2I3DA

Crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
PEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Atu1826
total genus 71
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i3dA00
3RLIA 1EK2A 4GW3A 2VSQA 1Q84A 2ACKA 2Y6UA 4C89A 5AKYA 3PFCA 1LGYA 3IB3A 5LZ8A 3H1AA 3U1TA 1PV1A 2X8BA 1SC9A 4KAFA 4UHEA 2XUFA 2PSHA 5T4BA 2WFZA 3O4HA 1WPXA 5K3CA 3SK0A 4M0EA 1UOOA 4BAGA 5IKXA 2BUBA 3VVLA 1B6GA 3G0IA 2WUGA 2HIHA 3H17A 3I2GA 3WKDA 2VJBA 4KRYA 3WK7A 1XZBA 2C0PA 5LLSA 5FDFA 4MQLA 1WM1A 4CG3A 1DWPA 5CURA 4BAZA 2HA4A 4ZWNA 1AURA 3U0VA 1DX4A 2OLEA 5AHXA 4A16A 3HJUA 1YA4A 1YR2A 3OG9A 5HF9A 2JGJA 1F0PA 1ZI9A 2HM7A 2O7VA 2FUKA 2V96A 5AKJA 3PF8A 2JGFA 3G0CA 5KREA 2PUJA 3D3NA 1IUNA 2HRQA 1LPSA 3CXUA 4DSZA 4I3FA 3LS2A 1CLEA 4E46A 2J3DA 4AN1A 1YB7A 5ALRA 1P0MA 3PFBA 4QDZA 1BS9A 3M82A 1LNSA 1SOMA 3E3AA 1XQVA 1XZCA 3BJMA 3E1GA 4G4IA 4XVCA 5JZSA 4LKOA 4WFKA 1WOMA 4GI1A 2XQGA 1H2ZA 3CN7A 4BCDA 5KBYA 1EB9A 4GXNA 4B0PA 4H7HA 3QZUA 2HADA 3AILA 5JZBA 4F5ZA 4K2AA 4WY5A 3MVEA 3GFFA 1H2WA 3HEAA 5CBKA 3V9AA 4G1FA 4DTCA 1U65A 1BCSA 1VXRA 2HA5A 3DL7A 2C0QA 2WJ4A 2V98A 1MU0A 5CT9A 5AI5A 4A23A 1QIDA 5ISMA 4U2BA 1EB8A 1SCQA 2BUAA 3O0DA 2VTVA 1TIBA 4BDSA 1A8UA 2EDCA 2R11A 1EI9A 3IUNA 3IIIA 5K3AA 4LXGA 5AK3A 3HYSA 5SYNA 4FOLA 4X95A 1ACLA 5ALMA 2HA7A 5HCUA 5A7GA 4Q05A 4PSUA 5AI9A 3QITA 2WFLB 1QOZA 4J0JA 3BDIA 4NS4A 2FJPA 3IURA 1MJ5A 5FV4A 1XZJA 3F9CA 3D4LA 1LPPA 1UKCA 2I78A 5AKGA 3DL4A 2GBFA 4EY4A 1AQLA 2P8SA 5AKHA 3RKSA 5T4FA 3VDXA 1ZOIA 1GT6A 4CCYA 1QJ4A 2HU7A 1ZIYA 1QIEA 3D7RA 3G9ZA 4U2CA 4Y2JA 1DQZA 1OXMA 1K6EA 1VZ2A 2Q0XA 3T4UA 1EX9A 4WY8A 5AOCA 4BZZA 5LZ2A 5LZ4A 3T52A 2XUDA 1WCYA 1TCCA 3H2HA 3V1KA 3ICVA 2RHTA 3A2NA 4Y2RA 5E4YA 2D5LA 2XLBA 3ESAA 2JF0A 1W75A 5FPQA 2EDAA 1GXSA 5ALNA 3QMWA 4ZGBA 1Y37A 5HQ3A 1ORVA 3FLAA 4PQEA 5D6OA 4KACA 2ZYHA 2XMQA 3P2MA 1QE3A 3OPMA 5ALIA 1T2NA 3WWDA 2J4CA 3V1NA 2QR5A 5EIEA 2J4FA 1CUYA 2GBCA 3N0TA 2QOEA 2WFLA 5C81A 3HSSA 4K6HA 4QE3A 2PUHA 5JAHA 3ZLVA 2C4HA 4MWTA 1HKHA 3C70A 4X91A 4QWMA 4X6YA 3PUIA 3BL8A 5JADA 3ZWQA 1CUDA 2HFJA 4IQ4A 2WUDA 4P08A 2W6CX 2WHPA 2VAXA 5E4JA 1DQYA 1AMNA 2R8BA 3EF3A 1JU4A 5LZ9A 1MO2A 3VJKA 1THTA 4G8DA 2WG2A 1YCDA 3D2AA 5FXMA 5ALPA 3NGMA 1W52X 2B61A 1C7IA 1CEXA 4Y2QA 5ALYA 4UHCA 1THGA 1EINA 3JW8A 3O95A 4X00A 4HZGA 2I03A 4F60A 1SFRA 3I6YA 2O2HA 5AKLA 4H77A 1XKTA 1JI3A 3DOIA 5LP1A 3EBLA 4C87A 1XLUA 4FNMA 2WQZA 3EQ8A 1BEZA 5T4HA 5IH7A 4UHFA 1YASA 1F8UA 4YK7A 2OPHA 3PICA 5CMLA 2ZJ7A 1XLVA 3KWFA 2VJCA 1FSSA 5A71A 2WIJA 5AI8A 1XKLA 2HHAA 2ECFA 3OM8A 1AGYA 3QPAA 1LPNA 1XZGA 2Z8XA 5EHQA 3IULA 3V48A 4H7KA 4H35A 1GQRA 5A62A 3D5EA 5ALLA 4BE9A 1UOPA 1DWOA 4AO6A 2G4LA 2X76A 3RARA 4EA6A 3ANSA 2C5FA 5HFAA 4X6XA 5ALVA 5FP0A 1LPMA 2VT7A 1GQSA 4G9EA 1YB6A 2BKLA 4E15A 5ALSA 5EGNA 3AFIA 4KRXA 4XX1A 5JD5A 3W05A 3TRDA 3O9MA 2I3DA 1XRMA 5J3JA 4KJXA 5K3FB 3R3XA 4MYSA 3KDAA 1JFRA 4L9AA 3ILSA 4J03A 2WJ3A 2DHCA 2OCKA 5AK5A 3WIOA 2HL6A 2WIKA 3WL5A 2C58A 3DQZA 3O9VA 5DWDA 4BTVA 3SX4A 4INZA 1CUXA 1LBSA 4Y2UA 5JYCA 3LIPA 4BDTA 3VJLA 1TCBA 3AZOA 3GUUA 1ZICA 4EY7A 3IDAA 4J7AA 3I2IA 1BN6A 1UXOA 3ZLUA 3WK4A 2B20A 3WWPA 4BE4A 2XUGA 3KOOA 1VE6A 2JGKA 5CXUA 1WPRA 3VISA 1EDBA 1A8QA 1GKLA 4N8DA 1HPLA 3UMJA 4AXBA 3MUOA 3UUFA 1NU6A 2QXTA 2JEZA 5AOAA 1UK9A 4MQMA 2DSNA 4B85A 2OGZA 4TVKA 4YASA 3OOSA 2VA9A 2RIPA 1XZKA 3A2LA 1S8OA 1QIMA 1VA4A 4MXDA 4X7BA 4Q3OA 1WHTA 4Q82A 1IUOA 1ODCA 3R3YA 1MNQA 1L7RA 4AX4A 3M83A 3C5VA 1N1MA 2QZPA 4UFPA 1JJFA 2ROQA 3LIIA 4IH1A 3G9UA 4B0OA 1UOQA 3RK4A 4CI9A 1QIJA 3AIKA 1K8QA 4JYPA 3WYNA 4UBIA 4HVTA 5HKAA 2ACEA 3HABA 3QH4A 5HFNA 2ZSIA 3D0KA 2H9YA 3STWA 2QT9A 1A7UA 1Y7HA 1MX1A 4HTAA 2CJPA 6YASA 3QBJA 1YS1X 5ALGA 1QIGA 2VF2A 3W2TA 2XDWA 4X71A 2PSJA 3LCRA 1PJAA 3DYIA 3IUQA 5JATA 4FBMA 3G7NA 5ALTA 3WK5A 3RM3A 1ODTC 1JU3A 4CFSA 1J1IA 2V9ZA 2AXEA 5H3HA 2XQFA 1H2YA 3WK6A 4MEAA 4C88A 1XZHA 3WK9A 2WTMA 5IVKA 3R3WA 5CT8A 1UK8A 4A5SA 5ALZA 2WG1A 3SWWA 4FNGA 2ZYSA 4H7FA 3R40A 3FLEA 1CUSA 1QTIA 1VA5A 4UHBA 4PNZA 4W1PA 1QIHA 2XB6A 3BDVA 4IH9A 1GKKA 1Q0RA 5DNWA 2XUHA 4PSDA 1QGED 3WQHA 1UT6A 1P0QA 1LPBB 3IBTA 4GBGA 3FSGD 5A7HA 1CRLA 2YYSA 2OXEA 4FLMA 2OCLA 4C4XA 2ZJFA 1QZ3A 4G9GA 3BF7A 5HF6A 4X92A 2LIPA 4GDMA 2XUKA 2WFMA 3HI4A 5I9IA 1XZAA 4Q34A 1XRPA 4QDOA 4G8BA 2XMGA 7YASA 3PDCA 5HZGA 5FLKA 4U2GA 2WG0A 2C7BA 3FCYA 5ESRA 1Q0ZA 2HU8A 3O4IA 4W9RA 1XQXA 4B6GA 1UKAA 4KR0A 2CZQA 1ZD3A 3EQ9A 5DYTA 1QIKA 3HZOA 5AK6A 5JARA 2D0DA 1W4LA 3WA6A 3C6XA 3JWEA 3G9XA 3G0BA 4Q3KA 2B9VA 1DX6A 4QDXA 1IVYA 2RAUA 2HFKA 4UHDA 3QPCA 4X94A 5ALOA 4AMYA 4DSAA 2ORYA 2OCIA 1FFDA 4JYMA 3E4DA 2Y2VA 2VJDA 4EY8A 4RE5A 2OG1A 3S8YA 4KAJA 2QS9A 1CQZA 1EHYA 1ACJA 2BCEA 5HKBA 4LXIA 3ICWA 4H7JA 5C8XA 3F96A 5ALJA 1QFSA 1M33A 4DNPA 2Z3ZA 4I19A 2HDWA 2QMQA 1Z68A 1R88A 1J07A 4P9NA 4QA9A 5D7BA 2DHEA 5AP9A 4QEKA 4X6UA 3KWJA 3KXPA 3S2ZA 3WIBA 3MGAA 3STUA 3A6ZA 1MNAA 5ALEA 2O2IA 1XROA 3LLCA 1H22A 5DYYA 1L7QA 1OCEA 2HA6A 1SCIA 2XLCA 4DMCA 1J06A 4BP8A 2RGUA 3EQ7A 5JASA 4UBOA 1CUIA 4CIBA 4OUKX 2EEPA 4B9AA 1XRRA 2GBIA 3NUZA 4B80A 2BAGA 1LZKA 2PPLA 3IUMA 5CH3A 5CW2A 4MWSA 5LIPA 3NWOA 4NVRA 1PFQA 1RP1A 4NZZA 3FLBA 3H04A 4C4YA 1CUGA 4X3CA 1R3DA 5AI4A 1XQYA 5EHZA 4DMKA 2WTNA 3EIOA 4O08A 2XMSA 3K6KA 4N8EA 1J2EA 1L7AA 1ISPA 3WZMA 1LPOA 4M0FA 5CT4A 4PF1A 4BC0A 5AIBA 3C87A 4BBZA 4UBKA 5ALUA 1SCKA 5AO9A 4LHEA 4W1SA 2PSDA 3WA7A 4K5QA 4WFJA 1XZFA 1MN6A 3W9UA 4YX9A 2DHDA 1N5RA 1IZ8A 1AZWA 3I28A 3STTA 5AI6A 5CRIA 2RHWA 1USWA 1T4MA 2VQ6A 4PV7A 1R1DA 2RONA 4J0CA 3C6YA 1O6FA 3ESCA 4DMFA 1DT5A 4H0CA 1QO9A 1XQWA 2AJBA 5FPPA 5HQ3B 3F98A 3WL7A 2QUAA 2XE4A 3QPDA 3H1BA 1B41A 3ED1A 2OAEA 3WI7A 1GPLA 5AM3A 3DD5A 5CH5A 5JD6A 2QRUA 2PX6A 5IVHA 4B81A 4ITVA 2AJCA 5C8ZA 1VKHA 4C01A 1XRNA 4M0MA 2WLSA 4HRXA 1CPYA 1BCRA 1JMKC 4RGYA 1W1IA 4DYHA 5CH8A 3V1LA 1I6WA 1VJ5A 4C4ZA 5K5EA 4F21A 2JGMA 3DCNA 5FUMA 2XMZA 5AM5A 1CUHA 1XZLA 3H18A 4NMWA 2K2QB 5HF5A 3HC7A 4PSCA 4JUIA 1EVQA 1TAHA 1XZIA 3F97A 2DFPA 4BZWA 2HA2A 1QTRA 1R4ZA 3D2BA 4FKBA 2XMRA 4UBJA 2E3JA 3G0DA 1BN7A 5JIBA 3QMMA 4ZI5A 4H18A 1GGVA 1DU4A 3ESBA 5ALKA 1WB4A 4HXGA 4WFIA 2ZJ6A 1ZGBA 5AICA 1JJIA 2WKWA 1WB5A 4EBBA 3H2KA 4CCWA 1CUEA 4KYVA 1P0IA 3GELA 4ARAA 1NX9A 1HDEA 3C6ZA 4UHHA 1UK7A 2VT6A 4I4CA 4FBLA 4FWBA 3WWCA 5HK9A 1P0PA 5AKZA 4RNCA 3R3VA 4Y2VA 5EFZA 1CQWA 4TGLA 5A2GA 3IUJA 2WHPB 5LKAA 2XI4A 2CEKA 3PI6A 2FX5A 3WMRA 3K2IA 1XZDA 5T4EA 4DLNA 3YASA 4AO8A 3GROA 5AK4A 4H7DA 2QXUA 4EB0A 5JAPA 1LZLA 2BGRA 2ZVDA 3FBWA 2WHQA 2WSLA 3PE6A 2XMBA 3K9BA 2WHRA 4ZREA 3FYUA 4C6HA 1W76A 2HA3A 2GZRA 3C8DA 3WKAA 3ESDA 1CUCA 1RYYA 3C43A 2WUFA 5AKEA 1UWCA 3C5WP 3BWXA 2IITA 1ZJ5A 4OD0A 5C8VA 5KWIA 1VZ3A 3WJ1A 4U2FA 2Z5GA 2H7XA 1DT3A 1XFDA 3ZV7A 5FRDA 3BIWA 4CCYB 3QMVA 1JKMA 4GWLA 1A8SA 3I6MA 1MTZA 2OGTA 3H2IA 4TPKA 5ALWA 1CUVA 5AM4A 4UUQA 1XZEA 5I7UA 4OU4A 3FYUC 5LZ7A 4FTWA 2ONCA 5AKKA 1Q83A 1QONA 4E11A 1YAHA 5D3ZA 3I2HA 5ALDA 3WZLA 2HRRA 1Y7IA 4J0HA 5YASA 4JEIA 1ZI6A 3WJ2A 3DKKA 2QUBA 2WM2A 4B82A 1JT2A 1F0NA 1ZJ4A 5D3KA 2JEYA 5AM0A 4EZIA 4IHAA 3JYHA 1MX5A 4N5IX 2DR0A 5DTIA 4ROTA 3I2JA 2QJWA 4OB7A 3FNBA 5IVDA 1ZD4A 4BCBA 2HU5A 4H7EA 2GYUA 4UFNA 1CVLA 3WKCA 3DOHA 1KEZA 2BGNA 3I2FA 4J0KA 1N5MA 2FJ0A 2QVBA 3DLTA 3BE8A 4Y7DA 4U2DA 2WIDA 2OCGA 3QM1A 5FOQA 1AX9A 4DMHA 5EHXA 3R3ZA 1A88A 2AJ8A 1VOTA 4BTLA 2AJDA 4ARBA 5I8PA 2H7CA 2VJAA 4BRSA 4GHWA 2XUAA 3O4JA 4KE7A 3V1MA 1CUJA 4ETWA 2YASA 1HBJA 2WU3A 1XRQA 2XQIA 3WWEA 4BATA 1OILA 1W6RA 3O4GA 3SC2A 5A6VA 3I1IA 5ALQA 4OCZA 1CFJA 2H7YA 3STYA 2QJRA 3STVA 3VVMA 1R50A 2DQZA 4XWGA 4J0IA 2I3ZA 3F8SA 4BVKA 3STXA 3OURA 4L3WA 1TCAA 3X3HA 3QVMA 1FFBA 1YA8A 2G5TA 1HQDA 4P92A 4AO7A 4UBLA 1K5PA 1FFCA 4HXEB 4DNFA 2W22A 2GYVA 1G42A 3C45A 3DS8A 2ZYIA 1HL7A 1ODSA 1R9MA 3CCCA 3N2ZB 3R0VA 1XZMA 2WIGA 5K3EA 1E8NA 1CIJA 3FOBA 4OYYA 5DLPA 1IMJA 5BV7A 3OC0A 3ZPXA 3H2JA 3W9BA 4EY6A 3DJYA 3AIOA 4Y2YA 3L1HA 4UBNA 3FVRA 1LPAB 4DM7A 3Q0TA 3VKFA 4HRYA 4Z49A 1ZI8A 3UUEA 3I6ZA 1KU0A 2PSEA 3LP5A 4UPDA 1WHSA 5DNVA 2XUIA 1IZ7A 1MPXA 5DYWA 1JMYA 5IVIA 3I2KA 1YAJA 5AOBA 4ZV9A 1H23A 2HA0A 2IIVA 1BEEA 3M81A 2BFNA 2CMFA 4GECA 2X5XA 3KD2A 1ZIXA 1BRTA 2DQYA 4OU5A 2CBGA 1FFAA 3DYVA 4FFWA 4LXHA 1U4NA 3VJMA 5CXXA 5K3DA 1ZGCA 3BXPA 1VLQA 4DIUA 5BOVA 1F6WA 4UBMA 4OB8A 4WCVA 2H1IA 3KSRA 4Y9SA 3HRHA 1YS2X 1UKBA 4QLAA 4X97A 4BCCA 2OGSA 1UZAA 2VEOA 1CUWA 4B7ZA 3GZJA 1AUOA 5FKJA 3L1IA 4JNCA 2XQKA 2OQIA 3AUKA 4AMZA 1IUPA 1EVEA 2G63A 1G5FA 4FMPA 4E14A 2GYWA 2XT0A 3IA2A 2YXPX 4ZRDA 4G8CA 1MAAA 4B84A 4GEGA 5EIHA 4BVLA 2JGIA 5EHNA 4DNOA 1MX9A 2C5GA 4W1QA 2JGEA 1C4XA 3DKRA 5ALHA 1X2EA 3WKBA 4RE6A 3G9TA 1O6GA 5ALXA 1QIFA 5E4TA 4BC1A 4WJLA 4MYDA 4KE6A 4RPCA 3G8YA 4F0JA 3FSGA 4AQDA 1GZ7A 5AKXA 3AIMA 5KWJA 3W06A 4IH4A 4LIPD 3VXKA 4LYEA 4B83A 2QM0A 3WL8A 2XUQA 4BAUA 2IX9A 1MT3A 3G02A 5BWCA 5K3BA 1K63A 2QTBA 2UZ0A 4ZV7A 1JJBA 3PF9A 1D07A 2XUPA 4XJVA 5BWBA 3CCBA 5ALFA 1BU8A 3AZPA 4XIIA 4G4JA 3WWOA 3FCXA 4FHZA 3F67A 2PBLA 1QIIA 3GA7A 2CUTA 4H7IA 4GLBA 5HF8A 3H0CA 1RWQA 1YSCA 1TK3A 4JH0A 4U2EA 1EA5A 1XLWA 2PU5A 1CUAA 4W63A 2XUOA 1E66A 1KU6A 4W1RA 4QZVA 3L1JA 4FLEA 3AZQA 3TJMA 4Y2SA 5JAUA 2Z8ZA 3E0XA 1CUUA 3ZI7A 2Y6VA 5CT5A 3BJRA 2O2GA 4OPMA 5C7YA 5LZ5A 4PO3X 3Q8WA 2ZYRA 1UFOA 3C6BA 5CT6A 1CUFA 2XUJA 3B3QA 5AJHA 4PW0A 1K4YA 4D9JA 4BRZA 1ORWA 3G0GA 4KEAA 5F4ZA 3WLAA 2JIDA 1EK1A 1E89A 5A7FA 5AM1A 3A70A 3HXKA 4AB1A 2WJ6A 1U2EA 2PL5A 4BYMA 4G5XA 3GBSA 4LYDA 1AKNA 1EDEA 3HLKA 4CG1A 1EDDA 1BROA 4FFVA 2CKMA 2Z3WA 1CUBA 4B9EA 3B12A 2WIFA 1DINA 2PU7A 3TGLA 5JANA 3I1YA 2VAVA 4EY5A 3AJAA 4QLOA 2VATA 1G66A 5EI5A 3HACA 4P93A 3WL6A 4L0CA 3FAKA 1ETHA 2CB9A 4KE9A 4CIAA 2ZSHA 4MJ3A 5E2IA 4BP9A 4ZXFA 4CG2A 1DTEA 4KE8A 2ES4A 5CTAA 3FVTA 5JAOA 4X90A 2AJLI 4UFOA 1ZD5A 1E8MA 1AC5A 3WYDA 1CR6A 4QWWA 3NOXA 1WB6A 1XRLA 3OTQA 4DNQA 2O7RA 2JBWA 1E8DA 1EH5A 2B4KA 3WKEA 3W04A 1GPKA 2WU4A 3R41A 5AI0A 1X70A 1TQHA 2Y1KA 2PM8A 1NU8A 3BF8A 3FWHA 4J0GA 5HK8A 1E3QA 4HAIA 4Q1VA 3C8HA 3R3UA 2GZSA 2V97A 1BE0A 1FFEA 1LBTA 1CUZA 4OB6A 3H2GA 5AIAA 5DTJA 1UK6A 5LYYA 1CV2A 1LLFA 2PSFA 4EUSA 4FDMA 4OYLA 3D59A 4HXFB 2J3QA 3D2CA 4BVJA 5EIAA 4DGQA 1EXWA 3PUHA 2YH2A 4X85A 3DDUA 1HLGA 2OAGA 3DEAA 3ZLTA 5DNUA 4Y2XA 3B5EA 4AZ0A 2QKYA 2NW6A 4KAAA 3BIXA 1E5TA 2XQJA 4QNNA 3WK8A 1MAHA 3ANTA 2WILA 4K6KA 3DNMA 4L72A 1X2BA 2PVSA 3IVMA 1N8SA 4OSEA 4EHBA 2G5PA 1VXOA 4X93A 4J0DA 2Y2UA 3M3DA 1G4HA 3H19A 4YPVA 1TKRA 4QDTA 2WUEA 1ZD2P 3QYJA 4N5HX 1DWQA 4MEBA 1U8EA 4WDQA 2JGLA 4QDUA 4K6GA 3FYUB 3MUNA 5JZ9A 1VE7A 4FLFA 3TEJA 1QO7A 5JD4A 1QLWA 5SYMA 4WDRA 4V2IA 4IO0A 2PKYX 2XMDA 1GPNA 2XMCA 2OQVA 4Y2PA 5JALA 4BB0A 5LKRA 1R9NA 2GBGA 2BUCA 2BJHA 5AM2A 2DCMA 2RI6A 3FYTA 1TRHA 4Y2TA 3AINA 1FJ2A 4AN0A 4S0XA 1H2XA 4N8SA 5AKIA 3A2MA 4AZ3A 1C7JA 1QFMA 3CN9A 5AH0A 4J3JA 5DJ5A 4Q3LA 5K3FA 4HS9A 4G4GA
chains in the Genus database with same CATH superfamily
3IGFA 4HPJB 4W8GA 4AD8A 3TNJA 3OQPA 3EVZA 4DSNA 3AL2A 5DI3B 4GW3A 4PG7A 1H5NA 1GG9A 3LFUA 4YDHB 3TJRA 4OJKA 1ZRSA 4B8ZA 1P19A 3AETB 4E4TA 1PL6A 3CUKA 2CHGA 2EKZA 1O08A 1Y63A 3HKDB 1VCMA 4HJRA 5AKYA 4C89A 3JZIA 4RAQA 1KARA 1KP2A 2BEKA 2YMLA 4MUEA 1WMAA 3DUFB 2X8BA 1RNLA 2WDZA 3N2IA 4KAFA 2DLNA 1FTQA 2XWJI 3AYZB 1PD0A 1CJKC 3O8LA 3GD7A 3E9CA 3NBFA 3KJZA 1E3EA 1OFGA 1WNFA 4L28A 4D8YA 5KWEA 1Q0SA 2CDBA 2FMKA 4FHGA 1SKQA 4O5OA 5T4BA 2XDQB 3T41A 4HL6A 5I01A 3RODA 5KHLB 3O4HA 1QB7A 5GAJA 2Z04A 2R66A 3SK0A 3EVBA 5DHQA 1TLFA 3K0BA 3VVLA 3L93A 1N1EA 3NHSA 1SPBS 5IJZA 4DR1B 2WUGA 3PWKA 4I55A 3ET5A 3U7GA 4BB9A 3NIDB 4X61A 1FP1D 4CEHA 1DJLA 1CYEA 4F96A 3WGNA 3WK7A 3FG9A 3Q3IA 1GCIA 3FVWA 1JHYA 1XZBA 3DE1X 5H4HA 5LLSA 3VOTA 3LDGA 2OUIA 5EJEA 5KNBD 4QODA 2IS6A 4RANA 4R81A 1ZCZA 2K4MA 3U0VA 1DX4A 4DUGA 4X3OA 5I48A 2YYYA 5JSFA 3HJUA 4HN2A 2O8DB 1AQJA 2JGJA 1ZI9A 4HKTA 3FUUA 2P6PA 4RKQA 1O1YA 4DSTA 1X8KA 2WYOA 2BHSA 3MOIA 3I09A 4PSAA 2FUKA 5IH3A 3VYRB 2V96A 2G28A 1OLSA 1YDEA 2X0IA 4X8OA 4B73A 4QM6A 1W59A 1NQOA 4UUPA 2Z09A 2V8OA 3ZHYA 2AX3A 1GVNB 4MLZA 3K2QA 4P4NA 5KREA 3MWDB 1H8HA 1YRLA 2CMHA 1IUNA 1XJCA 1JWBB 1WPGA 5EJAA 3NS7A 3QU2A 4PQFA 3Q9LA 4D5EA 2D54A 4IZ6A 3THOA 1IWBB 1YQGA 2ZCUA 3COVA 1XQ1A 1GNVA 2W2PA 3RREA 1SUBA 3BA6A 5CD1A 2LIVA 2W6JD 3M2PA 2FQXA 4YV7A 4YT4A 3TAUA 1E20A 1XAIA 2CDCA 3TKAA 1P0MA 4CKWA 3HXMA 2AVDA 1E1YA 3PFBA 2GBLA 4PPFA 4B7AA 1FBNA 3O4FA 2AC4A 4Q7KA 3MTJA 3EMDA 4M1TA 4RH1A 3N2NA 4BP3A 5DBOA 5ECDA 9LDTA 1LNSA 5FV7A 2DUJA 3E3AA 1M34E 1G5PA 1QWOA 2GWRA 3A6KA 3GPCA 3KXLA 3N86A 2ASEA 4K0RA 4RJKA 1V6CA 1BHO1 1XZCA 3H6GA 4BV3A 1OFHA 2G7MC 1HT3A 1WW8A 1Z0KA 2QYHA 2W6QA 3GLVA 1HV8A 4G4IA 2OSBA 2C98A 1JB1A 1MAVA 2PUTA 3KOZA 1CE8A 4NNOA 3H8VA 4WNAA 1Q21A 1W36B 2FE1A 2FW6A 5DE3A 1UANA 4KUGA 5KNDA 4QPDA 1ONBA 4LSMA 1PN3A 2XQGA 3S8EA 3AR3A 3K09C 3LP6A 2JFOA 2JNWA 4Q16A 5LOVF 4WBXC 5G40A 3QHQA 5TPWA 2PAAA 2XXBA 4MHOA 1GUZA 5L6LB 2C77A 1NZFA 3TJZA 2TS1A 1CLUA 3QWBA 2Q2VA 1P9WA 3WGTA 4B5LA 2ZI4A 3JAKA 4HRAA 4XGKA 5HM6A 2PIAA 1BO6A 1O97C 2QAGC 2A1IA 2Y0BA 4KRFA 1IHUA 3WMFA 3C4JA 2PL3A 3UTCA 3L8GA 2UYOA 2H2AA 1H2WA 4DJ5X 2R8ZA 8GPBA 3V9AA 3BK2A 2XKJE 4PGHA 3FPFA 1GITA 4MI3A 3SS7X 621PA 2I7DA 4I50F 5AHRA 3AF0A 3ZKAA 2PXHA 3NEJA 4TUYF 4ZVTA 2ZT7A 3IO3A 1JJ7A 4RKFA 5DRYA 1BCSA 1V2GA 3DL7A 1EWQA 2C0QA 4FONA 4BUCA 4D56A 4R2XA 3PNVA 3HBLA 1MPTA 2V98A 1T3GA 1WA5A 5AI5A 3WISA 1FSFA 3C24A 3KZMA 5C1OA 1C5KA 2VP4A 5JH7B 5KOIA 2VDJA 4A23A 1DEOA 2R5WA 4PPNA 3KQMA 5ISMA 2B99A 3T3EA 3ZZMA 4P33A 1NWHA 4YONB 4C7VA 1TIBA 1JLMA 1ATIA 3CF6R 2NUPA 2PS3A 4NCIA 1VSQA 5E7QA 4BDSA 4EF4A 1QQAA 5ANRB 4ZC8A 2R11A 4LY6A 1UM9B 2OBBA 3T7IA 2NO0A 3GT7A 2PV7A 1SQFA 3PNQA 2R60A 2WYVA 2QMOA 2CV0A 2XCSB 1UZNA 4PHGA 1H2AS 4XFJA 2JCGA 3COZA 1DFGA 3LBAA 1M73E 1US8A 2YMPA 5AK3A 3HYSA 3B5IA 3IH5A 3QOYA 1DJNA 1L8QA 4L5CA 3E2IA 4LOAA 1G2QA 5EP4A 5EXEA 3SHFA 3ZWXA 5BN5A 3CNNA 3G0OA 3RTDA 3TZHA 4B3RB 4X95A 1Q3HA 4Q4AB 3BWYA 4JLAA 1WU8A 4FQ7A 5ALMA 1X7ZB 3O82A 2CLOB 5A7GA 5IT4A 1ABBA 2Y67A 4JWTA 3DCIA 4Q9KA 3F74A 4GMHA 3UFXA 3WAGA 3J81k 2RMKA 2GPYA 2WNIA 4PSUA 3RG2A 5KVSA 4PPQA 1G2OA 3A06A 3B9RA 3ROMA 4MRSA 3ZV3A 2HO5A 1ZRHA 3ZQUA 2FJPA 2ZPUA 4MS1B 4XWAA 2G3YA 3A8TA 3ZE7A 1IPEA 1SUFA 2IXGA 3VHQA 1PVVA 4LJSA 5KYYA 2DT5A 1CNEA 1JRLA 3BH7A 1V3QE 4PYQA 1G19A 4Q66C 4LVCA 5AKGA 4GP7A 1EIWA 2IPXA 4HYTA 4MW4A 1HFEL 1HXHA 3EXHB 1RHKA 4EO9A 5KO2A 2W9XA 4FOTA 1GUFA 3MS4A 4TRNA 1WXDA 2J08A 2G83A 4CMJA 1XWFA 2B6NA 3EB9A 5A5DA 4QLBA 4ARCA 3L7KA 4PBRA 1PZNA 1I7NA 3OEHD 1ZOIA 3VDXA 2E5LB 5T57A 4LXUA 1PEDA 2P6RA 4PICA 4Z8XA 1P4SA 3U4IA 3WRXC 1GNQA 1Y9AA 2AN3A 4AJEA 2A0YA 4EKNB 4GMXA 2Q2NA 4Z4QA 1M1NA 3MS2A 2ATXA 4NV1A 1XTTA 3EUWA 1IXRC 1E7RA 1ZXLA 3VKWA 5B3JC 3QW2A 3GHHA 2PT7A 3D7RA 4OXIA 4R16A 4Y2JA 2VJKA 1DQZA 2JH9A 2Z58A 4YN3A 4BU0A 2GDZA 4MVJH 1K6EA 1VZ2A 1EEHA 4RL6A 4ZYXA 5HCIA 2Q1XA 4WY8A 3QU5A 3ZYCA 3F4LA 4DLZA 2F3QA 3K9CA 4G25A 1WCYA 3T52A 1TCCA 2FZEA 1VE3A 2I4NA 3HCRA 3ICVA 2GVNA 2R62A 3VSCA 4E2XA 4L9RA 4Q7JB 1N7GA 1TLLA 5EYPB 2D5LA 1W5FA 3QWAA 5E1DA 3PT9A 3G5LA 1VJCA 1YHZA 2XLBA 4DLVA 1MH1A 3BDAA 4DADA 5BMVF 4C76A 2W11A 2VNSA 4GXTA 1X13A 1XVTA 2FLWA 3MJCA 4NG5A 4YJ3A 1L5LA 3D8SA 1GXSA 4M6WB 2X0KA 3UJPA 4BGVA 4PGAA 2FVYA 3B9PA 4ZGBA 2R6DA 2DE0X 4HJXA 5ILOA 2NZ8A 4PQEA 3OJ0A 4FMCB 5D6OA 2A5GA 1CVRA 3AG5A 3C39A 4ZIRA 3TBKA 1L7VC 1Y6JA 2H4JA 2QTWB 3JD3A 3OO0A 1WL8A 1U5AA 1G4AE 4HDMB 3S44A 2IH2A 4CRWB 1BU5A 1Z5OA 5G41A 3RQIA 4BEWA 1M2FA 3OPMA 4IIUA 1BXKA 3QK7A 3QLUA 2C7PA 2C5BA 1T2NA 1T29A 2NQ2C 4M54A 1YQUA 1ZSYA 5HZKA 2Q4RA 4FYJA 3GRRA 3SJCA 4Y98A 5I3ZA 2L17A 4OHPA 2VP5A 2QGNA 2QNIA 4HWGA 1L9XA 2GAIA 1CUYA 1EXNA 1FMLA 3OIUA 1BVUA 4TSRA 4HDKB 5CDTA 2WFLA 3IOYA 1F12A 2WFAA 2JIPA 3AFGA 3JASB 4RENA 3I9V1 4FDVA 1NURA 2FQ1A 4OQYA 5TGDA 1R0ZA 2QP3A 3DMDA 4GRAA 2G5CA 1ZJZA 3GP3A 4LJ5A 4M8KA 1CW2B 1W0KD 2J85A 4IDNA 4LSGA 2PCJA 4KMMA 1GSIA 4AECA 4B6QA 1GIAA 2YXNA 4ZI7B 3DOOA 2FSVC 4RKRA 5BSTA 4MWTA 4HWSA 4YUZA 3DOEA 3WLRA 1FJGB 4MDFA 2HIGA 3ZE2B 1NLFA 3BBPA 4U00A 2KLHA 5MN4A 1VP3A 3ZWOA 4D6XA 2QJOA 3DEIA 4OQXA 3HCFA 3Q87B 3WHKA 5DNCA 5IG2A 4QWMA 3RTGA 3SOZA 3GGCA 2EW1A 3PUIA 4I6EA 2JKZA 2QM7A 4GD3Q 2XF8A 1YJCA 3LFHA 1ADGA 4L5IA 4F56A 1ZKDA 5B3LA 4G63A 1GTRA 1A9TA 2PJRA 4DLWA 1JHUA 3CZCA 3ZWQA 4NCNA 1E4OA 4BQQA 4QFDA 2H51A 3OQVA 4UDYX 2HN9A 3PGVA 3UG6A 1ZFNA 2CNWD 2H2HA 3DBLA 3KXDA 1COWD 4BZXA 4EYQA 1QP4A 3VU8A 2Q9CA 3J7TA 2AD5A 2N42A 3S2UA 2Q5EA 2QMYA 2ZVPX 3N8KA 2Z98A 2DPXA 3AETA 5E4JA 2W6IA 3UJAA 4QO8A 2SNIE 2E6KA 4IIBA 4J9UE 1AMNA 4S1TA 4E2YA 1RE1A 3EF3A 3GLUA 4BNYA 3X0DA 1VJGA 5LZ9A 4KAXA 1Z6YA 4TYQA 3VJKA 1JHRA 3GPLA 1I2ZA 1QBKC 5TB5A 4CM6A 1YCDA 2NNWB 1CQIB 2FZVA 4FGSA 3PL5A 2H2GA 3T5MA 4YYEA 4RACA 4UZEA 1LSJA 4BNIA 1TMGE 1EG2A 1I5RA 2DPHA 1F1BA 1CEXA 1ECBA 2QGZA 2ZIXA 1SHTX 1FFWA 3T35A 5TS2A 1J1ZA 1N0WA 2MR5A 1WW2A 4HFRA 4KLNA 1IVSA 1AK9A 3IIKA 2C9BA 1EJBA 1RJEA 5CVUA 1PZGA 1S2NA 1VYUA 4OYHA 1PS8A 1I3OA 3AI7A 1JEAA 2ZJ4A 1N9KA 5KYTA 1QYXA 3D4BA 5LP1A 2NSHA 3E53A 1KJQA 2C2GA 3PRYA 5D01A 3WVNA 2V7PA 3A4MA 1I2DA 1BEZA 5CEJA 1YASA 3DBOB 3EWIA 4J9VA 1XA0A 5JVDF 4NEGA 1WPQA 4XH9B 3EPHA 2XXAA 1JBKA 2G07A 4LV5B 1L4FA 1L6IA 1DBIA 1FFXA 1ULSA 2E9SA 2EWMA 3NWEA 2ZJ7A 4KX5A 5CMLA 1XLVA 2AC7A 3OWXA 3MWEA 2IV3A 2OBFA 3EC1A 2J0UB 5ER9A 4OQEA 2CZGA 2AN9A 1OT5A 4ZMSA 3CLRC 3PYXA 3B6IA 3QF7A 4Z9AA 4IWYA 4BLTA 1GEEA 2WNHA 5CM8B 1XKLA 3FOCA 3RU2A 3W2GA 1ZH2A 6PFKA 1SZPA 2ZUFA 2DH5A 1TO6A 1YL5A 2FMXA 1PS0A 4DC1A 2CW5A 2NLOA 3FPAA 4BFTA 1T1IA 1XZGA 1DBRA 2FOIA 2IH4A 1QC5A 1JVBA 2QUIA 4K0KB 1FSZA 1W4ZA 1GUDA 1GTMA 1NNLA 2NSDA 2Z2ZA 1CG6A 1NJ8A 1NUQA 3LXRA 4TXNA 3D5EA 5ALLA 5FQOA 1EBUA 3LAWA 2B92A 1ORIA 5CUQA 3ROTA 4JI3B 3SF8B 5DM70 2X1LA 2OBMA 3ETJA 4PX9A 1UOPA 4L02A 2DFTA 5B3JA 5CFQA 1LI4A 4OQZA 4GRDA 4HPWA 3FMOB 3ANSA 3AR4A 3BK7A 3GLHB 4TMZA 4Q9JA 4MR7B 4KREA 1CWUA 4XIJA 3DBHB 5FBRB 3S2YA 5ALVA 1F14A 3PC4A 2R6ZA 1Z0JA 4MKGA 3IBSA 2X19A 2PLNA 4RS3A 2GERA 1XF1A 3PPWA 5FP0A 2ZSBA 1KZ1A 3UXEA 4EJFA 1LQ2A 1Z2EA 2D0PB 3ZD8A 2JJMA 3GQBB 4EYKA 1B16A 3QV1A 5ESDA 4ZJYA 2G6TA 4LBVA 2HK9A 3J80A 4MW6A 2DXIA 4JSTA 1E1RD 3T95A 4IUDS 5LD2C 1YK1A 1BWRA 1KEWA 2IVFA 3T9FA 1MIHA 4B3HA 4YAFA 5EGNA 4IIDA 3ZJTA 1S7CA 4KRXA 1WSBA 4XX1A 5DBEX 1TK9A 4HGZA 4MQEA 4BLOA 1CU1A 4DIMA 4I55F 1UPXA 1YRAA 3Q4GA 1EFUA 3THWB 3D8RA 3LZDA 4IZHA 4MVJP 3T1NA 2XB9A 1T2VA 3TRDA 2D74A 3H7IA 4Q00A 4ZDIA 1PJ3A 4GE3A 5KB3A 1XRMA 2JVKA 2ZK7A 1GYRA 4JVMA 4Q37A 3GG9A 4PGGA 3RI3A 5K4AA 5J3JA 3I6BA 1O95C 3IDOA 5EQDA 5K3FB 1CS0A 1ZCFA 5FUWA 1JFRA 1M7GA 2CE2X 5K8LA 3MJSA 2PH1A 3B13B 3GPIA 1GQ2A 3MQFA 3CKLA 1SU7A 3OZCA 1O5TA 3IQEA 1NFFA 5EJ9A 3H5RA 2WJ3A 3CVYA 2DHCA 1M6EX 3N05A 3KYJB 3L0ZA 4G23A 3NIBA 1NV8A 2Q2WA 4EITA 4JFAA 4RHXA 1ELOA 2E82A 1U1DA 2PY6A 4WKPA 5JCJD 4Q4HB 4RVSA 1VE9A 3AL3A 3H5LA 3NPMA 3CVWA 1XPOA 3RIXA 3WIOA 1UXIA 4EX7A 4DYDA 2WIKA 3K94A 5KNCD 3K4HA 2FE4A 1CERA 3CLSC 3MT9A 2Y1FA 1OKKD 1FXSA 2MSKA 4FYVA 4X0EA 4AAYA 3H9CA 5I6DA 2D0IA 5ICCA 1SUWA 1PQUA 4LPSA 2ATCA 2JIMA 4EHAA 5A9SA 5BY2A 1PV4A 4PG5A 1J8VA 3COYA 4BTVA 1YHYA 1WZ2A 1ZMXA 1CUXA 2R7MA 4KQKA 3OCYA 5ABPA 2VDMB 4NBVA 2FEMA 2D0OB 4HLUA 5CNMA 3EDQA 5FTMA 4QBIA 1O2DA 3RS8A 4F38A 3ZHRA 3VR2D 3S27A 5LD2B 3H9GA 1O0CA 4QL3A 4FEEA 4QGHA 5BV0A 1E1QA 1VM6A 1N6HA 2FETA 3I8XA 4AWBA 4F5YA 3GN1A 2GTPA 5DM1A 3CZAA 3IDAA 2BFCB 3DFFA 5FWXB 3K71B 1BN6A 3ESRA 4F84A 1T9CA 1S7GA 2XBLA 4BNMA 4CLXA 3K5IA 2XUGA 2CDAA 4M1MA 2C7GA 4ZPJA 4ZZ1A 4JB0A 4P31A 2OPHA 2UXBB 2QF7A 2GPBA 3M33A 1WPRA 3FWNA 3VISA 3AJDA 3QFRA 2O1XA 1EDBA 3TTVA 5F21A 3RO7A 4K81B 1SPXA 1NOIA 2NXJA 4MJLA 4X1IB 3UMJA 4COKA 3HGQA 4U3JA 3OTOB 2DKFA 3DTVD 5FBHA 3OQMA 3UUFA 4JOCA 1NU6A 2GPJA 2CD7A 2JEZA 4HH1A 3UWSA 3SMVA 1UQRA 3GJ7A 1GSAA 3VZBA 3IBCA 4M0KA 1PR2A 2Y71A 2GCEA 2VPQA 3V2UA 3O8BA 1RJGA 2YY5A 3H2BA 2OGZA 4HUQA 4IZIA 1Z74A 3DFIA 2O7SA 3UAYA 5BVGB 3MOSA 3JAWB 2O3JA 1JEQA 1VP9A 3RLFA 4IQ0A 3EVEA 3K9LA 2J5RA 1KR5A 3G23A 4UM5A 3T5BA 3DZCA 1L7MA 3D8NA 1KPIA 2NZXA 2J31A 1DPFA 3ZU6A 4K8RB 3GJ6A 3K9FC 5CFOA 2GM3A 5GIPE 4TM8A 3R3YA 1SMKA 1R9GA 2C61A 1PT5A 1W46A 4FR5A 1NOKA 1VL1A 2G4CA 2ZIXB 3NYRA 3VKUA 1MFPA 2HSDA 3M83A 2HWUA 2DR2A 2GAFA 1N1MA 3GMDA 6CHYA 2XOXA 4MWOA 5DYNA 3BKXA 2DKOA 2YHBA 4JELA 2RIRA 4YTEA 4MB2A 4DCPA 1NNEA 3ICQB 4LJ4A 1F6BA 2YOFA 2ZCVA 4GR5A 3ZNNA 2IT1A 5E1OA 4UTZA 1JJFA 2OXCA 3AEUA 1RI1A 3EGVA 3PD7A 4IH1A 4JLWA 3ZK9A 4CHTA 5I51A 1P2SA 3F5SA 5TSDA 2RGGA 4FWTA 4IYRA 5U4XA 4CI9A 3AIKA 3WRVA 5AW1A 1W5BA 2AE2A 2BGLA 1IXZA 3GCZA 1DBPA 2HV9A 3ZUPA 4LJLA 2CMGA 4K05A 4XD7A 1B8NA 1KK3A 1ZW1A 2ACEA 3HDQA 4PZDA 3UH1A 3HABA 4FNAA 1TPZA 3QH4A 1P4GA 1C30B 1U31A 1V8BA 4IG9A 4KVZA 4K28A 5FLYA 4NFHA 3ESQA 3ICPA 4ZI7F 5I9LA 2FMHA 2WSSD 5M34A 1XPUA 5CYFA 5A02A 2WIBA 4U7FA 2VP9A 1W2GA 4JB3A 1QG2A 4PYLA 5LUBA 3U4QB 5ARCA 1S4QA 1TAUA 4EL5A 1OR8A 1IC6A 1N3IA 3GP8A 1K75A 1YZFA 1M0SA 1GFZA 2FFRA 2EW2A 3IRVA 1KDRA 5BMVB 1QP7A 1E0SA 4D4KA 1GZHB 2R85A 1ZL2A 1P17A 2IWRA 4E7OA 2GARA 4C5BA 4DV0B 4ZOAA 3O94A 1G21E 1QIGA 4QXPA 1QGZA 1SCBA 2H48A 5JJ5A 3W2TA 2XDWA 3NIWA 4X71A 1K8YB 1KDYA 3RFTA 3Q8MA 1PG5A 1FYWA 2EFYA 1UWVA 5HVNA 1UDBA 3LT4A 2ON6A 1FQJA 3G7NA 3VDRA 1NIPA 4B6JA 3E2MA 3O8DA 2JI8A 1DNPA 1ODTC 1N0VC 3DKVA 4LY0A 1LDGA 5M29A 2VDOB 4CFSA 4D96A 3IP9A 2V9ZA 3BN3A 4NBUA 5J1TB 3KVOA 1W7AA 3ZW7A 2BVNA 1JSZA 3ABOB 1ESCA 3O5AA 3WSTA 2DQSA 2PX0A 4S1OA 1HORA 4HUJA 2XQFA 3B3JA 3FZGA 3PFKA 5IAJA 5GZ3A 4F5WA 3E27A 3F2IA 1QR2A 2ZPAA 1TMOA 2H85A 4EK9A 3PXBA 5F23A 4A03A 3KJIA 4HCJA 2V55B 2XVAA 3FROA 1RPAA 1SEPA 1XZ8A 1NIJA 1NXVA 5EE0A 5AQEA 3IL2A 1LKZA 3ACCA 1YRQA 2ZRCA 4B46A 1H3FA 1CTQA 1FTWA 2HY7A 4ILEA 1CDZA 2VWGA 1LK7A 1EJ6A 1B42A 3OT1B 4LDQA 2AI1A 1LVUA 2C2ZA 3KV3O 4WBNA 2J7PD 3NDBB 4Q4JB 1H1LA 4JBXA 5K7SA 1SCNE 3A1NA 1I2BA 4FFNA 1PWXA 2PQ0A 4OHRA 4JDUA 2RK3A 1VA5A 3PX3A 3ITKA 1DKUA 2QIOA 3JQFA 1KMIY 1Y34E 2YV1A 4L95C 4PNZA 3ILVA 4QOSA 1GJRA 1PHRA 1ZINA 3IMCA 1J39A 5LBIA 3X1XA 4AMBA 4YMTA 4M86A 2XB6A 4MPJA 1GGJA 2RHRA 3LOPA 1UC5B 3PWSA 4TTRA 4XVHA 4IH9A 1EFVB 1ZIOA 1KGDA 3ORFA 1GKKA 4G5HA 4NX2A 3RAJA 4C4SA 1Q0RA 5JNLA 1HY3A 4WESB 2XUHA 5AJZA 1IK6A 1FUEA 2QD4A 5FWYB 5LA6A 1QGED 3VH3A 4BB6A 1P2BA 1SUIA 4B4DA 1P0QA 4J3FA 4LMBA 4GBGA 3ZTTA 4BU1A 4RVGA 5L3QB 3FSGD 5H5JA 4X5OA 2FSGA 5IAEA 5EJ7A 3BEOA 1H4VB 3OJEA 4D0LB 1UUFA 1VRCA 2V6IA 4FLMA 4TL7A 2H8GA 3TLAA 2GJ8A 4EABA 2D1QA 3REFA 4PG6A 2ZJFA 1QZ3A 1Q7RA 1NATA 1UC8A 1MW9X 4JJ7A 4BNDA 3CF4G 2R6HA 4MV7A 3P45A 4B2LA 4R0VA 5THXA 2P65A 4KZKA 2B83A 4MR9B 4ED9A 2EQAA 1CFZA 4IDEA 2N0SA 2WFMA 3HWSA 3T5CA 1IBCA 5HCNA 1PBTA 3W1WA 5JSUA 1OTXA 1PDWA 5I9IA 4NC9A 2A88A 5FYDA 3PFWO 1FXUA 1YH3A 3B70A 4QDOA 1IN1A 3CBQA 3CF0A 4AG5A 5A1TA 3KUDA 1D1PA 3PDCA 4IXDA 2R2GA 5KNBH 3H1GA 4IBOA 1DGQA 1V37A 2DFNA 1Y4UA 3K0FB 2WG0A 1E7YA 3E82A 4PNPA 2P4SA 4Z3DA 5ESRA 1U8ZA 1G3IA 1NYRA 3F3KA 3GJ3A 1ID1A 2W8BB 3OC6A 2HU8A 1NUSA 3AEKB 4HWOA 3PIDA 3H87A 4ZXPA 4ZN6A 1C3OB 1KHHA 3JATA 2DBVO 4P3OA 5HTKA 4B6GA 2A0FA 3BFXA 4EHLA 1E9CA 2BOVA 2QD5A 4CKWB 5H59A 1B1AA 2I6FA 3R3JA 1WNTA 2B8NA 2Z83A 4U7JA 3RS5A 1U9IC 2AEJA 2QWXA 1GPDG 2HF7A 3PKZA 4UEKA 1L8LA 3WMXA 4A6DA 4C04A 1NNSA 4EUHA 2GWHA 1MFZA 3Q1LA 2PVCA 1I7QB 3H1PA 3IV9A 5L51A 5FA6A 3V1TC 3WA6A 3JWEA 2EG5A 3IT1A 4ESOA 2VPIA 4DQUA 3WGLA 5BXQC 1K0FA 2O2YA 3AB7A 4KDRA 4OK5A 1APBA 4F9EA 3S2FA 2RAUA 3VR4A 4DQVA 5KYWA 4LE1A 4X94A 4AMYA 2VP3A 3OWOA 4NQZA 3TTSA 1TJNA 5HRAA 3LQFA 1UJ2A 3K1AA 1FFDA 3A6EA 4TKMA 4EW1A 3E1SA 1Y4SA 3A36A 1SWVA 3F1LA 2VHJA 1W30A 3CINA 2QAGA 2Y2VA 4S1NA 3HYRA 4BNGA 4EGJA 1T0UA 1XZQA 3I76A 3WJ7A 1SK8A 1UBUS 5TR9A 4D9GA 2W6NA 3UYLA 4MW7A 4OIFA 1M6WA 2Q5CA 1JHQA 2BY4A 1CJVC 2QS9A 3K0CC 2COUA 3LUGA 4PLWA 2REOA 1GZ3A 1VMDA 4YUYA 2BCEA 1KO7A 2G36A 1PR3A 4LXIA 2BSQA 3BXEA 3NNNA 4M83A 3GFGA 1YZVA 1Z7EA 2WI8A 3IAUA 3OAAD 3JWGA 3NTQA 4MA5A 1SCUA 2EIHA 4M9XA 1TIKA 4ZVUA 3AH8A 1GUYA 1HURA 3QYAA 4FMBB 5A3VA 3RC9A 2MMCA 2Z3ZA 3MQ2A 4MDHA 1VLHA 4O0LA 4RY9A 1N75A 1QU3A 4NF2A 4JGBA 1TTHA 1UMCB 2EP8A 4UEQA 1XPJA 5KTRA 5H3CA 1J07A 1FVOA 1Z8DA 2QZ9A 4FUQA 4UASA 3THXB 4P9NA 2FPXA 2CXRA 1E6MA 2VZEA 2C00A 4ZTZB 1A98A 1DL5A 4RPHA 4YT8A 5JH7F 4EEZA 4RKYA 5BYJA 2PFSA 2W98A 2C2MA 2NPIA 4JGIA 3STHA 3M3HA 4YUVA 1QG6A 4CFZA 1KTIA 1WU7A 4DIBA 5CIYA 2W42A 1EGMB 2QMEA 1RWNA 2VTKA 1QCDA 3CRNA 5HMMA 3S2ZA 1IZ0A 3PCRB 3MGAA 2DY0A 4RGBA 1PX2A 1YB1A 1MNAA 5KSPA 2O2IA 4C2AA 3IPCA 2VP2A 1A95A 2GLTA 4RTLA 2FEXA 1L7QA 1N5IA 3DA8A 3PHGA 1QFYA 4UCFA 3QBTA 4DMCA 1YR9A 4W5NA 2G17A 3U40A 2FPIB 3KR2A 5AHOA 3HI6A 1YZ3A 1TL7C 3AR5A 1B8PA 1KK1A 3LPDA 4IEIA 5DHPA 1MABA 4I1YA 3T3PB 1KL7A 2H5EA 1LDYA 4AP6A 3VNVA 4RZUA 1NUUA 2VDLB 4C7JA 3UJCA 1U2DC 3D8HA 3VR4H 2RK6A 5B2FA 1N3YA 3NKLA 1S2MA 4ZT2A 4B9AA 3AVYA 3A0UA 3RHFA 5AD1A 2P40A 1TM1E 1R8SA 1TVEA 2WZBA 4YIKA 1YJ5A 1OFTA 4OKNA 4B80A 1U2PA 2C2KA 1GAEO 2BAGA 3GNQA 1RC0A 2Y92A 4BMCA 2DCUA 5HXAA 1QQ5A 1DG3A 5CW2A 1DKRA 4MWSA 1XTJA 3M5CA 3MMSA 3QELB 1LDNA 3VPDA 4ZYTA 4JP2A 4NVRA 2AEEA 1ODIA 1V11A 3OCUA 3DF9A 1S96A 2D1YA 4IZOA 2I65A 4E13A 2Y1EA 6GPBA 3ABQB 4HUQB 2LD4A 3JYOA 3LRTA 1G18A 2I33A 3OZUA 3TIGA 1EFTA 4L76A 4C4YA 4RLFA 1EUCA 2I2FA 2J9ZB 3ENNA 1CUGA 1ZVKA 2R8PA 3CF4A 5CLGA 4ND7A 3UUWA 1DAOA 4DQ0A 4EAQA 3U7HB 5KTOA 5EHZA 4DMKA 2BTQA 2I8AA 3NWPA 4Q4CA 4OSPA 2H1SA 3B1XA 1J2EA 3K6KA 4OEHA 4ECEA 4LQDA 4M4SA 3GRKA 4IWNA 5LWHA 2QLFA 1D9XA 1MF7A 5IJ9B 4MQ4A 5EY5B 5EE9A 2YWCA 3IUPA 3ECAA 1E1CA 3OU2A 2XT6A 3U7RA 3NUGA 4W5JA 3ZOKA 4Y9UA 3L84A 4CM8A 3TTUA 2GN9A 2IVZA 3HUEA 4QQFA 3RSGA 1BFDA 2CYCA 3WLOA 1LU9A 3GVIA 3VO2A 4C5AA 2QA5A 3B53X 3HFSA 1PS9A 4I4IA 2B94A 4UBKA 1Z4IA 4YV0A 5DW3A 3BWDD 3PCXA 2FZKA 2RG7A 1SCKA 5D3MB 1ZJYA 2QE7D 1VBKA 1T8TA 1EFLA 3IJRA 1CDDA 3BM5A 2IYYA 2C07A 2ODBA 3E23A 3T4PA 3VTKA 3V2HA 1N2ZA 1MN6A 2Y8EA 2EJWA 3W9UA 1JSCA 1YI1A 2O23A 2AFHB 5JV5A 2CHVA 2VL7A 3I28A 5KQGA 4JBIA 2QRVB 1FMJA 2EGHA 5AI6A 3ZE9A 1USWA 3QFSA 2COEA 3TW6A 1Z4NA 2E4XA 2VQ6A 1CE8B 1SHUX 1JDSA 1XP5A 4IV5A 4R8MA 5CAEA 1R1DA 1NPTO 2PLWA 2O0MA 3DFKA 5EMJA 3FDXA 3O73A 1CZLA 3G5UA 4AJJA 1NP3A 3O1HB 3K92A 3K96A 5JH7A 4IHKA 1E99A 1Q77A 4JLJA 3N76A 4Z7NB 1Q22A 2X4IA 1FVFA 1LQUA 3CZRA 3FIJA 1K4MA 2AJBA 3KFXA 3GDGA 4ANFA 4YAOA 4RJTA 3LDAA 4IG4A 4NYMQ 5KX5A 4KI0A 3K0SA 2PUFA 3KUXA 1J0XO 3QYPA 3ZV5A 1L7DA 4O2BB 5LP6C 5SZJA 2W2VA 3PITA 1QRRA 4XLLA 2IZ1A 1Q19A 1AQUA 1EM8A 4JFRA 4AZ3B 1QANA 3NJ8A 1GPLA 3GD5A 1EU1A 3CX7A 4GLLA 1DXOA 3DD5A 3QG5A 5DVZA 2GJ4A 2HX1A 5JD6A 3EVFA 3QQPA 3UK6A 3HA2A 3GFVA 4GT1A 3RVSA 1SVMA 1IG0A 3BMXA 5AVJA 5G0TA 4EO4A 3O8OA 4XKJA 2GPNA 4WXHA 4AKEA 4DCCA 2AG5A 1T6YA 5JRDS 4KK3A 2E1PA 1B14A 4INOA 4C01A 2WT8A 2FH5B 2YOGA 1XRNA 2PJDA 2QW1A 4HRXA 4N39A 3KETA 3FKJA 1F0YA 2IUEA 3B1JA 3W8FA 5KJ6A 1AXGA 4C78A 1TYDE 1IBRA 3ABIA 5EESA 3V1LA 2VJYA 5B57C 5DU2A 1UBCA 3UWPA 5T3YA 2G76A 2R1TB 1G9XA 5K5EA 1XU7A 3R7AA 1GEGA 4G41A 3IQHX 2GNPA 1TC2A 4NWIA 2UUOA 3BTVA 3LFTA 3DCNA 4R7TA 3EK2A 1UPTA 3FI9A 4DJDC 2VAPA 1MJFA 4MMXB 4EA9A 4XWOA 1K92A 1XZLA 1Z18A 3M1AA 2QMUA 2A9OA 4NMWA 4BNFA 4GZ3A 1KXZA 1EVQA 4QGBA 3A37A 3TRIA 3EW7A 1JS1X 1N3BA 4LXQA 1SKYB 2PLRA 2DFPA 3MMNA 3PA8A 1NQTA 4PTLA 4CMAA 1TPYA 4MKRA 1KK2A 2AMJA 2HA2A 1QTRA 3VO8A 2OCYC 2XCUA 1M0TA 3FWZA 3JD1A 4R2WA 4MVJA 4ERXA 4D0RA 3GV0A 1ONSA 1RZRD 4MICA 1U7PA 4WCDA 4QVKA 1BN7A 1BD4A 2A5YB 1EGAA 1IM8A 3C97A 3DNFA 4V0OA 1F2TA 2Q50A 2XNDA 1KK0A 3DF7A 1FYDA 1YB2A 2CNOA 3JZDA 4I9NA 4M9CA 4ZI5A 2W70A 4NFYA 1C0PA 5ALKA 4F6CA 1QFZA 2AQ8A 2YWFA 3RS4A 1ZPDA 4PLHA 4KVGA 3QWHA 4HXGA 1M8PA 4CXMA 4D9BA 4WFIA 1UMDB 3DDHA 2ZB8A 2JZNA 2UKDA 4LQ4A 4BE4A 2ZJ6A 1SXGA 2O05A 3EVDA 1X8XA 1ZGBA 3PJDA 4DV6B 4FSHA 3RE1A 2RGBA 2O8NA 5G4KB 3I45A 3EXEA 3QVSA 1RBZA 1OXKB 2CCJA 4WX2B 3HXPA 1E6UA 1XDUA 2BJWA 3DTYA 5KQPA 2OXTA 3A58B 5C1IA 1GGHA 4DNXA 5AT1A 1YUMA 1JG2A 2WJIA 4FFDA 4A27A 1HETA 4L08A 4NZOA 4JBNA 1T36A 4RA6B 4PCVA 4AZVA 4HAZA 5I7FA 3ER9A 1P0IA 2AW5A 2ZITA 2LTAA 4RVCA 4Q9LA 3ZDQA 1D1QA 2BGMA 4NCKA 4JY7A 1WRBA 1JG1A 5SY4A 2HB6A 2Z4TA 4BKOA 2YZ2A 2Q4TA 2JI4A 4M55A 3AX6A 2RC6A 3RS2A 1EWYA 4FYKA 4OX9B 2C3MA 3GYGA 1QYCA 1D8TA 4YAJA 1GDDA 5T5QA 2FW8A 3H75A 3PGJA 1QQTA 5EINA 2Q7OE 5HJ5A 3K20A 2JANA 4I4CA 4PC2A 3WWCA 1K7YA 1UJ4A 2OOSA 1V25A 2XYQA 2WPDA 3GCXA 4C0AC 2PZMA 4M1YA 1S2IA 5REQA 2A9JA 5HK9A 5KMGA 4RTOA 2QUZA 5AKZA 1NL3A 4KXUA 1LF5A 1MB4A 4Y2VA 4C06A 4TL8A 3W90A 3UWOA 1MEJA 4C4AA 3FOWA 1B0UA 2G80A 4Z9YA 2X7XA 1QJCA 1X38A 3SJ7A 1IJKA 1GN8A 1L5ZA 1SA0B 1A1SA 1R0KA 3EWNA 1B15A 2AN1A 2C5SA 3FHCB 4MUIA 1KYZA 1NW3A 3GVXA 2CEKA 4NE9A 2GM5A 1OH6A 4RJ2A 4UDXX 1USGA 1PNQA 2FX5A 2ECPA 3BMQB 1WZCA 2GLXA 3BHNA 3OEED 2SKCA 2R00A 2XZTA 1XCLA 4MVJE 1BMDA 1WDMA 4KG7A 4NENB 5T4EA 3RROA 3PKJA 4DLNA 3H42B 2HPAA 1Z07A 1SVWA 2WT4A 3YASA 1X7YB 4CMCA 4Z0TA 4C0HA 1DKPA 1N92A 4AO8A 2GXSA 3L7AA 4DM3A 1L7NA 2VDKB 4RZSA 1E1CB 1FFSA 2BFMA 2Z2KA 3FPEA 3PQ4A 4GO1A 2WJVA 1H66A 3FGPA 5CFNA 2O7QA 2D06A 3E9RA 5ENDA 4KQEA 1XDBA 2FZLA 3ZXIA 3GN2A 3IERA 5A4MS 1PJ2A 4QTXA 3EEIA 1LZLA 1H0HA 3W5SA 3VSBA 2BGRA 1C3LA 3FBWA 1IOZA 3C5HA 3GY0A 4DCSA 1JR4A 1AT1A 1W36C 3SSOA 3F6CA 2NV2B 2UUAB 1E60A 2BZ1A 3K9BA 4DJJA 3N0VA 2Q3MA 2E4AA 2XE7A 4XQGA 5CNIA 4AS1A 2ZB2A 2FPPB 3ZEAA 4RTRA 1H1LB 5K8UA 1M0EA 3C8DA 1FFGA 4AXXA 1QKKA 3WKAA 4DCNA 4D6YA 1K7XB 2AVNA 3B89A 1G1AA 4MS4B 3T15A 3TXYA 5IT0A 4OLJA 1AGRA 2A1UA 4BO9A 5KYXA 1CUCA 2RKOA 3BE6A 3PFIA 5DKFA 2TYSB 5AKEA 2X0EA 3Q6NA 1UWCA 1T8PA 1E7SA 5A4IS 2PGLA 2C9ZA 3C5WP 4IMJB 2GILA 4UQPA 2EWWA 1T34A 3O90A 1BW9B 4RSRA 4P35A 2A7QA 3ADOA 3EZFA 4H1UA 2VHUA 3AC0A 2IITA 5BSWA 2FPRA 2Y4NA 1XU4A 2P2YA 3ODGA 3JQ9A 4FWIB 4OMFG 5JRZA 2BMWA 4U2FA 2Z5GA 3FUXA 3H2ZA 1T2EA 1YIDA 3QEBZ 1DT3A 3KLNA 1Q11A 3M4XA 3THSA 3ZV7A 1NP6A 4DXHA 1OZHA 4YJ3B 5B37A 4FFPA 2JVIA 2LZ0A 3LT1A 4M6WA 4MRRA 3W5VA 4DA0A 4MDYA 4RK0A 1XTQA 5DI9A 3C7TA 1DV2A 2RBGA 2G77B 3MCZA 3F7MA 2Z4RA 3LQ1A 3BD7A 3ASYA 3UC9A 3I6MA 4NCHA 4DA4A 5IASA 1WX1A 3BGSA 4UD6A 1SY7A 1XTKA 1USIA 3L4SO 4G1BA 2BC9A 3UOGA 3MGCA 1OAKA 4RPLA 4EDFA 2YRXA 521PA 4CQLB 5DBFA 1XEXA 3B3FA 1PZMA 1YE8A 3MBOA 1RXCA 4P3XA 2QVZX 3ZTWA 1FXWF 3AHIA 1D4ZA 3GDFA 3JD0A 5AKKA 4P98A 2VBGA 4P3KA 3TFQA 2CBXA 1RTKA 3EXIA 2P0AA 2XTMA 3GGOA 3WZLA 1HLPA 3HBJA 5CA1B 2EERA 4M87A 2HRRA 1ISSA 1Z73A 3TL3A 2FUCA 2Z56A 3EFBA 4RDXA 2ZSEA 1ZGJA 1KDVA 1XYYA 5LL6P 1QX3A 3AFHA 1CY6A 4RS4A 3SXJA 3H2YA 3ACBA 4P7BA 3ZU2A 3VYSB 1ZI6A 1A7JA 1KQPA 1ZS9A 4HG2A 4U7HA 3OVMA 1XCJA 3RU9A 2CVPA 4E4RA 3GPBA 4KQJA 4N7MA 3A4TA 5BYBA 3TSZA 4AMGA 4AI6A 1U3DA 2Q1WA 1LTKA 3L8YA 4B82A 1ADYA 2O57A 4MWDA 1F0NA 4LWOA 3HJCA 2IXDA 3AW9A 1WP9A 1NVVR 1RBMA 4RXMA 3PB3A 4TSFA 2ISQA 2WJYA 4H16A 1OC4A 2MU1A 3WFJA 1ZJ4A 5D3KA 1KH2A 1C1DB 2JEYA 1SBCA 5LWQA 1ECCA 3Q5DA 1IN6A 4PPGA 1R0WA 3W4KA 4AYTA 1KO4A 5TQ2B 4H9GA 1P9LA 2QB5A 1OH5A 2PS9A 3HN2A 3PVSA 4DY4A 1S2OA 1F4VA 2XOEA 4KQ9A 4QGFA 4NMHA 1FDSA 2YWBA 2F3SA 2IZOA 1OFUX 3C3CA 2D62A 1LBQA 4GYJA 4RVNA 2ONJA 5A1JA 3HN7A 3KYDB 5DLDA 3PVZA 1AKWA 8OHMA 1TEVA 1C29B 2EYUA 4EHNA 5C3MA 4TYWA 4PLCA 1ZD4A 2NG1A 3PIRA 4O25A 1OD6A 3RYFB 1T5LA 3JYPA 4GXQA 5LXTF 3TZ6A 4WXYB 1GPAA 1M54A 1PG2A 1RU3A 3GJQA 2A1UB 2FK8A 3GMIA 2ZAGA 3H4TA 4MUJA 5KYXB 3IODA 1WUJS 4UFNA 3WL3A 4EFMA 3FJ1A 1KF0A 4LHSA 3EGXB 3I9KA 5H81A 4TYYA 1Y1KE 2YFHA 4M1EA 4FB5A 4M7OA 3D7NA 4NDAA 3MRTA 1N5MA 3W6UA 1PNVA 3PSAA 3BE8A 4EG7A 3T7KA 4CMIB 5JJCA 2WSIA 1W6UA 4C22A 1J8YF 2ACWA 2PLFA 4Y7DA 1DTWA 4YRGA 3DL0A 5EWLB 5ICMA 3W5JA 4JL5A 3A04A 3QLTA 4U2DA 5A9TA 3UMGA 3CWQA 2JAWA 3D1LA 4CKCB 5D8DA 4JT8A 4G84A 4TV9B 1UPBA 4E2ZA 1W36D 1OGJA 3I9OA 3RYCB 3QM1A 4J76A 4BB5A 4KIJA 4NARA 1YJBA 5FOQA 2X4LA 4A6PA 4DMHA 3OCCA 3UMRA 1R18A 1E4YA 4OK6A 3I61A 3WGOA 1KH3A 3FFXA 4DDWA 2WDPA 3HZZA 1VOTA 3PHJA 5DOZA 5EWMA 2P5YA 4UREA 2FY8A 3I5XA 1Z2DA 1O87A 4ARBA 2CV2A 4TKVA 3D4NA 2VJAA 4G0WA 4QIHA 1YNSA 2DFKB 3SVTA 4KMRA 2HHLA 3LWBA 1SM4A 3O4JA 4HLCA 4PXYA 5K0ZA 1SXIA 3KT3A 2ZVQX 1P45A 5GPBA 4MI6A 2YCBA 3QI7A 4B31A 2QHXA 2ANBA 1HBJA 3RHSA 2E5WA 4WACA 5EKTA 1T4CA 1H2FA 2OSVA 3CLUC 3WTCA 5AVOA 4PWZA 3RQSA 1OILA 4BATA 2ZQZA 3O4GA 4TV8A 1Y33E 2MSWA 2FEPA 3UATA 3QXSA 3LO5A 1JE0A 3WP0A 3DYBA 3OE7D 5EC8A 1ZHHA 3RYHA 3SQWA 5TF4A 3R0XA 3CZQA 3FRIA 3QVGB 3STYA 1VYTA 4KHZA 4L3OA 3F6BX 1RBQA 3HL4A 2KSQA 4G65A 5COBA 1TUBA 1D2RA 2WJJA 3ZCTA 3KTDA 3NP7A 4BVKA 5BNZA 3IELA 4ZHQF 1Z0AA 2WSYB 4M1KA 2OECA 2ZTLA 4LY3A 2QSYA 4FSXA 3OLQA 4PFQA 3A0RB 1N2EA 1YA8A 2QMZA 4YC7A 1VIVA 5BXYA 3V7NA 4F3KA 2E18A 3DH0A 2PMCA 4IDCA 4MUGA 4A0RA 1CY7A 2A9RA 2W4QA 2X8JB 4UBLA 5C1PA 4RZIA 1O5IA 5H7XA 4A10A 1UBFA 4DQDA 1B0AA 3X43A 2G6BA 4WZBE 2UZ4A 2C94A 4K9NA 4TMWA 3KPJA 3PNLA 2ZRBA 2VHWA 3EBOA 3EZ2A 3FX2A 1DE0A 3HR4A 4UUMA 4PLVA 5GV8A 2ZYTX 1Q1ZA 3IDZA 1I0ZA 3IHKA 1PQWA 1XN1A 2NU6A 5AESA 1IBMB 1KAEA 1AG9A 1ZD1A 3JARA 1ZU4A 4M0CA 1ODSA 5T6MA 4F9FA 2WEKA 1QO0A 4DLPA 5E38A 4KTTE 4OGLA 1CRQA 3OIDA 1TJYA 3OJLA 2GETA 1ONNA 3N8DA 4X24A 3VTAA 2C84A 1XZMA 4U3JB 2HK8A 5K3EA 3EEBA 3ZWCA 4M46A 4QD3A 5L3RA 4D9KA 4K03A 2VJPA 3RS0A 4GQBA 4PLYA 1ILWA 4MI9A 3OC0A 5ELXA 3H2JA 1V5IA 3ABZA 1N0IA 4XQ0A 3QFFA 1LLQA 1TADA 2UVPA 2GT1A 2WWTA 3D0RA 3RV4A 3TNYA 4E6PA 5JCOC 2AK2A 1KY5A 3KIPA 3MA0A 4YJ3F 5JT1A 2ID8A 3QLVA 4A8JC 4Y2YA 5CR9A 1ESEA 3WYBA 1R16A 5IM5A 4RIHA 4ZALA 1L5NA 1IB6A 2X8WA 4DM7A 2ZEJA 1UKEA 1H2EA 1X8LA 4JT2A 3MB8A 3H6HA 3H9JA 2XTZA 5JNSA 3WSVA 4LYGA 2BFWA 2KI5A 1VBNA 3I6ZA 2HCJB 2M98A 1C3OA 4QVIA 3NHFA 4FFOA 4EYEA 2ZIAA 5KYUB 3O8CA 1EK0A 4MGZR 1JA0A 3IS3A 3NORA 3O0TA 3FTEA 2PDAA 1NYTA 5I4IA 5T64A 1X0VA 4Y6OA 2XDQA 3KQWA 2F2TA 2NYRA 2WVHA 5IVIA 4JHLA 3JPYA 3THYB 1O0SA 1QFXA 1YBMA 3TDKA 4NJEB 3UMFA 2WF8A 4D9IA 2PRKA 2NT3A 1FP4A 1II8A 1KS9A 3AI3A 4BVEA 4EVQA 4JMPA 4KMOA 2BFNA 2ST1A 2PX3A 4GECA 4RELA 4ZQBA 4JI2B 4M89A 2FQYA 1TU3A 1UBJS 3OLXA 5EIOA 1P77A 3O1IC 4PONA 3SJUA 1KAMA 3SKXA 1DJPA 1CKEA 2BKXA 1UH5A 3D8UA 2IJGX 4C2BA 5IZ4A 2XECA 2BFFB 1J97A 4UVGA 1HC7A 4BZPA 1KBZA 2FMFA 1E2DA 3PGXA 4LXHA 3RFXA 1T1RA 3VJMA 2ZBVA 4MS1A 2J8ZA 5K3DA 1F17A 1U9CA 1ZGCA 1JW9B 5LQKA 2QX4A 4QPPA 3KFVA 4W5QA 1S2DA 1P7PA 2CLCX 3SM3A 3UENA 5BPHA 2QG6A 4B3FX 3HNPA 1E18A 1IAVA 2IBMA 1DFHA 1F6WA 2V6MA 2BHTA 2W6MA 3IP7A 4OB8A 4X8HA 4Y1GA 3JQEA 4WCVA 5E3IA 1T0IA 3WNDA 5KJEA 4PVCA 4KR6A 3KSRA 3MTQA 4B3DA 4LZAA 1JHPA 2OO5C 5I9SA 3P9PA 1QH9A 1IOLA 1N5LA 4B74A 5KCMA 3UJ6A 2LPMA 4JOQA 1BHQ1 4EHKA 4IP0A 5C5EA 2C4KA 5K8JB 2ZT5A 5K0TA 4J90A 4IVQA 2G9NA 1GN9A 2R1TA 2IOYA 3OM1A 4RAOA 2Q49A 1UPCA 3KV1A 1CP2A 3BT7A 2RHCA 2OQIA 2IEZA 1TQDA 4OQPA 8LDHA 3NHAA 5HOQA 1CIVA 5J2TA 5KDOA 2CXPA 2V45A 3P0IA 3PBKA 2EHJA 2X58A 2IA5A 3LVFO 4JK3A 1Y1PA 4JS0A 2EFGA 2NQTA 4H6XA 3SZUA 1WZIA 4FCCA 1DZ3A 3EYWA 3BFKA 3R9XB 3MS7A 4NZNA 4HQOA 3O2JA 4E14A 2GYWA 5DCYA 5IDYA 2XT0A 5B4TA 1LNQA 2MJLA 2QI9F 4Y6RA 3UN1A 3WLPA 5EE5B 2JDID 3UAZA 2K7FA 4JXKA 4GEGA 1T4DA 4NE7A 1L5SA 4KSCA 1NVBA 2ZSKA 3QHPA 1S1MA 2JGIA 5EHNA 3P9XA 4H3HB 2ZRDA 2R4TA 3EXG1 3ZHTA 3BHIA 1KJYA 4TLDA 4YAUA 1NAIA 2VRCD 3DZBA 5ULLA 3K1TA 5GINE 3GIWA 1PR1A 5D00A 3PGMA 4IDFA 4WXPA 1X3LA 1R15A 1RACA 4RE6A 2WTXA 3A1DA 4UVDA 4CM9D 4I36A 4PLFA 3OJCA 1JDPA 2NZYA 1IQUA 2RCNA 5EMLA 1QIFA 1Z6AA 2P6UA 3FZNA 4A9AA 1RWOA 1RC8A 2UXDB 4HF7A 3IO5A 4QYTA 1Z4JA 4HSEA 1SOVA 2OFPA 2GRAA 3TLZA 3J81A 2C9OA 1I94B 1YFLA 3FSRA 3UICA 3R76A 3KOYA 4LDNA 3U48A 3T1OA 2QR2A 3T5GA 2QV0A 5BPFA 3NU1A 5BYAA 1C3EA 3LQQA 3FETA 3THYA 2GAAA 4NHEA 5GTDA 3W06A 3HUDA 2IKSA 4LIPD 4DIEA 2BL4A 4B4UA 3ZCQA 1CR2A 4YDSA 1P80A 1VLVA 1BVHA 1GVHA 1SC3A 4WOKA 2X2FA 1HFWA 3TM4A 1T4CB 3HH8A 5LP6B 3TSWA 1FFHA 2QGFA 5EMHA 3UJ7A 1DRVA 2R65A 4MYRA 3E5HA 4XI9A 2ZR9A 5E6SA 1K6MA 4R1LA 1EFHA 5JNVA 4LF8B 2IOHA 4G1UC 4WOCA 5J4LA 5JD3A 4IR7A 3WQSB 4RQBA 5J2UF 3A6FA 4D3ZA 5JY1A 3FFWA 4DV7B 1CIPA 1TYAE 5K99A 1GSOA 3RBVA 1UKYA 3OLZA 5KX5F 3O3MB 4ALJA 3MD9A 3LPNA 3PF9A 5CA1F 1OYOA 2I0FA 2MSNA 5IAOA 3TSAA 4PZPA 3AY0A 3AHDA 3DV0B 2C0CA 2QZ4A 3CCBA 3UKDA 4QAJA 4HADA 5G0VA 3DTNA 4C05A 4ZOQI 4LMAA 2V7TA 5EJ8A 4G4JA 1CK4A 3FCXA 1MVLA 2ZULA 3F67A 2PBLA 4NICA 1D9ZA 1QIIA 3LHFA 4URUR 3GA7A 3AEZA 4H7IA 1A9PA 1X7ZA 2G04A 2I2BA 4QASA 3DDZX 1G21B 1QQ7A 2Q8NA 3U0BA 3S7ZA 3H0CA 1RWQA 1RXEA 2TSYB 1YSCA 1LV7A 3KOMA 4JH0A 1Z06A 1WQ1R 3FPLA 2CNNA 4E5SA 2ZFUA 4XA8A 2PTHA 3U6BA 5LJIA 3EGWA 4MS3B 4ND5A 2EW8A 1IHXA 3W9SA 3MHTA 5AJWA 4N12A 3NIFB 4LZNA 1AB5A 4U9HS 1RM4A 5IM4F 1YDGA 4JYBA 4W63A 3T9EA 1RI5A 4R1MA 2NV6A 2XUOA 3OWHA 1GLVA 3A9CA 4W1RA 1VG1A 1JLLB 3KQKA 3WYCA 2W48A 3NUQA 1HLDA 3N8GA 4NBNA 3VPBA 3TJMA 3ZD9A 3O3NB 4Y2SA 4ARVA 2NTYC 4I5IA 1ZQ9A 2WKRA 2Z8ZA 3E0XA 3EXHA 3KKKA 4KVAA 2AOUA 2QN1A 4W6QA 3ZCSA 1RPJA 1CRZA 1UR5A 4II3A 3W3AH 4TZ0A 3TLBA 1Z7GA 2XXJA 1EFDN 1AKUA 1OWPA 3LHDA 1TJ3A 3RGWS 3U7QA 5LXTB 2FR0A 5L4LA 4KBGA 3R9IA 3NONA 4L73A 2FR8C 1EE9A 1IUKA 4MGIR 3G8DA 4PZAA 3WXMA 1FX0B 2FZCA 5HIMA 3F3YA 4I1IA 2ZANA 3BUSA 5JQGA 3N53A 2R47A 4LTDA 2GN2A 3KWMA 4J29A 1AB6A 1JJVA 1K4YA 5TDHA 5AJXA 4N03A 4ALLA 1V7PC 2PKXA 1ZA2A 1QHYA 2I62A 4QBGB 5FFFA 3WLAA 1TO1E 2ZW9A 3A11A 3GMTA 1E89A 2J0UA 3UUGA 3AXSA 4E1AA 1SQ6A 1CQPA 3F46A 2YJ4A 1XO1A 3LWDA 2JFGA 2BP7B 3R0JA 4UEOA 3WXBA 1JQKA 2IYNA 4AB1A 4E09A 2CXNA 5A6SB 1QBGA 1R0SA 1WVMA 4JT4A 1FNSA 1ZO8A 1AF7A 2ZUCA 4MLDA 2A3NA 5DGCA 4LYDA 2IHTA 1KEVA 2JAHA 2HLDD 1AKNA 4ZV4A 4FINA 1K8XB 4LJ8A 1I7DA 1Y3AA 3EZYA 2AFIE 3AT1A 4B17A 4CG1A 2PUWA 1WY5A 1U3TA 4WLEA 4WMLA 2H0AA 2W0SA 2CKMA 3ONFA 4B9EA 4JN6B 4AK9A 4D8VA 4WY2A 1U80A 3VR3D 5IBPA 1T0JB 3MPUA 4IOKA 2W43A 5DCUA 4AZTA 3TGLA 5DGXA 2MYUA 2IHZA 4R8KA 3EXFA 3CG0A 1DUIA 4G9BA 1UC9A 2PUCA 3OJFA 3TNDA 4ZOEA 1S1CA 1PQYA 1FU7A 5EI5A 3GBPA 3ZGVA 3WL6A 5GADl 4B3BA 2D7CA 4L0CA 4P5EA 2R7AA 3FAKA 4QBFA 4N1AA 2BGUA 3OICA 4JUBA 1MABB 4GPD1 2Y1XA 4XQ9A 3M3PA 4EG0A 4W8OA 1L2TA 1KYXA 2WTAA 3I0MA 1IG3A 3RHZA 5M04A 4CIAA 4ME6A 3O4VA 3GEGA 4B3JA 2Y9PB 1I7SB 1H42A 2ZSHA 4MJ3A 1RKUA 3DTVB 3JCZA 4QRIA 2BONA 5EIFA 4AJ2A 3HKCB 3VR6H 1O54A 2BMEA 5JAOA 2I6QA 2ZS7A 3FH0A 4V3CA 2HR1A 5MHTA 2AJLI 2HMUA 5LLTA 1WVIA 5EXDA 4MQEB 4TLCA 1AC5A 1NDHA 2WAOA 3ZWMA 4DWOA 1QGYA 1CR6A 2VH1A 2W71A 3L01A 3ANYB 4HX9A 4A2CA 4LF5B 2OZKA 5J2TB 2EV9A 1Q0LA 3MBKA 5I3CA 3BL6A 5TQ2A 2VKTA 2JBWA 2EKDA 3CURA 5CIWA 3VX3A 4S04A 1E8DA 2FXVA 3RSQA 4FS3A 1IHOA 3B7PA 3L7IA 2BGWA 3W04A 3WYFA 3UFXB 3TX2A 1MHPA 2RAFA 1T8SA 1TX4B 1X14A 3RWOA 3I6IA 1GLGA 2X1VA 3Q7QA 3BGIA 1E58A 1ZU5A 3UAXA 5L7TA 1O96A 3S81A 1NU8A 3DR3A 5HK8A 1CEEA 4FT4A 3N2LA 4HFJA 3RTBA 4FJ1A 4HPXB 3WYAA 1OLUA 4XIGS 1IY1A 2MSDB 2AGVA 3P0FA 3FOFC 3C8HA 2VLBA 3N2GA 1IMOA 3VV3A 3U1VA 1Q74A 4IGIA 4JSRA 3E03A 4HVAA 2YJZA 1XTRA 2ZRJA 3OKCA 1Z0IA 3DTTA 1X0XA 3IUSA 1Z17A 3EHDA 3L2OB 5JVDA 1RJ9A 1OTYA 1Q7CA 1F2DA 1LBTA 3BWCA 3DT6A 4JOBA 4OB6A 4P6VF 4RF3A 3T0IA 3DVSX 3VR6A 4V1CB 1IXYA 5AIAA 4HTFB 4AF7A 4YJHA 2V3CC 5CFRA 5JQWA 1XD2B 1CY8A 2EJBA 3AJEA 2V7VA 4Q7EA 3G8BA 3BZUA 1L5HB 1JEEA 2JIZA 4FDMA 1K5HA 4OYLA 1XHLA 4HXFB 4ENUA 2CYAA 2NTEA 1T5IA 2Q46A 4KKVA 4ER3A 3CUSA 5BV8A 4QG3A 1MUUA 1IBKB 1P2DA 2FSIA 3FKSA 1F2UB 1B7GO 3C98A 1E59A 5H4GA 2FPKA 5NLLA 2VPYA 3VZPA 3L41A 1SBYA 5FFMA 2HIAA 2JIBA 1KMHB 2XEXA 3CSUA 1J8QA 1GFSA 3DBVO 2IXEA 2OB2A 4IJ6A 2J3EA 4YPOA 5K0JA 5KX5B 1JI0A 2YWGA 4YCAA 3CWZA 3DDUA 4LZJA 3GMSA 3OD5A 2FMUA 4NG4A 4LX0A 4Y2XA 3X1MA 4DR2B 1QYRA 1RKQA 2QKYA 3DE7X 2YCLA 4R01A 2JJ2A 1NM5C 1M2JA 2QPOA 1STOA 1E5TA 1KJZA 3DMRA 4OK3A 3I83A 1VKJA 1WLYA 3LL7A 4BEJA 2FAXA 4KPEC 3NHLA 4PLPA 5C7OO 5I4BA 1R4NB 1Y98A 1H3NA 3ANNA 3Q6IA 1EP2B 2VF7A 4X3PA 1TVKB 4C0SA 4FGKA 4WCFA 5DPMA 2IUUA 2V5AA 2PJZA 4EJSA 4EPRA 4L72A 1X2BA 4BFUA 3TQIA 2F9LA 4LV6A 4EHBA 1J21A 3QVWA 1O8BA 4LDPA 1DUSA 3AI1A 5DM4A 2FVXA 2GDJA 3Q10A 1IN5A 2CHEA 1PTKA 3O1JC 4CDNA 3LQ4A 4CKYA 3GI1A 2P3SA 1GP2A 4LBWA 2ZJ0A 3M3DA 3WRWA 3ZYZA 2J0VA 4A0QA 1ENPA 4TMKA 2WKQA 5H8WA 3H19A 4MW9A 4Z4CA 1PEAA 3PG5A 4YPVA 4JLSA 5CDHA 3UY4A 2WUEA 1JIJA 5MN5A 1WMDA 3AEUB 1KORA 4YCSA 1QX4A 3DT9A 2F67A 3QYJA 4UZSA 2WYHA 1DWQA 1ULHA 4NLLA 3TVTA 4F8EA 3L7OA 5CU7A 3FCCA 1U8EA 4MEBA 4QDUA 5DT9A 5JSQA 5U9CA 2NNLD 2EP5A 1MENA 1XDSA 3L79A 4MUNA 3BL5A 3ADBA 4V38A 4O0MA 1NVVQ 1UBRS 4WOJA 3O83A 5JZ9A 4IF6A 3G2HA 1YIOA 5CJJA 4B7UA 2YWHA 1X86B 3BWVA 4ZCTA 5AW8A 1ZM2A 4ID9A 1NY6A 4KJZA 1VE7A 3K30A 1T6XA 4FLFA 3TEJA 4CQMA 3ENQA 2P11A 2ZBQA 5B1SA 2OQ2A 5TRTA 2Q41A 3TQCA 1QLWA 1EZZA 4QX6A 2IU3A 3CV3A 2IWHA 2TMDA 2VJLA 1CDEA 1OZFA 2JARA 2NZVG 2X4DA 3N0XA 4M88A 4DJAA 2O8DA 4PR0A 2PKYX 4PCAA 3I9FA 3GVPA 3GWGA 5H0IA 3MT0A 5L7WA 3BD6A 1YC2A 1GGMA 4JX9A 3MHPA 4PIVA 4BB0A 4DLBA 4CLOB 3E0QA 3FTNA 3I0ZA 5LJLA 2ZBUA 3IXLA 3AVVA 4J0EA 2BJHA 1QVVA 2DCMA 3HUTA 3M89A 5F1PA 3FYTA 4A0HA 3C3KA 4C7BA 5DN6A 1KVUA 4HNVA 1JPVA 1O6ZA 3B20A 1R8JA 1SD2A 2GHIA 4YP7A 4AJIA 1W47A 1C30A 1YJXA 3HJFA 1X15A 3CEMA 1GL6A 3U4GA 4W7SA 1IOWA 4EYSA 3T1TA 1TZMA 4JJKA 1H8EA 1H2XA 3EISA 3PR2B 1RLTA 4NP6A 3TW4A 2VCYA 1NBIA 2IUTA 4N8SA 4AU1A 1P4HA 2FR1A 3UWDA 2IV2X