3FYUA

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
total genus 115
structure length 317
sequence length 318
chains with identical sequence I
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuA00
2PUJA 2DHCA 4JUIA 1CUFA 3U0VA 4CG2A 4DSAA 1P0MA 4X93A 5IVIA 4FLEA 2R8BA 2RHWA 2OLEA 4BAUA 1KU6A 3ZLTA 2XMGA 3WKCA 3WYNA 2HA6A 5AM5A 4EY4A 1XZBA 1G5FA 5HF9A 3L1IA 3WI7A 2WHPB 3UUFA 2CZQA 1HL7A 3G9UA 3AFIA 2J4FA 3WWCA 5LZ2A 1UXOA 1T4MA 5F4ZA 1GQSA 3GBSA 1H2WA 3FNBA 1ISPA 2P8SA 3DEAA 1DX6A 3AINA 4YX9A 4OSEA 2PSHA 3H04A 2VATA 3ANTA 3C5VA 4H35A 4C6HA 3ANSA 2HRRA 1R9MA 2CKMA 3C45A 2WKWA 3ZWQA 1XZKA 1IUPA 3G9ZA 3IUMA 4YPVA 1XQXA 3G7NA 4JNCA 1FJ2A 2HFJA 4FFWA 1XQYA 3QYJA 2XMZA 5E4YA 5ESRA 3NWOA 2GBCA 3OTQA 1QIDA 5HKAA 3PI6A 2AJBA 2W22A 5AI0A 2C5FA 3ESCA 4INZA 3QBJA 2XMDA 3LCRA 1E89A 3I2GA 4BYMA 1JT2A 3T52A 2Z3WA 3B3QA 4HVTA 4N5IX 3DYVA 4U2BA 2HA2A 2O2HA 4NS4A 5ALHA 1EHYA 3DKRA 2VEOA 1VZ2A 2VA9A 3SX4A 5AK6A 1THTA 4XJVA 4PNZA 5ALNA 1XLUA 3BDIA 1TIBA 1PV1A 3WK9A 1NU6A 2QXTA 1R3DA 1DWOA 3D5EA 4U2CA 1OXMA 4FKBA 3C87A 4BCCA 1CUUA 3EQ9A 4Y7DA 1CVLA 5ALIA 4KRYA 3AIMA 3W9BA 1CFJA 4NZZA 3H1BA 3HZOA 4B82A 1QTRA 4DGQA 2I3ZA 4OB7A 3H1AA 3BXPA 4DM7A 1P0QA 5ISMA 4U2EA 1N5RA 5ALWA 1XZGA 2JGMA 3O4IA 2H9YA 1LPSA 5ALYA 2JBWA 4HXEB 4WDQA 1KEZA 4G4JA 4ZREA 3WZMA 2PKYX 4OCZA 3STUA 2NW6A 4LXHA 4BE4A 3HC7A 4K5QA 4MXDA 5AO9A 4A23A 1WPRA 3E0XA 2QR5A 4J0JA 3PF8A 1XLWA 4Q05A 3WWEA 1XLVA 3F67A 2QUBA 1C7IA 3STYA 1BE0A 2XUAA 2XMQA 2H7CA 1MAAA 1F0NA 1ZD5A 2HM7A 3R3XA 2QJWA 4C4ZA 2YXPX 2Z3ZA 4K2AA 4CCWA 5K3DA 2XI4A 5AM3A 1JJBA 5AM4A 4QNNA 3HLKA 2WUDA 2PSJA 5HFNA 1CUSA 3GELA 2QMQA 1EDEA 5JD5A 2OAEA 1Q83A 3WL6A 3QM1A 2G5PA 3AUKA 5EHNA 4G9EA 5HF5A 5DYTA 3EF3A 2Z8XA 2WJ4A 4UBIA 5ALPA 1YA8A 4HZGA 5LYYA 2ZYIA 4AX4A 3YASA 3AIOA 3BWXA 5E4TA 4C87A 5IVKA 5AH0A 1QLWA 5D7BA 1MAHA 4GW3A 3M82A 5ALOA 4J0DA 3WK4A 5SYMA 4J3JA 3C5WP 3JWEA 4RNCA 2J4CA 4C89A 2WHPA 4UHFA 1Y7IA 5AKXA 5JZBA 1XRNA 1XQVA 5JD6A 1P0PA 2FJPA 5BV7A 3WK8A 3S8YA 2D0DA 3HXKA 1LPMA 4G5XA 4WY8A 1XRPA 2FX5A 3EQ7A 5EGNA 3NGMA 2WIGA 4C01A 2RGUA 4UHDA 3RKSA 1EA5A 2CEKA 3TGLA 5T4HA 3ESBA 2ES4A 1LPOA 4F0JA 1H23A 5EHZA 4A16A 3VXKA 2DHDA 2GYVA 1YA4A 2J3DA 2WIFA 1YB6A 4FBLA 5JALA 4AB1A 1ODTC 3H0CA 3IVMA 1CIJA 3STVA 4PQEA 3P2MA 1XZJA 4DSZA 2DQYA 4X71A 4ARBA 4YK7A 1LZLA 4FLMA 2XUOA 1MX9A 2JGEA 3O4GA 4MYSA 1ACJA 2EEPA 2HFKA 1QOZA 5SYNA 2PBLA 5AKYA 5I7UA 4HRYA 3WIBA 2BUBA 3D2BA 1YCDA 5AJHA 1EI9A 3CCCA 5CH5A 5CXUA 1J2EA 2OXEA 2Y6VA 2XQIA 1CUEA 2PU5A 5CT5A 1RWQA 1QIMA 2HA4A 3F98A 2WG1A 4I4CA 4D9JA 2UZ0A 4X6UA 1LPAB 5DYWA 1EDDA 1EXWA 1EX9A 5ALEA 5K5EA 3A2MA 1UKAA 4B85A 4G8BA 4MQLA 4E14A 4NVRA 2FJ0A 2DFPA 5KREA 3B5EA 3FYUC 4BE9A 3I6ZA 1THGA 4MYDA 4CCYB 3RK4A 1N1MA 3W2TA 4C4YA 5HZGA 1ZD3A 3R41A 5IH7A 2R11A 5HFAA 3AILA 4G4IA 1QIEA 2JGIA 3I2KA 5JAPA 3FSGD 3N2ZB 1CR6A 2ZJFA 1FSSA 3PDCA 2CBGA 4AO7A 4AN1A 1G42A 2WFLB 5DNVA 2EDAA 3RARA 5IVHA 3FLAA 1QO9A 3O4HA 3O0DA 4B84A 1CUGA 4QDOA 1JU3A 3BJRA 1CQWA 5JZ9A 1UKCA 1SCIA 2PX6A 4MJ3A 4DMKA 1AGYA 2WFZA 1XZDA 1F0PA 4KE9A 2Q0XA 1LBSA 4QDXA 4EY6A 4DNOA 2JF0A 1BN6A 2ZSHA 5LZ7A 4UBLA 2XMBA 1JFRA 5JANA 4X85A 5KWJA 3R40A 4ZWNA 3PFBA 3FLEA 1VKHA 3BIWA 4JYMA 1FFBA 1ETHA 3WMRA 4PF1A 4UHCA 4N8EA 5A7FA 1GZ7A 5JIBA 3VVLA 4IHAA 5CURA 3UMJA 4UBNA 3ZPXA 2OGZA 4FMPA 5JYCA 2O7VA 3AIKA 5ALUA 3GZJA 1UZAA 4G8CA 1YAJA 3I2IA 3WL8A 3WL7A 1TCBA 4QWMA 4FLFA 1CUZA 3I1YA 4H7HA 4ZXFA 4DIUA 1DINA 1E3QA 3E4DA 1I6WA 3KD2A 1K6EA 4GHWA 3X3HA 2OGSA 2G5TA 1R1DA 4Y2XA 3EIOA 4GWLA 1Q0RA 1A8SA 4ZV9A 1W75A 3C70A 5D3KA 4B0PA 1TK3A 4X6XA 3DQZA 4QA9A 4TPKA 2XUDA 4KACA 3C6YA 3EQ8A 2G63A 1XZFA 4AN0A 2Z5GA 4KE6A 2XLBA 2XMRA 2XUJA 1LZKA 2BJHA 4KRXA 1VLQA 3WQHA 4Q1VA 5ALSA 2VT6A 3WK6A 3HEAA 1YS1X 2DSNA 3D3NA 4K6KA 4BC1A 1HLGA 2ECFA 3WWOA 1EINA 2C58A 5KWIA 5A6VA 1Z68A 4CFSA 2HU8A 3STTA 3TJMA 3DOIA 1DT5A 1MN6A 1GPNA 4W1QA 3ZV7A 1NX9A 5AKIA 1RP1A 4QDUA 1WOMA 1B41A 1G4HA 1L7RA 1QIFA 3BE8A 1K5PA 1TKRA 5A71A 3ZI7A 4LXGA 5KBYA 2HU7A 4OPMA 5CMLA 2GZSA 3LLCA 3FVTA 4BDTA 2IIVA 2GBFA 1XZLA 3DL7A 2HHAA 3BF7A 5DJ5A 3MUOA 2HIHA 2QT9A 3VISA 2WUGA 5JARA 1E8DA 4BZZA 1DQYA 4Q3LA 2B4KA 2OCKA 3H19A 4JH0A 2G4LA 5LZ9A 3QVMA 5AKGA 3OPMA 1NU8A 1UOOA 2OAGA 1UOPA 4TVKA 5I8PA 5CXXA 3WWPA 3G8YA 5T4BA 1MTZA 3DS8A 1FFEA 4GBGA 5ALQA 1CRLA 5JAOA 1L7AA 4L0CA 3HACA 1HDEA 1L7QA 4CCYA 5DWDA 1ZIYA 3TEJA 5AKHA 4UFNA 4WCVA 5EI5A 3OC0A 4QDZA 1WHSA 2HADA 3HRHA 1J07A 1QJ4A 4O08A 1MJ5A 3I2JA 1WPXA 2WHQA 1SCKA 4CG1A 5DYYA 1AUOA 4PSUA 3OURA 3R0VA 3C8DA 4KE7A 2WFLA 1CUXA 2WJ3A 2OQIA 2QZPA 1SC9A 3OOSA 4J0HA 1CUVA 2QS9A 1YS2X 5EHQA 1X2EA 2WIJA 4HAIA 4H18A 3WK7A 3A2NA 2GZRA 2X8BA 1DU4A 5K3EA 2IX9A 1UFOA 5K3AA 2PSFA 4PSDA 1ACLA 4DTCA 4EUSA 1QONA 1ZGBA 3FSGA 3W06A 1IVYA 2X76A 3DDUA 1AX9A 5ALVA 4FNGA 1VE7A 5BWCA 3O4JA 3I2FA 2CJPA 1J1IA 1D07A 3G0BA 2HRQA 3LP5A 4X3CA 4QEKA 1IMJA 2H7YA 3WKBA 3I2HA 3WL5A 1GPKA 4AMZA 3RM3A 1TQHA 3BDVA 2C0PA 1A8UA 3R3UA 4P9NA 4NMWA 4AZ0A 1QIGA 4MQMA 4B81A 3CN7A 4CG3A 5AOCA 3O9MA 4BCDA 2ZYSA 4BCBA 4EA6A 1H22A 3C6XA 1IZ8A 2BAGA 1ORVA 3F8SA 1RYYA 3K6KA 3WZLA 4P93A 1ZOIA 4GEGA 4H0CA 1QIJA 2W6CX 4UFOA 3VJKA 3FLBA 5ALDA 3HYSA 3PE6A 3V1NA 4RGYA 3W04A 1USWA 4V2IA 4UBKA 4PW0A 1LNSA 4X7BA 1XRQA 1LPBB 1UT6A 1SCQA 5LKRA 2HA5A 2VTVA 3GA7A 5K3FB 3F97A 4DLNA 3ED1A 1U2EA 1M33A 3MUNA 1XROA 2ACKA 3DKKA 3IA2A 1WB5A 2WG2A 2ACEA 3O95A 5HF6A 3NUZA 4KJXA 3FYTA 4I19A 1XKTA 3QH4A 4PO3X 1E66A 3ESDA 3IBTA 4ROTA 4QZVA 4IO0A 3BF8A 4EBBA 4U2GA 4Y9SA 4EY8A 4FTWA 4BC0A 2VAVA 1F6WA 2JIDA 4KE8A 4HTAA 5FDFA 4Q82A 4Z49A 3VDXA 7YASA 5DTIA 5DNUA 2EDCA 4Y2UA 1VOTA 1QIIA 3V1LA 1QTIA 4N8SA 1XZIA 4KAFA 5HQ3B 1ZJ5A 1HPLA 1MX1A 4B80A 2QVBA 5FRDA 3KOOA 4KYVA 4X94A 5AK4A 2QKYA 2VQ6A 3NOXA 1Y7HA 2QJRA 4B9AA 2C0QA 5ALLA 3QZUA 2JGFA 5AIAA 1ZI9A 3S2ZA 4H77A 1CPYA 2XUGA 1MT3A 1YR2A 4DNQA 1W76A 3MGAA 4LHEA 1DQZA 1XQWA 1E8NA 1R9NA 1W4LA 2DHEA 5AI8A 4CIBA 2OPHA 3BL8A 4EB0A 1N8SA 3V1KA 4BRZA 4HXGA 3WIOA 3G0GA 4AO6A 1DTEA 3C43A 2RHTA 1WM1A 1H2XA 3ILSA 4EHBA 5ALXA 4MEAA 4K6HA 3D2AA 1EB8A 5H3HA 4H7IA 2B20A 2XUFA 2VAXA 4UHBA 1JJIA 2PVSA 1EB9A 5IKXA 4CIAA 4I3FA 2CUTA 1BN7A 5D3ZA 3AZOA 4RE5A 2PSDA 1R88A 3WYDA 5AKKA 1W6RA 3RLIA 3WKAA 4GDMA 5JD4A 5LKAA 2VSQA 1UK7A 4Y2QA 5AHXA 4GECA 5YASA 1PJAA 2WFMA 3F96A 1HQDA 2JGKA 4WFKA 2I78A 5FUMA 1VXOA 1XZHA 3D59A 1CUHA 3LIPA 4OYYA 2WUEA 1A8QA 3G0DA 4WFIA 2H7XA 2JGJA 1AKNA 1XZCA 2I3DA 4IH4A 4UBOA 3WA7A 1WB6A 3UUEA 4CI9A 3PFCA 4QLAA 1R4ZA 4E46A 5AKZA 1EVEA 5FP0A 3DL4A 4TGLA 5JAHA 2HA7A 4MWSA 2WM2A 4X92A 1CUAA 3IURA 2DQZA 5BWBA 4H7DA 1YB7A 4BAZA 5HCUA 2GBGA 5CT4A 1LLFA 3VVMA 1OILA 1E8MA 1XZEA 2XUHA 1DX4A 5LZ8A 5AK5A 2O2GA 4OUKX 3QPCA 3R3YA 3G02A 4RE6A 3M81A 2C4HA 3FYUB 2PL5A 3H2HA 2HU5A 4EZIA 1WHTA 5K3FA 3WJ1A 4IQ4A 5C8VA 2GYUA 4BATA 5E4JA 3DOHA 3R3ZA 4LYEA 4BVJA 1R50A 3IUNA 2Y1KA 4F21A 1K4YA 5AK3A 1Y37A 2XUPA 3OG9A 4QDTA 3ESAA 4UHEA 5A2GA 4ETWA 4AXBA 3Q8WA 5CT8A 3AJAA 4G8DA 4ZI5A 4W63A 4Y2YA 2RIPA 5FLKA 3H18A 4U2FA 5ALKA 4ITVA 5D6OA 1F8UA 2C5GA 4LIPD 1UK9A 4OD0A 5EIEA 3WJ2A 4ZGBA 1BROA 5DTJA 1WCYA 3LS2A 4ZV7A 2WUFA 5CRIA 2C7BA 6YASA 1CUJA 2BUCA 2RI6A 4H7FA 4BBZA 4KAJA 1O6GA 4J7AA 2B61A 3BIXA 5HK9A 4Q3OA 4M0FA 2PPLA 1BU8A 2Z8ZA 3PUHA 3PUIA 3D7RA 5HQ3A 5K3BA 1XRMA 4W1RA 3HI4A 4DMHA 5A7HA 3AZQA 1YAHA 2AXEA 1X70A 4Q3KA 1A7UA 3ICVA 4B0OA 3H2JA 1XFDA 3HJUA 5CH3A 4H7KA 4L72A 2DCMA 2XDWA 2VJAA 4UPDA 4MWTA 5FKJA 5CW2A 3KDAA 1XZAA 1FFCA 2BKLA 1HKHA 2BFNA 1XRLA 5ALZA 3I1IA 4J0IA 1VZ3A 4WDRA 1MNAA 2RAUA 1K63A 3EBLA 4QLOA 2CB9A 4LYDA 2B9VA 3FBWA 3L1JA 5ALGA 1ZJ4A 4UBJA 4FNMA 3WWDA 4BTVA 5AKJA 2OCGA 3A70A 5LIPA 4X6YA 4X95A 4WJLA 3R3WA 1G66A 4M0EA 5CTAA 1FFAA 3K9BA 4X00A 1CUBA 1Q84A 2I03A 3PF9A 3SK0A 4E15A 5CT9A 3HABA 4IH9A 1DWQA 4C88A 1OCEA 1S8OA 4DMCA 3MVEA 4BDSA 1QIKA 4GLBA 2GBIA 5DNWA 5J3JA 2VJDA 2V98A 1EK2A 5ALRA 1A88A 3WKDA 1X2BA 2J3QA 5LZ5A 2ZSIA 4Y2VA 4B7ZA 4M0MA 3V9AA 3K2IA 2OGTA 2JEZA 4UBMA 2QTBA 1LPPA 4C4XA 1CEXA 1MNQA 2WIDA 3IUJA 1DT3A 2V9ZA 1CUYA 4JYPA 1MX5A 3H2IA 4J03A 1CV2A 1C4XA 3QMVA 1YASA 5DLPA 5AM0A 4KAAA 4Y2SA 1YSCA 1UOQA 4B83A 2IITA 4YASA 4J0KA 3C6ZA 3FOBA 3JW8A 2HDWA 2XQFA 2XE4A 1XRRA 5LZ4A 2VF2A 1MO2A 3O9VA 1IUOA 4BVKA 1GPLA 1H2ZA 3H2KA 5CT6A 4K6GA 3SWWA 3W9UA 3FYUA 1BS9A 2BUAA 3DNMA 5HKBA 2QUAA 3GFFA 5AI4A 1MU0A 1QIHA 1GXSA 4X91A 4AO8A 1E5TA 2ZYRA 1QZ3A 3Q0TA 1JI3A 3E3AA 4AZ3A 4B9EA 2PM8A 2VJCA 4HXFB 4RPCA 4JEIA 1CQZA 2ZVDA 1GGVA 4FOLA 1TCAA 3SC2A 4F60A 3HSSA 1WB4A 4G4GA 3WKEA 4EY7A 4FFVA 4B6GA 4PV7A 1VA4A 3I28A 3WLAA 4BP9A 4WFJA 4P08A 2WSLA 1W52X 3M3DA 1BCSA 2PUHA 4KR0A 2XMCA 1K8QA 1CUWA 3IDAA 4G1FA 4OU5A 1ZD4A 3L1HA 1TRHA 4OYLA 1IUNA 3E1GA 5A62A 1ZI6A 4LKOA 3U1TA 2E3JA 4X90A 3VKFA 5E2IA 4P92A 4DNPA 2WILA 5AKEA 3BJMA 2BGRA 2H1IA 3FCXA 1VXRA 2AJCA 2BCEA 2AJ8A 4WY5A 2LIPA 5T4EA 1AQLA 3LIIA 5EHXA 4J0GA 2HL6A 1JMKC 3G0IA 5AIBA 4IH1A 1ZGCA 2O2IA 1Q0ZA 4DNFA 5AM2A 4XX1A 1ZI8A 2XMSA 3GROA 1JJFA 1UKBA 5CH8A 3W05A 2WHRA 5AI6A 1UK8A 3TRDA 4UHHA 5FXMA 5AP9A 2ORYA 4E11A 2WIKA 3ZLVA 3C6BA 1H2YA 1U65A 4AQDA 4PSCA 5C8XA 1EVQA 5AI5A 1VE6A 4BP8A 1KU0A 1UK6A 5CBKA 5AM1A 1N5MA 3CCBA 3KXPA 3FCYA 3KWJA 1CLEA 2WU4A 2XUKA 3IB3A 1VA5A 1QO7A 1QFMA 1VJ5A 5AOAA 4A5SA 2XLCA 3IIIA 1P0IA 4U2DA 3A2LA 4FWBA 3D2CA 2WU3A 4Y2PA 2YASA 1MPXA 3DYIA 1QFSA 4MEBA 1QE3A 5BOVA 1AC5A 3DLTA 1ODSA 1CUIA 1TAHA 4XWGA 2CMFA 3B12A 3WK5A 1B6GA 1IZ7A 4F5ZA 2OQVA 2WTMA 3CXUA 1BEZA 1XZMA 1JMYA 1TCCA 3A6ZA 4GI1A 2V96A 2XB6A 1BRTA 3N0TA 1ZD2P 2YYSA 2AJDA 5K3CA 3KSRA 4Q34A 1GT6A 1EDBA 2D5LA 2ZJ7A 2OCIA 3GUUA 1FFDA 1HBJA 4QWWA 4N5HX 3G9XA 4OB8A 1O6FA 1U4NA 2XT0A 5JAUA 3V1MA 1LPNA 3G9TA 3QMWA 2AJLI 4BVLA 2ONCA 2YH2A 2WTNA 3JYHA 4UFPA 3H17A 4S0XA 3WA6A 3DJYA 4N8DA 2XQKA 5ALMA 4EY5A 3QMMA 1CUCA 2QOEA 4H7JA 2PSEA 5LP1A 2WQZA 2WJ6A 2Y2UA 5LLSA 1BEEA 1T2NA 2DR0A 3C8HA 1ORWA 4OU4A 1EK1A 3R3VA 1XKLA 2OCLA 1GQRA 4BRSA 2RONA 5IVDA 1C7JA 4UUQA 2HA3A 3G0CA 5FV4A 5T4FA 4L9AA 1PFQA 1EH5A 2XUQA 3M83A 4Y2TA 3V48A 4OB6A 2VJBA 4QE3A 4XIIA 3QPAA 3STWA 3I6MA 4X97A 2XQJA 1ODCA 3KWFA 2JGLA 3FWHA 3QPDA 4Y2RA 4L3WA 5EFZA 3ZLUA 5HF8A 2QM0A 4BAGA 4DMFA 1LBTA 2Y6UA 3CN9A 2FUKA 1ZIXA 3STXA 3D4LA 4W1SA 1GKKA 1J06A 4ARAA 4HS9A 2PU7A 2K2QB 5HK8A 1UWCA 2XQGA 3DD5A 4FHZA 3OM8A 1SFRA 3I6YA 4KEAA 1AURA 1DWPA 5FOQA 4G9GA 3FAKA 3IUQA 3D0KA 4BTLA 2WLSA 5AI9A 4W9RA 1BCRA 3AZPA 5JZSA 5A7GA 5AICA 1JKMA 2VT7A 5C8ZA 4FDMA 3H2GA 4DYHA 5EIAA 3T4UA 1ZICA 2O7RA 5C7YA 4LXIA 2X5XA 2V97A 1U8EA 1LGYA 3PICA 2Y2VA 4J0CA 5JADA 5ALJA 1QGED 4ZRDA 2ZYHA 3VJLA 2XUIA 2ZJ6A 5ALFA 4XVCA 3ICWA 2JEYA 5ALTA 3QITA 4FBMA 4H7EA 5AKLA 1GKLA 5FPQA 2QRUA 2HA0A 4Y2JA 1W1IA 5JASA 4AMYA 3F9CA 4BZWA 5I9IA 1JU4A 5EIHA 5AOBA 4HRXA 1SOMA 3IULA 3DCNA 2OG1A 5JATA 5C81A 5FPPA 4GXNA 3FVRA 2QXUA 2GYWA 1AMNA 3VJMA 2ROQA 2WG0A 4BB0A 1CUDA 2BGNA 4W1PA 1AZWA
chains in the Genus database with same CATH superfamily
3SHWA 3DDOA 4UEWA 2JFBA 1S2LA 2ZJZA 3IHWA 4UM5A 2GCEA 1NQWA 2HNAA 2EQAA 2QNIA 3LBYA 5LQSA 3TEFA 4DSAA 2Q0HA 5E1OA 3OUTA 1P0MA 1D03A 3RUDA 4E6EA 2O4CA 1E9DA 3IIMA 4JBIA 1ISMA 1K8RA 3SYLA 3W6UA 3PDWA 5SZHB 5JROA 4PAOA 2HMAA 4ZQHA 4CIWA 1NF2A 3OOHA 3W9SA 5CDFE 2LDXA 3JQGA 4M8IA 2DRIA 3OQVA 4ZCQA 3KTAA 2BEUA 4IGFA 2OLEA 1J25A 4Q6WA 5EMKA 3VU0A 1KFKB 2GAIA 3HCAA 4BQEA 5BNIA 5BNWA 1ADCA 2B21A 2FWNA 1NUQA 3J7AC 5CR9A 1Z83A 1YD7A 4V0LA 1NG9A 1T26A 2RGEA 3IBYA 3ENNA 3AEZA 3MS7A 4G0QA 4P36A 4PR0A 2NPIA 1ZJWA 1BFDA 3DDCA 3L92A 4N5DA 4WXEA 3UGTA 4YUWA 5ELXA 3AJ8A 3JR7A 4YVFA 3WX0A 4YUZA 1SXIA 3G9UA 3L7DA 3AFIA 1G1MA 2J4FA 1WUHS 3KKMA 1ODIA 1EDOA 2REXB 1T4MA 4J4HA 4TQAA 2YWXA 5TIIA 4WVLA 4KGDA 2VP5A 4QOFA 1ECGA 3K6SB 3ETLA 4QXQA 4RK6A 4JVOA 2IEIA 3NR2A 4M54A 5GZ1A 1OXXK 1C50A 3NIBA 2QUIA 3PT9A 2ZI9A 1FU8A 1Y82A 1PJ8A 3TD2A 4IOKA 4G1UC 4AY3A 1HC7A 2OD2A 4CUKA 4QFDA 5LB2A 4JY7A 2O3RA 1C3JA 4BJ3A 4D44A 3GJZA 4JI2B 3DEAA 1WU8A 3ASUA 3OPQA 1RE0A 2VJNA 1XTVA 4YX9A 2G4VA 4TMVA 3WG9A 3K72B 4B3JA 4D8WA 1WTAA 3I0ZA 1BS2A 1IZYA 4D9HA 4BO0A 2OORA 2FZGA 4R83A 2PSHA 1C3VA 1WDMA 1W29A 1NE2A 3ABZA 3H04A 1GZ5A 3UATA 4EGAA 4JLSA 1WKBA 2AI2A 3C5VA 2G9UA 2Q9CA 3N9IA 2WWXA 3SEZA 2CKMA 4AF7A 5DHPA 2P4HX 1UWLA 4C2BA 3E8XA 2YL2A 8ATCA 1KBQA 3AETA 1RM4A 3C45A 4MWGA 1YFLA 3GLQA 4MRSA 4EQ6A 2RHHA 2QVZX 2JNWA 2YJZA 2IP1A 2HRDA 3KEMA 3NAGA 1XZKA 2ODAA 2VS1A 4DB4A 3RT7A 5FFFA 3RF7A 2Y1OA 1PFWA 4AJPA 4Y7CA 2DC1A 4AY6A 2G9QA 1Y6QA 3R7DA 3HCRA 4MQ4A 1UPAA 2BMDA 1Y63A 2FOXA 4ENTA 4HPWA 4YAWA 1GNPA 2LCQA 5IXJA 3Q7RA 3NGXA 4CLDA 2A78A 2WYHA 1UC5B 3AR7A 1FJ2A 5HE8A 4CF3A 4ZHSA 4FFWA 4N0MA 1XQYA 1O0CA 4L57A 1K9SA 5AESA 2Z2YA 5T41A 1T1RA 4RPIA 3Q72A 1C0PA 4PN3A 2W0SA 1NVEA 1XU4A 4W7HA 5J5CA 1DELA 3II6X 3Q10A 4XTCS 3K4PA 3KB8A 1KPGA 4E1BA 3FMGA 5E7JA 5MGBA 2BI4A 3LVBA 2MIIA 3PI6A 1O95D 2QLLA 3AEKB 1ICEA 1XMJA 1PFGA 2JFPA 3DSRA 3TX2A 4WZ6A 4JB2A 5EYPA 1OU4A 1YRQA 2RGBA 3RF6A 3GBVA 4DG8A 3ESCA 3HVKA 4L15A 1PRYA 4HFRA 1ZCZA 2G06A 3CX8A 4INZA 1E1RA 1R8QA 5DM0A 4BRWA 4EMUA 1RS0A 3N6RA 2O1WA 3LLVA 1GDHA 2OXIA 1U81A 3LKVA 3G5AA 3AJEA 3RYFB 3T52A 4WSOA 4HVTA 4P33A 1WXXA 2VJOA 3VNSA 4U2BA 1F7VA 2HA2A 2O2HA 2XKJE 1JE0A 3M3HA 3MPUA 2JD2A 3DKRA 4NS4A 5BN1A 1LBEA 3D4OA 1IRIA 2VEOA 3K4HA 3QSYA 1JQAA 4CKYA 1P19A 1MO3A 1ZL0A 2PG3A 1N33B 1VZ2A 1EJ0A 1IQ0A 2ZJ0A 3UOGA 1TM2A 5CAEA 3PGJA 2VA9A 2GETA 4HX2A 2ZTHA 4R05A 1C0LA 4C0KA 4XJVA 3RPEA 3B9PA 4CV3A 3TNYA 1O5TA 2C96A 3SLGA 4H59A 4IDEA 3QOXA 1PV1A 2C8KA 2GOYA 2HNKA 2Q50A 4JC4A 2IPLA 3C7CB 4WEQA 5KB3A 2LUOA 5SICE 3QOWA 1N2EA 4NABA 5JS1A 1NXWA 4UTRA 2QXTA 5CLFA 4TWRA 1CWUA 3D5EA 3USES 1KMHB 1UXJA 1SXJD 3C6MA 4EKNB 1UQUA 2YV4A 1ZM2A 4BCCA 4RDCA 1TM3E 4HQFA 1FYDA 1GGNA 5TLSA 3EQ9A 4QDJA 4Y7DA 1POXA 3NT2A 2PMWB 4IWXA 3I62A 3AIMA 4YRRA 4R1MA 2YOFA 1IBMB 2P6RA 4MARA 3TX6A 1GA4A 1E4OA 1Z47A 3FHLA 3H1BA 3QNWA 3WDKA 3M6LA 3E9MA 1V3QE 3HZOA 3MM4A 3OD5A 4YCNA 4UCQA 4P5EA 1EXNA 2Z30A 4XCXA 3AFHA 2FSIA 2ZE7A 3MJSA 3MWDB 3RI3A 4KO3S 4X20B 2AKYA 2ATXA 2GJ8A 2C2MA 1THMA 4Y9RA 1VLVA 1NLYA 3AVWA 1H4QA 1E9CA 3DXFA 3PJFA 4UARA 3RUCA 4DPLA 1H6BA 5KVSA 2M6SA 3D6AA 1MHTA 2LGJA 4DM7A 1NVTA 3K8OE 3QFRA 3QW4B 2IYNA 5ALWA 4ZAXA 1XZGA 2JGMA 2M6KA 5GIOE 4I08A 1XV5A 5AW7A 3L4BA 1R9GA 2J7KA 3ZWOA 3HL0A 4WTOA 3UF0A 1VKJA 1OWPA 4QHSA 4O29A 1KEZA 1H6AA 2L2QA 4ZREA 5FOSA 2QRMA 5C5IA 1L8AA 2KHZA 3BX1A 1W94A 1YR3A 2PKYX 3ZEAA 5BNTA 2RGYA 5K6AA 1DJOA 4OCZA 2NW6A 1P5ZB 5FWXA 4BE4A 3HC7A 2B69A 4M7OA 5BN3B 4I55B 2J08A 3GJ5A 5AO9A 2IIPA 1VBKA 3E0XA 2QP3A 3KBOA 3L8HA 2HO4A 4QVIA 4J0JA 3EIWA 3N7TA 3PF8A 2EYQA 1O97C 3OLZA 2P6MA 4Q15A 1Z3CA 1KS9A 4L4UA 3RU9A 2GFIA 3L49A 5J2UA 4DRZA 1IXYA 2QUBA 4WXYB 1FUYB 1P5FA 5FBHA 2OC4A 2XUAA 4UQOA 2E48A 3O3OB 4KN5A 1J56A 4XVQA 1MAAA 2F8SA 1NJ1A 1R6AA 4RA9B 2Y1DA 4FIDA 3ZDEA 2Y9MB 4L6AA 3QU7A 2XXBA 3O8NA 2D7DA 2P5UA 1R0XA 2AS0A 5D00A 3OA0A 1HDYA 2WPDD 5E0KB 1F8YA 1I01A 1MAWA 1PEYA 2CFSA 1MEJA 4E7PA 2REQB 3L02A 3UXHA 1BKDR 4PS0A 4CCWA 3WHIA 4QUAA 1GKIA 4CM8A 2AFRA 2FN7A 5JS7A 5B3JA 3BH7A 3K96A 4HTFB 5FCDA 4CDMA 1E2JA 2F4VB 3HG7A 1KA9H 2C4NA 3IAM6 3LK7A 4KSBA 2QVXX 1R0KA 4AULA 5JOQA 2IOYA 3T9FA 1QLHA 4P5PA 4F46A 3H86A 5DNCA 5BUZA 2PSJA 2P1RA 4KV9A 4MR9B 4YB8A 4YRLA 5HFNA 3GGPA 3U7JA 1TA0A 2E5FA 4QXOA 2QMQA 1IJBA 1T0UA 2JHPA 3SG0A 2CXNA 5JJBA 1PAUA 3B6MA 4ZQFA 5F3DA 4KR7A 1CHDA 1II0A 2DJIA 4XGQA 2G5PA 2PO7A 4B8WA 3JR3A 4GPZA 1U0OC 1EVZA 5EHNA 3ZY2A 2QJOA 1CF9A 5HF5A 4KDEA 2PA0A 2YNMD 1U7WA 3DA8A 4FQ5A 2Z8XA 4CL8A 4UBIA 5ALPA 5BYAA 1YA8A 1KO5A 4AX4A 4D0SA 3EH2A 3ROEA 3L4JA 3F49S 2V1UA 5IVKA 3MWEA 1PR4A 3VV2A 1RYFA 3VUFA 2MSWA 3HB9A 5D7BA 3BA1A 1YZVA 2EW2A 4FI3F 2IV3A 5EQJB 2NT3A 2HJVA 5GADl 5DCUA 3I8OA 5CA0B 4GW3A 4A2QA 5G0SA 3W8RA 1AY0A 2N3ZA 4J3JA 4OLBA 1Q7BA 3WYEA 3P2IA 1EFRD 1Z8DA 2AK3A 3PPIA 4JD5A 2ILVA 4KFTA 4RNCA 3HGMA 2XYQA 1FU4A 2LV8A 4G26A 1C7RA 3IEPA 2G9RA 3IILA 3LO8A 5F2KA 1NW8A 4FZRA 5JZBA 1XRNA 2BF4A 2VDJA 3JZIA 1PBTA 4HNRA 5CHYA 4YACA 3YASA 1KE1A 2H1RA 1P0PA 1RU3A 3OZFA 3RCBA 1UXKA 4QELA 3WOHA 2DBRA 4GE3A 1ZRNA 3WK8A 4X65B 1FS4A 3RTDA 4GKKB 5FA6A 1R4AA 3HV0A 2Q5EA 4HDQB 5DVZA 4G5XA 3MOSA 1KZYC 1G8PA 4GF5A 1P3Y1 3AG5A 4Q3DA 1FMCA 2OXRA 1M0WA 3P0JA 3C3KA 4FYWA 5JBQA 2HLDD 3B52X 4JK3A 3CLKA 5EGNA 1M2KA 2ZS8A 3H4IA 3QKSB 2BFBA 3U4MA 4B4KA 4CIXA 3WGYA 5JE8A 2LW7A 4RH0A 4MVJI 1EFTA 2VJYA 1E62A 2Q4OA 3SHQA 3ZV5A 1G2IA 1YACA 4PRYA 4JYAB 3AIIA 2X14A 3O4FA 5C18A 3ISVA 3Q9SA 4UTOA 2AB0A 4W5NA 2WSSD 4F0JA 1CP3A 1YRYE 3TSZA 2FMXA 5DGDA 4EP1A 1V71A 1B6SA 2N42A 2YVAA 2FETA 4KXUA 3T5TA 5EHZA 1OV4A 1ORRA 1Z15A 2DHDA 4JB0A 4Q18A 3EPLA 1KI7A 3WHLA 2UU9B 2XZLA 1QRRA 2XX3A 1F9AA 2JD0A 1YQUA 3CQ9A 5CCDA 1MC5A 4IS2A 3QVGA 4KH1A 3KQQA 2GEUA 4M86A 1G7SA 2GK6A 3W4JA 5BWNA 5JALA 1FYWA 1CY2A 3TPZA 4G6ZA 3WL3A 2OFWA 2BR4A 3G89A 4MW5A 5KX5A 1JXAA 2BR5A 1H4TA 3PNMA 3HFGA 4FGZA 4FYMA 4YAFA 4AB1A 1M8JA 4CDNA 2WT8A 1ODTC 4R0NA 2C4UA 3PPXA 4IIGA 3KOMA 4AG3A 1R74A 1F17A 1P45A 4UZEA 3ETGA 4UE6A 4WKPA 1DVRA 4MJ7A 4PQEA 1A9ZA 3JQ6A 1MEEA 1XZJA 3UAWA 4M0UA 3F6YA 3NTRA 5EE3A 3EQ6A 1PJ3A 3F7NA 3FHCB 4G8JA 1JIVA 2DQYA 3VZDA 1P4SA 2J32A 3QGMA 4X71A 4KH0A 1SVIA 1J2YA 4AY2A 5KINB 1FTNA 3KL2A 3MMSA 2V7EA 2GM3A 4ARBA 1KO7A 2Y0CA 1AKYA 4FLMA 1N2HA 3P9QA 1IY8A 3ITEA 2ANBA 2QTHA 3NG1A 2AR0A 4PFQA 4YMSA 4A91A 2XVYA 1V8DA 4K3VA 4PGMA 3TUZC 1JQ3A 1D2AA 5DI3B 3LRTA 2QG9A 4HLDA 2AJTA 3B53X 4FX5A 4IUDS 4A8JA 4XYLA 1I3CA 1ULHA 2AOUA 5IM4A 3O4GA 3LKDA 3E05A 2IH4A 1WD7A 3CUTA 1Z4IA 2JLSA 2VYQA 5A2QA 1U7HA 4ARIA 3IE1A 2GXUA 3HRKA 3EXHC 4DXDA 1YB4A 2ZETA 4PFSA 1L7MA 1QOZA 1VM6A 2PUAA 1CETA 2NZ8A 2VRCA 4WA8A 5CPBA 3ZE6A 3HXQA 4BEJA 3B36A 3CF4G 4WZBB 4IJ5A 2F1RA 1U2DC 1U1DA 2PBLA 1IZZA 3N2YA 5AKYA 4AK9A 4RJTA 3RVSA 1T6YA 1SM4A 3IO3A 1OXBB 2NUAB 1XTPA 3DE7X 4S1NA 3RTGA 4GPD1 2VPPA 2AN4A 4V0RA 3D2BA 3K6JA 4RVFA 3UMVA 1I2BA 5E7MA 1JZSA 3V7FA 1B15A 1YCDA 1K75A 1SKUA 3U3OA 5C5EA 4TLCA 1SQ5A 4RZIA 3KBBA 1CDZA 4FPXA 2JFGA 3H1GA 5FLXA 4L8LA 1HDZA 2JZOA 4EHLA 3AJDA 1QH8A 3ZH2A 3K1TA 1N3LA 1C9JA 1LDEA 3O7MA 1Z6QA 1SB8A 1TVCA 3BVPA 4LQDA 2Y6VA 4QO8A 4UCFA 1BFKA 2GPNA 2I6GA 3CZAA 3E8SA 3AWDA 3PPYA 4RHXA 5T6BA 4ASUA 1V7QA 2AUMA 2XQIA 4YBZA 2Q5OA 1EFLA 5E9AA 4R9SA 4LDJA 1YL6A 3L8YA 3FYHA 4P34A 4KO4S 3GRUA 1RQ2A 3ZQ6A 5A4AA 3D64A 4WGFA 3WNDA 2CLKB 4M8LA 5DRTA 3SQDA 1EFAA 3B8EA 1SUSA 1P1HA 4AIRA 1Y9ZA 2CVFA 4DM3A 2G0AA 5I01A 1G8HA 1U04A 3VHXB 3DHYA 5F98A 4X6UA 3SS8A 2C2HA 3R0QA 5C51B 2BC9A 3D1VA 2H7VA 1EXWA 5I45A 1N7HA 3ZLJA 3MF4A 2AXNA 4GWKA 5ALEA 4BB5A 2D7JA 4C9BA 1ARZA 3HDHA 2XF8A 1C8BA 2J3JA 4O5OA 1Z4PX 4YREA 4E5PA 1F3LA 4PYIA 2YRFA 3V8NA 4RJLA 5CNKA 4R5MA 3Q1KA 2ZJ3A 2QQGA 1TAGA 1H85A 2FFJA 3B6EA 4XIFA 3TR5A 3ZKWA 5B7PA 4YRTA 3B5EA 3KWLA 3M1LA 1S0UA 1DADA 1RYBA 2VXBA 4PR3A 2DULA 2L82A 1ZK4A 2FW1A 1NW9B 3I6ZA 3LPMA 5CVCA 1RRCA 4EHDA 1JBEA 2XDQA 2ZATA 4MPPA 1I33A 4YJ3B 4CU5A 1B0AA 4FT4A 4J2OA 4MVYA 4UOQA 2R79A 1LTHR 1E2BA 1G16A 5B3JC 2SECE 3HZZA 1WVMA 1GZUA 4KBFA 4C4YA 1RZUA 1WW3A 2CNBA 2O8FA 5HRUA 1U7OA 2R11A 2UYCA 4ER5A 4P86A 1D4ZA 1HE8B 2BP7B 3JAWA 1KJ9A 4G4IA 4H17A 4B6PA 2WUWE 3DQQA 1M54A 1RKXA 2AC4A 3FSGD 4OI1A 1ZR4A 1JH9A 1KIMA 1ND6A 4KQXA 3M6WA 3IKLA 1R8YA 1PBNA 2PGXA 1MIOA 1NXQA 3EZLA 3GWZA 3CRMA 1FP4B 2YVUA 3PDCA 2CBGA 4JWTA 1V37A 1G7CA 2ZWMA 2QVCA 1BG6A 3DEKA 1YQQA 1J2UA 4HT3B 2G09A 2EGHA 5HS4A 4AN1A 2RGCA 2VT2A 3K0AB 4FSHA 3WYBA 2ZSJA 3D1JA 5DNVA 2EDAA 3OJLA 1NP7A 2E2WA 4PZCA 5JDCC 2BZSA 2H8KA 1ULSA 3RARA 2OBBA 5IVHA 3O4HA 5BRAA 4Q4JB 1UBGA 4JLJA 1SOUA 4JL8A 3LDFA 1CUGA 5CNIA 3SJCA 1IAQA 1CB7A 1W4BA 2CXRA 1M10A 2PT9A 2R6HA 3EARA 5FBLB 4Q9NA 3I9V1 1FNDA 4MPDA 2DEUA 1J8DA 1OIXA 1JZTA 2LRHA 4MUBA 1NHWA 2E18A 1SCIA 2PX6A 4MJ3A 5BVHA 4ABTA 3L8DA 1T8UA 2Y67A 4P38A 3OOWA 3UOAB 2YMMA 3NP7A 2BEKA 3UGKA 2JH3A 3ESRA 4ETMA 4AJ1A 2AN5A 4DE5A 4W5QA 4FMBB 1B74A 1R4MB 1Y9AA 4RQAA 4R2JA 5F64A 2FPLA 4Y1GA 3NBYC 4V0KA 1B3BA 4E1VA 1BVHA 1SAYA 4DSTA 1B8NA 4UDYX 3O7WA 5K3OA 1X7WB 1HF3A 1ZGGA 2H2HA 3CZCA 1OZAA 2JI6A 2Y0PA 4NBUA 4UBLA 1L5WA 2PBRA 3VMFA 1CP2A 1SWVA 4UPVA 3FZEA 1D5CA 5AJTA 4JLMA 4A0HA 1ZN8A 5JS6A 5B36A 1QR6A 1BJKA 1ZHFA 3KKLA 3FLEA 4BZQA 4X54A 1IONA 3U3JA 3ZU3A 5BOSB 1FFBA 1P1BA 2HK6A 4MB0A 4PF1A 1OSNA 2ZUCA 2FRXA 4N8EA 4UHCA 4ZTUB 3WLMA 1AQYA 3KG2A 4DR7B 5KNCA 4PX5A 2QW8A 4PNPA 5HDBB 3PIIA 3VVLA 1MXFA 4IHAA 2I2XB 3FN4A 4YJGA 1GTSA 2ZSAA 5IDYA 3RUAA 3IHLA 2VP2A 1S3FA 3IRUA 4FMPA 5HNKA 2D8AA 2O7VA 5ALUA 2H1LA 5IU6A 5M5BA 1GUDA 4BKPA 3NDBB 5J4LA 3GZJA 3AFGA 1XWWA 2F7SA 4G8CA 1F2VA 2XDYA 4GM4A 1Y4ZA 2CUKA 2GTPA 1I94B 4HY3A 4AZ0B 4BXOB 1NUUA 1YAJA 1N6IA 3PWTA 2JFUA 1MFZA 4MROA 1SD1A 2WM8A 3V6LA 1EXVA 3MLEA 1DO2A 4KPEC 3GA0A 4BBJA 3DXXA 1J20A 3I1YA 3GEHA 4C76A 2O2CA 1BVUA 2XECA 4HWGA 3ICEA 4XIJA 4X66B 1A5SB 3E82A 3FWKA 3PB3A 3TJRA 4U5QA 4WA7A 3E4DA 1QNLA 3QV1A 2IV7A 2JJ1D 1L4HA 5FBVB 3X3HA 2B0JA 1NP6A 4A26A 1Z5WA 2OGSA 1YGYA 2G5TA 4JX8A 2TMDA 4IZOA 3EIOA 3M2PA 4N3AA 5HJ5A 3HDJA 5DYGA 4ZV9A 2LBPA 1C8KA 1VJ1A 3M6AA 4FC7A 1ZM4A 3DT9A 2W4IA 4QOHA 2G6BA 2PKRA 3HNRA 2A3RA 3JQBA 3KDSE 5JFGA 3IV6A 1VHWA 1TK3A 3G5LA 3K0BA 4QA9A 4KQ2A 4W82A 2YBEA 1O9HA 2Y1LA 3NV7A 2YDXA 1KEUA 3H5NA 2IFTA 2XUDA 5JRDS 4LY0A 1U3UA 3RS2A 3T8YA 3UB3A 2XKKA 3AHIA 4PTLA 3UKOA 2IUFA 4AN0A 3ZVMA 3ITNA 4HYYA 4R8RA 1XTBA 1QVZA 1Z17A 4KE6A 4YI5A 8ADHA 5L4LA 3GNSA 4AI6A 1ZM7A 2BCJQ 3DQPA 3I04A 3Q40A 4LNHA 5F7OA 3WRYA 3K9QO 5JZOA 1SZJG 5A4KA 1WKVA 1Z0AA 3JQ8A 4QASA 5KYNA 3PUJA 4N3NA 3NVMB 3T54A 1RVV1 2RAVA 4BO3A 3CURA 1G98A 3PIDA 4DSOA 4AQYB 2GERA 4ZZIA 5DRYA 5KYUA 2DSNA 1FXUA 1C7FA 1D2MA 3MGCA 3FPLA 2XWJI 4M9QA 4R0MA 3AT1A 3PZRA 4BC1A 2P3LA 5JFOA 5TT1A 3FCUB 4FDAA 4XGIA 4AX8A 1AB6A 1EINA 3TLMA 3RFVA 3QBEA 2QMYA 5KWIA 1I5OA 2CSUA 3CZPA 2OP0A 1V8FA 3T35A 4IUBS 4KC0A 4CFSA 3AKDA 3MT9A 3RRBA 3PNVA 3W3ZB 1EZ4A 3OIWA 4XSHA 4XCQA 1GPNA 1Y8RA 4DAEA 4TTTS 5T6MA 1MW8X 2MOKA 1M5TA 3F3SA 5ITVA 1G6HA 2JJYA 4G85A 2CVZA 1USIA 1XVLA 2VBGA 2P6OA 2YJNA 1U80A 1BQ3A 2DLNA 3BMOB 1NX9A 3KOWA 3PNSA 4TZTA 1HEUA 2IY8A 4YMHA 1FVHA 2LE0A 1E2PA 4GOLD 3R9IA 4TLMB 4A82A 2RC6A 1TFUA 3INYA 4CZ2A 1TQ6A 1ZFNA 5ELMA 3HZHA 5K1ZA 3ADKA 3BE8A 1U8UA 4GLLA 2QE6A 4WEOA 1EFHA 2XDAA 4MKFA 2XCQA 3EVBA 4RFLA 4LXGA 5A71A 3WIEA 4D4LA 4LXTA 3DWEX 3ZY5A 1LWNA 5CMLA 2GZSA 5CA0F 2FFQA 3F46A 1J49A 3P9PA 4RZ2A 3R6WA 4UNSA 4Q01A 1OY1A 1ZZEA 2GBFA 4R1OA 3EEOA 3FI0A 3R77A 5JUWA 1XCLA 1YZKA 1ZH6A 4CMKA 4BQOA 2WU0A 3PJDA 1JVNA 1RWKA 2C7VA 2GXQA 3V46A 1SHLA 4YP7A 1KI6A 1I3OA 2DPLA 1KY2A 2Q6OA 2IYFA 3KDPA 2QT9A 3QNMA 4M0DA 3RFXA 4QFCA 5C7LO 3VR5H 4B1FA 5DXJA 2WUGA 1Q91A 2PLRA 4TRRA 2GB4A 3R8FA 2PYDA 2Q21A 5JARA 4J94A 2YHIB 4REQB 4N3CA 4BX8A 1T34A 1DQYA 4LNAA 1UT5A 1PG5A 3DD1A 4J7CA 3RS0A 2R97A 1WPQA 2GCOB 1BMQA 3PHCA 2B4KA 2HGZA 2OCKA 3C7KA 3H19A 3UJHA 4G1CA 4EARA 3RRFA 2VQEB 3DMYA 4BYGA 5KYGA 4QU8A 1DXHA 3U4IA 3TKAA 3SSAA 2NADA 2ZSEA 3PU6A 1DOZA 5AKGA 2SKCA 3UFXA 1LTQA 3Q5GA 1QHSA 4EF4A 1UOOA 2OAGA 3L6OO 4H1WA 4EI7A 3IP1A 2ZCVA 2OHHA 5I8PA 4M36A 2AKAB 3QV2A 3QF7A 3H5VA 3WGNA 2V9PA 1OFUA 4EGJA 3WWPA 2Q9UA 1ESZA 4DM4A 3G2NA 3ZGLA 5DWQA 2P9QA 5KYWB 1N2CA 3E2IA 2VP9A 1MTZA 2I9PA 3D6NB 4KLCA 2MTBA 2Y1WA 4YAKA 3GFPA 1FVXA 2J46A 3DS8A 1FDWA 4RD4A 4F7DA 3UV7A 3NHAA 3PBKA 3CNBA 3GFQA 1W85B 2DP4E 3LA6A 4HPJB 3TRKA 3A2KA 2ECKA 1AU9A 1RXSA 1ZIYA 3NWJA 3PJGA 3AEUA 4BX2A 5AUOB 5AKHA 1P60A 2WMNB 1UEJA 2Q1XA 4HUTA 1BH2A 1CS4C 3HWSA 2YFKA 1JWLA 2CV2A 1JPNA 3GJ8A 1NI4A 4OGKA 3N8IA 2WY2D 4MMXB 3URKA 3HVRA 3EISA 2C9OA 2IH5A 3AI2A 4Q0MA 3ABIA 4NYMR 2I6FA 3D7NA 4P3YA 5F2EA 3K2BA 2L0XA 2G8LA 3NAQA 2VK4A 2ZZNA 4I1VA 3EHDA 3W5BA 3G3EA 4KDCA 1W5BA 1KYYA 1JBKA 4R2HA 1SH7A 1KI4A 2WAXA 3RG2A 2WVAA 1WPXA 2CLHB 1ZOLA 3GIDA 1AUOA 2W4QA 3HS3A 4OXRA 4BLTA 2LWIA 1Q7TA 4PHTA 1SEPA 3KQLA 3E58A 2WFLA 1XXHE 1OAAA 2WJ3A 1RYHA 4J0HA 1REQA 1QK5A 1SC9A 3KXKA 1V8BA 3PVCA 4LCEA 4HKTA 2Z08A 4NPAA 1YS2X 2O1SA 1X2EA 3DBLB 5EHQA 3AY6A 4OXKA 5AR1A 4EZEA 3MBOA 5FR1A 3V6MA 2YZ7A 4HAIA 4WT7A 1PWZA 2AN1A 2BM1A 2ZQYA 3U4DA 1KBZA 2PUGA 4X64B 3PRYA 2W70A 4RZQA 1TYEB 3UMSA 3DLCA 2ZXUA 1KH1A 2GUGA 3JQ7B 1DU4A 2AFIA 5K3EA 2VF8A 2MYTA 2EG9A 4ZZ0A 2VNKA 3IAS1 5K3AA 3H7AA 3FMVA 4I9NA 3OZUA 2BMFA 1TGVA 4KK4A 5DOZA 2ZCUA 2G7MC 3NMUF 3GDGA 2OYRA 3EWNA 5JI3E 2JB9A 2WJJA 3HE3A 4OM7A 3SYRA 5J4KA 5BR1A 1GPYA 5E6UA 1GWNA 3L7JA 1E1YA 2FQQA 1IVYA 3KJIA 4XAQA 4DJ5X 1H4SA 3PDIA 3TDKA 2CHGA 3RYIA 5CUQA 1AX9A 2BMWA 4NDNE 1DBQA 9LDBA 5K4HA 4NWIA 4AKEA 3CB4A 1BW9A 3V8PA 2AVDA 4CTKA 3ANYB 5BWCA 3AEXA 3KELA 2XB8A 4OF4A 5P8WA 4Z1MA 3EF1A 1GILA 2ZIXB 3I2FA 5F78A 1RLUA 1USKA 4DCVA 3BN3A 4RVGA 3QOYA 2CHQA 3QMPA 4I4NA 1H0KA 1RM5A 1AS3A 1T35A 2CVHA 3LP5A 4QEKA 3WMFA 4QPPA 4ZHQA 3TK1A 2IPOA 2XYHA 1QC5B 3GLIB 3NS7A 2GYYA 4Q7QA 3D3JA 3ID6C 4IILA 2GF0A 4QBHA 3C4QA 5A4FS 3CC8A 5DLEA 4LVOA 5HM8A 5HP4A 2HCBA 3H84A 1CJKC 1EP1B 3FPSA 4DUGD 4GOJA 2FPWA 2PJZA 1TQHA 4MLPA 2JLRA 1A8UA 5AVKA 1C8LA 2HRZA 5TEVA 4KTVE 4X84A 1U3TA 2WSYB 2PGJA 3M6FA 1E1DA 1RI1A 1HYBA 4NMWA 4QARA 3X1MA 3LDAA 3UICA 1EM8B 2W8BA 1FIUA 5ECYA 4AIIA 3HU3A 2ZYSA 1JIKA 3GB9A 3QPVA 4C1BA 4F11A 3OCZA 3MWKA 3UTDA 4EA6A 5DZSA 1UDAA 1LJ8A 1H22A 4GSYA 1IZ8A 3OQNA 1DRWA 1JSXA 2FMKA 1K6XA 3Q3VA 4R1PA 4C7BA 3IAXA 2BAGA 2VI5A 4PPFA 1MKYA 4U9IS 1RYYA 3JVEA 3FZQA 4E5KA 5A1TA 1O3YA 1NN0A 1US8B 2HEGA 3A9RA 3K6KA 2Y27A 3WZLA 1K5HA 3CKYA 4GM1A 4GZMA 3ROPA 1Z7BA 3GLKA 3E9YA 4BIMA 4MEJA 1PNOA 2W6CX 4UFOA 5BN5A 5JQGA 3FLBA 1OAOC 3THYB 1XTQA 2BHSA 3OQJA 4OHKA 3RBZA 3KYCB 4ZOLB 4Z6KA 1NT4A 4KYUA 1VE1A 4RGYA 4ZRMA 4ER0A 1DLIA 3VDQA 1USWA 4V2IA 1V6CA 3F78A 4KQCA 1YNSA 2QVYX 4E7OA 5T3YA 2E21A 3OEHD 3CUSA 3UXYA 3X43A 1DAOA 3G5MA 4G0NA 3T0GA 4E5VA 2J3EA 1X1AA 3G2JA 1BIFA 2J8ZA 3GG9A 4MKZA 1LPBB 4QGBA 4N82A 4YJ3F 3DHWC 2JATA 4FCWA 1AQIA 4JUDX 3NXKA 5FHRA 5A3SA 1RJ9A 1DBIA 4I8IA 3BBLA 2O8DA 3GA7A 1FDOA 4DCSA 1F0YA 2BELA 5F7JA 1G21A 4MUHA 1UKVY 2H18A 3C3CA 4ZOQI 1K27A 4L27A 2H1HA 3CLTD 1LFDB 3TLGA 4XM0A 3RWOA 3ST7A 4DLNA 5DM2A 2DGDA 3SC3A 3U1BA 1AUPA 1ML4A 3GLTA 3MUNA 4AMVA 1YVPA 3IA2A 1B23P 2GRJA 5TF0A 4YUVA 3CXRA 3O3NB 1VGRA 3H1EA 3PUKA 4L2IA 4LMBA 3WJAA 2BMVA 2NYAA 5HF6A 1FU7A 2DPMA 4KUHA 4BV8A 2BYTA 2AEJA 3NUZA 3UVEA 4A03A 2YUIA 2O7SA 4X5OA 1JLKA 3UIEA 2A1TR 3FTCA 4MO9A 1L4KA 5KOHA 5KOIA 1WCXA 1DHRA 1DO0A 2PKCA 3ET5A 3Q7EA 1N5LA 3FPCA 4ZVKA 16PKA 5KJ6A 4PAWA 4E22A 2IYVA 4F5DA 1L1EA 1OFVA 3EQ2A 5JW6A 3H9UA 4QZVA 1O6BA 1ZRHA 5DHAA 1L5SA 4LTDA 3VR1A 4YQFA 4EBBA 3LNTA 1MZPA 4RAOA 1H2HA 3A27A 3DC2A 3E7XA 4Y9SA 4MIYA 3CKMA 1DO8A 1WOYA 4ZVQA 3LPAA 3ZW8A 1GR1A 2ERCA 2VDPB 2B2CA 2EZ4A 2JBAB 2O23A 4Q12A 3H1TA 4G09A 4RYLA 1F6WA 2W6JA 2WICA 1UJ5A 3P8ZA 4TZ6A 4BNUA 3PQ2A 4KE8A 3UMGA 4HMOA 1YKFA 1TJ4A 4JXKA 4LJKA 2PRZA 3ECSA 4G2NA 3N8HA 1EHCA 5KI6A 3VKUA 2IY9A 1QE5A 4XASA 2X9NA 3H5TA 3RYTC 1JALA 4S3MA 4B3CA 1V96A 3VDXA 2H4WA 4B09A 1WMAA 3BJIC 4QOJA 5JSUA 5HKKD 5DP2A 1HQKA 1GA6A 1AM4D 4MPTA 1ZXXA 3N53A 4E08A 4LYHA 4TMFA 1DCKA 1QIIA 3BCUA 1AMUA 3G2LA 4DLAA 3GH3A 3T1QA 3EODA 3W2EA 2CY0A 5JU6A 1E9SA 3EPPA 4OGLA 3VU3A 4NCKA 4ACAA 4N8SA 2VYVD 2PEZA 5GJWC 3GLGB 3DDHA 4RW0A 4US0R 5U4QA 5CDFA 4XUGB 1XHFA 3OQHA 2AX3A 5GV7A 1MX1A 2G07A 5CJPA 5EHGA 2ZRKA 4LGVA 3F5DA 4BNDA 2NZ2A 3HB5X 2X4GA 4NPCA 1EP3B 4M9CA 2CYAA 2JDIA 4GI3A 4KYVA 1DAKA 1SKYE 5AK4A 1RQPA 4MB2A 5DT9A 4X3PA 1I6KA 2JD1A 3NOXA 4B3DA 1P72A 3DAHA 3LUAA 4BN0A 1YIOA 3NHJA 4XDGA 2HSEA 4PYOA 3TLCA 3DCJA 3LI2A 2C61A 4U7PB 4EUEA 2GM4A 2H4JA 4ZEOA 5CJJA 3KM0A 1FQJA 4TL9A 4KXMA 1MJFA 5IM5A 2WKRA 3WLFA 4PZPA 1SJ9A 5ILGA 2II6A 1FJHA 4H77A 1DIAA 1T6BY 1TUGA 2ZFUA 4RZUA 3GEPA 1X1DA 2Q2QA 5K20A 1WBBA 4MR8A 13PKA 1MT3A 4I1RA 1V16B 3FNFA 2GAFA 4N9WA 5CB4F 5JO0A 2ADFA 4S1VA 4WKCA 1U98A 1GZ6A 3AEQA 3MGAA 1W19A 4LHEA 1RYDA 1ZNXA 2QPOA 2V6IA 2AOTB 1R7RA 3KVOA 2ZDGA 3T5PA 4R7ZA 5F1OA 4BUJA 5K6RA 1E8NA 4KG7A 4ZJZA 2ORWA 1XMXA 4WADA 2FKAA 3SKYA 4WOKA 3CVOA 3ZVLA 1U5CA 2R1ZA 1TO2E 2IOQA 3KQPA 4NQRA 1NKSA 2OUIA 1V95A 4E3WA 5CP8A 3Q6NA 3R5FA 4BRZA 4HXGA 3ZWMA 2A9FA 1JHOA 5EE9A 1E69A 3G0GA 4FYKA 5CCEA 3HXLA 4MP3A 4LSMA 4C4TA 1LH0A 4C03A 3LVFO 4MVWA 2Q5CA 1DC7A 1WM1A 3P20A 2AYXA 3TOSA 2XF2A 4LK2A 1SHUX 2VQDA 4O4JA 2Q1WA 3B1JA 3CEJA 2ZBVA 2XOKA 1SZDA 4H9GA 2J3LA 1BTOA 3LO5A 1MA0A 1EX1A 2BE7A 1BE8A 1CZLA 2H1SA 4RD3A 1N2JA 3RFFA 1GKUB 1EWVA 3ZOKA 5ALXA 3EOZA 3KLBA 1RPJA 3VNVA 2WTEA 1PR9A 1GYPA 3D0OA 3FYSA 3ZWNA 3C98A 1HE5A 2Q5HA 5KSZA 1WDTA 1ZH4A 4DABA 3D7MA 5HS6A 4X1KB 2O5RA 1O54A 3NVKI 3BEDA 3E9RA 1A9YA 1OTHA 1OHHA 5DMXA 3HN6A 3O31A 4NX2A 4HDNA 2QYTA 4WV3A 3T9AA 5E6RB 1RXIA 1BN7A 4IPTA 2HMWA 2B5VA 2ZULA 3GVXA 2ZYDA 3I8SA 5L6MB 3R0XA 4N7RA 2R6CA 1N0IA 3RLIA 5KNBA 3ZGYA 1IY9A 2H11A 2Z98A 4GDMA 5IJ9A 3NM4A 3FAZA 3HP1A 3AG6A 1DKUA 2P4EA 1U6IA 2VSQA 4EG5A 5HUJA 3ZBTA 3VNAA 4DDUA 4MKGA 1UPFA 5BNFA 5C5DA 4HNUA 2GPWA 2QMHA 2DTEA 4INAA 4ENSA 5IF3A 3F96A 4WFKA 2JGKA 5B12A 1T5SA 1FZQA 2P9BA 4HJRA 4OH7A 1OWNA 4LN1A 5DBOA 3ZIAA 3A4TA 4P4NA 3WWZA 1OGIA 1C3OA 1CUHA 4Q9AA 4RKRA 4OYYA 4RSGA 4UULA 2J9YB 3R6TA 4QJBA 1I9GA 3TXXA 5CHEA 2H7XA 4KN9S 4PG6A 4UBOA 1M9NA 1VHJA 3VO9A 1APBA 1WB6A 5IDVA 3BB1A 4BFUA 5TMPA 5DYIA 2RGNC 3PFCA 3PUZA 1DG1G 2JZCA 2XJ9A 4F91B 4TS9A 5AKZA 4NRDA 3A1FA 4LJLA 3BHMA 5FNVB 4OIFA 2A35A 3KKZA 3DL4A 3K70D 1NPYA 2DUJA 2PQ6A 1OASA 3S4YA 1K08A 3DWFA 2NQ2C 2YWGA 3ZCPA 2P30A 2WM2A 1GRNA 2C3OA 3EVGA 4BB6A 4LV5B 5FEMA 4YRBA 4ZI7F 3MHTA 5KO2A 3I9JA 1UT8A 4YT4A 5B3KA 1N8KA 5BRJA 1G3MA 2VYFA 3IURA 4L22A 2DQZA 4QYSA 1KJYA 4FOSA 4BJHB 5BWBA 2PWBA 5IJZA 3KHSA 1QX4A 5IULC 3IUPA 2ZB3A 4H7DA 1SA0B 4BAZA 6REQB 5JSQA 4P7GA 2XSZD 4UDNA 4NMHA 5KKNB 3SOPA 1NNLA 1M6NA 3B2QA 2RG7A 2JEOA 4JHXA 2PANA 2GGSA 3HI6A 2J30A 1OILA 1W4CA 2OWEA 5A3JA 1L8OA 4GH5A 2JI4A 5T3UA 1HDCA 1BVYF 3PHIA 5A0TA 1WCWA 2G83A 3QVKA 4PYJA 2D8MA 4RE6A 3E84A 3NEPX 4M1OA 1E58A 2R5FA 2XA1A 3WTBA 2JCVA 3L5OA 2OE2A 1EAYA 2Q2VA 2FQ1A 1ONBA 3Q0EA 4O4LB 3MJCA 4PX2A 3TQHA 1TX4B 3CRQA 1XMQB 2XW6A 3AR4A 2ZRJA 4QQFA 3R8CA 3TSWA 2OXFA 2FE4A 3DOHA 3S1AB 1X39A 4EUFA 3ZWDA 2DLCX 3LG2A 1I2MA 4Q00A 1NMZA 2K7ZA 1UBRS 1D4OA 5CA1B 2IIBA 1HL3A 3OT1B 5H4HA 1GXSB 2D06A 4QNMA 3IUNA 3FOZA 4ML3A 3LFTA 3BIJA 4A0QA 4F21A 3G1WA 4U5XA 1K4YA 1KEEB 4NBLA 2Q3BA 2PWAA 4GZ6A 1C30A 4IL5A 4K86A 4CM1A 4D74A 1RR6A 2D4HA 4MKHA 2XUPA 5A3QA 2R3SA 1VLMA 5C46F 3PQ7A 1S6YA 4E0BA 3DBVO 3DF9A 3K35A 2NSDA 3JVUA 4ZI5A 3QE3A 3RK0A 1Q0TA 1NC3A 4Y2YA 2BBTA 2F9LA 1M6HA 2J0QA 2IRWA 4WNYA 4HO1X 3LX4A 6ADHA 4R7GA 4ITVA 1T9CA 3LUFA 1YZGA 1HYQA 1N3YA 1F8UA 3TVDA 4OD0A 1HLPA 3Q12A 4Q1CA 2OO5A 2D1RA 1ZH0A 5EIEA 4KSCA 3OCCA 1U1EA 3HLYA 4YAOA 3NFYA 3G6WA 3CT6A 3Q8LA 4MGHA 4ZV7A 1B42A 4TN5A 3QLUC 3HCCA 3U3MA 1DBRA 2WVJA 3COVA 1CUJA 4H7FA 2ZB2A 3TW6A 3NHWA 4EKDA 4XFDA 2GSDA 4IS3A 1IOZA 3A0RB 2XGMA 2RB5A 1NUSA 3GLHA 4J7XA 4TTIA 5IC6A 5I7VA 1CTQA 3BWDD 3CNEA 1BVRA 4QIHA 2QRJA 2F1OA 3MAAC 3I23A 2O8EA 2H00A 1HDOA 5FFMA 4GMDA 1L5FA 5FPSA 1KIFA 5IABA 1RJWA 3K1AB 1G59A 5E8JA 2VWGA 1QF7A 1Z75A 3GJYA 4NH4A 3B5JA 2BY4A 4IVRA 2X9QA 4HP8A 1JSRA 1ZIDA 2FZVA 1XZ8A 4JBYA 3LHDA 3T9DA 2EFDB 2GD2A 3EZNA 2Z8ZA 1UWVA 1BXGA 1OAKA 3LQ4A 3QPWA 1NBWB 5CVJA 5IFLA 5KSWB 4GP7A 1GGHA 2NO9A 1C2YA 1NASA 2PUWA 3OHMA 5FUYA 2V7WA 4TLBA 2BISA 2ZJ1A 3MAJA 3E7PA 2WAAA 2XV1A 2L42A 4WE3A 4XD7A 4DQLA 5GVRA 1Q0UA 3IIJA 5KQRA 3ILVA 1GG9A 2O2EA 4CUJA 1V8ZA 2BGWA 1TK9A 2P68A 3G1UA 1GVNB 2XNDA 3AR6A 2GEVA 3JQQA 5FOTA 3UA4A 2F62A 1T9ZA 5IZCC 1PLKA 3BJZA 1XCBA 3GDWA 3OAAD 4U7GA 3TSAA 3HKCA 3PX3A 1KDVA 3HTXA 5DM4A 4NG4A 1RJEA 1BXRA 3HEBA 1AKQA 3ICVA 3ZUPA 1E79A 2RK6A 2ZSKA 3V8RA 1XFDA 5JSZB 3RVRA 5HRCA 2KWIA 3QENA 4ABYA 2CMDA 4L72A 3HUEA 4ZARA 4MGKR 4MA0A 1P1KA 3OE7D 3QI2A 4QL3A 2V7XA 4XJXA 3IAHA 2SICE 5IBQA 1NF8A 1OBVA 2ZZKA 3KDAA 1HKHA 3G23A 1KMQA 1EJBA 1FSPA 5FUWA 1T5LA 4WDRA 1BMFA 2I7CA 4OV6B 1MNAA 4QOGA 2PTGA 2RAUA 4IRMA 4TKUB 5A4JA 1ZA2A 3KCQA 5BQFA 3UEOA 2YWFA 4J1NA 3WIVA 3W2FA 4CF7A 4RBNA 1JYSA 3TLXA 4ECAA 1I2CA 3FBWA 4ZOLF 3L1JA 4IZHA 4UQPA 4G36A 5CBPB 2V7QD 4HX5A 1LF0A 4LZNA 4FNMA 3DV0A 3LQKA 1QO0D 2GD0A 1E96A 5DIFA 4DIKA 3FCAA 1O8CA 4H31A 2CXHA 2PJRA 4BTVA 3OCYA 3LJKA 5AKJA 2EJBA 1A4XA 3NTOA 4FU0A 1XZPA 4MQUA 5E7QA 1QP0A 2J6BA 3LDGA 1D6JA 1KERA 1WP9A 1SUWA 2OBLA 4KL8S 2IP2A 4XX0B 3CF0A 3D4BA 1G66A 1SCDA 1J0CA 4Q4AA 1Q11A 3SFZA 3GQVA 2XZPA 4E5MA 2O8CA 4DMGA 2C1ZA 2FAXA 2IL1A 3SZLA 5D84A 2FSFA 5TQVA 4C4PA 3V00A 3BC1A 3D3WB 3PHLA 3KO8A 4IEFB 1KVRA 4EHFA 1TL7C 2L17A 1GSIA 3I1FA 3R9KA 2QV0A 2XBUA 1IG3A 3KPUA 1GHTA 3FJ1A 4IOMA 1K7SN 4KX3A 3V97A 3JRWA 1DNPA 1D3AA 1MFPA 4OQEA 3D3KA 4DMCA 2D1YA 4Q1AA 1RBMA 3QY9A 4N4AA 4BFYA 1PW7A 1VYTA 1Z5UA 2C42A 3FZNA 4TXJA 4XZ3A 3GFSA 5TPWB 4DMMA 2PZJA 4QRDA 2CVPA 2PXAA 3I5UA 1WXGA 2G88A 4MA4A 2GBIA 5DNWA 4B3RB 1RRGA 5CFOA 1QMGA 1QGYA 1W8IA 3T6KA 1VMDA 3TUJC 4XUDA 5J3JA 2EIHA 4HZUA 4BZPA 3ON5A 2NQTA 3NKLA 3QLVA 1HQCA 4YONB 3VYSB 3F2IA 2XB9A 2O52A 1DG3A 3EXHA 4JL5A 4DAOA 2ZSIA 1VCIA 2O8DB 4Y2VA 4AP6A 2ZRIA 4LF4B 1PK7A 2P2LA 2TS1A 1W0KA 1A5AB 2ACVA 2BT4A 2HV9A 2QX6A 1OYYA 3JQEA 3KRTA 3KT8A 4LYJA 1OLXB 3BEOA 2HDNB 1GGJA 2QI9C 3COWA 3GRRA 5AJYA 5JJCA 5AHOA 1GFSA 2R6DA 4LFCB 3S0JA 1HFEL 4U7JA 5B1HA 1ZMRA 3MG9A 5K0FA 1M7GA 1O95C 3KT3A 4G0MA 4RJ2A 3T7TA 5C8DA 1MNQA 3NRCA 5DW3A 4B5LA 1WQ1R 3MBKA 3NH9A 4HZIA 4LHYA 1DT3A 1YU6A 1G17A 4JYPA 4XPIB 3WAJA 1G4AE 3ZN2A 2XGGA 1MX5A 1IH8A 3H2IA 4JCOA 3QQPA 1G8JA 4UNRA 1C4XA 1NWCA 4G0ZA 3QMVA 4GPBA 2H06A 4EPVA 1EFPB 4LJ7A 3G82C 3PQEA 3EUAA 4KAAA 2VHEA 1YSCA 1UOQA 3QWAA 4LHSA 4BWFB 4EW3A 2YIVX 1E7WA 3GX1A 3Q5DA 4KV7A 4REOA 4B83A 4LMAA 4EJ0A 4J0KA 1Z73A 3T5CA 2NU9B 2O7NA 2V03A 5G02A 4JI3B 4MLCA 5AD1A 3QFHA 2VPXA 1U3CA 3GJ3A 2X0EA 2HDWA 2HGSA 3DGFC 2NU7A 4HHEA 1RMQA 5KNDH 1KXJA 2FPUA 2VSYA 2YHAA 3IOBA 5DGCA 1M2WA 4OI2A 3VR5D 4PZEA 1W0JA 2BZ1A 3TGWA 3TIVA 3DE1X 1NZJA 1YDMA 3JSXA 4ZA2A 2CE7A 2XB4A 1XRRA 3EZGA 4L4YA 4PLZA 2ZB4A 4RD2A 3KP1A 4PPQA 5BQXA 5LZ4A 1P1IA 3DXYA 3NZEA 4ZOCA 2BKUA 3HJRA 2AD5A 3KB1A 2IYOA 1UDXA 1DS6A 1Q12A 3KLMX 3M5CA 1DJNA 1SXJC 4HJXA 4WUTA 5AUQA 3AH8A 1BOOA 1IUOA 4BVKA 3SDBA 1Y7PA 2IT1A 2O3JA 1H2ZA 2V4ZA 1OI7A 1Y1LA 3H2KA 4O2BB 4WX2B 4YN3A 4K6GA 2A88A 2VNSA 1K4KA 2JAQA 1Q21A 4LQ4A 4M7PA 3FDIA 4RTJA 3OQIA 2XCRB 4DA0A 2BJVA 3EYAA 4G5SA 4FFMA 3U40A 4JP2A 3UHFA 4NYIR 5KJEA 5J4VA 2FRDC 4S2EA 4ZU1X 4Q19A 4LBYA 3OJFA 2ZJYA 5B4VA 1UM9B 3PXDA 2P35A 3B3JA 5EUBA 4IX9A 6AT1A 4RTRA 2P9CA 2BHRA 1UXHA 1C1XB 2AH5A 2HHJA 3FR7A 3O03A 2CL7X 4HG2A 1CQJA 1Y3DE 4HQLA 4JZYA 4P83A 4IDCA 4KWIA 2H8GA 4CN9A 1H0RA 2Y9PB 4INOA 3UJ6A 4FD3A 4TX1A 2ZTSA 3TZQA 5DXFA 2YC2C 3O8QB 2I4IA 1FNSA 2GLTA 2UUCB 3EPKA 3V4SA 4ERNA 1KKLA 4F3YA 1F2UA 1Z2DA 2A9OA 2BMEA 4L51A 4BNHA 1QZ3A 2UKDA 4LECA 3N6XA 1RIIA 1QGUB 2F4NA 3ZWAA 3AY0A 3DF7A 3E3AA 1IL0A 2JCGA 4GZ3A 5KJ1A 2SKDA 3NYIA 2ICAA 1XN4A 1CQZA 3ESXA 4EJSB 1FQKA 2FZWA 1GGVA 3GJ0A 3NEAA 4RM3A 3RVMA 1HYGA 1F60A 2OZLB 3BG5A 1S4QA 1DKRA 1HTTA 1TCAA 1SD5A 2OV4A 4DGSA 1KIAA 1ORHA 3E1KA 1BWRA 4MQFB 1U2GC 5FOXA 3CW8X 2ADOA 2ZVQX 5E3IA 1TK2A 1WB4A 2Q1UA 1A69A 2J0UB 4ZT5A 3VKGA 1P80A 4IMIB 3N74A 1VE3A 2J3MA 2CN1A 2R5NA 2ZI5A 4FFVA 3WVNA 4B6GA 4C20A 2BSAA 3AU8A 4K6FA 2C00A 4II7A 1Z35A 4MYUA 4TQ9A 1XTIA 8OHMA 2NO5A 2X15A 1ZM9A 4Q1FA 4PV7A 4YR9A 1IPEA 1VA4A 1FLAA 5E2AA 1YU9A 4UU8A 3WLAA 2JLXA 1SUEA 1U9IA 3FNRA 3CNOA 4HAVA 4J3FA 4QX6A 2D59A 2C2OA 3DZFA 1Y8AA 4BP9A 1AMOA 4G65A 1E6MA 1JR3A 1JLMA 2WABA 1I2DA 4OOFA 3ENWA 3PHGA 1U7UA 3VO2A 2RG1A 1ZUNB 1XVAA 1ETUA 2QU8A 3PGXA 1VB3A 2ZP1A 2BM9A 2HD4A 2VHJA 3C85A 3V8MA 1UADA 3L7MA 4OYLA 3UHPA 3TEMA 5JRJA 2R8RA 3EAQA 2PZ8A 3E1GA 4GRDA 1WVIA 2ODNA 3PHHA 4TV9A 3SMVA 2E3JA 4HAYA 3RBXA 2JGNA 1G291 3JATB 2IX3A 3PLAE 5E2IA 1UMDB 2I6SA 3LNCA 4DNPA 2FXIA 2RGWA 1QQAA 4IV0A 1GUYA 3B82A 3C1OA 4UREA 5AKEA 4YRAA 5A1JA 3CEHA 4UW9A 2OL4A 2AJCA 1T36B 2VCEA 3ZX4A 1DXYA 1QP8A 1SUAA 1VCOA 2BTQB 2RK3A 2RHJA 2V7VA 2QAJA 2X2FA 5C9ZA 1L5YA 1RHQA 4PICA 2AJ8A 4WY5A 2LIPA 4BWGA 4F3CA 1AQLA 5EHXA 5IN5A 2HL6A 2X77A 2YNMC 3VI4B 5TF4A 1ZGCA 5HIIA 2JLBA 5JVDB 4CM9A 4EIWA 1TXGA 1Q0ZA 2O2YA 3LGAA 2ATIA 4G0OA 3NV9A 4JJ4A 4R2MA 4YJFB 5LP6C 5AM2A 3AVVA 2NTJA 2NXCA 1GL9B 1TT5A 1BCRB 2RHRA 3N75A 4YFVA 3THXB 4HQ6A 5EUMA 4A5OA 1COWA 4G41A 3HQ4O 1QHGA 1SBYA 2F64A 4MVJE 4UEQA 1RAGA 3T7CA 3VZPA 3LK6A 4H3VA 2I1QA 4CW7A 5JH7A 5KQPA 1G6OA 1JDVA 3F1KA 3VR4D 1WLSA 1MOQA 5KZMB 5K8UA 3EEYA 4RUKA 1LRLA 3HXTA 5CH8A 2WHRA 5AI6A 3M4XA 3JPWA 4V39A 1XHLA 2XE8A 4U63A 4EELA 2IDKA 1WQ4A 5JXHA 5T8KA 3OIFA 4TMZA 4D6YA 1U5AA 3EXFB 5KOJA 4OSOA 3RVNA 1NTRA 1A82A 1N36B 5BV0A 2JRLA 3AHFA 2WTAA 2GAOA 3EC2A 3H2SA 3MNFA 5KVQA 4E11A 5JSHA 2J0SA 5FBRB 2ISSD 3ZLVA 1FDTA 1UKYA 3K20A 3FNIA 5FAKA 1XN1A 5LOVB 4AQDA 1YJAA 2YY5A 1E1QA 1K66A 4PBTA 1T0JB 4MW4A 4CPDA 5B64A 1YJQA 1O58A 1G8SA 4EA7A 1NJSA 1ZUWA 1AA9A 5EIOA 3H6HA 2BV3A 2EBWA 3NIGB 1YCHA 3OE5A 5CBKA 1UBEA 3MXTA 3VZRA 5JNSA 1EFVB 1HZZA 1LU9A 1XFAA 2ZRLA 3PD0A 4KBGA 4QUDA 5D7NA 5IUKC 3G0HA 3P9KA 1NUHA 3SQWA 2V1XA 4K1LA 2WU4A 3DTVB 1N5JA 1R18A 2ZTVA 1Q92A 3HCNA 3LZDA 4XVHA 1F5SA 4HPXB 4FUQA 5FI5A 4F92B 3NTUA 3GJQA 4L5AA 1ID1A 2MDTA 5JWHA 1QO7A 1S89A 4CQMA 4OJNA 4FCCA 2KLHA 2NAFA 3FLMA 1X13A 3Q15C 5CA1F 4OXXA 4AUEA 4EFKA 2CJWB 4ZKDA 1OGJA 1KI1A 3K8ZA 2DTDA 1JX6A 2HPHA 2WSBA 3A2LA 3IJPA 3K73O 4U2DA 3GDFA 4FWBA 5EXDA 3EVCA 1A2BA 2ZYTX 3R6DA 1XCMA 4YECA 1RRPA 3OZBA 4L75A 1TMKA 1T6ZA 1NQXA 4JB8A 5GM2A 5A5VA 3UK6A 1N3BA 2J5BA 3C1TA 2YASA 1U1CA 2OV8A 3DYIA 3A1NA 1TFRA 3V34A 3GJ7A 3PUWA 4LSZA 4M6WB 4RIIA 2FMTA 2ZBUA 2ZVPX 5AVRA 1KP2A 2PLAA 4E2XA 5K01A 4XVRA 1QAQA 1AE1A 4D4HA 4JYZA 2NSHA 4NESA 1ODSA 4FGLA 3QEBZ 3A6PC 4XWGA 1KEWA 2CMFA 2EKQA 3CMCO 4FMDB 1F8FA 3DP7A 3RYCB 1FEZA 2YHUA 3RBAA 4OXNA 5EAIA 4U2KA 5FPHA 4F5ZA 4LY3A 3IAEA 2OQVA 5HZKA 1R12A 2OQRA 2WTMA 2IPMA 3FWPA 1MABA 3TG2A 1P39A 3CXUA 4O0MA 1JMYA 2YWHA 4IJQA 3ZD9A 3QX7A 3S2GA 1I32A 2B82A 1EZ1A 2W6QA 2DBQA 3SBEA 4UUBA 1V43A 2E89A 4E2YA 4KVFA 1DZIA 5EJ4A 1Y89A 2H1VA 1AUQA 3N0TA 4XB6B 4ER3A 1S3SA 3OUUA 3JQGB 2VIIA 1VKNA 3KTAB 1X14A 2BEUB 1U6KA 2FUCA 3C48A 2X2OA 1FX1A 1EDBA 4RVSA 2A0YA 2VT3A 5K7SA 4QBKA 2D5LA 3KZCA 2H1OA 2X3FA 1D0SA 1PHPA 3GUUA 3KL4A 2WJPA 3MXOA 4E30A 5DNEA 2IF0A 2AZTA 3CW2A 3QFSA 1WZUA 1JHUA 1WY5A 1ZH2A 2HY7A 2WYOA 5LUBA 1A98A 2BKVA 5FPYA 1ZKDA 4QTYA 1M76A 1FSZA 1Q0PA 4D0NA 1D2CA 3IFSA 4I46A 1M1ZA 3V1YA 5CFLA 3BXFA 2ECPA 5E2BA 3GLGA 1I7QB 2PT6A 1LPNA 1HTWA 3G9TA 3OZ7A 1RJGA 1CRQA 4LBZA 3I0NA 2XIQA 3Q8MA 1YE8A 1IK4A 2AJLI 1PZEA 2VBFA 5MN4A 3ADDA 4QM6A 1ODKA 1HO3A 1SIWA 2ONCA 2NGRA 2D62A 2WE8A 2ONZA 2YH2A 2G3YA 3AHGA 3EY4A 5CFNA 4UUMA 2NXNA 4GBJA 4C7XA 4QG3A 3MIIA 3VPDA 2HCFA 1IHDA 3FYCA 1SUDA 4DARA 2O57A 5ENDA 3WA6A 3DJYA 3MHPA 2PZBA 2OOKA 2XQKA 4N6OA 4N8DA 2ZYWX 3H99A 5ALMA 3KQVA 1GQYA 2CFIA 3TTSA 2DLDA 1VJDA 2ONJA 3EFEA 3P26A 1CDDA 2VQSA 3KVYA 5IC5A 1E7MA 3QMMA 2WJZB 1CUCA 3CNLA 2VDOB 3HN7A 5HKLA 5IC4A 4JYCA 2PSEA 1G0NA 1NMSA 2QD1A 2VUIB 2ZIWB 3A06A 3JXEA 2WQZA 3O94A 3T41A 4WBNA 5LP1A 2WJ6A 4LJ6A 4AUMA 1BYIA 1JI0A 3AETB 3ICOA 1NATA 4K6MA 1MJGA 3FOAA 4HN9A 4EQ6B 5K0BA 3A6HA 2BTOA 1XKXA 4O33A 2H17A 5FJJA 3E6AA 2LD4A 1XIVA 4MTCA 5HBRA 3B48A 4JJEA 2O8NA 2XTZA 4FOPA 1JW9B 3F7OA 1ORWA 1NTOA 4NP6A 4B3IA 3DFZA 4JENA 1A5ZA 1K7FB 1ENZA 2FGJA 3ND5A 3HM9A 4INJA 4S35A 4G5GA 3BFXA 4BO6A 2DB3A 4OU4A 1EK1A 2Q6KA 3N5CA 3GD7A 1GUAA 4KR3A 4RIEA 4B79A 5T4FA 1UFVA 1NF9A 4LJSA 4P4TA 1ZXBA 2FI1A 1EUDA 2R85A 4OQ4A 4Y2TA 1H5UA 4DBZA 4IDFA 5EYPB 1YDWA 3UC5A 4ALIA 1Q50A 2XWBF 1W44A 3SJZA 2O8VA 1E2HA 1B8VA 4FGWA 4L16A 3TIGA 1NR7A 2DG2A 1KJJA 3R4VA 1C1DA 3HRIA 3ROMA 2J0VA 3B6KA 3STWA 3HB7A 4RTKA 2KPOA 4GOKA 1GNSA 2E4AA 1RAFA 1YT5A 1ODCA 4Q16A 1NA5A 1BHO1 4BNJA 4MUEA 3CF6R 3NH6A 4LWOA 5L95A 2P0AA 4NNOA 4XM2A 3VYRB 4CQLB 3RV3A 2J5KA 2QK4A 3JU3A 2IP4A 4CMEC 4DMFA 3E3OA 4MUKA 4RS3A 2PUCA 2Y6UA 3DKPA 1ZVQA 4I1YA 4W4TA 2D13A 5CAEB 3STXA 1AF7A 1ZU4A 3OECA 2C84A 4Q66C 5A9TA 4YMLA 1E3EA 2C5EA 4FYVA 4ARAA 4QREA 3I39X 2E4ZA 1N2XA 1UBKS 2AI1A 1UP6A 1QXSA 4N3BA 4GVXA 2K2QB 4QPZA 1DBSA 1YDFA 3BK1A 1E20A 1A27A 5HK8A 2XQGA 2Y8EA 2OY0A 3BPSA 4FHZA 1S2IA 2NZJA 1YJ5A 1RQRA 2YOHA 3AF0A 4LC9A 2B5OA 2ZWOA 4NBVA 4XD2A 4CKWA 3ZE7A 1N0WA 3K94A 3O4VA 1I1OA 2OXTA 3RK1A 4DV0B 3P4XA 4KEAA 1QVWA 3GAZA 2MYUA 2BZGA 1F7UA 4G9GA 2HF8A 2AVNA 2X2EA 3FFBA 5AW0A 3ETHA 4QJ3A 1P2TA 3FUVA 4DLUA 1T9KA 2JLVA 1DAHA 4MUFA 5E3JA 1W2WB 4B7CA 5KWSA 1QYXA 2ID7A 1FSGA 5JZSA 5A7GA 3COJA 5KPDA 2BRUC 1CE8A 1JKMA 5B1EA 3MA0A 4MK4A 4DR3B 1MC4A 3EYWA 4K1XA 4JVLA 3K09C 4ZZ2A 5C8ZA 1DC3A 1C9MA 3RIXA 1EE1A 4PONA 2ZE8A 3LBIA 4KKXB 2EBFX 3RWMB 1TJ3A 1MBZA 2B7CA 2PYZA 4JSYA 1L0BA 2C83A 4DYHA 3T4UA 4CN8A 3KETA 3NETA 3KPJA 1OAOA 3P9IA 4P1ZA 5HGXA 2O7RA 3FOFC 4M87A 4KGZA 3ZDXB 5EEHA 2PH3A 2DWQA 1U8EA 4OOEA 3U7QA 2Y2VA 1LJLA 2CWWA 1AO0A 1XR3A 3EGVA 3H8WA 1MC8A 3U4QA 5I51A 5AJVB 1F4LA 1SO8A 1ORTA 4O2BF 5EKXA 4KR2A 2GMWA 2CDCA 1CJBA 4ZRDA 2H5EA 3VJLA 2ZJ6A 3KAPA 3KFVA 2CFCA