2I3DA

Crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
PEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Atu1826
publication title Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 71
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i3dA00
3WLAA 2HA7A 2XLBA 5DJ5A 2JGIA 2Z8ZA 1CUCA 2UZ0A 1R9NA 1JI3A 5BOVA 1EA5A 1TQHA 1BROA 3DQZA 5A7FA 3O4GA 3R3ZA 1CR6A 5JD6A 3WWOA 2JGJA 1RP1A 1J06A 1XZAA 4J0GA 3AJAA 1JJBA 1XZKA 5FPQA 2OG1A 3UUEA 5CXUA 1J2EA 1GT6A 4FBLA 3LIPA 4BC1A 3DOHA 2WJ6A 3QMWA 4DGQA 1CQZA 1NU8A 3OOSA 1XZBA 3QZUA 1NU6A 4I19A 5D6OA 3ZWQA 2IIVA 1WPXA 5FPPA 4UBMA 1XLWA 3MUNA 1VA5A 2WTNA 3WMRA 4ETWA 5JZBA 3DNMA 4FTWA 4Q1VA 3KWFA 2GBCA 2R11A 4UHEA 4DMKA 3C5WP 3I6ZA 3BIXA 4EUSA 4UBOA 5ALUA 5E4JA 4K5QA 2HIHA 2V97A 2W22A 3WL7A 4GECA 3NUZA 4KR0A 1LPSA 5AM5A 1PFQA 1C7JA 2BUBA 4OU4A 3H2GA 4W1RA 3G0IA 2QS9A 2PPLA 5DLPA 4CFSA 2WHRA 1XRMA 5ALIA 5ALJA 1I6WA 2WU3A 5AHXA 3M81A 4Y2TA 4B0OA 1F6WA 1BN7A 3E0XA 3LP5A 2Q0XA 1YCDA 1MO2A 1CIJA 4X93A 3DLTA 3L1JA 1QZ3A 2GBFA 2YH2A 3OTQA 1CUXA 1G4HA 3ZPXA 1DT5A 4RE6A 3FVRA 4J0IA 1ORVA 4GHWA 1RWQA 2VAVA 2ZVDA 3DL4A 4MWSA 4UFPA 3H2KA 5AKEA 1ZI6A 5FOQA 1AMNA 1LZKA 1DWOA 1QOZA 4UBIA 1CUVA 3FLBA 4RNCA 4Y2PA 5DYTA 4U2GA 5F4ZA 3O4HA 4UFOA 4CIAA 5AI4A 4UBJA 1F8UA 4MWTA 5D7BA 3FNBA 3RKSA 2VJAA 4JUIA 1MX5A 4QDUA 1BEEA 4FFVA 4D9JA 3FYUA 1XZCA 3WK9A 1CUBA 3I1IA 3VJMA 1QIMA 3EBLA 2O7VA 3R3VA 1IZ8A 3A70A 4PF1A 4B85A 1AQLA 2QMQA 2QT9A 3JYHA 3K2IA 5ALMA 5AM4A 3D2BA 4XIIA 3M83A 1B41A 2AJ8A 5A7GA 3D4LA 2VT7A 2ES4A 1FFEA 2XQFA 1P0QA 3R0VA 1SOMA 1LGYA 3NOXA 3RK4A 3FOBA 3DS8A 1FSSA 1FFBA 5JD5A 5LKRA 1F0PA 2JEYA 2WFLA 5KBYA 4C89A 4BP9A 4MJ3A 1F0NA 1QFSA 4KEAA 1A8SA 2ZJ7A 1EX9A 2VEOA 4G9EA 2WSLA 3I2IA 1P0PA 1ZD4A 2W6CX 3AINA 3I6MA 4X97A 1H2XA 2WU4A 1LBSA 2XB6A 3ZLUA 5FLKA 4QA9A 4BCDA 4C87A 4H0CA 2XDWA 4J03A 1A88A 3H2IA 3IUNA 4G4IA 2CJPA 2PSDA 3QMVA 4W1PA 1HQDA 1CUHA 1UK9A 5EHZA 4KJXA 3IBTA 5HK9A 2QR5A 1MAAA 2YXPX 2IX9A 4WY8A 3DKKA 4B84A 1C7IA 5AIBA 1XFDA 1UOPA 4W63A 1R50A 3PF8A 1ZD5A 4UHDA 1UKBA 2WQZA 1Q0RA 4X6XA 3FWHA 3ZLTA 1H2ZA 4MYDA 1UXOA 4EY8A 4DMFA 4X90A 4DNOA 1LZLA 2OAEA 4KAAA 5CH8A 4NMWA 4RGYA 4FMPA 3IULA 5H3HA 3FAKA 3STYA 1UKCA 4EY7A 3FVTA 1BCSA 3EQ9A 1AURA 2GBIA 2H7CA 5EHNA 1QFMA 2GZRA 1HDEA 3STVA 2ACEA 2XMRA 4GI1A 3G0BA 4RPCA 3PI6A 2VQ6A 3F98A 4OU5A 3PUHA 1XQXA 3VDXA 3FSGD 1B6GA 3BF7A 4B9AA 5AO9A 4WJLA 5AKHA 1DTEA 1QIGA 3ANSA 1GQSA 2XQKA 5EHQA 2OGTA 2PUJA 4J3JA 3D7RA 3ESDA 5D3KA 5JAUA 2JGKA 4P93A 4DNQA 1BU8A 4JYMA 1BRTA 1ZIYA 4Q82A 4G8BA 3FYUB 4Y2XA 2HU5A 1P0MA 1XZLA 2OGZA 4U2BA 3WZMA 3BE8A 4LYDA 5AK3A 3SK0A 4PO3X 3FYUC 2HA2A 3WA6A 3D2AA 2O2GA 4FHZA 1T4MA 1J1IA 4KE8A 5IVHA 2Y2VA 4J0CA 4KRXA 3ICWA 3C8DA 1IMJA 4W1SA 2QKYA 2Z3WA 5LZ8A 1USWA 1SFRA 1LPAB 1QIKA 4BTVA 3ESBA 3JW8A 5ALXA 1VA4A 4BRZA 1DINA 1DWQA 5ISMA 4H7IA 3O95A 3S8YA 4YPVA 3FBWA 3C87A 4JH0A 1UKAA 3UUFA 1HLGA 5KWJA 1VXOA 1CRLA 1K5PA 1YASA 2OQVA 3WL5A 5HKAA 1TKRA 4BYMA 2PX6A 3KXPA 1L7QA 3DOIA 3QPAA 7YASA 5HKBA 3IUJA 3G9XA 2Z5GA 4HAIA 1CUSA 2RI6A 2JGMA 3IURA 4IH9A 5JIBA 4J0KA 1GKKA 5CH5A 2ZJ6A 3W05A 3VVLA 4DM7A 1XZIA 2XUQA 2WJ4A 1XRQA 3ZV7A 3IIIA 2K2QB 4P9NA 3W9UA 2G63A 4AB1A 5ALGA 3QPCA 1OCEA 4EHBA 1MNQA 5T4HA 2XUDA 3T52A 3V1NA 5CT5A 2R8BA 1YR2A 4DMHA 1BEZA 2WIFA 3WWDA 1MX9A 4AN1A 5IVIA 3AIOA 4GW3A 1E8MA 1ZJ5A 1Z68A 2QUBA 3B3QA 3AFIA 1XKTA 3WIOA 1WPRA 5AP9A 2Y2UA 1GXSA 2V9ZA 3GA7A 3WKBA 4Y7DA 1IVYA 4X92A 3U0VA 1ORWA 1Y37A 3PFCA 4PV7A 3WQHA 3AZOA 3D2CA 1QJ4A 4X91A 2QZPA 5AI0A 4F5ZA 3F96A 2VJCA 2BJHA 4WFKA 5ALRA 5K3CA 3D0KA 4XVCA 2WJ3A 4Y2SA 3IUMA 1QE3A 3B12A 1PJAA 3F67A 4N5IX 2XLCA 3BDIA 1VZ3A 5CT4A 4U2FA 2CB9A 3ESAA 3IVMA 4FLMA 1EHYA 1CLEA 4X7BA 4UBLA 2DHEA 1JFRA 1IZ7A 2Y6VA 4X71A 2QVBA 3BJRA 3F8SA 3HYSA 2PM8A 1XZJA 3IB3A 4HXEB 2QUAA 4AN0A 4I3FA 4PQEA 2G5PA 3WI7A 3I28A 2JIDA 5CURA 1ODTC 5ALVA 1X2BA 4BVJA 4KE6A 2ROQA 4HVTA 1E5TA 3ANTA 1GGVA 3PDCA 4FOLA 1DWPA 3HABA 5T4EA 2ACKA 4EBBA 4QLAA 3IUQA 3OC0A 4ZXFA 3JWEA 2OLEA 4FNGA 4KACA 4X6YA 4HTAA 5AK4A 5AJHA 2HHAA 4U2EA 5C8VA 1XKLA 3SX4A 3OG9A 1M33A 4JYPA 5JYCA 1UK7A 3ZLVA 5HFAA 4HS9A 5I8PA 5DNWA 3G0DA 4BAUA 5C8ZA 3PUIA 5FXMA 3I2JA 3WKEA 1TCCA 4G5XA 2ORYA 3AILA 4DNFA 3LS2A 1UK6A 3DCNA 4C88A 3UMJA 5BV7A 5JZSA 4BVLA 5FDFA 1W52X 3TGLA 4AO8A 1G5FA 3QYJA 4A5SA 3A2MA 4PSCA 5EI5A 3OURA 2BCEA 3FLEA 2LIPA 4DSAA 1W6RA 5HZGA 4Q3OA 4BDSA 2XMDA 3A2NA 5ALWA 1QTIA 5JADA 5CW2A 4KYVA 4QE3A 1BS9A 1XZHA 5BWCA 5BWBA 1FFCA 4FNMA 3K9BA 5AOCA 3WYDA 1UWCA 1N8SA 1ZJ4A 4BDTA 1OILA 2XI4A 4ZI5A 1JU3A 2VJBA 2HU8A 5EIEA 1GPNA 4CG2A 2ZYIA 5LZ2A 3G0CA 4U2CA 2PSFA 1G66A 2WHPA 4BE9A 1YS2X 3VJKA 1JT2A 1QO7A 1MJ5A 3GFFA 5FV4A 2BUAA 1S8OA 4UHHA 4WDQA 4DTCA 3GELA 2HA5A 5FRDA 4XWGA 4MYSA 1WB4A 1CUUA 1HPLA 1FFDA 4AZ0A 2CUTA 5IKXA 1X70A 1CFJA 1R1DA 2O2IA 4HZGA 5D3ZA 4WFJA 2B9VA 4CI9A 1EVEA 2OCIA 4AZ3A 4OD0A 1Y7HA 5JAHA 5LZ7A 4MQLA 2OCGA 2AJBA 1A7UA 4NVRA 1RYYA 4W1QA 3PF9A 2NW6A 4Q3LA 1E3QA 4EB0A 3TEJA 5CT9A 4JEIA 5HCUA 2BAGA 4B6GA 1CUWA 4GBGA 1QO9A 3BXPA 4N8SA 4E11A 1CUEA 1CQWA 3EQ7A 4AO6A 1IUOA 4WDRA 3WL6A 2C0QA 5A62A 3DYVA 5LZ9A 1ZD3A 4J7AA 5DYWA 3FSGA 1EINA 3DKRA 2OQIA 5YASA 5HF5A 1GZ7A 2O2HA 3WK7A 4X94A 1VLQA 3AZPA 2XT0A 2I78A 1LNSA 5EHXA 2CBGA 4Y2JA 4L72A 3LLCA 1W75A 2B61A 1UOOA 2X8BA 1XQYA 2D0DA 4QWMA 1EDEA 1XQWA 4UPDA 5JD4A 4QDZA 1T2NA 2I03A 3C43A 2J3QA 1YB6A 4LYEA 1DQYA 2OGSA 1HBJA 3C5VA 3I2GA 4BAGA 1O6GA 4MEAA 2HA6A 3WYNA 3BDVA 3STXA 4AMZA 3W06A 2WUGA 3RARA 4HXFB 1YB7A 3B5EA 5JATA 1QLWA 5HQ3A 1QIJA 2C5FA 4QZVA 2C0PA 2EEPA 1XZDA 2AXEA 5ALEA 4A23A 4WY5A 3WWPA 1U2EA 3VJLA 5AIAA 5AICA 4N8DA 4M0MA 1WB6A 1QIHA 2H1IA 4X00A 4RE5A 5CMLA 2I3ZA 2WHPB 4QWWA 5C7YA 5AKJA 5DNVA 1QONA 4ROTA 3N0TA 1XRNA 4E15A 3HI4A 4UFNA 5K5EA 3VXKA 4CG1A 1TK3A 1E8DA 2RGUA 5ALNA 4H18A 2FX5A 3U1TA 4FFWA 4U2DA 4AXBA 3I6YA 2BFNA 3K6KA 3V48A 1THGA 3CCCA 5KWIA 1FJ2A 4LKOA 4OPMA 5AK6A 4B80A 2DSNA 4KE9A 3AIKA 5DYYA 5LYYA 2PSEA 4CG3A 2RAUA 3BWXA 2VAXA 4DIUA 2HA4A 2DQYA 1MNAA 2AJLI 5CT6A 1DQZA 2HA3A 1QTRA 1SCIA 3HACA 1H23A 4BP8A 1Q84A 3D59A 3WKDA 1BE0A 1MTZA 3M82A 2B20A 2QJRA 3S2ZA 2DR0A 3Q8WA 4BCBA 5ALZA 1W1IA 4OCZA 3WKCA 1SCQA 2JF0A 5ALFA 1EVQA 1MX1A 5AOAA 3HZOA 4XX1A 5AKGA 3ILSA 1GPLA 5JASA 4G9GA 4K6GA 4B0PA 1R3DA 1QIIA 4J0JA 1AUOA 3DL7A 2WIDA 1DX6A 4AO7A 2WIKA 4H35A 2RHWA 1EDDA 4HXGA 4P92A 1CUDA 4BC0A 2WM2A 2WILA 3F97A 3G02A 3DD5A 1LPPA 2OCLA 2HFJA 4J0HA 3EF3A 3VISA 2JGEA 2ZYHA 3V1LA 1XRPA 5HK8A 4MQMA 1KEZA 1R4ZA 2XUAA 1YSCA 1E66A 5AM3A 3HXKA 3WKAA 4BBZA 4K2AA 3QPDA 4C6HA 2PSJA 1Q83A 1TAHA 2GYUA 4GEGA 3IDAA 1WM1A 2VF2A 5JAOA 2Z3ZA 3WK6A 5J3JA 3VVMA 2QOEA 1VE7A 2XUKA 5K3EA 3W04A 1U4NA 3FCYA 4MXDA 3C70A 3I2KA 3LIIA 2IITA 3E4DA 4UUQA 2H9YA 4ZWNA 4BRSA 4FLFA 3YASA 5HQ3B 2QTBA 1E8NA 5SYNA 1XZEA 1ISPA 3CXUA 1AC5A 3W2TA 2D5LA 2WG0A 4EA6A 3V1KA 3STTA 4IHAA 5E4YA 4UBKA 5C81A 3H18A 4LXGA 5K3BA 3KOOA 1SC9A 3GBSA 4OYLA 3RLIA 3SWWA 1THTA 1ODCA 1ZI9A 2ZYRA 4F0JA 3HEAA 4Y2QA 1L7AA 1J07A 4Q3KA 2PUHA 1OXMA 1YAHA 3C8HA 4Y2UA 2GZSA 2XMQA 5JANA 5EIHA 4JNCA 1CUGA 1DU4A 2G5TA 3KSRA 1CUFA 4WFIA 3H17A 3H2JA 4HRXA 5ALQA 5AI6A 5AKLA 4G8DA 5ALTA 2GYVA 1YA4A 2DHDA 3HC7A 1WHSA 2WIGA 4ZV7A 2XQIA 2WIJA 5EFZA 4A16A 4OSEA 4BZWA 2X5XA 3FLAA 4FLEA 4G4GA 3GZJA 1VZ2A 4NZZA 4BATA 4BVKA 1JKMA 2RIPA 1R9MA 3IA2A 1JMKC 4AX4A 5LIPA 4Y9SA 4CCWA 4L0CA 1CVLA 5ALDA 5CTAA 3ZI7A 1LPOA 2HL6A 2RHTA 1HKHA 2XMSA 1XRLA 2B4KA 1XZFA 2PBLA 3R3WA 4X3CA 2JGFA 3WWCA 4KAFA 3STUA 1H2YA 3OPMA 1ZI8A 5E2IA 3EQ8A 1N1MA 1ETHA 2GYWA 2EDCA 4B83A 1EB8A 4XJVA 3LCRA 5A71A 1WB5A 3ICVA 5T4FA 3I1YA 4B82A 3CN7A 4Y2YA 2CKMA 5FP0A 3DYIA 3QM1A 4L3WA 3AZQA 1K8QA 2V96A 3VKFA 1AZWA 4UHCA 1C4XA 1DX4A 4X85A 4F60A 4WCVA 4BCCA 1YAJA 3GROA 4QDOA 2DCMA 5HF9A 2BGNA 3ED1A 2ZSIA 4KE7A 5SYMA 4N8EA 1YS1X 1K4YA 5CBKA 4IO0A 1Q0ZA 3R3UA 3MUOA 1XLVA 3BL8A 5ALHA 1MU0A 3W9BA 3E1GA 1KU0A 1A8UA 2OCKA 4YK7A 3L1HA 1QIFA 5LP1A 2O7RA 4KAJA 1BCRA 2YYSA 4QDXA 3WWEA 2AJCA 2RONA 2WHQA 4C01A 3C6ZA 3H2HA 1GPKA 2XUHA 2P8SA 1JU4A 1CUJA 3L1IA 5CT8A 4YX9A 2C4HA 2WFMA 4BAZA 1N5MA 4IH1A 1EK1A 5JARA 4INZA 1FFAA 4Y2VA 1H22A 2C5GA 2HDWA 1EK2A 3H04A 4X6UA 1BN6A 4LXIA 1MAHA 5DNUA 4EY5A 2WUDA 1GQRA 5ALPA 5IVDA 3H1AA 3KWJA 4AQDA 1EDBA 1HL7A 3P2MA 4DMCA 2VATA 1W4LA 1U8EA 2HU7A 4ZV9A 2CEKA 5LLSA 5AKXA 2V98A 2WG1A 3H19A 3NGMA 2QM0A 4H7FA 2PKYX 4I4CA 2XE4A 4X95A 1CUYA 3R3XA 5ALLA 1AKNA 3R41A 4AMYA 3I2FA 4GDMA 5K3FA 2QXTA 1CUZA 2HADA 2WKWA 5AOBA 2OAGA 2CMFA 1A8QA 4UBNA 4H7HA 4O08A 1CUAA 4DYHA 5FKJA 4Z49A 3WK4A 2ECFA 2XMCA 2ZJFA 4IH4A 3MGAA 3QBJA 3WK5A 4CCYA 4E14A 4DNPA 4K6HA 4TVKA 3HJUA 4H77A 5DWDA 3BJMA 3WJ1A 3FYTA 3G8YA 1ODSA 5AH0A 2PL5A 1XLUA 4H7KA 3D5EA 3PICA 1WCYA 5AI8A 3V9AA 1LLFA 1EH5A 2XQGA 5EIAA 3KD2A 3PE6A 1Y7IA 2QXUA 3STWA 4G4JA 3DDUA 2HM7A 4QDTA 4DSZA 5IH7A 5JAPA 5CXXA 2HA0A 1XROA 4OB6A 1CEXA 1EXWA 3CCBA 2WLSA 5HF8A 3WZLA 1G42A 3G7NA 4PW0A 2XUGA 1VOTA 4BE4A 4EY6A 4GLBA 5T4BA 1KU6A 1IUPA 2J4FA 1ZD2P 4LIPD 3A6ZA 1UFOA 2E3JA 5AM0A 3G0GA 2BKLA 4FWBA 1AX9A 4OUKX 4TPKA 3Q0TA 4P08A 4QLOA 2XUPA 4ZRDA 1ZOIA 2QJWA 1UZAA 5HFNA 3C6YA 5ALYA 1QGED 3G9UA 1NX9A 2BGRA 3FCXA 3KDAA 5EGNA 3BF8A 4FDMA 1PV1A 3O9VA 2DQZA 1MN6A 5I7UA 3R3YA 4OYYA 3NWOA 4V2IA 2XMGA 3O0DA 4BTLA 3HRHA 4UHFA 4G1FA 5AKYA 5JALA 5E4TA 1JJIA 2EDAA 1UOQA 5AI5A 2HRQA 4LXHA 5AKIA 1QIEA 2PSHA 2H7XA 1ZIXA 2J4CA 1N5RA 3WJ2A 4S0XA 3G9ZA 4ARAA 5FUMA 4M0FA 5ESRA 3QITA 1W76A 3TJMA 5AM2A 1VJ5A 1K6EA 1X2EA 2J3DA 4H7JA 2WUFA 4GXNA 5K3FB 2GBGA 4BZZA 1EI9A 2WUEA 3MVEA 2XUJA 2FJPA 5KREA 2Z8XA 4K6KA 4E46A 5A6VA 1TIBA 4DLNA 5AKZA 5LKAA 3D3NA 4UHBA 3WA7A 2XUOA 2CZQA 4GWLA 1VKHA 1ZGBA 2VSQA 4FKBA 4CCYB 4G8CA 4C4YA 4L9AA 4C4ZA 5LZ5A 4TGLA 2FJ0A 2XUIA 1EB9A 1LPMA 3QH4A 2DHCA 1MT3A 3AIMA 1JJFA 3V1MA 5AM1A 3ESCA 4BB0A 1XZMA 2FUKA 4Y2RA 1XRRA 3N2ZB 4PNZA 2WFLB 4C4XA 2XMZA 3WIBA 5JZ9A 3GUUA 4MEBA 5AK5A 4Q34A 1H2WA 4LHEA 5ALKA 3O4JA 5A7HA 2C58A 2WTMA 2DFPA 4Q05A 4ITVA 3DJYA 4PSDA 1ZICA 2JEZA 2G4LA 4QNNA 3HSSA 5ALSA 1LPBB 5I9IA 4OB8A 2I3DA 4M0EA 3QMMA 5C8XA 1R88A 1WOMA 2PU7A 1XZGA 3C6XA 2JGLA 1E89A 1YA8A 3QVMA 3T4UA 2VT6A 1ACLA 2VTVA 5CRIA 3TRDA 1WHTA 1U65A 2XMBA 4ARBA 2ZYSA 1DT3A 2AJDA 2XQJA 4J0DA 3C45A 3SC2A 3X3HA 5LZ4A 1XQVA 4IQ4A 3E3AA 4QEKA 4H7EA 3WK8A 3M3DA 5AI9A 3CN9A 2Y1KA 1GKLA 1CPYA 6YASA 1LBTA 3H1BA 4FBMA 1QIDA 3RM3A 4ZREA 2C7BA 3G9TA 3DEAA 1VXRA 3F9CA 5K3DA 1VE6A 4F21A 1IUNA 1K63A 5DTJA 5A2GA 2QRUA 3O4IA 4PSUA 4YASA 3O9MA 3A2LA 1D07A 3HLKA 5ALOA 4B7ZA 4EY4A 4W9RA 2HFKA 2ONCA 2HRRA 3I2HA 4OB7A 5IVKA 2WFZA 4H7DA 1SCKA 5CH3A 2OXEA 2X76A 2ZSHA 5AKKA 2VJDA 5K3AA 1TCBA 4ZGBA 1TCAA 4HRYA 1JMYA 1O6FA 1UK8A 5HF6A 2JBWA 1CV2A 1UT6A 1TRHA 4EZIA 1MPXA 1LPNA 3C6BA 3AUKA 4B9EA 3BIWA 1CUIA 3OM8A 4KRYA 4B81A 1ACJA 5DTIA 2BUCA 2PU5A 2H7YA 1ZGCA 2WG2A 1P0IA 3PFBA 3EIOA 3R40A 1AGYA 3H0CA 2OPHA 2VA9A 4NS4A 2Y6UA 3WL8A 4CIBA 2XUFA 2YASA 1L7RA 2PVSA 4N5HX
chains in the Genus database with same CATH superfamily
2BH2A 4MB0A 2HA7A 2OD9A 2GFIA 5B64A 13PKA 1MH1A 2HJ9A 2EFJA 5TGTA 2BC9A 5J2TB 1PX2A 3CUSA 3MRXA 1LCIA 4MW1A 5JRJA 3HQ4O 221PA 4G5YA 3LDGA 4EABA 2VUSA 5H02A 4QO8A 1BROA 3DQZA 3LY9A 4ZCPA 4DAOA 2P4UA 4P3XA 1FU8A 2H2HA 5C5CA 2OKCA 3FDIA 4TMZA 4AQ7A 2ZWMA 1R5NA 2FZVA 1H3NA 2B2NA 2RGXA 2WJYA 4YCBA 1EXVA 5A4IS 1XEWX 2VCYA 1CDDA 3QVSA 3TL2A 1C7RA 1J09A 1KI4A 3H7AA 2JGJA 4JK3A 2A88A 4OAQA 1XZAA 4V39A 3O91A 5CM2Z 1KEPA 1Q1AA 5L3RA 3CE9A 1W4BA 2ZUUA 4NQZA 1XEXA 3P96A 4GKVA 3SR3A 4GPAA 2R6HA 2Q5HA 3NANA 1TB4A 5FPQA 4DV3B 2GK4A 3ENNA 3UUEA 3BXOA 2WWXA 1N2GA 2C88A 2Q46A 5CA0F 3WGJA 2PLNA 4JX8A 3ZE9A 4B6OA 1GT6A 4G0WA 2ZIVB 3KEFA 3LVBA 4QYSA 1WSWA 3HLTA 2R1UA 3SY8A 3ZBUA 3QVGB 1T4CA 1XMJA 3P0IA 4BC1A 4M0DA 3DOHA 4AP9A 4HI0E 4TROA 1WXQA 4UM9B 5I7AA 4DGQA 4CU5A 3V4SA 3KM0A 2R1TB 1XZBA 3RIYA 1NU6A 2RFLA 4BJ3A 5LVAA 1G5RA 2FH5B 3CX4A 4RTOA 2DFNA 1WPXA 3W7AA 3OCJA 3QOYA 3NV7A 4FPXA 3FI9A 3ONNA 2BGLA 4JIGA 3WGOA 3T9FA 2B92A 1Q3TA 1HLDA 5I7HA 3RSHA 2WM8A 4C21A 4IIYA 3WMRA 4KXVA 2GJ8A 2CD9A 5IF3A 4ZQGA 3DZCA 2KE5A 1GNLA 4I6JA 5JZBA 2C2WA 4DQVA 3HA5A 3RSZA 1ISJA 4HNUA 2GILA 1V5WA 3AH8A 4R84A 5FWDA 3LBAA 1H0RA 4UHEA 5KAMA 5IPFA 2GPAA 3QKIA 3I6ZA 4GMFA 3UW1A 3V8PA 3N9IA 2C5EA 3GFSA 5HQJA 4AJEA 2Y1XA 4EVSA 3W0LB 2WB2A 5CU7A 1GA1A 4RKWA 2YJ4A 4ZRMA 1ILWA 3DMTC 4UBOA 4BO6A 1PUXA 1Q2UA 3QU5A 5E4JA 4Q4AA 5DBEX 1T25A 4O2BF 2G9QA 2HIHA 2WD7A 2X41A 3GGDA 3PTLA 4WNAB 4XLLA 4L75A 3WRYC 1Q0UA 1GRNA 4AP6A 4D02A 4DBVO 4E7OA 4ZHSA 3BH0A 1T0IA 3G2IA 3NUZA 4ECAA 1NUSA 1XRSB 3NZEA 1A76A 3AYXB 2HNBA 4AWXA 5GOTA 5F35A 4IX1A 3MBOA 3GEBA 4KQCA 4KTVE 2R4TA 2B8NA 3G0IA 3AGPA 1W96A 1KEEB 2I4MA 3GP5A 2QS9A 1XYYA 3VR4H 4CFSA 3SXUB 5L6LB 1KP2A 3FPJA 4PU0A 3GUZA 1CZUA 5FUBA 3VPSA 4RV4A 5L4SA 2BEVB 2ZZNA 3BK2A 4R7GA 1X3SA 4HP8A 4RD6A 2OCYC 1EUZA 3KV1A 4FDAA 3FW1A 1AU9A 1KXJA 2O0MA 1GPYA 1F6WA 1AKWA 5FOTA 2DFTA 1TZKA 3TTUA 1EFVB 4BMOB 4ZZIA 3SQXA 2FFHA 3B5JA 5JAQA 2IOFK 2Q3LA 3HPRA 1MO2A 1T5IA 3AR2A 2E0IA 2W2LD 4X93A 4EPXA 3DLTA 4DV5B 1A97A 1GCOA 1IBKB 1P75A 3OTQA 3JZMA 1WEHA 4BNKA 3FMPB 4MH0R 1DT5A 1J0AA 1NRIA 1WLSA 5DSXA 4RE6A 3RVMA 4DEVA 3EPJA 5BUQA 2X5OA 3FVRA 4J0IA 1RKXA 3KBBA 5CYFA 3DT8A 4KVZA 5H1YA 1N6RA 3M3PA 3QWIA 2VAVA 4F5EA 2ZVDA 1V8FA 2A94A 4GPIB 2CF6A 1QYWA 2F3PA 4MWSA 4N40A 1RHJA 1ZSNA 3GA5A 3LT4A 3P2KA 5DYNA 3JQ9A 1FQWA 3VOTA 3E23A 1ZRMA 4O2AF 4R9VA 1D9XA 2ZRFA 3NOOA 3RQSA 2AN5A 1UBNA 1MO4A 1WNTA 4RACA 1QOZA 1BFKA 1YB5A 1Q21A 2OLKA 5I4IA 5GONA 1MGOA 3SKVA 3UJ6A 2YKGA 1CUVA 1QQ6A 3C8ZA 2BFDB 4BBJA 4F5WA 1XMVA 4I66A 4UOEA 1ADYA 1T5BA 3UB2A 1G38A 1GSIA 1WL8A 4RS4A 3SBXA 2H11A 3QU2A 1M67A 1J8FA 1EEXB 4RNCA 4Y2PA 1MW8X 2RI0A 1M83A 3H1FA 2P77A 4QUBA 4XWTA 4UFOA 3ZHTA 3TTVA 3CG0A 2GK7A 3K0SA 2X1MA 3QF4A 4PS0A 1IXSB 3MT8A 3VC2A 2X6TA 3IPYA 1UZMA 2AE1A 2X4LA 1TU0A 2NTEA 2VJAA 4MULA 1C1DB 3K8YA 4B48A 1ZM7A 1JSLA 3GRZA 1JVSA 1XXHE 4RESA 3UV3A 3MQFA 3ZZUA 3HM2A 1SXGA 4JJEA 4IHQA 3ME5A 1Y1SA 2CXHA 3Q3JB 3TS1A 4CM4B 2ONJA 2LKCA 1RLJA 5B3JC 2FZ4A 3GBPA 3WK9A 2ZJZA 5ELXA 2IQIA 2WF5A 4K9OA 2ZTMA 4YAGA 1UDCA 3I1IA 1WY7A 3C24A 3NB0A 4R2IA 1QQBA 1DZ3A 1U0JA 2O7VA 1JQDA 2VHJA 2YMQA 3A70A 3HRIA 4R1MA 5IDWA 5KIAA 3P5BA 5JS6A 3V7NA 2NO4A 1P5ZB 3K2IA 3KV3O 3T8YA 1P29A 2JCBA 1YDEA 4P34A 1EUYA 2QBYA 1Z5ZA 3AWIA 4IMRA 1ZD1A 4QGHA 1IDN1 1ZRHA 1Z4JA 4Y7CA 5J59A 5DNAA 2PRKA 4A6XA 4M1SA 4LDNA 1PG2A 2BMDA 5E9AA 3PGJA 3LNCA 4NH0A 4PO9A 1WABA 3ODGA 2VHCA 4PINA 3D4LA 2FR0A 2BJWA 4XDHA 2DUJA 2VT7A 4ZAGA 1LWNA 1ULUA 4HUQB 5BUCA 1CZLA 2BMFA 2ES4A 3MCUA 3WIVA 4RF5A 4BGDA 2ACWA 5LIRA 1O08A 1U2GC 1P0QA 2FUNB 4L08A 3EZ6A 1UC8A 1E1NA 3BEOA 3PNOA 3QTBA 2XVYA 4UAUA 4EMTA 3MGCA 4F56A 1N78A 1DGQA 3UN1A 2VDRB 1A5AB 3U4QB 5F3DA 3M1AA 5C35A 4Q47A 5LJIA 5EJ5A 5EP4A 2JFVA 2I7CA 1Z82A 1M2WA 2QUIA 3MWEA 2FFAA 4JJ4A 4K9MA 1W9HA 5DPMA 2QZ9A 4MUNA 5BNIA 2OCDA 1QFSA 4KEAA 1E61A 4MQ5A 1IULA 1FXUA 3GN2A 5FFMA 1RI4A 4OVKA 4KV7A 1NC1A 4B71A 5CYOA 1JFSA 4FINA 1QP7A 2IBSA 1KAQA 5G0VA 1J8VA 3AINA 4B31A 5F2NA 3FHJA 2IU3A 2WMDA 5CNIA 5LOVB 4RIHA 2WU4A 3IJPA 4DF3A 3Q9LA 1IZYA 1M74A 1RM5A 4WGGA 1O5IA 3K09C 1QQTA 2H4YA 3O1HB 1PT5A 2MINA 2Q50A 2VAMA 4R0NA 5T64A 3GT0A 4KQHA 1UP4A 4FXOA 5JDIA 2TMDA 3TBFA 4HFRA 1Y7TA 5EIFA 5FTWA 5ES4B 1V6SA 4ID3A 1K7XB 2TS1A 3EZ7A 1PV4A 4H17A 1NJSA 1ESEA 2ZJ0A 4G4IA 5AESA 4IIBA 1E6WA 4R9NA 2CLLB 3QMVA 4W1PA 3URMA 2D2EA 1Y6JA 1R16A 2Q3CA 4PLCA 4LQLA 3TOVA 1Z4OA 2EQBA 3R6WA 4P3OA 1UK9A 2AKYA 3EOBI 5EHZA 3NAQA 3C48A 3IBTA 3O93A 4GYKA 1GTZA 1KK0A 4TKMA 4CTJA 3OZTA 4B80A 1MAAA 1QHEA 1IJKA 1T5DX 2CB0A 3AR3A 2HHLA 1XXHB 2WA2A 4DR2B 5CLIA 4W63A 3T94A 2J9FA 2OP0A 4TOIA 4UEWA 3A6GA 1R50A 1E5XA 3HBLA 4TSKA 4U4AA 3PF8A 4B73A 5HWSA 2EW1A 2LXNA 2J3LA 4E30A 1V71A 2WQZA 3S1AA 2DXIA 1T10A 2FKAA 1H2ZA 1SOVA 3AB8A 3GO4A 4RTSA 5EAIA 2I8AA 4FUQA 4I5FA 4EY8A 4DMFA 4PN7A 3OE5A 2FRVA 4I6GA 1Z7GA 1LZLA 2PFKA 5CH8A 1USIA 2IH5A 1CT9A 3LVQE 1KYZA 1R8JA 2NZ2A 2WWIA 4Q7LA 3ERCA 1WVIA 2E9SA 1TJPB 5JO0A 3FUUA 4K3UA 4BNUA 1B23P 3ZXSA 1RYEA 2FOXA 2P6PA 4RA6B 1PR1A 3GRUA 2X2FA 3GCXA 1DOHA 2XDAA 4YGYA 3SBDA 1DEHA 4N3CA 4S1TA 3K1AB 4GP6A 4Q9KA 4Q15A 4ZGWA 5FNZA 3STYA 3WMEA 5L45A 2NSLA 2HTEA 3M34A 1V1MB 1ZMOA 5HIMA 3OOWA 4F9TA 5JMTA 5K3OA 1D2GA 1BCSA 3NHKA 3BA6A 1A8HA 2Q3DA 4YAJA 5EKDA 4CQMB 4HV4A 2HEGA 3CEJA 1N2ZA 1QH8B 4RXTA 2H7CA 4DV7B 3U81A 1E2PA 2BMVA 4RFSB 3L8GA 4DG5A 1JJ7A 2GZRA 1P5RA 1US8B 3STVA 3UYLA 4JJ6A 2XMRA 4GI1A 4ALLA 1NW7A 1G5QA 3WYAA 2GRUA 3PJGA 1JIQA 5EN4A 3R9IA 3D81A 4QHSA 2YV1A 1BJTA 2KSQA 3MBKA 1AXEA 4Z4IA 4CQNA 1LI4A 4OU5A 3ZXYA 5ICSA 1LX6A 5G3YA 3EIWA 3QFHA 2O1XA 2CEAA 4IJQA 3BMCA 4IV0A 2WAXA 3AV0B 1GHTA 1RCUA 4FGKA 4O5AA 5CFPA 2VKQA 3A1FA 2XPCA 2P4HX 5LYJA 1OV6A 2QWXA 4B9AA 1MEOA 5D1NA 5G40A 1YWGO 5K0TA 2FSUA 2OB2A 3U40A 2I2BA 1XVTA 3NGXA 3RF6A 5AKHA 5AW0A 4JOSA 2C82A 3LKZA 5J4HA 2V6JA 1QC5A 4JI4B 3IV7A 3T99A 2A1IA 3LUDA 1YC2A 4B17A 3EVAA 3GJRA 1GPWB 3IYLW 5KOYA 1FRZA 4AZ0B 5KQMA 2UXDB 2AI1A 2AMFA 3GUVA 3HKEB 4G5FA 4CL8A 3INRA 4I55A 5EHQA 5KPJA 3W5HA 4J3JA 3KAQA 3HDJA 1JAYA 1TT5A 3ESDA 5JFTA 5GJCA 5JAUA 3L01A 3DEYX 1OX5A 5TRTA 2DC1A 5CGQB 1NONA 3O03A 4DNQA 4MB6A 2G6BA 2R65A 3G6KA 4M83A 3CV3A 5M7EA 4W5TA 4IV8A 3SM3A 1EK0A 1N2BA 4NBRA 1JHDA 4RTPA 4Y2XA 2HU5A 5ITZB 3A1VA 4GRAA 2PUFA 5IRCD 1XZLA 2C1ZA 1L3BA 1O1YA 1ZR4A 1MAUA 4LZAA 2HGZA 3CLRD 2VNIA 3MMZA 4YT5A 3L0YA 3ZJYA 2IP4A 3FUXA 3OE1A 1K88A 5BVGA 1OF1A 4LF4B 5I5GA 1ADGA 1U2DA 4LYDA 5BN5A 1SVWA 1WW3A 2Z0MA 4LCBA 4P0QB 1J20A 3AL3A 2O1SA 3OTOB 3R3HA 1YR9A 2C8JA 2HA2A 2JH3A 3AI2A 4YJGA 3D2AA 1BD4A 2AOXA 4Q4JA 4P2GA 1K8XB 1EWQA 2ZUWA 3L77A 2GM3A 4M38A 3SQDA 1T4MA 5HRAA 3IMFA 2CLOB 3DBLA 1PP4A 1RYFA 3JTEA 2ZK7A 4XEUA 2GCGA 3EVEA 3SQWA 1QDLB 2YICA 4NZMA 3L06A 1W9MA 3IQZA 4W1SA 3T5DA 5AVZA 1MW9X 1B1CA 3RI3A 3IERA 3P0FA 2YCLA 4BB6A 1MD9A 2B6HA 1OR8A 1USWA 5LZ8A 3S5UA 1P2FA 4BX0A 4EO4A 1OV4A 3H16A 1OASA 1S2IA 4B2IA 3QOWA 3A27A 1ONSA 3I4LA 4C29A 1QIKA 1YJAA 4X1YB 4BTVA 3TAHA 2YN0A 1EGVB 4YAKA 5IANA 5ICGA 1Z07A 2OVFA 3GLUA 4H7IA 3O95A 4YPVA 3FBWA 4Z1MD 3GGGA 1T8TA 4JCCA 1MR3F 1H1LB 1VI6A 2EBUA 2H1VA 1XQ1A 3ABQB 3I9KA 3UUFA 4AYTA 3IQHX 3RAEC 1YASA 1YE3A 2RG7A 2YBEA 1Y1KE 4KFSA 4UNIA 5FFNA 5HJEA 1P7CA 4PM4A 1T5OA 4IOLA 4WN3A 2A8YA 4XDGA 1A72A 5IKEA 1EUCA 1M0EA 3T7KA 3LXMA 3ORFA 1C9YA 1G8FA 4G0XA 4BYMA 3MJDA 2PX6A 4PCLA 5BNTA 1N7IA 3BWVA 5BRNA 7YASA 1E7SA 1UXGA 1H85A 1JZTA 2PWZA 3QPAA 4FKMA 1RQ2A 4PRLA 4U63A 3K53A 5HKBA 3FCUB 5JBQA 2V7PA 3WP0A 1KEKA 5KTOA 5J1SB 4G5OA 4PQGA 4URVR 2RAVA 3GJXC 4HAIA 3VM6A 2DAPA 3LK7A 2IHVA 3HEMA 3OU7A 4A9AA 1CULC 2Q8NA 4IH9A 4EKNB 1KBOA 1SJ9A 2W71A 4J0KA 5LMNB 4QRIA 1TW3A 3NCHA 3DOCA 3I37X 3W05A 1JQ5A 2JAHA 1I36A 3G2NA 3SDSA 4LFAB 2XUQA 3ZC3A 4YP0A 1PJZA 1T6ZA 3Q12A 2B4QA 3IB6A 2OAP1 1HX7A 1QZTA 2PRSA 3GDOA 4NZ9A 3PGA1 1I7DA 3NVAA 1OLSB 3WRYA 2X6QA 3QJ5A 2TYSB 1DLJA 4I9HA 5EP1A 1SCAA 5ALGA 1JLLA 5K2OA 3EGXA 1TUIA 4FR2A 3TH5A 4EHBA 1ZWLA 4DA6A 2CSXA 1KO7A 1T35A 4A27A 4E21A 5BN1A 4JJZA 1MNQA 5FHRA 4NEHB 3BXZA 1OI4A 1G16A 1YVPA 1LDMA 3HA7A 3T52A 4WNAA 2APJA 2H5JA 6Q21A 2YZKA 1BEZA 2QT1A 4JEUA 4KZKA 3WWDA 3P4YA 3JV7A 3LC7O 4LC0A 4OHUA 3V4RA 3H7IA 2B7CA 4AN1A 2B37A 3MIIA 5I45A 4V3CA 2AMJA 1IY8A 4XUEA 4WGFA 1KP9A 1FNMA 2ZJOA 1PFVA 3AY6A 3SIRA 1E8MA 1ZM4A 2O8CA 3PQ4A 5JS2A 4ZTBA 1YQ9A 2CNWA 1YL6A 5ICEA 1VJ0A 1KEEA 2BYTA 1N2CA 3CLUD 1KSHA 1FP7A 1HT1E 5EIBC 5IAKA 3SXUA 5FTNA 3WR5A 1GRRA 3EARA 1CS0A 2P9TA 1BWPA 2BEVA 2P30A 2PX4A 3EISA 5CD9A 4LQDA 3WIOA 2NTVA 2FYTA 5T6MA 1EE2A 3O9ZA 3SU8A 1D6MA 2V9ZA 4MDFA 1IAVA 4NU0A 2VT2A 3B51X 1BXGA 1DPGA 1MB9A 3MHTA 4NBKA 1EFVA 2CSUA 3SJZA 4ALNA 5HCNA 4YYZA 4DKJA 2I29A 5L3SA 3U31A 5M04A 2LWIA 4J1SA 4F97A 4BNTA 1A7AA 1A9TA 2FJUA 4LHYA 4UTPA 4O4HF 1CSEE 1NJ1A 1YC5A 5AW2A 1UBJS 1W1UA 3MAAC 1CY7A 2C4VA 5KQSA 3NIGB 1PX0A 1JDPA 3A05A 1ZGAA 4TQAA 5E6RA 4Q0MA 1ZDMA 5CDYA 4ZT4A 4X91A 2JFHA 1Q14A 3DZ8A 1IK4A 4NPHA 2C5HA 3I9MA 3F96A 1TQ6A 3WLHA 1ZC3A 3CNOA 4KHPB 4RDIA 1O96A 1TLFA 1W29A 3I72A 4BMNA 4BNMA 3C1AA 3I83A 3WGVA 1V5IA 1K97A 1Y3CE 3PVSA 3QY9A 5DGHA 1GPJA 3B52X 1XTQA 3H5RA 3KALA 3CCFA 3ENZA 1FFWA 1P4GA 2M98A 4U2KA 4YNBA 5DH9A 3RTAA 3UF0A 1Y1LA 1GNSA 3C3XA 3FZEA 2A0YA 4IFBA 1QRRA 4NYJR 1O03A 4WOPA 5ESXA 5EUQB 4FCVA 5KTMA 2PUGA 5AW4A 2ZBEA 1USVA 4HWOA 1WP9A 3INTA 4R9SA 5G4LA 4M54A 1F51E 2OSBA 1DJQA 2QVCA 1W49A 3F67A 3K0AB 5KNBA 3EPKA 2AG8A 1Y8ZA 1VZ3A 2FETA 4G01B 3RYHB 1FNNA 4G3XA 3IVMA 3UMCA 2JJ1D 2R79A 2PUCA 3JQBC 1ARZA 3BZBA 1V8ZA 4FLMA 2EYQA 1CLEA 2NTYC 4WOKA 4UBLA 1NASA 4D9BA 3AR7A 2MYNA 1Z38A 1L8AA 2HCBA 2QVXX 3DMRA 4HLQB 2AX3A 1NULA 3T5PA 1Q3KA 3H5AA 2Q0SA 4DCCA 1Z56C 2EHDA 3UMYA 4AROA 3F8SA 1ZC4A 3B5IA 3K0KA 1ODLA 4EG6A 1DKOA 2H8KA 1PJ3A 2RGNC 3RYIB 3TEMA 4E5NA 1MA3A 1L5KA 2O0HA 4HXEB 2A30A 3FPGA 2K7FA 4RZUA 2MSNA 2QUAA 1NVEA 1F8YA 3ZK8A 1J0XO 2V4MA 2VZ8A 1QF7A 4ETIA 4UUOA 4ZCRA 4F2WA 5C1OA 1KKLA 4L50A 3W3AD 3F6CA 1FW6A 5A06A 4L7VA 3I5YA 4MJLA 2D0OB 3NBKA 1JI0A 4Q7EA 5DX1A 3I28A 2CXNA 4A5OA 5CURA 1ZUHA 4YRSA 4ZJYA 4YDQA 2H08A 2X0DA 4HNTA 4BWFB 5CAEA 3ZXUB 2W2MA 4B76A 4IILA 1MJFA 3O3NB 4HUQA 3FMGA 2VJLA 4A2PA 4HVTA 4Y1FA 3DEHA 3VMMA 5HIAA 1OAOA 1E9SA 2O48X 1H2BA 3ANTA 1OY1A 4DSTA 4MPJA 1IHXA 3IX7A 3TDMA 3PDCA 1CEEA 1NI4B 2BE7A 3B1JA 3R44A 1G2OA 4C4SA 3IAFA 4HB0A 5H3LA 4L5YA 1XDWA 4L6AA 3RS8A 4D97A 1KEUA 3KLMX 4CMCA 4S1NA 3HABA 1OFHA 1B00A 3KQLA 3U4QA 3VFDA 4Z2AA 4I08A 4AI6A 4CKCA 1DMRA 4BYGA 4EBBA 4IMIB 4NYIR 2PKXA 4GAEA 3SJCA 1L2TA 1EP9A 3OC0A 2BT4A 4OHMA 3LLMA 1N34B 3NVDA 4HDNA 5H68A 1IPHA 1DIOB 3DEZA 3QIAA 1G8PA 2W2QA 5DT9A 1W5AA 2F8MA 2FQWA 4F4JA 5DHAA 2JEOA 4JFRA 4X3PA 4CUZA 1D5WA 3AMVA 1RBYA 2J07A 4KC0A 2GPNA 5AJHA 1Z5GA 1ZGGA 2IUEA 2UAGA 1E2GA 1VTKA 3ROGA 4IDCA 1R7RA 5LOVA 2AVDA 3KYCA 2JHGA 1IN7A 3FKSD 3N2KB 3OG9A 2Y1CA 2VA8A 3HKCB 3TZBA 2HT6A 3KPUA 4P7BA 2PUVA 1URPA 5JYCA 3AGQA 3Q3GE 3A58B 3FJ1A 2AH5A 1RXCA 1PI3A 2D1YA 3ZH2A 5DNWA 1U63A 4BAUA 5ANRB 3PUIA 1DG1G 1INLA 3GL9A 4JOCA 5FXMA 3DZGA 1Q1BA 2X8JB 4B4DA 1YR7A 1Q95A 3QXGA 3WKEA 2HN9A 1TCCA 3COVA 3GVHA 4Z8YA 4P4NA 1IEXA 3FPEA 4RM3A 1F5SA 1QZUA 4B47A 1S4QA 2ORYA 1S2GA 3C8MA 2BKEA 3CM0A 5EYPB 3VR3A 1MZVA 1UK6A 3NYWA 5BWMA 4KPYA 1TD1A 4KBGA 2CXOA 2X0KA 2RG1A 5IDYA 1SHJA 3DCNA 2IZ0A 4MV6A 2VNJA 2GLTA 1UP7A 2C20A 4GNRA 4RGBA 1PFYA 2FPKA 3REGA 3SJBA 3DO5A 3GJQA 4ZDKA 1MMFB 1KZ7B 1LK0A 3II6X 1H4TA 2Y1LA 5T8KC 1FE8A 2BFEA 2J59A 4L4UA 5JAMA 4K03A 5EI5A 1OC2A 1LUAA 3LZ6A 5IMSA 1JDZA 1YE5A 5GVSA 5C51B 1TIKA 3ZHSA 1N5KA 3TLYA 4BDSA 1PBTA 5I01A 2DULA 2NN3C 2XMDA 3B7WA 3ZU6A 2WF8A 1HZZC 4QKQA 4X54A 3UANA 3ZK7A 2AS0A 1XTKA 3NONA 1ZW6A 2CLSA 4K1XA 1TVMA 2Y0CA 4ZIRB 9GPBA 4HXYA 2YY7A 4HX9A 1Y80A 2I55A 2V7BA 1NFQA 3DUFB 3AI7A 4NSNA 5BT9A 5BWBA 1FFCA 4MEJA 4E5SA 2VXOA 2H1HA 4RELA 3P9KA 2HQOA 1SK9A 3CLKA 4OQZA 4YAWA 4ZCSA 1JZSA 3T0FA 4A4DA 1OTYA 3K1AA 5AOCA 2VPIA 4TRMA 4D99A 2R6ZA 4OKIA 1X1DA 3OA0A 2FZKA 2XI4A 4F6CA 2VNKA 2NV6A 1VI2A 4JYAB 1UDXA 1WMAA 3BYZA 1JPJA 2VJBA 1FJHA 3UWDA 4HYYA 5K0FA 4GM4A 1GPNA 3PUJA 4ZZ2A 1ESMA 5CTJA 2M6KA 4DCUA 5FEUA 3FHOA 3F8WA 1GRCA 2NGRA 4YRMA 4YO7A 3WXMA 4HBGA 3ZVRA 1R0WA 4FOOA 2H51A 2PSFA 3JWPA 2RIRA 2XNKA 1GZVA 4BE9A 3VHQA 2BI4A 4BNGA 4RM2A 4UMDA 3RK1A 3TZQA 1M8GA 1XDSA 2CDRA 2F59A 5FV4A 3GLHE 1P19A 3OZEA 1NAHA 3PQDA 4JZKA 2HHJA 4N0PA 5H9VA 5TPWB 4JMLA 3U7JA 5CG1A 2BUAA 4KMSA 5KQLA 3JD1A 5J9FA 5KNBH 1UFKA 4II2A 3FNQA 1DRUA 2DCUA 4DLAA 1UDAA 2Q5JA 5FRDA 2AV6A 4KO8A 5BRAA 3NH9A 3A1WA 1C1HA 2QX6A 2BEWB 3G85A 3QBDA 3TPCA 4P5EA 4URWR 3TYXA 1YRAA 5F7XA 4MKGA 1HPLA 1E2DA 1JBEA 1VGQA 1W46A 3CRRA 1ENZA 3OU6A 4UVHA 4WNCA 2WSMA 1V9LA 2QTNA 3GRYA 4QXOA 4LVNA 3AJ9A 4AZ0A 4UOZA 5BXQC 3HKEA 1CFJA 3RUHA 1R1DA 5CK4A 4GBMA 4WPGA 4YRRA 5UKDA 1M6NA 4XYMA 3K9FC 1Z26A 3ZHBA 5D3ZA 4NONA 5DU2A 1BX0A 2XTNA 2HY7A 4KDCA 2GPYA 2Q07A 2VHQA 4N9QA 1G64A 4CI9A 4O59O 4RJLA 4NZPA 4TM7A 3G59A 4I1RA 1Y7HA 2BLNA 1UF9A 4MB2A 1LV7A 5TSDA 2OCGA 2V55B 3KUCA 5ITZA 3I9JA 4KUEA 1WDLA 5JH7A 2EZTA 3KYDB 1TZMA 4NVRA 5BV0A 2VYND 2LCFA 2OBLA 3DMYA 5TPZD 4RULA 2YIDA 2IZOA 1GTL1 5C8DA 4KWIA 1BGVA 1ZH4A 4LS3A 5H0IA 4K86A 4NHOA 2E6UX 4OFBA 5BWOA 1FIUA 4C14A 1O89A 2GF2A 2RHGB 5F7OA 2BCJQ 2H31A 3OIDA 1U3DA 3R5FA 2FMKA 5EE3A 4ZALA 5SZJA 4ZHQF 1AJEA 5GQSA 5MN6A 4IWNA 4B6GA 2IPMA 1K7SN 3WMWA 2PZBA 3LYUA 4MGIR 3RVPA 4TV9F 1HQYE 3ZYZA 4WBNF 1KJJA 3DCIA 1IN1A 4MWDA 4PX2A 3QUTA 4UM5A 2O50A 3ZEAA 1R66A 4LWOA 1F48A 4B4VA 3WGUA 1AMUA 2B3DA 3ODPA 4MVJI 1FF9A 10MHA 3IUBA 1SUAA 1HDRA 2UUOA 3HS3A 3O2QB 4DNXA 1PVVA 4FFRA 1EWKA 4XGRA 4Y6QA 4YQZA 3DGFC 2OT3B 1P5FA 3N0WA 4HK4A 4BJHB 1Q91A 1RM0A 3L7OA 4F5DA 5DHRA 3PXGA 4B8ZA 4DS3A 1TYAE 2ZSFA 5LZ9A 1SG0A 3TUJC 4EG4A 4II3A 1OWOA 4CV2A 3L93A 5DYWA 2ZE7A 1N2OA 1ZSVA 2HCRA 3N3AC 4AIIA 1VE9A 1W2HA 3IPRA 3DKRA 1UEIA 2QL9A 3DDCA 3UPDA 4FEEA 5G0UA 3PGMA 4IEIA 5C32A 5FO1A 1JIIA 2BZ0A 3WIUA 3BERA 4FFOA 3U3RA 4B4KA 2BHLA 4BY9E 3IE2A 1NVTA 4CF4A 3PDJA 2BZSA 1UJCA 3GLHB 1T2VA 1C9DB 3F47A 3AZPA 1BGXT 2DFVA 5J5CA 1HNZB 4GX2A 2N75A 2PT6A 4CF3A 2ZOSA 4GMDA 3ELWA 4L72A 1G41A 2I6XA 1YI0A 3FWYA 4NV3A 1JTVA 3TW8B 2D2VA 1L4EA 2QNRA 3OLXA 5F64A 4N4AA 3LQYA 4GI3A 2FWRA 3K2EA 1XQYA 4L02A 4LXTA 1B4DA 3WC4A 6CHYA 4TX1A 1Z2EA 4QWMA 4LF9B 1W5BA 4X7MA 1KFBB 2RHHA 3AEYA 3O8DA 4F4UA 1HE1C 2ZI5A 3B38A 3NKVA 2JJ2A 3I0MA 4MPPA 2QTGA 2BFPA 4EQ6B 1FDIA 5A9SB 4NBWA 2BFFB 3O8QB 4M37A 1W0JD 2H29A 2GS9A 3ER6A 1WX1A 4R51A 2AT1A 1OLSA 2CLFB 1ISIA 2ADFA 2LIVA 2GO7A 2R48A 3C0KA 3NWBA 4CMIB 3KQKA 2BGGA 1N6IA 2CDBA 3SJAA 1PR4A 5KTSA 1YB6A 1JIUA 1S2OA 5A1TA 3QW2A 1DQYA 1P45A 1Y3FE 2O06A 4II7A 3VNUA 1HORA 5ILGA 1XU7A 4OBBA 5C1BA 4BAGA 4TLBA 3LP8A 4GVXA 4ZCLA 3OIVA 5IN5A 2A5FA 3CX7A 2HA6A 3IUYA 2WJHA 4IG9A 3ANXA 2OA0A 2GHTA 3NWJA 3STXA 3S1SA 4BVBA 4AKIA 3KVNA 1I4DD 4P82A 4FNOA 1JR2A 3BK1A 3DR5A 4URYR 3UG7A 1FQOA 3EASA 4S2UA 3UK2A 5AJZA 1AGPA 1EVKA 1NQOA 3TLBA 4PXAA 1NDHA 1RAGA 1YB7A 1Z4NA 3JATB 4GD3Q 2COKA 4PO1A 4TMFA 5EE9A 5EMHA 3V7WA 4BB9A 4LEIA 2FEKA 2XBUA 1PWHA 1IOLA 1O6CA 3ABRB 4UXJA 4QZVA 4CYMA 4QICA 1EGAA 3D1JA 3WLMA 3THYA 1XO1A 2P2CA 2C4UA 2QLJA 3C3AA 1LBIA 2OHJA 5JNVA 3JVVA 4L9RA 5KTNA 4KIJA 1ST3A 2CXSA 2P78A 3PS9A 4WY5A 3WWPA 4MZDA 1KJYA 3Q3CA 3DVRX 1DEXA 1U2EA 1VLZA 2H5IA 2JFNA 2QT0A 3FDJA 3L7MA 5TS3A 3UGTA 3X1JA 4AF7A 2JHFA 5AIAA 3HSYA 5AICA 4YCLA 2P79A 3NVKI 3GRAA 4OI0A 1WB6A 4MUFA 1JLMA 5EUBA 2PLRA 3CEHA 1V16A 5CMLA 1RACA 1ST2A 2H1IA 2IHJA 4RE5A 4X00A 1RWBA 3FTQA 4E09A 4D6PA 2ZE5A 5E8JA 2I3ZA 2WHPB 1PHRA 5DNVA 1F4PA 2A2ZA 2GK3A 1KJ8A 2VT3A 3GGCA 3MGBA 4EDHA 9ATCA 1D9ZA 1FDWA 3K0BA 4HMQA 5CB4A 1TYEB 1C7QA 2O19A 2C2GA 2PS1A 3KXKA 4XX0B 1LWOA 4GP7A 1XRNA 2YUIA 4E15A 5I3CA 1TVCA 1JIXA 1MG5A 1M76A 1YBAA 3QBEA 4YEDA 2HLNA 1GCIA 3PC6A 5IZCA 3QXHA 1XTZA 3EODA 2VN8A 4RD2A 3DPUA 5K5EA 3U9SA 5KYNA 1FC0A 1PK9A 1ETUA 5F21A 1G17A 1H05A 4URHA 3H4IA 2RGUA 3LCJA 2NXNA 3T15A 4HN4B 4R0VA 4H18A 3MHPA 2QLBA 4EK9A 1P2UA 2XCUA 4J9UE 5EWMB 5IBPA 1YVUA 2WAAA 4FFWA 1ZJWA 1V8OA 4AF6A 5EIXA 5GV7A 3G2MA 3W8RA 3K6KA 5JSFA 2Q1TA 3C74A 4NWIA 2VCEA 2Z5FA 3CCCA 1Z6AA 5F7JA 5KWIA 1B73A 3EGDB 2H63A 2JFYA 1LI7A 4AZ3B 2EKBA 2GN4A 2IXGA 2R47A 2XVMA 3F3SA 5DYYA 2RBGA 1TEVA 3TVTA 5AVVA 1SEPA 1TZCA 1DBWA 3V4PB 4CG3A 3MK31 1LQUA 1SVNA 1J2JA 3ABZA 3OECA 4DTIA 3IP6A 1NP6A 2BMAA 2KBEA 3BWXA 3CFYA 5HA5A 4DIUA 5KYGA 3DW3X 3FZQA 2AJTA 1YVEI 2GFHA 1VMIA 2O8NA 3BSWA 3H9JA 3M4YA 4I5GA 4XD7A 2VSOA 5CHYA 1DKMA 1MNAA 3ESXA 1Z4MA 2V3VA 2AJLI 3I9OA 4RVGA 3TSZA 4H7PA 4IX9A 4J49A 1H4SA 1LD3A 2FNAA 3EAGA 3MPOA 4R16A 3VZBA 1QTRA 2R97A 1K1EA 3TQCA 1PV2A 1ZGZA 2AC4A 3V8EA 3GFVA 4CT5A 4F5YA 4BP8A 5B4TA 2ZZMA 3TSCA 1Q84A 3D59A 3NHLA 3WKDA 1PLLA 1MTZA 3M82A 4M55A 1P4AA 4X61A 5CPBA 2B20A 3GMDA 4LGMA 2QJRA 2JI6A 3IT3A 4BLOA 2I6UA 4J07A 1C1XB 3QKWA 1EJBA 4JI6B 4JR0A 4DLSA 1SCQA 1VQ1A 4FZVA 1VG0B 1OI2A 4R3UC 1DUIA 3UATA 3V42A 1GZ5A 1MFPA 1XJCA 1G0NA 3HPQA 4CM7A 1H2AS 1KI8A 3GPBA 4G8JA 4DUGD 3TIGA 3C5CA 3OX4A 2FF7A 1OBCA 1DRJA 2I6FA 4I9NA 1K68A 3BZWA 3HZOA 4YRQA 3OQVA 4JVLA 4AYXA 3T5BA 4C0KA 2YV5A 3HCBA 2BONA 2ET6A 3AG6A 4K6GA 3WZ2A 4UUBA 1G2QA 1IRIA 2IYNA 3NTXA 4B0PA 1A7JA 1V7PC 3LCUA 3R0JA 1QIIA 2BIFA 3N2EA 4OGLA 4WXPA 1K5HA 4C4TA 3FTEA 2YJZA 3A0RB 4U7DA 1EE1A 1C9MA 2WIKA 1U8YA 2RHWA 3OZXA 1EDDA 1I7QB 4M1EA 3K2QA 1YDFA 4HWSA 1X1BA 4HQFA 2PGIA 5JWOA 2MDTA 4I9GA 1U3TA 3WTCA 2UUCB 4A6PA 4R7ZA 1JB9A 1KVTA 1WTAA 1LPPA 1V35A 2OCLA 1WETA 1JTEA 1G19A 1Z0ZA 1Y1TA 3MN1A 3WHLA 1CEYA 4XYLA 5REQB 1CR4A 2GEJA 3RS3A 4UPEA 2Q2OA 1XYVA 1NMXA 2R8PA 5P21A 1KYVA 4AG5A 5C18A 5KYXB 5B3KA 5BW6B 3DTYA 1T2FA 2XUAA 1YSCA 3HKCA 4C30A 4RY9A 3BGOS 1XDBA 3F74A 3I09A 4KIFA 1XDZA 3ZIDA 2VJNA 4R6WA 1NLYA 3HZHA 4F1WA 1P3Y1 3TIFA 5IAEA 1NVMB 2ACVA 2AZTA 2IXAA 1W30A 1TKCA 3N05A 1U0LA 2AOUB 3PL1A 4Y9UA 2JIRA 2ZP1A 1NR7A 2WJJA 1O7JA 4ZQHA 4GZLA 1KDVA 2IPXA 4JEHA 4BE7B 2FVYA 2VF2A 5JAOA 4V1CB 2Z3ZA 1U5BB 5T8KA 4PG4A 1WAMA 1KYWA 1QQ5A 2B0CA 1TF2A 2DBRA 1IH8A 5EYPA 4J0EA 2M6LA 4OQLA 5CJ2A 5DK6A 1JHPA 2JLYA 1JDVA 1I1OA 4OMUA 4Q37A 4KQEA 3RQIA 4MITA 3ZWVA 4AJ1A 4MW0A 4B6PA 2XUKA 2ATVA 3BULA 2ZB2A 3RGGA 5A05A 3F5DA 5BV1A 3ER8A 1N5DA 3VKVA 3EXFB 4LGVA 3CLTD 4MGZR 1HZZA 1C2YA 3Q15C 5MHTA 1I0ZA 3RRYA 5HUJA 3RGWS 4EGQA 3BWEA 3H9BA 1D1PA 3E4DA 3T1QA 3K5WA 3EXIA 2QY6A 3I32A 4DM4A 1AK2A 1OXBB 4BRSA 2C4NA 3OBBA 5JPDA 3PE3A 2AK2A 2HDOA 2QDXA 1CCWA 2XR1A 4FLFA 4QAJA 2HHCA 3PZRA 2QTBA 1UDWA 1P1CA 1JHMA 4TYMA 3MTBA 1XZEA 2YWBA 1KQNA 2J33A 1MO5A 4ZIRA 5K09A 4PHCA 5IAOA 3UMMA 2ZJ8A 2QEQA 3DDOA 1ECBA 4IIHA 3LHDA 4DR3B 2NXCA 3MC1A 2HKIA 2OBFA 2D5LA 2C7GA 4UXHA 4RJKA 2O8EB 2H3EA 3IOMA 3QU9A 4QUKA 1AQIA 3CMCO 3RABA 1I33A 2KW5A 2LBPA 4Z3OA 4QBHA 4KR2A 4RF4A 2YFKA 1PG5A 2QG9A 4UBKA 3ZWCA 1QBKC 3VNQA 3OM9A 5C81A 1QF9A 4EQZA 4R1TA 3VJRA 2YC4C 1G9SA 4JP3A 4C4PA 4EF5A 2W4MA 5EZYB 3M2PA 4BO0A 3ZDDA 3KOOA 4I9UA 1SC9A 3GBSA 4GYJA 3RLIA 3BXXA 1R9JA 1KSGA 4PY2A 4F0JA 3IV6A 4RV9A 1AZSC 1DI0A 2EQ5A 5B1YA 4GZ3A 2NT3A 1XNHA 4KREA 1LVHA 3S2YA 2A1TS 3DQQA 1OZFA 2X19A 5KYWA 3ZCXA 4IDOA 4LJAA 2WAOA 3R5XA 2PS0A 3VPGA 5J1TB 3PR2B 2W7TA 1DEOA 3C3EA 3CSDA 3G5UA 4AZWA 1A27A 1QK4A 3IJ5A 4ARUA 2PFSA 3HP7A 4DT1A 5DLQC 4EZBA 1E79D 3KXIA 4JHLA 5ECDA 4W82A 2L19A 2BR5A 2CNNA 1O8BA 4QODA 3N75A 4KPFC 1YAHA 3MLEA 3EYAA 3RIXA 1JKJB 1YJQA 3BRQA 3NRJA 2E48A 4BEVA 2DWOA 2YWJA 4EAQA 4LK2A 4C3VA 3LC2O 3T34A 3UMBA 1TVEA 1AO0A 2XKAA 4LRYA 2FZGA 2HRDA 3UHOA 4LNUB 5JNWA 4CFZA 2IXBA 3T5GA 2GN6A 4AJKA 1DU4A 2BEWA 1B2LA 4QTTB 1NVKA 2C3PA 1NVUQ 2Q1YA 2VDNB 1CK4A 1NBWB 3B7PA 3OTIA 4OLJA 3ZV5A 5C37A 1XLTA 4HS4A 2HF7A 2VXCA 5KVAA 4GR4A 4YUZA 5CPFA 4DY6A 1U2QA 3IKMB 3PEVA 3UT6A 2JI4A 2C7OA 4MCJA 2GYVA 2R1VA 3QHPA 2DKNA 4YRGA 5EG5A 1CRWG 3DKPA 3H4MA 1E2HA 1P7ZA 3OFVA 4K05A 3IO5A 4BZWA 721PA 2X5XA 3U4MA 4CIYA 2A9KA 2VOEA 3QGMA 3B60A 1E2NA 1IY0A 4FLEA 4QAQA 4RETA 3K8QA 1PS0A 3M9LA 5BMVB 4Y30A 3KYDA 2WM9B 3R76A 4NZZA 3ZCUA 2J3MA 4JKIA 3EZFA 2GZ3A 1A5SB 4RMIA 3U7GA 1GUYA 5JZMA 3CNHA 1YQTA 5FPYA 1GTJ1 2RIPA 3UKJA 3Q6NA 4KIWA 1X1TA 4BGUA 1N3YA 1WXDA 2OBMA 2WTEA 3IA2A 1F8FA 1DQPA 4FFMA 4RY2A 5CVDA 1QQ7A 2I4NA 4JLBA 2PMWB 1DAFA 2D1FA 3WMGA 2VH5R 1PQUA 2HDHA 3U49A 4PYJA 4BGEA 3W2FA 1RFLA 3NHYA 2IJGX 4L0CA 2QG6A 1WUKS 3OVMA 5CTAA 4LDAA 5KSYA 3T1HB 4OF4A 4M22A 1ZD9A 2PANA 2W11A 3J7TA 4L85A 1MCZA 2RHTA 1X80A 1XRLA 1CC1S 3U1VA 3EC7A 2B4KA 1XZFA 2PBLA 3C15C 1N9GA 2ODEA 3CLHA 5G1PA 4CMJA 4YLGA 5EQTA 4NMMA 5E2AA 5FLXA 2JGFA 4HRVA 1DBSA 3FWPA 5DM0A 3PX7A 3LVRE 3RU3A 3RW9A 2O07A 4PNPA 5CIWA 2I22A 2WSSA 3WLSA 3F4LA 4LZNA 4KAFA 4RORA 1U0TA 2CF5A 2ZPTX 3HN6A 2GOYA 3COZA 3OM0A 1UJ4A 4O63O 2QTMA 4RY0A 5J43A 1QYRA 5E2IA 2CV2A 2IYSA 3LQ2A 3T3NA 1EXMA 1X7DA 3AFNA 3EQ8A 3K6RA 4N39A 1J97A 5FYQA 2W8ZA 4H6XA 1YU6A 1ETHA 3KDPA 3SE0A 4XOUA 3SX2A 4TTIA 1LS1A 3BG5A 4RZQA 1T1IA 2R60A 3P27A 4KQ2A 3T7JA 3UENA 2E89A 1E3SA 3I01M 4G0YA 4U7TB 5D00A 3RDPA 2QX9A 5IWAB 3U7QB 4TWZA 2B78A 2H59A 2P9JA 3AM5A 4YMHA 1Y63A 1C4WA 3JASA 2UZAA 3I1YA 3UA4A 4M53A 5LA6B 1GU7A 4YR7A 4QYTA 3WNDA 2CKMA 2PTHA 2VSXA 2L42A 2W2VA 3DYIA 3QM1A 4L3WA 4PPYA 1J25A 5C34B 5L51A 3AZQA 1P91A 3RV4A 2ZBQA 3KKEA 4CM6A 1SVMA 2V4ZA 4KLCA 1QB8A 4ZI7B 3VKFA 2M6RA 4EMSA 4CPDA 4OJTA 4X85A 2IS2A 2P2LA 3FHCB 2PGXA 1O6ZA 2PA3A 3EPPA 3PQ3A 5BUSA 5IC5A 4JV5B 3D8BA 3ZUPA 1BWSA 5BYJA 4QDOA 3HXQA 1PGNA 5B6PA 2DCMA 3JX9A 5LXTF 3F6BX 1YH3A 2O0LA 3L82B 4UZSA 5T6BA 1RJ9B 2QDKA 2H1OA 2P41A 1VGRA 2BFFA 3ED1A 3HCFA 3O8QA 4I1SA 5AQ1A 5L7TA 2GAFA 1EZ4A 3IOYA 1NUHA 1SVKA 1A4IA 1FEZA 2HREA 1CIPA 1S8NA 1ZN8A 2RKBA 3C3DA 2CUKA 2JAPA 2QQ0A 3EQ6A 3QUAA 5EXXA 4KH0A 3ZVNA 1YS1X 1U8ZA 4Z4CA 4FN5A 3U4HA 1KH2A 1TUGA 1P2DA 2GPJA 2OECA 2WWWA 3CS3A 1WW2A 3I9NA 4UUMA 1XK7A 3VX4A 2GD6A 5JC1A 3ZJVA 1PSWA 1XZPA 1I1QB 3HXTA 3F7NA 1XLVA 1JIVA 1AB5A 3IQXA 3MUOA 4JUCA 4MAFA 5DFAA 3BL8A 3W8NA 4MQFB 1Y6GA 4BXOB 5AHKA 3GLIA 1RAHA 4D8XA 2HIAA 4TXHA 5FULA 4ZYVA 5A04A 1NNSA 5DRYA 5CX1B 1Z34A 2XUZA 1YZYA 2XOKA 3P94A 1NC3A 5DIFA 3R7BA 3SFZA 4EZEA 1GEEA 1ZM3A 3ICPA 3LW8A 3X2SA 1UBEA 3CUWA 1Q7BA 2YWEA 4GF5A 3KUXA 3N1UA 1MB3A 4GPD1 3L0SA 1KEWA 3KB6A 1XMSA 1RHUA 3ASUA 3L1HA 1HWYA 1YBMA 3SSNA 5I7WA 5LP1A 3K2BA 1N3IA 3QVLA 4EOGA 1SBIA 4NYMQ 1LK7A 1IBRA 1L4BA 2P65A 2YYSA 4MGKR 4YWHA 3WWEA 1SQFA 2AJCA 2WHQA 2FW1A 4IHJB 3NHWA 1T0UA 3I4CA 2A9QA 5KSOA 1IMOA 3OD1A 3H2HA 3ZCPA 3QLVA 2CL7X 5AK0A 5HUHA 1PSZA 1NSTA 1D6NA 3F3MA 4QLBA 3EAQA 1VJ1A 3L1IA 5C53B 3KZMA 3VU8A 3QNUA 4JSYA 1OYOA 3KYIB 3LBYA 2ZAYA 1EQ2A 3K9CA 4GL4A 2YHIB 2ZYGA 1D0IA 1VM6A 1L5HB 2WFMA 3N53A 4HYEA 3B6KA 4N5MA 3TUIC 4LY6A 5HMMA 2NV2B 1AHHA 3BMQB 4PZDA 4WZBA 5AVQA 3VR0A 4AN4A 4MW2A 1UFQA 1NL3A 5F12A 2IV7A 3DNPA 1FUEA 3N87A 3QE4A 4GX1A 4INZA 5HXAA 4RWEA 5AJVB 2C5GA 2PGOA 4FHDA 3H04A 3KKZA 4OAPA 2XITA 4X6UA 4TXNA 1PJCA 3WTBA 1HFWA 4G41A 3TDKA 2IH4A 3DOOA 1JG7A 3PE4A 4W7IA 4WWHA 3UO8B 1FU7A 3BJIC 4K9NA 4J0FA 5D85A 3VU0A 2C3UA 3QE3A 4EY5A 1I1HA 2VYQA 3WP1B 1GP2A 1XEAA 3E3NA 1T5SA 1C30A 1DTWB 1WZNA 3H5TA 4L78A 5ALPA 1E0JA 4O1HA 5L6MB 3A0UA 2AF4C 3BH7A 3TCNA 5TMPA 2FEAA 3ZDYB 4HLDA 2BFBB 1HL7A 3P2MA 4MUKA 4YCAA 4DMCA 2OC4A 4CU2A 4R7TA 5DDIP 2R7MA 5J2UA 1W44A 1LU9A 3NTQA 1T8RA 2V98A 2WG1A 3D8NA 4QXQA 1OA0A 3V8VA 4K1LA 1W73A 1OFUA 3THRA 2QTWB 2PKYX 2RH9B 2VDUE 2XE4A 3U37A 1CUYA 2I54A 4Q3AA 4F92B 4FM9A 3GLGA 2ZPAA 1FUUA 1WIWA 2CD7A 2GNAA 4L73A 2XNDA 4Q03A 1U7TA 3R41A 4YT8A 4PIMA 1W0KD 4WN9B 4WMLA 2VTBB 1U7DA 1NN5A 2FZLA 4HJRA 1YS7A 2ZI4A 2FFJA 4JT4A 4JLJA 4AMYA 5LP6B 1XCJA 4MRAA 3FZNA 3I2FA 4L4RA 4BFXA 3A3OA 1U7PA 2E4WA 3P4XA 1CUZA 5FOUA 4DDHA 3LUKA 4KQ6A 4TTPA 2FCRA 2IF0A 1JB1A 3L7JA 3OFNA 5JWRA 5ULLA 1C1XA 2GVNA 4N0MA 1A8QA 1GQFA 1Z75A 3V1TC 4UBNA 3KZOA 4EFDA 5G4KA 1G3QA 5LP6C 4JLVA 5THQA 1CUAA 3LP6A 1EFTA 1X0VA 4ND3A 5FKJA 2CMHA 1TO2E 3TFOA 4QARA 3L0CA 3WJAA 2ECFA 2OFPA 3BIOA 3DTVB 4R98A 4ZAWA 1P2VA 1TQ8A 3DL0A 1GY8A 4LRQA 4MUMA 1M2JA 2J08A 1M8JA 3IAHA 2GMWA 1E7YA 3HCEA 1G7CA 1V4VA 4IH4A 1TQ2A 1W35A 3KKLA 2B8JA 4NJOA 4PYKA 5FOVA 3S29A 4D8UA 2BP7B 4DNPA 4KWHA 1IB6A 2GN8A 4WESB 2RHJA 1ORTA 3IVAA 2E55A 1PTJC 2B35A 3ZHXA 4YRIA 5EQFA 4JBHA 4B3RB 4JGBA 2EIHA 4IFTA 3FZGA 2QN1A 4O4IB 5TQ2A 4YXWD 1GYPA 4ZOLF 4D45A 1OPRA 1YGYA 5DHTA 5JNUA 2BHTA 3S7TA 4K6CA 1B6RA 1U7OA 1JDJA 1KDPA 2BVNA 2PEZA 3JU3A 4U39A 4YRLA 1XWWA 3SD7A 2NVBA 3FYTA 3WJ1A 1OLXB 3O8OB 2QRHA 1T5TA 1ODSA 3BN3A 4HWGA 4MWBA 5GM1A 4NI5A 4QBGB 2WE7A 3A3KA 1UAYA 2E7ZA 2DBYA 5AHOA 4CCSA 2EWWA 3PD1A 2ZRLA 3D5EA 5REQA 5AI8A 3V9AA 2DOKA 3M89A 4AAYA 3E9NA 4CDRA 4E5YA 1WBDA 3S27A 2I5PO 2H4JA 4LJLA 1D2RA 2B0JA 3S2SA 5KYXA 4QT4A 2GA8A 1UJNA 3KD2A 3L1KA 3SHVA 1FLDA 3U9LA 2D2XA 3GEGA 4CQMD 1XCMA 4KK4A 5E3IA 4D3ZA 3VA7A 4HGPA 1ZVKA 5CDTA 5THKA 2QXUA 4A0HA 1E3TA 2ZDGA 4DA9A 5LC1A 3PHLA 2JI8A 3CH7A 2FP4A 1UCFA 1PZXA 3DDUA 2AN1A 4QDTA 4CTMA 3EWNA 4Y2GA 5GINE 5EMKA 2AOUA 2RAFA 3A6DA 2HA0A 5CXXA 1EK5A 4H15A 2NZ8A 4M1QA 4YI5A 3ZU2A 4PNEA 4P3NA 5L8VA 1CRPA 3FMFA 4ENUA 1PL0A 2OGUA 2QLNA 3RD5A 2IHZA 1NBIA 2EV9A 3BCHA 3LPNA 3N07A 3NAMA 4A0GA 4MW7A 4B3GA 3NRCA 2P2SA 4FDTA 1RLIA 2WLSA 1DC3A 1Q17A 3LWBA 2V7TA 4FWIB 4PCUA 3I73A 1SVUA 2W00A 4R2LA 4LGCA 1NF8A 1QHGA 1WXEA 4OK6A 4B7CA 4JAVC 1C9NA 4PFQA 2XWJI 3DFZA 2Y93A 1IUPA 3ACDA 3M33A 3P9IA 2GASA 2QVGA 1M0TA 3O92A 4HMOA 4RW0A 5JJCA 5LJLA 2JAUA 1ZD2P 4E03A 4AUKA 3REFA 5HZHA 4W99A 5F9MA 4ZEVA 3A6ZA 3D31A 5EZSA 1T0BA 1TDJA 2E3JA 1SVIA 5AM0A 5ARCA 3RS0A 1WE2A 1N7HA 4CODB 2H4ZA 3TTXA 3ZGZA 5BSMA 2HBZA 1J5XA 4PBTA 2CGEA 3BFKA 1G291 1RRKA 4N0EA 5DLEA 2OHVA 1I7SB 2CN1A 3C6MA 5U1PA 2D8AA 3IT2A 3HO1A 4TPKA 3F6PA 2H0QA 3KKNA 5IJ9B 3NDJA 1EQAA 2QA5A 4OP2A 4Z9BA 2QJWA 4JC8A 1IBLB 4DJDC 3QI2A 1Z22A 2ZQYA 4P8RA 1WF3A 3LDHA 4LV6A 4PYQA 3Q6IA 1HDCA 1Q1GA 1QMPA 3H3FA 2F3UA 2DPYA 2P5SA 4AY6A 5F1KA 1QLHA 3BGWA 3G9UA 2AR7A 5IH3A 3RSCA 2BGRA 3SNHA 3FCXA 3WJ7A 2G4VA 5EZYA 1EXNA 1PV1A 3MJCA 4JR2A 4RDCA 3QOFA 2VZ9A 2EKPA 3EUWA 3RROA 3R3YA 3KXDA 4NMHA 2Y67A 4QIHA 4V2IA 3ZWBA 3SPXA 2XMGA 1VDMA 1Q1NA 1GAEO 3O0DA 1SUPA 3QPWA 3HRHA 4N49A 4B5KA 4DV4B 3OZIA 1TKBA 3PR1A 4IS3A 4QC2A 2ZJ3A 2YHUA 4N03A 4UHFA 5LNK6 3RC8A 3MMPA 5JSZA 3ICQB 3N8KA 4NU6A 5JMWA 2DR3A 4MUGA 4DIOA 2OEPA 2W6ID 3PYMA 3H87A 3VKGA 4IQFA 2MCFA 5E6SB 2PYDA 3D6VA 1GR1A 2ZUVA 3AF0A 1TQ4A 2JAQA 3JVEA 5EJMA 4O8ZA 3WV4A 1UOQA 4BN0A 1TZ2A 2OO5A 4YJ2B 4C5AA 5EE1A 2NTJA 5K8JB 1EFKA 4UTZA 4FCCA 5TMDA 4YLEA 4MS1A 3I01A 5I9MA 4G2TA 1T36B 2OV8A 1QIEA 4PNHA 3ZGXA 3A3NA 2I91A 2NU6B 3V33A 2NNLD 2PSHA 3O8BA 1G18A 2J4CA 2J6CA 3QX7A 1QR2A 3OFSA 3RS4A 3LHKA 3TRKA 1F9AA 1NHWA 2HV9A 2PGAA 1SBCA 4QPCA 1O94A 4AULA 3CH6A 2VHEA 4M0FA 1QCZA 5FF9A 1KGDA 1IHPA 3QITA 3I3SR 5JQGB 2VHTA 1E5QA 5I7RA 1N2IA 4GRIA 3TJMA 2QN6A 1ZW1A 3IILA 3RIMA 2FMUA 3S2GA 3T4EA 3RNLA 4ZOQI 5K7SA 3A1CA 1SGWA 3EEYA 2R00C 2RGDA 1K3FA 2HSJA 4GT1A 1JFVA 3WGTA 2ZJAA 4Q4HA 1E1QD 1VJ5A 2LDXA 2ZI7A 3FJYA 3F78A 2V8BA 3S81A 1Q92A 2J5QA 3NNSA 4JI1B 1OIVA 2CJFA 1V95A 3EIEA 1JG3A 3MERA 3QF7A 4AT1A 3H5WA 3SHWA 4DQ0A 2IA5A 4JLWA 5JLJA 5K3FB 2RI1A 2QY9A 3H5LA 1R0BA 4CF7A 5TEVA 1JAHA 3DDWA 3U6BA 1F60A 2AQIA 4LISA 1E2QA 3AXSA 2R7KA 4RVDA 3HR8A 4JSTA 5JVDB 3W34A 2CVOA 2FJPA 3PWSA 2ISSD 3A4YA 2VIIA 2VP2A 3O4RA 3Q9NA 3LOQA 4K6KA 3DF7A 5D5PA 2IP2A 3TW4A 3ASYA 4UMVA 4MIOA 1OYYA 1RWNA 5AKZA 1XFAA 1IHYA 4FE3A 1D0SA 5HGJA 3RTDA 5JFOA 2YOHA 1L3CA 4AP5A 4QGAA 1E6MA 2ZYVX 4GWLA 3RSFA 2EZ8A 2H2WA 4NE2A 5KOIA 4C4YA 4L9AA 5KNLA 4KNVA 2PL9A 3GI1A 4BFZA 4U9HS 1QS0A 2COEA 1GG9A 1BW9B 2ZIUB 4Z4QA 3JQGA 3EZYA 2FSVC 2EF1A 1X7ZA 5T7BA 2GAAA 2ZB7A 1O58A 3W8FA 1WTCA 5EIBD 1NQUA 1QP8A 4LY0A 3AEQA 3CUVA 1SELA 2J67A 3QH4A 3QXJA 3ZWDA 2DHCA 1MJGM 4JU9A 1VPWA 2NVWA 3AIMA 3R6LA 3ONVA 3AFOA 5F5LA 3MTAA 5TGDA 1DO8A 5JAIA 2GWHA 2EFYA 1KO4A 5B2EA 4OMFG 1FTGA 4BB0A 1JHYA 5IBQA 3U7FB 5B1EA 4MVJA 1G5IA 3ZBQA 1U1EA 3D1VA 4NMLA 1D8AA 3MRVA 2JG3A 3MNFA 4KQGA 4EITA 3ZJTA 2G8LA 4PNZA 3FRHA 4DLKA 3DE4X 2XMZA 1AKYA 2VXYA 3DKVA 2NZJA 3DZDA 4P98A 4ENSA 4HLCA 2F3SA 5ALKA 1IBSA 3O4JA 1U2ZA 2C2YA 5LA6A 1HC7A 2E1PA 4Y0AA 5K4AA 3B85A 4UMFA 5DI9A 4ITVA 2I6SA 5TS2A 4YRPA 2IGTA 4WNYA 3DLAA 3DUWA 2PT5A 4KN5A 3WNBA 3U6KA 4JP1A 4P38A 1ZN7A 1HTTA 2CK3A 3NIWA 4ND4A 5E9QA 4FW8A 2XT6A 4D4MA 2G4LA 2IP1A 4DQXA 2XHEA 2WU0A 4BWVA 1X19A 3G23A 1DFHA 1SCUB 3QVJA 4H60A 2BZ1A 1HYHA 3EMVA 1PZFA 3OLYA 5EXSA 1IM5A 1J0BA 2A1TR 2N3ZA 1AV7A 1LRJA 4NV1A 1KHHA 3UOWA 4OB8A 2DRIA 3N8DA 4X0EA 1AQUA 1DV1A 2VCHA 1LEHA 4REMA 2OPBA 2Y1DA 4Q6BA 3A9TA 1QH1B 1R88A 2GM5A 3B3GA 3DR3A 3AVWA 2AWNA 3EVFA 2J7KA 4U6QA 2XJ4A 4NG5A 3IXLA 3BTVA 4YMSA 2A33A 4ZEMA 3C6XA 4FR0A 5HS4A 2JGLA 3EXAA 4DMMA 2A1UA 1RE1A 4C03A 4LDZA 1E89A 4X9XA 4ZU6X 3E7XA 3P0HA 1J21A 2WUWE 2VT6A 1RRCA 3AW8A 2DH6A 3OICA 2VTVA 4BMCA 4IMJB 1U65A 2QE6A 4M1ZA 3IUEA 2PWYA 4B8WA 2DBZA 4IIGA 2ZVJA 1SC1A 2RSLA 4MKFA 3ZE2B 4F2PA 3DMGA 3RU2A 3WV5A 2AJDA 2XQJA 4PLZA 5CX1A 5BR1A 3VBEA 1VCNA 1TU4A 2ODBA 3G5LA 1J7KA 2CFSA 3C45A 5ILOA 1HE2A 3X3HA 1M5RA 3LXRA 2ECPA 2AG1A 2JFXA 3FTPA 1XQVA 2VDWB 3LX8A 4QEKA 5FWYB 4ZVSA 4FYYA 5DN6D 4K26A 3U2QA 1RW4A 4RZ2A 2B7LA 3CN9A 4DCTA 4I50F 4ADSG 2YWCA 9ABPA 3FYSA 4XR4A 5BR4A 3ZVKA 2B1GA 3T4XA 4LQCA 5IMBA 5JD3A 1AO3A 1E3IA 5DW3A 4DUZB 4JLMA 2IIPA 5IP5A 3N3BC 1QU2A 3IAAA 4XWKA 1NBMA 3E35A 1CZOA 1GV0A 2ZWOA 2HSGA 2NIPA 2VDQB 1Q74A 4OREX 5DM4A 1RPZA 1C81A 3B1FA 4FBMA 4C2TA 1IG0A 1YMVA 4M7RA 3TD2A 3WGIA 1JLSA 4HNVA 2C7BA 3LQKA 4IJ5A 3ZHRA 4BKQA 4E5KA 2BE9A 3EDYA 4XWAA 3H4VA 2AQHA 2YHIA 1KZHA 3EEBA 2YWGA 4WOJA 1VSQA 3BMQA 2GAIA 5AHWA 1C7EA 3PUVA 2HJWA 2L17A 5DP1A 5K3DA 5JEDA 1IUNA 4XCXA 1SVLA 3JZDA 1ECGA 4B46A 3HJGA 1P31A 2G09A 3O4IA 3ZDAA 4KWTA 4P58A 1YZUA 5LMCA 1VG8A 3GHHA 1B1AA 2OUIA 4KFRA 3BFJA 4O2BB 3GT4A 1GZHB 1LJ8A 1N0HA 4Q3CA 4KGZA 1D07A 5AXBA 2PNJA 3VPXA 4B7ZA 3ZU4A 4EY4A 5CIYA 2VP9A 4AMGA 5HNKA 1VRWA 1XCGB 2VF8A 4R81A 2P67A 1DVRA 1GV1A 1K2WA 4TTSA 3RSSA 1H6DA 3NASA 2X5KO 4OB7A 2P3SA 3UT5B 3ZHOA 4H7DA 4HNAA 4NJEA 3RSLA 2ATEA 5HRCA 3OP1A 1SCKA 2B5OA 4RPIA 5CH3A