3FYUA

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 115
structure length 317
sequence length 318
chains with identical sequence I
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuA00
5DYWA 4G9GA 2JGMA 1YB6A 4X3CA 5JARA 4Y2RA 1LPMA 2O2HA 5HQ3B 2XMZA 1MPXA 2C7BA 2WHPA 2Z5GA 2AJ8A 2HL6A 3F67A 1EB8A 5LZ5A 3R40A 3BF8A 5AKYA 5EHNA 3ANSA 4H7EA 1DINA 2YASA 5AKGA 1FFAA 1W6RA 4MXDA 3DCNA 2I3DA 5JAPA 4C4XA 1WB6A 1IZ8A 4WFJA 5D7BA 4FFWA 4UPDA 3H2GA 3WZLA 3G0IA 4P93A 4BRSA 2B9VA 3WK6A 5AKKA 1KEZA 1CUGA 2OCKA 1CQWA 1CUSA 3QMVA 4RE6A 4JEIA 2JGKA 5AI6A 3F8SA 1DX6A 3HYSA 3KWFA 5ALQA 3A70A 1VZ3A 2HU5A 2ZJFA 2GBCA 5CXXA 1Q0ZA 2JGFA 4RE5A 2WIKA 6YASA 4BE4A 5K3DA 3UMJA 3STUA 4C88A 1R9NA 1CUVA 2ONCA 4DSAA 2PSEA 3STYA 3WA6A 3G02A 4C6HA 1TIBA 2O2IA 1F6WA 2WIFA 1X70A 3D7RA 3C8HA 1QONA 4KYVA 3PUIA 4J0DA 4BDTA 4X00A 2PSFA 3PE6A 3LS2A 1XLVA 3RKSA 1CUAA 2HFKA 4G4IA 4Q34A 3MUOA 5EFZA 5KWJA 4UBIA 1ORWA 4MWTA 5HQ3A 5DYTA 1DQZA 4GECA 3G8YA 3BL8A 3UUFA 1TCBA 1JKMA 3DL7A 1AGYA 3QVMA 5C8ZA 5DNVA 3WLAA 5K3CA 1G4HA 2XUAA 2WUEA 4GWLA 1X2EA 1QO7A 4I3FA 3SWWA 1DQYA 2PX6A 3DS8A 5A6VA 4F21A 4W1RA 2OCGA 2DR0A 2BGNA 2WILA 3G0GA 3G0BA 4Y2SA 1F8UA 5CT5A 3WKAA 5T4EA 2RGUA 2PM8A 3RM3A 2HDWA 2PL5A 4PNZA 2IX9A 3SC2A 4G8DA 1DWPA 4H7DA 2VEOA 4DNQA 3QPDA 3FYUA 2DHEA 1RP1A 3CXUA 3D2CA 2PSJA 4F5ZA 3FYUB 4EHBA 4QE3A 1XZFA 2HA5A 2Z3WA 3TJMA 2OQVA 1VKHA 3TRDA 4FFVA 3SX4A 3WJ1A 5FP0A 4QWMA 4BCDA 2JEZA 5IH7A 5JIBA 5FDFA 2HM7A 3STXA 5JALA 3BDIA 4UHHA 3K2IA 2EDCA 3WWCA 4OB8A 2OCIA 5EI5A 1LGYA 1GT6A 1R4ZA 3I2JA 2WLSA 4X85A 3O4JA 5ALHA 4DLNA 2G5PA 1ODSA 2GZSA 1T2NA 1UKAA 3W06A 5LIPA 4XIIA 2XQGA 2WFLB 3IURA 4GI1A 3IBTA 1JJFA 3QBJA 1MX1A 1XLUA 2JEYA 3V1KA 1K6EA 3STTA 1WOMA 4KACA 4OD0A 3BJRA 1U2EA 5ALJA 1S8OA 4B9EA 4L0CA 1QJ4A 5D6OA 3AIMA 2XMCA 3H0CA 1CUDA 4MQLA 1N8SA 5CURA 3V48A 4GBGA 2XMDA 4CG3A 1QIJA 3JWEA 5AIAA 1AQLA 1CUZA 2XMSA 3RLIA 1LPBB 1MO2A 1K5PA 3H04A 2PSDA 3UUEA 3KSRA 5ALZA 2XLCA 4X97A 1DTEA 1U65A 4DNOA 1FJ2A 4Q1VA 2XUOA 3AIKA 1J07A 1BS9A 5JZSA 1VA5A 5A7FA 2FJ0A 1ZOIA 1HQDA 2B61A 3FWHA 1CUXA 4U2BA 2H9YA 4K2AA 4KAAA 5A7HA 4J7AA 3A2LA 3WIBA 1XQWA 1P0MA 4L72A 2UZ0A 3H17A 4X6YA 2H7CA 1ZD5A 4B85A 2FX5A 4MJ3A 1J1IA 1H2ZA 3BJMA 3MUNA 3H1BA 4QDUA 4GEGA 4X92A 3WK5A 4BCBA 4MYSA 3GA7A 1DT5A 3S8YA 4UBJA 1FFCA 4LXHA 4X93A 3K6KA 4DNPA 4C4ZA 5K3FA 2O7RA 2HU8A 4PW0A 5K3FB 3H1AA 4BZWA 5H3HA 4W1QA 3ZLVA 1EXWA 1B41A 5AOCA 4KE8A 3QITA 1UOPA 1Q84A 5FRDA 4HXGA 4BTLA 4IO0A 3WYNA 1ISPA 1QE3A 4Q05A 5ALYA 3WA7A 1A88A 2CBGA 1HPLA 5CRIA 3WKDA 2ZYSA 2D0DA 3A2NA 1BN6A 1JU4A 1QTIA 2GBFA 5AK5A 3I1YA 2PU5A 1EVQA 4Z49A 5IVIA 2GYUA 1WPXA 5ALSA 1BN7A 5AI5A 4OB6A 2GZRA 4PO3X 1P0QA 4J0KA 1Q0RA 4CI9A 4QDOA 4MQMA 3BIXA 1CIJA 5E4JA 5I9IA 3W05A 4B7ZA 3HLKA 4C01A 3EQ7A 2ROQA 3O4HA 4P9NA 2XUDA 2XUGA 5BOVA 5AK4A 3DOIA 4E46A 3VJMA 4IHAA 4FTWA 1BCSA 5AKJA 2XUKA 3B5EA 4EBBA 1EI9A 2QUBA 2HA4A 2H7XA 3A6ZA 1GQRA 2BGRA 3C5VA 2E3JA 4A5SA 3ED1A 4PQEA 4ZV7A 5C8XA 5C8VA 2ECFA 5JZ9A 2I3ZA 2V97A 3B12A 3FCXA 1YAHA 1XLWA 3VJKA 1MAHA 2V9ZA 4A23A 5JANA 2WU4A 2G5TA 3DKRA 3WZMA 4RGYA 2HA0A 4HAIA 1XRRA 2J3QA 1NU8A 1YA8A 4X7BA 4P92A 3HRHA 5ESRA 3ESAA 3H2HA 3LIIA 2RIPA 2R8BA 1UWCA 1P0PA 5AKHA 3EBLA 1XZAA 1WB4A 3M3DA 3RK4A 1P0IA 3EF3A 3QZUA 4X6XA 2HA7A 2HFJA 1CUIA 3W2TA 4W9RA 4O08A 4WCVA 3Q0TA 4IH9A 3WI7A 4XX1A 5CT4A 3DEAA 1BE0A 4CCYA 3SK0A 2ZYIA 1LZKA 2XUPA 4IH4A 3OG9A 1MN6A 1VJ5A 4G1FA 3NUZA 3LIPA 3GELA 4X90A 1IZ7A 3AZOA 5AM4A 1XZLA 1YA4A 2RHTA 4QNNA 1EB9A 1G5FA 2WFLA 1A8QA 5AI9A 3PF9A 4HRYA 4AXBA 4GW3A 3H2KA 4UUQA 3V1MA 3FVRA 1ACJA 1OILA 3IA2A 1JJBA 3NOXA 2OQIA 1M33A 3C70A 1MT3A 3ICVA 5F4ZA 3S2ZA 1SCIA 1XKLA 4H7FA 4G9EA 1VE6A 1XZDA 5C7YA 1Y7HA 4UBMA 3AINA 3FAKA 4BC0A 3PF8A 2XMQA 2WJ6A 3Q8WA 5FKJA 3C6XA 4AN1A 3QPAA 3FNBA 4ZGBA 1EINA 5K5EA 1G42A 4ITVA 4EY7A 1ZI8A 4QA9A 2WUFA 1QFSA 1LBTA 4W1PA 5ISMA 3DQZA 1E3QA 3E0XA 5IVDA 4LHEA 2AJCA 4Y2YA 2CZQA 3D4LA 5JAUA 3WWPA 5E4YA 2WJ4A 2CJPA 1QFMA 5AKZA 5JZBA 3CCBA 4OYYA 5HFNA 1ZD2P 2Q0XA 2BKLA 5ALUA 1QGED 4ARBA 3DDUA 4U2FA 4EB0A 5ALEA 3VVLA 2DHDA 4ROTA 5FPQA 2GBIA 2ZVDA 1BU8A 4BP9A 5FPPA 4UHFA 1YSCA 4C89A 1IUPA 4WY8A 2CMFA 5JD5A 4B84A 1XROA 4BP8A 1XRPA 2QTBA 2QT9A 1Q83A 2ZJ6A 3WK7A 1XZJA 4U2CA 4AN0A 2XLBA 1CUWA 2D5LA 5CMLA 4RNCA 1KU0A 1PV1A 3AJAA 4GXNA 4J03A 1UXOA 3FYTA 5ALNA 1DT3A 4E14A 1NU6A 3WWDA 4G4JA 4DYHA 2V98A 1CV2A 1O6GA 3QMMA 4TGLA 1CLEA 3H19A 1W75A 1DWOA 1MJ5A 1GPKA 5LZ7A 5C81A 5JATA 4FKBA 1XZIA 1RWQA 4K6GA 4DGQA 4UHDA 5LKRA 1C7IA 4N5IX 2NW6A 4BAUA 1XZKA 5D3KA 1FSSA 2JIDA 1QIIA 1JJIA 2HA2A 3R3WA 3YASA 4DIUA 2DQZA 1AKNA 3O9VA 4WDRA 3R41A 3BWXA 4JYPA 2WFZA 1L7QA 5DLPA 4H77A 2QRUA 3I2KA 3ZI7A 1EK2A 1IUOA 4QDXA 1HLGA 1Z68A 3GUUA 2XI4A 1TKRA 4B0PA 1GPNA 5FUMA 4AO7A 3WL7A 1CVLA 5CT6A 1AURA 2DCMA 3K9BA 2YXPX 1LLFA 2WIJA 2VATA 3AIOA 1GGVA 3ESCA 3MVEA 5BWBA 1E5TA 3M82A 3IUQA 2VAXA 1D07A 2QS9A 1CUUA 5AK6A 4S0XA 2XMBA 4KR0A 4E15A 4OPMA 1R3DA 3R3UA 3DL4A 3HJUA 3AUKA 3KXPA 3ZPXA 3H2JA 4J0IA 2OLEA 4L9AA 1CR6A 3QYJA 4OB7A 1R1DA 5AH0A 7YASA 3CN9A 2WKWA 3IUNA 1XRMA 3ESBA 1W52X 4N8EA 3C8DA 4H7HA 3NWOA 2V96A 3VXKA 1FFEA 5ALLA 2Y2VA 4IH1A 5AK3A 4BCCA 2GYVA 1LZLA 1XZMA 3W04A 4OUKX 4CG1A 1EDDA 1NX9A 3WL5A 4CCWA 5I7UA 2RAUA 4FLFA 3WMRA 4EY6A 5YASA 4ZREA 4H0CA 4XWGA 1Y7IA 2RHWA 5HFAA 3KOOA 3F97A 1SOMA 3U1TA 4AO8A 3QH4A 5LYYA 4FWBA 4FNGA 2HA3A 3A2MA 1WHSA 1OCEA 5AKLA 2BUCA 4B83A 2VAVA 4JNCA 1CUCA 2QOEA 3T4UA 5K3AA 2I78A 5BV7A 4Y2XA 4CIBA 2CKMA 1EA5A 3G9TA 1JT2A 4NS4A 3EIOA 1GKLA 3W9BA 3TGLA 2JGJA 1TK3A 5ALGA 4ARAA 4H7JA 2HHAA 1XRLA 5EIEA 3OC0A 3AFIA 3W9UA 2K2QB 2HADA 4TVKA 1TQHA 2WG2A 5FV4A 5AJHA 4Y2QA 5LKAA 4HS9A 3IUMA 2WIDA 2ES4A 1AX9A 4UBNA 5ALRA 4QZVA 4DTCA 5JYCA 1ODTC 4J3JA 2WIGA 3BF7A 1CUHA 3EQ8A 1CUEA 2Y1KA 2WQZA 1UT6A 2WTMA 2C4HA 5HK9A 4NVRA 3QMWA 2OGTA 1MU0A 1PJAA 1LPOA 1H23A 2XUFA 5CT9A 2QZPA 4FNMA 2DFPA 1JU3A 2PUHA 1QLWA 1C4XA 3O4GA 1TRHA 2R11A 4KE9A 1RYYA 4FMPA 1HBJA 1K63A 1J06A 1LPNA 2VQ6A 1QIKA 2QJRA 1ZJ4A 2QR5A 5JAHA 1ZD4A 1H22A 4U2EA 5CXUA 4AZ3A 1XQYA 4G4GA 4JYMA 1UK7A 4B82A 1ORVA 3AZQA 4X95A 4E11A 3R3ZA 1XFDA 3IVMA 1DWQA 1DX4A 1N5RA 1WB5A 1ZGBA 2X5XA 3KWJA 4H7IA 2C0PA 3WKCA 4OU5A 3AILA 5AOBA 2Z8ZA 1GQSA 2BUAA 4LIPD 3FBWA 5AM3A 1HDEA 4GDMA 3H18A 5LZ8A 3WQHA 5BWCA 1CUJA 1VXRA 3O9MA 1BCRA 5LLSA 3C6BA 2HRQA 5AM5A 5IVHA 1U8EA 1ZI6A 2ZYRA 1YAJA 4M0MA 3D2BA 1JFRA 1N1MA 1YR2A 4FLEA 3BDVA 2XUJA 1HKHA 1W1IA 3L1JA 3L1IA 1ZICA 2XUIA 4Y2JA 1XRQA 3WL8A 3DNMA 3HXKA 2FUKA 1FFDA 5DYYA 3EQ9A 4X94A 1O6FA 1LPSA 3M81A 4X71A 2PU7A 3NGMA 5KBYA 5FXMA 4Y2UA 4B0OA 4KRYA 4AMZA 4Y2TA 2WJ3A 1XZCA 1CQZA 4QLAA 3I6ZA 4OCZA 4CIAA 5AKEA 5HF8A 4GLBA 3U0VA 2Y6UA 5I8PA 1VA4A 1EDBA 3DOHA 1XKTA 4INZA 4J0CA 4KAFA 2PKYX 4AMYA 5JASA 5EHXA 3ZV7A 5ALDA 1UK9A 4C4YA 1QO9A 4FHZA 1UOQA 4UFOA 2B20A 1AZWA 5HF6A 5AI4A 2WHRA 1THTA 4PF1A 1YB7A 4FLMA 2BJHA 3R0VA 4IQ4A 4W1SA 4EA6A 2BAGA 2CB9A 3DKKA 4YK7A 1THGA 4FDMA 4HVTA 3O0DA 1GPLA 2OG1A 2ZSHA 1N5MA 2VJDA 2OPHA 1QOZA 3WWEA 4Y7DA 2HIHA 2C58A 4FOLA 5CH5A 5AM2A 4DNFA 2XB6A 3CCCA 4P08A 1U4NA 2GYWA 5ALTA 3JYHA 1SCQA 4KRXA 1XRNA 2G63A 4Y9SA 3STWA 3WK8A 5K3EA 4HXEB 5CH8A 3HEAA 2ZYHA 4ZXFA 4BZZA 1BRTA 1IMJA 2VTVA 3G7NA 4AZ0A 1YS1X 1SCKA 5KWIA 1AMNA 2BCEA 3D59A 2QVBA 4WFKA 3PFCA 4XVCA 2J4FA 1ODCA 3F96A 1AC5A 1GXSA 3FLEA 4ZI5A 5AIBA 2XT0A 1R88A 5AHXA 4BAZA 3B3QA 5A2GA 4EZIA 4GHWA 5AKIA 2C5FA 4BB0A 4LXGA 1LPPA 2WSLA 3FSGA 4J0GA 2WHPB 1XZEA 3G9ZA 2W22A 1UKCA 1BEZA 5AOAA 2ACEA 3F98A 5ALXA 1QIHA 4A16A 1WM1A 2PPLA 3GFFA 3HI4A 1E8DA 3DYVA 2VF2A 1H2XA 4H7KA 3DYIA 1FFBA 4EY4A 2VJBA 4I19A 1EHYA 5A62A 2Y2UA 3I2IA 4KAJA 4UBKA 4UBLA 4BYMA 5ALKA 5HKBA 1F0PA 2H1IA 1Y37A 5AM1A 2BFNA 2ORYA 1CRLA 5CH3A 5AO9A 1EVEA 3WKBA 4NZZA 4N8DA 4HRXA 3C5WP 5HKAA 4KJXA 4WDQA 3C6YA 4RPCA 4G8CA 3ILSA 4PV7A 4N8SA 5ALOA 4EY5A 4BC1A 2WU3A 4DMFA 2VT6A 1XZHA 1A7UA 2VJCA 1WHTA 1UK8A 5EGNA 3D2AA 1GZ7A 3FCYA 5EIHA 3D5EA 4JH0A 4UHEA 3VJLA 4KE7A 1ZIYA 2ACKA 1X2BA 2Z3ZA 4KEAA 5FOQA 5ALPA 1UK6A 4AX4A 1MNQA 2HU7A 1QIGA 3P2MA 1YASA 4WFIA 4M0EA 2IIVA 1TCAA 2Z8XA 4HTAA 3DLTA 3WK9A 2QMQA 4U2GA 2EDAA 2G4LA 3E3AA 2H7YA 2X8BA 1L7RA 1R9MA 5JAOA 4ZRDA 2HRRA 3D3NA 5HF5A 4B81A 1WPRA 5DTJA 5T4FA 2OGSA 4M0FA 5ALWA 4B6GA 1JI3A 2LIPA 3WL6A 2P8SA 3CN7A 4BRZA 5E4TA 3ESDA 3L1HA 4MWSA 2WG0A 3HZOA 2ZJ7A 3AZPA 2GBGA 3VISA 2OAGA 4X91A 4ZV9A 3QM1A 2WM2A 2RONA 4H18A 2J4CA 4K6HA 2X76A 2XQIA 4J0HA 1YS2X 2VSQA 5SYNA 2CUTA 4D9JA 5T4HA 3BIWA 4UFPA 1XQXA 4EY8A 1QIEA 1ZJ5A 4LXIA 1EX9A 4F0JA 5AI8A 5HF9A 3HABA 1JMYA 5HCUA 1VLQA 5DWDA 3BXPA 3STVA 3G0DA 2FJPA 3PFBA 3I2GA 4HZGA 3E4DA 3H2IA 1ACLA 1A8SA 3FVTA 4ZWNA 4DM7A 2JBWA 2O7VA 4BE9A 2C5GA 1B6GA 1UOOA 3T52A 4WY5A 2PSHA 1CFJA 3IB3A 4Q3OA 2AJDA 5KREA 4Q3LA 2CEKA 1OXMA 3GZJA 1LNSA 4L3WA 2HA6A 2DHCA 1HL7A 1T4MA 5IKXA 1CEXA 3FYUC 2XDWA 3IULA 5DNUA 4I4CA 3G9UA 4OYLA 1MAAA 3C43A 3V1LA 3I6MA 3E1GA 3M83A 3R3XA 1E89A 2ZSIA 2C0QA 2EEPA 1C7JA 1K8QA 2QXUA 3PDCA 1W76A 4MEAA 5CBKA 3WJ2A 5FLKA 4BTVA 5AM0A 5DJ5A 4TPKA 4KE6A 1J2EA 3OPMA 1MNAA 1UZAA 3JW8A 4K6KA 4BDSA 3FLAA 5LZ2A 2VJAA 5CT8A 2OCLA 4Y2PA 4FBLA 1YCDA 1W4LA 2DSNA 2PUJA 4EUSA 1H2YA 2XUQA 3OTQA 4QWWA 5EIAA 4W63A 4PSUA 3I2FA 1MTZA 2XUHA 5SYMA 3WKEA 1CUBA 2AXEA 3WIOA 2QJWA 4AO6A 4UBOA 1JMKC 2JF0A 3DJYA 3I28A 5DNWA 5JADA 5A7GA 4DMKA 2BUBA 2PBLA 4G5XA 1GKKA 4K5QA 3V1NA 4YX9A 4HXFB 4J0JA 3ZLTA 3WYDA 1K4YA 2JGIA 3HACA 1H2WA 2QXTA 5CTAA 2YYSA 4DSZA 3FLBA 5E2IA 3VKFA 1QIFA 5EHZA 1VOTA 1CUFA 3KDAA 4BVKA 5JD6A 4BVJA 1LBSA 4JUIA 5HK8A 3RARA 1VE7A 5HZGA 1E8MA 1ZD3A 4DMHA 1SFRA 4QDTA 3R3VA 2W6CX 3O95A 4Q3KA 3BE8A 2XMRA 1F0NA 3KD2A 5AI0A 4H35A 5J3JA 3VDXA 3LLCA 1TCCA 2YH2A 1L7AA 3V9AA 1CUYA 4LYDA 1E8NA 3C6ZA 5ALFA 2B4KA 2WHQA 5K3BA 4B9AA 5ALMA 1EDEA 1TAHA 3OURA 5ALIA 4UFNA 1AUOA 3G9XA 1A8UA 1ZGCA 2WG1A 2RI6A 2XQJA 1ZI9A 4AB1A 4F60A 5DTIA 1UFOA 3HSSA 2AJBA 4BATA 3DD5A 1XZBA 2XQKA 5CW2A 3PI6A 4YASA 4ETWA 3FOBA 1DU4A 3PUHA 4Q82A 5A71A 4U2DA 2WTNA 4PSCA 4WJLA 5AP9A 3OOSA 4UHCA 1SC9A 2Y6VA 2QM0A 1MX9A 3WK4A 1USWA 4V2IA 3QPCA 5LZ9A 5AKXA 4C87A 5IVKA 4PSDA 4BBZA 5ALVA 1UKBA 4OU4A 2O2GA 4CCYB 4BVLA 3TEJA 4MEBA 3ICWA 4CFSA 4AQDA 1XQVA 2WUDA 1ZIXA 5EHQA 4G8BA 4B80A 3D0KA 3GROA 3IDAA 3HC7A 4NMWA 4BAGA 3OM8A 3LCRA 2OAEA 1VXOA 1QIDA 3WWOA 4Y2VA 3VVMA 3R3YA 2OXEA 4YPVA 3N0TA 2PVSA 2JGEA 3C45A 1WCYA 3G0CA 2IITA 1IVYA 1EK1A 4LKOA 4LYEA 2XE4A 4DMCA 2DQYA 2QKYA 2OGZA 2I03A 4QLOA 1MX5A 5T4BA 2WUGA 5JD4A 3LP5A 1G66A 3IIIA 4CG2A 4QDZA 2VT7A 1BROA 3MGAA 1ETHA 3X3HA 3I6YA 3ZWQA 1I6WA 1R50A 3O4IA 1CPYA 3FSGD 1QTRA 1PFQA 1EH5A 1IUNA 1LPAB 3ZLUA 4OSEA 3GBSA 2J3DA 1BEEA 1XZGA 3ANTA 1QZ3A 4MYDA 4XJVA 5AICA 3I1IA 3N2ZB 1QIMA 3I2HA 5D3ZA 4N5HX 1KU6A 5LZ4A 3F9CA 5LP1A 3PICA 2JGLA 3C87A 2XMGA 4FBMA 2WFMA 2AJLI 1E66A 4X6UA 1VZ2A 4QEKA 2XQFA 2QUAA 3IUJA 2VA9A 4UHBA
chains in the Genus database with same CATH superfamily
1L8AA 3ZG6A 1G60A 1HNZB 5DTRA 1V8ZA 3AQIA 3F74A 5DYWA 3RJ9A 3VMMA 1PUJA 4XPIA 4MGKR 3ZHBA 2E0IA 5IUNC 1WBJB 4Y2RA 5JARA 1U0JA 3NKFA 1K3UB 3N7UA 4ACBA 4G0YA 4JI8B 1GTSA 3KOUA 2FLVA 4PTYA 5B64A 2QM8A 1ZLXA 1Z13A 1IVSA 4KO3S 5EJ8A 3DZFA 1YCHA 2DLCX 1Y98A 2FSUA 4CTOA 5HM8A 1AKRA 1Q2UA 3JX9A 2ZDGA 4MPRA 4OQEA 1A5TA 2AJ8A 3NI2A 4U2KA 5TB5A 2J3JA 2HL6A 2O2YA 3BG5A 4J9VA 4K05A 4AY3A 3F67A 3BGOS 4IIHA 1MOPA 4PLCA 4EFDA 2AOVA 3IPXA 1JKXA 5JE8A 2VQFB 1GTL1 4UM9B 3W2IA 2QAJA 3CB2A 1NG9A 3SIXA 3IH5A 1XU4A 3C24A 4DOMA 1RAIA 1NN3A 1U90A 1S2IA 5FAKA 1GUAA 3PUXA 4YRLA 3TOXA 1AHNA 1JEJA 3R6WA 2IOFK 2YWGA 2BP7B 2PAFA 3LUBA 4HLNA 4MXDA 1SHTX 4M1ZA 3KKLA 1T4DA 1DDOA 1SKQA 4BNYA 1FTWA 2QE6A 3KJHA 1XZPA 2AK3A 1DKLA 1ZNXA 2GEFA 2WBLC 2WJWA 3RSQA 3PC8C 3V1TC 5BYAA 3R3HA 4DWJA 3PD7A 1G3IA 3PT9A 4FHDA 1JXQA 1N7GA 3FETA 2BGTA 3TBFA 1XDWA 1ULUA 1R8XA 2ZIFA 4BRSA 2B9VA 3PPWA 5T7BA 2G04A 2PXAA 4R9NA 3VTAA 1KWGA 1PJRA 5AKKA 2D59A 3CEAA 3DEZA 2OCKA 4EJMA 2B2NA 4Q9KA 1MAUA 3PQ8A 3HJGA 4MCAA 5K0GA 5L3RA 2IP2A 4OATA 1V9LA 4JEIA 4Z9YA 1OREA 2NU8B 2CJWB 1P81A 4YJHB 3TRKA 4PVDA 3U0BA 1GTRA 4MUGA 2W8BA 3HKDB 4FN4A 4N5MA 5AI6A 4BFUA 5SY6A 1V43A 4J4TA 4WCFA 3MELA 4R1TA 4S2EA 5CM2Z 1SBCA 1VZ3A 4LZLA 2HU5A 4B2IA 1E3MA 2ZJFA 3KYBA 2C5EA 2EBHX 3RROA 3PGJA 1YDFA 5FAXA 3QEBZ 1R0BA 1CR4A 4WNCA 2FEAA 1FRZA 2PXCA 2ZKLA 3TFWA 3M2PA 4BP1A 3SXPA 1WZEA 1JH9A 3SAJA 3E22B 4CTNA 4NK5A 2GR9A 1AE1A 3S27A 5H80A 4OUDA 5K3DA 4YRDA 3WQQA 1MZPA 4GVPA 4MRAA 3STUA 4MUKA 4JXKA 2A1IA 5DBFA 2PSEA 3STYA 4DLVA 1N9KA 5KTOA 1U0HC 3LK7A 5K0BA 1L5ZA 2GWRA 5A3VA 2FW6A 2AQKA 2IU6A 3BHNA 1Q95A 3GUVA 3SHFA 1MFPA 2RDMA 4MRNA 2O2CA 2CDAA 2YIJA 4NFYA 1HDOA 3IJPA 4KH1A 2CZGA 1QONA 1YS9A 4UARA 4DWWA 2I6UA 1C30A 4KYVA 4P2GA 2GA9A 2R68A 1PSWA 5J2UB 5TMBA 3Q3CA 3SXJA 4J0DA 1RC8A 4IOJA 1K8XB 3WGHA 1IPFA 3S7ZA 3ZQJA 4J0FA 4GZ6A 4B34A 1DKMA 1CY6A 3E48A 1RFLA 3LS2A 4KQJA 1W6UA 2C94A 2EVWX 3KJQA 4BASA 5HJEA 4IGAA 1NZJA 4NQZA 2RKBA 5EFOA 4F3TA 1E2IA 1Z7GA 2HFKA 3QPWA 4G4IA 3MUOA 2Q5QA 4N3CA 4Z51A 3RS5A 4H1WA 1JEYA 5F64A 3MJ4A 1E1RA 3GN1A 5DNCA 5CHEA 1M6YA 1KORA 2P75A 5JZMA 1ORWA 4MWTA 1RMYA 1D9ZA 4HI0E 4R8MA 1QF7A 3ID6C 3OKAA 5E7MA 5LOVF 4Q7LA 1K7XB 3AU9A 1W47A 3A0RB 2BGMA 3PFFA 1DQZA 3KQKA 4YROA 4PYQA 4Z0TA 1NXQA 5C8YA 3BL8A 3WV5A 5JY1A 1TCBA 1JKMA 3DL7A 4UMFA 3D4BA 3AJ8A 4KGXA 1AGYA 4M76B 4MVJI 4RHTA 3V8VA 2NTEA 2ERXA 1UBTS 1M2KA 1VE9A 2P9CA 4BO3A 5BWNA 1P8AA 2IP1A 1SXQA 2AXQA 2VSOA 1GNLA 2REXB 1IZ9A 5JXGA 1WZIA 3E7FA 1QO7A 1X2EA 4GWLA 4OQ4A 4AYWA 3EEFA 4UVGA 2OCGA 1M2NA 2X4IA 4ALNA 1XRSB 2WK1A 3OJOA 3PQDA 4IGEA 1YHZA 3NC1C 3TR5A 3DLCA 3C8ZA 3G0GA 9ATCA 1PJTA 1ZUNB 1F8UA 1NFQA 1NXXA 3C6MA 2CLLB 3PHCA 3V1YA 2PGAA 3L7NA 1U3TA 1RZUA 2AXNA 3TYXA 3WKAA 4AF7A 4C7XA 1M1ZA 1OLUA 1P60A 3GZNA 4WASA 2WSSA 4LA4A 3B60A 2OK7A 1SIWA 5KX5A 3GT4A 2MIIA 1ES9A 3AKYA 1TD1A 4PNZA 4K26A 1E1RD 2QRMA 3JVIA 2IX9A 5KDLA 1U9IC 3WDMA 3ZV4A 1EHIA 3HB9A 3H8VA 3DFZA 4H7DA 2FSIA 4ZQIA 2VEOA 2P7HA 3DAGA 3H5IA 4PTZA 5FWAA 1ECBA 4IIUA 4RQTA 3FYUA 5KB3A 3DOUA 4ZARA 3W6UA 5KJFA 2PD3A 1B76A 2VBFA 2PSJA 5M04A 4UDYX 2J07A 1QRRA 3E70C 4JJFA 4QJBA 4EHBA 1YH3A 2QBYB 4WY2A 1OW3B 1UPUA 4EFLA 2HA5A 2Z2JA 1YDEA 3P5SA 4GXRA 3TJMA 3LE8A 3OCCA 2EFYA 1G5RA 4AUMA 3DHVA 2OQVA 4DQVA 3ABOB 2DRIA 2FZVA 4QNRA 4MIKA 3QUCA 2B30A 3TRDA 3JAKA 4ME6A 3PG5A 5CB0A 2MYNA 3IQIX 3ICEA 3Q6NA 5LMCA 4KVZA 1ZH8A 2WNHA 2C95A 2GN6A 3RAEC 5HR5A 4FKZA 1J90A 1MMFB 2QQFA 2JEZA 4DWOA 4DHEA 5C80A 4Q16A 3IAS1 3K9GA 5CVVA 2OYCA 3UWDA 4EDFA 2YIMA 3U4AA 4D6YA 2C5LA 2XQVA 4EX6A 5FDFA 2FEKA 1GPYA 3S81A 1X1TA 2WSIA 3BFKA 3BH6A 3HYLA 4I4TA 4PTLA 4DRYA 3TZLA 2WAMA 2FB9A 2BEJA 2IXDA 2E4WA 5IJ0A 2ZAMA 5DK6A 1CNEA 5JS7A 3P9KA 3I9OA 4HEA6 3QSYA 2Q07A 1MKYA 5FX2A 3OD5A 4ZVQA 1M76A 3QIAA 2Q50A 1DJQA 3ZE0B 4R7TA 1FQJA 2HSEA 3LHFA 5MN5A 1SCNE 5HOEA 2LP4Y 3I2JA 4LSZA 1X3SA 3JR7A 1FF9A 4JR0A 5ALHA 4QUHA 3RLIA 4DIEA 1SUAA 4DLNA 2GERA 4DL9A 3HCWA 1HT1E 4KO4S 3TPFA 1HO3A 1J1ZA 3SM9A 4EHFA 4GZMA 1ILWA 5AJXA 3F3YA 1M2JA 2YRFA 3R23A 4ENUA 3QNMA 3EUFA 5L7TA 1MPTA 4DV1B 4RTMA 3W06A 5EIBD 1N5LA 4GM0A 4Z4HA 2QZ4A 5JNWA 3GN2A 2WAYA 1I94B 4FGZA 4XIIA 4CUKA 3AHHA 3IDSA 2OO3A 1PKEA 1G20E 3E9DA 3FCEA 3IURA 3L6OO 3QVTA 4FKMA 4LJ7A 3AHIA 2BBOA 1GPMA 3BGWA 4GI1A 1N3IA 4NI5A 3UJPA 1ESDA 1HTTA 1RS0A 3CZ9A 4CMIA 4HAWA 5DXAA 1ZGAA 3MPOA 3OQ1A 1D3AA 4RVSA 1GL3A 3ZBUA 1XLUA 4HATA 2N9UA 2B36A 4URXR 4X20A 4DUZB 4CQNA 3WJAA 3GJQA 3S40A 1FA9A 1TEVA 2WWFA 1K6EA 2FAXA 3LL7A 1O2DA 3STTA 4PAWA 3EEOA 4K9LA 2IQ5A 2PUEA 1BE1A 2ZJAA 4KACA 1IQUA 5B3AA 1G9XA 4OD0A 2B98A 3IT1A 3WGVA 1V8FA 3PHLA 3BJRA 3U7RA 3JWJA 4YJHA 3BD6A 4GL4A 3PIDA 5BMVA 2WTUA 1TYAE 1GR0A 3B7PA 1LDNA 3RU7A 3NNNA 4M22A 4A7PA 4TWRA 3P27A 2ZZNA 4A0QA 5J5CA 1NPDA 3AWDA 1W8IA 1WZUA 5EMHA 3AYZB 3PDIA 2Y27A 3S2IA 2ZQ5A 5TV2A 4Y1GA 1RD4A 3U7EB 1QV7A 3F6BX 1IATA 2XMDA 4GBGA 2C3UA 4QOIA 2IWRA 2XKAA 3JWEA 1ORRA 1NKVA 1RU3A 4C3UA 2BDEA 2VUHB 1U0TA 2P9FA 5AVYA 3AVPA 2IU4A 2W58A 5KU1A 3OO1A 1JBEA 3RVDA 1GVNB 1ETUA 1QYCA 1QR2A 3H04A 5EJ2A 1QYIA 3QYPA 1C1DB 3I9MA 1CEEA 4A8JA 1BQ3A 4X97A 4DBLE 3JY6A 1J2RA 1T5LA 4NAUA 4QOEA 4DNOA 3VR5D 1M2OB 1N2HA 1BJTA 3X0DA 1ACMA 1IN1A 5EIOA 1R4NA 5CA0F 3D6NB 3H9QA 2PUFA 3E7XA 1FBTA 4XFDA 4Q1VA 4OA5A 1YD7A 4XH9B 2PG3A 3EEIA 3OEED 2PUTA 4P5EA 5ELMA 1L7DA 3AIKA 5CBPA 3VR6H 5FWYA 1J07A 1XAGA 3O8BA 4YA6A 3AFOA 2EARA 1Z26A 4P98A 1C9YA 2OORC 2CNWD 2Q1SA 3M4YA 4FOSA 5KCMA 3NM4A 3H4TA 1WF6A 1XJCA 2XRMA 3A1UA 3I5UA 4R05A 1FIUA 1SZCA 5JCPA 3TE6A 3WLTA 3A06A 5BN5A 3SF8B 1DIAA 1J0DA 4K2AA 2VF7A 4NBVA 4BIMA 5A7HA 1MO5A 1A5AB 2DWPA 3K1TA 1Q3TA 2UXCB 4HUQA 2O6HA 1B73A 3ZDQA 1ADCA 1V1JA 3VM6A 3NXKA 4IJUA 3HCDA 4O8CA 3E03A 3AR5A 1QK4A 2PZLA 4PQYA 4K9QA 5BOSB 5JCJD 2YW9A 3MCVA 5KSOA 4L72A 1ABEA 1L1EA 3RRJA 4OTZA 5TEVA 1HXHA 4X6YA 4Q21A 4TYNA 1LBHA 4MW1A 4GPBA 3UJ9A 2QT0A 2H7CA 3RF6A 4L5JA 3HDVA 2KS6A 3QIVA 5J63A 1T36B 2YKGA 1J1IA 4OP3A 3COYA 3H1BA 3X1XA 3N70A 3KQQA 3HSYA 3DGEC 4Q03A 3IO5A 1W73A 3AFGA 1JIJA 3I9JA 4GR4A 4MYSA 3MS4A 2PMDA 1SG9A 3H9CA 3ZI4A 4ZZIA 3GA7A 1N1EA 5C8YF 4NXNB 3VOTA 2H5LA 3QKRB 2XWJI 5FUYA 4DLKA 4UEOA 4EPTA 3WHPA 4DUPA 1ZMBA 3FTCA 4WESA 1UJ4A 2W4IA 1FFCA 1XKQA 2BCJQ 4TXHA 3OFSA 4LDZA 4RD1A 4UC0A 5BY2A 3K6KA 4BLPA 4E5UA 3LVFO 1I51A 1J00A 4YBZA 4MJ7A 1CZRA 2PQ6A 3DC2A 3IUSA 1EXVA 4C4ZA 1YVEI 2OC9A 4TVSA 2CFRA 2GCOA 3K96A 3SS9X 2HU8A 3WGLA 2PT7A 3CVXA 1ENOA 1P2VA 3F7TA 3DZJA 4MMXB 3MIZA 2I6GA 1R6DA 2XE8A 4HGRA 4M49A 4MUAA 4OQFA 3OTGA 4K8OA 2AFRA 4ADSG 6Q21A 5BQPA 1RC0A 2QQ5A 3KOXA 3M6WA 4WXMA 4X1OA 2VDUE 2W4QA 2XCLA 4I9FA 5T6BA 3M3PA 3W5IA 4EO4A 2PUBA 1SD1A 2QN7A 3HA3A 2WJYA 4ACAA 2IH4A 2GLUA 5AOCA 3NIGB 3NIWA 5FRDA 5E9AA 2AGVA 3R76A 4G5RA 1CBUA 2RAVA 5DX8A 4DMGA 3R9WA 1DAHA 1V7ZA 2DTEA 2H1LA 4K81B 2COEA 4HXGA 4BU0A 2IZ5A 1BHQ1 1JPVA 4FZRA 3TZKA 4IXTA 2VDWA 2I7DA 3DZIA 1H66A 4F4DA 3BXXA 3TKAA 4DCPA 1DEXA 1V11A 2OK8A 3A31A 3COVA 2YCBA 2C0CA 1P2FA 1QE3A 4DCOA 5GV8A 3E58A 1YZGA 4CPDA 3G1TA 1E1NA 1F8XA 1X7WB 4DCCA 2QTRA 2IH2A 3RSZA 1A88A 1E2JA 1HPLA 3R75A 5L3QB 1UT5A 2FPGA 3A4YA 1NF9A 3HCFA 1MEOA 2J45A 2RH9B 2D0DA 1UH5A 5JPDA 5IJ0B 1YS6A 3JQCA 3SJZA 3LTEA 2ADOA 4MAMA 1G8SA 2GFQA 2NSYA 3B7GA 1WDWB 1U0EA 2BE9A 2IXAA 2JJMA 3KVYA 2G4CA 3IQZA 3ENWA 5EZ5A 4EI7A 1YNOA 4PCUA 3WIDA 5JAIA 4LRQA 1VKOA 1UKVY 3SHVA 1QTIA 4Z9FA 2GBFA 1S3GA 3ZXYA 1NL3A 1C80A 3GQVA 3KUCA 4MITA 2PU5A 3DUWA 3OZSA 2EJVA 4G5GA 4N5LA 1OV6A 1HLPA 3VZPA 1DKNA 3IE2A 1NR7A 2VQ3A 4OGFA 4RTPA 3W5HA 2IEGA 1WZ2A 3GEPA 4C9BA 2XRZA 2OBNA 2GYUA 1RC1A 5DHAA 2DLNA 4ZVKA 3DKPA 2KSQA 4WZAA 1GUDA 2X7XA 1ABFA 1BN7A 1OZFA 1E7RA 1TJYA 1XSEA 4MMYB 2Q6IA 1E2UA 1XYGA 1ZK2A 1MO4A 3HFGA 4K1XA 5DSTA 2VJNA 3NBYC 3TQTA 4LFBB 2C5SA 1BX1A 4IGIA 1FK8A 3DG9A 5EZYB 4BMCA 1CIJA 2OYRA 5U9CA 5E4JA 3D6JA 5C1PA 2J5QA 3T3EA 5BMOA 4FYVA 1FP4B 5BSVA 3X1YA 5HIJA 4C01A 1Y3HA 2HMAA 4UU7A 4S24A 1JGTA 5GINE 4FOPA 4RKRA 2XUDA 2V45A 3FWKA 4RFLA 4BO6A 4FGSA 1SCAA 4FIZA 4R8VA 2PLRA 4FFRA 4LBZA 3ZQ6A 2EFGA 3LNCA 4HWPA 1ESNA 4B74A 4CMHA 4E46A 3Q12A 1WXGA 3FM9A 3BE6A 3CUYA 4I5IA 4S1TA 4PXSA 4ZQBA 1PKXA 1II8B 4YAIA 1WABA 3E15A 2CN1A 1NP7A 1XJ0A 2QNIA 2ZTMA 5DW0A 2Y1DA 5LL6P 3DEYX 1RYNA 5CDFE 5DGDA 3AHEA 3ASYA 2VNJA 3CW2A 3E82A 3GGGA 3MWJA 4KW7A 2PA0A 3UPDA 4BB9A 4DJJA 1Z73A 1EZZA 1QYRA 2AT1A 3FPKA 2F9FA 4QTXA 1P9RA 3OF2A 5TF4A 4AAYA 3MJHA 4YRGA 5AVTA 5JJLA 2M6SA 1BGXT 1NMYA 1XA4A 1UMDB 1E0KA 1BXGB 3F3SA 2B8NA 3MILA 1Q91A 4B3RB 1G8HA 2AF4C 2YHIB 4RTNA 1JKFA 4A5SA 3KTAA 3TE7A 5KNBA 1LW7A 1V39A 2Y1GA 3GY0A 2ECFA 4E1BA 4Q4JB 3ZVMA 4AQ7A 1P9WA 1VHWA 3T0IA 2C3YA 3OE1A 2PMEA 3AVVA 4XRRA 3JZIA 3FNEA 3PEEA 3LQQA 4U6QA 3SNHA 5A6SB 4MQBA 4Y1EA 3V4LA 3VJKA 1ML4A 3K20A 4E07A 3L93A 3OT1B 1FY2A 5EPEA 1ZVQA 1EM6A 2C97A 2YS6A 5IZ4A 1P19A 1US8B 1X9IA 1CP2A 3DKRA 1ZX1A 4BFWA 4RGYA 2JJ1D 4HAIA 2J3QA 4NFHA 4WZBE 1G41A 1OROA 3TFQA 1QJCA 2CUZA 4IMPA 4A82A 4ZVVA 4AMUA 4BO0A 4X7BA 2XNDD 4JI2B 4IFIA 1U8TA 4CLEA 2IYLD 1K86A 4RFSA 4C04A 3F0TA 2P78A 2ZUBA 1A8HA 4JUBA 4DKJA 3ICOA 4ER6A 3TGWA 2VJLA 3H2HA 8ADHA 1QVWA 2HJSA 2RIPA 3CNLA 3L0IB 1WXQA 1EGHA 1WKVA 4KWIA 3KTFA 3OMLA 1CE8A 1UWCA 4TKMA 4FVTA 4CKZA 5IVPA 4LC9A 3ZZNA 1INLA 2HB6A 2JAWA 3EBLA 4UAGA 4NCXA 4ALMA 1VCNA 1WB4A 3DTYA 5KWVA 1FRVA 3HWSA 4YAFA 3UMYA 4M8KA 2PTGA 4XTRA 4D5EA 4DPKA 2LXNA 3FKSA 4RMGA 3T3PB 4KBFA 3MMNA 5D3MB 1BXRB 3TR0A 4DV5B 1FNBA 3W2TA 2PXHA 5F78A 4O08A 2UU9B 4EG1A 2HBZA 2KX7A 3O94A 1ML3A 4WCVA 1ZVMA 1UPBA 4IH9A 1Z28A 1JAIA 3IIMA 1UDRA 3QG1A 4NF2A 4YJ3A 1S7GA 1KWKA 3I32A 1TO2E 2HEIA 1CY0A 4KFRA 5LQKA 3SOZA 3RIMA 5CT4A 2VBGA 3D6FA 4KLCA 4RK5A 1RXSA 5JMWA 3NBZC 4P3PA 4XM1A 5AW9A 3NHYA 3C1OA 2E82A 1MB2A 3ADPA 2X13A 1SG6A 2O3TA 4HXYA 4F6RB 2XUPA 1XNRB 2NTNA 1SELA 3HR4A 1BDJA 3LQ4A 4N0EA 3V6LA 1HT3A 3OG9A 4QU9A 2BC9A 1CHNA 3WDKA 5J2TA 3ZE8A 4G1FA 2V5AA 4KVAA 3NUZA 3LIPA 5A4IS 1Q44A 1S2LA 1PHRA 2NO6A 3FNIA 3S99A 4X90A 3HR7A 4JQCA 3IRVA 4QNMA 3W90A 1U63A 1NDUA 1JFFB 4JELA 3V2UA 1YA4A 5K03A 3L46A 1SKYB 1W0KD 1G5FA 4OJTA 4WERA 3E61A 4J2OA 4QRHA 5H59A 3P9CA 2JIBA 4ENQA 2PTHA 4RDCA 5DRYA 3AM1A 2VHVA 1QLHA 1NR5A 1NQWA 4PGMA 3B3JA 3CZ5A 1UXIA 2PFKA 3FYHA 5HIIA 1G5HA 3SEQA 1OILA 1MB3A 2YMMA 3RJMA 1ZUWA 2RGAA 3L0CA 4YJFA 1JJBA 1BGWA 1UBSB 3KSBC 3NOXA 1TT5A 2YZ2A 4GM1A 3EF1A 2V6FA 3JQBA 4MA5A 1WMDA 1YZLA 1UWLA 2VSXA 3G59A 4XZ3A 1CVIA 3ICVA 1RXWA 5H5JA 2CNOA 1CFZA 3EDYA 3FSJX 5ELLA 2GM3A 1NFFA 5CNJA 3ITDA 1FDVA 3BZUA 4MV5A 4ZI3A 4ID3A 5B7GA 4CU5A 5JRJA 2VK1A 2YHSA 3EOBI 4BNKA 1AA6A 1NYQA 1VE6A 4MGZR 4FEEA 2WQ7A 2AG6A 1JUDA 1XZDA 1K06A 1U1FA 4AKEA 5C7YA 5HBGA 3OZBA 4UBMA 4QYIB 3R9KA 5GJBA 3KR2A 2XD9A 5K01A 4BC0A 4EHAA 3M34A 3PNSA 1WUKS 1WULS 3D7MA 4Z8YA 4HDQB 4TLLB 4E30A 2FE4A 3GGJA 2B99A 2XMQA 2JHCA 2ZXFA 3A28A 3AM3A 3DPSA 3V8MA 3RRMA 5JRDS 3NM6B 2EL9A 1JPJA 5AXBA 1RBMA 1TPZA 2C00A 4HYEA 4BEJA 4N0DA 2OHVA 2V1XA 2IP4A 3KT6A 3LQKA 5TQVA 5KTTA 5HG0A 3OO0A 1U99A 1DJMA 4OXIA 1CF2O 4TWBA 1U98A 3W3AA 2BHNA 1QHYA 1CQIA 2V6BA 3G49A 3MT7A 4MKRA 1EINA 3OJCA 1V11B 1MJGM 2E4UA 1G42A 1P4RA 5DM2A 1SY7A 3TAHA 1ZI8A 4NNJA 5C0OE 3VTFA 4B3GA 3FE2A 3BC1A 2WUFA 3PV0A 4R9RA 2PWAA 1JA1A 4M9UA 4I8IA 5I9BA 3EMKA 3DQZA 1P5RA 1W4AA 1E3QA 3NHBA 4EI9A 5C8DA 3C1UA 1K97A 5J5AA 5EQJB 4OBEA 3E0XA 4G0UA 4H3HB 2M2IA 1U7TA 4U4AA 1X7ZB 1YUNA 2NADA 4WD3A 1UQUA 1FDRA 2E5LB 3MOGA 2NU6B 4LHEA 1CRQA 1Z2EA 3WADA 3UV6A 1EU1A 1RJEA 2YZMA 3D4LA 1JH8A 3DP9A 4N41A 1ZRSA 5E4YA 2B34A 1FDOA 1ZXLA 1ENPA 4S2UA 4JNKA 1F14A 5J9FA 3ZEIA 3H2BA 4PAMA 2FWJA 4XQ0A 3QWIA 5AKZA 5JZBA 1QZTA 3TZ6A 4LECA 1K8ZB 4O4JB 4LJKA 4V2UA 4UVIA 3BE4A 1OYOA 5HFNA 5ERXA 4YX9A 4NICA 4F9EA 1G21B 3AUTA 1AV6A 3HU5A 1F6BA 3H75A 5DWVA 2Q0XA 1VSUA 1O94A 1O87A 2GAFA 2HEGA 2JI4A 3E84A 1YDHA 1UF9A 1VG8A 3PPXA 3IJ5A 1FVXA 4ZHSA 1VL1A 1O97C 3HHEA 3OTWA 2OG2A 3PHIA 2APJA 1TQ2A 4NJMA 1E1QD 5ALEA 1GQOA 2ZKIA 3T9EA 2Q6OA 1C3OB 2F3UA 2NUTB 2QUKA 3L3BA 4ZCTA 3NTQA 3JSAA 1DIGA 1GQFA 5DFAA 4BO5A 2CV2A 2BMAA 4HMPA 5CVDA 3DO8A 5F2OA 4XJSA 1WHSB 1KH1A 3EXEB 4UE6A 1CVRA 3T4PA 1OLSB 5CX1B 1QBGA 4UHFA 2JARA 5BSWA 3DXXA 5BNZA 2OBXA 2G6BA 3DWFA 2OHHA 3RC8A 3QK7A 2OZPA 1Z0JA 5F3DA 5BUZA 1Z15A 1ARZA 1DAEA 3ETDA 1DHTA 4TV8A 1XROA 521PA 4BP8A 4DDWA 4Q39A 1U0SY 4KO2S 1BFKA 1TTPB 2HK8A 4MPDA 1JTFA 2GGSA 1V8PA 5B1IA 2QZSA 5JPCA 4LJAA 2FMHA 2ZR8A 4M53A 1L7NA 2J9ZB 2C4UA 2QT9A 1NGSA 1Q83A 1RQLA 1XZJA 3C97A 3G6WA 2XLBA 3T94A 3UQYS 1RMQA 2BR3A 3SM3A 2EJTA 4GI5A 3ND7A 1Q1ZA 5FI3A 2BDUA 4C30A 1PV1A 2EF1A 3JWPA 2L69A 4GXNA 3CIOA 4HRVA 2VYQA 5SV2A 3FYTA 4O4LB 3PNLA 2ZOSA 2ZTVA 1DT3A 2BI4A 5HKOA 2H5JA 2ZT5A 4Q3DA 1FMTA 3RHFA 3PT5A 1OMOA 3D3WA 3DMGA 1NU6A 2WP8J 4RY8A 1OGIA 2OV2A 1G64A 4CW7A 1LLUA 4LRTB 1O9HA 3QMMA 1SHZA 2RI0A 3MC1A 3ZX4A 1JSZA 1S02A 2AQHA 2XVYA 2Q7XA 1Y7TA 3AHFA 3H19A 3PIRA 3AVTA 3F6PA 1F2DA 1MJ5A 3UKJA 4BN0A 3QEAZ 4MWBA 3HYRA 6REQB 1DAOA 3T8YA 1XMOB 3EA5A 1Z63A 4O4IA 4X62B 5K8UA 4KN9S 3KZVA 3UO8B 4PFJA 1QGUA 1B0PA 4UHDA 1XCLA 2BF7A 3BMOA 2BHRA 2Z9CA 2NW6A 4M1EA 4N5IX 2FG6C 1YZFA 4MS3A 4ALLA 4XYGA 1PEKE 4B35A 1XZKA 3FOWA 2FMFA 4KODA 5D3KA 5KQLA 3V46A 1CYEA 1FSSA 2OESA 1KR5A 2C8LA 2O3UA 2QI9F 4RENA 1QIIA 5LB2A 3RTGA 5A9SA 1UMKA 5LM3A 2ECOA 4HGOA 1QRSA 3TNJA 3Q5GA 3IP1A 4KXXA 3EVGA 3HGMA 1FB5A 1W4BA 2Y1OA 3F5SA 2D2VA 3PUZA 4MICA 3YASA 5A0FA 2FK8A 2GM5A 2YQ4A 2HMVA 4G0OA 5BRNA 4GUAA 1KH3A 1U28A 3IR5A 3SLGA 1EG7A 1IEXA 2A58A 4D6XA 4DIUA 2V5UA 4EG7A 3C7AA 2FVXA 3SIRA 4ZMRA 4I50B 3EVDA 4RK0A 1XXHB 1RM0A 3F8TA 4ZEXA 3BWXA 4C76A 2C54A 3QUAA 4XWAA 3SBXA 2BGUA 2B4TO 1YCGA 3DTVD 3P7MA 4G67A 5EG5A 4D9BA 5C1DA 3RAGA 1I2CA 3JTEA 3I2KA 4UUAA 1A1VA 5CB4B 1EMDA 2PY6A 3K0AA 2IVZA 5DHTA 4FW9A 1P72A 3SDBA 2P4EA 4PRKA 1Z68A 1QAMA 1K66A 1WDTA 1UOEA 3SPXA 4L78A 2GKGA 1TKRA 1XNJA 1B2RA 3B1KA 5TJHA 1M6HA 2Z57A 1L5QA 4NV3A 3K35A 1G2IA 3IERA 3A9UA 3NB0A 4HQ6A 3ZHVA 1AURA 4NYMR 5ADVA 4DV2B 3KZOA 4HPXB 2YXPX 4AMVA 3HEMA 1CR2A 3KCNA 1JE1A 4GQBA 2CZCA 2Z56A 3EW9A 2HHHB 1LKZA 4RLHA 2CCKA 4MW5A 1RJGA 4CMIB 4NZMA 3F46A 4I2VA 2UZAA 4L5AA 4O2BB 3U3DA 3WL4A 4TYQA 1N0VC 2VTBA 5BW8A 1Y42X 1AG9A 1S1MA 3CNQS 2VIIA 3LY5A 5HILA 4CR7A 5H8WA 3T7AA 1OZAA 3EZ2A 2EZ8A 5KDDA 1L7BA 4IV0A 3ZK8A 2EXXA 3IBFA 2X7HA 3QUSA 3S44A 4KR0A 3D1LA 1GV0A 4OPMA 4RGQA 1S6YA 1ZRNA 2ZUTA 1M9NA 3EVFA 1B0AA 3DUFB 4MROA 2P3LA 2VJKA 3I72A 3KR9A 3BXOA 4PHHA 4BVBA 1Y3BE 1FQWA 2V55B 3OLVA 1A9PA 1SWVA 2HW8A 4JIGA 2UVDA 3CO5A 2A59A 2FPMA 3H2JA 2CSXA 3OP4A 2BM0A 1EEXB 1LFDB 4C6RA 1U2GA 4R54A 3HB4X 1K88A 1YRAA 3JQAA 5BQFA 1TW2A 4JOQA 4Z4IA 1VIMA 2WB2A 3S8MA 4Y3UA 3QYJA 1K4KA 2GFHA 5A4JA 4F5EA 1R1DA 3DVAB 1J8MF 5AH0A 2YZ7A 5TX7A 2ZE5A 4AG5A 1X7GA 4NDAA 2IY7A 3IUNA 1XRMA 1KVRA 4F1JA 3QWFA 1T2DA 1QQBA 3PDHA 4PLGA 3AESA 3GB9A 1WSWA 3NKLA 5LXTF 3EVCA 3LG2A 5HXAA 4PSAA 5CFOA 1XTIA 3I8OA 4RANA 2ZPAA 4HFMA 1VLVA 2V96A 5H68A 2CYBA 2GXUA 3OCWA 4GQAA 5ECYA 2D1SA 3WZ2A 4L02A 5AUOB 2IHNA 5I51A 3PYMA 2PJRA 3EZXA 1XP5A 4Q7KA 3LX6A 4Y6OA 4Q4LA 4C6SA 4DR2B 2H1CA 4NONA 2IIPA 1J09A 2E89A 4CMAA 5E7QA 1NC1A 3BS4A 2HC9A 4KN6A 5EIBC 3W04A 5DNDA 1L4MA 1BDBA 1R5OA 2GDJA 2X9VA 2XDQA 3BXZA 4KLNA 4MVWA 5BYBA 1NX9A 3A10A 1HYBA 4TLAA 2ODAA 2P6PA 1XQ1A 2FRDC 1Z2PX 1NURA 3WGYA 2R96A 1QG4A 3I04M 3Q3VA 4NBUA 2VAPA 4ZO8A 3VR0A 3OIYA 2PZGA 1OU4A 1L8QA 3IE0A 1RBYA 1DV1A 1W5SA 4MVCA 4Y30A 2R1ZA 3G68A 4XYBA 3WNQA 4QATA 5IKPA 2J9FB 4N6GA 5KQMA 1YZYA 3OQNA 1MJHA 1H8ED 1Y6RA 4NG4A 3UT5B 4H0CA 1UBEA 4XWGA 3BD8A 2ZJBA 2J9FA 4MW0A 4ZJUA 2WTAA 1J0BA 4OLBA 2WJPA 1YR9A 4DXHA 3FAZA 3KOOA 4IZHA 4XEUA 5EUQB 4D80A 1SOMA 3C0KA 3UAVA 5JNSA 2ZETA 5K6AC 4AO8A 3QH4A 4GC9A 4IW3B 4F85A 3U16A 2FFJA 1VJRA 1ZH0A 1KXJA 2W83A 4FNGA 1UM8A 4Q7MB 1N0WA 3EGEA 1CY8A 4P22A 1SUBA 2H2FA 3AI1A 3FKQA 4KTTE 2OA0A 3AUAA 1A5SB 3FZQA 4P86A 1IIBA 1Y48E 2JVKA 4C7JA 3DHEA 1M10A 4WEQA 4B83A 2QVGA 4CIXA 5CYGA 1W25A 4JUAA 4JNCA 5FJIA 1NQVA 4A8JC 2VXCA 3WLRA 2UUBB 1ISMA 5CB4A 3C5HA 3KNZA 2IXEA 3OCUA 5ABPA 3B2EA 2Q1UA 4Y2XA 1COWA 1XEAA 3QOXA 3RYFB 1BOOA 2GBLA 4G5QA 2FRXA 3WGMA 5AVKA 4D02A 1JU9A 2RBKA 5KYTA 1IG0A 4F38A 4NS4A 3DT8A 1NRJB 3PXDA 3THSA 3EIOA 4BB6A 4GP6A 4QT0A 3CISA 3BX1A 2CHFA 4HY3A 1FXSA 4LV8B 3DAFA 3UK7A 4L9RA 1RLJA 2QORA 3DDHA 4U7DA 1Z8HA 3CLUD 1FDSA 2HHAA 2ENUA 4H7JA 3INGA 3QKRA 2AI1A 3ZDEA 5EYPB 3FMOB 1YI0A 2IEDA 6CHYA 4ZCSA 2V7QD 2QZJA 2WT8A 3CBQA 4U7GA 1TKAA 5DHFA 3R8CA 3SLKA 5LQRA 1PGPA 1H9BA 3MCTA 3W9UA 2R9VA 4Q1BA 3EG9B 1YR3A 4DXDA 4RF5A 2W2QA 5KHAA 1PW7A 4J8PA 2QN9A 3RRZA 4QUGA 1T5HX 1H2AS 1QE0A 1XTRA 2VPIA 3GWZA 2Z8YA 3LUAA 5AJHA 4B43A 1RQ7A 1WRBA 4X60A 2DB3A 2IYWA 3IAM1 4QGFA 2WF7A 1VCOA 4Y2QA 3CKLA 3QG5A 2ERCA 4K40A 5LKAA 5JJCA 3DZHA 5EHGA 1ZJZA 4LMRA 3IUMA 3QKIA 2WIDA 3OIVA 4KQXA 3GL9A 5CJ2A 1YHNA 3EHDA 1DBSA 4LQ4A 2YFQA 1GN9A 1O6CA 2XRYA 3GO4A 2YHUA 4MPJA 5JEDA 3BF7A 4TVBA 3UATA 1JTVA 4H4EA 4ZAVA 1PD0A 1MX3A 1O3YA 3E9MA 1DUSA 2VP4A 4NOJA 4TWJA 5HK9A 2JIOA 1RRCA 1YZTA 3NBFA 4K9MA 3JXEA 1P3DA 4NVRA 1PSZA 1L5LA 3GLFB 3I5XA 4BIIA 1V9SA 2PS3A 3WBJA 4D0NA 2X4DA 3GMDA 3U31A 1OB5A 2C7OA 1KERA 3NP7A 3ZDCA 3H1GA 3G5UA 4MYUA 3CRQA 3R1IA 3HUFA 4J16C 4IVQA 1M7BA 4TL9A 1I0ZA 1FLAA 5CLLA 1N5OX 2XDYA 4ZDWA 3CEJA 4G1CA 2IV3A 1P91A 3CMCO 2I9PA 3O2QB 3X1WA 1SJ9A 3IP3A 1VC2A 1V5GA 5CA1F 5IYZB 1XD8A 3B1JA 1XXHA 1DC8A 2RGBA 4H1VA 1QF9A 3E2PA 1I2BA 1N92A 1VRVA 4CMEA 3EPKA 1JU3A 1PBTA 3AOGA 2D4AA 1Z0ZA 2Q3DA 1V71A 1JAHA 4LQDA 1TRHA 3RO7A 2UVPB 1GQYA 1EFUA 1EFVA 2GQ0A 3N0VA 3LVRE 2A78A 4DPLA 3NHKA 3U7FB 3R77A 1NJ6A 1Y34E 4FMPA 1HBJA 1K63A 1C29B 2XADA 4PLHA 3WISA 4Y2GA 1SB9A 1KAGA 5A02A 3OZAA 3KZMA 4ONEA 1ZJ4A 1SKUA 2QR5A 1TVKB 4TN1A 2V3CC 2J0EA 1Q5PA 3ITKA 4XSGA 1LUAA 3ZE2B 3OKFA 3C3KA 1U3GA 4TKUA 1ZD4A 3AHJA 4AMBA 4C5AA 1WBBA 5ERGB 4ZXPA 4NRDA 1P1BA 3ZKWB 5LA6F 1FP4A 4GLFA 1O95D 1UK7A 2XRFA 1GRRA 2JZOA 1YKFA 3OJXA 4K87A 2VTDA 4D0RA 3MF4A 4IJWA 3AZQA 4X95A 1Q22A 2AOUB 1OYYA 1U6KA 3S28A 4DANA 2GWHA 3M6IA 2BPOA 3IVMA 1N5RA 1DX4A 2E4YA 3EVZA 2X5XA 1K7CA 2C0PA 3LXRA 4MKFA 4TLMB 1QH9A 2PWYA 1FDIA 3A1VA 3CSDA 1W581 3AILA 2Z8ZA 1GQSA 4H1UA 2FZLA 3OM9A 3FBWA 3P45A 2G5GX 1IJFA 1OAOC 1MABB 3EYAA 3HB0A 1M34B 2LIVA 2GJ9A 4RJJA 4XLLA 4I5DA 4ZANA 1SHLA 5JAQA 2ZROA 3EZFA 3KKOA 1GKUB 2VXYA 3B36A 2W9XA 3NVAA 3O9MA 4KXFB 1IOLA 1BCRA 1T2EA 5JJBA 2AR9A 3PTLA 2EKZA 3IVXA 4QREA 1MC8A 3V8QA 3RUFA 3OOJA 3H0EA 4G0XA 3W2EA 5JXHA 4OX9Y 4FI3C 4H7IA 4U3JB 1JIVA 4ZT3A 5ED4A 4KLZA 5EEHA 2O8BA 2ZYRA 1O4WA 4WK6A 3QLTA 1EFCA 1GYPA 1PT7A 3L06A 4HNAB 5MFZA 3D2BA 2DBVO 2IY9A 4YAKA 1DP4A 3PXAA 3KJNA 5IDXA 5EWJB 1UINA 4PQGA 1E3SA 2OLKA 3CUSA 4GSYA 2XHZA 1Y5IA 1RIFA 3FWYA 2WZQA 2PMCA 4N12A 4Q4AB 4ND6A 4KGZA 4E2XA 4F2HA 3U44B 1QBKC 1JIQA 3M1LA 1RRKA 2JLBA 4KHZA 2JATA 4Z4EA 1JXOA 1STOA 3BFPA 4CM9A 3PFHA 1H9CA 1ZHOA 1C7RA 2FWIA 2FZEA 5JMTA 2PZKA 5I9SA 2AC7A 3ZV6A 2VRCA 4PYRA 1KDVA 4MIOA 3HJHA 1Z6GA 3GZNB 4G4SO 1W1IA 2JB9A 1NMXA 1DKRA 1E77A 3PUKA 3R0JA 2CLCX 2XSZD 2PBFA 4RORA 4E5MA 3AVXA 5H1YA 3C3XA 3W1EA 2PRZA 4HZUA 3DOJA 4KQKA 3T7KA 1X9HA 3KOYA 4QG3A 4ZQGA 4EM6A 1GCIA 4R9SA 3U62A 3UGKA 4D41A 3RABA 3GV0A 1E96A 4HAUA 1NIJA 1NLZA 3KXIA 5C35A 3T3NA 2ZAGA 3S0JA 1BKSB 5K7SA 4F9TA 4CKCB 1IM2A 4EX7A 3MJSA 2PQ2A 4X94A 1W36D 4QVIA 1D7OA 3AL3A 3MTDA 2WJVA 4MOWA 5KMGB 3NGMA 1CE8B 2NXEA 3DVLA 1ZCBA 2FP4A 2XD4A 3WOHA 1I7QB 3U6BA 2R7AA 2X15A 3ST7A 3GLFA 4CBVA 1NI3A 1Q7TA 1RJDA 3HUDA 4GOOD 6ABPA 1ZH2A 2ILVA 2G06A 5G0VA 2A1UA 1UDXA 2R6ZA 3ZDZB 1KFJB 4J0EA 2VL7A 4AMZA 3ABQB 4OHXA 1M74A 2IEIA 3OZFA 1CU1A 1ZXBA 1IN5A 4XWTA 4G2NA 3PFWO 2A3NA 4CIAA 2BH2A 1ZD1A 2PT5A 4PC2A 3QQ5A 4XPIB 4Z0HO 1EHCA 3R24A 4AP9A 4ZYXA 5BVHB 2GZDA 4F6CA 2VYNA 2VZ9A 1EK0A 1EGVB 2CVOA 3M6LA 3UMBA 3ZY5A 1Y63A 4IIBA 2BRUC 3ZHSA 2QD1A 3JQ9C 3SZOA 5EHXA 5JDCA 3F90A 2IOHA 3ZJ4A 3ZV7A 2C59A 4TL6A 1NVVR 3QUTA 1QRTA 1T3LA 2V4UA 3DHWC 1UEXC 2PFGA 4HWSA 3EC1A 4MJLA 4WOCA 5B6IA 5C5DA 1SHKA 1CDDA 4TM8A 4WAUA 1UOQA 3V42A 5L4SA 2GPSA 3AXSA 4LV5B 3MWYW 4UM5A 5HBRA 4U1RA 3LUKA 2B20A 4P0QB 2TYSB 3P5BA 5DGIA 4ZALA 2Z8YM 3W3AH 5DTQA 3M1IA 3NOQA 3ZOKA 4HH4A 1GNVA 3U13A 4MI3A 3A05A 4YV0A 5EE1A 3H86A 2O8FA 2WHRA 4K88A 1F2UA 4GUDA 3OCVA 1ZM9A 4PF1A 1O58A 3FZYA 4IDQA 4C14A 5MDHA 3IR7A 4FBGA 3N8DA 4FLMA 3RC9A 3OOYA 1EX7A 2PYIA 2ZIXA 3KXDA 3DA8A 3TK1A 3WLQA 4M1QA 4B75A 3DZBA 4W1SA 2HSZA 2ZB4A 2QLMA 3KP1A 4BGEA 2VQEB 5LD2B 3WLIA 2G4VA 2CB9A 1D2CA 1NWCA 5IK2A 1GUFA 4HVTA 2OG1A 4R1LA 1BMFD 3OLYA 3TVDA 1V3VA 4MKIA 7GPBA 3RVSA 4BXOB 1N5MA 2VJDA 2G9ZA 2QF7A 3CQ9A 3EOAI 1E2LA 2JIZA 1G1MA 3EFHA 4IZOA 4LJSA 1HT2E 1U0OC 3NGXA 5FUXA 1KZYC 3PC6A 4ZZ3A 4N82A 4O25A 3ZHYA 2W2LA 1ECGA 4JUDX 5CH5A 4RK1A 2B92A 3RE1A 4U7FA 1FNNA 1X1EA 5ARBA 3WYEA 3L7DA 5AM2A 3LDFA 2X1MA 2UZ4A 2RD2A 2QLJA 2YYAA 3ZBPA 5KTPA 1P1FA 1WNFA 2R8XA 2FR8C 4Z99A 3VPBA 2XYGA 5IU6A 3F7MA 4CQMB 2C88A 4QUJA 1U4NA 4BNUA 4EJ0A 1D0IA 1R2QA 2GYWA 3ETGA 4MRMA 4A2PA 4A10A 2HI0A 1M5TA 2I6XA 3JYHA 4N03A 5BN4A 1XELA 4KB5A 4ZI2A 3UICA 3ZY4A 1KYVA 4FHCA 3M9XA 1SCQA 2XWQA 4R1MA 3PJGA 1YGYA 2MU1A 4FD3A 4BLWA 2ZSKA 1YV9A 1XRNA 1PR2A 4IMIB 4CKXA 2GEDA 2HMYB 1XMQB 2EOAA 2QTGA 2X9GA 1H4TA 4BX3A 1Z7EA 2E6KA 4OHBA 1H8HD 9MHTA 4F96A 4F91B 1HYQA 5L6LB 2HNAA 4HXEB 3OIFA 4XIGS 1UR5A 1QM5A 2Q3LA 2ZYHA 3LMKA 1SIOA 3ZW8A 4BZZA 1JZSA 1N8TA 1W2WB 1CIPA 1BRTA 2WT4A 3L1VA 5CLIA 2W2OA 3HH8A 3B5IA 4IDAA 3W7VA 1YS1X 5KWIA 4IHQA 4D9MA 1XKXA 2F1JA 3MERA 5EKTA 5C31A 1JIUA 2PH5A 3VU1A 4DAEA 6PFKA 4QD3A 3AR4A 2ISCA 5E8JA 2C1EA 1Z2CA 2ABWA 2B6HA 3ZD9A 3ZGOA 3VOBA 2YV3A 1AC5A 1E2HA 3AFMA 3O90A 2UZIR 4OQMA 5DRTA 4YP1A 1NONA 4OHCA 2XT0A 4LV6A 3GJ3A 4Q7EA 1R88A 2JFWA 3KB1A 3LW7A 3MGGA 5AHXA 4Q3AA 1M0SA 3HZRA 2WIBA 3B3QA 3OLCX 2P9YA 3FWPA 3K6RA 2RCNA 3QVXA 4M1SA 4DEYA 5CG2A 5SY4A 3ZGVA 3JS5A 4FR0A 1SD2A 1JNXX 2R8ZA 4D79A 1Q7BA 2VDPB 1RNLA 4LXGA 1YIAA 3C41J 4J0GA 1AOXA 3CONA 2WHPB 3JZMA 3OF5A 4JYZA 3RHZA 1N77A 5JSZB 3DMPA 1OVGA 2DGDA 3LVBA 5AVOA 3WMGA 1BQEA 2H9IA 1ULTA 3UWSA 3R09A 1Z6YA 5CFPA 4KXUA 2EKDA 3HNPA 2Y1FA 1TVEA 1W36B 4MUIA 1HOTA 1U8UA 1H69A 2V4MA 4XASA 2PPLA 3NT4A 3W4KA 3GFFA 4A16A 3DYVA 3K1AA 2X0IA 1JT9A 4JL6A 4YP9A 1OH6A 3DYIA 4PSVA 4EY4A 2VJBA 2GLXA 4I19A 3H8WA 1ZDMA 4OYHA 2Y2UA 4EPWA 4W9MC 1QP0A 3I2IA 2BOVA 4YUVA 3TINA 3UG7A 4PZCA 1GGFA 2WHEA 3KO8A 4DRXB 4KAJA 2G40A 3CY6A 3I0ZA 3K94A 4ZQCB 1QYXA 2Q8PA 4UBKA 4YI5A 1FMCA 5LDDC 4D9HA 821PA 4ZO7A 3TJZA 5ALKA 4FMCF 3FDFA 1L5GB 3GUCA 4GKJB 4BJHB 1IVNA 2IPOA 1PN3A 3FSEA 4FYXA 2X6RA 2ORYA 3JAWB 3O3OB 3ZWOA 3DMDA 2XF8A 1FFYA 3WKBA 3OZ7A 5KSZA 1MOQA 2ZSFA 4Z3DA 4HB2A 1P7CA 2AFIE 2IEZA 4QAQA 1BFDA 1T3HA 2PEYA 4QM6A 3E8MA 3WVNA 2WAAA 3SFVA 3RYHA 4KJXA 1U3CA 3I1FA 3C6YA 3KDSE 1W34A 4G8CA 1VL0A 2XEDA 4PV7A 2BYTA 1HG1A 1HT0A 2ZVPX 3ZKAA 4ZO6A 1JDVA 3QHAA 1KE2A 1L6IA 1FP6A 1DC6A 3QSGA 1BDIA 2DPLA 2WU3A 3OCXA 2GZHA 3AF6A 1T5DX 1ZA1A 2ICAA 2WJIA 2W2XA 1HFEL 1VJGA 1OFTA 1KJIA 3GGSA 4N3BA 4UKDA 3VYRB 1NY5A 1UK8A 3BL6A 3D2AA 2ZSDA 3IOMA 3PJEA 1JIKA 3FCYA 5EGNA 4C2AA 4D1YA 1FNSA 1SRRA 5TQJA 1MQAA 3VJLA 4F06A 2CXPA 2VDNB 4M46A 4N40A 3U1BA 1ZIYA 1ZSVA 2ACKA 2ZDHA 3ML1A 1N7IA 1MJNA 1PK7A 1YBAA 3H6GA 4BQFA 3F49S 4YMUA 4HBGA 2NYUA 3Q0IA 1ECLA 3H1FA 1D1TA 4MSUA 5CVEA 5FOQA 1PFYA 3I58A 5EJGA 5D84A 1ZOPA 1UK6A 4PIMA 1DRJA 1WX1A 4V24A 4LZWA 5ALPA 4F97A 1MNQA 2HU7A 2HRBA 2QDKA 4HNSA 4LCJA 1NVDA 3WMFA 5H82A 4LC1A 3P2MA 2GPJA 5LR6A 5G40A 2B83A 2UVPA 2I34A 1TZJA 1CY7A 2RGRA 1X1CA 3QRWA 4CM5A 2ZUEA 4X8OA 3WK9A 2VPZA 1VFNA 4CN8A 1MIHA 1WS6A 4M6WB 2NZVG 4QXPA 3PC2A 1L7RA 2LD4A 2P8JA 3B7WA 3MFQA 3GFQA 1PQUA 2R8YA 4EJSC 4ZRDA 2ZP1A 3HS3A 5KNCA 5A1TA 1BWSA 2P69A 1FMJA 3SKXA 4CF6A 2I22A 1Z0KA 2VUSA 3M89A 1P3JA 4DIDA 4YRKA 1NVXQ 1OJLA 2LCFA 1WPRA 5T4FA 2XHEA 3OF3A 4DR4B 1GZ6A 4B6GA 1NF8A 2IXFA 1JI3A 2F62A 2LIPA 1I3CA 2ID8A 4NJEB 4YJ2A 4NHEA 4HD8A 3CN7A 2XZOA 3ZCVA 2YR0A 4V0MA 4BRZA 4DCGA 2IKSA 3AEYA 3TL6A 1M6VA 2UUOA 5AXCA 1F48A 2JFHA 2JH3A 3I9NA 1P1HA 2IY8A 3CU5A 4HQRA 2WQ6A 2DFKB 4UU1A 3HZOA 5TS2A 2Z0MA 5HKKA 3AZPA 1PEDA 5KS2A 3MTIA 2XJ9A 4X91A 2BVNA 5K8CA 1ZHHA 1BSVA 2WM2A 3JVUA 2WF9A 1A98A 2IBMA 5EVCA 4ZT7A 4EG8A 4W8GA 1XZNA 1N2JA 1SK8A 3A6FA 3PP8A 2CNDA 4K6HA 1QS0B 2DBZA 1NW6A 2VPYA 4IFBA 3PCRB 5IUKC 3S70A 1UL1X 1KMHB 1ZVJA 2VR1A 2C9YA 1ECJA 4XIJA 1U8XX 1JJ7A 3B53X 1RXCA 2VSQA 2HT1A 2D1TA 3INRA 4CKWB 1YQXA 2FN7A 3QELA 1XPJA 4D9JA 4ZYUA 4IS3A 2OHXA 10MHA 2A5YB 3UJDA 1NIPA 4F2PA 1DXQA 1WU8A 3G0OA 1Y9AA 2D1YA 3DFMA 4HH1A 4PC7A 4CQMA 5BMVB 3Q8MA 3ONNA 1WF3A 2CLDX 1QIEA 4UM9D 4BOYA 4QTYA 2CSUA 1JECA 3D6VA 3IKLA 3IKJA 3O0TA 4XQGA 3S6JA 3RANA 4IVNA 5AI8A 4TTQA 5HF9A 1Y5RA 4NL4H 3T12A 4GRAA 3HABA 2SKCA 4B3XA 1EJBA 3ICQB 2ZSAA 2IJGX 5HCUA 3DMFA 1CS0A 2FGJA 4XQEA 4L2IA 2W2KA 2J08A 4E31A 4Q3CA 3AHCA 5K2MA 4G5OA 5BVGA 4O63O 3T7IA 1O1YA 4LI0A 5EXTA 1AKMA 2OHOA 1U0BB 4ZEVA 3SVTA 3BXPA 3VGPA 4LSGA 1U8AA 3SC4A 4OK5A 2VS1A 2IVFA 2OSVA 3VO2A 1I0LA 5B2ZA 2WV9A 2VNAA 4G01B 4O0LA 1W88B 4G56A 2AMLA 3E4DA 1P61B 2ZRGA 4HCJA 4AZVA 1RACA 2UKDA 2IYZA 5DH9A 2WWHA 1Z5WA 2FMIA 2FUEA 4XYLA 3QNWA 4LHSA 4YR7A 1G63A 1XTUA 1WUYA 1GQ2A 4KI7A 2ECPA 3P2OA 5IJ9A 3T34A 1KYXA 1EZ4A 1JWBB 4PO1A 3OU6A 1YMUA 4YRJA 4N3GA 3ABIA 4JEMA 3TW4A 3K72B 3JRWA 3BBPA 3HBNA 4HVAA 1KJ9A 5IXSA 4PGAA 4ZA2A 1JEOA 5JZVA 1XVUA 1CFJA 2AOXA 4Q3OA 4YCMA 5TPZA 4IJ5A 4D0GA 1I2AA 3H42B 1DJLA 1LRLA 3GPCA 3KT3A 1WR8A 4Q3LA 4RS3A 5AXAA 4R0VA 5LWQA 1SUDA 2G0TA 1LNSA 2VJMA 2BZSA 1NVEA 4L3WA 5BXYA 5JNVA 3I37X 5GWXA 5C4GB 1DCKA 1VL6A 4AN4A 4B32A 5C5IA 3BIOA 2X1VA 3ONVA 1N0HA 4K9RA 3GLFE 2H8GA 1FNCA 4LMBA 5CFLA 3AG6A 1NT4A 1GLNA 3Q40A 1KY3A 1SH7A 4OQXA 3GW8A 4UXIA 1IJEA 2BY4A 4QYSA 4R69A 2AEMA 2PSSA 3IO3A 2VXOA 4U00A 4YJFB 1BYIA 2PZMA 1PQWA 2EP5A 3KUXA 3NORA 2C8JA 2FMKA 2ECKA 1HSOA 3I5MA 1WDMA 1J9EA 3NAZA 1FVHA 1X38A 2FW9A 3DNFA 4IG4A 4ZMSA 2O59A 3AJEA 4DDKA 2AYXA 4NSNA 1CR1A 3ZEAA 3VUFA 3A4NA 3JR3A 3M83A 1N2BA 2Y77A 4HLCA 5K3OA 2ZR7A 2A0UA 1SXIA 2AZDA 1USIA 3ACDA 3V7YA 5T67A 3V8NA 4F12A 1YZVA 1R9JA 4CVNA 3ELYA 1AXEA 3C3JA 4NOKA 2DG2A 2NWQA 4P31A 5AVUA 4FWTA 4PSKA 1T35A 2C7PA 4X20B 1K8QA 2GCGA 3AVOA 1SPXA 2B8TA 3AIIA 3OEWA 4JU9A 3RLFA 3L8CA 3E3OA 1U2QA 4MWCA 4QT4A 1QG0A 2PJZA 1RMTA 3JAWA 3NUQA 5CYFA 5TQ2B 4BTVA 1U1CA 5AM0A 2RFLA 5DJ5A 3MSCA 3QX3A 1JBKA 4R2LA 4TPKA 3WRXC 4KE6A 1SUSA 2GK6A 4MKXA 4L16A 2J8ZA 1LVGA 1CY2A 4BDSA 1YZQA 4B4VA 4ZN6A 5C46F 4QRDA 5DU2A 3R5KA 2V7VA 4UTPA 3FLAA 4DC9A 2HHJA 2WTEA 4XWKA 5KJ1A 2I3BA 3GVPA 5LZ2A 1HX7A 2VJAA 1ZMRA 4W8OA 4NBNA 3HVIA 4PLVA 5M3BA 2DECA 4AJIA 5HOQA 3KQMA 4L4ZA 5DM4A 1PJ4A 3M5DA 2QPOA 4W63A 4MI1A 2XT6A 3GBVA 2XMPA 3O8RA 3CEPB 3QMPA 1MTZA 3QU2A 4TZ0A 3PQ6A 3HJFA 1IJBA 4DZRA 3O4FA 3OOEA 5EAIA 1QRDA 4WRRA 4C0LA 3GQBA 3TIFA 3JARB 4F56A 3RU3A 1OD6A 3WIOA 2QJWA 3QX7A 4JGIA 4RPIA 4DV7B 1BRMA 4LSMA 3UMVA 2A5JA 4RFSB 4LXQA 4UBOA 4EF5A 1PR9A 4MPPA 2Q4EA 3GBPA 4BMYA 1LU9A 2QGZA 4FDUA 3KQOA 2ZYTX 3U1VA 1Q1EA 3V97A 3DSRA 3NBUA 4IQ0A 3TAXA 5JJIA 5JSFA 1YB1A 3BSWA 3GEIA 2W90A 3VA7A 1FMLA 2NVUA 2EJWA 4MWGA 4HMOA 1OI4A 1T10A 1V2HE 2GD1O 3K73O 3A25A 3V00A 2AI2A 3HUUA 4BX2A 3CR3C 4QC2A 3NYWA 3VR6A 1NNSA 3ZLTA 1XLTA 2JL1A 1V5WA 3O8CA 1M2WA 2FHSA 2HT6A 1GZ5A 5ARCA 3ZIAD 1G59A 1VRCA 5CTAA 3AVYA 2YJ4A 4YMHA 1YTLA 2JHGA 5E2IA 1LLQA 4LE1A 4R5MA 1OPRA 2YV4A 5J23A 3EMBA 4K9OA 3KDAA 1P44A 1JWLA 3N75A 3IQWA 1O95A 2ZXEA 4Q12A 4JZYA 4RXUA 2DH5A 3KYJB 1NQ5A 1YVUA 1E8MA 3QX9A 4JP3A 1ZD3A 3DO6A 4HFJA 1Y6GA 3Q3JB 1T1RA 4GM4A 2O48X 3R3VA 1WKBA 1ID8A 3OHMA 3W4IA 2NUTA 4OMFG 4Y9UA 4ALKA 1QS0A 3K16A 5JNLA 1OWOA 2JCSA 4W5QA 3BE8A 4G86A 1F0NA 1JKJB 4KXQA 2P2LA 4U9UA 3V3KA 4XD2A 1Q19A 2H2DA 1N7JA 5J3JA 1UBNA 2ZPTX 2ZT8A 3KV3O 3QYFA 1IWBB 4Y18A 2A5GA 1TCCA 2VYVD 4JJGA 3R9XB 1TM7E 1PG2A 5J2UF 3V9AA 2A33A 1QYWA 4UAJA 5LU9A 4W7IA 4RF4A 4RF2A 2OHGA 5INTA 4LYDA 5T6MA 4RD4A 3DE0X 3C6ZA 1RXYA 2PNJA 1I1QB 3JQ8A 3OICA 4LVOA 1N5IA 4P84A 4WK4B 4EFMA 5BSMA 2VDRB 4ZYVA 3P4YA 2Q1TA 2I7VA 3IQEA 3IBSA 4H60A 1N8NA 1C50A 2HK6A 3BQ9A 3WY9A 4B9AA 4COKA 3PEWA 3PTZA 5A6SA 1Y3DE 1TAHA 4OO3A 4J3FA 3L7YA 2QLTA 5D5QA 4WXHA 4EG0A 4MUYA 3L92A 4H0FA 5HRAA 5E6RA 4UFNA 5BN1A 3G9XA 3CMMA 3AETB 3HCBA 4BKUA 3EXFB 2XY4A 4MKZA 3DOFA 3IPLA 2WG1A 3O8NA 1J0CA 1NNEA 3LCCA 1EVIA 4PBTA 2RI6A 2XQJA 3Q2KA 3ORRA 2OM6A 3MJTA 2Q5OA 3F5MA 3AV0B 1F6DA 1OT5A 1Z0AA 4RIIA 1GOTA 3PNQA 5DTIA 3L0ZA 2JIQA 1W85B 1YO6A 1T9GS 4IF4A 2VHWA 2GNOA 4UATA 4BATA 3DD5A 4XDZA 3AUUA 1NE7A 3ROZA 3PI6A 4YASA 4M36A 1Z6ZA 3D2LA 3FOBA 4EIWA 1DU4A 1NXOA 1RRMA 2B7BA 2ST1A 1HNXB 3L9WA 1P2UA 3OIDA 3FHJA 4Q7QA 1L4GA 4DABA 4DJFC 3B1FA 2G1KA 4GGMX 4E6PA 2V7BA 3TSYA 4BO1A 2Z2IA 2MSCB 4B6RA 1MTOA 1GDTA 3ELDA 1YRQA 1P8JA 1PYDA 4CV1A 1JAXA 1NN1A 1JEEA 2Y6VA 2PIAA 3GVCA 2BFFB 5ERYA 1JHXA 2FSGA 4ZDJA 1MX9A 1XHLA 4UD2A 1USWA 1J5XA 1GRNA 4MULA 4QHTA 4V2IA 3K2QA 4OYRA 2ZJ3A 3K1JA 2HR1A 3DLAA 4DFDA 5LZ9A 3LY7A 1N6NA 2JANA 2XNSA 1VHDA 1HYHA 2WB4A 2VZ8A 3GG2A 3LKBA 1UKBA 4OU4A 2O2GA 4PSDA 1ZP6A 4ZYTA 1QTQA 4UTXA 2X3UA 1E2EA 4HB0A 3EZYA 2WY2D 3AI3A 1UJ2A 5LQCA 1UDBA 2IHVA 5I9TA 3AP2A 4MEBA 4AJLA 2XGMA 2YN4A 4EW2A 3FCCA 4GBED 3DF9A 3RSOA 3RAJA 4C3OB 1WXEA 1XQVA 1T6ZA 4R41A 3CHYA 1AN0A 1Z34A 2C04A 1ZIXA 2I4LA 3SQNA 1COWD 4TV9F 5KWSA 3T3MB 1N2OA 2CK3D 2MTBA 5A4AA 1ATZA 4PN7A 1XWIA 4ZO9A 3JD0A 4QOHA 1MBZA 5EJIA 1V8BA 2DU8A 3CNEA 1I5RA 3IDAA 3LL4A 4NMWA 4RPHA 2F1KA 1ADFA 3OSUA 3Q41A 1SCDA 4FJ1A 4K9NA 4Y0AA 5I6DA 3QLUA 1VXOA 2EZUA 3AM4A 2X1HA 3WWOA 1YOVA 2BEUA 2Z2ZA 3HGQA 3N8IA 1SULA 3G2IA 1SXHA 4KRFA 1QR6A 4RY9A 2OXEA 2XNHA 3N0TA 4RTSA 2CHVA 3UTCA 1QFJA 3Q9UA 3CZCA 4JB0A 3ZIDA 1WCYA 2E9SA 2R7MA 2PS0A 4MW4A 5TC4A 1JS1X 4UOQA 3SQDA 1E18A 2PKWA 3A1FA 3SLRA 1VP9A 1IVYA 2FEPA 3CNNA 1C1YA 1H9AA 4YRQA 4D8TA 4ENTA 1Y33E 5E6SB 1JG2A 4LKOA 2Q3FA 2RG7A 3ASZA 3DBHB 4GPAA 4POAA 3DYBA 4YBRA 5IKOA 5E6SA 1AO3A 4D3FA 4B1FA 2I03A 3GJ8A 1M8JA 2P1RA 4G6ZA 3UTDA 4BKOA 4KBGA 3FUTA 4NYJQ 5DO9A 2DLDA 4HQOA 1D1QA 5GP1A 2PD4A 2QTZA 3H5VA 1AK2A 3LP5A 5K3SA 3EHEA 1PT8A 3LBYA 3WIEA 3TD6A