2I3DA

Crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
218
structure length
218
Chain Sequence
PEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Atu1826
publication title Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 71
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i3dA00
5KBYA 2WIJA 5AKYA 1CUJA 3FLAA 1L7RA 2G5PA 4DSAA 1EDBA 4S0XA 5AKLA 2WG0A 2XQFA 5JATA 3HI4A 1XRPA 1JT2A 2PM8A 1IZ8A 4X3CA 4AB1A 1TQHA 1USWA 3VVLA 4DMHA 5ALGA 2QOEA 1MJ5A 4PSUA 1XRRA 1AKNA 1U4NA 2HM7A 2I78A 3H19A 3B5EA 1R1DA 1AMNA 4Y2XA 4OU5A 4UFNA 4UPDA 2AJLI 3A2NA 3PFBA 4O08A 2ES4A 4H7EA 4YASA 2GZRA 4XVCA 5ALKA 1K8QA 2PUHA 4TGLA 1A8UA 1ZIXA 1W6RA 3BE8A 4B0OA 2UZ0A 3WIOA 1B41A 2YYSA 1R50A 1YAJA 4X71A 3AJAA 2GYVA 4DYHA 2WFZA 3PUIA 4N5IX 3FYUB 5AJHA 4MYSA 1BE0A 4ZXFA 1C7JA 1XQYA 2JEZA 1FFDA 1XZHA 5LZ7A 5AIAA 3F9CA 4FHZA 5D7BA 1QZ3A 3A2LA 5HFAA 4GECA 5AKKA 4B85A 2C5GA 4KJXA 3I6YA 2V98A 3R41A 1MO2A 3LS2A 4C4YA 1C4XA 1LPPA 4PW0A 1RP1A 3G9ZA 3QMVA 2ZVDA 3R3UA 1UWCA 3QM1A 3FBWA 3SX4A 1QIMA 4DLNA 1H2XA 4HRXA 1NU8A 2G4LA 3DL7A 2WU4A 1CVLA 4I3FA 5CMLA 5E4TA 2RIPA 1PJAA 2Z8ZA 3AIKA 5D6OA 1YAHA 4C87A 3I6MA 5AKXA 5EIHA 5LIPA 5ALQA 1DT5A 3U0VA 3B3QA 2HA7A 2XQKA 3WKBA 3PI6A 5J3JA 2BGRA 1ZI8A 4B7ZA 3QZUA 2QRUA 5SYNA 3I2IA 3FLBA 4J0HA 3B12A 4JNCA 3O0DA 3HEAA 4CI9A 5D3KA 2RHTA 4HTAA 4UHDA 3WJ1A 4LYDA 4LXGA 2RGUA 2JGMA 5LLSA 4GLBA 2B9VA 2H7YA 3WK6A 3DQZA 3F96A 1P0QA 4PV7A 3LIIA 2OCIA 1D07A 2WUDA 4KR0A 4WCVA 1CUVA 4EBBA 2WILA 4BTLA 1IMJA 7YASA 4YX9A 1UT6A 2Z8XA 5JYCA 4M0FA 1UK6A 5ESRA 1H2ZA 1K5PA 1E3QA 3DEAA 1EI9A 3GZJA 4H7FA 4U2BA 1EA5A 4OB6A 4YPVA 3C70A 4KAJA 5EHZA 5FDFA 1CQZA 3WQHA 2ZJ7A 4K5QA 1F0PA 1GPNA 4I4CA 3NGMA 1MNAA 3I2JA 1KU6A 1EHYA 5AK5A 1VZ2A 1H2WA 4BRZA 5LYYA 1U2EA 3UUEA 3VISA 2XUKA 3R40A 3FVRA 4XJVA 4B9EA 1JMKC 4BC0A 4L3WA 2V9ZA 4KACA 2DFPA 3AZOA 1EVEA 4UBKA 1ACJA 3M82A 1IUPA 2PKYX 3FVTA 5FXMA 2CMFA 4BVLA 1QO9A 4BAGA 4J7AA 3R3VA 1I6WA 3DJYA 4KEAA 5DJ5A 4NVRA 1HBJA 5DNVA 1W75A 1L7QA 1QONA 1UFOA 2E3JA 3FWHA 1BEEA 5K3AA 5JD4A 1R4ZA 3FYUA 3E4DA 1EB9A 2YH2A 4H77A 4RE6A 1RYYA 3WKCA 2QMQA 1CUBA 5JASA 2BKLA 3BDIA 4L0CA 2HHAA 4W9RA 1AX9A 2ZSHA 4EY8A 2DHDA 1E8NA 3C8HA 4UFOA 1UK8A 3HZOA 2HA4A 4AMYA 1AZWA 4UHHA 2XMGA 1SC9A 3DLTA 1OILA 2X8BA 3I2FA 5LP1A 2PBLA 5AK3A 5BOVA 4QDTA 3HRHA 2HA3A 4X6YA 4FFVA 3O4GA 3ZLTA 4GEGA 5DYTA 1WPXA 4EA6A 2BUCA 1FFEA 3OTQA 4Q05A 4X00A 4BDSA 4UHFA 4OYLA 3ZLVA 4B82A 5T4EA 2WJ3A 5AK6A 3F67A 1K6EA 4Y2JA 1QIDA 2WHPB 5HKBA 2JGIA 5CXUA 3LP5A 5EHQA 4ZRDA 3NUZA 1JKMA 3GFFA 2OQVA 5JIBA 1ORVA 2Y6VA 2GZSA 1DWPA 3H2JA 3QPCA 4BAZA 1P0IA 1CUZA 3G0DA 1BEZA 3WWEA 3I2KA 4B0PA 5CH8A 3VVMA 1XQWA 2OCKA 1VXOA 3DKKA 4J0JA 4OYYA 2FJ0A 5JD5A 1ZD5A 3OPMA 1E8DA 1XZMA 4GDMA 2RHWA 1DX4A 2X5XA 1ZD3A 5AHXA 4LXIA 3BXPA 3H2KA 5AOAA 3R3XA 2ACKA 4E46A 5CBKA 3ILSA 2BUBA 2WQZA 3ZV7A 3E1GA 3WKDA 3DNMA 2GBFA 2VJDA 4BZZA 3H04A 4HXFB 5EHNA 5A62A 2IIVA 1DINA 4UHEA 5LZ8A 1SCKA 5K5EA 1WB6A 1QIEA 5HF8A 1MPXA 3HXKA 4CCWA 3WKAA 1GQRA 4OD0A 5AM4A 4TVKA 5AIBA 4J0GA 2ZJ6A 1JU3A 1N1MA 1Y37A 3HC7A 5DTIA 2CB9A 1N5MA 4B84A 1Y7HA 3TEJA 3R0VA 3FCXA 3WJ2A 2AJDA 3A2MA 5I7UA 1LLFA 1MN6A 1J1IA 4DM7A 1OXMA 1CUUA 2Y6UA 3IBTA 3QYJA 4J0CA 5C8ZA 3W05A 5LZ4A 4N8EA 5HCUA 4GW3A 1WM1A 1GXSA 3D3NA 2P8SA 2IITA 3TJMA 2C4HA 1LPSA 1YR2A 1ZICA 2WTNA 3O9MA 4AZ0A 1CR6A 5LZ2A 2FJPA 1GPLA 4GI1A 5AKIA 3V1KA 1HQDA 2GYWA 3MUNA 3C43A 4M0MA 4FLFA 3GUUA 4EB0A 3W06A 3KOOA 2Z3WA 4H0CA 1J2EA 3JYHA 5FUMA 4BTVA 1TIBA 3CXUA 2VT6A 3SC2A 2OAGA 5BV7A 3WIBA 3D0KA 4JUIA 1FJ2A 4AN0A 2GBCA 1UOPA 4MEBA 5ALLA 4X95A 2CUTA 4G4GA 4CFSA 2PUJA 3G0IA 3GROA 4P92A 4XWGA 3IUNA 3HSSA 3ESCA 1XFDA 4UBLA 2XLBA 5A7GA 4A5SA 1WPRA 3KSRA 2O7VA 1LPMA 4Q1VA 4ETWA 3G9TA 1QIHA 4WFKA 1CLEA 4CIBA 2WHPA 3WK8A 3G02A 4F5ZA 1N5RA 5C7YA 3CN9A 3STXA 1FSSA 5IVDA 3PDCA 3Q8WA 4QNNA 5AICA 2QXUA 3IUJA 4MYDA 2XUPA 3C6XA 2BAGA 4Y7DA 3RK4A 3ESBA 3FAKA 1CRLA 4PSCA 1CIJA 3R3YA 3O9VA 4H18A 4DIUA 3EIOA 4AO7A 3HYSA 4IH9A 4OUKX 1NU6A 3ICWA 3D59A 4PF1A 5EIAA 1YSCA 1LPAB 5HFNA 4M0EA 4DTCA 2O2HA 2WUEA 1X2EA 2D0DA 2XQIA 1VXRA 5JADA 1XZJA 4N8SA 2ZSIA 2I3ZA 3IURA 3G0CA 4CG1A 4HS9A 2WFLB 3E3AA 1GPKA 5JALA 1QIIA 1XKTA 5KWIA 4C01A 4LHEA 5AP9A 4IH4A 2V97A 1E5TA 3AILA 4BC1A 3FSGD 2QUAA 5CT9A 3PF9A 2BUAA 1BN6A 4Q3LA 4BE4A 2HIHA 2Y2UA 3QPAA 4C4ZA 2HU7A 3BDVA 1YA4A 5EGNA 5AOCA 3WL6A 3PUHA 4G8BA 4CCYA 3N2ZB 3C8DA 2X76A 2Y2VA 1R9NA 1MNQA 3H17A 5FRDA 3V9AA 5CRIA 4MEAA 4G9GA 4QA9A 1CUHA 5K3CA 3STVA 1A7UA 4NMWA 4WFJA 1Q84A 5HK8A 3DCNA 5ALSA 5C8XA 4Q82A 1M33A 2XT0A 3O4HA 1QGED 4DSZA 3GELA 5CH3A 3H1AA 2VJAA 2VSQA 4BRSA 4BE9A 2V96A 3V1MA 5DLPA 3M81A 1OCEA 2EDAA 1QLWA 5IVKA 2HFKA 5ALRA 2XLCA 2XMQA 3OOSA 1CUDA 4AO6A 2PU5A 1CUGA 1ODTC 2XUJA 3SWWA 4FDMA 4EY5A 4KE7A 1QIGA 4AQDA 4GHWA 3C45A 5ALUA 2LIPA 1VLQA 3H18A 3FYTA 2YXPX 4DNPA 2QJRA 5EIEA 1ACLA 2WIKA 1ZOIA 4FLMA 1MAAA 3EQ8A 2QXTA 3VJKA 1JU4A 1MX9A 1LZLA 3BIWA 5CT6A 4AXBA 2H9YA 3HLKA 4FOLA 4BB0A 2O7RA 2WSLA 3WK4A 5EFZA 1AURA 2PSEA 4E14A 3ICVA 4RPCA 3AUKA 5HF6A 3ANSA 4U2EA 5EHXA 4J3JA 4WDRA 1CEXA 4ROTA 3F97A 4FMPA 4G8DA 4IH1A 2ZJFA 1ZIYA 2ONCA 1Q0RA 1WOMA 3H2HA 2CBGA 4HAIA 5JANA 2J3DA 3FOBA 4E15A 3W2TA 1CUFA 4FLEA 4OSEA 5FKJA 2QKYA 1DTEA 4MJ3A 1DU4A 1MX1A 3TRDA 2VAXA 3G7NA 1DQZA 2QUBA 3T52A 2HA6A 4BATA 1IUOA 1EK2A 4NS4A 1BU8A 3QPDA 5JAHA 3QMWA 4ITVA 2FX5A 3NWOA 3Q0TA 2BFNA 2WFLA 2YASA 4BP8A 3H2GA 4KE6A 1XZKA 4X97A 5I8PA 1J07A 4MWSA 5HF5A 4U2GA 1TCBA 4BP9A 2HA5A 2RONA 3O4IA 3JW8A 4W1QA 2PL5A 1HPLA 2PSJA 1F0NA 5H3HA 2Y1KA 1ZI6A 4OCZA 2WKWA 4C4XA 3KDAA 1JFRA 1DWOA 5AKZA 4H7JA 3RLIA 4QEKA 5T4FA 5SYMA 4H35A 1QO7A 4FNGA 4X94A 3WMRA 4DNFA 3L1JA 4EHBA 1MU0A 1H23A 1FFCA 2PX6A 3D5EA 1EVQA 4FBLA 2WM2A 2WIDA 2VJCA 3S2ZA 5AI4A 2HFJA 1ISPA 3D2BA 4L9AA 2OG1A 2OAEA 2XE4A 4C89A 3WWCA 1GQSA 1MT3A 3BWXA 4N5HX 1H2YA 2XMCA 5JD6A 4JYPA 2ZYIA 4EY4A 2VF2A 2XUQA 3NOXA 5AK4A 3RM3A 1TK3A 1YS2X 5ALFA 3EQ9A 4BVKA 1A8SA 3G0BA 3STUA 3WKEA 5ALTA 2XDWA 4W1RA 4BZWA 1LPBB 2DSNA 4CIAA 1N8SA 3LCRA 1K4YA 2VQ6A 1MTZA 1ZGBA 5AM2A 1CQWA 1F8UA 2O2IA 4V2IA 4A23A 1EDDA 1ZD4A 3HJUA 1BS9A 4NZZA 1VKHA 4FBMA 4X91A 4AO8A 4K6KA 4EZIA 3VJLA 4U2DA 3WA7A 5JAUA 1XZDA 3CCBA 2OCGA 4EY7A 3A70A 4J0DA 2G5TA 1QIJA 3DOHA 1XZBA 5E4JA 2I03A 1YCDA 3IULA 4B83A 5AM5A 1F6WA 3BJMA 5KREA 1UKAA 3AFIA 2HU5A 1BROA 2WUGA 1XKLA 2OGSA 2HRRA 4ZWNA 3BIXA 4OB7A 4BCCA 4KE8A 4BCDA 5I9IA 3QMMA 3HACA 2JGLA 3DKRA 2XQGA 2Z5GA 2JEYA 4PNZA 3N0TA 2OLEA 2W6CX 4JEIA 3QBJA 4KRXA 4INZA 1X2BA 1XQXA 4JH0A 1EH5A 3ZLUA 1BCSA 1K63A 1NX9A 5DYWA 4UBIA 4B81A 3STTA 2ZYHA 2JGFA 3PFCA 1R3DA 4Q3OA 2ORYA 1XROA 4AN1A 1XZAA 2HADA 4B80A 4HXGA 4CG2A 3KD2A 3GBSA 4CCYB 1XRMA 2XB6A 2DHCA 1VA4A 3C87A 2EEPA 4FTWA 3H2IA 4H7IA 5JZ9A 2XMRA 3WLAA 4QLOA 3YASA 4AX4A 4H7DA 4XX1A 1FFAA 2WUFA 3DYVA 5ALJA 1G42A 3LIPA 2DQYA 1MX5A 4UUQA 4Z49A 1ORWA 2B61A 1T4MA 1ZI9A 3WL5A 3WWPA 3T4UA 2WFMA 1ZJ5A 5AKHA 2PSDA 5C8VA 2C58A 3H0CA 2H1IA 3UUFA 1LZKA 4ZGBA 3KWFA 4F21A 3FLEA 4QE3A 2PSFA 1WB5A 2HA0A 1CV2A 3VJMA 4F60A 3R3WA 4LXHA 2CEKA 4PO3X 1VE7A 4Y2QA 5K3EA 1W1IA 4DMFA 1QTRA 2B4KA 3ESAA 1R9MA 2AJ8A 2DR0A 3ANTA 5FP0A 1UKBA 4QDZA 4ZV7A 1HDEA 1JI3A 2QVBA 2BJHA 4K2AA 4PSDA 3D4LA 1CUWA 4I19A 2HL6A 1EDEA 5ALPA 3S8YA 4K6GA 1MAHA 2C5FA 1G66A 2XQJA 3C5VA 3BJRA 4N8DA 1C7IA 1QFMA 1CUAA 2VJBA 1JMYA 2O2GA 3FNBA 3HABA 4KAAA 3W9UA 1BRTA 4DMCA 4K6HA 1QIFA 4WDQA 5D3ZA 3V48A 3L1HA 3STYA 4LYEA 4KAFA 1E89A 1XZIA 4QWMA 1XZFA 2C0PA 1P0MA 4Q34A 5JAOA 3WWOA 3IUQA 5AI0A 1TKRA 4B9AA 1ZD2P 3WYNA 3OC0A 4BDTA 1FFBA 4BYMA 5HF9A 1WHSA 2CKMA 2WLSA 2XMZA 3AIMA 2IX9A 3PF8A 5A2GA 3I1IA 1RWQA 4RNCA 3M83A 1T2NA 5ALHA 5HQ3B 3FCYA 3AINA 1HLGA 3IUMA 3ZI7A 1W76A 3E0XA 4X85A 2K2QB 2WG2A 2C7BA 2NW6A 1SOMA 2HU8A 3O4JA 5AH0A 3D2AA 4MXDA 5IVIA 5ISMA 4X93A 3C6YA 2GYUA 5AI9A 3WK5A 1DX6A 5K3FA 2H7XA 1WCYA 3G8YA 2VEOA 3AIOA 4Y2PA 4J03A 2VA9A 4OB8A 3I2GA 1CPYA 2HRQA 3I2HA 4G9EA 4WY8A 3WL8A 1IZ7A 3G0GA 2OPHA 1LPOA 1R88A 2ZYSA 2QTBA 1QE3A 5E2IA 1WB4A 3K6KA 5CH5A 1XLUA 1S8OA 4Y2SA 1VA5A 2PSHA 5LZ5A 3A6ZA 4J0IA 2D5LA 4AMZA 1ODCA 1LNSA 4IO0A 1SCQA 5AKGA 5IKXA 1UOOA 1YB6A 4E11A 1O6FA 1YA8A 4FWBA 3V1NA 3BF7A 1TAHA 2XI4A 2QZPA 4BBZA 1AUOA 3AZQA 4P9NA 4FKBA 5DTJA 4HRYA 1ZJ4A 4GWLA 5JAPA 3X3HA 1H22A 5AI5A 5BWCA 3QH4A 1THTA 5AM0A 3VDXA 4B6GA 2I3DA 3RARA 4Y2YA 2CJPA 1JJIA 2OXEA 5DWDA 1DWQA 4Y2VA 1KU0A 4G1FA 4GBGA 5E4YA 4TPKA 4QDOA 3DD5A 3AZPA 3G9XA 2ZYRA 5ALVA 5ALEA 1VE6A 3LLCA 4WJLA 4GXNA 5FPPA 5AM3A 2XMSA 2QS9A 3VKFA 2B20A 2DCMA 2VAVA 2Z3ZA 4OU4A 3M3DA 1XZCA 3TGLA 2VATA 4UBJA 4EY6A 1EXWA 2CZQA 4X92A 1ODSA 1XLWA 1TCAA 4MQLA 4P08A 3EQ7A 3EF3A 2ROQA 3ED1A 4P93A 2JF0A 1AC5A 4A16A 2JGJA 1CUSA 5CW2A 6YASA 1TCCA 5LKAA 5A71A 2DHEA 3L1IA 5FPQA 4RGYA 1Z68A 1TRHA 5FOQA 1X70A 4HVTA 2QM0A 3C5WP 1W4LA 3WK9A 2J3QA 1HKHA 1PV1A 4JYMA 5JZBA 2AJBA 1CFJA 5IH7A 1JJFA 1E8MA 2R11A 1AQLA 3P2MA 2XUAA 3K2IA 3RKSA 3BF8A 1QJ4A 4D9JA 3MUOA 1THGA 2WJ4A 5CXXA 4MQMA 2WIGA 5ALXA 3WZMA 2WHRA 1VOTA 5AI6A 4ARAA 5HQ3A 4Y2TA 3WK7A 1GGVA 3KWJA 4MWTA 1VZ3A 4UFPA 3ESDA 3IVMA 4YK7A 1XRNA 1LBSA 2FUKA 4Y9SA 3GA7A 1LPNA 1QFSA 2G63A 2BGNA 2XMDA 2WIFA 2HDWA 5ALDA 2AXEA 1CUEA 3G9UA 1XZEA 1YS1X 4FFWA 1W52X 4L72A 1GT6A 3UMJA 2JGEA 3OG9A 5CTAA 5CURA 2JGKA 4IHAA 4Q3KA 3ZWQA 1ZGCA 5F4ZA 2RI6A 3BL8A 4X6UA 4U2CA 3IIIA 3W04A 3W9BA 4EUSA 2Q0XA 1CUCA 2RAUA 4Y2RA 4DNQA 2WU3A 2VT7A 3SK0A 4H7KA 5DNUA 1PFQA 5A7FA 4ARBA 2VTVA 1YASA 3WI7A 3OM8A 1QIKA 1GZ7A 3IDAA 5HKAA 4FNMA 4IQ4A 4F0JA 3WWDA 3KXPA 3I1YA 3VXKA 5IVHA 5CT4A 5K3DA 2WJ6A 5AOBA 4C6HA 3QVMA 5K3BA 1Y7IA 4UHCA 1IUNA 5BWBA 3DOIA 5JZSA 3F8SA 3FYUC 3F98A 5T4BA 3C6ZA 1UZAA 1B6GA 1SFRA 3OURA 2XUGA 1J06A 4AZ3A 1XRQA 3IB3A 5ALZA 1U8EA 1XZGA 5HK9A 1XRLA 1QOZA 4HZGA 2WTMA 3MGAA 4G4JA 4UHBA 4BAUA 1EX9A 2JIDA 1WHTA 4DMKA 2C0QA 4LIPD 4DGQA 1LBTA 4G8CA 5YASA 5KWJA 4C88A 2ECFA 3DDUA 1XLVA 1UOQA 3QITA 1U65A 4UBNA 1LGYA 1EK1A 4KYVA 3PE6A 1GKKA 3CCCA 5ALOA 2DQZA 1A88A 5AI8A 4RE5A 4BVJA 1AGYA 4ZI5A 4KE9A 4X90A 4ZREA 4QDUA 5ALMA 1DQYA 3V1LA 5LKRA 2XMBA 2ACEA 1GKLA 3R3ZA 5ALYA 2BCEA 2QR5A 3JWEA 1G4HA 3STWA 3PICA 5AM1A 4OPMA 5ALWA 3WYDA 1BN7A 5CT8A 5CT5A 3CN7A 5ALIA 5K3FB 4H7HA 1Q0ZA 3I6ZA 3IA2A 5DNWA 5ALNA 1UK9A 2WHQA 5FLKA 3FSGA 4J0KA 4WFIA 2GBGA 4UBOA 1BCRA 2XUIA 1P0PA 1ETHA 5FV4A 1UKCA 2XUHA 3WL7A 3H1BA 2HA2A 3D7RA 2OCLA 1HL7A 3DL4A 5T4HA 1VJ5A 2OGZA 3O95A 2AJCA 4UBMA 3I28A 3WZLA 4QLAA 5EI5A 2WG1A 1SCIA 5DYYA 4QDXA 4X6XA 4CG3A 5HZGA 4HXEB 1EB8A 4DNOA 1O6GA 1CUXA 3MVEA 5C81A 2XUFA 2EDCA 2PVSA 4Y2UA 4KRYA 1CUIA 2GBIA 1A8QA 5A6VA 3DYIA 5AKEA 1UXOA 4G4IA 2J4FA 3D2CA 2QT9A 2J4CA 3U1TA 2XUOA 1L7AA 5AO9A 4QWWA 2OGTA 4G5XA 2R8BA 1G5FA 1DT3A 1EINA 3EBLA 1XQVA 1JJBA 4U2FA 4W63A 2H7CA 1E66A 1KEZA 1XZLA 3K9BA 4XIIA 1Q83A 3WA6A 4PQEA 4X7BA 5LZ9A 5A7HA 4WY5A 1IVYA 5AKJA 1UK7A 2W22A 4W1SA 2XUDA 2QJWA 1YB7A 3C6BA 2PU7A 1CUYA 5JARA 2JBWA 2OQIA 4ZV9A 4LKOA 4QZVA 4BCBA 4W1PA 1QTIA 2PPLA 3ZPXA 3DS8A
chains in the Genus database with same CATH superfamily
4B34A 5EE9A 3IVCA 4N0QA 4M9RA 4PSKA 2VYFA 1ZR2A 1CUJA 3DTNA 4IDCA 3TQSA 4O2BB 1RQPA 4W4TA 3PGMA 1XZQA 2W2QA 4R0MA 2X8WA 1U0GA 2G5PA 1LK5A 1T43A 2JJQA 1QRAA 1DG9A 3UGQA 4GD3Q 1BC5A 3DW1X 2ZPAA 3QK7A 1GAEO 1N6RA 4LJ9A 5HIJA 3ZCPA 4H1UA 2MSEB 1QUEA 3MFQA 4V0OA 5BR7A 3K32A 4MWDA 3IBYA 5LJLA 2L19A 3RVRA 4IAOA 4O4LF 4X3CA 1TQHA 1A9XA 1ECLA 1EWVA 4EG4A 3IELA 4MR8A 1SD2A 4K88A 5ALGA 1U3UA 1ZXBA 4PSUA 1G1AA 2C82A 4Q6WA 1GKIA 5D3QA 4KKVA 3TYXA 3ZHYA 4D02A 1KDOA 1C3XA 1LDGA 1LS1A 1SHZA 2GDJA 1U4NA 3JU3A 3LBIA 2J6CA 4XI9A 3W8DA 2HN9A 5KMGA 1CE8B 1ZRHA 3LXRA 5D51S 3H5NA 4ME6A 3DFZA 4Y2XA 1AMNA 2PRIA 1Y3HA 1V4VA 2TMGA 3L05A 4GKBA 3HYNA 4TKUB 1CRQA 1MZVA 4C0AC 1C30B 2M6SA 2OCYC 3ZXXA 2HPVA 1BW9A 2QX9A 4CLDA 1DPFA 4LF4B 2D0PB 5LD2B 3FJOA 2QX7A 3FTDA 5B1SA 3B78A 3KV3O 1V2HE 4BQPA 1FNSA 5CBPA 4P80A 1E9AA 1UWVA 1VKRA 4QGHA 2X77A 3E2IA 5KI6A 3W8RA 3EPJA 2XD9A 2NU6B 3N3AC 3AF3A 1FDVA 3GXOA 3RODA 2PUHA 1PX2A 1DXYA 2PVCA 4LHXA 4O5AA 4TVOA 4EMUA 9MHTA 4P5DA 1W6RA 3TD9A 3EXG1 4G84A 2K7FA 2MWMA 4S1PA 3WRXA 4IWXA 3RDPA 3AVYA 4YAGA 2ZB7A 1WIWA 2A5DA 1BXGA 1NV9A 1ZHHA 3LSYA 3TLYA 1R50A 3OWHA 1YAJA 3AY7A 1EGAA 4HGZA 4WCDA 3WGJA 5LNK6 4X71A 2QNBA 3FI9A 1T1SA 4F12A 4RYDA 4NP6A 3E9ZA 4LXQA 5GTDA 3ELWA 5KTNA 4BMZA 4CHTA 1H0RA 4ER0A 3A6LA 2YVUA 1U2SA 1JRLA 2B0CA 1C0IA 3VDQA 4EJSA 3OTWA 4TT3A 3FYUB 5AJHA 4YP7A 4F2PA 1TQ4A 2HK8A 3RC2A 4CM3A 2I7XA 3FZQA 4IIEA 1IZYA 1JXMA 3GR6A 3LWBA 3RJ5A 1NY5A 2JHFA 1JEDA 2Z58A 2REXB 3KRTA 4G56A 1V8OA 4GC5A 4ZHQB 1IBLB 2BTOA 3GJXC 1GADO 1SN7A 4I50A 4PGMA 5KOHA 1Z56C 2YJZA 1W5AA 2AC7A 3BRCA 4Z3OA 2F59A 2WSYB 5L4NA 1TT7A 3JV7A 3A6PC 1H8EA 2R1TB 5JAZA 1KKUA 4KDFA 3FPEA 2Q4DA 1IRXA 2FSVC 3GLQA 3M6XA 4XASA 1MXHA 2R44A 1T4BA 1MDFA 5AKKA 1T9GR 1U0EA 4KJXA 2ZRFA 2EHDA 3U5ZB 2FHSA 2ZREA 4ZU1X 1YI0A 3LT5A 4KN6A 1EUCB 4JZKA 1O6BA 2E4VA 1MO2A 4H4EA 3VSBA 3DLHA 2BP7A 1YR1A 3NT2A 1PJBA 2R96A 3ZH9B 2JFHA 4PW0A 3QMVA 3QW4B 5D6NA 2COEA 2G82A 3HB5X 4ZCPA 5CFNA 1ODLA 3VHQA 1SUWA 1AKWA 1N7HA 3WWZA 1K0UA 1MHPA 1UWCA 2R6AA 3SX4A 5JHGB 1KSFX 1PNTA 3DOOA 4DLNA 1H2XA 3L6BA 2AGVA 5IWCA 3NI2A 4HRXA 1RBQA 3ECSA 4FMCB 4M60A 4HWKA 1WMEA 4U39A 1VJTA 4RIEA 3ZWDA 1E69A 2FR0A 3WBFA 1PR3A 5T64A 2CYCA 3GJSA 1J70A 3ZGNA 4I3FA 2H2FA 4LYYA 3B85A 2CL5A 4R1MA 3AIKA 1PJAA 1XPUA 4OAPA 4R2XA 5D6OA 5K6RA 4JNKA 1S2DA 3I6MA 3D54D 3DE0X 4R40A 4WOKA 3MB8A 3T9BA 2I4NA 5E1MA 3TRIA 1OXKB 1PLKA 3TZEA 2X2OA 1GAWA 3LUHA 3M0EA 4DR2B 1J0BA 3LQ1A 1E9BA 2XQKA 2H16A 4RJLA 4LDPA 3UB3A 3UEOA 3U5TA 3QEAZ 3CEMA 5K0JA 2HQ1A 1D3AA 3ZBUA 2DHQA 4C1NA 1VL0A 4XX0B 2EG9A 5D1HA 2ZUFA 4OLHA 1MV8A 1RZRD 4DXHA 1YF3A 3ZHSA 1QTNA 4MIKA 1VM6A 5BN1A 2ZZNA 2FLWA 2QRUA 4HDOB 2QG4A 3QY0A 1G8PA 4O0LA 4WECA 4MS4A 5CVTA 3IR5A 3KHSA 3FPBA 3GGGA 1YFJA 3CWZA 2WYVA 1Y98A 2G1KA 1FL9A 1G18A 4TLAA 4FYVA 4DC0A 1D1TA 4ALJA 3FGZA 4TYWA 4BNFA 2QTCA 4R01A 2W70A 3ET5A 3EG9B 4MMXB 2Z43A 4MUNA 1UAAA 2DBVO 3FFTA 1U2PA 3PBKA 5NLLA 1SB8A 2JIMA 3INTA 3AH8A 4D4HA 2QGZA 3GCDA 3IQWA 2XYGA 2EJTA 1TU4A 4LHVA 3WJ1A 5EP3A 3R5SA 4PLPA 1S2IA 2B5WA 2R1VB 3FKSD 4NFYA 5FULA 3HDQA 2RGUA 3C3BA 2OBNA 2Q9AA 2ID9A 3GMIA 2C9BA 3GUZA 3HB1A 2BONA 1F4VA 3CH4B 4JOQA 4DLAA 1U8FO 2LKDA 2VF4X 4BUZA 1FVXA 1GGFA 1U2DC 3ADOA 1C8LA 3KR1A 3WK6A 3UK0A 5ITWA 4KR7A 2PBRA 3GLKA 4PV7A 3OE5A 4N01A 1KPHA 2QD5A 1CUVA 1E32A 4EBBA 1C4KA 2WILA 4GVXA 1P1HA 1TM2A 1YB4A 2WF9A 3HA5A 4QUHA 3AG5A 1YJQA 1UT6A 3ZV5A 3WAGA 3GLIB 3E48A 1IL0A 1K88A 3UJBA 3W0LB 2FN7A 2WM3A 4M0FA 4OKIA 3PXBA 4YREA 4JI7B 1B23P 1H2ZA 1VJGA 1DC6A 1FNDA 2RG7A 1L7MA 2IUFA 2XGJA 1K5PA 1VMAA 2OB2A 2WYOA 1BE8A 4BJ6A 1E3QA 1U5BA 1H4VB 2WUVA 3O03A 4Q6BA 3GFSA 4H7FA 4U2KA 2G4VA 4U2BA 1Z0FA 4LVUA 4NJEB 1EA5A 1DC8A 1L4GA 1SK9A 2Q0HA 1PYOA 2XXJA 1OX4B 2ZTMA 3OM9A 3QOWA 4KAJA 2QIOA 1H1LB 1P8AA 2YHIB 3FFXA 2CGEA 4IFBA 2A9FA 4UNQA 2IYPA 2PEYA 2GR9A 2VEDA 1ENOA 3TR0A 4N03A 1ESCA 2BW0A 1RWXA 4K5QA 4ND5A 3WQHA 2A92A 1O0CA 4C6TA 1WKVA 3AFOA 5A0TA 1QH1B 2YV2A 2HTFA 2JGAA 1C7FA 3TW8A 3I2JA 1JZSA 1KU6A 1X77A 2EW8A 2V8BA 4IZOA 4IIHA 3EXEA 4QICA 5AK5A 2CEAA 3OLXA 1NF8A 1CQXA 3DOCA 3RRYA 1H2WA 2M9MA 3OTGA 3WIVA 2TS1A 4CM9D 1O95A 1X80A 1JR6A 4HLUA 1U2EA 1W25A 1KVTA 3EQZA 3UUEA 4BFXA 5IWAB 3T5PA 1LTHR 3R40A 1WSAA 1N5JA 3FVRA 3P9KA 5LDHA 1TK2A 5BW5A 1JQ5A 3CUTA 2Q9CA 2RKOA 1SD1A 4YO7A 3RKRA 2AHRA 4GAEA 1WMSA 2Y1CA 4L3WA 4N47A 2FSGA 4PYOA 3UWOA 3VZBA 2XB8A 4JGIA 2IP4A 2C84A 2JAQA 1QPBA 4XIJA 4MV0A 2REQB 5K20A 1UH5A 4OXKA 3V4FA 4P6VF 4H27A 1EVEA 2P1ZA 1ACJA 1B8VA 3M82A 1IUPA 1PZXA 3NS7A 4PICA 4ZRNA 5FXMA 4FILA 4QVIA 2O1WA 4NATA 3OCUA 2FZEA 1WQ4A 3AJ9A 3KHUA 3PQ3A 1W88B 2CNKA 3L7IA 1GU7A 2GK6A 2YICA 3HKCA 4KBGA 2GPWA 3C1TA 2LVBA 5ANRB 1V5IA 4IZIA 2FMXA 5CA0F 2WQ6A 4JA0A 1GT91 2YCBA 4NESA 2CDBA 1GXSB 4J4HA 1RXVA 3H5TA 3U9SA 2O8FB 2BFBA 3C3MA 4R2MA 3KEOA 4J6FA 2A9PA 1NBEA 1C9KA 3WADA 1HSZA 1VHWA 3OPYB 5C80A 1IG3A 4FZ3A 4EEKA 2FQXA 3KEMA 3KQKA 4XXHA 3B51X 4KQJA 2R1ZA 1V8PA 2YZ2A 1JKJA 2ZI7A 1P17A 4PC1A 1U6IA 3HY6A 3ABRB 3KV1A 8GPBA 1OT3A 5JNUA 4ZA2A 3CY6A 3R0XA 2JIRA 3QHQA 5DM2A 1U1FA 4JUCA 1DQNA 1KJJA 3K6JA 3UMSA 4TV9B 4N9WA 4B6RA 1TPZA 5GOTA 1IJBA 1NVTA 3K20A 4EHHA 2X3UA 1JDZA 1NJ8A 1OI2A 2H2AA 2HHLA 4J16A 4M0CA 3ZU2A 3PC8A 3QJYA 1HYEA 5EXTA 2QMQA 1SUBA 3LT1A 3MS7A 4HP8A 2IUTA 1CXZA 3UW1A 3OJ0A 2V0NA 1I3CA 4Q9LA 1XNGA 1HL3A 4RQUA 1A9OA 1PK8A 3BDIA 1EX1A 1QU3A 2G08A 4NCIA 2VUHB 3Q6IA 2JZCA 5A03A 1RTTA 4ZQHA 2BZ0A 2ZSHA 4MCJA 3DEZA 4UMDA 2NUAB 3CTMA 3M4ZA 1GHTA 1Q7RA 3DDOA 1F3OA 4KBYA 1K8ZB 3QBDA 2BKVA 2Z6AA 1TDJA 5L6LB 1N32B 3PC4A 5AVOA 1YCGA 4UFOA 1JDUA 2OFOA 3HZOA 4JLPA 3C3CA 4BBJA 5FX2A 1L8OA 3OIWA 4LXYA 1YD7A 3TI9A 1FRFS 3QV2A 3UHPA 1PNVA 1BH2A 1JHDA 4UHHA 1EGVB 2B1IA 2MR5A 3DAHA 4Q24A 4QHYA 4PCLA 1YRQA 2VNIA 3ZY5A 4C7BA 4QM7A 3ZDAA 1MEEA 1F20A 4FZVA 3RTAA 3W2IA 2OZPA 2GEBA 5BQ3A 1P5ZB 2PBLA 5BPFA 2WMNB 5BOVA 1YVUA 3PFNA 4QDTA 5TF0A 1QGUA 5J1SB 3UB2A 2IFTA 3M1IA 4UUAA 1P1KA 4EW2A 1X94A 1Y4DE 2VLIA 1YGPA 2IYXA 1Y8RA 3DLCA 3R74A 3U80A 5FBQB 4AY4A 4H0FA 1PEDA 2GJ8A 4HLCA 4E0BA 2D5CA 2LDBA 3EY9A 3PV0A 3UQZA 1G8FA 2ZTLA 1WPXA 1G8KA 4OM7A 3GLTA 4EA6A 4A0FA 1P4JA 1GNRA 4TS3A 1BE1A 1FFEA 2ENWA 3DDHA 3K9GA 2IYOA 4X00A 1RQRA 1QYVA 1CD5A 2HZBA 4HZUB 4BWVA 3FOEC 4BDSA 4UHFA 1P7VA 4FHGA 3U3JA 4AULA 3TRHA 1Z5WA 3U3OA 3MG9A 3GMSA 2CFIA 2N1MA 2PO5A 1K06A 4D5GA 3IRVA 3UQYS 3QI7A 1XTSA 5I7HA 3THXB 3I04M 1KNXA 4QBFA 4ZVUA 1FRNA 3B8EA 4Z2AA 4PX2A 4K9DA 1E3DA 3R7AA 1J09A 1XTZA 4EQ6B 2Y9PB 3M6AA 1DFHA 2QPTA 2W6NA 3T3EA 2ZBDA 1U99A 5JJ5A 1JDNA 1OZ0A 1G8SA 4XUDA 3RUIA 3T15A 1VB3A 2Q2WA 2IU0A 4N4AA 2OQVA 5EHIA 5CW1A 2DZDA 1GTZA 3HP4A 5JIBA 3RUHA 1XL1A 4MI1A 1V6AA 2KSQA 4MS1B 4WCFB 5F5NA 4B48A 4UQLA 2GZSA 4FSDA 4W7IA 3TIXB 4OI4A 1FTWA 1OFUA 2ZB4A 2GA9A 2QMOA 4BAZA 1CUZA 2ZJ1A 1BEZA 3X2EA 4P7JA 3DPIA 2A3NA 1FVHA 3BN3A 2CN1A 3HB0A 4GLOA 5K0LA 3WWEA 4ETNA 4QYMA 3FHLA 5A9TA 3OX2A 5L3RA 1JT9A 1FLDA 1HDXA 1XQWA 3ACCA 5DKFA 3DKKA 3R6DA 1SC4A 1GG2A 3IMFA 3DZHA 1T1JA 1R0XA 1IXSB 1E8DA 3FN4A 3HADA 2RHWA 4IDAA 4D8TA 2Q0QA 2O5EA 4CMHA 5FNVA 4GOOD 4IV8A 4XFDA 1F6BA 5FUYA 2YYAA 1ZD3A 2QLNA 4TZKA 3MEQA 1QCDA 1WP4A 1YBVA 2A88A 2R87A 2GAFA 5LDGA 3UIEA 3WIEA 4B33A 1J90A 4Y30A 5HVNA 2B35A 3U61B 1SUDA 2QUZA 3H2KA 1R16A 3L8DA 5AOAA 3UAXA 1GPH1 4BNDA 2CSXA 2G76A 3UKOA 1ZBDA 4LWQA 1E96A 1DIGA 3TD6A 3ILSA 2B6HA 3K0AB 3TXAA 3ZK9A 1T3LA 2BUBA 5JPCA 1WUKS 3L7JA 4DLBA 5FEUA 4I55B 3EF0A 4MVWA 4IMJB 3MWFA 5K3OA 4IUDS 3VR6A 1NE7A 2VPQA 1ZGAA 2NZYA 3KE9A 1M5RA 3IT2A 2WJJA 3EEYA 4XKJA 5EHNA 5A62A 1OA0A 3ND8A 2D6FA 5CD9A 3TBFA 1XELA 4GOMD 1ZUHA 4YAOA 1CY6A 2PD6A 2ZE5A 3QRWA 4LE2A 1UPBA 4XW2A 4DSTA 4HVCA 2AEMA 3QPBA 5ITVA 4KQGA 2VLBA 3Q6MA 3QHPA 3UYKA 5T6MA 1NMSA 3I09A 4Z8XA 4YRNA 1GQRA 3CB2A 3FMPB 1O4WA 2VXYA 1GZVA 3MWEB 1N5LA 1NFRA 5DASA 1AKTA 4I6GA 2NO6A 2ZJ6A 3R7LA 2JI6A 5E6RB 1Y37A 5DULA 5TQ0B 2CB9A 3VOAA 4H1WA 1VL8A 4HAWA 1D2GA 1EWRA 1GLNA 1S2MA 1Y7HA 1LBQA 3A4YA 2KB0A 3R0VA 2YW9A 4YYEA 2W6QA 3D3WB 1QRUA 1ZNYA 3FCXA 1Z22A 4DEXA 4MCIA 4XWWA 2Q1WA 2QQ5A 3DZ8A 4DTIA 3KJZA 4TMWA 1UPAA 3V8QA 4YPOA 1U8AA 5JT1A 3UJ9A 1R4NB 4TUYA 1LLFA 2W2NA 2C3OA 4M9UA 4IQFA 1S0UA 3KAKA 2AUNA 2R65A 2CB0A 1KKLA 3WNVA 3RI3A 2FDRA 3PD0A 3B9BA 4Q1BA 5JQWA 2W6ZA 1Z37A 1NBAA 4RD1A 1PUIA 1FXWF 5EIBC 4HH0A 5L3SA 4PR3A 3VMMA 3I3OA 5IRCD 1M1YB 5F3RA 4YONB 5CYOA 4P3KA 2K2WA 2W2VA 1GQ2A 3QY9A 4BEVA 4C2AA 3NWJA 4FKBA 4GW3A 3OTIA 5IMSA 2P8SA 1QF7A 5DXFA 3DDNA 4W7SA 2OA0A 2IC5A 4QQ8A 3IHWA 4V02A 2IITA 2VDNB 4RWZA 4A92A 4ALMA 2EX0A 5AHOA 1L5MA 4F9FA 1QFZA 1SG6A 3CHYA 3M34A 4MB6A 4DQ0A 1JTVA 1OIVA 3W6OA 5IXYA 1NL3A 4PPNA 3W7AA 1XFAA 1ORTA 2D3WA 1PQ4A 4HHEA 2BCJQ 3AW8A 1U2GC 3O9MA 5C1OA 2A5YB 4D9HA 2P77A 1GRCA 1NYTA 4TLMB 1DOAA 2F8MA 4ZI7A 5LZ2A 1KMMA 4DR6B 3LT0A 2X23A 2UZ3A 1Z4QA 4QUAA 4CGZA 3H8VA 1GPLA 3EZGA 4GI1A 1E2JA 3MT7A 4LW8A 5L9AA 2XNCA 3P0RA 1NVUQ 3SKYA 3V1KA 1HQDA 1S02A 3C43A 1SXHA 3RVSA 4RFSB 3W06A 1SU4A 2WHYA 3KOOA 2Z3WA 4FGKA 4DLXA 221PA 2Q3MA 5KQGA 1WLYA 1H1DA 3CLHA 3LJKA 1H0SA 1QYIA 4J76A 4UE6A 1NRJB 1C1DA 1YC5A 4JLVA 2VF7A 4KVAA 1G8GA 5L7WA 1TIBA 2F6RA 4LYAA 4RZQA 3CV3A 5H3LA 1OU4A 2H59A 4JL6A 3RTCA 1SO8A 4ND8B 3N7AA 1T2DA 1EE1A 2P9QA 5BV7A 3NT5A 3WIBA 3R5FA 4IDQA 4RZHA 5FWXB 5CK4A 4HYTA 4RA9B 1NW4A 3N2KA 4LHWA 4MEBA 5A9SA 2AEEA 1XU4A 1QVAA 1VLMA 3EXIA 4ON9A 1YZVA 3MMPA 1MFZA 3RT7A 3EZ9A 4ISCA 5C1DA 3E7PA 1GGHA 2J30A 3PFGA 2XCSB 4E4RA 3S7TA 4DCPA 4I9GA 3ELYA 3LKDA 1XVIA 5EEGA 2QYSA 4IGKA 4EA9A 2C97A 3G0IA 5AW3A 1JHYA 3PXEA 1Z18A 3N2IA 1Z7EA 1KBZA 1W0JA 2WRZA 1NSYA 2GKGA 4X44A 3FTEA 3MBIA 3W7VA 3TOXA 1WQ3A 1RAHA 3VRHA 4EW6A 4IIGA 5AJYA 1PFWA 4RD3A 3VPBA 3GGCA 1I6MA 4EVSA 3C5EA 2PT6A 5ELXA 1PL0A 2XTAA 4V0QA 1TVCA 3LUDA 1GAJA 3F7NA 1DJNA 2E89A 4YV7A 4V1CA 1NN5A 1E9SA 2XLBA 3LGAA 3QLTA 4BVGA 5J4KA 5L6MB 1UJ5A 5J2UA 5CR9A 3BICA 4P0PB 5TQ2A 3KSRA 2O7VA 2QQ0A 1RJ9A 2RBGA 2QTGA 4IGFA 4Q1VA 3Q9NA 4DQKA 3FGNA 2PT7A 3K8ZA 3BRQA 1U8TA 4UTZA 2P9HA 4YDHB 5I7WA 2PWZA 2Z5LA 4HG2A 2BR5A 3HCEA 4DV4B 4CIBA 2WHPA 3JAWB 3L6RA 4WZBB 1FYXA 1NWCA 2BFDB 1USKA 3HNPA 3I9V6 2OCAA 2QMHA 4NTZA 3U7QB 1YVPA 3G02A 1G21B 1FLAA 4N5LA 2ASVA 2IRWA 2I7TA 3RAGA 4CQLA 4F5ZA 2X8JA 2G09A 1E0DA 1KY2A 4X84A 1BWQA 3RJTA 1CW2B 3IAUA 1FSSA 4OJTA 3P9ZA 4YP9A 3HA3A 3OO1A 2IZOA 2QRVA 3DNPA 2GJAA 1EKXA 3ITNA 2WWFA 2FWAA 2NAPA 3ETNA 4ALIA 3HKBB 2C8LA 2VJMB 5K8UA 3C3AA 1E1KA 3V4OA 4Z5XA 3ICQB 4RVNA 1XMPA 3GEMA 4ASUD 1WDWB 1I3OA 3T5AA 4IP0A 3FAKA 5CYFA 5FI5A 3AJEA 5KCMA 3Q3JB 4PSCA 4PLWA 2BFEB 1CIJA 3TX6A 4ZK6A 4TM8A 1FVOA 4JITA 3TSCA 3MJSA 2JIZA 3U4DA 1T1GA 4QSMA 4GZLA 4PC7A 5TS3A 4AO7A 2HMYB 3HYSA 1QC5B 4XEUA 4RK6A 1I2ZA 2YFQA 4OUKX 4PO1A 4YJ2A 1MB3A 1O77A 5KYWB 3AR5A 421PA 2YIVX 1IHPA 1ZUNB 2A3RA 3HR8A 4FUQA 4P4GA 2POQX 3EUEA 2X2PA 2JLUA 1HLPA 3R3HA 4P84A 4C0KA 1DKOA 1I3LA 3QG1A 3C8MA 4S04A 4UPVA 1OROA 3IQDB 3L0PA 2XQIA 3K8QA 1NKTA 4AN4A 2QWXA 5E9WA 1KA9H 1XZJA 2PZJA 2I4IA 3EPHA 1T9AA 1AH2A 2CNLA 3N74A 3PEUA 2PL1A 4JI0B 4PYQA 3C39A 4Z7NB 3O8NA 2FSVA 4M8NE 1E4VA 4HQOA 2J5KA 1E6EA 3E3AA 4LTDA 4P1ZA 1CTQA 4Z54A 2NZJA 3ZWBA 4EUFA 1L3IA 4QOGA 1Y5LA 3PE3A 1FS4A 3LZCA 1SZDA 1XA3A 2DFVA 3D6UA 3VO9A 3PEVA 3OX1A 2C9CA 4BO6A 2NYUA 4FJ2A 5FWDA 4C01A 4ECAA 3T12A 3CU5A 5GINE 4WN9A 4BC1A 2HTEA 4ZOCA 5JH7F 1D2MA 1L4FA 3RYHA 3FJ1A 4L15A 1XMJA 2VK8A 4ZYZA 3EDCA 4LQDA 4IVPA 3B5JA 1G8JA 1UXHA 2JG3A 1KP2A 4CQNA 2FX3A 1KH2A 3ZU5A 2JLVA 1RVV1 2WNSA 3N70A 1QGZA 3CH5A 3V7YA 1OJLA 1VG1A 5BN4A 3ZQKA 1ZW6A 3RUPA 3N2YA 3PFHA 2DX7A 1RBMA 3V7FA 5FBHA 3QQ5A 1Z6AA 2YVQA 4YT4A 1VCMA 3WGLA 1HA3A 1W4BA 4JP3A 2OHIA 3PYLA 2NTVA 4NMLA 5TSDA 2EFGA 3BDVA 1X6VA 3BE4A 4A6EA 2DB3A 3FFBA 5AOCA 1JXAA 3PUHA 5HG0A 1E4YA 4Q16A 2ZATA 4CM8B 3N2ZB 4MQFA 3EFHA 3RYFA 2MDTA 3AI2A 2Y2VA 1FYWA 1OHHA 2GOYA 2XJ4A 4ZAYA 1USUA 3W2EA 3HDVA 3PGXA 5KYKA 3H17A 4Q18A 3RHZA 3VX4A 3EFEA 4LQCA 3V9AA 1VKZA 3LCUA 4J1TC 4KHZA 2CMHA 4G9GA 3RS9A 4YAKA 5LA6A 5AXCA 1E1QD 3S2SA 3G2MA 4G0MA 6NULA 3OIVA 2HCTA 3VTKA 4UM9B 2ZE8A 3D43A 4D26A 1CP3A 1A7UA 1NF2A 4MVCA 3VYUB 3CPSA 2PR2A 4WFJA 4YUAA 4HEHA 4NY1A 2HAEA 4D92A 2I9KA 3SHOA 4CDRA 1FDUA 5GWXA 3AKCA 5ED4A 2P2NA 4I1YA 1VMDA 2YN2A 3EZFA 2XT0A 2ZBQA 3O8QB 3R7SA 3KOYA 5EWLB 3GELA 3P9PA 2ZULA 2HWXA 4LHYA 5E6SB 1P1IA 4JLAA 4GMHA 4WKCA 1J99A 1V8ZA 1BA2A 2P0EA 5ERYA 1ZJZA 3AVPA 1M66A 1YQDA 4QRDA 3RK0A 1Z3CA 2MSKA 5F23A 5KNDH 5KYNA 5ECYA 3V1MA 2XAAA 4C6RA 4MW9A 4E51A 5JO9A 2XLCA 4L3VA 3D1LA 1HEIA 4AS3A 4RTPA 3CRQA 5BV8A 6ABPA 2PU5A 4OQEA 1CUGA 3TZQA 4MGZR 3NAZA 3SWWA 3JYQA 1P0CA 4MIEA 2Y66A 2KI5A 4Z2YA 5J58A 3V34A 2FMUA 3TBKA 1U2DA 1XTTA 3A9VA 2OENG 2AOTA 5I4KA 5ALUA 3PA8A 3PTLA 3ER6A 1YNSA 1JQLB 3RS4A 5I7AA 4P4NA 1VLQA 1BSVA 2H4ZA 3FYTA 3GYGA 2QYHA 3WYCA 3FMOB 4DNPA 4O4JA 1ZHOA 5E9JA 3CUYA 4MO9A 5BURA 4GP7A 4POAA 2XBMA 1JALA 4WLUA 1ZOIA 1XN4A 1PI3A 2W43A 5CHYA 2PGOA 4ISBA 1XJQA 4BWFB 1I24A 2FGJA 5BSGA 3KC2A 4QTZA 5DK6A 5G1PA 4E07A 3B7PA 4O4LB 1G8MA 3D8UA 1KPIA 1F1JA 3CURA 3P2IA 3HN2A 3NDPA 2XHEA 3T7EA 3U31A 5C8DA 5ICCA 5IXSA 2XCQA 3MIIA 4G1UC 4ZCRA 1MX9A 1C3OA 1L4MA 3E4CA 2HDNB 3AQIA 3OQIB 3TLKA 5EIFA 5JEDA 1YQXA 3KVVA 2UUBB 1TF2A 4LMBA 4KWTA 5EMMA 1E9CA 3R3JA 1V45E 1T2FA 1L1QA 1L4KA 4M1WA 2J9FB 3JRXA 1N0VC 2VZ9A 3WDLA 4JP8A 1GTRA 3H2SA 3ONFA 1NUSA 4FOLA 4U3JB 4QSHA 1YUNA 3AEKB 4F96A 4E08A 1E0AA 1Y1TA 2ON6A 3S2GA 1L6RA 4C0XA 3RC3A 2EX4A 1X13A 4IS2A 4MI3A 2GN2A 4QRIA 2WAAA 3CVJA 1H6DA 4KNWA 4OHBA 2XKJE 5DYIA 3CLUC 1ULUA 4ZTZB 4L6AA 4KQIA 1PT9A 4CODB 2ENUA 2PSEA 3I34X 3Q7PA 3ZJ5A 1SUCA 3H1FA 4CT4B 4JYZA 1AM4D 3AUJB 2C88A 3HUEA 3NEAA 1DTSA 3HFGA 3AUKA 3OE7A 4GM0A 5H80A 2OTCA 5KVQA 4B7XA 2H07A 1EEXB 3MILA 4U2EA 3NXSA 4DB2A 4I3HA 1NN0A 2OZKA 3SIRA 4DQDA 4JMPA 3KAJA 4NHEA 3L8MA 4RAQA 4ROTA 3TLGA 1H2FA 4CWAA 1IK4A 1OC2A 3PUKA 5KC9A 3VSDA 2Q2OA 2VP0A 1F0KA 2P0YA 2C2KA 5LQJA 3CLKA 1JIJA 1L7OA 1OY1A 3L41A 3L77A 3IA7A 1NUPA 4FMPA 3GEEA 1ZA1A 5KOYA 1A4RA 3KUUA 5CIYA 4Z53A 3NQ41 5IABA 4OUDB 4QTTB 5I8WA 3JARB 3CZ4A 4ID3A 5LBIA 2ZJFA 1ZIYA 3U44B 2CE2X 4OHOA 1OYVA 1BMFD 3RC9A 4EAAA 2WWYA 2DR2A 1KMCA 4MP8A 1WOMA 4DDUA 4EBFA 2C2GA 4D6XA 2GAIA 2CBGA 3RS5A 1FP4A 4BMSA 5JANA 3VR0A 1GFWA 1F2VA 3TW0A 2WB4A 3EGXA 5ELLA 3BTUA 2HQOA 3MW8A 5IUJC 2XE6A 5C8YA 2XHZA 5C7OO 5GVRA 5GGXA 1RC0A 3AVTA 1CUFA 4F3TA 4YRDA 5DN6D 2WW8A 3CX3A 3H4TA 3OE1A 4S35A 3IEUA 1V16A 3PEYA 1DTEA 2QAGB 2GHIA 3NONA 1FDIA 3CZPA 3OAAA 2L17A 4IKOA 2M6LA 4I4TF 3RNLA 2AMFA 1V48A 4V0RA 2EL7A 3ZGXA 2JGDA 1DAMA 3A6EA 3T52A 4NPAA 4OLJA 4C4RA 1EK2A 3TIFA 4OM8A 3JQ7B 1SCBA 3IBCA 3HV0A 2AFHE 3JAKA 1E0KA 1YHYA 2P41A 1L4UA 1XXHE 2YN0A 2ZS8A 5JAHA 4WLOA 5F35A 3LUBA 5EINA 2J46A 4L4RA 4TTJA 3IMEA 1FDWA 1UDWA 2X14A 1RTKA 5EXPA 3W4JA 1TMYA 3Q0TA 4MPJA 4A2PA 4EVIA 4R8KA 4TZ6A 3BS4A 2V7XA 5DM1A 4GO1A 4YP6A 4MPPA 5ULLA 5C7IO 4KQWA 3TCKA 3QEBZ 5KTKA 2A14A 3FNFA 2WJPA 4KUEA 3OKAA 1I7PA 1JQBA 2KW5A 1CJUC 1AIPA 2B94A 3LSTA 3PPVA 4U2GA 1RM0A 1A27A 3OKPA 5CPBA 5JS2A 4EUEA 1FDOA 2FZVA 3RIXA 3BQMB 2YWGA 1E63A 4IHJA 3NPMA 1LB1B 4IJVA 1QTQA 3KXIA 1TJYA 4QXMA 3DHYA 4BE7B 1H4TA 1B43A 3PHJA 4G07A 4E4TA 2X13A 4G0WA 5AHKA 1N2CB 2ZEJA 3P26A 4EG6A 1HPLA 4FEGA 4F3NA 4RXMA 2CXXA 1NNLA 1IBCA 1F0NA 1SBYA 2QTVA 2SKEA 1QFYA 3OLCX 2P68A 3ZZNA 2HBQA 1AK1A 3ZVMA 2VBCA 3RABA 3EVAA 4Z3DA 1NIPA 3H3FA 3A37A 5HWSA 1NBME 3LXXA 3H9BA 3GLHE 1QXSA 2DLNA 5KAMA 5AKZA 3CRVA 1GZHB 4QC2A 1OYWA 2R7AA 1R0WA 5IP5A 3PJGA 4PBSA 2H5JA 4PEVA 1YMUA 5T4FA 4GBED 3HVUA 4KLCA 4JOCA 1PFGA 4H35A 1DRJA 1QO7A 3COSA 3K5WA 4FNGA 3SZMA 2A5FA 2QVGA 2X4GA 2J3JA 4LV5B 5TR9A 4BVAA 2O8BA 3G88A 4YT8A 3L1JA 4XCQA 1KYTA 4ND2A 5FUWA 1MU0A 4AT1A 3EXHB 2GCPA 1EVQA 4C2BA 4PO8A 1BVYF 2NT4A 3G1WA 3A9RA 2WIDA 5FA5A 2VJCA 1JLHA 4NZNA 2R68A 1MH1A 1YQGA 1ZM7A 2HFJA 3SICE 2O54A 2XR1A 4IMIB 2PX0A 3D2BA 1JIUA 1IY0A 1J00A 4Q21A 4DQUA 2OAEA 3G8DA 4IDEA 3K1AB 3FUCA 3ILYA 2GN0A 1GQSA 4V03A 4J07A 3WWCA 4JYAB 4Z8YA 3IKVA 1XTKA 1JHMA 7REQA 3LZ6A 4EYEA 2VP4A 1UWLA 4X8MA 4ZAGA 3K7EA 2NVUB 1Y42X 1BZYA 5JD6A 3JWHA 3N2GB 1RWMA 1UC9A 3FR8A 3Q7SA 4C43A 2ZYIA 1W59A 2ZM6B 2FR8C 5MF6A 4EY4A 5LPNA 5HE8A 4JQSA 1EU1A 1MW9X 3RHTA 1ZH2A 2VF2A 2O59A 2XUQA 2ZR9A 3A4MA 3PUXA 5LD2C 4KU4A 5FHRA 2AIRA 3HEBA 3RM3A 1YS2X 1SBIA 3DMFA 4UD2A 5BSKA 5C1IA 1YJCA 1F3LA 2FW1A 2AFIA 2OVFA 4RD0A 4UREA 5FWAA 5J2TA 4Q15A 1KOJA 2NV6A 2G5GX 3COVA 1WDKA 2AN3A 4GPZA 4BFUA 1LPBB 4FZRA 2YWBA 2D74A 2DSNA 2IXBA 2W2KA 3ECCA 5EKSA 1WUYA 3REFA 1IQUA 1N8SA 4A8PA 4OG2A 3WX0A 1P4HA 1VLJA 2VQ6A 1MTZA 4JAVC 5BVHA 1H3NA 2AG6A 1WZUA 1DWUA 1EFVA 2Q8QA 2C9MA 1ZOSA 1F8UA 3MGBA 2QVCA 3CLRD 4V2IA 2HYDA 1OLSB 3TH5A 5AT1A 2FN8A 4FIDA 4H1HA 1COWD 2OBBA 5IAOA 3CX8A 1BS9A 1Y8QB 4IGIA 4OJNA 5LNK1 2B7CA 3HCFA 5C4IA 5JYCA 2CMKA 2RI0A 4BNKA 1CHDA 2V6FA 3B1XA 3WLPA 2FLVA 2YRWA 3X2SA 4AO8A 4W9MC 5DISB 2B30A 1NZFA 3QQPA 4K6KA 2IYLD 2ONKA 2PRYA 4B47A 4EZIA 1Z39A 3V4LA 3OT5A 2HBYA 1NP6A 1U1DA 2VUUA 3QVTA 5P8WA 1KI6B 1VYTA 1TO1E 2HWWA 4L7QA 1X0VA 4G0NA 5KJ1A 4DR7B 1P3DA 2H5LA 2KJQA 2Z04A 2VCYA 5EGSA 4U00A 3GQBB 4EY7A 4D3SA 1ODKA 4XYBA 2QIPA 1NQAO 1LLDA 2CLIB 1KO5A 2G5TA 2V6GA 1COZA 1QIJA 4RHEA 4WOBA 3RJ9A 4E03A 5AVQA 4AY2A 4FFNA 3NFYA 4JYBA 1E64A 4V39A 1N7IA 3MLAA 4YHBA 3U3DA 4BVBA 3KQNA 3DL2A 4MS3A 1XZBA 2BIFA 2I03A 2NTNA 1CB7A 2X0DA 4B83A 5AM5A 3WGOA 4YV0A 1RWNA 4KREA 2IYNA 3BJMA 2GFIA 1BJRE 4JXXA 1W5TA 3RIMA 4X65B 4FDUA 2F8LA 2X22A 3C7KA 4EG1A 4JB8A 3GEHA 3SYRA 1YDFA 3NHFA 1BROA 1N2HA 2DFNA 3VR5D 4D9MA 2FQQA 5CFRA 1GU1A 5CJ2A 1ZC4A 3KCQA 4YUZA 4B3CA 1VMKA 4O2RA 4LX0A 2X8AA 3C41J 1Z88A 1KVRA 2HIAA 2EBFX 2OK8A 3MWLA 4DLPA 1FS5A 1IXKA 5JJCA 1N5KA 3L7OA 3ORFA 3A7DA 1W34A 3PGJA 1M6NA 1A4IA 3HACA 1Z8NA 2Z5GA 4N41A 2JEYA 3LDHA 3BBLA 1M34B 2OLEA 1GR1A 3ZTYA 2E4ZA 3TDMA 4RKFA 1U2GA 3VVBA 2J9XB 2DE0X 3LF2A 3DUWA 1ISMA 3LX8A 4JFRA 4JEIA 1VMIA 2ZROA 4DQXA 1VLZA 2QUHA 1TTPB 2VHYA 2R4TA 1A9SA 1EXMA 4UDYX 2NU8A 4C03A 3NHKA 1XQXA 4XDYA 2ZT7A 4ZYUA 5TPZD 3U4QB 1RWWA 3D7LA 2H48A 2O8CA 1W87A 1ZJYA 2WBLC 4LISA 3OEWA 5AVSA 2I2BA 4OQNA 3I9JA 5TE9A 4IQ8A 2NU9B 2WINI 3FPKA 1C2TA 2VQSA 2IXTA 4KLNA 4AURA 5AESA 5DGXA 4BQIA 4UBIA 3STTA 2PUTA 2JGFA 2W2TA 1I33A 2BMAA 4HK4A 2AZTA 4LYHA 3F4BA 3VU9A 2FZWA 4BKPA 4XLLA 1VP9A 4IY1A 3H5VA 2JCSA 4RKQA 1GFZA 1RABA 4GE0A 4Y2GA 4XB2A 5IG2A 5M29A 1XZAA 4GRIA 2HADA 1TGVA 1L5KA 4I2VA 1PL6A 3A6GA 3KD2A 4CG2A 5B2EA 3T3NA 3PCXA 3W5CA 1XRMA 2W2PA 2XB6A 4GM4A 4QPNA 1VA4A 5ERGB 4LF9B 1J8MF 3GO4A 3MYRA 4K03A 4FTWA 4QXPA 3VAZA 4ENSA 1XHLA 1WTCA 3DKIA 5T41A 1F2TB 1MA3A 1KR2A 5HMLA 3MWJA 4ZYXA 3MXOA 4QPJC 2QROA 2PCJA 1ADGA 4MNTA 4YXWD 5B2FA 3QVKA 4EHLA 2PSSA 1WVIA 1HLFA 4DUZB 3CX7A 1TF7A 4XZ3A 5SY6A 4BNIA 4UTXA 3NHRA 3I76A 3H99A 2GO7A 2WTEA 2PGDA 2ZKLA 4KZKA 4H7DA 3CYFA 5DHQA 1NMEA 4BNYA 1QYWA 3NNNA 2NO0A 1KYZA 1CR1A 1CY1A 2YV4A 3DBRB 4W5NA 2RGWA 1YKFA 1R74A 3PC3A 1DMSA 1YJBA 1Z08A 3MMSA 1NKVA 3O38A 4DT1B 4EKIA 2HDHA 3KP1A 3I45A 1FZTA 5HKKA 1MX5A 3TQIA 5BR1A 3OQOA 1ZN8A 1R8XA 4M87A 4Z49A 1OBCA 1QWOA 3H11A 2RDMA 1V7ZA 1RVDA 3IAAA 2UVQA 4CFYA 4EDFA 1K7EB 1ZI9A 2R8OA 3WWPA 4RD4A 1T6ZA 3T4UA 3W3AA 1GILA 2B8EA 4IEEA 4RA6B 2O2SA 4X1KB 2A2ZA 5LQDA 2FPPB 3GY0A 2BR3A 2PSDA 1JFFA 4NCNA 1TI7A 3FB1A 3FOCA 4N5MA 5G2OA 3M6UA 1AA9A 10MHA 2FXVA 3ZTWA 3UUFA 4YRRA 2YFKA 4WK4B 4ZGBA 2GCOA 2O2ZA 3DC7A 3RVOA 1QS0B 3E82A 3PNPA 2G1UA 5HILA 3USCS 2V7BA 1KAHA 4M7RA 3REQA 3UK1A 4C4OA 1CV2A 1J1UA 1KYQA 3B6JA 3INNA 3SS9X 2CJYA 2V55B 3VJMA 3SE0A 1HXHA 1Q3KA 2C0CA 2XNDA 3CONA 3R3WA 4LXHA 5BO5A 4BFTA 4HNRA 1Y3FE 5EESA 3IEMA 4KPEC 4C1BA 3KSBC 4IWNA 2ECOA 1YJAA 3THWB 1ZCZA 2X2EA 5CVDA 1NPYA 1O5IA 1G3MA 1TCVA 3ZC3A 2X1VA 2CJFA 1P4SA 1RPJA 3E9YA 2W8BA 3MTIA 2O1EA 4MIYA 2AJ8A 4Y9RA 5BN5A 2NP7A 4MVJA 4YMHA 2FMTA 4Q4AA 4ALLA 1DC5A 3ANTA 4NOKA 4TTSA 5H9WA 1NLUA 1PSDA 5FP0A 5FDFA 1B6SA 4QDZA 3U40A 1GNSA 5KTRA 4PONA 1G20E 1PEAA 4RPKA 3QUAA 2CDRA 1JP7A 1WSWA 2A0FA 2VHQA 4ZT7A 1HDEA 3VR1A 3HM2A 4DFDA 4AF8A 1KDPA 2P2LA 2VK2A 3SE7A 2AKEA 4J3NA 3SJZA 1WBJB 2BJHA 1Z0AA 4PSDA 1FU8A 4HN9A 3D4LA 1CUWA 5A02A 1OH6A 2J8ZA 5GIOE 4CIVA 3GJ0A 3HTXA 1FYVA 2GRAA 1MDBA 3C3DA 3GLGE 4LDJA 3R7WB 2QBYB 5EP4A 2G8LA 2N42A 1BAPA 2PLFA 3JSXA 3K0FB 3AVQA 4K6GA 4R2KA 2O8VA 3L0ZA 5CM2Z 1KEEB 2A4KA 2AHOA 2EKDA 2SNIE 4K3UA 4FB4A 1GLGA 5BWLA 3MMXA 2R8XA 2BMDA 4MQUA 2E5LB 3CR7A 2AXNA 1TJ5A 3AR4A 4DCCA 4B3SB 3HJNA 2XOKA 2VN8A 2X5KO 3FNBA 4DMCA 3JQCA 3Q9LA 1BRTA 3EEBA 4JJEA 1NXXA 2C92A 2ZTUA 3ZHZA 4DBZA 1JDPA 4J7UA 4WLNA 4FOOA 4K6HA 5B12A 3KQUA 1AUVA 1ZSYA 1PZFA 1E7QA 3O2SB 3B8HA 1JYSA 4I1PA 3DH0A 4L6CA 3FLMA 1P44A 3M6LA 4CM6A 3KT0A 3M9LA 2ZRCA 4KQXA 3R5XA 2OILA 2JANA 5HE9A 1W4AA 2A9VA 4OL0A 1JFVA 4QXRA 1E1RA 1XZIA 4BUJA 3EIXA 4HUQA 4CKEA 1UBJS 2VWGA 4AJLA 1G4UR 3SX0A 2C0PA 1JG2A 2CHEA 1QNFA 3OEEA 3TSOA 4BPRA 1O96A 3AL2A 3OWXA 5C1BA 3Q98A 4GICA 4OV6B 3TXYA 4CQMA 3AB3A 5FFMA 4U6SA 5F7JA 5HMMA 3R75A 5FWYA 1J5EB 2XTMA 5AI0A 3ZWCA 3NV7A 2G83A 4W8OA 1NJ5A 3S44A 1O4VA 4TWBA 1L8AA 4H6WA 1ETUA 1FU7A 3KBOA 1QSGA 2F9MA 2HEIA 3PEEA 2JFVA 4QPPA 1J24A 3T7CA 3WYNA 3BB1A 4J1TA 2PL9A 4BDTA 4F6CA 4PS1A 1E79A 4NONA 4KLRA 5HF9A 3ZWPA 4X20B 4JJZA 2WAMA 5IBPA 1E5LA 2AQIA 3AIMA 4H6PA 2ZS7A 3UXYA 4JC0A 3PF8A 4ESVA 1EFKA 5TX7A 4WJKB 5LMUB 5JMPA 3E2PA 4JS0A 1RWQA 4BX8A 4BVEA 3D02A 5SV2A 3RC8A 3M83A 4KI0A 1V6SA 4CV3A 4HEQA 3ZVRA 2HBRA 3U37A 3NH9A 1L4EA 4M49A 3AINA 2P78A 5FAXA 5JS1A 3CF4G 1LJUA 2K2QB 1QLHA 1Y48E 1YE8A 4TROA 4LJKA 2GK3A 2EFEB 1LW7A 1X7YB 1WCWA 2O1SA 3B7WA 2ZCUA 1SOMA 2HU8A 3ANLA 3BFJA 3EUFA 3RU7A 4DR5B 2GM9A 3NWEA 2C7OA 4JKIA 1MO4A 3BWVA 5TVKA 2ZI9A 3D2AA 5JYBA 1WKCA 4R31A 4YFVA 5EMNA 1KDZA 1VPVA 1AZTA 4UU7A 1Y8AA 2W4MA 1PK7A 3UN1A 4AK9A 2FFQA 3E1SA 3C6YA 4HYEA 3N0VA 4TOIA 4TWJA 5BNTA 1B00A 2DU8A 2OG2A 3PIIA 4WCFC 2X3FA 3EHEA 3LD9A 4OLAA 1GGKA 3HV2A 5AI9A 5BSFA 1G3UA 5FNVF 3U4AA 3WK5A 1DX6A 2QPOA 1RRFA 5LFAA 3KOUA 2H7XA 1WCYA 1R0ZA 2IOHA 1LD3A 3EASA 1P2TA 3G8YA 4DG8A 3P27A 4DYVA 5L53A 4N3GA 1DZIA 4XAQA 1KP3A 4BNMA 2JJ1A 2NO5A 4OB8A 2GJ9A 5EPUA 2NUTA 3DFFA 4HJRA 3TQHA 4E1AA 3KB6A 1AXRA 4UD6A 3QOFA 2W6JA 3PX3A 4D3YA 1SKUA 3O3OB 4CLHA 4WY8A 2HT1A 3L0YA 3HDGA 3V2HA 3MJEA 5DSXA 2BKXA 4RIFA 5IKMA 1TCUA 1HNWB 5JDCC 1K6XA 3HUUA 3NIDB 1TF5A 4A91A 4QQFA 4IF4A 3IQFA 1RHRA 3P94A 3PNOA 1EMDA 3F6CA 3BE6A 2I7DA 3QUCA 1JPUA 3ZNNA 4BP1A 1U7UA 2ZYSA 5GZ6A 2QVLA 2HNAA 4GVLA 4XH9B 4F5YA 4WBNB 2EP8A 3H1TA 2W42A 1ZWLA 3BG5A 1UAYA 1H2BA 4FDVA 4QHSA 4PYLA 4US1R 3EVTA 4GR9A 4OFXA 4KQ1A 4YDSA 1QAMA 1UDRA 2ABWA 3HFJA 2NZVG 3A6ZA 4J0IA 3WGTA 2DUNA 4DCOA 2IS1A 1P39A 1ODCA 4TTQA 3TECE 1LNSA 3GLUA 1SCQA 2WE8A 4P82A 5E2BA 4TYQA 1YB5A 3ZCTA 1THMA 2E5FA 2J3MA 3BF7A 1TX4B 1AB5A 1FUEA 4KC0A 2HIGA 1DCMA 5K51A 2COUA 4QASA 2DY1A 1OLXB 3SMQA 1GPYA 3I0MA 3KDSE 3NOVA 5G41A 4TUYF 1AUOA 2YY7A 3IXMA 2EC5A 2F1OA 3AZQA 4G86A 2J3IA 3PGVA 4GI7A 4JLDA 5IM5A 5DTJA 2R6R1 2VYCA 2FP4A 4GWLA 4HAYA 1IEXA 1XV5A 2SCUB 3T3IA 1CRPA 4D3ZA 4RVUA 5GONA 5F5LA 1PT7A 2HRZA 2A84A 3QH4A 4KZPA 4Q1AA 1O9HA 2DUMA 3QA3E 4Q7KA 5AM0A 4GRDA 1JHRA 5H02A 3TEFA 1XTVA 1MORA 3ZWXA 1K6IA 4RORA 1Q17A 4NBKA 3WLSA 2V5VA 1JJIA 1YL7A 1T5BA 2VT2A 4PIMA 1YL5A 2QEQA 4GLJA 1X8XA 1I32A 2QN1A 3GRKA 4I46A 4YJ3F 1KU0A 5LQUA 2FPXA 4A8HA 3DPSA 5HRCA 5I47A 3EHDA 4QDOA 4AMVA 1NE2A 1RYMA 3ZJYA 5DIZA 2G6TA 4YRZA 2O8DA 4BO5A 2MT9A 2R7LA 3SLKA 2VYVA 3BH6A 3FYDA 4KFTA 4FYPA 2JB9A 4DNXA 1N1DA 3MUEA 2E0IA 3VR4D 3FFWA 4KO4S 4WJLA 1C0EA 3KIPA 3NYQA 4GXNA 3V32A 4PRZA 5DHSA 5LU9A 4ZI7F 1G60A 3TVDA 4Q7EA 2BGWA 3TOCA 4ESHA 2DQ4A 4MUEA 1KOFA 4JCOA 4RKEA 2ZR8A 3DDWA 4J0EA 1GAXA 4K9PA 1PCXA 3M3DA 1XZCA 2F62A 1C1XA 4Z9AA 3WSVA 1QANA 3CNEA 1GNTA 1D6SA 2OCDA 2OECA 5KEIA 1EGMB 4BXOA 3AXSA 1B1CA 4N82A 4TLLB 6Q21A 1ZK4A 1A2KC 1XT6A 3MTEA 2DGDA 3P52A 5FOVA 2IZ1A 4F5DA 1GCGA 1BGXT 4P08A 4WWHA 3KYDA 4DA7A 2CLLB 4OSOA 2R9VA 3A28A 4BNVA 1Q3TA 4CUZA 3ZIDA 3HJHA 3CH7A 5DT2A 4CL2A 2HJVA 5B3JC 4F2HA 1NQTA 2ROQA 4P93A 1V7QA 2YTZA 2OV4A 3A1TA 3D5QA 4NU5A 4D2IA 2X1LA 2JH9A 3AEYA 3ONVA 2Q49A 3VKGA 1RBYA 1R4MB 2HF8A 3LMKA 3ECAA 3IVAA 5KNBA 4N7RA 5CW2A 1AJEA 3T5DA 3PD1A 1GP2A 1XU7A 3U7RA 5A71A 1TK9A 3DF9A 1JEYA 1GCUA 1W93A 5KNCA 2W0SA 4YLYA 2FI1A 2CV0A 1Z68A 2C94A 2GCIA 2JIBA 4DLVA 2G88A 1EX7A 1GPWB 2ZIGA 4HVTA 3HCBA 5DI9A 3OECA 4IVRA 1CERA 1SC3A 3NYRA 2VIIA 3UJ7A 3SEZA 3KYBA 3WK9A 4QOJA 1G0OA 3DBHB 3IOBA 4HNHA 4CUKA 2WD7A 4GBMA 2HREA 1PV1A 2RHRA 1ZUIA 3WLMA 2GGSA 2XYPA 5IBCA 2VUSA 1U02A 3VV3A 3HCRA 4DA0A 5JZBA 1IDOA 1UC4B 1CQPA 1SKYE 4HO1X 2H0AA 2RGXA 5CCDA 1JJFA 4ERNA 3F78A 3KKKA 1E8MA 2Z5VA 2PZAA 4ACAA 4ER6A 3FCSB 3ZJ4A 2XUAA 2GEUA 3IAS6 3WB2A 3FIUA 5COBA 1L7NA 5J2UF 4L5IA 4AWXA 4R8MA 1E2BA 4HDNB 1Y3CE 4MKXA 3KUDA 2RGNC 3IODA 3E84A 1BCSB 3QE0A 4N3AA 3FMVA 4PLGA 5C0OE 5JMWA 4IOMA 3K9WA 4LDZA 3O8RA 3K1JA 1C3LA 3MUOA 3OZ7A 5IJ9B 2OFPA 4B2YA 3W78A 5C46F 1O89A 1SCDA 3P1JA 4L85A 4DZRA 4MJLA 5ALXA 3PDIB 1GJRA 2WHRA 1I14A 4F86A 1VOTA 1FQOA 1EXDA 4Y6RA 3EGVA 5EJIA 1SBNE 3T94A 3UF0A 1U9YA 1KZ6A 4J1SA 4N3BA 1J0CA 3KE8A 1GGVA 3HE3A 5I8ZA 1E3SA 3SS8A 3ABSB 5IM4A 3DE7X 3NBFA 2VPIA 1CE8A 1PKXA 2OZVA 1M72A 1XL0A 4I66A 3ZD8A 5MN6A 1BE6A 1BCRB 1AGNA 5FI1B 3FNGA 3FUTA 3MAAC 5AK0A 1EQUA 5FPSA 4B2LA 1QORA 4INOA 1OF1A 2QRHA 3C6QA 1EE2A 3GA7A 4HAVA 5FQOA 3BQ9A 3OI7A 4CTJA 4G81A 3K70D 3OEHD 1QFSA 4CTNA 3I9V1 2BGNA 3M5WA 1ABBA 4FFRA 4MINA 4RMNA 2JVKA 2PTGA 1ARZA 3DM9B 1P74A 2NU6A 3DAOA 1X1EA 4FT2A 4MW0A 5ALDA 5EJ4A 3JTEA 2AXEA 1FRZA 1JBEA 3GCXA 3G2LA 3ZDFA 4GKVA 1YHNA 4QFBA 4YJ2F 3VNAA 1W52X 1AHPA 1G5HA 3H6KA 4M1OA 4D4LA 3H5OA 3ZOKA 1GT6A 2PYIA 2JGEA 3GFBA 5HR5A 1C50A 5DP1A 5B4UA 2QUJA 3GDGA 4GC9A 3ZQ6A 2DH5A 2QU8A 1UMBB 3TKYA 3UY4A 3FBTA 5TC4A 5GPBA 4IHAA 4HMPA 4S1VA 5HEKA 3ZE0B 4V3CA 5HIIA 3ZXIA 4LXXA 2D7JA 1GQQA 3AM3A 5MGBA 1FU4A 4KPYA 2ZWOA 3RVKA 1CNMA 4X6UA 4U2CA 3IIIA 4LRUA 1QK5A 3TOSA 3TEMA 1Y0BA 1Z34A 3M9XA 4Y2RA 4EHFA 5CAEA 5KDLA 4J7XA 3AY6A 5ICGA 4DNQA 3R0IA 2JLYA 3BX1A 1Z4IA 5BQPA 2P3QA 3SK0A 4QGBA 3U17A 3V4RA 3IIJA 1DCTA 4IYJA 4M21A 1RXUA 1NUTA 1AHNA 3AR9A 3UNXA 2R1TA 1X39A 3NHLA 1TM4E 1TVKA 3C74A 3NBXX 4H7KA 1JH8A 3SZ3A 1OXVA 4ARBA 1KFCB 1K8RA 3LF1A 5A7FA 2VTVA 1YASA 3IEVA 2YHSA 3GP5A 4MKHA 3UT5A 5IS2A 1RQGA 1U0RA 4BQQA 4DUGD 2VT3A 4RZ2A 3OZGA 3RRXA 4WXRA 1ISHA 4HAUA 2WSBA 4MA5A 1J1ZA 3MYYA 1M2VB 4MRAA 5JBQA 4M0UA 1Q7EA 2DMRA 3JXEA 3PSHA 1GZ7A 1R6XA 1TA0A 2P30A 3GT4A 3OETA 2JL1A 3FD8A 3OSUA 5CFMA 1QQBA 1Y9JA 3BJEA 1QH8B 3AI7A 3FSEA 4R2HA 2NXNA 1UBRS 4KSCA 2LDXA 4IQ4A 3WWDA 1FA9A 1U3WA 5C53B 3C1AA 4JVLA 3V2IA 5L8VA 5IVHA 1T3GA 3NHMA 4KO2S 8MHTA 2MR6A 1NJ2A 1KBQA 3E27A 3HBLA 4ZCSA 3S6JA 2PUFA 4N7BA 4D56A 4C6HA 3F9RA 2QAIA 4XVHA 3VH2A 4DJDC 2IH5A 5JE8A 1E1YA 1SVIA 2CJWB 1F2UB 1V7PC 2AEFA 2QV0A 2HMUA 4J1QA 4RTNA 3F8SA 2PFSA 1JHAA 4Z4HA 3J81k 4Q01A 2QSJA 3C6ZA 3HB4X 2YQ5A 4LJ5A 5CGZA 1T6XA 4I4TB 1ZK1A 1JW9B 3HJAA 1OTHA 3C7CB 1FDRA 3OM1A 2L2QA 1XRQA 4IDDA 4YGYA 3ROXA 1Z2OX 4DKJA 4ZP1A 2FF7A 1GM5A 4CN9A 5GMOA 5JECA 4DJFC 1P60A 1JDBB 2YS7A 1EUDB 3DF7A 3K16A 4UTVA 1OSNA 1GOTA 3CZMA 1DTWB 5JAMA 2HMAA 2FFHA 3GJ6A 3MGAA 2YV1A 3N7UA 3IE1A 4OGFA 4UU1A 3L7DA 3EIHA 4G4JA 4Q4DA 1GRRA 2GDZA 4HQ0A 1JR3A 1OGJA 3KQHA 1DIAA 1SXPA 5KQMA 3VOSA 4B74A 4CE6A 1AO3A 1M2HA 2WWGA 3E22A 3L4SO 4NDZA 1OH5A 3BMCB 3QWFA 2OUIA 4FEEA 4FNOA 3ZTTA 3ADDA 5D86A 2GLUA 4C88A 2ZI6A 2GM3A 2ECFA 4HTFA 1RT9A 3DDUA 4HX5A 4CUJA 5WRFA 4URXR 3A14A 1PG2A 4EEXA 3EG9A 4HL6A 1G7TA 5PNTA 3MWGA 4K9NA 5ESWA 3QITA 3X0DA 1U65A 1WQ1R 2EWMA 3LBFA 3PFKA 4UUPA 4UBNA 5H68A 4DIMA 2O2YA 2VPXA 2O06A 1MAVA 1T4CB 4KMRA 4DYDA 5HX7A 2PG3A 2ZXEA 1MX3A 3FHJA 5AUOB 2PX2A 2Q2NA 4ZMRA 3A7EA 4MUIA 2C5BA 3D8SA 4FHDA 2NVOA 3I92A 4ZKDA 4F92B 1JJAA 2L42A 4OJMX 3JZFA 1GKKA 2V03A 1XTRA 3J7TA 5DEOA 3SR0A 1A88A 3HGQA 4L9WA 3ZV4A 4AIRA 2C5SA 3TTWA 4RE5A 4BVJA 1FP7A 2HEGA 4RPLA 3AJDA 4KE9A 2EXXA 4X3PA 3V33A 4ALNA 4ZD6A 1CF9A 1Y3AA 2RCYA 4CKYA 1V37A 3EYAA 4ZT2A 2DWOA 3K72B 3TW6A 4K87A 2JEOA 3RFTA 5ALMA 2PN1A 3L5KA 4JU9A 4WX2B 2FN4A 1A9XB 4KUHA 1H94A 2PANA 4MR8B 5LKRA 1U8XX 1UXKA 2QRPA 3DO5A 2XMBA 4CKCA 4G1MB 4F3CA 1M8FA 2DEUA 5KMGB 4EHKA 1GKLA 7ABPA 3R7DA 2JLBA 2RHGB 1GVNB 4OMUA 5B58C 4ZDWA 1EA7A 1XEFA 2QR5A 1AKMA 1NVVQ 3TQQA 2PUBA 1MG0A 1OYYA 4BZPA 2RAPA 4P3XA 4PWYA 1NBMD 4F11A 4YDQA 2FUCA 1T1IA 2PKXA 2PMWB 3CM0A 1Z15A 1XMVA 3C7TA 1BW9B 3DAYA 1D09A 3QP9A 1MCZA 1LK0A 1R6TA 2GTPA 2PMFA 5FLYA 5HGJA 4BJ3A 5AM1A 1OX4A 5CITA 4OGKA 5J23A 4B7CA 2I6QA 2ZJ3A 3G2JA 2PWAA 1GAQA 3COPA 5CBPB 5BMVA 2P40A 2JAOA 1D7OA 2JW5A 3EVNA 1OJ7A 4Q5IA 3WDSA 5K3FB 2KHZA 5HGXA 3IA2A 4YP5A 1ZR4A 1H8HA 1ZSVA 4UCQA 2GCNA 2JI8A 1UK9A 4JI6B 4L4ZA 3U19A 5FOTA 4FWTA 1SVWA 4C08A 1FQJA 2Q5EA 3ISTA 3KB8A 1VSVA 4M1EA 4EHJA 2RGDA 2BMFA 4BO1A 3B9RA 2GBGA 1EUZA 2P9FA 5JSZA 3GBPA 4TWAA 3UAVA 4P2GA 3V8MA 1AE1A 3H87A 1ZAKA 3SSNA 3VYVA 2OYSA 1CJTC 2R8YA 4Q9DA 4X54A 1UKVY 2ZBEA 4H1TA 4RVGA 3VMFA 4QYSA 3R5KA 2DWPA 9GPBA 1CB0A 2UUPA 3H1BA 2XDQB 3PC6A 3T7IA 4UARA 3WGUA 1E9DA 1AK2A 1II0A 4OMFG 3UWKA 2X6QA 1H0KA 5GZ3A 1OVGA 1ZVQA 4GI2A 4I2NA 5DMHA 3VDNB 3PEWA 5C8YF 1HL7A 1SPXA 4QGAA 4B3IA 3KQOA 3DL4A 1NLZA 2GILA 1XD9A 4I50B 5KOHB 2QUKA 2B21A 3NTQA 4W5HA 3HZZA 1C9YA 1RWVA 2LTAA 2XA9A 3GG2A 4W5QA 3DSRA 2XBLA 1LXCA 2PJUA 3OQPA 3I28A 3NHAA 3OPYA 4IIJA 4DE5A 3P97A 3WZLA 4E3WA 1ECJA 4C05A 5EI5A 1UBTS 3ACBA 3NC4A 2WG1A 2NACA 5JCZA 4DCUA 3T7TA 4CF6A 4EK9A 3VGJA 5KTTA 4IGEA 3E18A 3BZBA 2X7HA 3D6NB 3U3RA 2K87A 2OSBA 3A9TA 4CG3A 2XRMA 4HXEB 5TF4A 1EB8A 4DNOA 2BP7B 2ODAA 2QAGC 1MENA 1CUXA 1LSOA 3BCRA 2NSJA 3X2FA 1JWAB 3UJ8A 1YJXA 2WWTA 1RYEA 2XUFA 4AU1A 2YKGA 4Z99A 5FPYA 1PJLA 3LT4A 2MMCA 1PFVA 2B69A 1L7DA 1R8QA 2NOAA 4KRYA 1I0ZA 4LAFA 3TRKA 2EBWA 3T4XA 2QL6A 2QG6A 1CUIA 3ZXYA 3PUZA 3X44A 1E7SA 1A8QA 3QHAA 4N3NA 4HD8A 2D7DA 4R2IA 3OD5A 1YZYA 2OXTA 2CYAA 3S81A 2XRZA 1FX0A 1E20A 1XD2B 3L5OA 2NUAA 2ZWVA 4IX1A 3RD5A 3T8YA 4NI5A 4PLYA 3VBEA 4F7DA 1WETA 2Q50A 2ZJAA 1DADA 1OWNA 2QZZA 3UMBA 2G1JA 1GQYA 2WB2A 1Z06A 1P5FA 3LPDA 2WKRA 5A6SA 1QRSA