4UMVA 3PKZA 2B3TA 3CF4G 2CEKA 5DGDA 3RVRA 4FGKA 1TCVA 1K86A 5LMUB 4W6ZA 4D6XA 1P74A 2FZ4A 2EX4A 5HF9A 3RHZA 5ICCA 1E92A 5DU2A 3RHFA 1IN8A 2J9RA 4BEVA 5I7UA 3NT4A 4UZSA 1ZCZA 2AV6A 2JVIA 4URFA 4FYWA 3H5NA 4FVTA 2QD1A 1TJPB 5J23A 2PQ6A 2XMGA 4A82A 1BA3A 4RHTA 5F35A 1E3QA 1QYVA 4XGRA 1QHIA 2G80A 1WUKS 2OFWA 4KODA 3WJ2A 4BLOA 1EX7A 3F3MA 3RVQA 2GEKA 1PJ4A 4QDUA 1PFYA 1RWOA 3EVNA 3HM2A 4AJ4A 5ABPA 1EINA 3GUUA 2F00A 2FUG6 3GLHB 5KTNA 4LWPA 4WEOA 1TGYA 3JZFA 5TDHA 1HEYA 3UTDA 4LGMA 3MWDB 2BISA 3GEDA 5CUQA 2AZ4A 4Y9TA 3N2LA 3PFHA 4UVDA 1L3CA 4S1VA 4WZAA 3Q15C 1KXJA 4RJIA 4DLPA 3FPFA 2D5IA 1XROA 4WGGA 2FR0A 3MAGA 5B6JA 1T2UA 5FO0A 4KLAA 4L16A 3TW8B 3KPYA 2ZWPA 3SYKA 2A86A 2AW3A 5AICA 3SX2A 1F7VA 1Y63A 1KYZA 1QZ3A 1QO9A 4JLSA 4XLTA 4ZICA 3GW8A 3PITA 4ZU1X 1NDUA 3VMMA 4DMMA 1YZTA 2R8OA 1LU9A 1PYOA 2OBLA 4P2GA 2YQ4A 5F3WB 2UZAA 1NAHA 1T91A 1NXPA 2D0IA 1TE2A 2X2PA 4FMDB 4QQ8A 3V1LA 4V24A 4LZNA 4Z1MA 2B0CA 4L8YA 4YMLA 2DTXA 2VJDA 3Q0TA 1H5QA 4W5TA 3FOEC 3NOQA 4P7GA 1T25A 2YQ5A 4RYLA 1R8YA 3ITKA 4N5NA 4Z5XA 3AL2A 5BWCA 2HNBA 3HA7A 1X38A 3T6KA 2NYUA 2ZUFA 3C3EA 1YKSA 2TMYA 1KHTA 2Q1YA 1Q7RA 4N6OA 3RF6A 3BHJA 1A5ZA 1UCFA 1YOVA 4KLZA 3IBGA 4K87A 4A8JB 5L3SB 4KPYA 4HLQB 5D3MA 1L9XA 1Q12A 3RUEA 2WJJA 1W76A 2BMVA 3DT6A 4H6PA 3OMWA 1V9LA 3C0KA 5JECA 4YI5A 3K71B 3UG7A 1HTBA 4PE5B 3SYTA 3AR5A 3DTVA 3NMUF 4NAVA 4PSCA 5DLDA 3ZNOA 5KPDA 3ZD6A 3C3XA 4DMGA 2YOGA 3HADA 4UUBA 2JI8A 4LYGA 2DPXA 2CCKA 2X1VA 3GFVA 4M9RA 5FNZA 3U3OA 1UMBB 2PBRA 2QD4A 2UUPA 3WSVA 3AM5A 1SC4A 2QX7A 5FUQA 4W5RA 2JDID 4DV0B 2D4AA 4OMDA 3FNHA 1JEAA 1XJQA 5JXHA 1Y7TA 2B82A 2I2DA 2AKAB 2RSLA 3LCUA 4FT4A 4KBGA 3FHJA 2O8DA 4XUGB 1BXZA 3G2OA 4Z3KA 4Y7DA 1G7RA 5B3KA 4AXXA 4X65B 1OA0A 2EKZA 4FK8A 4AWXA 3B48A 1PK8A 3UK1A 2VJBA 4IHJB 5DWDA 1O94C 1XPOA 2C8KA 2JGEA 1IHDA 2YZ2A 1F8XA 5KSZA 3P45A 4HGRA 2L69A 5C37A 2JLZA 1LLFA 1OIVA 2Q9CA 4EO4A 3DBHA 2D3TA 1PHPA 3U19A 4MMXB 1NJGA 3E82A 4FFVA 2OBXA 3RRNA 3UMVA 4UTVA 2D06A 4I4TB 3ZVNA 3KIPA 1E0DA 1DKOA 1ZXXA 1T8WA 1Y5RA 1OLOA 3AVUA 4R7GA 4BNIA 1RJ9A 4DNXA 1LF0A 4FPXA 2AJLI 4QOFA 3X3HA 5KKNB 5K3OA 5J1TB 5KNLA 4JKOA 4O2AF 4F4FA 3UYKA 4ZMSA 3PGJA 2R86A 3VVMA 1EZZA 4LXUA 3U7QB 1XRQA 2G40A 2JCVA 4AG6A 1OB5A 2ADOA 1KNQA 5JS2A 5LC1A 5KNBH 3QEBZ 3LGXA 2W42A 4UEWA 3W5UA 3GI1A 3WLAA 4B6GA 5EXEA 1BHO1 1TB4A 4ZEWA 2DFDA 3ZCXA 4N41A 4M9QA 1KOGA 2H2HA 4Y6PA 3FIUA 1HLFA 4WCFC 2JATA 1QTQA 3N87A 4L76A 2ZI3A 5CD9A 4FM9A 4C0KA 1BGVA 3JAKA 1BWSA 3C3YA 4O2AA 4ACAA 4DEYA 3VSEA 1W93A 3R1IA 3L6BA 5DDIP 3O2JA 3AFOA 2AFIB 4R5MA 4P84A 1R8XA 1T3TA 4D6PA 4D8XA 3GJSA 1YDWA 1KQFA 1Q7TA 3SHOA 1NVVR 1WPGA 1BCRB 1MPXA 1YASA 1PR4A 1J25A 2DX7A 3H4IA 4LPSA 3FPAA 1YZKA 3GARA 3F78A 4BVJA 1WSBA 2ZB4A 4RF4A 2QSYA 3ZNNA 1PYGA 3RYFA 3ND5A 2O59A 2R44A 5CVTA 1Z7YA 4G01B 5IASA 2NAPA 1I30A 1LXCA 2VF7A 4RK7A 3U61B 3KJIA 4D4JA 3GQBB 4N3BA 4CM9A 3GH1A 1Y89A 4EYOA 4I4IA 3FE2A 3PXCX 4NG4A 2J5XA 4KXFB 4LCEA 1R0CA 4JLKA 4X9XA 1VA4A 1F5SA 3MS7A 4LJ9A 4UTXA 2MYTA 1U0SY 1DXHA 3PJFA 1THZA 4DJEC 2YFKA 2JFBA 4YDRA 5F77A 3LV8A 4IJ5A 4S1PA 3RKSA 2O54A 2ERYA 5KREA 4EF5A 1JEEA 1JB1A 1K2WA 1J2RA 3VGJA 3C5WP 2E1PA 1N3YA 1E9EA 1W2HA 5DSZA 3VO1A 4PICA 5DCUA 1DT3A 3VZQA 2UKDA 1R0KA 5CT9A 4B4VA 1QV9A 1VP3A 1L6IA 3PVSA 1NQ5A 1UC9A 2VBGA 2RHLA 3B6KA 5LWQA 5EHZA 4MQFA 1J8DA 2EEZA 3DBRA 3CQ9A 4ZI5A 2FPGA 3LRXA 3OEED 4XVHA 4ZCLA 2R8YA 3PL1A 5KCZA 5ELXA 2AGVA 1HK7A 5E4TA 4R98A 4WHMA 3MB5A 2BGMA 3NBXX 1O6GA 3TIXB 4F96A 1CEEA 3UATA 3TOVA 4PG8A 2FEMA 4KWHA 4CF6A 4N18A 5DSTA 1WQ1R 5G1PA 2RE8A 1TA0A 3DBOB 1EUDB 3M70A 3LXRA 1PNRA 1SAYA 3BXZA 3NONA 2YWBA 1R0BA 1TIPA 3NYQA 5EIOA 3W9BA 1AKYA 4EX7A 1E6LA 3FCEA 1IHYA 1N3BA 1CR0A 4ZU3A 3E61A 5IDQA 1Z6QA 2VXBA 5FLYA 2B78A 4ZOBA 4QM7A 1ZJWA 3G8DA 1MB9A 3KOUA 1BG6A 4AX8A 2WPNA 5CDFA 1ZVJA 1YIAA 3CEMA 3MTJA 4A9AA 3V7WA 1I4TD 4M9XA 1WDWB 5IXYA 4K9QA 4P7JA 1H2AS 1PDWA 1QKKA 2P2NA 3AJEA 2ZRFA 5D3QA 3V4SA 2WJPA 4KR0A 1HDIA 4AU1A 4UVGA 1Y7HA 1YKFA 2ZDHA 3H2KA 4MR8B 5DXFA 3UB3A 4ERNA 3U39A 2IS6A 2PKQO 1LZKA 1CFZA 3I1JA 1Y98A 5GZ1A 1MBZA 2HIMA 2WFZA 4RVHA 5JSUA 3A1FA 3T5MA 4Q00A 5IM4F 1IPFA 5DXJA 2H4WA 4B45A 3ZQJA 4G6ZA 3G3EA 4MEBA 3ND7A 1L3IA 1KP3A 2ZYIA 4JNKA 2FPKA 4PZEA 2V5AA 3AVTA 4IOKA 4EFLA 3LVFO 4U9HS 1WP9A 1EVEA 3NDPA 1J0XO 3H9EO 3BQ9A 4G89A 1P18A 2D4HA 4GLFA 1E6CA 4OUDB 4RY9A 2IYZA 4ENUA 1J8MF 1NLMA 3T9CA 5LR6A 1AGYA 2M6SA 3U2QA 5G4LA 5JRJA 1F2TA 3HYCA 4PNPA 4WLFA 3CT6A 3LUKA 3NPMA 4HGNA 4NHEA 4F56A 5A71A 5KSPA 5IM4A 4AZWA 4ZGWA 1EQAA 3E7PA 4KHZA 4YLEA 4CKYA 4QSMA 4NQRA 5AKKA 3VHQA 4KQ1A 1I6KA 2JRLA 4B4DA 4X93A 3ZTTA 4KK3A 5LU9A 4YMHA 3X1KA 4FDAA 4UCWA 4OP3A 2ZUTA 1LPMA 2IY8A 2FH5B 2CJFA 1Y8AA 1OILA 1UBHS 2Q9BA 2XGMA 3IXMA 4HWSA 4JODA 4LK3A 3ZDFA 2FEAA 2AG1A 2AOWA 3RWMB 4TRRA 1WPQA 1D6MA 2OHFA 4D9FA 5KQRA 4PTZA 2P6PA 1GUDA 1K7FB 2BKEA 1IEQA 2G5CA 2IU3A 1FVXA 2J3KA 3T4EA 3MWJA 4J0JA 4ZYVA 2QTHA 3PSAA 3FYTA 3QVLA 2QVCA 3T0FA 5B3AA 1T6YA 1QP4A 3UPUA 4KO8A 3WGIA 1V1JA 1IVSA 2ZRPA 2BPOA 3K0FA 3ORYA 3EVGA 3A26A 3BK1A 4NYIR 3CURA 1GIAA 3FD8A 3PC6A 2IYEA 1WMSA 1E5DA 3A3YA 2PL3A 2PE5A 1EWQA 3DA8A 3DNFA 1XTUA 5CNJA 1N0IA 4Y6LA 3KQSA 4P3OA 2I62A 4YXWD 2H4FA 4MV7A 5EERA 1AT1A 4KZPA 4W1QA 3MUNA 2CBZA 3RSCA 1AC5A 5T57A 4WVLA 3TEFA 3NVKI 3FRJA 3PR3A 2WOOA 2H2IA 1N2CB 3MCVA 4FSHA 5LUBA 4D26A 3FGOA 1QU3A 4JI3B 2G06A 4QASA 4U2CA 5DN6A 1EGAA 4ERXA 3V4LA 2EL7A 5JSHA 4DB2A 3VZBA 4BPRA 5K5EA 3CNQS 1IXYA 3WIUA 4FC7A 1M2EA 4AJOA 4EHDA 1P4GA 4BKPA 1VM6A 4RY8A 2FPOA 4QBHA 4IVRA 1KOFA 1Z5NA 2W2VA 4PC6A 3ZZUA 4DJJA 2FFAA 1C9JA 1M2JA 1ADFA 1UPCA 1FNMA 3KHTA 4E0BA 2BSQA 5C1IA 2GXAA 3V1TC 3DVRX 3G0DA 3FSGD 4FDLA 5T4EA 1PZEA 3IMCA 1U6JA 1KKUA 1DHRA 2Y1OA 3GLVA 1SM4A 3WQQA 5BNWA 4DIMA 3TECE 2B92A 3IPYA 2BDTA 2SKCA 3A1EA 1WCIB 3EZ2A 1DI0A 1H8EA 1XE3A 5LJIA 3KYJB 3QU9A 3VR2A 2OEPA 2A5GA 2OUIA 5BN5B 3SZOA 3V4FA 3MELA 5AJXA 2QQEA 2ZRQA 5I7HA 1WS6A 3B6EA 1ZONA 1MO5A 1XCGB 2WV9A 3PNPA 2Y1FA 4N5IX 1E2JA 2ZIZA 1P1RA 4WJKB 2PRIA 5K3EA 3MJVA 5HM8A 1KBZA 3TLEA 4AJLA 2A9PA 4IHQA 5M7EA 4EOGA 1C7JA 3SICE 4KUGA 4AL4A 2CDNA 2JANA 3RABA 1JQLB 3ZLTA 2AJDA 3UW3A 3GP5A 1KOJA 1E5TA 3COJA 4E5SA 2B34A 4JBGA 3UENA 5AHRA 2PJRA 2O50A 2CMKA 2EZ8A 5BOVA 1TNDA 3O83A 1BQEA 1O77A 1U1DA 2V9CA 2JGIA 3G89A 1J56A 3GRVA 2Q0QA 4Q15A 4P3PA 3VTFA 1RMYA 4MJLA 1B3BA 3HCDA 1T3SA 2M9MA 4NC9A 4PSAA 4PVCA 4XOUA 5IKPA 4YJ3F 2AQIA 1XPUA 1S1CA 1O87A 2C4HA 4G86A 2D8MA 3QI2A 4AXBA 2DERA 5EVCA 3N0VA 2VR1A 4CQLA 2GN2A 5JZMA 3OURA 3L6DA 3QKWA 4XFDA 5KOJB 2W83A 4ZAXA 1NOIA 2YMMA 3RS7A 3JRNA 1GFZA 4Q4JA 4KV9A 4PLCA 1JR3E 2RB4A 3AIOA 3FOBA 4MVJI 3B89A 3K15A 4B47A 4CHTA 1VJ5A 2QUIA 2WABA 1ENYA 4NV0A 3RBZA 4TLEA 2IU0A 4PO3X 4J0FA 2ATVA 3QNWA 1KK0A 2I4NA 3HYSA 3V1KA 4YJ3A 3GLGE 5BSHA 4GH5A 2C57A 4LJAA 1LX6A 4CMEC 4P0PB 2VQFB 1Z63A 3M6VA 3CLTC 5F2OA 1KI2A 3G9UA 1ST3A 5ALNA 3UUGA 1WF6A 1HEUA 4RZHA 5FJIA 2NU9B 3D6MA 4C7KA 3GAAA 3TQIA 2CXHA 4P4GA 3I2HA 4H1VA 5FWXA 4D9KA 3NJRA 1I4LD 1M2VA 4E22A 1E69A 1XTKA 1XTPA 2NU7B 1WOMA 2Q6OA 2RMKA 4Y1EA 3O75A 4C4PA 3K2BA 4KTVE 1VSQA 3QX9A 5BQFA 5DIZA 2PZEA 5EJGA 5ILGA 1TQ4A 4PNHA 1ZC4A 2XQVA 4ZOLF 3JRXA 5JNLA 2ZG6A 2W11A 3IEXA 3OM8A 2IUSA 2PX6A 4UDOA 2PD6A 4ZAZA 2J3HA 1ZW1A 1YA8A 1FP6A 2PFGA 4G4JA 4CRWB 2DU8A 4F6LA 1E9FA 2LNDA 1VTKA 4L9WA 3V9AA 2JH8A 5A7FA 5LP6B 2BT4A 1L4FA 2QMUA 5HF5A 1O7JA 5DLYA 6NULA 5EP1A 4R9RA 1NVXQ 4JJKA 1XNRB 3OE5A 3IOEA 3LI2A 3RAFC 1E3DA 2EG5A 3ZWQA 3OY2A 5JH7B 3EQ2A 3EAQA 2I03A 3GRPA 3OM0A 3FSRA 3ADDA 4DMRA 5ALUA 5DCLA 4NFHA 1YZVA 4GC9A 4ZOLA 3HU1A 2FV8A 3OOEA 3RUAA 3AVWA 5ALMA 2OCIA 5SYAA 1QS0A 4CMEA 5JJLA 2ZDGA 3FLMA 1FBNA 1EGQA 2CYBA 2ZIWB 3L4SO 3L7YA 1EVZA 3R20A 5C4GB 1L5KA 1E6UA 1PJ3A 2G4VA 4WMLA 3ED1A 1N1DA 2HCRA 1I5RA 3NV9A 2CUTA 1AQ6A 1LRLA 1RMQA 3MJ4A 1FFDA 1HE2A 4ZU6X 1VKZA 2JLUA 1SQSA 4R7TA 3LXMA 1IVNA 3SQLA 3JZMA 2YV2A 1PQYA 1N25A 4PGMA 4G4SP 3D0OA 4P5EA 5SZIA 3RKRA 5G0WA 3GEEA 1A82A 2G71A 1E3TA 2DFLA 2XUZA 2COKA 2BZSA 4MAMA 5GV8A 4DLXA 2Q50A 1JHVA 1B1CA 2F48A 1NNEA 2A94A 3LBYA 3RU9A 1U9CA 3F2VA 4JT9A 1LPPA 5F1PA 3UAGA 4I3GA 2YDXA 4ZGBA 5T3YA 5EJ7A 1GXSA 3U1TA 1U11A 1YIOA 1Z5GA 5KIAA 1CQJA 4BO5A 3FKSA 5CB6A 1QQBA 5HKBA 1REQB 4BXOA 1IM8A 1ULHA 1PO7A 2BI8A 4J3NA 4AIRA 3T9BA 3HSSA 4HFMA 3ICEA 1LCIA 2RH8A 4P4NA 4EGAA 2GFIA 3ZK7A 1MLDA 2BFOA 2IDJA 1E98A 1V7ZA 5SYNA 3ESRA 4UCQA 4OHUA 4N8SA 2XOKD 4L7VA 2XNHA 3D02A 1IHOA 3AY7A 3CEJA 2ZCJA 4YRGA 1S8FA 2CVQA 3SWWA 2ZU6A 2CNKA 4O4JF 2GILA 2DTEA 2NTEA 1C1XB 2P8SA 2X4GA 3KD2A 3UFXB 2ZVDA 4QO7A 3SXPA 5CJPA 3FVVA 3TD9A 2IP2A 2PUHA 1U3TA 1FDIA 1NXOA 3W6ZA 4TSKA 2G83A 5HZMA 5HBGA 3R9XA 4I14A 2WU4A 5EE5B 1NX6A 3O9ZA 1JZSA 2OZLA 3QQ5A 3ZGXA 4BX0A 4RV5A 4IIYA 5IAKA 1UPFA 4O4JA 1RXWA 3GLFA 4NU8X 1EYZA 3H9GA 4FYVA 4WCFB 2H5EA 3MGBA 1UFOA 5DLEA 3UT5B 3QPWA 3V3KA 2YVQA 4JBWA 1N2BA 4XDZA 3X1XA 3OZXA 2HYDA 2Z2YA 3I42A 4P4LA 4PO8A 3T0GA 3MC1A 5HEKA 4HNVA 2PSJA 4BNDB 5JD5A 3L46A 3C4QA 2EV9A 3UM9A 3QV2A 1KIFA 3DE2X 2ZUWA 3USZA 3DBIA 1P7WA 1JVNA 4LJKA 4OPMA 5FPPA 1NRJB 2IP4A 1AUXA 1A98A 1U0HC 2VHTA 1NM5C 3OWOA 4L95C 2ODEA 1YFKA 2SCUB 1E7QA 2HEIA 2QRVB 2V03A 3DWEX 3FNFA 3M6FA 1OLSA 1V1MB 1KOLA 5SY4A 3IILA 4RTKA 3VZSA 2IYXA 2RBGA 4BZPA 4N3AA 2H4YA 5ECGC 3Q0IA 4MVCA 3PZRA 2QZPA 2PL1A 3HJAA 1OHHA 2XTMA 3AJAA 3MWYW 2Y0DA 2UAGA 4XD7A 4OTZA 2C82A 1B23P 2I6FA 3KKKA 2X23A 1W5BA 2JFQA 1XP8A 3JTEA 1NNI1 3Q7SA 2O0HA 3NHWA 2H48A 2G17A 5COQA 5EGSA 3VSCA 1ZLYA 3TLKA 5IC5A 4B3DA 1NXTA 4JHLA 2C5BA 2CYAA 1P2TA 4DCCA 4LC0A 4DT1B 4CCWA 4QQRA 3LUFA 6REQA 3IEMA 2VZ9A 3PDJA 2V1UA 4B3MB 5IK2A 1TKRA 4HXGA 3WNQA 1RRPA 3QUAA 5JC8A 1NFQA 1P2FA 2CLCX 3ESYA 1W94A 4EUFA 3WGKA 3AL0C 4RM2A 1DBVO 3FLAA 4WNIA 1NSYA 4DLRA 1AUVA 5LKRA 5AK6A 1LLCA 4G0PA 4N0QA 4YO8A 5FQOA 4BYGA 2XMPA 1DIRA 2F3PA 1CQPA 5GVRA 4UHCA 4R1UA 1HSOA 3OWHA 1J2YA 4NNOA 1Q0PA 3FOZA 4D8WA 3NC0C 4RIIA 5DJ5A 3EAFA 4ZGGA 4Z3OA 4KXLA 3AY6A 4BKQA 2Q1TA 4YCBA 5CNMA 5JASA 3CZ5A 4EQ6A 1SG6A 4JYAB 3ICQB 1KJ9A 1WP4A 3VKVA 1NM5A 2VSOA 2NO4A 4NOMA 1IM2A 3AI7A 3VGPA 3V2HA 1Z3IX 1OV6A 4FE7A 1IXSB 4PIPA 4CM6A 3BQMB 3IURA 5L3VA 3SQNA 3GH3A 1XF1A 3VZDA 5JALA 4P7BA 4JASB 4D1YA 3JYNA 3KSAC 4HBGA 1OU4A 1XKXA 1D3AA 2G8NA 1E60A 3WA7A 1GPBA 1QHSA 4YRJA 4F3YA 1RQLA 4H7EA 3HGQA 1Z4NA 2E4AA 3R09A 5AUPB 3T1TA 3AR7A 5K3SA 1ZCFA 4AUKA 1K06A 3R3VA 2I2XB 3F90A 4NRDA 2CDRA 4PXSA 3NVDA 3BIFA 4GX5A 1IY8A 4HH0A 4Y0VA 3HFJA 3TEMA 1JDNA 3HC7A 4CMIA 1KSHA 2CL7X 2QMOA 4B09A 5HRAA 1WQ3A 2C3MA 2ZT7A 2P2GA 1SELA 2AEEA 1VL6A 2EWVA 5D6NA 2OK8A 4O4LF 4MCIA 2QPLA 3AKYA 1L7OA 1FVFA 1SBIA 1BXRA 2QLTA 4RIGA 1QOZA 5FFMA 3W2TA 2VF5X 3IPCA 3SJBA 1EXWA 3P9QA 5G41A 1O0SA 4XJVA 4ZI2A 3A70A 1QRAA 5AH0A 2JJQA 2FN4A 4N65A 4ZOQI 4XFKA 1T5SA 3SC2B 3LK7A 3UANA 2DPMA 3LW7A 4KUEA 3M5CA 3O8OA 4NQZA 5D6OA 3KETA 1ES9A 4KVFA 4KWTA 3U4DA 1YRLA 1MT3A 2UVDA 3NKLA 3INRA 4G1VA 2BFEA 2WEKA 1KTVA 2AN3A 4O4LA 3FX2A 5CW1A 1IXRC 4PLGA 4COOA 4DY6A 2QN1A 3MJFA 3KJFA 2Q4DA 3RAJA 2R85A 3VKGA 1A77A 3Q88A 2X9GA 3VPBA 3AFNA 4R5HA 4B34A 4ZJPA 3B3JA 1W36D 2PWAA 2XA2A 2YUTA 2J67A 2ZRNA 4KWEA 4UC0A 3F71A 5JMTA 1PEKE 1YS6A 2VRCD 2D0PB 1EZ1A 2WD8A 1WUYA 4JKIA 1RWMA 3H5LA 1OVGA 3UICA 4A8TA 1JFFB 3JTMA 1XZGA 3CTPA 4RTSA 5B3JA 2DHDA 1LD3A 2IY9A 2OZEA 4XYEA 1Q22A 5L7WA 5G4KA 5FI3A 4CCYB 3NEAA 3TAUA 1NW3A 1XIVA 3PV0A 2EQBA 4G0MA 2P0AA 4YCAA 5T6BA 2LCQA 2ODBA 4ZALA 4WESB 3TCKA 5GONB 1ZCJA 4RX1A 3NEYA 4FKMA 3DTNA 1ZH2A 2CJWB 3WJ1A 4IMIB 4RTOA 2B8WA 5JLJA 3RV4A 1SZPA 1UBNA 3FPHA 3VDNB 3CG4A 4UHHA 4K46A 1ND6A 5E6UA 3ND6A 2WIKA 2HCBA 4MRRA 4MUEA 1KO1A 1X2BA 3I6MA 1CLUA 4HDSA 5MFZA 1NY5A 1QIGA 5CG2A 5I5GA 3OT1B 2NSDA 1CTQA 1BVYF 3QPBA 5JATA 3AUAA 4NH0A 4ZARA 3RLFA 1UPAA 2DLNA 1Q57A 2WC1A 3ELUA 3PFFA 2ACWA 1FK8A 2HLDD 1XD8A 3Q11A 1DEXA 5GV7A 2L0XA 4X1IB 2H65A 1DO8A 1T4GA 1VZ2A 3CTMA 4U7PB 1OYWA 4BFLA 4DRYA 1TXGA 4MH0R 4TTJA 1BJTA 4G97A 3JWIA 2X15A 1JJ7A 2LDXA 3B70A 2BM9A 5L45A 1Y8RA 3VVLA 2YXDA 2AZTA 4N47A 5AI6A 1E5XA 5C52B 6PFKA 2DPLA 4N5MA 4GNKA 4KBFA 3LDGA 5I8PA 1R12A 1QCYA 1WNTA 3EOBI 3HCOA 3KSDO 3OPYA 3DVSX 4ID3A 3MERA 4WDQA 4YQYA 5JS6A 1VFPA 1L5ZA 4MAFA 1L5HB 5HUJA 4B75A 2DBRA 3DYIA 3NX4A 4IJMA 4Z0PA 5B57C 1RBYA 1IZZA 3IKVA 3EGCA 1RYEA 1XI2A 3HZHA 4N8EA 4RGYA 5G3YA 3RUCA 5K8UA 3D4IA 4KLNA 2G88A 2WTNA 4F4DA 1QIKA 1OROA 3ENWA 4RZ2A 2DECA 1Z28A 2GMWA 3L8MA 1CIJA 3UT6A 4RHFA 3ZY5A 2HWKA 2UDPA 2WWYA 2IXGA 1ULTA 3HDQA 3N70A 2FI1A 5IZCC 4ENPA 1U1FA 1OIWA 3L6OO 1J24A 2VBFA 3OCXA 3AF3A 5BSRA 5DBEX 3IP6A 4CM3A 4AMUA 4O02B 2F4VB 2G0AA 4TRNA 2DQYA 3HUTA 4MV3A 1NASA 3EAGA 2XTZA 1RJDA 3JATB 3VPFA 3HVRA 3G5TA 2ZJ3A 3GVPA 4WVFA 1P0QA 5C2JB 2ZOSA 4QOHA 5A9SA 3D4LA 4YAKA 5A4MS 1R6AA 4MZXA 1NQUA 1PJ2A 2XKJE 4FNGA 4FYXA 1DKMA 4FDVA 5CLJA 2F8MA 4AP6A 4Y1RA 2YR0A 4XX0B 3HK2A 4OIFA 1G4HA 4M1SA 4D5EA 4DXDA 4X1YA 5F3DA 5TVKA 3WGVA 5JQWA 4YP5A 4HCJA 1O1YA 2FOIA 1LSUA 3AYZB 2V58A 4TS9A 3NR2A 4RMGA 4M1ZA 3WGYA 2IL1A 1DRJA 2WICA 2GFQA 2X0EA 2GF9A 4L4SA 1VHQA 3GWZA 2J4DA 3GF4A 4KIUA 1UIMA 4BO7A 5IN4A 1UFRA 2JFGA 2GTHA 4ZIRB 1G21E 5F1YA 1T8TA 3SDZA 3UV6A 3G5AA 5DGTA 1X15A 2OBNA 1U2PA 1Y37A 2FFRA 1OW3B 2XB8A 4M8KA 4PZCA 3L06A 2PSEA 1ZKMA 4GWKA 2AD5A 1T6ZA 2W90A 3P5SA 3B1FA 3SVZA 3T99A 2MTBA 4GLOA 1H5NA 1II0A 1E3LA 3W34A 2B1QA 1M2OA 3HB0A 4JEUA 4F12A 1L7RA 1R0YA 1ZDMA 3DL2A 1V39A 3S81A 5B58C 4YNBA 1E1RA 2KX7A 4MV9A 2WIDA 1P44A 1PU2A 4GW3A 1UBFA 3CUTA 1U8AA 2OCGA 3P9SA 1KO8A 3ZJVA 3SGLA 2QBYA 3KAKA 3L7LA 2FOLA 4N0MA 2IUUA 5BR7A 1FCJA 1ODIA 3VH2A 3F5DA 4I08A 3RC2A 4UTPA 3OPQA 2IKQA 1WAMA 2JK1A 3MCZA 2BCJQ 5CYOA 3SQOA 4DUZB 3HKBA 3EIUA 3L1UA 3W4KA 3WLIA 2KQUA 2GCOB 5JJCA 1FMJA 1C3VA 2NT3A 2OB1A 3GNTA 1DXQA 4YV7A 1CYDA 5LDDC 2KW5A 4F2PA 4OGWA 3CUSA 4WUTA 5ALEA 3RTCA 4QTTB 1WV1A 3BERA 3M4JA 1D2GA 3GWGA 2JZCA 1PD1A 3A9SA 3L1KA 4G5GA 2QZ9A 5L4LA 3L7BA 4EY6A 4HS4A 4KQWA 2G6TA 1A1SA 4WZ6A 3N2YA 4IZHA 2GXSA 2JFPA 1K3UB 4ARIA 4O4HF 4EF6A 4FYIA 5JNVA 4MUJA 4ND7A 1XZNA 2Q9UA 4ALNA 5PGMA 1KJWA 2DWPA 3D5QA 3G1WA 3EWSA 1QH0A 2EGUA 1EVYA 3HLTA 2F9FA 5TPWA 4AWBA 1GQRA 4J49A 3B12A 5A5GA 1RRCA 4KYTA 2VYVD 5HIMA 4DWJA 3PDIB 3DOEA 4X90A 2QE7A 4ARBA 2GPAA 4CLEA 1ELOA 1QUFA 1NV8A 1R0ZA 1Z8FA 5HZGA 3JAWA 4NDNE 2QRHA 3B3AA 1I4DD 4RESA 1AZLA 4C7VA 4OJKA 3EBLA 4IDDA 1SOMA 4O4HA 4X0EA 3RYTC 4TXHA 4HPXB 3TAXA 1DCFA 4GQAA 4K9LA 1S3FA 1T36B 3Q2OA 1T0JB 3DV0A 1SN7A 3E8SA 3DTYA 5CCBA 1BE6A 3BMOB 3F6RA 4JP5A 3EXIB 1DT5A 2J6HA 4GYYA 5KC9A 4C78A 2C83A 4R2IA 5ERGB 2H52A 1U0GA 1KZ1A 1U2GC 3RYHA 1J7JA 4FW8A 1US8B 5TEWA 2Z9BA 2XT0A 2D1SA 2AEMA 3CB2A 5JQGF 2H2WA 4YJHA 1TZJA 2XE4A 3CZPA 3IA2A 2JBAB 3U4QB 2ERXA 4ZCMA 3C1TA 3QYPA 1EXNA 1L7BA 3B8EA 2RCYA 2ZUVA 4LYYA 1FTWA 3IDAA 3IO3A 4MQ4A 1KSGA 1YJXA 4BFZA 4W8OA 3X1DA 3CCFA 4PFQA 3U4MA 4R51A 2ID4A 3D1JA 1Y8ZA 2OO7A 3VTAA 1BFKA 1SR8A 3IJRA 1SULA 3QE2A 4OIMA 2ZWAA 5EXXA 4C6TB 5JR3A 4PINA 1UR5A 2CXPA 4EJSC 4S05A 2A5DA 3B9BA 2P9BA 4LBVA 2AE2A 4Y9UA 5JQGA 4JI4B 4BKOA 3AHHA 2FZLA 4W4TA 1I36A 1SBYA 1GD1O 1WDTA 2N75A 2VSQA 3CUVA 3T9EA 1CT9A 1KBQA 1YZYA 3I30X 3KFLA 4LJ4A 2VZEA 5ED0A 5HR5A 3X0DA 2X4IA 3RBAA 1QRTA 1BS2A 2Q5HA 4DLTA 4ENQA 4YYZA 4KEAA 2E48A 1Z2EA 1XKTA 2BMWA 2CWWA 3G5UA 4NCBA 5IH3A 1PL7A 2F1OA 2Z4SA 4QX6A 4EFMA 1M2HA 2QG4A 3NXSA 2BTQA 3N5CA 1FPMA 4CM1A 2H1LA 1UADA 3GN2A 1UZNA 3C8UA 2VF8A 2O48X 5K4AA 3SZRA 4OAPA 2GX6A 3BIOA 5EZYF 1E9AA 1U2GA 3UAZA 4N3CA 4QGAA 3OHPA 1P4RA 2AUTA 2HR1A 1MZPA 1X77A 4YUAA 4GKBA 4TT3A 1L1QA 1T26A 1XYGA 1Z12A 2H1VA 3D2LA 3G13A 4OHZA 2WJ3A 4BFVA 3UK6A 4AJPA 4BTEA 1T2EA 1POXA 5JAPA 1T8SA 3V8EA 3P52A 5JEEA 3OBBA 2UVQA 3IAS1 4I1OA 3CM0A 5F51A 3RF7A 3E05A 2BFFB 3PUHA 3H3XA 4KQ9A 1I3MA 3BJRA 2WTBA 4GP6A 2C4TA 3H19A 3RH0A 4DAOA 5KPJA 2BV3A 2G63A 1N6KA 3V8PA 1NUTA 1ENPA 5EZYA 1E3MA 3OH8A 3AEKA 2HU8A 1UMKA 3ZEAA 2UUBB 1O6CA 4FZJA 4EJSA 3R5HA 1GITA 1P2UA 1K9SA 4TTTS 1DVRA 3UCEA 1YQ9A 4TGLA 1DC4A 4FI3F 3SOPA 3EPKA 1NXXA 3EZXA 5ADUS 2FUCA 2Q5QA 3L8HA 4HF7A 4HUTA 2G28A 1NG9A 3H8JA 3BGVA 4R1QA 1KFBB 2FLWA 3AGPA 4PAOA 4BBJA 2VJMB 5TC4A 4ND5A 1B6RA 1GCUA 3TRFA 2NXJA 1ZM2A 3IBFA 4NK4A 4FJ2A 1A7KA 9MHTA 4JCOA 2NYVA 1V95A 4BWVA 1YQTA 2W2KB 2REQA 1J90A 3BMNA 4F6CA 1KARA 3QENA 3MWFA 4XIIA 4AZVA 3PF9A 2NP7A 1VCNA 4QTXA 2OXIA 1A8QA 4MKIA 1KR5A 3IUSA 4JQCA 4PPYA 1M2KA 4QOSA 1ML3A 3ILHA 4Q4AB 4D96A 2NPFA 3W4JA 4GI1A 5IBPA 3WG9A 4R54A 5KS2A 1SMKA 4OQNA 5EMLA 1ITZA 4U3JA 3GDFA 4NJMA 1C29B 1MC5A 3AETB 1CJTC 2IUYA 1PV1A 3CLKA 4NCNA 1PW7A 1PI3A 4NONA 4RJ2A 5AJUA 2DUMA 3CLSD 3K3PA 2J4FA 2WAAA 1JQ5A 2FZEA 2FSHA 4QREA 4X64B 4LK2A 1YR3A 2V54A 1MOQA 5FT9A 4RLFA 4KMOA 4U2BA 2QYHA 3ZPXA 3FA2A 3JASA 2ESRA 5IKEA 4MRPA 3TIIA 2OECA 1GRNA 3ELYA 4QHTA 4UEKA 3UHFA 2A9OA 1OXUA 1UZAA 3OZFA 1U04A 1U90A 2HA2A 4UM9B 3V55A 2FCRA 2F1RA 5CLFA 4XCVA 4BU1A 1SCBA 2KB0A 2XUAA 5FEMA 3HWSA 4IW3B 4UARA 1J8YF 3NWOA 3HLYA 2XPCA 4F5YA 3HYNA 1QPGA 3E4CA 1THGA 3FF1A 2NVWA 3M6XA 1COWA 4LOJA 4X60A 1D5CA 1U7WA 2W93A 1JNYA 2IYWA 2DPYA 4FOSA 2QX6A 4NY1A 1TEZA 3QJYA 1ZN8A 3WHKA 5KOHA 1J1ZA 1U1IA 2CB9A 4FJ0A 4OUKX 2VDMB 4FMCB 5FPTA 4WBNB 821PA 1DBIA 2ZJAA 3C48A 5KYYA 4KIFA 5HP4A 1CRLA 1V35A 5DX8A 4D8VA 5HTKA 4BN5A 5BWLA 1KFCB 4EW3A 5HJ7A 1XTQA 5KJFA 4PZUA 2UZ1B 5J47A 1GV1A 4NH4A 5FI0B 2EC5A 2OR3A 2QL7A 4X1OA 3D3KA 5IF3A 4GBJA 2EZ4A 5D01A 4AY4A 4NFSA 1JG6A 4KDEA 2VJQA 2Q1WA 3A1VA 2FPSA 2C5HA 1EE2A 2ZWIA 3V1MA 3WWOA 4J9UE 4YK7A 2AK3A 2ZCVA 4IDBA 4WA7A 4MICA 4MKRA 5LIPA 1RXIA 4AY5A 2R751 2K6GA 3AVPA 3I6QA 4NNPA 1ARZA 4BO3A 3MJTA 3PFGA 2C9OA 5JSZA 3BYZA 3HCPA 4FFMA 3WHLA 5HF6A 1GHTA 1NI4A 2AI3A 2QUAA 3C6ZA 5SY9A 2DETA 4OQYA 1PS0A 3RODA 1NLUA 5IVKA 3DXXA 1CNFA 4P5PA 4D9IA 2UV8A 1BFDA 3F7NA 4G8DA 2B5OA 2H4XA 2X8LA 1Q7CA 3ASVA 3PK0A 5EKXA 4ZWNA 3KYDA 4BFSA 3I72A 1GPDG 4N9WA 3T3EA 3ZU2A 1ZEJA 3BJEA 3ZN2A 4AO7A 1CQIA 2DH5A 3KOWA 1E79D 5CEJA 3ZDAA 3KO8A 4B4UA 2OUKA 3ZWKA 1FQWA 1LDEA 1QX4A 4WD3A 1ISHA 2VAVA 3CNEA 1RHUA 3W9YA 1H4QA 3OETA 3BWVA 4TXJA 3N2IA 3M82A 3WK8A 4G0ZA 4Z4FA 4D9EA 3W3AH 5GADl 2WSIA 3CN9A 4TV8B 5C5CA 4N12A 5JXJA 3MRSA 1AQYA 2EOAA 4GRAA 4HQFA 5ER6A 4RQUA 1TM4E 3O94A 1X3SA 1KS2A 3FR7A 2ILVA 1KORA 1K6MA 1M8KA 4C2BA 4XGKA 4DN6A 1I6LA 4EA6A 4R05A 4P81A 1PT6A 3EODA 3ISJA 4KDCA 4K9PA 5C32A 1ZUWA 3OQIA 1J5PA 1LW6E 4NABA 5JI3E 4GYJA 1GZVA 1QTIA 2QD5A 1R8QA 4H4CA 1W1UA 3OUTA 2VPXA 4I1RA 4CM8B 3U1BA 5JXIA 4JEMA 4KBYA 3DD5A 1RZRD 1C7RA 4N4AA 1LFAA 4RHYA 4EG0A 2JLCA 4PX2A 4JJAA 4DFDA 4TKVB 4AKHA 1O5TA 3HCFA 2DZDA 2EIXA 3ZWVA 3B36A 3B52X 1E1KA 1V1RB 1OLUA 3T15A 3VU9A 4LRUA 4YJFB 4JDUA 3CEAA 2QGZA 4RY2A 3G2MA 1VKNA 3JY6A 3SZ3A 2WJZB 4OH7A 3K9BA 2VOJA 4KI7A 2IITA 3RIXA 3UMMA 1U8UA 2FRVA 3NWJA 1KJIA 2QMHA 3TPCA 2NVUA 1OZFA 1TDJA 1Z4OA 4MARA 2OQRA 3EIHA 3WE7A 3A4MA 3AF6A 5AM1A 3UAVA 1AZSC 1U98A 2OBYA 5AVWA 3VSDA 5BVHA 2BFDA 4LNAA 1KF0A 1JAXA 1PFQA 2V4MA 4WFJA 2HRBA 4IVPA 1HRDA 5I3CA 2C4MA 2YBEA 2V4ZA 4B6RA 5JAMA 1I1HA 3C43A 3K1YA 4H6XA 3AFMA 4DSZA 3TL2A 1UEIA 4X8LA 2QGNA 1BEZA 1VRCA 1Z56C 3L6EA 5TXGA 1HFJA 4E15A 1DJLA 2PH3A 2ID8A 2XADA 3AF2A 4KDFA 4PTYA 1RAAA 5AM5A 4OGKA 2HJRA 1L1FA 1A8SA 3TNYA 5KWSA 3PIDA 4FD3A 2Y4OA 2ZJ2A 1Y82A 4QHSA 3JWHA 3LT0A 3MOGA 2EW2A 3R5XA 2WWIA 5G0UA 4YQZA 2NM0A 1DQNA 3B1YA 4DABA 1NBMD 2PU5A 2VDPB 3TW4A 2Z09A 3AGQA 3FGNA 2XUOA 3ZE9A 1YS2X 1DPGA 2NQTA 3OQBA 4IIXA 2C2WA 3L1VA 4IWNA 2DJIA 3NBQA 3REFA 2AQKA 4O2BB 1JYFA 2QRLA 2UYGA 3MGGA 1LSSA 3JCZA 1O4VA 2YJ4A 5L95A 5EUMA 3RCBA 3ER8A 4XUCA 2PT9A 3F4KA 3WK6A 1X1CA 2GD2A 1X1DA 4LJ6A 4QZVA 4UAGA 5JMOA 1H65A 4JVLA 1NJ5A 1SHUX 1VLLA 1VFNA 4FYYA 2XXAB 2XKBA 2HDWA 5CDUA 2AMJA 1DIGA 1VLVA 2GF0A 3JVUA 1I7PA 2OC9A 1MQSA 5C7YA 2F90A 1ANKA 1QNFA 2F17A 3WLOA 2O5EA 2BRUC 2YWDA 3GLRA 2JGJA 1VIMA 2O1SA 5LYJF 3DLAA 3IKLA 1K8XB 4TMFA 3TSZA 4Q03A 2K7ZA 3FR8A 4LF9B 4EL5A 1KO4A 3QELA 1SVWA 3BF7A 4JWKA 1K8ZB 3A3KA 2IE8A 1AF7A 5K45A 1FOEB 4IDFA 5HTOA 2F3SA 1EM6A 4A15A 2JIQA 5DBGA 1JVBA 5EE0A 1SUAA 2HSWA 1NIPA 1NC1A 2GD6A 1OY1A 3IULA 3M3PA 4O1MA 2CWDA 1QAQA 5ECYA 4OHWA 3QEKA 3PF8A 5J9FA 2JAWA 3SS8A 5HJ2A 1GT91 1Z8HA 3QKSB 5CB4B 5DPMA 3MGCA 1OXSC 1YAJA 3R6TA 3CA8A 5TS3A 3V6LA 1IXKA 1KJZA 1W35A 2ZRGA 3T35A 1NN3A 3FG9A 3IL2A 2FRDA 4DEVA 4E32A 2VUUA 4O29A 1LW7A 3NIGB 4RFSA 5FPYA 5G3ZA 1EESA 1LTHR 3CNOA 3DR5A 5AKYA 5DNYB 5CFZA 4MYUA 2Y2UA 4DNQA 5H80A 1DQSA 3CRW1 4R8SA 3V1UA 1L8LA 1JKJA 3R7BA 3FVRA 1JIVA 4YT2A 3C3PA 4KXQA 2NO1A 4Q12A 4R6XA 3TH5A 5K0JA 5LNK1 4YRPA 1T4CA 2KWIA 2PBFA 3HZRA 4UUMA 4DHEA 3DE7X 3GFPA 2I2CA 1B16A 1E1MA 3HY3A 3FPCA 4P31A 2P75A 2BDEA 2BRUA 3Q3IA 4I8DA 5I6DA 1QGED 2QG9A 4BNWA 3MBOA 4CIYA 1A8PA 3S1SA 4MW9A 4C30A 1NQWA 1HTWA 3ELBA 4CMGA 2FW7A 1PDOA 2A6PA 3N2GA 3PS9A 1V8PA 4DA9A 1YQUA 1LBEA 3RVNA 4J0DA 1DKNA 1XMVA 3T54A 1IY9A 1NMSA 1XLWA 3AX6A 4XVRA 5E6RB 2BFBB 3LYUA 4GVXA 2PG3A 3NTVA 5BNTA 2AG0A 2H3HA 4CG0A 3DLHA 5SZKB 1A5AB 3GA7A 1IJKA 1MO3A 1PK7A 3FCCA 3H11B 4CCSA 3R0QA 2QMQA 1D7OA 1PZGA 3GLKA 3UZUA 4B4OA 1UPBA 1H2YA 3LX8A 3RC8A 4TWZA 4E13A 2ARKA 4RHUA 5AHKA 2AN4A 4F11A 1FS6A 3USES 4LBZA 1QM5A 1QGDA 5B2FA 4IUBS 4J4HA 4TXNA 5C81A 2CNLA 3R6WA 4QBGB 5CM2Z 3ZVKA 4LF4B 1KR2A 3W8EA 4LI3X 3QVKA 4FOPA 1YB5A 4IO1A 4LXHA 4X5OA 3HCEA 5JXGA 5IAJA 5AW2A 4QXRA 3DZJA 2FHPA 1WUIS 4GUDA 2WQ7A 1RCFA 2X58A 1SHLA 3D7MA 3GJ0A 3ZV7A 3PX7A 1KZ9A 2FSFA 1ZD2P 1NP6A 1JQBA 3NHSA 4FYKA 4E2XA 5IFKA 2FN9A 2G36A 1GN8A 2JI7A 2Q07A 4WN3A 4EPTA 1HDGO 3LQ4A 4LWQA 4IEIA 2H1HA 2IEZA 3EEFA 1KAQA 3ETCA 2XF2A 2BKLA 4J75A 3ROTA 1PG2A 2AH5A 2HMAA 1DPFA 4I1VA 4QPDA 3EGDA 3SFTA 3ZJ5A 3C14C 3AERA 2JGDB 5CVVA 4X24A 2FEPA 1JHPA 2X0NA 3F9IA 2P5SA 2JAHA 4OXNA 3PNMA 1GUZA 1L8QA 3BVPA 4QXMA 4YJ2B 2C9YA 2MYUA 4E08A 3DSRA 1JHZA 4BO2A 3AW9A 1E1NA 1H2FA 2Y76A 1W46A 3FZNA 5KOIA 3BHMA 4KW7A 3KLOA 5C7IO 1VCOA 1M2NA 1Z2PX 1X74A 1KYYA 1SBHA 3IXQA 5GGYA 1J7KA 3N74A 5MGNA 2P2YA 1XJWA 2Z83A 1RWKA 2BR4A 4DZZA 2IOQA 4Y2UA 4DUGD 1E2FA 1H2RS 1KEEB 1LBIA 1IBKB 4IDQA 1TRKA 3PXUA 5ARBA 4UHDA 1UIRA 2WTEA 4HH1A 3JD3A 5JPIA 4TS3A 4D99A 1WMBA 3P9KA 4DRZA 4Y3UA 5JAQA 3K05A 4KNVA 1QH8A 4IL5A 2WB2A 2YIVX 3KJHA 3C8HA 2NUBA 4IVNA 1IY0A 3ISTA 3Q41A 1EFDN 1FRQA 3PHIA 3WIBA 1KMQA 1NNSA 2FDXA 3MWEB 4PY2A 3PLAE 3PWZA 2QROA 2GZRA 2V96A 2JFOA 5EFZA 2ANBA 1P91A 3KP1A 5FWYB 4FZ3A 1ND5A 5A3RA 3IOBA 5BRJA 5LBUA 4CKWB 2P27A 3I3OA 3U3RA 4YCDA 4PLWA 4QBTA 3GLTA 3PNYA 4S0XA 5BN3B 2JDIA 2BW0A 3TZLA 1I6MA 2DUJA 2QZZA 1GNSA 3U7JA 1RQPA 1V6AA 4AJNA 1BQ4A 1E4VA 2J5BA 3NP7A 1KEUA 4QO8A 3DDSA 1UPUA 4FDMA 3RS3A 4KN6A 2K2QB 3ETNA 3KEQA 5FV7A 3HR7A 3UOGA 3DEZA 4MWEA 4BC0A 4CMKA 1K97A 1SOUA 3IP9A 1FNDA 4Z7QB 2FFBA 3V00A 2G0TA 3L4BC 1C2YA 2PGDA 3DOJA 4KTTE 2RK3A 1C8VB 2QUKA 4P33A 5CCDA 2XYRA 1GNVA 5E1DA 4IRXA 3VJKA 2EHJA 1HMYA 4OGGA 4Q34A 5EWMB 3FIJA 4BB0A 4QG3A 2G1AA 4GMGA 3TI7A 1MX1A 1TW2A 1I24A 3MT7A 2QNRA 2ET6A 1PK9A 1Z6YA 4M53A 3CBGA 4IR7A 2JIDA 4QWMA 1N6OA 3R7WA 4PHTA 4DEXA 2YMPA 4LYEA 1W30A 1PL8A 4CDGA 1MVNA 4W5HA 1I51A 3JD0A 4Y2HA 5BP7A 5EYPB 2YW9A 3HI6A 4JT4A 1SFRA 1WRBA 3WIEA 1Z13A 3MJSA 4M8NE 4U7WA 1IHPA 5BV1A 2PYDA 4B3CA 1JLMA 1H6BA 3K0KA 1GTSA 3TSOA 3HTXA 3B6IA 5EQFA 3RBVA 1R2QA 1BYUA 4FWBA 2DH6A 2X0DA 2J9YB 1U0JA 2TS1A 2X0IA 3CFYA 1BS1A 3G7UA 3K0HA 4KQKA 1II9A 5TQ2A 1XEFA 2GJSA 3TTYA 1FVOA 3CX3A 3EULA 1E94E 2FFQA 2H06A 1BEEA 1KI6B 3P2IA 4L4RA 5G53C 1F2VA 3KEOA 1GQSA 4Z51A 2EXXA 3AV3A 2GJAA 2MSEB 3MCAA 1A97A 4C4OA 3KUCA 2R2GA 1MO4A 5DMHA 4E5MA 1FFGA 3GYBA 1KE2A 3S2YA 1D4AA 2PSHA 5ALTA 5A9TA 1NATA 3RC7A 2HO4A 1OXBB 5B1EA 1E63A 2R5WA 5M29A 4NK5A 4GO1A 5HW0A 1H66A 5CH8A 2B61A 5I4KA 2QL6A 4AG5A 1UBJS 3B7PA 2WHRA 3K5PA 4RPKA 3JVIA 3OQHA 1UZMA 3KPJA 4RTJA 3IIKA 5LMZA 2GNOA 3G0HA 2C5GA 5JBNA 5I9LA 2I1WA 2IC5A 5CU7A 5B12A 3QLJA 1Q84A 3QU4A 4BLSA 1DIAA 3IUMA 4Z9FA 1NGSA 4HYYA 3FTQA 4ASUA 3S2IA 3SLKA 4X94A 4RHEA 3EMDA 3HHEA 5H5JA 1OAOC 2J5QA 2CNNA 3NLLA 3GPLA 2IYSA 5TQVA 1QFXA 4F5ZA 1NMQA 2QTZA 2IDMA 1YS9A 5AK5A 1M0SA 3ACCA 1R18A 2Z5VA 1JXMA 1Z5ZA 1XTBA 1XTRA 4XKJA 2E4VA 2PMWB 4HHEA 1W29A 4L15A 4IDOA 1ZD1A 3SI7A 1QIHA 1BDJA 2R9VA 2QDKA 1NN0A 5H59A 3RASA 4DA6A 1UAGA 1HFWA 4Z7OB 2VVTA 1WMDA 5IJZA 3R3UA 3OEHA