3FYUA

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 115
structure length 317
sequence length 318
chains with identical sequence I
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuA00
5FOQA 5D3ZA 2D5LA 1MU0A 2G63A 4HXGA 1MNQA 2XUKA 5LP1A 3KSRA 2B20A 3MUOA 2XMCA 3V1MA 4C6HA 4H7IA 2I03A 1RWQA 4C88A 4CIBA 4Q3LA 4ZREA 3VJLA 2OGZA 1R9NA 4GI1A 2OGTA 4J0JA 4W63A 4KJXA 4IH4A 3S2ZA 5CXXA 5ALFA 1QFSA 1CR6A 2CEKA 3M82A 1VE7A 5EGNA 2HA7A 5ALRA 3CCCA 1LGYA 1WPXA 4FLMA 3F8SA 3WQHA 5ALIA 1SOMA 2DR0A 3BIWA 5ALOA 5HCUA 3SK0A 1YSCA 4FBMA 3O9VA 1DU4A 1QTRA 2HRRA 5AKJA 1DWQA 1XQVA 2WTNA 3ANSA 4X6XA 3BL8A 5IVHA 1IUPA 4J03A 3GROA 1TCBA 3RLIA 1N5RA 5JAPA 1TK3A 2E3JA 4G4JA 5ALSA 2XB6A 4UHEA 5ALTA 4DNQA 4G8DA 4QLOA 3W2TA 1QIDA 2VJBA 2I3DA 2ZYHA 4KYVA 2YYSA 2OLEA 3I6ZA 4FKBA 3LS2A 4FOLA 1MX1A 1D07A 1BCSA 3V1NA 5HF9A 3K9BA 4L0CA 3OPMA 2WFMA 5AM2A 3LP5A 4X6UA 4QZVA 4Y2QA 2XMBA 4Y2JA 2CJPA 4F0JA 1EDDA 1ODTC 5A6VA 5DTJA 3AIOA 3IB3A 2WM2A 3IUQA 3ZLUA 1C4XA 1UKAA 1FSSA 1X2BA 3O4IA 2Z3WA 1GKLA 2WG2A 4DM7A 3WKBA 3C8DA 4PSCA 3AINA 3IULA 1UWCA 1XQYA 4FNGA 2QUBA 1UKBA 1XZIA 5ALVA 1EB9A 4GHWA 2WIGA 4UUQA 2WU3A 3H0CA 2WHRA 5DTIA 2GBFA 3H04A 1BEZA 3H17A 3VVMA 3D7RA 4PSDA 2XDWA 2CBGA 3FLBA 5AKGA 4Y9SA 1WOMA 4NZZA 2C7BA 2GBGA 5E4JA 2WJ6A 2XQGA 3DCNA 3HABA 4L3WA 3SWWA 5HFAA 3I28A 5HKBA 1BEEA 3O4JA 3WJ2A 4QWMA 4P08A 2BKLA 2ZYIA 4AMZA 5DYTA 3GZJA 1O6GA 4KAAA 5HFNA 4AQDA 4RE6A 1CQWA 1XLWA 3ZWQA 1CUFA 5JARA 2QRUA 3WWOA 2Z8XA 1U65A 4UHHA 5F4ZA 2J3DA 1GPKA 1X2EA 2FJ0A 1ETHA 2BUCA 1GKKA 5FRDA 4H18A 1XKLA 4MWSA 5ALZA 4X85A 2PSDA 4P92A 3FCXA 2XLCA 4ZV9A 1Y7HA 4PV7A 2OPHA 4QLAA 4W9RA 3R3ZA 1H2ZA 4M0EA 2GBIA 3GELA 1HBJA 1LPBB 1UK6A 1EXWA 5CH5A 4GBGA 2QJRA 4Q05A 4X00A 1P0QA 1G5FA 2RHWA 4F21A 3I2FA 3PFCA 4JEIA 4WFIA 2BJHA 1F0PA 1Y37A 2O2GA 3C5VA 1LBTA 1VLQA 2OQIA 1W1IA 2ZYSA 1C7IA 5LLSA 2WQZA 1YAHA 3WA6A 3MUNA 5CXUA 4B81A 2R11A 1LPSA 1QIFA 4Y2RA 3PFBA 4E15A 2GZSA 4ZV7A 2AJBA 1BN6A 1UK7A 2X76A 1HDEA 3C6ZA 4QA9A 1XZDA 1QTIA 4HXFB 5A7GA 3STXA 5DYWA 2XQFA 3NWOA 4OUKX 3WYDA 4DMFA 2ZJ7A 1QFMA 2LIPA 1P0IA 3G9XA 2WHPA 1LZKA 5AOCA 2O7RA 3FYUC 4CCWA 5JZ9A 4K6GA 5AJHA 2ZJFA 3EQ7A 2YASA 4QDUA 1H2WA 1XRNA 5I7UA 1ZD5A 1H22A 4BDSA 4ZI5A 3ICVA 4FHZA 1MNAA 1BS9A 1UKCA 4BVLA 1Z68A 2G5PA 1CUEA 5LYYA 3ZI7A 3OC0A 4BTLA 4LIPD 1K4YA 3QMWA 4YK7A 4UHDA 4UBMA 4PO3X 2XQKA 1BRTA 3FYUA 3C70A 3ZV7A 4YX9A 5DJ5A 5ALDA 4BAZA 1GPNA 1AURA 2DQYA 3D0KA 3QBJA 4AO6A 1T2NA 1N5MA 3CCBA 2DHCA 5LZ4A 3WWPA 4BRSA 4GXNA 2XMRA 4C4XA 2WTMA 2H7XA 5YASA 1F6WA 2GBCA 1I6WA 2XUFA 3F97A 2ES4A 1VXRA 5AKZA 4DNFA 2JF0A 4QWWA 5HK8A 5HKAA 4EZIA 2QKYA 1UOQA 3OTQA 4BATA 1R50A 4EY4A 5C8ZA 2EDCA 3B12A 1FFBA 4X91A 1DX6A 1SFRA 2O2IA 1W76A 4W1SA 4PF1A 3C6BA 5JYCA 1EX9A 5DNVA 1CPYA 4IH9A 2OXEA 2QMQA 1ACJA 5DNWA 1XRLA 2DFPA 5ALXA 4DTCA 3F9CA 4A16A 1J07A 2GYVA 5EHNA 4LHEA 4UHBA 4B9AA 5A7FA 1LPMA 1BU8A 3F96A 3WK7A 3AZPA 3I2JA 3NUZA 2ZYRA 1NU8A 1MN6A 4Y2UA 2WG0A 1JU4A 2ZSIA 1EA5A 3D3NA 4MEBA 4H7EA 3M83A 1VZ2A 5DLPA 1XZKA 2QZPA 4EY6A 5T4FA 1OILA 4H0CA 3HC7A 3X3HA 3GFFA 3IUJA 3L1IA 3D4LA 3FLAA 2ZSHA 4MEAA 2RONA 2JEYA 2OQVA 4B83A 4LXIA 2RIPA 1KEZA 5CT4A 5AM1A 3IA2A 4H35A 1TCCA 1K5PA 4Y2YA 2B61A 1U4NA 4QDTA 4CI9A 5C7YA 1QIIA 4KAJA 3ESDA 2BCEA 1WPRA 4EY5A 3H18A 3W9BA 1ZJ5A 3QMVA 3VJMA 1DWPA 5JAOA 1VA5A 4Y2PA 2QOEA 4QE3A 5EHQA 3WK8A 5DYYA 4KRXA 4H77A 4Q3KA 1BE0A 4UBOA 1UZAA 5LZ5A 3D2AA 4X92A 4H7FA 3UMJA 4HZGA 3DKRA 4CIAA 3W04A 4KR0A 1R1DA 3ED1A 3GBSA 3BWXA 4N8SA 1DQZA 4KAFA 5ALHA 1QJ4A 4BZWA 3WWDA 4HRYA 2C4HA 4EY7A 4ZXFA 5LZ8A 4AO7A 2XMDA 1ZGCA 4AZ3A 4FMPA 3AZQA 1WB5A 5JALA 4XVCA 1S8OA 4GWLA 5AI9A 4GLBA 3WMRA 5ALLA 4LKOA 4P9NA 3NGMA 1CUAA 4A5SA 2B9VA 3WL5A 1QO7A 3TJMA 1EDBA 1O6FA 2QXUA 4ZRDA 3SX4A 5A7HA 2OG1A 1CUUA 4HXEB 4X71A 1ZIYA 5D7BA 4K6HA 4U2EA 2WHPB 3D2CA 5FXMA 3HSSA 2XUJA 1UOOA 5AM0A 4YPVA 4B82A 4G8CA 3G7NA 3DD5A 3HRHA 1JU3A 2QM0A 3UUEA 4I3FA 3HLKA 1CUCA 5ALMA 1JFRA 2XUHA 2WJ4A 5SYNA 2Y2UA 5D6OA 3RM3A 4EHBA 1TIBA 2VAXA 1WB6A 3C6XA 2JGIA 5FDFA 2ROQA 4ARAA 5AK6A 1NX9A 4ZWNA 2G4LA 4LYDA 4EA6A 3TRDA 4BP9A 3E0XA 4CG3A 5A2GA 4X7BA 4B80A 2WFLB 2VEOA 5CH8A 5AKYA 4Z49A 5JD6A 5LIPA 3G0IA 4C4YA 3VKFA 1TAHA 2RI6A 2QVBA 5LKAA 2BFNA 2FX5A 5AOBA 1K6EA 3QPCA 5ALGA 3A70A 3IUNA 1WHTA 5FUMA 1MTZA 4PW0A 3WLAA 2UZ0A 1T4MA 3AILA 4KRYA 1JMYA 2VF2A 4RPCA 5E4YA 1QIKA 1QO9A 3KWJA 1XQWA 1E66A 2JGEA 5AK5A 3QM1A 4JNCA 4PSUA 3AIKA 1QIJA 1DT3A 5ALJA 3E4DA 4L9AA 3BF7A 1XROA 5AIBA 2ZVDA 3D59A 5JASA 1F8UA 3WKCA 3DS8A 5AKXA 3WL7A 3VXKA 4X3CA 3KOOA 3G0BA 3G8YA 4GW3A 3I1YA 1XKTA 2WSLA 2OAEA 3HEAA 5BWCA 2WIFA 2G5TA 2PX6A 5DWDA 2HL6A 1E3QA 3WWEA 3FYUB 5EIHA 4N5HX 1Q84A 4F5ZA 4B0PA 1TQHA 1Q0RA 5FP0A 5C81A 3FOBA 4H7DA 1JMKC 5AI8A 2VJCA 1HPLA 1XZLA 2HU8A 3A2LA 2J4CA 4BCCA 1U8EA 4X94A 4EB0A 3LCRA 5K3AA 3HYSA 1UXOA 1MPXA 3WKEA 4WY8A 4AMYA 3IBTA 5CMLA 1Q0ZA 4PNZA 5JZSA 6YASA 1F0NA 1MT3A 3PICA 3EQ8A 4DYHA 3BJMA 3KXPA 2XMSA 4WDRA 3YASA 3O4GA 4Y7DA 1QGED 4G4GA 4FNMA 1H2YA 5CRIA 4KACA 2VATA 2XUQA 1P0MA 2FJPA 5AIAA 5EIEA 2J4FA 1EH5A 5IVKA 4OSEA 3QITA 1GPLA 4W1PA 2OCKA 3BJRA 1THGA 2PL5A 5AM4A 4J3JA 2IIVA 1ODSA 3H2KA 3DOHA 2C0PA 3PE6A 5HF6A 1LNSA 4TPKA 2PSHA 3WWCA 4ETWA 4DGQA 1GXSA 4GECA 5HK9A 1W52X 1ZIXA 3OURA 4UBKA 1QIEA 2AJ8A 3U0VA 1CIJA 4G8BA 4H7JA 3OG9A 2ORYA 3BE8A 1IMJA 3WIOA 4UFOA 1XRMA 4DSZA 1AGYA 2NW6A 1SCIA 1SCKA 1UOPA 3WYNA 3G9UA 4IHAA 4HAIA 5D3KA 2JBWA 2PKYX 5EI5A 2AXEA 1Q83A 2HRQA 1XLVA 1ZGBA 4K2AA 3H2IA 5ALKA 2GYWA 4IO0A 4UBIA 3JYHA 2C0QA 2V97A 4HRXA 4FLEA 4RNCA 2WUGA 4G5XA 2HADA 3G02A 3JWEA 2XE4A 1CEXA 3DLTA 5HQ3A 4ARBA 5CBKA 2Y6VA 1SC9A 4P93A 1CLEA 5ALWA 3STVA 2WUEA 4AX4A 3IURA 2V98A 1KU6A 1G66A 4E14A 2VTVA 2EEPA 4CG2A 5K3CA 5JD4A 3FVTA 1R3DA 5E2IA 5ALQA 3F67A 1OXMA 2H7YA 1MX9A 3DQZA 4AO8A 1DT5A 1EI9A 2WUFA 4K5QA 2XMQA 2HA4A 3ZLVA 1RYYA 1VZ3A 4CCYA 1MO2A 3RKSA 1N8SA 1TRHA 3DKKA 4FBLA 4DNOA 3C8HA 4J7AA 1AC5A 1HKHA 2Q0XA 2WLSA 3I6MA 4BYMA 3S8YA 4L72A 2H9YA 3I6YA 5AM3A 3VDXA 3IDAA 5AKIA 1L7QA 4Y2TA 3IUMA 7YASA 2QTBA 1JJIA 1LZLA 3HZOA 4CFSA 3ESBA 5BOVA 2K2QB 2P8SA 5K3EA 1EK2A 3STTA 3FYTA 1AMNA 3VVLA 2CKMA 2CMFA 3A6ZA 5AKEA 2HDWA 5CURA 2VAVA 2WIDA 2XUDA 1WCYA 4B0OA 1CVLA 5K3BA 3G9ZA 2C58A 4N8EA 3PUHA 4KE7A 1LPOA 1XZFA 1XZJA 3BDIA 1QZ3A 3G0GA 4V2IA 2Z8ZA 4LYEA 3DYVA 3WK5A 4Q82A 3CN9A 1E8MA 2HA3A 1YS1X 4N8DA 3U1TA 3TGLA 2XUOA 4DNPA 5JAHA 5K3DA 3AJAA 1XRRA 4U2CA 2Y6UA 1DWOA 2Y2VA 3QMMA 4DIUA 2HA0A 1QLWA 2XUGA 3I2GA 5AI5A 3DOIA 1W75A 1XZBA 4JYMA 4KE9A 4ZGBA 4F60A 2WUDA 1QIMA 2VT7A 3ILSA 1BCRA 4MYDA 1EK1A 4FFWA 4BVKA 3WI7A 3VISA 4BC1A 1TKRA 1YA4A 3GA7A 4J0CA 1A8QA 2PU7A 2VSQA 1GQRA 4NVRA 1UFOA 4BCDA 5K5EA 1ZD4A 2AJLI 2C5FA 4DSAA 1A88A 1M33A 4BP8A 4BRZA 2DHEA 2ECFA 1ORWA 3CN7A 3HACA 2VA9A 1N1MA 2QS9A 4QDXA 1JJBA 1E8DA 4QDZA 2RGUA 3C43A 4FTWA 4DMHA 1HL7A 2HU7A 5ESRA 4WDQA 1VJ5A 4NMWA 4UPDA 2Y1KA 5IH7A 3PI6A 1CUSA 2Z3ZA 4AB1A 3CXUA 3Q8WA 4B85A 1YR2A 4FWBA 1KU0A 1U2EA 5JD5A 4MQMA 1VXOA 3KWFA 1TCAA 4M0FA 3W06A 3R40A 5A71A 1QIHA 3SC2A 5AHXA 1XZAA 5AK3A 1H2XA 4OYLA 3L1JA 3R3XA 4BVJA 1MJ5A 2HHAA 3VJKA 5CT6A 4H7KA 3DL4A 3R3WA 2V96A 4U2DA 2WKWA 4MQLA 3HI4A 4TGLA 1ZOIA 3K6KA 3N0TA 4BB0A 1DQYA 1DX4A 4GEGA 1FFEA 5K3FA 3BXPA 4B84A 2XQIA 1XZCA 4B7ZA 3WK9A 3DJYA 2HIHA 1NU6A 4Q3OA 4A23A 3W05A 3Q0TA 5JAUA 4OB6A 4JUIA 4U2GA 4DMKA 3DYIA 3EF3A 1USWA 1B41A 1ZI6A 1FFAA 1LLFA 1G4HA 5LKRA 1RP1A 2XMZA 3QPAA 3LIIA 5AH0A 4OCZA 2JIDA 4Y2VA 3FVRA 1IUOA 3LIPA 2CUTA 4MWTA 2H1IA 2DQZA 2C5GA 1SCQA 1AX9A 2QT9A 3L1HA 4MJ3A 4OB7A 2YH2A 4CCYB 3ZLTA 1ORVA 3D2BA 1E5TA 3UUFA 4EBBA 4WY5A 5IVDA 1A8UA 5JIBA 4MYSA 1ODCA 5CH3A 5IKXA 4J0HA 2OAGA 2YXPX 3E1GA 5LZ7A 4EY8A 1PFQA 4AN0A 2HFKA 1CUHA 1K8QA 1ZI8A 3MGAA 3T4UA 3HJUA 4BDTA 1XZHA 3C87A 1UT6A 1JI3A 1QE3A 4BZZA 3RARA 4QNNA 4KEAA 2XT0A 3R3UA 2RHTA 2H7CA 3H19A 4I4CA 3I2KA 1CUGA 1DTEA 3OOSA 4M0MA 1R4ZA 2WG1A 5EHZA 1LPPA 1J06A 1CUWA 3E3AA 3HXKA 3I2HA 1MX5A 1YA8A 4D9JA 5AI0A 5BWBA 4G9GA 4HVTA 2PSJA 1PJAA 3WKAA 1MAHA 4Q1VA 3FAKA 4XIIA 1LPNA 3O0DA 4U2FA 4BC0A 1YS2X 1XZMA 1H23A 4XWGA 2R8BA 2HFJA 4JH0A 3IIIA 2DHDA 5IVIA 1YB6A 5FPPA 2BGNA 2HA2A 5AOAA 4OYYA 4WFKA 5ALYA 3R41A 3MVEA 3T52A 2IITA 1J1IA 4UBLA 3KDAA 3A2MA 4G4IA 1WB4A 2CZQA 5ALUA 4BAUA 4X6YA 4OB8A 1VA4A 3N2ZB 1AQLA 1J2EA 1ZJ4A 4E46A 4RE5A 1L7RA 1QOZA 4Q34A 5HF8A 5T4BA 4EUSA 4OU5A 2VQ6A 4Y2XA 2PBLA 4UFNA 4UBNA 5KWIA 3R3YA 1ZICA 4C4ZA 5AKKA 4UHFA 1CRLA 5ALEA 2XMGA 3TEJA 2PU5A 2O7VA 2X5XA 2HU5A 5AP9A 3A2NA 2BGRA 1XZEA 1GQSA 3EQ9A 3ICWA 1PV1A 1ZI9A 4WJLA 1A7UA 1UK9A 4BE9A 4BE4A 5AM5A 2X8BA 5AKHA 1QONA 4CG1A 4H7HA 3C6YA 2XUPA 2WHQA 4B6GA 2GZRA 5EHXA 4U2BA 1E89A 5ALNA 2Z5GA 5FKJA 1AKNA 4NS4A 1CUIA 2WU4A 4INZA 3C5WP 1QIGA 1P0PA 3PDCA 4J0GA 1R88A 5HF5A 4G1FA 4HTAA 1CQZA 5FPQA 2WFZA 3PF9A 3PF8A 4OPMA 4BTVA 2XUIA 1LBSA 1EHYA 3ESCA 3R0VA 3DL7A 3V1KA 2VT6A 4IH1A 2HA6A 1CUBA 3WL6A 3BDVA 2B4KA 2OCIA 4YASA 3WL8A 1VE6A 2OGSA 1XLUA 4X95A 2ONCA 3M3DA 5H3HA 5T4EA 4E11A 1WM1A 1YASA 2W6CX 5AK4A 4FLFA 3P2MA 3FWHA 1YCDA 4AXBA 5FV4A 5CT5A 1CUYA 5SYMA 2BUAA 2PSEA 2AJDA 1JJFA 4J0KA 1CUZA 2JGJA 3GUUA 3QH4A 3STUA 2JGMA 3BIXA 1MAAA 4BAGA 2ACEA 4I19A 4ITVA 4HS9A 3QYJA 2I3ZA 3R3VA 5C8XA 5LZ2A 1CUVA 3WIBA 1XQXA 1ACLA 2OCLA 2PVSA 1CFJA 4BBZA 2WIKA 2DCMA 3BF8A 1JT2A 2PPLA 1EDEA 2BUBA 3WZLA 4Y2SA 3V1LA 1L7AA 1C7JA 4J0IA 5JZBA 1BN7A 5AI6A 1DINA 5AKLA 3V48A 4C89A 5ISMA 3DEAA 1ISPA 4FDMA 2JGLA 2EDAA 2XUAA 3O95A 4WFJA 2IX9A 5C8VA 3FSGA 3WK4A 4W1QA 1R9MA 2HM7A 3QVMA 1YB7A 4TVKA 3WJ1A 3STWA 3G0CA 1ZD3A 1A8SA 3B5EA 4QDOA 5AICA 3WK6A 3ZPXA 2QXTA 5A62A 5KBYA 1W6RA 3AIMA 4BCBA 4AN1A 2QR5A 4OU4A 5DNUA 1ZD2P 4N5IX 1XRPA 2XQJA 2PSFA 3I2IA 2D0DA 1G42A 3AUKA 2VJAA 2GYUA 1EB8A 1THTA 5CW2A 3W9UA 1XRQA 2J3QA 4RGYA 4C87A 4UHCA 2FUKA 1X70A 3V9AA 1B6GA 2PM8A 1FJ2A 2QJWA 2I78A 3FBWA 3DNMA 3O9MA 4DLNA 3WA7A 4KE6A 2QUAA 2XI4A 4PQEA 3OM8A 4LXGA 1K63A 5HZGA 3M81A 3AFIA 4G9EA 4J0DA 3STYA 2OCGA 2W22A 3C45A 1Y7IA 4X90A 3D5EA 4FFVA 4KE8A 1CUXA 2WIJA 3QZUA 1HLGA 1YAJA 5CT8A 4LXHA 3DDUA 1IZ7A 3B3QA 3QPDA 4XJVA 5LZ9A 2WILA 4X97A 3WKDA 2V9ZA 1JKMA 1CUJA 5CTAA 3G0DA 2WFLA 4UBJA 2ACKA 2HA5A 2XLBA 4W1RA 5I9IA 3F98A 2CB9A 4UFPA 3K2IA 1HQDA 4AZ0A 3EIOA 5T4HA 3FCYA 4ROTA 4QEKA 3FSGD 2VJDA 1VKHA 1CV2A 1EINA 3G9TA 3LLCA 1OCEA 1UK8A 5KWJA 4IQ4A 2JGFA 3EBLA 4MXDA 3KD2A 4S0XA 4X93A 5JANA 5HQ3B 5CT9A 3FLEA 4C01A 3H1AA 2PUJA 1EVEA 3RK4A 3NOXA 5AO9A 5EIAA 1W4LA 4B9EA 2O2HA 2DSNA 3IVMA 3FNBA 3PUIA 1E8NA 3JW8A 5J3JA 3ANTA 3AZOA 1CUDA 2JGKA 1AUOA 1IVYA 5AI4A 2JEZA 4XX1A 3I1IA 5I8PA 1FFCA 5EFZA 1GT6A 1IZ8A 3WZMA 5E4TA 2WJ3A 5KREA 1GGVA 2BAGA 4JYPA 5K3FB 1VOTA 5JATA 1EVQA 3ESAA 5ALPA 3H2GA 4O08A 1BROA 5BV7A 1AZWA 1WHSA 4GDMA 1XFDA 2PUHA 3H1BA 4WCVA 1XZGA 3H2JA 4K6KA 2ZJ6A 1IUNA 1FFDA 1LPAB 3H2HA 5JADA 3O4HA 2AJCA 1GZ7A 2RAUA 4DMCA 4OD0A 5FLKA
chains in the Genus database with same CATH superfamily
1W1WA 4NNJA 2YL2A 4L57A 3VZSA 2XVXA 4EKGA 4YUAA 5D3ZA 3BUSA 4XKJA 4FUTA 4PVDA 4RZHA 2GKGA 4UXHA 4RX1A 4H4CA 4WK4B 5EZ6B 5T3UA 4RNDB 2WJAA 2PUCA 3N8HA 3F1KA 3Q7RA 3L7DA 3Q3EA 1OFGA 3DMNA 2XUKA 5C0OE 3ASYA 1U8XX 2YFQA 2H5IA 2B20A 2J7KA 2B5WA 1FIUA 3GFQA 3MUOA 4UTOA 1EFPB 1F2TA 1MMFB 3TK1A 3K9HA 4ID9A 4C6HA 2XRZA 4CMKA 4KHPB 4R2HA 1PG5A 1SVUA 2GZ2A 5FBWB 1KK2A 4BEWA 2WSIA 3RHTA 3TLZA 4EKNB 4KV7A 1T9GR 4F3KA 1DCKA 5F9HA 3HU2A 1D7AA 3M49A 5CK5A 5K4HA 3E5RA 3UKJA 3RIHA 2V7GA 3FFWA 1XEWX 3BORA 5DGIA 1PZMA 1YZHA 3UV3A 3HKEB 2GA9A 1CJCA 3O1LA 3IVAA 1H8ED 3Q2KA 2ZB8A 1QYXA 4M6WB 5BVGB 4N76A 3NDBB 5JQGB 1GPWB 1N4AA 4TT3A 4IH4A 4UOEA 1S8FA 2GH1A 5IUNC 5CXXA 5ALFA 9MHTA 3CF6R 3BA1A 3HA2A 1NMSA 1XXHA 4L0QA 1XCJA 4I2NA 2JIZA 2HA7A 4GP9A 1YH3A 2X1MA 4LWZA 4X9XA 2O0KA 3BXXA 4FR0A 4JT2A 1BJTA 1LGYA 3KTFA 2O7QA 3AQIA 3G2PA 4KDCA 3ZZUA 1GAQA 3V1TC 1WPXA 1XTJA 4FLMA 3L5OA 4E5VA 5KVCA 1C9YA 4FT2A 4IHJB 2CW5A 4MS3B 2V3WA 3G2OA 1SOMA 1LCIA 2Y0BA 5AVXA 4ZEVA 3HBMA 4Q02A 2TS1A 2HO4A 1QK4A 1BCSB 1FLAA 3OFKA 3U3OA 2GEFA 1RT9A 4NY1A 2AOTA 1Y81A 1ISGA 1QZUA 2VCYA 3BIWA 2YVLA 5ALOA 4CGZA 3ON5A 4HWOA 4FBMA 1MQ9A 4A8TA 1YBMA 3WYGA 4TXNA 2YXLA 1II8B 4RZIA 4F2WA 5JLAA 3FOFC 1N32B 3ONDA 2BGTA 4DA7A 4KITB 2CC2A 1M2VB 4Y0VA 3E8MA 5CB0A 3NAMA 1VMAA 1PG0A 2EV9A 1IUPA 2ISSD 1L7NA 1FOEB 4TZTA 3DM5A 1QGAA 1Z4MA 1G4AE 4ZCPA 1SVLA 4DIEA 2XYPA 4BWVA 2HRZA 3RVSA 4GOLD 5L4SA 3VU1A 2CF5A 3HS3A 1JIQA 2WDPA 4H3KB 2G4VA 2PVCA 3DZHA 4G4JA 5C1IA 1BVRA 1I7NA 4P6VF 5KYKA 4Z0TA 3DE6X 1MOPA 2XB6A 4IZIA 2H6EA 4J8PA 4LDPA 3N5KA 3MTGA 5DM0A 3SLKA 1P1JA 2MT9A 3CRRA 4G8DA 4LHXA 1JLSA 5KTPA 1UJ2A 4EHLA 4HP8A 2I3DA 2ZYHA 2YYSA 3BTSA 1FF9A 2HI0A 2PAAA 2JLCA 3HBFA 1BXZA 1D07A 1MX1A 4FOLA 3BH7A 4K1XA 4WT7A 1EDZA 3AEUB 1GXSB 2CMHA 3K9BA 3TLBA 1GDTA 2QD2A 2WFMA 1Y7PA 1QLJA 5E7MA 5LB4A 5TS3A 5C7OO 1NW7A 2XYQA 1KRWA 3ELDA 2VXYA 4UAUA 3BK2A 3LP5A 2Q1UA 4MA4A 5KKAA 4EYGA 3G6WA 3AUAA 5KU1A 1E92A 2I2WA 2ZQYA 1M7GA 4QZVA 3LF1A 4C3OB 4D3XA 1C3OA 2DMRA 1DAOA 2I99A 4KQ6A 4D9HA 2XCSB 4PZUA 3MS7A 5HRUA 3T4PA 2J87A 3VU0A 1RAGA 3H5LA 3P0RA 1MOZA 1Q1ZA 2J09A 4CF4A 4N0QA 4AU1A 1YQEA 5A6VA 2OHVA 3SD7A 4KLNA 4EG1A 3AIOA 3K5WA 3ZWXA 4C43A 1JFTA 3GDGA 2WM2A 3UAOA 5T64A 3TZKA 3ZLUA 1GZUA 3EYAA 5B7QA 1J5EB 3RS0A 3O21A 3FCUB 3N74A 4TKZA 1UKAA 1Z2EA 5EOVA 1KVTA 4Z1MA 4U8GA 4MYRA 2WG2A 3SSOA 4BZPA 1HT3A 3AXTA 5LOVF 1VG1A 3HP1A 2CSXA 1V4VA 1WJGA 3AHGA 1XP5A 4YT2A 1I9CA 1ZNXA 4PSCA 1GT91 3KPVA 1EGVB 2Y1FA 2VUUA 1G9SA 3FAZA 4D8XA 3AB8A 4FYMA 2EFEB 4QBIA 1AUPA 2PX5A 4WA8A 1KIFA 1EGMB 2P2LA 1XTZA 1E3DA 2IHVA 2RC5A 5I5GA 3OF2A 3Q3IA 5ALVA 5E4FA 1AD2A 2E4YA 1TAGA 4RVUA 1CIPA 3OH8A 2Q0QA 1DUVG 1ML4A 3VR1A 3QXHA 3JWHA 4GHWA 3MWJA 3EZGA 4V39A 5KHLB 1M10A 1EDOA 1P1RA 1WZIA 1CEYA 3DPSA 2WHRA 5TJHA 1Z22A 1FNDA 5KJFA 2VTBB 1URPA 2D1SA 2D59A 5HA5A 4C22A 1BEZA 2QIOA 3H17A 4IQGA 4IW3B 1FP7A 2RG7A 4IIJA 4C4SA 7REQA 3D7RA 4PRYA 4OXYA 4RXUA 1Q92A 4HVAA 3OHSX 4N3BA 1MIOB 4ZCLA 1ZK1A 1RAAA 4D4JA 3KUKA 4F85A 1FNBA 4ZDWA 2A33A 3HI6A 1ZINA 1VMDA 2FZKA 3CW2A 4HSEA 4J0QA 3W3AD 4RVCA 3Q7QA 1S7CA 3LU1A 1OTYA 3SF8A 5BW4A 4WX2B 5LJLA 2UVPA 2J6BA 1RBQA 2WJ6A 5KZMB 5B3AA 3I28A 2IIPA 2LGJA 4YIHA 3A4LA 2H06A 2D06A 4ZVUA 1WUIS 2FRXA 2JFQA 2FXIA 3ELYA 4G4SO 4QWMA 3UUGA 3AYZB 3UJ6A 1VJ0A 2FQYA 3DW1X 1KGDA 4R31A 2XYRA 3ABZA 1N6OA 4X7MA 2ZRBA 4S24A 1R74A 2CXUA 3VC1A 1Q6ZA 1K6IA 3HEMA 2B94A 2ZYIA 4S35A 1F8YA 4LQ4A 4YP1A 4B6OA 1WBBA 3KB2A 5HFNA 3FZGA 1VL8A 2REOA 2QNRA 3GLGA 1TUEA 2B83A 2WOJA 5EZ5A 1YULA 3DTVA 5FULA 4I99A 3HKDB 3ZWQA 3NU1A 3X1XA 1EUYA 4GOND 4A9AA 4BMZA 5JARA 5E2AA 2QRUA 4H4EA 1GPYA 5JQGF 1CULC 4V0QA 4KIWA 3JWJA 2V5VA 1Y9JA 2QRQA 1OLSB 4Q4HA 4TQUS 1MRZA 3WGGA 1DP4A 4MO9A 3CVJA 2QYHA 1RTTA 3CX3A 2BUCA 1TVCA 3BG5A 4KX3A 4LRQA 3M1AA 1BFUA 5ALZA 4UM5A 2NU8B 2Y76A 4P92A 1GTZA 1FS6A 2Q1YA 3IVXA 4AUEA 4IVRA 3EG9B 3GLHE 3Q8XB 3LFHA 2OPHA 1FXSA 3PNQA 3NC0C 4QLAA 4D81A 3SBDA 5KNDA 1BMFA 1JAZA 3HPRA 4A8JB 3RJTA 3KT8A 4P3KA 1G21A 1ENPA 4OX9B 2QA5A 2W43A 5K2OA 1H2ZA 4IOLA 2GBIA 1GUBA 2O5VA 5A3JA 4BNJA 1ONOA 4GNRA 3WLHA 3ZU2A 3OFNA 4NYMR 4HNGA 2Q2QA 3HKEA 4HEQA 4PZCA 2PBZA 3BGWA 3RE1A 3FB4A 4ETMA 3NDRA 4G5RA 3MERA 1PKEA 1MC8A 1DV2A 1RC0A 2O0JA 2X19A 2XBLA 2FRDC 1SG0A 1AVTA 1EAYA 5MN5A 5BSHA 2ZRNA 2CNNA 2Q2OA 4J4TA 3G3EA 4O8ZA 4RIHA 3SQWA 5T5QA 1EMDA 2HQ1A 5DEIA 1UMBB 3EF0A 1T9DA 3I2FA 3CVXA 2OV2A 2CF6A 4RLSA 1ZCBA 1KPHA 1O5OA 3H3JA 2OO7A 3KHSA 1F0PA 1PK7A 1Y37A 1JDSA 2O2GA 3C5VA 3W9YA 4C5AA 1LBTA 3WP1B 2GCGA 3TTVA 1V26A 3E9ZA 3F5DA 1PSDA 1W8IA 1W1IA 1YJBA 5FPSA 4ZT3A 1EEXB 2KW5A 4ZGWA 5DM2A 4ZC1A 1LVUA 4FW9A 5AW0A 2C9ZA 4M1ZA 5IC6A 2V7TA 1AUXA 2WI8A 1YAHA 3FRJA 1EHIA 2B4TO 2C95A 5DYGA 4R1PA 2QP9X 3PHGA 1A98A 1G59A 1XNGA 1ZH0A 2E1PA 1LPSA 1YOVA 4I08A 5KTKA 3FKJA 4KMSA 2H07A 4C3VA 2RGBA 3ETLA 3JQBC 5BUZA 3AL3A 3AHCA 3AJ9A 4E15A 1VC2A 1G41A 4J1QA 4FJ1A 2NZ8A 2A9KA 2PGNA 3M3HA 3FNGA 1AQYA 5E1DA 1NMYA 2OBLA 4ZV7A 4HWSA 4E07A 1UF9A 2VSXA 2CHQA 4JX8A 4MLPA 1S89A 2PRJA 2W6OA 3LW7A 4IILA 3C6ZA 3LZDA 2ZIFA 2CLSA 1XZDA 4WBSA 1F8GA 2E21A 4WCFC 2JZCA 1T5TA 2AYYA 3GJYA 5D1NA 3NBKA 3R9WA 1VJGA 1SC1A 1YIOA 2BH9A 2XE8A 5B6PA 2XQFA 2A6PA 3ZS8A 1PP4A 1GQ2A 4HS4A 4R8LA 3NWOA 2ZWVA 1EP1B 4OUKX 4ARUA 1K7CA 4DMFA 2FK8A 2LIPA 5BN5B 1P0IA 1EFRA 3KZVA 3MD9A 3JYNA 3RS9A 3VJRA 3QHPA 1XDDA 2O7RA 3ML1A 4FIZA 3CPSA 1N33B 4X1KB 2IH5A 3LYUA 2A5GA 2XZLA 2PMBA 4NYIQ 1O3YA 5AJHA 2WKQA 3J7AC 4I6JA 2YASA 1P77A 1UPUA 1H2WA 3UC9A 1O6CA 1G0NA 3U4GA 5A5FA 3RRMA 2YICA 3VR3A 3FPHA 3SAJA 3N2IA 1CS0A 4R8VA 2P2NA 2WJJA 4QXAA 3ED5A 2CVPA 1RI2A 1XRNA 2D1RA 4F4HA 5I7UA 5JY1A 3BPSA 1MXFA 3OZWA 2LD4A 1B0UA 1CR2A 3UATA 2QI9F 2RHJA 2BBWA 4PLYA 5E8JA 5JZOA 1MNAA 2A9RA 1L5FA 3PU6A 4FHZA 2FLKA 4AURA 1J99A 5ICGA 3GP3A 1XZ8A 4GRAA 2O1WA 2IX3A 3RC8A 4F97A 1N5LA 1C1XB 2HHLA 1CUEA 4JP3A 5J2TA 3OC0A 4MSUA 1V71A 3L7BA 3LPLA 3GLIB 3F6RA 1FCJA 3VFDA 4V0RA 4HAOA 4C3UA 3QUBA 1I4DD 1PRYA 2OFPA 4HDNB 1C30B 3MTEA 1NOIA 2IYYA 5IARA 1M7HA 2V45A 4UHDA 3FNIA 2PYZA 4LF9B 4IR7A 4UBMA 1QHHB 4PO3X 4KPUB 3ZYZA 2XQKA 2V7QD 4B4VA 4BB5A 3UMYA 4TKVB 5JXIA 2REQB 3M6UA 3ZV7A 4YX9A 3HB9A 3FPSA 1HF3A 3A4VA 1RM3A 3AEKA 3CZMA 4GP6A 4GXTA 4YJFA 5DJ5A 5ALDA 3R8XA 4CEHA 1DFIA 1FUYB 2G04A 5CD9A 2NP7A 3O82A 1M0EA 3A6HA 3DUFA 2ZJ2A 1FMCA 2Q5EA 5CFRA 1EXMA 1YCFA 1ZGJA 4KQ2A 4PX9A 3RQIA 3ZW9A 2ID7A 1IU9A 1BD3A 3JQAB 1L2TA 3E9MA 2C83A 5AJXA 1HR0B 4GXNA 3RU7A 3QXJA 4WKBA 3A9WA 2Y05A 3CYFA 3WL4A 3MMXA 4A0GA 2ISQA 1VG0B 1NKVA 2BRUA 1Z5UA 3RNLA 1JLLA 4ND3A 4UVEA 4FD2A 1E6KA 2FPLA 1YVEI 1VXRA 4K6FA 2AEMA 4QU0A 3PTZA 5CIQA 2ZP1A 2Y4NA 3CSSA 2OZKA 3FPFA 2C78A 4NS1A 3TSWA 1KC1A 2DLNA 3NHYA 3ETDA 4BBAA 4MGIR 1RC8A 3IEMA 1MHPA 2GEKA 3C5EA 2FR1A 4KZKA 2F4NA 1C8VB 5AW2A 3W6ZA 1NYTA 2VL7A 3LQRA 4HBZA 5F7JA 5KUTA 4PGGA 1QO0D 3TTSA 2MOKA 1CY7A 4POAA 3G88A 2XH8A 1R50A 3JSAA 3MZ0A 3A8TA 4FMCF 1X9IA 3B12A 3WNVA 4H1TA 2KWIA 1Z15A 2GA8A 2QW0X 4MZXA 1PK9A 3EQ2A 1ZLXA 2O2IA 3RYFB 3T9CA 3PPIA 3ZE9A 4PF1A 3LL4A 2AMVA 2Z5LA 2Z4SA 4QUKA 2BISA 5BYAA 1U8UA 1OLXA 3DLCA 5H0IA 1RPNA 3KR0A 1FXWF 3FUXA 4EF4A 5DNVA 1VB5A 1KQPA 3PCTA 1F6DA 4NWIA 3SVLA 3W2IA 2OXEA 3CEJA 2GBPA 1UFQA 4GMGA 3U9TA 3K6SA 1PZGA 2A4KA 9ABPA 2WZBA 2I2FA 1FP4A 2QD3A 4IWXA 3PFHA 3C3MA 2Q1XA 1M6HA 2BV3A 1L8QA 2RGRA 3FFXA 5ECWA 4E3WA 1JEEA 4RL6A 4J49A 5CM2Z 2E9SA 5EIWA 3SS8A 1RM4A 4DTCA 2I4RA 4HMQA 2NO0A 4Q15A 1J07A 4E51A 5BURA 5F35A 2RDMA 4LHEA 2VOEA 4UHBA 4ZZ2A 3W4JA 4B9AA 1P4HA 2IODA 2IYAA 2EX1A 3MCWA 1IEVA 2QVZX 1YE3A 3OE7D 4ZP1A 3RU9A 3ZV6A 4Y6RA 2O8DA 1FLNA 3N2LA 4JEMA 3IE1A 4PZ0A 3BICA 4YAJA 3G5MA 4O4IF 4UDNA 1JU4A 4ZT6A 4CMIA 3IP9A 4MVXA 1L9KA 2P5UA 4JELA 3D3NA 4O2BB 5C34B 2UYYA 2BKVA 2BFEA 4UUOA 4MEBA 3C3JA 2DSTA 1JR3E 1OFTA 1XZKA 3D9QX 2QZPA 4GR9A 4DYDA 4YPFA 3KT0A 4FYJA 1T91A 4EQ6B 1A9RA 3K5HA 4PYLA 1QVVA 1E1MA 1PWHA 1TTPB 1K7SN 1OILA 1X9GA 3G23A 3K15A 2VRBA 2Q9UA 3HC7A 1LLUA 3TBFA 1SVSA 3JQBA 5K8LA 5LYJF 2CXRA 3LUCA 3K2EA 3NCTA 3GRAA 4M21A 5AW4A 2YOHA 3D7KA 1RXYA 1Y5RA 2R1TA 2E7ZA 2W6JA 3HVKA 1SKAA 4Z4CA 5KSWB 1JLKA 3GUCA 1L6RA 2ZWIA 1WXEA 4V1CA 4NCJA 5ILQA 1ODKA 1YQWA 3D4LA 3FLAA 3HYNA 3OT5A 4LW8A 5EJGA 2ZUSA 1TYZA 2JEYA 5LQCA 2RH9B 3AR7A 1L4GA 4LTMA 5EE5B 3UJ8A 3FMIA 4LXQA 3DAOA 1KEZA 3ZBQA 4HAYA 5IKEA 3KYBA 3LQ1A 3N58A 4H35A 3WNZA 1QWSA 2ZSFA 3PHHA 5ELXA 4LDNA 1V45E 5CLGA 3PC8C 1K5PA 1QAOA 3L7KA 4UTXA 1DDOA 2OD7A 1E32A 2B61A 2YVUA 3EH1A 1ML3A 3F9IA 3JY6A 4NE9A 1DJPA 1J9ZA 1IHDA 4XDYA 4TROA 5EXEA 5HIIA 3F6SA 3D8NA 1C0EA 1NLYA 1UDAA 3D8HA 4FFRA 3HVJA 3HZHA 3RJ9A 3ESDA 2IOFK 2O3TA 1NT2A 1Q11A 4RK1A 3GIDA 2C03A 3JQAA 1HYEA 4Q18A 3EGXA 3QXCA 1TLLA 2VDNB 1VI2A 3I9LA 4Z9XA 3GUVA 3VJMA 3ZWBA 1BWQA 4E70A 2JVKA 4FI3C 4H15A 3GJQA 1VA5A 1ZO8A 2F7SA 2JAHA 4S1TA 3T1VA 2A0KA 3EE6A 4M38A 2IEIA 4JC8A 4S1VA 4RZQA 5EHQA 2VH5R 3WLIA 3DT9A 5KDDA 4LRWA 4BNTA 2E18A 2HF9A 1A2QA 2P9HA 5IXJA 4KFUA 1DPFA 4KRXA 4OP1A 1XFAA 3WLKX 2AGVA 3P9CA 5EL0A 1DOZA 2AVNA 1U9JA 2M1XA 3VGPA 5DHAA 1QRRA 4TZ6A 3D2AA 4CTKA 1NBIA 4H7FA 4NDNE 4HDOB 1VJTA 2WWXA 1R1DA 5LMCA 3MQ2A 4F84A 1IJEA 4N8SA 4EGFA 1ZR4A 4IGKA 3BGIA 1EVJA 3ODPA 2QD1A 1QJ4A 5IHXA 3HU1A 1LS1A 2EKZA 2N9UA 3GEGA 4NAHA 1A27A 3ADPA 1RKUA 4TMXA 3S27A 2WWWA 4DXHA 1P45A 3FYSA 2ZR8A 4ZXFA 5KTOA 3FOEC 5GV7A 3ZLJA 1X1AA 4LWPA 1QX4A 4TSFD 1T36B 1MEEA 4FMPA 1PJ3A 3GYBA 3EPHA 1NKSA 2QTZA 3DMRA 1E2GA 1V4NA 2HO5A 3LT2A 4GOXA 3VMFA 2C5AA 2XR1A 3JU3A 3L6UA 5LQJA 3GPLA 1LQTA 3KRTA 4P9NA 3EPKA 5K03A 4M8SA 4NYIR 4U7GA 4JFRA 1KHTA 4NJEA 3S1LA 5F77A 3EUEA 3EG5A 4IO1A 3WL5A 2FVXA 3I53A 3O83A 3KB6A 4J2HA 5DNAA 3TEFA 4ZIRA 5HHTA 1NBHA 5CBPB 2IGTA 2YY7A 2D4HA 1KYTA 1UQUA 3OHMA 1U6KA 2QXUA 1U4SA 2WV7A 3L92A 3NQ41 4XM0A 5EP4A 1LW6E 4L5YA 4G0UA 2FW1A 1JNXX 1NYQA 3EZ9A 5A5VA 1AE1A 2H18A 4KTVE 3R76A 1UMCB 3ZLBA 3U3JA 1KRHA 1YQ9A 4K2HA 5D7BA 1V4BA 4ONEA 1L3BA 2G9UA 4TV8A 3D6NB 2V58A 5DE3A 4YP6A 5BPHA 2IPNA 4KDRA 4GQBA 1IHOA 4LHVA 5SY9A 2HJRA 5CUQA 2ZRJA 1Z62A 1UOOA 2BHTA 3EWNA 1KJIA 3KFLA 4YPVA 1VRCA 3NX4A 3ZQUA 1SJ9A 1HE8B 1KSGA 5LPNA 2B0CA 2BEVA 4AIIA 4YCJA 4C0LA 1JU3A 2F00A 3VTFA 4QT4A 5BXQC 2V7PA 5JROA 1AIPA 3DL2A 2R8YA 1Z8DA 1LEHA 1X7XB 3QOYA 1E0KA 3OC6A 1DDIA 3RU3A 2BGWA 3OQBA 4EMBA 1KQGA 3RREA 3RRBA 3PDIA 3Q98A 4I3FA 1DUSA 4M7WA 1CZHA 1SUBA 1OX4B 1ZVKA 2H3EA 1MORA 3H1EA 1VIYA 3HLKA 1Y5NA 5I8WA 2PZEA 1FFGA 2QRJA 2XUHA 3EGOA 3BX1A 1ESEA 1H2AS 1AUQA 2WJ4A 4PTZA 5LU9A 1SBCA 5SYNA 1N2CB 5TMBA 3U7GA 4IIVA 2B1QA 3ZN2A 3L6BA 2GJKA 4KQIA 3RM3A 1TIBA 2Q41A 3AUTA 4ZYLA 4OHCA 4WTOA 3OKPA 4R0NA 3PI7A 3UT5A 3HADA 2ROQA 4U7DA 3MTIA 2YJ6A 2B8TA 4R0VA 2E6UX 5DVZA 3RASA 3ENVA 2M1ZA 1T5DX 3CRMA 3HZRA 1K8YB 1DOAA 4NICA 5ECGC 1NQWA 5HCIA 4FX2A 2O3UA 2VPIA 2FI1A 3ZBTA 1ILWA 5FWXB 1CDZA 3GA5A 4TXJA 2ZJBA 3IEIA 3RC1A 4A73A 1D04A 4PYJA 1EIWA 1HOTA 2HJVA 3QBEA 1FRQA 1QZXA 4MGEA 3QUSA 1I1QB 3TLGA 3W5IA 2HCRA 5IEJA 5AKYA 2H4WA 2PKRA 3ITEA 3Q40A 4GZ3A 4LA4A 3X2EA 2OHOA 3GN1A 4NOKA 1PJ2A 4PLPA 3HV0A 3DLHA 1E3JA 4RQUA 3DGFC 2FFRA 5DHRA 4RH3A 2BTEA 4LJLA 3VKFA 1AQ6A 2ZYUX 2V7XA 3UJAA 1E2FA 1UPAA 4AG6A 2EF1A 4HDNA 1N2BA 4AROA 5GGXA 1E1RA 1WDKA 4ABYA 1WBDA 2BFNA 1U9IA 2VDOB 3U3DA 3QPCA 5JSZB 2RGYA 4LF8B 2ZE6A 4GI7A 5EEGA 1NMZA 2FEWB 4WZ6A 4YUWA 1KJQA 3JQ7B 1EP3B 4ERXA 4K9RA 1P80A 3THWB 4C1BA 3RVQA 2B4YA 2GZHA 2JGDB 1P3DA 4QGBA 3NI2A 3GOQA 1MXHA 4FYWA 3F7OA 4IMPA 2OBMA 1E3WB 1JW9B 1YVUA 2XDYA 3B9RA 3KWJA 1V8DA 2WT4A 4E08A 1TGVA 4J2OA 1F06A 2X40A 4LYJA 3H2YA 4WECA 5K9ZA 2EZ9A 2ZRHA 3FWNA 1Z0JA 2BMVA 3QNMA 2ATVA 1Z3IX 3QM1A 1MAWA 2XOEA 3LQFA 1BYUA 1XK6A 1YKGA 4RS4A 1TZCA 3OPNA 3AIKA 1AJEA 1E64A 3RFXA 1Q95A 1QIJA 1QGUB 1DEAA 2GGSA 5FAKA 4J4BA 4AI6A 2NQ2C 5EWJB 3VDRA 3RLFA 1UDXA 3TFQA 4CGYA 1RQ2A 1TM3E 2Y1XA 4I9UA 4BLOA 3HP4A 3ZHVA 1MZPA 3LA6A 4B6EA 1CF2O 3OESA 1GSAA 1C0KA 2P9CA 5JYEA 4IVPA 1F8UA 2E1RA 3FDFA 1JSXA 4HNAA 3EPRA 3MCTA 2FG7C 4IL5A 3UZUA 4LJKA 3L0IB 1BDBA 2HQRA 4KXVA 1SK8A 2AFHA 4Y1EA 2DQKA 5CNKA 3T15A 3PEWA 1RRCA 1R6TA 1KTVA 1ZR2A 1H69A 3Q9LA 3K32A 2WU0A 4OGWA 2ENUA 2V1XA 4NNOA 3VXKA 4X3CA 4B40A 6CHYA 2HV8A 3AYXB 4NBNA 3R7WA 1EZ1A 1MGOA 3KOOA 2IS2A 4NCHA 1XEWY 4PO1A 3RSGA 4UVHA 4WIAA 2XNSA 4KWCA 1NW6A 4N65A 4AUMA 1DSSG 4GVXA 3BN3A 3NH9A 1MW9X 2RHMA 2OAEA 4BU1A 1NM5C 2WIFA 3A1WA 4JJ6A 3VBEA 3VI3B 2HL6A 2BOVA 1T3SA 3EGWA 3HE3A 5BSRA 1Q6YA 3WWEA 1Z4PX 5EIHA 3R4VA 1Z45A 5HKLA 1Q84A 4Z3OA 2IW1A 2R68A 4QKQA 3L7JA 1R6DA 3DAYA 2FPPA 1C7QA 2C57A 4GE0A 5ITSA 4KO2S 1IOWA 1JALA 1ODFA 4N49A 4Q3DA 4D25A 4HB4A 4Y0AA 2QTVB 3OCWA 3DDHA 5BQOA 1UBJS 1EBBA 1E6LA 1ISFA 5BR7A 5AXDA 3KO8A 5EESA 4PG4A 1P19A 2VJCA 4TLMB 3KAPA 4M89A 4Y98A 1HEIA 1ZK4A 4N9QA 4YRFA 2HU8A 5LM3A 3A2LA 4BCCA 2NSHA 4X94A 1CU1A 4OM8A 3KVVA 4ENRA 3DV2A 4BQPA 1OXUA 5MDHA 1WAMA 2R7AA 3TGPA 1PR5A 1RWOA 5K3AA 1ZESA 3U6BA 3C3EA 1BKYA 2F90A 4WEQA 1MPXA 3PD0A 1ZIOA 1XZQA 1N2OA 5F7ZA 3O8LA 3IBTA 1OIWA 4HB2A 2D2VA 2OCDA 1PHPA 2G9ZA 2YWRA 2FPMA 3B5IA 3KVNA 2VDLB 3Q3JB 2VHXA 3VKUA 2XCUA 5TF4A 4B2PA 1EG2A 4FEGA 3O7MA 5JZSA 3WY9A 1PZNA 2QMEA 2R66A 4XCVA 4DC0A 4YT8A 2Q49A 1FW6A 5A0VA 4XWOA 4OH1A 4AG3A 5IULC 3QFTA 2ZS9A 4L1KA 3JASB 1SUSA 1D1QA 3TCNA 3QNUA 3M1YA 2C8VA 4IG4A 3C8ZA 4G4GA 3T1QA 1RQGA 5JMPA 3AKYA 4PU0A 5JPDA 4KR2A 1EU1A 4GBMA 4GMKA 5KDLA 1MG5A 3IPCA 5JDCA 1ONPA 4N7BA 4OXQA 3L02A 4CM5A 5TE9A 1EFKA 2FJPA 3D4BA 1BFDA 4CUJA 3H11B 4D45A 4JBIA 4U5XA 2OHXA 1ESZA 3BWVA 3K09A 2O05A 4KXNA 1OVGA 3E7XA 3H5VA 3NCHA 5IVKA 4OSEA 5CLQA 2AG8A 3DKIA 4GQIA 2Z6VA 1TRKA 3QITA 2E85A 3PXUA 5TV2A 5HX7A 2G3YA 5C1DA 5JSUA 5CNJA 5AFSA 1MQ8B 3CV3A 3QVOA 4KXWA 2ZWAA 5DK4A 2GCEA 2JGRA 2RHGB 4UJ3A 4LYFA 3DZJA 3QKRB 4MQFA 4M0KA 3CVYA 4I5GA 2AE2A 1SOVA 2IPAB 2ZM6B 2J6CA 2PH3A 3T3IA 1RWXA 2H8GA 3V8MA 3R6LA 5JS8A 4FM9A 2KI5A 2VP0A 1ODSA 4Z4FA 3OD1A 3L4SO 2I6SA 3FNRA 3N2GA 3EZLA 4GFDA 2FF5A 4L5IA 1EKXA 1Q77A 1ZOOA 4UUMA 4DFDA 2YHIB 5L3SB 3GLGE 2QJOA 2NP6A 3C3KA 4UE2A 2F43A 5K4AA 4B2IA 4GSKA 2BFBB 4FMBB 1PBNA 4WMLA 2JNWA 2GZAA 3CRQA 3D3QA 4TWZA 1ZL2A 3BWBA 4BWFB 4TPKA 4EDHA 5ICSA 1X15A 2B8JA 1JE0A 1KO4A 3JWPA 3PA8A 4ETWA 1IWBB 1KAHA 1G8PA 5AQEA 4KNWA 2UYHA 4ARIA 4B4UA 2AFHB 4ALIA 3OUZA 1ISJA 3ABSB 1HZZC 1GXSA 2CDRA 3PP8A 5BORA 1F2DA 3CB2A 1DG9A 3U40A 4X63A 3AOEA 5CYPA 5IT0A 3WQRA 1W85B 1AGPA 3D6AA 4MVJG 4LOKA 4CMEC 4L7QA 2BFCA 2XGMA 3MK31 1RXUA 3E8SA 1QIEA 3C98A 4MKGA 4I6GA 3HCAA 4QBTA 5GTDA 2WYUA 1XDWA 4OFWA 3HBJA 1G5QA 1SVIA 4Y9UA 3VSCA 4BFTA 3OG9A 2CVOA 4B4WA 5LMNB 1IWPB 1IAVA 3N87A 1DARA 3CW9A 4TXHA 4GWGA 4W8GA 2Q5LA 3OTIA 3ZJ4A 4WWHA 4NAUA 3T3DA 5JXWA 3WIOA 4QXRA 4V0SA 4UFOA 2J9XB 3QBVA 3IERA 1SRQA 1X7YA 1AM4D 1Q0UA 1AGYA 2GLTA 3IMEA 2CL6X 4O25A 1DQNA 5CJPA 2C7GA 4A1FA 3HUFA 2QNBA 3Q5EA 5FTLA 2DERA 1SCKA 2PT5A 3I5UA 1J2RA 3BK1A 3H0EA 3QKSB 3RVLA 1ISRA 4OK3A 2AD1A 2FY8A 1KR2A 1USKA 2AV6A 2N3ZA 5T6MA 2I4LA 5M7EA 2Q4RA 3FFBA 3GD7A 2AXEA 4K87A 2GM3A 4BNDA 2JG3A 1R0WA 4POOA 1M6VA 1N9ZA 1E6EA 3S8EA 2OBYA 4D3SA 3RSLA 3MT7A 1XLVA 5AVZA 1J1UA 2BGLA 2Z95A 4C6TB 1XQ6A 2PT9A 2IBMA 4X1OA 2VHUA 5C7IO 4GZMA 4LCJA 2HT6A 3EZ7A 5BW6B 4XWYA 1FYDA 2LKDA 4BO4A 1K3TA 4IO0A 3ZZ1A 1GNRA 3FHJA 4LSMA 3CR8A 4RJ2A 1OHHD 2ZXFA 2NAPA 2R87A 4HRXA 4BWYA 2J3HA 2R8PA 1RPJA 2WUGA 5EJAA 4HQFA 1IB6A 4II7A 5LOVA 2IS1A 1A9OA 1TO2E 1TOAA 4OAQA 1Z8FA 4XYLA 1UP4A 1ZA1A 3P9XA 4N1AA 2OTCA 3EA0A 3ZYCA 4EJSC 1S4MA 5TPWA 4AC9A 2EHJA 4Y6PA 2BWJA 3CUTA 2CL5A 2CFOA 3EMVA 4ARBA 5KYTA 3MTQA 2E5LB 3DSRA 1A4IA 3U4QB 3PUYA 2YCLA 4JQYA 1E2UA 5ALWA 2P4QA 2VCEA 2IIQA 1O77A 3BS4A 4JCCA 3ZZTA 2F55A 1QFYA 1ZUD1 2F8SA 3PPVA 3FHTA 3HFJA 4DM4A 5IABA 1ECLA 4BNLA 4HLUC 5JJLA 4WLUA 4E14A 2PKQO 3H5RA 1PGPA 1QORA 1I2CA 2EEPA 1E94E 3SR0A 2IYQA 3A4YA 1AZSC 1EUDA 3EVAA 4D5EA 1PVOA 3E3LA 2PJZA 2DQ4A 2WW8A 3OZIA 4W9MC 4MI1A 3FVTA 3MT9A 1R3DA 2P68A 3LBAA 5JG7A 2VDRB 5ALQA 3OE1A 1P1KA 1OXMA 3F67A 2H7YA 1CQIA 1R4MA 2FWIA 4IJWA 3P4XA 4NJEB 4R1SA 4X8LA 5TXGA 1Z06A 3VH2A 4L8FA 4D3ZA 4NK4A 3S2YA 5KNDH 2UUAB 4N40A 4RUKA 5JD3A 2CFSA 4OEHA 1HDGO 4RCYA 1GL6A 1NJSA 1U8CB 3DUWA 3UGQA 2HWKA 3COVA 5I9MA 2QTFA 1A5BB 3UENA 4CCYA 1DAIA 1JPNA 1WG8A 4MWCA 5KKCA 5FR2A 1TRHA 1GPUA 2GERA 4C7OB 2NU9B 4DNOA 1VBKA 3K9NA 5CK4A 2FUG1 1IJFA 1LSOA 2I0FA 1K0FA 3C8HA 3HGMA 3KTDA 1G21B 2FUNB 1HV8A 1P2DA 3L82B 4J07A 1O4WA 3N2KB 5CPFA 4BFXA 5KYNA 1KYVA 2I9KA 1HKHA 3IQGX 1SA0B 1LDEA 4KIUA 1DS6A 3QVKA 1KMCA 1ATIA 2ECKA 5BYBA 4B3GA 1X7WB 2W9XA 2Q0XA 3X0DA 3KZMA 3RIMA 2JLZA 1DAKA 3A6JA 1ZU5A 5T8KC 3H86A 3S7ZA 3S8YA 2PPVA 5CYGA 1R5NA 5LBUA 4DV6B 5DEOA 3KJNA 1JIIA 4ESEA 3V7UA 3HVRA 1KI2A 4AKTA 1Z5WA 4C7XA 5ELMA 1WZEA 3ZUGA 4KLAA 3SDZA 1QHIA 2IELA 2LZ0A 3IDAA 5AKIA 3DHNA 3O26A 2D7DA 4O4JB 4PICA 4H59A 4Y2TA 1PEKE 4K9SA 3U4AA 5BQPA 1E6WA 1I30A 1OY1A 1G21E 3DAHA 5IU6A 1KYIA 4AD8A 1OGJA 2ZGVA 1A7KA 4TMWA 4CODB 1RYFA 2H2HA 4DCMA 4A8PA 2ZWMA 4YBZA 3VC2A 2H29A 1LZLA 1W87A 2KLHA 3HCBA 2FSVC 3MWFA 2PWAA 3EFBA 3WRXA 1LK7A 3R8FA 1DBPA 2ZS7A 1K9VF 4IIJB 5BOVA 1Q50A 4FYKA 2GAAA 4BFVA 2P8SA 2B8NA 3STTA 5G2OA 3S4YA 1SUFA 2QD4A 4OLJA 1JWBB 3NALA 4R71A 4ENWA 3RS7A 1E1CA 4F1WA 1T5HX 3ABOB 3TQTA 3ZTTA 4HT3B 3UAVA 1ZSNA 3LLUA 1C1DB 3Q7IA 1M1NA 3W4IA 3IJEB 1CZUA 5K3BA 3O1HB 3KSDO 1W49A 1A5ZA 3G9ZA 3IKMB 2FWNA 2C58A 4XEHA 4DHWA 3P9QA 1XN4A 2EX4A 1C9MA 4IZHA 1YS4A 3W1VA 3RYCA 1O8BA 1XA3A 1P33A 3OQIA 5CAEA 3KVOA 4KE7A 4JCOA 3BDIA 4GPD1 4Q9IA 1G3RA 1GFWA 1XHLA 2IZ0A 2P5TB 2OCXA 4K6MA 5BRAA 3AHJA 4JWTA 3L01A 3EOBI 3COYA 2Z8ZA 3VU3A 2ZUCA 2UV8A 3LO8A 3Q3CA 4BMXA 4TRNA 2VQSA 5BSVA 2GO1A 2YDYA 2CVZA 4HWPA 4JI5B 4C0KA 3BWEA 5J59A 3NIDB 2PVPA 2FX3A 3D6HA 4U39A 4RKWA 5DWQA 1LK0A 2H16A 1BGXT 2L82A 1ZMRA 4PGAA 4WD3A 2RH4A 4F3CA 4Q47A 2C1ZA 5HNKA 3WB9A 4QPZA 2C2WA 2OCAA 4WBNB 1BU5A 1OX4A 2WIBA 4XGKA 6Q21A 2BF4A 3RABA 3U1TA 4I55A 4B32A 1OE0A 3AWIA 2VUTA 4DNPA 3D0QA 3L8GA 1PWYE 1EFAA 4KQXA 4BQEA 2J67A 2HT1A 3AJAA 2RSLA 3AVUA 1PFVA 1TZJA 1DWOA 2PMWB 4R9NA 4DCJA 2YS7A 3GDFA 1R37A 4D4GA 3EBOA 3H99A 3UH0A 1YB2A 3GBPA 2HA0A 4DTIA 1NM5A 1NN1A 3WOVA 1IOVA 2G1UA 1UC4B 2RKBA 5EUBA 1XNRB 4JGGA 4QEDA 2LDXA 1QYIA 2XA9A 2C3YA 1ZMBA 4KJZA 1G9XA 4NENB 4R6XA 3ZE6A 3OZBA 2ONJA 1QHHA 4FFMA 1D0IA 3L7OA 4KE9A 5EKUA 4EUNA 4WUVA 2E2WA 1P9LA 1Y5MA 1I4TD 1W59A 2ZI3A 4M7PA 1KI4A 1BDIA 1NULA 2XB2A 3O2QB 4FB5A 5EIOA 2PRYA 3HXLA 4PCLA 1ZD8A 3AK4A 4C2AA 1JN0A 2PT6A 3C3YA 1BCRA 3GH1A 3D0RA 2B99A 3FA2A 4GIBA 4MKHA 1NUUA 1TVKA 4IUDS 4MYDA 3TQCA 3WMXA 2AC2A 4BLWA 1E3IA 3AVQA 3ZIDA 3S99A 4NBTA 2FE4A 3QYPA 4WLNA 3VNVA 1VJ1A 4WLFA 5JSZA 3CKKA 2O57A 5K3OA 4ID3A 3VH3A 1FUUA 2V65A 4E21A 3GMTA 2GPYA 3MWEB 2RMKA 1BDJA 4DBLE 4FHFA 5LXTB 2HWXA 2VSQA 3QI2A 2HPZA 4NVRA 4PPNA 1UFOA 4JS0A 4EI2A 2B6HA 3PEVA 3IKTA 2GZMA 4AJEA 4B45A 4GQAA 5J58A 3OQMA 2E4UA 1WVGA 3VNQA 2C5FA 5T67A 3NBZC 1A88A 1AN0A 3DTVB 4J3NA 3ZDXB 1SXPA 3DXFA 2PXCA 3LCCA 5DOVA 4OMFG 1XRJA 4W5NA 4FZRA 2Y0PA 3FOWA 2X0FA 1JHXA 4KN9S 2HF8A 2KS6A 2DHEA 5FPTA 2PK3A 3SM3A 2VA9A 2QS9A 1JJBA 2W2KB 5HGJA 2BMDA 2ZBRA 3UH1A 3PQ5A 3QU5A 5JVDF 13PKA 3C43A 4QOEA 4DMHA 4Z9AA 5HDBB 1CRZA 2JBAA 5H5JA 3W8RA 1A72A 3H7AA 1L0BA 3A3YA 5LP1A 2MYTA 4BNZA 1CY1A 1I0IA 2BN4A 4LEIA 2XB8A 3X2SA 5BN5A 3KKLA 3PI6A 3V8RA 5IUKC 4AB1A 3H0KA 4BWGA 4WOKA 2A9OA 3Q8WA 1YR2A 3N28A 4FWBA 3K0FA 2R62A 3I83A 3KLMX 4CL0A 1YZFA 1NWCA 2WB4A 1OOEA 3EYWA 3L1UA 3NYRA 3H4VA 4HL6A 1OYYA 5IVPA 3K6SB 4MQMA 4Q9NA 1NVDA 3B7GA 3NDJA 4ZCSA 1UJ6A 2E48A 1P4GA 3UOWA 4YV0A 2AN9A 1I4LD 1RYZA 1CERA 4IJVA 4BO3A 5FLXA 2FPWA 4FEEA 1QKJA 3D81A 3SC2A 4UXJA 1SBYA 3SNKA 5ER9A 1L4UA 1WUYA 3ID6C 1XZAA 4ODIA 3H4MA 1PNOA 3Q6IA 4R5MA 4D4MA 4XQEA 1ZL0A 4R8MA 1H05A 4JBLA 4OYLA 4JOQA 2CLCX 4PN7A 2Y1DA 4I5DA 2QQEA 4Q4JA 3QELB 4B8YA 3VJKA 3IMFA 3TNDA 5J2UA 5CT6A 4J1NA 4MCHA 1T2AA 4XYEA 3M33A 2GPNA 2K2WA 1EM8B 4JENA 3ENNA 4OQDA 3T9EA 1O9GA 3ANNA 6REQA 3R3WA 2V6IA 4P81A 1KAEA 2II6A 1QMGA 4U2DA 1U2ZA 5FH9A 1JKXA 1P9WA 1PJRA 2QRLA 2ZROA 3HI4A 4FSXA 4RHCA 2RB5A 5DTRA 1OI4A 1ZRHA 3GLQA 1ZRMA 3K6KA 1P3JA 1DQPA 3ZNNA 2BR3A 3B48A 3MT0A 4UTZA 1KE2A 4AMGA 3GOHA 5MGBA 3ET4A 4HOYA 1X8JA 2P27A 3BFVA 3PHJA 4DLTA 1DCTA 4LJRA 2ZXEA 4ZYXA 4YWJA 2FQXA 3L8YA 4GPIB 4X1YA 7MDHA 4EECA 1ZOLA 5EIBC 3RIEA 4PANA 3Q8MA 1GGNA 3PQ6A 1DXHA 1L1EA 3MEQA 4AS1A 1JBKA 5K3FA 1U1DA 4JL8A 5A4FS 2FCRA 2TSYB 3KM0A 2GHTA 3IIMA 3G2NA 4LECA 5LP6A 3PGA1 1MQSA 1XAHA 1HQYE 4MV1A 4RULA 1JBEA 2QRZA 1Y7TA 4HB3A 3E9NA 2QMUA 3L7CA 3U4IA 1W0KD 4IS2A 4KMMA 3W05A 5LQDA 5G4KB 2Z58A 5H8WA 2P9YA 4RA9B 1NE2A 3NWBA 4KZPA 4QUEA 4JUIA 3RAEC 1H3FA 1Y1TA 2HSZA 1L5VA 4FCCA 2IEBA 3HZZA 3QX7A 5KQGA 3GJ3A 4MR9A 3CNBA 4NCIA 1ZI6A 4YRIA 3GJ8A 4BJ5A 1G3MA 2HK9A 2PEYA 3EVDA 1G4HA 5T3YA 5LKRA 1NAHA 1LJUA 1K5HA 4X0EA 1MENA 4K26A 2IPOA 3EJ6A 2N0SA 3KJHA 5AH0A 4HH1A 4LC0A 5FAXA 1VM6A 2HC9A 5ESXA 2LW7A 4DDTA 2OO5C 4OKSA 3T7DA 4BV8A 1DKPA 3FJYA 3C1OA 2WYIA 1E9VA 4E2FA 5IAGA 1GTG1 2OXIA 4BZQA 3L40A 2CUTA 3IP8A 3OLXA 3WRYA 1FSPA 3OJOA 4QODA 1QRSA 3NS7A 2GASA 2VDUE 4U9HS 4QELA 5C1OA 4O4IA 2DQZA 3UF0A 1G20A 2C5GA 4LOLA 2G5CA 4LG1A 1M2WA 4U00A 2VHZA 3TQHA 4NTZA 3ZUPA 4AP5A 1T9AA 2C7PA 3SQXA 3AY7A 1BXRA 2PXXA 1M8PA 4RZ3A 4JGIA 1KBZA 1XELA 4FE7A 1HY3A 3SG0A 3SI7A 1IBCA 2HN9A 5EE3A 3W3AH 4CCYB 2HMTA 3ZLTA 1N75A 2DZDA 2FP4A 1ORVA 4MMXB 1OZAA 2ZT6A 4YB8A 3F5SA 5E7QA 1KMHA 3UJPA 3GHYA 3VV3A 5G3YA 5JTTA 2AC4A 3K0AA 1C3VA 4IKPA 1RRGA 1OFUA 3HXMA 2WF9A 3GJ5A 5EMLA 1OAKA 1RWBA 4R83A 3CLUD 5EKXA 3FR8A 4PLWA 1A8UA 1P1CA 5IH7A 2AK3A 3H5WA 1E5QA 1UBGA 1FXWA 1Z47A 3E9DA 3GA0A 4J0HA 4D6YA 5ABPA 1ZM2A 2OAGA 5LZ7A 5KKNB 5TQJA 4PZLA 4BLRA 3OFJA 1SC4A 4NDZA 1RKVA 4TKLA 2NZWA 1E2BA 4EG5A 5ED0A 1Z17A 3SJUA 4F9EA 2RH8A 2RGWA 4JLJA 4EIWA 1D4FA 2QV0A 3QU4A 4N0DA 4J16C 1SCBA 3DOCA 3GWZA 3SIXA 3MJTA 4L6AA 2GK6A 2IHYA 1EESA 4YRNA 4GM1A 4QU5A 4WN9B 1L4EA 1KY4A 1N2GA 1W25A 4BZZA 4M1WA 2MR5A 2I71A 1NAIA 2OK8A 1YRBA 2GZDA 2X9GA 4YCMA 4J1TC 4MX8A 3X1KA 3PQ8A 4D74A 1DMRA 3VX3A 3ZTYA 2RHTA 4NZ9A 2DULA 1PD0A 1L3IA 2H2FA 4G5SA 3RYHA 1MT0A 4MGHA 4IVQA 3KJIA 5IDVA 5EERA 1DJLA 2FUG6 2QRVB 4ZFNA 1ZXBA 2OVFA 2VH1A 1R6XA 1VHLA 2BTQA 3QU9A 1MJNA 4IJKA 4CTJA 1E2JA 4GOJA 2IY9A 5K0SA 3I4LA 1M1NB 4LJYA 3OX2A 4O4HF 2CBZA 4YLYA 5GOZA 1QH8A 2NO9A 1DEOA 5MFPA 1VDMA 1A5AB 2R6AA 1WSDA 2EL7A 3LDUA 1LPPA 5FL7D 2ZIXB 1YL7A 5DTMA 1PTJA 1V3QE 3E3AA 1G8AA 3AR6A 2GAIA 5HZKA 5KMGB 3FMOB 1OTHA 3P9SA 4LY6A 2H1CA 4P38A 5FA5A 5AD1A 5CDHA 5FV7A 4XUDA 3SMVA 4ANFA 1MC1A 1DDGA 5BWBA 1GA6A 3COZA 1GV0A 1NN0A 3LPMA 3R0JA 3R23A 2PSJA 4D8TA 2VHJA 4CFYA 1WMDA 1V5WA 1QSGA 3DE0X 4EVRA 4MUKA 2NYRA 5EMNA 2CUNA 2HD4A 3WGVA 4NBRA 2XZDA 4OHVA 2EJTA 2ZYVX 4DMUB 4G5HA 1R0ZA 1D03A 3RPEA 1U7ZA 4C7KA 3CWZA 3O0DA 1AKMA 1S2MA 2P1DA 4KI0A 5C46F 4BC0A 1H85A 1TD1A 4ER5A 3GQBA 4F5DA 3TNFA 1XZMA 2Y99A 5K99A 2C5LA 2Q2NA 3RUAA 4DCOA 2HFJA 4EGSA 3MBOA 1JHZA 1KKLA 1LH0A 2F3UA 2ZJ1A 3IIIA 4JH0A 3W5VA 1Z2CA 2YZ7A 4EOGA 1JILA 1GPMA 1F9AA 1UOEA 3FW1A 1J8MF 2YC4C 1N2ZA 1XU9A 2P75A 2R47A 3QEBZ 3CZ9A 4RV5A 3KKMA 4UZEA 4XUCA 2QORA 2BGNA 1RWNA 3FI0A 2OMKA 3N8GA 4MCAA 2P2SA 3FDXA 4Y1RB 1OFIA 4CMAA 5AW3A 3T5DA 4NBWA 1G4UR 3E5MA 3PE3A 4WFKA 5AJWA 3K0CA 1KEUA 5ALYA 3MVEA 1WY5A 3T52A 2AR9A 4MB2A 5J43A 4DL9A 1JTVA 3HA3A 1Z7BA 5IFLA 1Y8AA 4ZHSA 1EG7A 2WKSA 3GIWA 2J9ZB 5K2MA 1WB4A 4KXUA 4CDGA 1HOXA 3GHHA 4NE7A 2EVWX 2VHYA 1H1LA 3PR2B 3MIIA 4RFVA 4DC1A 3WSTA 2PX2A 4R9RA 4AG5A 1W5AA 3ZXSA 4YAKA 3BTOA 3KXKA 2DFDA 1LQUA 1EEHA 4B75A 1SPXA 1RU3A 3AB3A 3BL5A 3D4IA 4HX2A 4K0KB 1Y9ZA 1HNZB 5F2OA 3PEYA 3N2ZB 1ZOSA 1GCAA 3N70A 1F1BA 5C4GB 1DTSA 4JQSA 1L7RA 1QOZA 3DEYX 3EVEA 2JK1A 4XYBA 3HUTA 2L19A 2BMEA 2FUEA 1WDTA 4MWDA 4NQRA 2JJ1D 9LDBA 1CRWG 4HDKB 4MV9A 2PE5A 2A35A 1EUCA 2I55A 3T34A 4KGZA 2PBLA 3SZGA 1OW3B 5FWYB 4ZJZA 3DDNA 1CKEA 4ZRMA 1F0YA 4X61A 4ZYVA 2HXYA 4PZPA 4GG1A 4JJ8A 2Z6QA 4Z53A 4UBNA 2D1TA 3PIRA 1GL7A 3SSNA 1MA3A 3ENZA 1D5CA 3L4EA 1W5EA 3KJGA 4ISBA 3I04M 1XRSB 1DKQA 3EWAA 2ZSBA 4FDTA 5DGTA 3KQHA 5KWIA 2NM0A 3DWIA 3JV7A 1P75A 4QATA 1KEKA 2ILVA 2AOUA 3DEIA 2FMKA 1T0UA 3DZ8A 7MHTA 4MDFA 5G4KA 2CJYA 5AKKA 1CRLA 1QNFA 4L5JA 2Y0DA 3AI3A 5K05A 4A10A 4IGIA 4CWAA 2CV0A 1FNCA 1WW2A 1C80A 1QDUA 4EB3A 4DDHA 2ECOA 4O8CA 1OT5A 2QX7A 2D0IA 1T3GA 3HJTA 2VAMA 3ZHUA 2A1TR 2A3RA 1Y8QA 3M9LA 1RP7A 4MQUA 3WGOA 3INRA 3PJRA 4N4AA 1I5OA 2BGRA 3UT0A 1B3BA 3O3OB 1XZEA 3LC1O 4PS1A 3WE7A 3U6KA 4FQ5A 1U0RA 1MFZA 3UWMA 4E5SA 3ICWA 4ZN6A 2WQ6A 3TL2A 3RODA 4I8IA 4TRJA 1P29A 3H1TA 4B44A 2BSQA 1KK1A 1EYZA 2GI4A 4NENA 1Q20A 4MV6A 4QYSA 2MSLA 1YRQA 4XI9A 3BXZA 3HKDA 3KR2A 3W1EA 4BE9A 3HBLA 3H16A 4F4CA 4W5QA 1F48A 1B8VA 2P9EA 3FHCB 4GC5A 4L4UA 5E7JA 1JG6A 2XGSA 2UAGA 1T43A 1JHDA 1QONA 4HB0A 3ZR4B 3OF5A 3P9RA 1U0FA 3C85A 1I2AA 1A8HA 2XUPA 5CP8A 4UU7A 3R09A 1BNCA 1ZK2A 8ADHA 1M9NA 1I0ZA 3B20A 3U44A 3ITNA 3WGIA 2J30A 2WHQA 1C4OA 5AJYA 4OJTA 5B37A 4B6GA 3HU5A 4CLRB 2VBFA 3KNZA 1YC2A 5EHXA 1OREA 3N3BC 1U0LA 2D5BA 1E2QA 1WMEA 4P7GA 2IDJA 2XODA 1TE2A 4QUDA 4BQRA 2GTIA 1E89A 5AT1A 5FUWA 2LCFA 4DEXA 1ZS9A 3SC3A 4GOOD 3T1NA 4WBNA 4JYBA 1TYCA 1FSZA 1GJRA 3UK1A 1CUIA 4ABTA 4RHUA 5D00A 1JPVA 2ZVJA 1JTEA 4M8LA 2HF2A 2RGXA 2HXGA 3FZYA 2RH5A 1T34A 4YUXA 1KRXA 3LGSA 4RFSB 1D8AA 2B4QA 4EI7A 5CYOA 5G1NA 4P34A 5MN6A 2QX9A 1Q91A 2VP6A 3OZXA 4LNAA 4YC7A 2YNMC 5TT0A 5EJ4A 2ODTX 3SJCA 1OBHA 5CVVA 4BV3A 3V8BA 5CVUA 4ATNA 1N9GA 3HDTA 1Q1NA 2I1LA 1E7RA 2ZI4A 3QIAA 4W8HA 4KYTA 3ZW7A 5KVAA 4S05A 4TYNA 1YVPA 3G68A 2BGGA 2AUNA 3AR9A 5CU7A 1WKBA 4M53A 4JJAA 2MSKA 3CGGA 1OMOA 5DRYA 2XUIA 3SZ3A 5CDUA 3IV7A 5LA6B 4UNRA 2PGIA 3BZBA 5AVSA 3HNPA 3IJRA 2ZB4A 4B3RB 5C4MA 1B23P 4RF4A 5BMVA 1QU3A 4F3YA 1UUFA 2ZRPA 3H65A 4N82A 4D42A 1NI4A 5EJ6A 4YAWA 4DG5A 2O59A 2ZS8A 5IK2A 1K4MA 4WE3A 4BNVA 1T2DA 3M5DA 5CBPA 2HXSA 4Q1DA 1Z6QA 3B1VA 3GLRA 4P86A 3QJYA 1JI0A 3WMEA 2J3IA 3T3NA 3Q6NA 4TVSA 4RPHA 5IJ0B 5L8VA 3TJZA 3RTGA 3WL8A 2FRDA 4RZSA 1OQAA 1FBNA 1T4GA 1VE6A 1I14A 1Z6XA 2OGSA 3AFMA 2J41A 3AB7A 1WMSA 5BYJA 3IHLA 5BUQA 3R3SA 3EY4A 3WZ2A 3B53X 3KYDB 4MULA 1TCVA 3K70D 1TEZA 1RJ9B 1T2FA 4B8ZA 5ADUS 3NOVA 3GLHB 1UR5A 3KVRA 3B1KA 4J76A 4E11A 3ESXA 1ZY2A 5CVJA 1XVLA 2OM6A 1YASA 4ERNA 5BMOA 2W6CX 5AK4A 5CCXA 1AN9A 3MWKA 3I61A 1WU8A 4FLFA 2P3QA 3P2MA 3ROPA 2NV2B 3S5JA 2YCBA 5LP6F 1NJ1A 4ZJYA 3O8QA 3U48A 1ZVVA 3IR6A 4YDSA 2AJDA 2Y9PB 3TRFA 3A1NA 2DT5A 2ODWA 3B13B 2IXFA 1J23A 2JGJA 3GUUA 3VO2A 1O0CA 1T15A 1RAFA 3BIXA 4OATA 2IBSA 3FTEA 3OLVA 3DOJA 4DA6A 2EZ4A 2PQ0A 2R2AA 3OT1B 5GIPE 5C8XA 2YIDA 5DISB 4GOMD 3B60A 4QOGA 4R54A 4Z4IA 1KZGB 4V0OA 4KUHA 5B3KA 1ACLA 4QO7A 4N7JA 2B2CA 4RF2A 4BBZA 1YJ8A 2DUJA 3DV9A 4TV9F 3LVQE 1RQLA 3BF8A 1FPMA 1TPZA 4GVPA 4J1SA 3BSYA 3NIFB 1SHKA 3SFTA 3WZLA 3LY8A 3GRUA 5K1ZA 4LF4B 5D87A 3SHQA 1L4KA 4UDYX 2H4JA 2AFIA 4J0IA 3M6WA 4B6QA 1U0GA 2B1GA 3TI9A 3L0PA 2PFSA 1HC7A 2O0HA 3I64A 4LZOA 4C3ZA 5AKLA 4E88A 4G67A 1GAWA 1ECGA 2I4TA 1JSLA 2H85A 2W6QA 1G5RA 2WJHA 1X7YB 4Q3AA 2A4MA 3KDPA 4HX9A 1VPDA 3IXMA 1EJ0A 3HDYA 3RGWS 5JFOA 1ZM9A 4M22A 4YQEA 1Z6GA 4HNAB 4MV0A 3AFOA 5TQVA 4EL0A 1ISPA 2GVNA 2P4EA 4KDFA 1F38A 1VP3A 4MAAA 1YHYA 4OQXA 3M5PA 4V38A 1A9ZA 2XBMA 1FU4A 1NF3A 1AB6A 2IX9A 1LJ8A 4OQQA 1LRLA 1M2NA 3GCZA 1U0SY 2ZT8A 1HFKA 1VB3A 1LA2A 4XCXA 4DVGA 3G79A 1NUAA 3R7WB 1R9MA 4QXPA 3UAWA 1VPLA 5BT8A 2B8WA 3WJ1A 1T4BA 3JAKA 4GL2A 2PFGA 1PNQA 2XSZA 1IC6A 1D4AA 2IA5A 2JCVA 2VP4A 2I2BA 3IMKA 1Z0FA 3ZOKA 1YIDA 4RLQA 3A25A 3FE2A 3K3PA 5LDHA 1ZD3A 4LSGA 4Q1EA 4IV0A 3B5EA 4QDOA 2X1VA 5BOSA 4DBVO 4DLVA 1FJGB 2QXTA 3U4MA 3C1TA 5FNVA 4PHGA 2D3WA 1SD2A 4B6FA 3EEFA 1NUPA 4CI0B 2F8TA 1X1RA 5K8VA 4TMZA 1T29A 2EFGA 1I3OA 3MTAA 4BCBA 1PWEA 2YZGA 1KKMA 3H05A 4HJRA 4CV3A 3UA4A 4R1NA 4AN1A 2QR5A 5BVHA 4YAUA 1XRPA 2RJOA 3OAAA 1Q22A 2NU6A 2JCYA 5DCYA 5MFZA 2D0DA 3ODGA 2EBWA 4JEUA 4QGFA 4C5CA 1L4BA 3SJ7A 3T7EA 2D4AA 1GR1A 1E4OA 1M8FA 2VJAA 4L3OA 4JI7B 4TV9B 3CVOA 2DWUA 2FP4B 2GYUA 4LJ4A 4LSWA 3T4XA 3UIEA 4RTJA 4OQMA 5EMKA 2ZB7A 3PRHA 1THTA 1I94B 3NONA 4ND8A 1SELA 1XRQA 3W9UA 4RGYA 1P17A 1GGMA 2MTBA 3TW0A 2ZUFA 1Y8QB 3W90A 1X70A 3PRJA 4DLUA 4R7GA 1FJ2A 4XIYA 1FQOA 1R2QA 4IIJF 1Y4DE 4KYUA 3WIEA 2AA3A 2G1JA 3GRKA 4DLNA 1EGAA 1ZK0A 2QUAA 2XI4A 4JUCA 4DCSA 1MV5A 4DS3A 2V0NA 2VPYA 1K63A 2V6GA 3DEJA 1FXUA 4EATA 3H2BA 3LF2A 3AKZA 1E4EB 2IUUA 1WP9A 4QUJA 5K0ZA 2WVAA 1E4VA 3DMTA 1PVVA 4RW0A 3AFIA 2ERXA 1CHNA 2ZU6A 2P9GA 4LCEA 1K7EB 2XOKA 4OHXA 4WCDA 1Y7IA 1ZEJA 4TTRA 3CH7A 3D5EA 4I5EA 4BECA 1P44A 1FFXA 2FETA 3VV2A 5EPUA 4DUGD 4E5YA 2BL4A 5JMWA 2Q3CA 3OA2A 3ENKA 3DE4X 4FFVA 5DHTA 1DRUA 5FOXA 1JH8A 3UWPA 1VI6A 1CUXA 2AX4A 4HK4A 4J2TA 4PZ9A 1N6LA 3UK2A 4PNPA 4LY9A 3VSAA 2WDZA 5JC8A 3VKHA 2HLPA 1BX0A 2XCLA 3QZUA 3VTAA 2FPPB 3OMXA 5DLEA 5JCJA 4B6PA 3F47A 2BKEA 2PWYA 2QUKA 3OSUA 1GU1A 3HCEA 1NF2A 3OQJA 1ZH4A 2O0LA 1EK5A 4WXEA 1BEUB 3A05A 1IZ7A 4RGBA 3V2UA 2WEKA 3W2GA 1YRLA 3B3QA 3ZGVA 4PR3A 1P2SA 3WKDA 5C52B 5BSFA 2WAOA 3W78A 1GEGA 1RYDA 2PV0A 4FX5A 4YI3A 3G0DA 2WFLA 3DCJA 4HPWA 1TJNA 3GDOA 3F98A 5GAJA 2VYCA 4TYYA 3K9WA 2FPSA 4NARA 1CG6A 5I9NA 4DCNA 2FA9A 4GD3Q 3GW8A 4Z1MD 4KI7A 1KF0A 1NVVQ 3OCXA 1MV8A 4AZ0A 4DV7B 2H5LA 3G2IA 3P5BA 1XL0A 1XI2A 3CT4A 2JAXA 4ROTA 2AFIB 3WLFA 4I55F 4A8HA 4BEJA 1P31A 3Q9NA 4CLXA 2XCOA 4EUFA 1VKHA 4DV4B 3VUFA 2XWBF 4FDAA 4KUEA 1CV2A 1RM5A 2IU3A 4L76A 5H3LA 2W2NA 5EWMA 4TSRA 4GDFA 3CJRA 4JY7A 1PFWA 1SB9A 1Q44A 2NOAA 5KWJA 1USIA 3O75A 2JGFA 2FN4A 4WHMA 3JQGB 3EBLA 4URWR 3UKOA 1XK7A 4YRTA 4AYTA 4LNUA 1SQGA 1ZOPA 1OXKB 3QYAA 2JLQA 5DX8A 1UDCA 2DHQA 1UMBA 1DBSA 1IIRA 1Z2DA 4HDMA 1RZRA 3KT3A 4MWEA 4RHTA 1PWXA 1ZAYA 1SWVA 1QRAA 4O1MA 5F76A 1EVEA 5KYVA 5EVJA 4ZOQI 2IY8A 4RL4A 2ZYDA 3IDFA 3NOXA 4LYGA 4UTVA 5H9WA 1F8XA 2XNDA 4G85A 3ORHA 3VR2D 1W4LA 2IDZA 4QPDA 4N3NA 5JVDB 4HF7A 2WY2D 1CNEA 1RHQA 4JI3B 5SZIA 5JY6A 3H11A 1I6LA 2QZ9A 5CJJA 3PUIA 4RDHA 3LVFO 4TQAA 1FYWA 1R16A 1ZP6A 3IQDB 4LBYA 4PPYA 3RCBA 4BX8A 4ECAA 4QM6A 4CR6A 1JDBB 2XQVA 3HM2A 3R20A 1Z35A 4TL9A 4IUCS 1AUOA 2GEBA 2DBZA 4XX1A 5CDFA 1QYDA 1Z29A 2F1IA 3I1IA 2G07A 2EJVA 4EMTA