3FYUA

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 115
structure length 317
sequence length 318
chains with identical sequence I
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuA00
4H7DA 4TPKA 5E4YA 4CG3A 4B82A 5CRIA 1MX5A 4EA6A 2AJDA 5DWDA 1NU8A 4S0XA 3N0TA 3IUNA 3LIPA 3WIOA 5LIPA 5AKXA 4B80A 5SYMA 1JMYA 3UMJA 3F98A 1FFCA 1P0MA 2EDCA 2RGUA 3MGAA 4IQ4A 3PI6A 1U65A 1XZGA 5AM2A 3B12A 2D0DA 4YX9A 1W76A 3AIKA 4BC1A 3GUUA 1ZGCA 1XZJA 3AZQA 2VEOA 4W1RA 1VKHA 2FJPA 5JZ9A 3FWHA 4EY6A 4W1PA 4CCYB 1J06A 4G8CA 2VQ6A 2B4KA 4BAUA 1XKTA 5LZ7A 5ISMA 1LBTA 2XMQA 1CUUA 5K3FA 1KU6A 2I3DA 5E2IA 3WYDA 3DNMA 5AP9A 2DR0A 4LXIA 5IVKA 5ALGA 1ETHA 1ODTC 2PPLA 2VSQA 1QIJA 4UPDA 4AZ0A 3MVEA 2O2IA 5CT9A 4Y2VA 3C6BA 1Q0ZA 3FOBA 3U1TA 5AK3A 1LPSA 3VJMA 4QLAA 5FUMA 1IUPA 2B20A 1YASA 3I28A 4KE6A 2XUHA 4JYMA 3OM8A 3L1JA 3G02A 1TKRA 4BP9A 4LXHA 4QLOA 5CT4A 5ALYA 1ZD5A 2BUCA 4J03A 1FFEA 2PKYX 4UBLA 2XQGA 3FBWA 4J0CA 1H2YA 2DHDA 3AILA 4AO8A 1N5RA 2XUDA 4AQDA 3ICVA 2XB6A 1W52X 3C45A 4HRYA 1GXSA 4YK7A 4B84A 2XUPA 4K6HA 1CPYA 3TEJA 3LLCA 4CG2A 2Z8XA 5K5EA 2WU4A 2IITA 5ALTA 4Y2RA 3I2GA 5BWBA 2QJWA 1WPRA 1QIFA 3O4GA 4FLMA 4W9RA 2DHCA 4JEIA 5ALEA 2W22A 4AN0A 5CT6A 4DGQA 1S8OA 5AKGA 1CUEA 3E4DA 3PFBA 5HK8A 4F21A 3STWA 5EIHA 3MUOA 5AI0A 4KE8A 1D07A 3X3HA 3A70A 3STTA 3G8YA 3P2MA 2XUJA 2ES4A 1W1IA 4UFOA 2HRRA 3WKDA 5FV4A 4B9EA 3IVMA 7YASA 2J3DA 4G9EA 4W1QA 3F8SA 3R41A 5DNUA 1RWQA 1XRMA 1CUBA 5EHNA 1F6WA 4I3FA 4DNOA 2O2HA 3MUNA 4OB7A 2X5XA 2O7RA 1PV1A 1QIHA 4E15A 3BXPA 1YA8A 5AKYA 1HPLA 2XMCA 5JASA 1FJ2A 1OILA 1MT3A 1ZICA 3GZJA 3BIWA 3NOXA 4EY7A 2BGNA 1VXRA 1FFDA 5JANA 4M0FA 3TGLA 4X91A 4QE3A 2JIDA 1K4YA 2CMFA 2GBCA 4MXDA 1T4MA 1JJBA 2WJ3A 2VATA 1LPMA 2C5FA 1H2WA 4LKOA 1MN6A 2ORYA 5AICA 5K3DA 1USWA 4G8BA 4G4IA 4GEGA 4UFNA 1GQSA 1JU3A 5ALDA 3WK4A 1MJ5A 2JEZA 2XUGA 3JYHA 5AI5A 1MAHA 1EK1A 3I6YA 4JH0A 3ZI7A 2CBGA 2JGKA 1VZ3A 4PSDA 3W9UA 4KYVA 1A8UA 1HKHA 4WDQA 1YCDA 1EH5A 4GW3A 2GYWA 3IA2A 5E4TA 1BN7A 2DFPA 4J0DA 1QIMA 4UFPA 2GZSA 3PICA 5FKJA 2W6CX 2XT0A 5AO9A 2OQVA 2ZSHA 2PUJA 4G1FA 2QUBA 2XMSA 1EI9A 3EQ7A 5HKAA 1K6EA 1XQXA 2QZPA 2WHPB 2G5PA 1Y7HA 2PSHA 3RK4A 1B41A 1YA4A 1XRRA 3I2IA 1X70A 5T4EA 2QVBA 3WK5A 1SFRA 4L9AA 2OCLA 2H7CA 3AZOA 4AO7A 3QMWA 4FWBA 1GPNA 1CIJA 3F97A 5LKRA 1T2NA 3D2CA 4J7AA 3I1IA 5KREA 3UUEA 4ZV7A 5AI4A 1IUOA 4CCYA 1BCSA 4UHFA 3OTQA 4K6GA 1ZJ4A 1EXWA 2BGRA 3C43A 4ZRDA 5HF5A 2WG0A 1R4ZA 2QT9A 1FFAA 3I2HA 2PSJA 4Y2SA 4ZXFA 1KEZA 3D4LA 1XZEA 3H17A 3VVLA 4CFSA 2DCMA 2C7BA 1CUAA 1X2BA 2XQKA 4UBOA 1MX9A 4ZREA 1VLQA 2YASA 2YH2A 4X3CA 1DWOA 3SWWA 5HF9A 1E5TA 4AMYA 1Q84A 5K3AA 4X71A 5AI9A 1CUFA 2XMDA 3SX4A 5AIBA 2WUFA 3O4JA 4Q34A 3B3QA 4J3JA 4E14A 3YASA 2VF2A 6YASA 2XI4A 4MWTA 4C4ZA 3LS2A 1A8QA 5AKEA 1TQHA 2CB9A 5AKZA 3QITA 3OC0A 2H1IA 2NW6A 4I19A 1L7RA 1ZD3A 2YXPX 3STXA 3WJ2A 4UUQA 4WFIA 5IKXA 1AURA 1O6GA 1LLFA 4DMFA 1QE3A 1DU4A 4Y2XA 3QVMA 3HJUA 1BEZA 1R9NA 2Q0XA 5DTIA 3KOOA 1THGA 5FLKA 4X6YA 1TCAA 2X76A 4XJVA 5IVIA 1VE6A 3CXUA 4BB0A 1MO2A 1AGYA 1XZLA 1WHSA 3DKKA 4X92A 3DS8A 3LP5A 5EFZA 5CT5A 1KU0A 5CURA 3PUHA 3G9ZA 3EQ9A 3M82A 2XUFA 1BEEA 4LHEA 4GI1A 5D3ZA 1UK6A 3DOHA 5AI6A 2HA4A 3GBSA 2V97A 3WYNA 3JWEA 4NVRA 3ESAA 4QEKA 2X8BA 5ALQA 5H3HA 3IB3A 3C5WP 2HRQA 3OG9A 3RM3A 1YAJA 1BE0A 2HU8A 3WWPA 2H7XA 3IUMA 3SC2A 3OPMA 2FUKA 4MEBA 3FYTA 3G0CA 1CUDA 2UZ0A 1HDEA 1QZ3A 4OYYA 2HFKA 5ALIA 4HXFB 5CBKA 4LXGA 3R40A 3EF3A 4AMZA 2OAGA 2XQIA 2J4FA 1LNSA 3BJRA 1VOTA 5A7GA 5ALXA 2XQJA 5HF6A 4ITVA 4DIUA 4BCCA 2JBWA 1HQDA 3BF7A 4GLBA 2CZQA 4FFVA 4X85A 4AN1A 4OYLA 5ALMA 3R3VA 3RKSA 5AKKA 4D9JA 2VT6A 2XLBA 3JW8A 1E89A 1THTA 2CKMA 2HM7A 4CIAA 2PM8A 1UT6A 2ZJ7A 3O95A 3DD5A 5ALSA 1ODSA 5JD6A 1EVEA 4QWWA 4CCWA 1XROA 5ALHA 3BJMA 3O4IA 4MEAA 1G42A 2R8BA 5ALVA 4B83A 1GPKA 3WWEA 5DJ5A 3H1BA 4L72A 4HAIA 2QOEA 4J0HA 5AKHA 4DMKA 3PFCA 1MPXA 1F8UA 5C7YA 1P0QA 1GKKA 4FFWA 2Z5GA 1DX6A 1QONA 4Y2YA 2AJLI 2I03A 1LPAB 4BRSA 2ZYIA 3C5VA 5EI5A 2VA9A 2HA3A 3AIOA 5AKLA 3KSRA 2PSEA 1E3QA 3WZLA 3DYIA 3VXKA 2HU7A 3V1KA 4YPVA 1WB6A 5AKJA 2AJCA 4DNFA 5AK5A 4X00A 2WIFA 3ZV7A 4DNQA 4G8DA 4BZZA 5CH8A 3DEAA 4U2GA 3Q0TA 4GDMA 3IUJA 4KR0A 3W9BA 2BCEA 1N5MA 3RLIA 4O08A 3TJMA 1UXOA 1U4NA 5EIAA 2VJCA 2WILA 5CTAA 1XQVA 1CUGA 5A2GA 2OPHA 2VAVA 4MJ3A 3R3XA 5AM1A 3IUQA 1QIEA 1ZIYA 1R3DA 4P9NA 4RE5A 1VA4A 4MYDA 5ALUA 4A5SA 1XZMA 4H7FA 5JADA 1AC5A 1H22A 2WFLA 2QS9A 3WK7A 2JEYA 1DWPA 2HADA 4WY8A 3RARA 4IH1A 1SC9A 2ZYSA 5EHXA 1AKNA 2BAGA 3PF8A 2HDWA 3DQZA 1ZOIA 4G9GA 2WG2A 1GZ7A 3VISA 4C4YA 1CUZA 3CCBA 4FBMA 4DM7A 3WA6A 4HZGA 2WJ6A 4JUIA 4BE4A 2G5TA 3DKRA 3Q8WA 3BDIA 1GT6A 4C01A 5HKBA 1FSSA 3B5EA 2RI6A 1HL7A 2CJPA 1YS1X 3ESCA 4AXBA 3D0KA 4F0JA 2ACKA 2QXTA 4UHBA 2EDAA 4HTAA 3I2FA 4A16A 2HIHA 3DYVA 1R1DA 3WQHA 5LKAA 2WKWA 5FOQA 1IMJA 4N8DA 4F5ZA 1DQZA 3E1GA 3WWOA 1EB9A 1UKAA 3ESDA 3S2ZA 2I78A 1IVYA 4FBLA 4EY5A 2XUAA 4J0KA 2R11A 5HCUA 4C88A 3H0CA 2OCIA 1Z68A 1QO7A 1JKMA 5EGNA 4BTVA 1XZFA 5FXMA 4E11A 2WIGA 5JARA 2XUKA 3ZWQA 4CI9A 3G9TA 2WFMA 4AB1A 3V1MA 4FNGA 4BYMA 4H7HA 1H2ZA 2WIDA 5AM4A 2PU7A 1LGYA 1LPBB 3FYUB 4FTWA 5CW2A 3G0GA 4X90A 2IIVA 1EINA 3C87A 3O0DA 1DTEA 5JAHA 1XRNA 4B7ZA 3FSGA 5HFNA 2QMQA 4TVKA 4Q82A 4FMPA 3HYSA 5LZ9A 5K3CA 3W2TA 3NUZA 4FNMA 2JGFA 3FLAA 4QDZA 4PQEA 3QMMA 3WKCA 2CEKA 4PV7A 1ISPA 2XUOA 3D5EA 4X93A 3K9BA 3ILSA 4P92A 4N5IX 1XFDA 1XLUA 2JF0A 3FCXA 3K6KA 3FYUC 5ALOA 3M3DA 4BRZA 3QBJA 4UHCA 4B6GA 3ZLTA 4QNNA 4K2AA 1FFBA 1TCBA 1N8SA 1MNQA 5HFAA 4UBNA 5A7FA 2WIKA 3WKEA 4ZGBA 4OUKX 2BUBA 1M33A 4I4CA 2OQIA 2WSLA 5AHXA 4CIBA 2LIPA 3M81A 1RP1A 3HZOA 2WLSA 1QJ4A 5FP0A 3H04A 2Z8ZA 1I6WA 3D2AA 1BROA 4M0MA 1CQWA 1VXOA 3DL4A 2BUAA 5C8VA 5IVHA 3AZPA 4Y2UA 3EQ8A 4BC0A 2ZJ6A 3CN9A 2HA7A 2ZVDA 3OOSA 2PUHA 4X94A 3KXPA 3N2ZB 2HL6A 1AX9A 5JAPA 4H7KA 3STUA 5FRDA 5CXUA 5DYYA 3IIIA 4ARAA 4J0JA 2QTBA 3F96A 3L1IA 3T52A 2OLEA 1OXMA 4XWGA 1CFJA 1QTIA 4PSCA 4W1SA 4B0OA 4QA9A 1QO9A 5F4ZA 3WK6A 5JAOA 2ZYHA 4DNPA 3I1YA 1E8MA 1QLWA 3FVRA 2VAXA 3G7NA 3DLTA 3WJ1A 4Q3LA 5JZBA 2B61A 1XZCA 1GPLA 4YASA 1H2XA 5ALWA 1F0NA 2WFZA 1QOZA 4MQMA 2P8SA 3V1NA 4EZIA 3C70A 4BCDA 1XZAA 4H7IA 2H9YA 1P0IA 3H2HA 3W04A 2Y6VA 3F9CA 1PJAA 3WKBA 4U2EA 2GBIA 5FDFA 1LPNA 3ZPXA 4DSAA 5ALRA 4EY8A 1HLGA 1JU4A 4KAJA 4B81A 1ODCA 3C8DA 5FPQA 2RHWA 4DTCA 4HVTA 1EDEA 4L3WA 4U2CA 1Y37A 1YB7A 5AKIA 1ZI9A 3HSSA 2OG1A 2XMGA 1ZIXA 2XUIA 2RONA 2ZJFA 3BE8A 1DWQA 4UBMA 3ICWA 3W06A 1R50A 4GBGA 3C6YA 1UK8A 2QR5A 4FOLA 3G9UA 1JMKC 2Z3WA 1ZJ5A 4HS9A 1LZKA 1ORVA 4ZWNA 3HABA 3FAKA 2QUAA 5JZSA 5EHQA 1ZGBA 3NWOA 4M0EA 4Q1VA 2GBGA 4G4JA 1XZIA 4PO3X 3ESBA 5T4FA 4H7EA 3HXKA 3V1LA 5JD4A 4B85A 5BWCA 2WM2A 4FKBA 3WK8A 2GZRA 1DT3A 1ACLA 3WMRA 5A62A 1GKLA 2ONCA 5C81A 1K5PA 1W6RA 3GROA 3WWDA 4PNZA 4QDOA 3F67A 4U2DA 1WM1A 2ECFA 2XDWA 4BZWA 4C87A 2VJAA 5BV7A 4Q3OA 5FPPA 3WIBA 1AUOA 5LLSA 1QIIA 3BIXA 4G4GA 4DYHA 3M83A 2HHAA 3R3WA 3AINA 2PL5A 2BKLA 1QFMA 3AIMA 4WFJA 2E3JA 4Y7DA 4W63A 4NMWA 3NGMA 4J0IA 3QH4A 3QPCA 3O4HA 1J1IA 1CUIA 1QIKA 4X6XA 4IH9A 3BWXA 3BDVA 4FLFA 3A6ZA 4H18A 1EHYA 4A23A 5JIBA 2VTVA 2PSDA 2OCGA 4PSUA 2AJ8A 3HEAA 1EA5A 2AXEA 3ANTA 3O9VA 3C8HA 5A71A 1ZI8A 2WUDA 4PF1A 1VE7A 4RE6A 4OU5A 3G9XA 5DNVA 1UFOA 1N1MA 4DMCA 1C7JA 2WHPA 1YAHA 3EBLA 3PUIA 2WHRA 1EX9A 1J2EA 1NU6A 3UUFA 4LIPD 4UHDA 4BVKA 1B6GA 1GQRA 1LZLA 1TRHA 3DL7A 4BATA 1VA5A 1OCEA 3R3ZA 2HFJA 3QYJA 3QPDA 2DQYA 1YB6A 5CH5A 3D3NA 2C5GA 1VJ5A 5HK9A 5ALKA 3IURA 2WHQA 1E66A 3FLEA 3PDCA 4KE9A 4RNCA 5D7BA 4BTLA 2I3ZA 3U0VA 5HQ3B 2QXUA 4DSZA 1Q83A 4WY5A 4BVJA 4AO6A 1TIBA 1E8DA 4OB8A 3FNBA 2H7YA 3GFFA 1K63A 4JNCA 4B0PA 3WK9A 3KDAA 4NZZA 5AM0A 2VT7A 1CV2A 1WB4A 2Y1KA 1GGVA 2RHTA 5AOBA 3L1HA 1AZWA 3EIOA 2XMZA 5DTJA 5LZ8A 1JJFA 1DT5A 1EVQA 5A7HA 3G0DA 1HBJA 1A8SA 2ACEA 3VDXA 2GBFA 1XLWA 2K2QB 4INZA 1UOQA 5JATA 2G4LA 1TCCA 2O2GA 3CCCA 3TRDA 4LYDA 3QMVA 4UBKA 1MU0A 4BAGA 1UKBA 1XRQA 1CUCA 1L7AA 1H23A 5C8XA 3HRHA 4U2BA 3S8YA 1TK3A 4CG1A 5DYWA 1ZD4A 4DLNA 2OAEA 1W75A 2OXEA 5HZGA 4UBIA 3H2GA 1MX1A 4KE7A 1G5FA 4ZI5A 1XRPA 4KRXA 2OGZA 1MTZA 3ZLVA 1SCQA 2XMBA 5AI8A 4GHWA 1CUXA 1EDDA 5D3KA 5AM3A 4EY4A 1UOPA 4QDXA 4EB0A 3I6MA 3D59A 1XQWA 4N8SA 1YR2A 5CXXA 2PU5A 1C7IA 3GA7A 2ROQA 3R3YA 4G5XA 1IZ7A 4QDUA 1U2EA 4X7BA 2G63A 3WKAA 5ALLA 1A88A 2WTMA 1XKLA 1CUHA 3STVA 4QZVA 1UK7A 4Y2JA 2OGSA 2WTNA 1QTRA 2WG1A 3G0BA 2OCKA 4RGYA 5E4JA 3WL8A 1G4HA 4TGLA 1R9MA 1CUJA 1BCRA 1UWCA 1JFRA 4P08A 5ALJA 2HA2A 3DJYA 5JAUA 1DINA 1WB5A 5HF8A 4E46A 4MWSA 3IULA 1XZDA 3WL5A 2ZSIA 5I8PA 5ALFA 3IBTA 2QM0A 4KAAA 4KAFA 1SCIA 2WUGA 1W4LA 3DOIA 1WHTA 4HXEB 1QIDA 2J3QA 3WA7A 2JGJA 4FLEA 4H77A 2C4HA 1IZ8A 4HXGA 1CLEA 5ALPA 5T4HA 2QRUA 1F0PA 2AJBA 5LZ2A 4HRXA 4C4XA 4BBZA 5IH7A 1SOMA 4BAZA 4BDTA 4X97A 1EB8A 4C6HA 3G0IA 2XLCA 3FCYA 3KD2A 3KWFA 4AZ3A 2Y2UA 3WL6A 1TAHA 1CVLA 3I2KA 1BS9A 3W05A 4MQLA 1WPXA 2QKYA 1J07A 2V9ZA 2GYUA 2IX9A 3HI4A 3I2JA 5BOVA 2WU3A 4L0CA 1CQZA 4BP8A 1ACJA 3KWJA 3T4UA 5KBYA 4ZV9A 5KWIA 5DNWA 2ZYRA 3VKFA 3V48A 3IDAA 5AK4A 4K5QA 4X95A 3K2IA 5JYCA 5KWJA 4KRYA 2HU5A 4XX1A 5AJHA 4IHAA 2D5LA 3AJAA 1BN6A 2XUQA 5AOAA 3ZLUA 5CMLA 3V9AA 3H18A 2Y6UA 4MYSA 4OPMA 1XQYA 5DYTA 3PE6A 2RAUA 3A2LA 1EK2A 5EIEA 3D7RA 4XVCA 5EHZA 4BCBA 4WCVA 5HQ3A 4GXNA 3GELA 2PBLA 2Z3ZA 3H2JA 1UK9A 1IUNA 2JGMA 3R3UA 4V2IA 3FSGD 2BFNA 2DQZA 1ZD2P 4Q05A 2DSNA 3HLKA 3E3AA 2WQZA 1SCKA 1XZKA 4OCZA 3PF9A 3O9MA 5AK6A 2WUEA 2QJRA 2EEPA 4GWLA 1QIGA 4J0GA 2XQFA 2BJHA 4EUSA 3LIIA 4RPCA 5K3FB 2HA6A 5K3BA 2OGTA 4K6KA 2HA0A 3QM1A 3H19A 3H2KA 1UZAA 1ZI6A 5ESRA 3OURA 2FJ0A 1RYYA 5CH3A 2JGIA 4F60A 4AX4A 2CUTA 4GECA 1XZBA 4Y2TA 1JI3A 5D6OA 1A7UA 3HC7A 5YASA 4UHEA 4XIIA 5A6VA 5K3EA 4ROTA 4NS4A 4BVLA 3WZMA 2O7VA 3WWCA 1CEXA 3FLBA 1QGED 4KACA 4LYEA 4OB6A 5J3JA 1DX4A 3H1AA 5C8ZA 2WFLB 3SK0A 1C4XA 4Q3KA 4KJXA 5ALZA 2C0PA 3R0VA 2WJ4A 4WJLA 2C0QA 2J4CA 2PVSA 4Y2QA 3ANSA 1O6FA 3A2MA 1YS2X 4Y9SA 1WCYA 5AOCA 1U8EA 1AQLA 1ORWA 3C6ZA 3H2IA 4QWMA 4U2FA 3D2BA 5LZ4A 4EBBA 1K8QA 4UHHA 4ETWA 4BE9A 1CRLA 4ARBA 2V96A 1BRTA 3E0XA 4FHZA 5DLPA 4OSEA 1X2EA 5IVDA 4DMHA 3QPAA 2XMRA 5I7UA 1DQYA 5LYYA 3ED1A 3BF8A 3LCRA 3A2NA 1NX9A 2Y2VA 5AH0A 1JT2A 5SYNA 2PX6A 5LZ5A 1XLVA 1Y7IA 2GYVA 2WIJA 3HACA 4H7JA 2JGLA 1MAAA 3FYUA 3VJKA 2HA5A 3DCNA 4FDMA 3VVMA 1MNAA 2YYSA 4Z49A 5LP1A 4WDRA 1L7QA 1YSCA 1Q0RA 1R88A 3AFIA 5JD5A 1AMNA 4IO0A 4UBJA 4JYPA 2PSFA 1JJIA 2VJDA 3WL7A 1CUWA 1CUVA 2C58A 4Y2PA 2DHEA 1CUSA 5ALNA 1LPPA 3VJLA 3CN7A 3QZUA 5AIAA 4EHBA 2FX5A 3WLAA 4X6UA 1LPOA 3STYA 1LBSA 2RIPA 3DDUA 5I9IA 3I6ZA 1UOOA 1XZHA 4KEAA 4N5HX 1G66A 4C89A 1P0PA 4IH4A 4N8EA 1PFQA 3FVTA 1E8NA 1BU8A 1WOMA 4PW0A 4BDSA 3AUKA 4H0CA 3WI7A 1CR6A 4OD0A 4B9AA 5AM5A 3C6XA 1EDBA 5JALA 2VJBA 3BL8A 4QDTA 5CT8A 2B9VA 2V98A 4P93A 4OU4A 1CUYA 1UKCA 1XRLA 2JGEA 5T4BA 1VZ2A 1QFSA 2XE4A 4H35A 4WFKA
chains in the Genus database with same CATH superfamily
3TWOA 3FNRA 3GT0A 4J7XA 2X7JA 5DLEA 1UXGA 3FF4A 5K6AA 3D0RA 3G2JA 1DFHA 3TNYA 3X1XA 2XZOA 4LFCB 3DXXA 6LDHA 1DE0A 2HWKA 5KOJA 2QL9A 2A4KA 1PD0A 4GAEA 4BVAA 4E13A 2I76A 3OLXA 4FI3C 3ZD9A 1T8UA 2BFCA 3O84A 1GADO 3N0TA 5B64A 3L41A 2P2SA 4LXTA 5G53C 3LIPA 5CA0F 1GZHB 3OKFA 4B6EA 4B80A 1W9HA 3V5NA 3U1VA 3H1EA 3PL1A 5C8YB 1U1EA 2FU5C 5EZYB 2WWYA 2QTRA 1BS2A 5ERXA 2VQEB 4MQ5A 4DCGA 3F98A 3NRBA 1CY7A 1IJBA 2EGHA 1KSJA 2E4ZA 5CCBA 1C2YA 1BHO1 3ML1A 4RVHA 4MS3B 1BKDR 2EDCA 3PHIA 4JJIA 5HIKA 1T9AA 1A5SB 1NRIA 2RGUA 4CR7A 3T3OA 4HEJA 1BRMA 4BMNA 2WSSD 2FP4A 2XNHA 3P9IA 4MKXA 1TEHA 3B12A 3V4FA 1NVAA 3QFFA 1W76A 5BRAA 1TQ6A 3O8RA 2OHFA 4GR9A 3MHPA 1BE6A 5IDVA 3SHFA 1PJRA 4P32A 4BP1A 4C3VA 4WZZA 5SICE 4C4PA 4CU5A 2GZHA 5EZYF 5CCXA 1NI5A 1MEOA 3VKVA 5J47A 4UQOA 4OTZA 1UAAA 4M1KA 4H17A 1E69A 3PXGA 1ZGCA 4RFSA 4F12A 1MC4A 1XZJA 2PL9A 2PLAA 3LBHA 4D2IA 1Z17A 3GWZA 2Q3HA 1B73A 4LC1A 2VJPA 1VKHA 1BXGA 3AJRA 3X44A 3E18A 1HYHA 1BGVA 3E9MA 3AFOA 4PHFA 5EINA 5JVDB 3QSYA 4DMGA 2GFIA 4G25A 1BMTA 2WK1A 3MINA 1UFRA 4O1MA 4RD1A 3T7IA 2HGZA 3VYUB 1BCSB 4RA9B 4DQUA 2PH1A 5B36A 3E3NA 3P71T 1DEKA 1P3JA 5CX1A 4BAUA 5DM0A 2RH8A 2I55A 3DONA 4MRAA 1RR6A 5LZ7A 9ATCA 3F6PA 1XAIA 4LF4B 2DERA 2XMQA 2R65A 1KP2A 5K99A 1PAUA 2VDOB 5HE9A 1A1VA 4QJ3A 1Z83A 3PNYA 4LXIA 4KH0A 5AP9A 3ADOA 3VQTA 5JS6A 10MHA 5ALGA 1QGOA 2ZREA 4C4SA 1G8GA 4D98A 2V9CA 1UBEA 4TMZA 1YB5A 1MJHA 1ETHA 1QYVA 1RI1A 1KDZA 4BMXA 4AQ7A 4KPYA 1JDTA 3EDMA 3HFJA 1YQUA 4HQKA 3SNKA 3PLRA 2FMIA 1T9ZA 5HCNA 3FUCA 4UPDA 4AZ0A 4BLVA 3MVEA 4LJ6A 2Q6LA 2QU8A 3ZCQA 4MTLA 4BO7A 1BGXT 2C5LA 3W34A 4Y2VA 5K0SA 1VHLA 2XMPA 4IL5A 1M6HA 2BFMA 3LDGA 5L3VA 1F4PA 1GAEO 5JJ5A 5GV8A 3G2OA 3FOBA 3RSZA 3TRFA 4ZOLF 4B2LA 4MW7A 2BRUC 2ZZKA 3AW8A 1SVIA 3I2YX 2ZRMA 4MRVA 2Z1MA 1DQPA 3B3AA 4ZPXA 3EOZA 5CA1A 4KQHA 2HJ9A 1F60A 4O2LA 5DRYA 5LR6A 1N0UA 1U0BB 4V0KA 3MRTA 2B20A 2H5EA 4KE6A 1U04A 1M66A 4DTIA 2JRCA 1WXEA 2Z6AA 3DD1A 3KYDB 1YMUA 4JLDA 3LZCA 1HLFA 4UASA 5C52B 1CQIB 1Z2PX 3N6VA 4ESOA 3UMYA 5CT4A 3HCOA 3GRYA 3UJDA 3JASB 4A1OA 3NHPA 1F2TB 3L7MA 4HNGA 4UNQA 3SLKA 3ZHYA 4EG8A 1GN9A 1XOIA 3DAFA 3DZFA 4U9UA 3RSHA 3NM6B 4TS4A 1X8JA 4Z4GA 1Y9JA 3DXYA 1PG0A 4ARCA 3IDOA 1XEWY 1Z07A 4GO1A 1GQFA 2YVKA 1N5RA 4GGMX 3VPDA 3ICVA 1M0WA 3OC6A 5EJGA 1RFGE 1YZQA 3V97A 4CT5A 5B4TA 2WE7A 1X7XB 1YZHA 4FGWA 1JI0A 2WU8A 3BA6A 4YK7A 4B84A 4JLWA 2OP1A 4YMIA 2R44A 5JSKA 4QLBA 4LJKA 3AF1A 3KJHA 3UAVA 2HCBA 4EPTA 3M33A 3JARA 1AS0A 3A28A 3TJRA 1NUTA 1F7UA 5ALTA 2J3LA 2OLKA 3ZWKA 5EJ6A 1AMUA 2XWJI 2MINA 4QASA 5TQ2A 1JDZA 5CK5A 1SKYB 3NWPA 5AW9A 1L6RA 4NPAA 2ZQ5A 1WMBA 2QJWA 1XF9A 2B30A 2Z98A 3LY5A 5FR1A 3WBJA 1PFWA 2G77B 3SLRA 3ZZ0A 5D87A 2B8TA 4EARA 4F9EA 1QIFA 2PUWA 4FLMA 2FFJA 4R0VA 3IKTA 1KMMA 4REOA 5ALEA 4ZCLA 2W22A 1IRIA 4GZLA 1ISGA 2EC5A 4MUEA 5BPFA 4KXXA 1EFRD 4FMBB 4F93B 4HB2A 5CT6A 4MUHA 4DGQA 4Z1OA 3I1FA 3QK7A 2B2XA 2G8LA 1SXJE 3FPAA 3PU6A 4JJ6A 3LRPA 3STWA 1E94E 1GUZA 4NBTA 3NVKI 2B1RA 3JRNA 4KE8A 1LRLA 3A70A 2DBQA 1VLMA 3VOBA 3UMMA 2J7PD 3G8YA 3P2MA 4ME6A 3EEQA 3QLUA 1VKZA 2IUEA 3TZKA 2X9VA 2QSJA 2JARA 1TVKA 4YQYA 2XZDA 1LDMA 3OEED 4E6PA 3SQOA 3DE1X 2H9AA 4QX6A 4FC7A 4B9EA 5B6IA 2DB3A 2J3DA 1EWQA 3V4RA 2PY6A 5FPHA 3KJXA 3F8SA 1RI5A 3R41A 2PYIA 8MHTA 5LM3A 1JL3A 4Z8XA 2J5KA 5LD2C 1XRMA 5I9NA 4OXRA 3V00A 1QHNA 2JH3A 2ZRPA 1XGKA 1XLTC 3B2EA 3ENQA 3EPLA 5EHNA 4Z53A 1G3IA 3MWGA 5JYDA 1F6WA 1X77A 2PGDA 4XUDA 4DV4B 2HD4A 2O2HA 3KQMA 4HC4A 2PKQO 2HCRA 4L4XA 4OB7A 2X5XA 3GT3A 2O7RA 2R62A 1IATA 1HDOA 3R3JA 5JNRA 1HORA 2H48A 1E63A 3S55A 3TO5A 5KNCD 3A3NA 1KDVA 5IZCC 2MWMA 2SHKA 5AW1A 4RHYA 4UTOA 1C8LA 4W8OA 2R68A 1M1NB 5JASA 4C4OA 1ESNA 3QTLA 4MWDA 4KXFB 2V4UA 2PGXA 2B9EA 1GT91 4PIMA 2R6AA 1Q91A 2QRPA 3EC2A 1NKVA 3JQ7B 3K1TA 1YBAA 4XIYA 4CTNA 4W4TA 1N2CE 2BGNA 3GCGA 4HQ6A 4NEQA 3U5TA 1FFDA 1CNEA 4FVTA 1EM8A 4M0FA 4IJWA 1H1TA 4U9HS 1YBMA 2PH3A 5A5VA 3W2EA 4CLXA 3FX2A 3TGLA 4ND8B 3EPKA 4D26A 3SF8A 2P2GA 3OM1A 1M7GA 2AZMA 1YFJA 1YUNA 1GR1A 4Y18A 2VPPA 2YNMC 4D4HA 2V7XA 4WOPA 4AF8A 5B2EA 3GLIE 1JJBA 2WJ3A 4XVUA 2C5FA 4BWYA 1H2WA 4KBFA 2O1EA 3KE9A 4UNPA 4JLKA 2CHVA 3EIWA 1TTTA 3R20A 3Q7QA 4G8BA 4KYTA 3ANMA 2X19A 2REBA 5FBZA 1QV6A 3UWSA 2CNOA 2UKDA 1JU3A 4FSDA 5F1PA 4LXUA 3DDSA 3IOBA 4JELA 2X0NA 5EP2A 4WJKB 5C2JB 5CFQA 5ALDA 1VKJA 1J8YF 5E1OA 4BEBA 3NIFB 5HR5A 4W99A 1S3IA 1YNSA 1MJ5A 2FN4A 3M9XA 1FQWA 2LV8A 1B15A 3Q12A 1A9PA 1AKUA 4IDFA 4JH0A 1JEQB 1GRCA 4NNJA 3ZI7A 1EMDA 2O3JA 2R6GA 3DVAB 4MO2A 3OWHA 1KL7A 3K9NA 1CJSA 3F6RA 2P7IA 1G21A 2QVLA 4PYJA 2IOHA 3RIYA 2B2NA 1A8UA 3L06A 5FOXA 2J7KA 1RLJA 4GSKA 5CA0A 3F3KA 3R7FA 2P6OA 3ND6A 4R81A 4WDQA 1IN8A 4EHKA 1J90A 3K20A 2O06A 1CP3A 2FR8A 5E4TA 3AHHA 1JN0A 3IA2A 4DWWA 5BNZA 2DFPA 1RACA 1G9SA 4UFPA 2GZSA 5B2FA 2DBRA 5D84A 2W6CX 3D8RA 5KHLB 2ID4A 4NFLA 5HUQA 4DV6B 5CU7A 1E5XA 3RRYA 2IYVA 2PKWA 3GOQA 4G1FA 5FEMA 5JJIA 4RWZA 5LMCA 1VKNA 3EQ7A 5CB8A 3NKVA 3P0EA 3KWMA 4CNQA 1CETA 4DQVA 1FMTA 1U7ZA 2GZMA 2X3YA 1I3KA 3C3AA 3F46A 4TXLA 5DXJA 1ZUWA 1ZJZA 3N2YA 1OH8A 1A9RA 1CHNA 1VDZA 5C8YA 5CVEA 2JGDB 5EZYA 2I2XB 3HL0A 2KLHA 4BLWA 4J91A 4CEHB 1RPTA 1YDFA 2PNFA 2FRDA 3MPOA 4IGEA 3ZGNA 1B41A 3F6YA 4FGSA 4Y6PA 1XRRA 2P5TB 3C98A 1TK2A 2PEYA 1X70A 5T4EA 4AZSA 3QSGA 1E9BA 3BAFA 3HXOA 1G3RA 2MCFA 1YQDA 1WZ2A 4L9AA 1U2SA 3N8KA 2CC2A 3LRTA 2R2AA 1NVKA 5HQJA 1QKIA 4P84A 5TT0A 3JS5A 4C22A 4DCOA 1JPJA 2ANBA 2BN4A 1R6DA 3H5IA 1YDEA 1CF2O 5FNVB 3RVLA 5KU1A 3CONA 3ILHA 1R37A 4MX8A 3PNPA 2P9FA 3Q1LA 4BNZA 1CIJA 1GDTA 3GLFB 1WCXA 2IU3A 2DYKA 1CY8A 1WW8A 3EEYA 1L5YA 1T2NA 2DZDA 1P5HA 3C6MA 3GEEA 3K1AB 3OLYA 4J7AA 4NJEB 4NH0A 2NO4A 4HNAA 5D6NA 2DTDA 2GF9A 3KXDA 4CIDA 2O8BA 3GEHA 3A14A 1S2MA 5JVDA 4KVAA 4EYSA 1ADYA 3BXOA 3OFND 1B3RA 1UPBA 2AOVA 3HVJA 1BCSA 4IJMA 4JL6A 4M6WA 2Y1FA 4JFAA 4YLEA 1XCMA 3QVLA 1X1TA 1U2GA 1X80A 1ZIDA 4FZVA 2JI4A 1U8XX 5GINE 3QUSA 1P33A 2PPVA 4NAVA 2CK3D 1XX6A 3BWVA 2FQWA 2PDAA 2MSNA 2FPMA 3IH5A 5HF5A 5C31A 3UGQA 4F4FA 5K8LA 1E6WA 3T7TA 3OZDA 2BM9A 1XZ8A 4MNTA 4DJ5X 2IHZA 1OX6A 2YKGA 2JAQA 5BXYA 5C9ZA 2LNDA 2Y77A 1JMVA 1IBLB 7MHTA 3SEZA 4ZXFA 1KEZA 3D4LA 1OLOA 4LYYA 4OSOA 1QQAA 3N59A 4QJ4A 3H17A 2OG2A 4X7MA 2JI7A 3KHTA 3VVLA 4YJ3B 4CUJA 4YAUA 4KO8A 3CE6A 2DCMA 3PL5A 4DIFA 4ENRA 4ZYVA 3UYLA 2JLUA 1Q14A 2PKCA 3BD8A 4EMUA 5IAGA 3GCZA 2XQKA 4HUQB 2BY4A 4II3A 4A0GA 4Y6LA 4GI3A 4Z0NA 3QYFA 3VNRA 5H3LA 3KPUA 5JG7A 4FFBA 3D3KA 4NCKA 3V33A 2B5WA 2R4QA 4X3CA 1POWA 2OPBA 4FQ8A 4JKIA 4BQQA 2HZBA 4GP7A 5IARA 3NRCA 3QWFA 4FU0A 4PLPA 1F17A 4UDXX 1N6HA 4FFOA 1RIIA 3JZMA 4WCDA 4LWZA 3KYDA 1C4WA 1ZNZA 2IEYA 1V5GA 1IYZA 4L9WA 3LDFA 4MV0A 1ONPA 5BV0A 3HA3A 1O87A 4OKSA 1JEEA 3PRHA 3E82A 4TQ9A 1CQIA 4ND1A 2GEFA 4KQJA 5DM4A 3VV3A 4CLHA 4BQIA 1Q0SA 4Z9AA 4G5YA 1CUFA 3KXLA 1JIKA 2QG9A 5AIBA 3JASA 3U6BA 3GEBA 2P6RA 5GTDA 4MVJE 3LO5A 1F2TA 3C4JA 2A1UB 4E14A 3U60B 2QUIA 2VF2A 5DCLA 5LQJA 2IYFA 3IBCA 5BSWA 4JIGA 3W1EA 1AZTA 1MQ8B 1IEWA 2WWGA 2ALJA 5K2OA 1L1FA 1U9CA 1HK7A 1XU4A 1OF1A 4C2UA 5A06A 3IO5A 3LS2A 1GRRA 4MS1A 5CLQA 1OAKA 3Q88A 3C3WA 3PIIA 4P83A 3GD7A 2GPYA 2ZBEA 1NXPA 1X7XA 2R8EA 3INGA 3QIVA 2VSXA 2PX8A 1C0KA 2JK0A 1NF2A 4K9RA 1L2TA 2JAOA 2P40A 1HT2E 3NDBB 2NW6A 4L0MA 5K1ZA 5TB5A 4CE6A 2QLBA 3TINA 4WEOA 3O73A 4EKGA 5JMPA 3MSXA 4O2BF 2XNDA 3FFWA 1KPIA 1IXYA 2BR4A 4IXNA 1Y7TA 2GLXA 3DT6A 1FFGA 3SR4A 1CF4A 2QLLA 4DMFA 3MA0A 2RJOA 1IC6A 1SVUA 3CVJA 3KEGA 3UK0A 1QE3A 1UDCA 2F64A 3IQGX 4HBGA 5EE9A 5IC5A 1II8B 4TSRA 4EEZA 3WYEA 2F8MA 8ABPA 1WNFA 3ZE0B 2R1VA 3RSQA 4V0OA 2OHOA 2QNIA 3ILYA 3PWZA 1XU7A 3P4XA 4O4HF 3SBOA 1PJSA 3A4MA 3H5WA 3R9XB 4HPXB 3M7IA 4M54A 1Y3IA 3SEQA 2AUMA 2A1TR 3GQBB 1THGA 2INGX 3NV7A 4YRQA 2QRHA 3U4CA 2QYTA 1FSZA 3OPYB 4DA8A 4I99A 3KXKA 4UZEA 4U6QA 3SBXA 5IANA 1MHTA 2H0RA 3HCEA 1GTG1 4JODA 3KT8A 4YV1A 3D4NA 3P0HA 2RB4A 2Q41A 1RC0A 4RFLA 3ZVLA 4BNTA 2JI9A 4RPLA 2O3UA 3WLNA 4FNOA 3ZW9A 1YQ9A 2H1LA 3ONNA 3AP2A 1W5FA 4LNUB 5BWOA 4LCJA 3OCCA 1XZLA 3RTBA 5MN5A 3PA6A 5JU6A 2F8TA 5ARBA 2BM0A 5T4BA 1DARA 5CM9C 1BNCA 3O2JA 5I8ZA 3LP5A 3K2QA 5EFZA 4HZIA 3Q3IA 3AEZA 2LTAA 3PUHA 3TMYA 3R5KA 4AJLA 2GZDA 3EQ9A 5E7MA 4EA7A 4KX5A 5LLTA 1ZFNA 4OH7A 1CNFA 4MKIA 3E3MA 3PJRA 2KX7A 1B0AA 4OVKA 4LHEA 2PRYA 4G5QA 1H4TA 2Q46A 2YX1A 4LYGA 3SJ7A 3GBSA 4EI9A 1E9FA 4FMCB 4UVDA 3N2KB 3L0IB 1U7WA 3FUVA 3TTSA 2UZAA 1M6VA 2A5YB 1D6NA 2ZTMA 2P3OA 1PS9A 1NDHA 2X8BA 1U3FA 3L18A 3L7IA 3WVNA 1B1AA 3GV0A 2Y0DA 2H6EA 3IB3A 3P20A 2G1KA 2N42A 4JMLA 3T5GA 4BE7B 4ZHSA 2VTKA 3TI9A 1X9GA 1FXWF 3TX2A 5C80A 1NW9B 1V11A 3M6AA 2OZKA 4LTNA 1BE0A 2QN9A 3TB6A 3F49S 2PX0A 1EYZA 2WDPA 3K0KA 4UNIA 3X1JA 1K5DA 2HU8A 1LK7A 3EVBA 1JNXX 2ZBGA 5L51A 3VU0A 3K9FC 2OZPA 4LZWA 3OPMA 2ISQA 4FK8A 5KKNB 3NNNA 2A5DA 4ND8A 3GLTA 4MI3A 4F45A 1RADA 1AK2A 3LNTA 3UENA 2BJWA 4G1UC 3HKEB 4ZVRA 2QT1A 2ST1A 3NV9A 4P4NA 1RCUA 3WFZA 4L27A 4ES6A 3VZSA 2AQHA 1NASA 4C08A 5TPZA 4OAOA 2CHGA 2UXDB 1A5TA 5LWQA 2PKQP 1OSNA 3NTUA 2D74A 2G83A 4ZPJA 4MSUA 5HE8A 2A3NA 3E7DA 3R40A 3VC7A 4EW3A 4QOJA 3C8MA 3S5JA 3N8NA 4C30A 3EQZA 2HNBA 2IODA 1L5HA 1T35A 3BL5A 4OLJA 1KMHA 2XGSA 5D8DA 4IIUA 4I50B 5C3UA 5BNTA 2YYAA 3G1WA 4TYNA 5FIUA 2OC9A 5HF6A 4IF4A 1RC1A 1UP7A 1JEQA 1BFUA 3WRYC 1YR8A 4BGVA 4Z6KA 5CB6A 4AG6A 1ODJA 2JBWA 1HQDA 3DVAA 3IJEB 2CZQA 3P8ZA 1QORA 1BC5A 2V1UA 2BFWA 4KNYA 3DTVB 1Q6ZA 3TX6A 1R0LA 3VNQA 2J85A 3H3JA 1Z6ZA 4DBLC 3PI7A 4ECEA 5D5PA 3I12A 2V7UA 1X0XA 2ZAYA 4GOXA 4OYRA 3UK2A 1N0VC 4D9JA 5CLLA 4GF5A 3FHCB 4GX0A 2I66A 1B8OA 1VGQA 3JW8A 3MAGA 4MP6A 5KJ6A 1YTUA 1E89A 1UPUA 1GD1O 1C50A 2CKMA 2NT3A 4WMLA 1REQB 3CTMA 1YMQA 1SELA 2PM8A 1NV8A 4HEA1 3R8FA 2O0KA 1FNDA 2GFHA 2ODBA 3DD5A 3NLLA 1UM9B 2ZJ2A 4ZVMA 2A78A 1T2AA 2XBLA 2GVZC 3AERB 3RFTA 2AE1A 4YXWD 4PQYA 1UANA 4CCWA 4LTDA 5C18A 3AUXA 4HP8A 4M8KA 4AUKA 1XROA 1MKYA 5ALHA 5F76A 3BJMA 2JGDA 3KPWA 3WMGA 4PYKA 3C6KA 2HQRA 4BV3A 1G42A 5F2OA 4DDVA 2FXIA 2CXNA 1N5DA 5AFSA 4M7RA 3H3XA 2OZEA 3FHTA 3GFSA 3R0IA 4RNDB 3WWEA 5DJ5A 3MERA 5HGXA 1NLMA 2IPOA 2AYXA 2ZQYA 1Y98A 2C5AA 2SKDA 3K1JA 3E9NA 4GLOA 4ND7A 4YBZA 4TL7A 4KGZA 4XWKA 4CKWB 4DMKA 1ZUIA 2W6JD 3QXGA 1ZHFA 2QSUA 1E2LA 1AJEA 4LE2A 1L8LA 2I4OA 1T36B 3EZLA 4KN5A 4B75A 5L4LA 2Z5GA 5FWXB 2QYOA 2GLUA 3C15C 5BV1A 3T3NA 1DX6A 1QONA 4Y2YA 2G88A 2HMVA 4P7KA 4BUZA 4HMOA 4OA8A 3MTGA 3WB1A 3RAJA 3LE8A 1RWVA 4DDMA 4DCMA 2V7QA 2O8CA 2BHRA 4XGQA 4ALJA 5CDTA 4DILA 2ZRDA 3B8EA 1D2HA 1FSGA 3T41A 4E5NA 4NATA 3MFQA 5EI5A 5TRTA 4LI3X 1AA6A 4R2HA 3AIOA 2P6MA 2BEWB 1H94A 4OJMX 2H5LA 1MEEA 3H0KA 1HRKA 4XYLA 2LZ0A 1GUDA 1HI9A 2V0CA 2Q4RA 2IP2A 2Z04A 3SZOA 4IJKA 4ZVTA 1YJCA 4DDUA 3RRBA 1H9AA 1P1IA 2CUKA 3KEFA 5HIMA 2WM8A 2GPNA 3W3AA 4D7AA 4TZKA 4RULA 1OREA 1U80A 1G5QA 1NE2A 1NSYA 1WB6A 4LHWA 4X7RA 4Y1GA 4BBAA 4YV7A 3ILXA 3VR4D 3QNUA 2AFVA 1JJ7A 2JVKA 3KBOA 2UUBB 1QU3A 3NTLA 1T8YA 2IU4A 2QRMA 2HKIA 2XVXA 4WESB 5I9TA 2CJFA 4N7RA 1RWXA 4ZAGA 4YP6A 3VTZA 2QMUA 2RJNA 1TKAA 1BS1A 1BMDA 1R12A 4IOMA 4JGGA 1FUKA 2ZJBA 3ZWPA 1C9DB 2WMNB 1GL3A 4GDMA 2VH1A 7AT1A 4HOYA 1EVLA 3O7WA 1L7BA 4GM1A 1UZLA 5F2EA 1TYCA 1T5SA 4URUR 3QU2A 5EXXA 2BCEA 4ZU1X 1KOFA 5K3SA 3K09A 4PYOA 2RC5A 3U9LA 2GESA 4D46A 1UXOA 1KK2A 3I53A 2X9GA 4R51A 1TW2A 2HSWA 1FK8A 1G98A 4WCFA 3UWKA 2WJAA 3EIFA 3PWSA 1TM1E 1E6LA 3A0RB 4OQMA 2WUWE 1IEQA 2XCUA 2H1CA 3E8SA 2OPHA 2ZRHA 2GKOA 1V2HE 1SZCA 2EQAA 3DLIA 1PIWA 4NBKA 1T0IA 4YA6A 5G0SA 4ENVA 1IRXA 3KM0A 1FF9A 1V4BA 2WKPA 1BHQ1 1E6MA 1TM3E 1X7WB 3R3XA 4A8HA 4AN4A 2NU9B 1D8AA 4FQ7A 3ZJ4A 1H2AS 1RPNA 3OLCX 4B43A 1ZIYA 5C4IA 4GOOD 1QHSA 2ZR0A 2UZ1B 3KOUA 4LE0A 4YRKA 4R9NA 1E6UA 5JLAA 1XZNA 3F4LA 3AUYA 4IJ6A 3S7ZA 4D79A 1UDXA 5IAOA 1YZVA 1JLRA 2A1UA 3RRNA 1XMJA 3T4XA 3SDBA 2WFLA 3AR6A 3IKJA 3O92A 4O2BA 4ZTZB 4QXRA 2F2TA 1KVUA 1O4VA 1KFEB 2AHOA 2JEYA 4LOLA 3R7SA 3GR6A 3WK7A 3K9WA 2WM3A 3K0CA 3DP7A 3OUZA 1RRCA 1Q20A 5I6DA 2AWNA 1GNSA 5EHXA 4R1OA 1AKNA 3PF8A 5JFOA 2FN3A 1U1CA 3S2GA 4RTKA 2BF7A 1KPHA 2WBLC 4Q1EA 1ZGAA 3O2SB 4MB0A 4O4HA 1TLFA 1XO1A 4WJZA 5ESXA 1RWBA 5B1HA 3CNHA 3WNBA 4CUZA 2XB8A 1YE3A 4FBMA 2PK3A 3UAGA 1F0KA 1LW6E 2F1JA 3VX4A 3WA6A 2WZBA 2CJXA 1G291 4HH4A 4N5NA 3ZU5A 2QP4A 1WUIS 1PWYE 4JUIA 2QROA 3M4NA 4BE4A 2K5UA 4XWTA 4IILA 3DKRA 3QBTA 1YACA 1Q2UA 4GWKA 1II8A 3MOGA 1SHJA 4WT7A 1G5RA 4IDNA 3L7JA 4FD2A 4H0FA 5HKBA 1P2UA 1KJIA 2YC2C 1F38A 4V2UA 3KT3A 3NPAA 4AJ4A 2ACWA 4BMYA 4UTVA 5L3SB 4PANA 4DPMA 4MULA 1A7KA 1IY8A 1NE7A 1NJGA 3EC7A 4ZC8A 1YS1X 1JAIA 2DT5A 2MTBA 5KTKA 4MYTA 2J41A 4OQYA 3UK6A 2O2CA 4EOGA 4F1WA 3CS3A 1DXHA 2O2DA 2ZK7A 1CDDA 3ETCA 3FSJX 4GRIA 3T7CA 4F0JA 1O2DA 1SBTA 4E3ZA 3D7KA 2EDAA 1HDCA 4J6EA 3VDNB 1Q1NA 3HE3A 4FMDB 3NM4A 1CVRA 1ZS9A 1GWNA 2WKSA 4FHEA 1J7KA 2OBXA 3HJCA 3I2FA 1Y4ZA 1T4BA 4TLMB 4YPOA 2ERYA 3DYVA 3IBSA 3W5HA 3O1IC 3OZ7A 1JDVA 1TM7E 2HDHA 3BXFA 1U9IA 2C54A 4LXQA 4OATA 4A82A 5LKAA 5F12A 3EWIA 3OFKA 3VYRB 4LPSA 2F43B 3VVCA 4P1ZA 2DPHA 1SUFA 1TPYA 3OQVA 3FH0A 3OY2A 4TWBA 4XSGA 3SYKA 3O91A 4KO4S 3HCRA 2Y67A 3ZE7A 1MJFA 4F5ZA 2WKRA 1DQZA 1FXWA 5F5NA 2CWWA 2P62A 1LQUA 5F3RA 3E1GA 4AJEA 1U7UA 1E1YA 1ZK1A 3B36A 1IN1A 3ESDA 1QRDA 3MTIA 2I78A 1K7EB 2DFKB 4MARA 5FO1A 3S2ZA 1U1FA 1N6NA 3N2KA 2XUAA 3M5CA 4RM2A 2FUCA 4E5KA 2ZAGA 2D6FA 3O4RA 5IN4A 2R11A 4ZQGA 5HCUA 4ALKA 3QG1A 4HDSB 2OCIA 1Z68A 4JD5A 5BW6B 1ZSVA 4FOSA 1CRZA 3D1JA 4UQLA 5FHQA 3AF0A 3H75A 2DTEA 3GPCA 3LAWA 3PUXA 1WO8A 2A9VA 2DPMA 2XUKA 3CW9A 1XE3A 1N36B 2QTMA 4R1SA 1B93A 3VBEA 1EU1A 2FPSA 2Y71A 3ICPA 2QM3A 5FUVA 4QYSA 4GKAA 1Z5UA 2VHUA 1IJFA 2IKSA 3FRHA 3IKLA 2HT6A 4H7HA 2CT8A 2WIDA 1U7DA 5KTOA 5E3JA 1FP7A 5KSYA 2F55A 3X43A 1B6SA 5JCXA 2ZZMA 1LGYA 3SU8A 1MP0A 2J5RA 3NTQA 1LPBB 3FYUB 1Z6TA 5CIQA 4BEWA 1DKUA 1Z3CA 4RS3A 5TMPA 4WFQA 5IYZB 1CJTC 1I2AA 2C3UA 4C0QC 5J2UF 4DLSA 4ER6A 3HEMA 3JQCA 2IQIA 2OFOA 5A3QA 3QUAA 3UXHA 5LXTF 3KSUA 3DZJA 5AVQA 1CVIA 1QG6A 4RPJA 4W9NC 1MGOA 4FBGA 5JSQA 4DC0A 4DSOA 4OHWA 3LQRA 1RXUA 2VJMB 1RFLA 5KJEA 1AQUA 4MDFA 2HDOA 3B1ZA 3PDHA 3UJ6A 5K3CA 4D8YA 4I50A 3ZLBA 2QMEA 5IYZF 1A9XB 5ICMA 3GJ8A 1O1YA 4MW6A 5TMDA 2YZNA 3RWMB 1NULA 3L93A 1ISPA 5M7EA 2PJZA 4MW0A 1JA9A 4B8ZA 2WAAA 4L5JA 4BNLA 3LVRE 2PEZA 2AKEA 4X93A 1IOZA 4CDMA 1MZVA 1OA0A 1X3SA 2D1YA 1XFDA 2GI4A 3MRVA 4PHCA 4YXFA 1XLUA 1QANA 1HEIA 5LMUB 1BH2A 1KC3A 4LE1A 3FA2A 4PXYA 3M3DA 2GERA 5DH9A 3L6BA 4PZ9A 1IK4A 1L8QA 3KKEA 1REQA 5M3BA 4IEEA 4PGAA 3QBJA 3ODGA 4RZXA 1WKCA 3MOSA 4UHCA 1UM9A 3JV7A 3L4BA 1U0TA 1Z8FA 2W6PA 3HVHA 4NABA 5IN5A 1TT5B 5MGNA 3N0RA 1QR6A 5A0TA 3HNOA 4UTZA 2AMVA 2OMKA 1SG6A 3JQAB 2BMJA 3BRQA 3ZDCA 5ARCA 1MFZA 1MV8A 3BC1A 4GQBA 4EYEA 1D03A 3WKEA 2V6JA 4RS4A 1MC5A 4ZGBA 4OUKX 2BUBA 3LNCA 5DN6A 1JQBA 5M34A 3B20A 2Q8QA 2Q8NA 3KQTA 4BMSA 3DNPA 1I5RA 3QEMB 2J67A 2P9TA 2EKDA 1B43A 3E27A 4I4CA 2VQ3A 1ZU5A 1I4EB 4YJHA 2ZUSA 3E9ZA 5AHXA 2B4RO 1RYMA 3PUVA 1EIZA 1YJXA 3M81A 2J6HA 3R4VA 2RHBA 4EGFA 1EBFA 1QJ4A 1X94A 2J6IA 1BKSB 3WNVA 4BX0A 5DLDA 2ZIEA 1CZRA 2I33A 4FJ2A 4HGRA 5FOSA 2JLBA 4QXMA 4GT1A 3ND9A 5LMNB 1W0KA 2NIPA 3H04A 5JCJA 2FE1A 1EPUA 2G06A 1T36A 2PYZA 2YWRA 3CH7A 3H8SA 5DKFA 2CHEA 2CLOB 4Q4JB 5C0OE 2J6BA 2ZUDA 3S5UA 4BO9A 1O8BA 4XUEA 4M0MA 3H86A 1W8DA 5KDDA 4HDAA 1ZD8A 4QO7A 3FMVA 5IK2A 1DXQA 3JYOA 2C61A 3WAGA 2C59A 2HR1A 1F4LA 4C4AA 1H8EA 5L45A 2W6ID 3LL7A 2FQXA 4MGIR 2UZ3A 3RS8A 3CBGA 4RBNA 4BC0A 2FTKE 2ZGVA 4F9GA 1G0NA 4EW1A 3OIYA 1UEXC 2WYIA 1AHNA 2ZJ6A 3KOWA 5IF9A 3M9WA 1N34B 2Q45A 1KBQA 2NT4A 2KBEA 2P2NA 1F2DA 1GSOA 2GD6A 4QPJC 3NHWA 4ZVPA 1EFDN 2NUBA 3DNFA 4DRXB 1FTNA 3L43A 2JATA 2XDYA 1P3Y1 2P3QA 2RCNA 4W5QA 1QHHA 5C1PA 1BJRE 3V7WA 1ZYUA 1SRRA 1V0JA 5A2QA 2PUAA 4HXYA 5CJPA 2PKEA 4ZRMA 4CWAA 4H7KA 2BONA 1EA7A 3QQPA 4LA4A 3P2YA 2W9XA 2BTEA 1KYWA 4CR6A 1U5AA 4FEYA 3RS7A 1W4RA 2QY9A 2D7JA 1FS5A 4WESA 4WZBE 5JSYA 5JH7F 3ORRA 3S7TA 4DABA 1WTAA 2B0JA 3A0UA 4YCBA 3VX3A 2JW5A 3VZPA 2ZCJA 5AWFC 1Z5NA 2XZTA 4OFWA 4KLCA 1B26A 2OCPA 1KS2A 1XCJA 2B1JA 1P5JA 3W4IA 1SCJA 4E22A 4PG8A 1E6EA 1NBOA 3H87A 3LQKA 4UXIA 4XWGA 1UJ6A 2EL7A 3KJQA 1A4UA 1CFJA 1I13A 1QTIA 1SRQA 1RZRD 4ZOAA 2V4ZA 3I62A 1QRSA 4C0WA 2OP0A 1OV4A 3I0MA 1QO9A 1SQ6A 4BO0A 1FP1D 2P65A 4M1YA 1TQ2A 3UMCA 3DBHB 1GKIA 3TIXB 5K6AC 3OPXA 4K9SA 2QSZA 1M0TA 3ZG6A 1OU4A 1NG9A 1PL8A 3GJ3A 1JKXA 4S1OA 4F4DA 1G8SA 1XHFA 4XD2A 1VJRA 3KPYA 2F3QA 2CY0A 3GEMA 3TR5A 2VCEA 4DG9A 1I6LA 1SXJB 5JZBA 2YY6A 2QRGA 3JYPA 2DQKA 3QVVA 3IAM6 4GC5A 5HG0A 1DLJA 1GPLA 2Q29A 4EYKA 5FJJA 3KQUA 1H2XA 1XPJA 2XHEA 3OCVA 4QOFA 3GGOA 1HE2A 4J9VA 1E64A 1OLXB 1GO2A 3CF4A 3QVGB 4XWAA 1T8TA 1KDYA 3RUEA 3X1MA 3NORA 4A1FA 2XECA 2XB4A 3PEYA 2A1IA 4F5WA 3D6MA 1AF4A 1FYDA 1QQ6A 3HDVA 3LYUA 5EG5A 1BDMA 1E2GA 2PQ6A 4BN0A 2CGEA 2BM1A 4J7CA 3VSDA 4NYIR 3BMNB 4BECA 5DLYA 3WQBA 1N2ZA 3IR6A 2HLDA 2CF6A 4KR6A 5DTMA 2XQVA 3K05A 5BWLA 3H83A 4F7DA 3HUTA 2QRQA 3PCRB 2KM1A 1JR2A 4KQEA 1QGZA 2K87A 2KS6A 4YJGA 3V7UA 1KI4A 1WDKA 3WKBA 4G0QA 3INRA 4A73A 1ST2A 2FEXA 4FDTA 2AGVA 1DP4A 1G8HA 1JRLA 1MUUA 1SURA 1LPNA 2Y66A 3AVQA 4LBYA 2OUKA 5E1BA 3I04A 4Q4AA 2V7PA 2XPCA 1VI5A 3IV9A 1PGQA 3R5TA 3X1DA 1NR7A 2XGOA 4MIKA 3TSZA 1EFTA 1ZHHA 3IR5A 2VT3A 3GG9A 3EDCA 1Z62A 3JQ9A 1E6CA 1KMNA 4Z9BA 2N47A 3QRWA 2PKXA 3W4KA 3E5RA 3C8DA 2C8VA 3QFTA 4NTZA 4CNBA 4AY5A 2GLTA 5CEEA 4LWQA 3I9JA 4BNDB 5I5EA 5T64A 5JDIA 5U9CA 1MVOA 2PWYA 2RHWA 1GRQA 2P9ZA 4DTCA 4TOIA 2JFBA 5G0UA 3HR8A 4LMPA 3G7SA 4YP7A 1EDEA 1N2CB 1LRKA 1TRKA 3FOEC 5JQWA 3RH0A 3LWZA 2HBYA 4RXTA 4RM3A 3ZJ5A 3JSAA 4BZXA 3GMIA 4AI6A 2D2EA 2H7VA 2ZB8A 3WRVA 1Y37A 1YB7A 4YP9A 2E0IA 3W6NA 4AS1A 2F9FA 5LB4A 4LDJA 2C04A 4YRLA 1G0OA 3GJ0A 1MB2A 3OZXA 5DGTA 1ZIXA 2HNAA 2WJJA 3ABOB 5F23A 3GLIB 1UXIA 2RG7A 2RONA 3Q98A 5MFZA 3QVTA 5KJCA 3LXXA 1I2ZA 2COUA 3OQPA 4BPRA 3A3KA 1ORTA 3IAFA 2VRCD 3KFVA 4FFDA 2JFNA 1XN4A 1Z73A 1R50A 1COWD 1VI6A 3GZ4A 3Q7RA 4Q37A 3PGVA 3ZIDA 3CUYA 4FSHA 1OWNA 1NVWQ 1FYVA 3C14C 4DCCA 3AB7A 3PZBA 2Q5JA 4QAJA 1QBKC 4EW2A 1JMKC 1SHTX 3HCCA 1YXMA 1U6KA 4RTJA 2CNLA 5K6RA 1OHHA 1ORVA 3QVWA 3ZJUA 3EULA 2K4MA 4ZWNA 4DR6B 3CKYA 3HABA 3JQ8A 5NULA 4A6DA 2P3SA 4GBED 3FAKA 3OEHA 2ZWPA 1WU7A 4KXYA 3RSGA 4GSYA 5HA5A 1K9SA 2X0DA 2GTHA 4O5OA 2PV0A 2R6R1 4F2DA 3EZNA 4Z2YA 4JU8A 3C41J 3DE4X 3FYHA 4TRJA 5K8IA 2C83A 5GZ6A 3SE0A 3EXEB 1JLHA 3NUGA 1O94A 3TLYA 4TS9A 2VYQA 4M0EA 1GZ4A 3RG8A 2I9KA 121PA 3LCUA 3ZZ1A 2QXYA 4NH4A 3PX3A 4MQFB 4RZ2A 4KR9A 2QX6A 4NFHA 5EOVA 1XDBA 4JSRA 1IHPA 4FINA 2DKFA 1DNPA 3AVOA 4PQRA 3FI9A 4OGWA 4K3UA 4INPA 1C4OA 1UMKA 1UT5A 1ACMA 1K1EA 3HXKA 3IPAA 4RF3A 5J2UA 4HGQA 1JFTA 5IT0A 1BSVA 4F1KA 3K70B 3DZCA 3V1LA 2QVZX 1SB9A 2H52A 3K6RA 4OHPA 1VP9A 3WJ7A 1LNZA 1S2NA 4YROA 1Z0DA 5LXTA 4RTRA 4RTLA 1WL8A 3N05A 5F1OA 3UG6A 5IH3A 1Z25A 1DT3A 1KZGB 3HXTA 3UJBA 3VPSA 4KQCA 4P4SB 4Q3EA 3CISA 2PUCA 1LSSA 1V8OA 1GKLA 2FK7A 3K5WA 2C57A 2ONCA 4LYFA 4NYJQ 4DIKA 1W6RA 3GROA 4PNZA 2IPXA 4L6CA 3PK0A 4KXLA 2QNRA 3L2OB 2Q1TA 1WM1A 3DE7X 3MMPA 3OAAD 3QU4A 4U6NA 4B33A 4C87A 2VJAA 5EZ6B 4LGVA 3NC0C 4DFDA 4CV2A 4X62B 1AUOA 1I7NA 1TU0A 1ULUA 3ZN2A 2AEJA 3HSYA 2YWDA 4J07A 4R31A 5EMMA 1QGUB 1R6AA 2WTUA 3T1HB 2YFHA 2E4WA 3QXXA 2CJYA 4TT3A 3PLAE 3BIJA 2PL5A 4KIUA 2VJMA 1RS0A 1K06A 1JQEA 4UMVA 1SK9A 5A4KA 2Q1XA 1D2EA 2ODPA 4EL0A 4HDQB 4MA5A 8GPBA 4HVLA 1ZG3A 4WFJA 1MAWA 1IB0A 4YT5A 4G84A 4PLTA 1I3CA 2E3JA 4M0PA 2VLIA 4H6VA 5BSHA 1HG1A 1CJKC 1ICIA 4W63A 4HQNA 2DVMA 3AU8A 3QH4A 4I5DA 1U5CA 4J16C 1P4HA 5B5SA 3WIDA 3O4HA 1S9DA 2OXIA 3LC0A 3AB3A 1NJ6A 1WZNA 4ZOBA 1EK5A 1EE2A 4EI2A 3NOQA 2ZYTX 4U8GA 1CIPA 4DZTA 1LSJA 5H3CA 1DAGA 3BWXA 1GNRA 1LKZA 3VR2D 3AT1A 3CFYA 4RPIA 2IV2X 3T5DA 5AW2A 4Q3BA 3O5AA 5AHKA 4ESVA 4KMMA 2ZRJA 3WGMA 4CLOB 1TT5A 2WT8A 3DEKA 2O8FB 2G3YA 1D1QA 1VPTA 2BW0A 1AKEA 1MMFB 3PXEA 3JQAA 4B4KA 4GKJB 3M0EA 3CH6A 1ZXXA 3KZMA 3KJNA 2WFAA 2KYRA 2KPOA 1HF3A 2ECOA 3C8HA 1TM2A 4QSHA 2IU0A 4RHXA 5AUQA 3NFRA 4OFZA 3PKIA 5ECWA 2NO9A 4UAUA 3FKSA 2CFRA 1JG6A 1Y3FE 3IAEA 4LVNA 5CCDA 2B4QA 3UJPA 4C4TA 2YHIB 4CM4A 3ADDA 3IQFA 3A9RA 1YV9A 4RE6A 1KO5A 1U3UA 3AWDA 3SFZA 3OZFA 3HU3A 3A26A 3DDZX 2MYNA 5DNVA 2ISSD 3WX0A 4A2QA 1FJGB 1UFOA 2A30A 3I4CA 3Q4GA 1EDOA 3D2LA 4PPNA 3EBLA 3PUIA 3NBAA 1FZTA 1EX9A 1PT8A 4F3CA 1EK6A 3ISTA 4GGOA 4Q4JA 3U7QA 3AHGA 3TCXB 4MRPA 4JNKA 1XTTA 3AETB 4UHDA 4A0FA 4BVKA 5FTJA 1B6GA 1GQRA 1Z4JA 2SCUB 5EJ9A 4BB6A 3ER8A 1PG2A 2FYTA 3LGAA 4OKIA 5I4KA 3ENVA 4NCIA 1CS0B 2IDZA 1VA5A 4FFSA 1KKMA 4RENA 1NNUA 3LLSA 2ZATA 1NBWB 1QHEA 2FWJA 2HFJA 4DY6A 4L73A 5AVJA 4JCCA 4I14A 4K40A 5JH7A 1GU1A 1I7DA 2LDXA 1RYEA 2B94A 4G5GA 5FUXA 4DBVO 1P8AA 4ENQA 2F4NA 3IX7A 4DRXA 3DO5A 3B1YA 1OJLA 3Q2IA 1AOXA 5AW4A 4U63A 1I0IA 2EWMA 3M4YA 4Q47A 4DHEA 5DI3B 5ICSA 2GBLA 2IVZA 4MVJF 5DGDA 4HMQA 3H7AA 4ID3A 3K35A 4JV5B 5D1HA 4CDGA 2CWDA 4OXKA 2ADFA 3X1YA 2R6ZA 4HV4A 4IDBA 3U37A 2O14A 5BSMA 5JWOA 1SVKA 5EWLB 4BTLA 4XVRA 4EW6A 2VVTA 1PE0A 4OQFA 2QXUA 5HTKA 2G5GX 1K08A 1G7SA 2OENG 3EVNA 1G2OA 2WP0A 4UPVA 3F2VA 1NUAA 1RU3A 5KQSA 4AO6A 1O58A 4RLQA 3T38A 2ZULA 1RKBA 3H5NA 3FNBA 2FR8C 1U3WA 5J2TF 1ISIA 2H7YA 3GFFA 3DBHA 2VDMB 3OUTA 4DCUA 3KR9A 5LYJB 2JD0A 3Q85A 2FR1A 1I24A 5A4DA 4TV8F 2ZKIA 1KERA 1GGMA 4QUHA 1GNTA 2CF5A 1OGIA 2B3TA 1G16A 2FSGA 2WJVA 1Q3HA 2GSDA 4HPWA 3PSHA 4L57A 4BO2A 1SXJA 2E9SA 2AG8A 3GAFA 4K86A 4F84A 4YI5A 2JD1A 3NWJA 5COQA 2C7GA 3BT7A 2EFJA 1H2EA 3Q9UA 4I1VA 3K2BA 4P0TA 5BQXA 3T5AA 4FUQA 2FRDC 3BXEA 4RD2A 1A8IA 1OLXA 3PGKA 4DZZA 1K2WA 1PZHA 3ADCA 1G64A 2CDRA 2OHGA 3Q2OA 5KNDH 3NH6A 1D2GA 2Q3DA 2WV7A 5AOBA 3NBZC 1JBEA 3WLPA 2FMHA 2XMZA 2XDAA 2ZR9A 3BMNA 4JAVC 4RIGA 1DT5A 2V74B 3I9MA 5FQNA 3DT9A 3RBZA 1R8QA 3QQ5A 4LF9B 2W2TA 4JP1A 4KIWA 3LPAA 3DPSA 4GYKA 1A95A 1SZDA 2ZIGA 2MSLA 1TI7A 2V5VA 3U81A 3W5UA 3TW8B 4EJSA 1O6CA 1A8SA 1U8AA 1NVUQ 1DJOA 2ACEA 4BGIA 1W88A 4XCQA 5BSFA 2VWPA 5COAA 1Z5OA 3U3DA 1UEJA 3UW3A 4INZA 2WVGA 1IBSA 3NHKA 1UOQA 3AL2A 2JS7A 1SOVA 3CURA 4F97A 4QM7A 4DCSA 2OY0A 2ZI4A 4O25A 3W77A 3TRDA 2I34A 3DT8A 3TZBA 4AROA 3LTNC 3SX2A 3RUCA 1E96A 1D2AA 1U2GC 3IJRA 3LBIA 3VR5A 2BIFA 3IIEA 4BNDA 5ERGB 5IF3A 4UBKA 4YMSA 3WLQA 3PX2A 4M1WA 1YB2A 1MU0A 3FJOA 5JAZA 1N2CA 4WOKA 4BQEA 2XNSA 1H23A 1UZUA 1T26A 5C8XA 4RK7A 5FAXA 3A9CA 2EKQA 3EVTA 4D3YA 3KVOA 3L0SA 4EITA 4CG1A 4KO1S 3HBFA 5DYWA 1Q57A 1MPTA 1U0LA 1ZD4A 2DBZA 3TEFA 4NS1A 2I7CA 3ZHQA 1RD4A 3CEAA 2OAEA 2D4HA 1PEKE 4IGFA 2QDXA 3UJHA 1R0WA 3GLIA 2C2KA 3HYNA 5B7PA 3CLUD 4GE0A 4P80A 1XRPA 2J3EA 1AU9A 4H3KB 4KRXA 3ZLVA 1X7YA 1OXTA 2YHBA 2O8NA 3RHTA 1S7CA 3CLTD 2DG2A 2YJ4A 4UMEA 1TKCA 4DJDC 3PGA1 1N1GA 1SN7A 5B37A 5D3KA 3EARA 3UAZA 1XRSB 1DQSA 2XE8A 2XKJE 5SY6A 4EY4A 4O3FA 4TX1A 3HY3A 1A5AB 1X1SA 1DTWB 3H4VA 4MPDA 3ETJA 4N0DA 4AZVA 2GTIA 1O95C 5EKSA 2PL3A 2Q2NA 1Y8RB 4EB3A 3L4KA 4NDNE 2CNWA 2FOIA 3K72B 3LT2A 3T7JA 4X45A 4MV8A 4QEZA 3WGUA 3DEHA 4N8SA 1YR2A 5CXXA 1NMXA 4MQ6A 1QYCA 1SUDA 5AVVA 5C37A 3VH4A 1Q1EA 3OF5A 4RQAA 4YCNA 3QYAA 1ECPA 2EJBA 3E70C 3WSVA 2VAMA 5HJ2A 4UE2A 3OFSA 4YUVA 2X0JA 4JEUA 1R10A 4NCXA 2OESA 3EXEA 5CB0A 1IZ7A 3Q8MA 1U2EA 4DMMA 4GKKB 1F6BA 1JFFA 2PLWA 3AI1A 2IE0A 4AX8A 5K8VA 3N75A 4MQFA 4PICA 1UBTS 5BW5A 5DNEA 3J7TA 4G36A 2WTMA 3WV4A 5JEEA 1KSGA 1KWKA 4XGKA 1UK7A 2FPPB 3ZOZA 1DDGA 2AI3A 2X1HA 2EP8A 4EDHA 3AESB 2EZTA 3OLZA 1XMOB 1W36B 3I9LA 4J4BA 1YUBA 1T1IA 2OCKA 3PEVA 1N2EA 4RGYA 3E58A 5KTMA 4FIZA 3PHLA 3TBFA 1T29A 5IS2A 3LXUX 1CY0A 3TIIA 2DPXA 2E4YA 2QWXA 4P4SA 3Q40A 1P2VA 4MA4A 3WLKX 3CZMA 2HSJA 3K1ZA 4UNRA 5F78A 1V6CA 3BGDA 4BP3A 4QODA 4TRRA 3GJ7A 3JU3A 4PAOA 4O29A 4ZVUA 3HYCA 2CFCA 2RKBA 3MELA 2HA2A 3WGHA 1RM0A 3TQIA 2Q9AA 4AMGA 4DB2A 3DJYA 1XDGA 5ES3A 1L1EA 2DWOA 3BZUA 5C4GB 2WPDD 3AUUA 2I9PA 1DINA 1WB5A 1Y9ZA 1ZH8A 3A1FA 3FNQA 3GLVA 3GX1A 4PHTA 2H17A 4TQUS 4CQLB 4PYRA 1DQRA 3M6UA 3BEOA 4QRDA 3CF6R 2QD2A 3IULA 1GCOA 1XZDA 5E6SA 1PZNA 2ZTSA 1Z0KA 5AJUA 5I8PA 4EF6A 3H9EO 5C5DA 2WUGA 4M2LA 5EKXA 3RODA 1Z4QA 5BR8B 2BJVA 2BMAA 1OOEA 4BXOB 4Y9RA 3PDJA 4YIKA 1IQRA 2BTOA 3EGXB 1H3FA 1JQDA 3UHFA 4S2EA 4C0KA 1TC2A 1W29A 2J3QA 2JGJA 5ER9A 1NRXA 3I45A 4OI1A 2H16A 4FLEA 4IJVA 5KOHA 2CNKA 1GEGA 4MYUA 4DSUA 1WDLA 1T1JA 3T1QA 4K9KA 1QB7A 3S3TA 3WR5A 1FPMA 1VP3A 2XRYA 3JCZA 1GKUB 1WXDA 4Q66C 5T4HA 3W5DA 4EVSA 3TD9A 1HDGO 1DAPA 3EMKA 4BBZA 3ZWDA 5JMWA 3THYA 4EHIA 4Q6WA 2GDJA 2SKCA 2AQ8A 4TS3A 3VMMA 4CLOA 3CO5A 4TKUA 2B0CA 4HF7A 2O8FA 2BHSA 4WVLA 3F47A 3DAOA 3HB5X 3TLJA 2N0SA 3P9SA 4FT2A 2PX2A 3FCYA 5IKOA 3RRJA 3BAZA 2BDTA 1LV8A 2XSZA 4RH3A 1PJQA 4LYJA 1FA9A 3I2KA 4YS6A 2OYSA 3D5TA 2QKYA 2IELA 3BX1A 3F9IA 4QQNA 4RIEA 4S24A 1J07A 4WNAB 1T6XA 1ZH4A 5HBRA 3B7GA 5C7OO 1DO2A 4OAQA 4W5RA 2ECPA 2OBYA 4G26A 3I2JA 1Z0FA 4A6PA 1U0GA 2X8AA 1YCGA 4YNBA 3E48A 1U2DA 2GYYA 3BUSA 1UP6A 1ACJA 2ETXA 3KWJA 5KIAA 5B58C 3RJTA 3F7OA 1NJFA 3ZDQA 1BU5A 4JC8A 4GQIA 3T4UA 4DW8A 2XZLA 3OSUA 4ASUA 1PCXA 1X19A 4UTPA 1CDOA 1XL1A 1JHOA 3LC7O 3MD0A 1WABA 3T5MA 5KWIA 3HLYA 4IX1A 5BRJA 821PA 4DCVA 4DUPA 5T8KA 3ETEA 4MVJA 2YN0A 1GLNA 1LVHA 2FHPA 4IV8A 3VKFA 3V48A 3EFOB 1RHJA 2QL6A 1V5IA 3NHRA 1C7RA 4NI5A 1ZVQA 1P39A 1Z4IA 4MQ4A 2YN4A 4KRYA 3A1WA 2HU5A 2IDJA 1E2NA 2W5UA 2ZDQA 4PZDA 3OE7D 4QGAA 4ZYWA 1FP4B 5KVQA 4G97A 4XH9B 1C9KA 4JN6B 1N2GA 4MAFA 5AOAA 4IXTA 3AP3A 2PWZA 3B6IA 3KZVA 3H18A 3SSNA 4N01A 4UMFA 1BAPA 3CLVA 4EVQA 1Z36A 4MYSA 4OPMA 3TXXA 1JHXA 1KJJA 2IUFA 1EGQA 4Q0MA 1HTTA 5DYTA 3ZJYA 5J2TA 4BFTA 1U63A 1E1RD 3PDWA 3WHKA 1SUBA 1C9YA 4HZUA 4DDKA 4MW1A 2NV6A 2YQZA 2AZDA 3LT0A 2JAXA 4L78A 2C20A 3U4IA 4BBPA 1BVRA 4TV8A 4WCVA 1RWKA 2WA1A 1GILA 3JVVA 3C1TA 1Q1ZA 2PBLA 1VIDA 1A2QA 1I4OA 3C39A 4TS1A 1MD9A 5CYGA 1ZK0A 2FZGA 1J56A 2YHUA 1GPBA 5J1TB 2ZYDA 4PIPA 1HLPA 3FWNA 1JFVA 1L1RA 3EXAA 4JWKA 4RY0A 4WZAE 1J5PA 1HO3A 1FMJA 1NP6A 1Q1BA 2PT5A 3L7KA 3QI7A 3NEAA 3QX7A 2P6PA 3H16A 5I48A 2I7VA 1F1BA 3DFUA 1GAQA 3R74A 3Q9NA 3HLKA 1VSBA 3UKDA 5HZKA 3ZH2A 1JEAA 4NR0A 5B3LA 3CZRA 3V3TA 3Q6IA 4ZT2A 3B51X 4K9QA 1TC1A 1BVUA 5U4XA 1C1DA 3G6KA 4OCZA 3HFGA 3C5HA 2UVPB 1P45A 4TV9B 3SG0A 2HUPA 5IJZA 5G1NA 4B3SB 3EBPA 2HQBA 3EMDA 2X13A 1OLSB 1XMXA 2WUEA 3L07A 4M9CA 2ORED 4UEKA 1QE5A 5JXJA 3COJA 4TLBA 2EEPA 4GWLA 1QIGA 3AVYA 2BEVB 2XQFA 2QJFA 1XVAA 2Q6VA 1UF9A 1JJVA 2AC2A 2HA6A 5EYPB 2OGTA 3CZ9A 5K3BA 4LRXA 5K3FB 4PR3A 2BR3A 4HN4B 3EVGA 5LP6B 1JHMA 2FFBA 3L7DA 1E1QA 1EWVA 3BXZA 4KDRA 3OE1A 1HG0A 1MIOB 4F71A 4ENSA 3BULA 1K3TA 3H2ZA 1C2TA 4U3JB 4C4RA 3CPEA 4GP6A 4JBLA 3H6HA 3DHYA 4F60A 4QTYA 4EL5A 2GD1O 1UBMS 4PBTA 4AX4A 2FG6C 4KXUA 2B8WA 3U3XA 3V34A 3Q15C 1U7HA 3IQZA 4A9AA 1DI0A 2I1WA 1EFKA 2J5XA 2BMDA 1Z4KA 3BZWA 2H11A 3TLCA 4BQSA 4C6RA 3HDTA 4D74A 5BN3B 3CLHA 4DA0A 1EXDA 5TGZA 4EG7A 2BTQB 1SD5A 4XB6B 1YQTA 3PPIA 1YDWA 2FW7A 2HPHA 2PZAA 4JY7A 1VFPA 2P2DA 4JBNA 2QM7A 4NS4A 1RAHA 4RK5A 3V8RA 1N3BA 2BHNA 4A2CA 1WQ1R 2AR7A 1UMDB 2OFFA 2PUEA 5LQNA 5IBCA 1YH3A 2VIIA 2CFIA 1S01A 3GVCA 3FLBA 1QGED 3D4OA 4H1WA 1N4AA 1FIUA 1R0ZA 2YFQA 3OCUA 4RZSA 1P7VA 3BHNA 4HL6A 1EHCA 5H83A 4DV2B 5C34B 1NVDA 3CTPA 3CRNA 1AT1A 1ONNA 2IEZA 5D86A 4YQFA 2PZFA 4KIFA 4LSWA 1Y48E 4F85A 2V0GA 3ANYB 4UUNA 4LJ8A 1U9JA 1KO4A 2CBZA 2L19A 3BFKA 1KEVA 5B1SA 3ZK8A 4KJXA 3ITKA 4EMBA 2E49A 2IHYA 1R6UA 1OH6A 4KWEA 1DTWA 1VPLA 4YRFA 5EZQA 3ESRA 1LXCA 2C0PA 3K09C 4UOQA 3RI3A 3TW6A 3DAGA 3K4PA 1Y8RA 2PUDA 4B3CA 3OOEA 3CSSA 3DLAA 4WCFC 1EGVB 5CDUA 1NY5A 1QH8B 2R86A 3TVYA 4FB5A 3NU1A 3CLRD 4FILA 2DM6A 4URZR 3UM9A 4D9CA 5JZMA 2ZI3A 4NP6A 1RHRA 4B8YA 4DEVA 4S2UA 1U8EA 3GEIA 1OPXA 2BP7B 3C6ZA 4QXPA 4CUKA 5JC8A 2GPJA 4AURA 2G25A 3TH5A 4RK6A 3F4BA 3H9CA 4U2FA 3WBFA 3IESA 4BX2A 3D2BA 3T9AA 1ZLYA 4PBSA 1PT7A 4RANA 5GADl 4U4AA 3ZDXB 2H3HA 2P4UA 4H6PA 2FPPA 2FPLA 5EERA 4UEQA 3WLSA 3CZCA 2WT4A 3E8MA 3IEPA 2J3KA 3AESA 1HSOA 4GD3Q 5DLPA 1INLA 3GXBA 4FKZA 4HAUA 1X2EA 5FORA 4HS4A 5K03A 1E2MA 1TFRA 1OXVA 4QGHA 2QTZA 3AF4A 2XMRA 2FKAA 3PC8A 4KSYA 3ERCA 2OQRA 2ZBPA 3IYLW 1NFQA 3ED1A 4R41A 5I9MA 4Q9HA 5A4MS 1GPAA 1NX9A 1IM8A 4GXRA 1XD8A 4TN1A 3U0BA 5K05A 3ZYZA 3O1HB 3L05A 4ZCIA 3DZHA 3U19A 4U7TB 1RC8A 2VHCA 1Z63A 4C7JA 4KYUA 3RIMA 2FFRA 2QLFA 3EWNA 1WZIA 2A58A 3FTQA 3OU2A 1Q7GA 4TTAA 4EY3A 1Y7IA 1OBOA 3FVWA 4YECA 5LNK6 3HYRA 5DISB 2WIJA 2IW3A 4CQLA 3COYA 3O8OB 4H6WA 1OFGA 1VKOA 4EGAA 3HKDB 1MABB 2HA5A 3VJKA 4HX2A 2C1EA 4UM7A 3DCNA 1A27A 4LBZA 5EXDA 5IU6A 2C98A 3SSAA 4FDMA 1B3BA 2Z4SA 3VVMA 4EX7A 2ZAOA 1M2WA 2XT6A 4O4IB 1WA5A 5LP1A 3GFQA 2OZLB 2QK4A 1TB4A 4DLUA 2JZNA 3RS5A 1VCMA 4D8XA 4BQFA 5DBHX 2ZSJA 1R88A 3R7NA 1G20E 1JWLA 1AGRA 4UBJA 5FI0B 3THXB 3D02A 1JXOA 1R64A 2PZEA 5E8JA 5HIAA 3AR7A 3N86A 4JYPA 5EHIA 5K0LA 1AUVA 1RWPA 4PZLA 4YRGA 5BVHA 2Q5QA 4OHRA 4QATA 3RVRA 5KVSA 4DR2B 1KJYA 1QF6A 3TLGB 3AF2A 1NN0A 2JG3A 1HZZC 3WL7A 2WE8A 2Q2QA 1CUWA 1H4QA 5CFLA 2ZUTA 1U9IC 1CUVA 3KV3O 4Y2PA 3WOVA 3GVIA 4O4IF 1T6YA 2DFNA 3RK1A 4D0GA 1QFYA 3CN7A 4TYWA 5T3YA 4W6ZA 3SVLA 3LPLA 4WZBB 2NAPA 1PFGA 4L4UA 4DS3A 3B6JA 1W47A 2FSHA 4OBWA 1URPA 3KBBA 2ODTX 3LDUA 5IJ0B 5L7TA 3DUFB 1VG1A 2ZPTX 1H6CA 2YY7A 4DHWA 3AVTA 1D0IA 1NFFA 2FX5A 2X22A 1A8PA 1LPOA 4FFPA 3WLAA 4BLSA 4JC0A 1B6TA 1Y5IA 3ADPA 4M1TA 2NU8A 3VUEA 1PJ8A 2JBAB 5CYPA 3H5AA 4L2IB 3D43A 4GM0A 2OV6A 5KYXA 3TNDA 2ZIXA 1MA0A 3OFVA 1DMRA 2WVAA 1VE3A 4WNAA 5EXEA 1XTSA 2P6NA 1KZ1A 1OVMA 2XX3A 4N3BA 1I9CA 4JSTA 1JAHA 1TAQA 2OO7A 3RFUA 3GRFA 3U4HA 1P0PA 4G67A 4WADA 4I3GA 4O4JB 3IOEA 4WVFA 1PFQA 2PWBA 2V0NA 2EBUA 4YJ2B 2B6HA 2N1BA 3QWAA 2CL6X 1XWWA 1WOMA 3BQNB 5CNMA 4BDSA 1XK7A 5FOVA 3WI7A 3SPXA 1WXQA 4BNHA 3CLSD 5LVAA 3ZQ6A 3R76A 4ARZB 1QK5A 2M6LA 1W7AA 2E6UX 3N6XA 2YZ2A 4CHGA 3LLMA 3PRYA 1V96A 3ZR4B 4HT3B 2C2BA 3UWDA 1TUIA 2IDKA 4ZEWA 2O19A 3EFOA 3UFBA 2YHAA 4JP8A 1HDZA 1R5JA 5JALA 5IEBA 2POQX 1P2TA 4O4JF 1XMIA 4MWGA 4X54A 2IYTA 5EFOA 3BL8A 2VYNA 2ZRCA 3BSSA 3LBFA 2V98A 2GUGA 1I51A 4FI3F 4P93A 5DGXA 2GASA 5FBRB 1F48A 1CUYA 1D2RA 3FR8A 1BQ3A 4I9NA 3FDZB 1FP4A 4RGVA 2JFOA 1SVNA 3G49A 1FE8A 2Q2VA 2VWHA 1JQJC 4ODIA 1YRAA 5BN4B 3A4TA 3OZVA 1X1EA 3UJ3X 5FJIA 1N2IA 3GRUA 1QFSA 3NVDA 2R7MA 4E4TA 3P5SA <