3FYUA

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
b'MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 115
structure length 317
sequence length 318
chains with identical sequence I
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuA00
1MN6A 5EIHA 2WIJA 4X6XA 4W1RA 5T4HA 5K3BA 2CBGA 5LZ2A 2RGUA 5HF6A 4M0MA 4MWSA 2J4FA 4C89A 4J0IA 1GQRA 4YK7A 4DIUA 1VOTA 3VJMA 1E8DA 3C6YA 4ARBA 2Z5GA 1GKLA 3R3WA 2VEOA 5EIEA 3N2ZB 3HLKA 1UWCA 3OM8A 3R3ZA 1K63A 4KE8A 4WDQA 1ODCA 4PQEA 4J03A 4G4IA 1FFDA 3WIOA 3BL8A 4MXDA 4XWGA 2WUEA 4H77A 4AX4A 1EH5A 3AJAA 5AH0A 3AFIA 4J0KA 5K3DA 4BAUA 4KE6A 1LPNA 2VT6A 3R0VA 1LBSA 2EDAA 2Q0XA 5ALPA 3WWPA 3KWFA 2IIVA 2PU7A 1VXOA 4H7EA 1XQXA 1YA8A 5FKJA 2WG1A 2GBFA 3L1JA 2XUPA 3HI4A 3FCYA 1UOQA 3QBJA 5JALA 4AN0A 3D2CA 4X85A 2C4HA 4OUKX 2G63A 3FLEA 4MYDA 3QM1A 2DCMA 3IBTA 1XZAA 2FJ0A 3RM3A 4JH0A 1CUHA 3AZQA 4N8EA 2PKYX 1W4LA 1JU3A 3F97A 3JYHA 3WKCA 1BCSA 3QYJA 4GEGA 5JASA 4CG3A 4X95A 4GDMA 2CKMA 1EINA 2HFKA 5LZ9A 5IVDA 3TGLA 2K2QB 2HHAA 3WIBA 2QVBA 3W9UA 1UK6A 4H7IA 4BP9A 1YAHA 5I7UA 5EHNA 1JFRA 5SYMA 1VZ2A 3O4GA 3WWCA 3MVEA 3BE8A 3I28A 2C0QA 4ZXFA 3DDUA 3QPDA 4MWTA 3WJ2A 5JZ9A 4HRYA 2WIGA 1H2XA 1S8OA 5HZGA 3U1TA 3QMVA 1VLQA 1FSSA 1VZ3A 1VKHA 1LLFA 4WY8A 4EY4A 3M83A 1JKMA 3S2ZA 1NX9A 2HM7A 1E8MA 5CTAA 4L72A 5AOBA 4Y2YA 1ZI6A 2CB9A 3ESDA 5JAHA 3TJMA 5AI9A 1HLGA 1IUNA 2OGZA 3D3NA 2ORYA 3SK0A 1EA5A 4KEAA 5LYYA 3FNBA 2WLSA 3D7RA 2JGIA 1K5PA 4BB0A 2WUDA 4IO0A 2B61A 5FXMA 4BZZA 3CN7A 1H2WA 4G8BA 2RONA 4YASA 4QDZA 3V48A 5CT8A 3FOBA 2YASA 4X90A 5A6VA 4HXGA 4H7FA 5FLKA 1MX9A 3NGMA 2DHCA 4K6KA 2Z3WA 3HXKA 3V1MA 4FBLA 4H18A 4G9GA 3V9AA 5AIAA 1XRMA 3H19A 4FFVA 4J3JA 1CPYA 4X91A 3C45A 3O4JA 3AIKA 2NW6A 3FLBA 2WTMA 1C7IA 1YA4A 4KR0A 3VJLA 5AJHA 2Y6VA 4G5XA 4E46A 3K6KA 5BV7A 1KU0A 3JW8A 4U2BA 3U0VA 1AZWA 1UZAA 4CIBA 3H17A 2QT9A 5CH3A 1GPNA 3DL4A 4AZ3A 5H3HA 5AKEA 4Y2PA 5LIPA 2EDCA 1A7UA 4DTCA 2H9YA 1DWOA 3DYVA 1Q0RA 4OB8A 4KAFA 2JEYA 5KREA 4GWLA 2OAGA 5E4TA 1YAJA 1XZDA 5AI6A 5FPPA 1EI9A 3WLAA 4UBIA 3O0DA 2W22A 1IZ8A 3VVMA 1J06A 4TVKA 5HFAA 2BKLA 2WIKA 2WU3A 5AKHA 5HK8A 5KWJA 1K8QA 2JGFA 1P0QA 3FSGA 4UBLA 3BJMA 1MJ5A 1ZD5A 1W52X 4AMZA 4Q3KA 1I6WA 5ISMA 4BAGA 2FUKA 2ZJFA 5JD4A 4DMKA 2IITA 5ALTA 5A71A 1ORWA 3ZPXA 4UHHA 3IA2A 4D9JA 4B9AA 1EK1A 3FYTA 5JD5A 2WSLA 2ACEA 1HPLA 3ANTA 1OCEA 1H2ZA 2G4LA 5K5EA 1BN7A 1ZD4A 2H1IA 3WMRA 2X5XA 1CUBA 4YPVA 2V96A 5AM3A 1EHYA 3STYA 4Y2QA 1FFAA 3I2HA 4UFOA 1DQZA 3AZPA 2BUCA 5AKJA 3CXUA 1T2NA 3H2IA 1VE6A 4QZVA 3IVMA 3GBSA 1IMJA 4HAIA 2OCGA 3FYUC 4QEKA 4WJLA 5YASA 4OU4A 4DNOA 1CUAA 1BROA 3H1BA 3SWWA 1OILA 2PSDA 1CUWA 4QLOA 3F96A 5HCUA 4LYDA 4J7AA 2HA5A 5CMLA 3R40A 1THGA 4K6GA 2R11A 4L9AA 4DM7A 4NMWA 4BC1A 5KBYA 1QIKA 2RAUA 5ALRA 3QZUA 3W04A 2HA4A 2PUJA 3VXKA 1XZJA 3TRDA 3FYUB 2XQFA 1ZGCA 4FTWA 2HU5A 4EHBA 4BAZA 2HA6A 1MAHA 3RKSA 2V9ZA 1DTEA 5AKLA 1U65A 3K2IA 5ALNA 3HZOA 5HQ3B 2GYVA 3BXPA 1K6EA 5ALJA 3DEAA 1GQSA 1XKLA 2JGEA 3WK5A 2WFMA 1YB6A 5ALGA 1CUEA 5C8VA 1CQWA 4QA9A 2JEZA 3WWEA 3GROA 1BS9A 1X2BA 1ZD2P 2VQ6A 1ACLA 4BRSA 4EY8A 3P2MA 5JD6A 3ZLTA 4U2FA 1WM1A 5K3FA 3IUNA 1D07A 2WHPA 4B83A 1A8QA 1JJBA 3R3XA 1MNQA 1ODTC 1F8UA 2AJLI 4MEAA 2ECFA 3F67A 1MO2A 4PSDA 1UT6A 1XZLA 1X2EA 2Y6UA 4IH1A 1MX1A 4UHCA 4FLFA 4CCWA 3BIXA 2WILA 1TCCA 5ALIA 3WYDA 3AZOA 2C5GA 2VAVA 2DR0A 5JANA 3H2KA 3WL6A 3CN9A 1XRNA 5SYNA 3HYSA 1JU4A 4WY5A 3DKRA 4UPDA 1USWA 1IZ7A 1XZEA 2HA3A 1K4YA 1AC5A 1W76A 3UUEA 3ICVA 4RNCA 5JZBA 4DSZA 3C8DA 5AM5A 4PO3X 4C4YA 4UHBA 2E3JA 1CUSA 2BGNA 3FVRA 1O6FA 4X97A 3DLTA 4CCYA 3DNMA 4ZGBA 1R1DA 4QDXA 1QIMA 1U2EA 2VSQA 4DMFA 1ORVA 1P0PA 2QJRA 4P92A 4PF1A 3WKEA 4H7HA 2BUBA 3NUZA 3IUQA 1IUPA 2XUIA 4RE6A 2JGLA 3WQHA 3HSSA 3KOOA 3WL7A 2XMQA 4K2AA 4EA6A 3BF8A 5FDFA 4P08A 1R88A 5ALXA 3MUNA 2IX9A 3LIPA 3ILSA 3W05A 5EIAA 3ZLUA 1EXWA 4NZZA 1A88A 5K3CA 3OTQA 2Z8XA 2Z8ZA 1BU8A 4FOLA 3STXA 1ZJ4A 5DJ5A 3KDAA 1Y37A 5EHZA 5IVKA 4XVCA 1MU0A 4UBNA 5JIBA 1YASA 4Y2JA 5CRIA 3VJKA 2I03A 4Q1VA 3STVA 3PI6A 1LPSA 4F21A 3WZLA 4PW0A 4HZGA 5AK5A 3R3YA 2XLBA 2R8BA 3DS8A 4FNGA 4JYMA 5CXUA 4UHFA 1W1IA 2XE4A 4KE7A 4HVTA 2XUAA 5AI0A 2VTVA 2PPLA 4HXFB 3WA7A 2DFPA 4HXEB 3C6BA 2C58A 2QXTA 4PSUA 4B84A 3MGAA 4ZI5A 2OLEA 3W2TA 1QIIA 1ZGBA 1J1IA 1BEZA 1JI3A 2PUHA 5LZ7A 1WHTA 5EHXA 2WKWA 3C70A 3G0DA 5ALQA 2WFZA 3OG9A 5AKIA 1VE7A 3WWDA 1AURA 3I2JA 4ROTA 1KU6A 4BP8A 3YASA 3BF7A 4BCBA 1GT6A 1YCDA 4G8CA 1WB4A 4I3FA 2BCEA 2UZ0A 1GPKA 4BE9A 1PFQA 4BTVA 5KWIA 3EF3A 5DNUA 3F8SA 1G4HA 3DJYA 3FCXA 4ITVA 2OCLA 5C8XA 1LPMA 4L0CA 2ZYRA 3C8HA 5CW2A 3A2LA 1ISPA 2QRUA 5CT9A 5HK9A 3PFBA 1XQYA 4DYHA 2WG2A 2QJWA 4OCZA 5AP9A 1QIDA 4U2EA 1MTZA 5JYCA 2GZRA 4P9NA 1G5FA 4FKBA 1LZLA 1TCAA 1XZMA 4KRXA 4QLAA 3UMJA 3G0GA 2GZSA 3KXPA 4X92A 4DNQA 2AJCA 3G0BA 2YXPX 4RE5A 2QUBA 4ETWA 2X8BA 1XZGA 2WG0A 4UHDA 2XB6A 3O9VA 4BYMA 5ALHA 2W6CX 4WDRA 3C5VA 1UXOA 5HFNA 1QIGA 2JIDA 4BRZA 2J3QA 4AO8A 4BTLA 2VJAA 2PSHA 2OCIA 2XMDA 1E89A 4J0JA 2WHQA 3QMWA 2QZPA 4FMPA 2XUJA 5BWBA 4GHWA 3GFFA 5JADA 4N5IX 3H18A 1R9NA 4IH9A 1Y7HA 4TPKA 4G1FA 1RWQA 4OPMA 3FSGD 4BBZA 2JGJA 4LXHA 1H2YA 2XUKA 4LHEA 3HC7A 3G9UA 4M0FA 1AMNA 1UKBA 1LZKA 3STTA 1O6GA 5LZ8A 5DWDA 1ODSA 4HRXA 3WK8A 2XI4A 1UKAA 4FLEA 2QMQA 1CV2A 1R9MA 4IHAA 5E4JA 4GBGA 3D5EA 2OXEA 2H7YA 5ALWA 3R3VA 4A5SA 4B7ZA 1BE0A 4AQDA 4B0OA 1QFSA 4CI9A 4KRYA 4EZIA 2VJDA 4J0GA 2YH2A 2VT7A 5CBKA 1N5MA 3O9MA 5EHQA 5FOQA 3G9TA 4X6YA 2XMGA 5BOVA 1HQDA 5ALVA 2J4CA 5IVIA 4FFWA 1JJFA 1TQHA 1AKNA 1TKRA 4C87A 3FLAA 5ALZA 5AM1A 4J0HA 5I8PA 4MQMA 3IULA 3V1KA 3OC0A 1CLEA 5C7YA 2AXEA 3WL8A 2HRQA 4IQ4A 2HU8A 1LPAB 3DQZA 3G9ZA 4YX9A 1EDBA 4EBBA 2OQVA 1VJ5A 3H0CA 1TRHA 1ZIXA 4LKOA 5DYTA 3F98A 1QFMA 2G5TA 5CH5A 3E1GA 4DMCA 4DGQA 1IUOA 3EQ9A 3PDCA 5FP0A 2WIDA 3H2JA 1ZD3A 2ZVDA 3DOHA 1F0PA 1IVYA 4DNFA 1XZIA 5ALYA 4DNPA 2EEPA 3AIOA 2Y2UA 3OOSA 4B0PA 4W9RA 5AM4A 2PVSA 3UUFA 2HU7A 5ALLA 2HA7A 1QZ3A 2WFLA 1E5TA 3GELA 1LPOA 1NU6A 1XRRA 4ZWNA 5AKYA 1AX9A 2XQIA 3HJUA 2JBWA 2BJHA 4Y2SA 4UFPA 3B12A 2WJ3A 2XUFA 2RI6A 1CUJA 2FX5A 3FYUA 4X6UA 3I2KA 5JZSA 5AK6A 4A16A 5HF8A 5BWCA 5ALKA 3Q0TA 4UUQA 3KSRA 4W1QA 4EUSA 1RP1A 1F0NA 4INZA 5D6OA 3ZV7A 5HQ3A 5AM0A 4H7KA 4BE4A 4AO7A 1QE3A 2XMRA 3D59A 3WYNA 2VATA 2OCKA 5EGNA 4Q82A 1QIHA 1EVEA 3RLIA 4M0EA 7YASA 3A2NA 3PF9A 4BVJA 5JARA 3DL7A 1DWQA 2ZYSA 2XUQA 1DWPA 4KE9A 4AZ0A 4W63A 1EX9A 3ESAA 3GUUA 1L7RA 4AXBA 3LCRA 3WK6A 3WZMA 3R3UA 3I2FA 4WCVA 3LP5A 4BDSA 3HEAA 3O4IA 5T4BA 1TIBA 3DOIA 4B85A 4LXIA 4RGYA 2OPHA 4S0XA 3WK4A 1QO9A 2QOEA 2YYSA 3VKFA 1UK7A 1AUOA 1ZOIA 3G9XA 3D0KA 2QTBA 1QOZA 3SX4A 3T52A 3AUKA 3E3AA 4I19A 4J0DA 1FFCA 3C5WP 5A7FA 2WJ4A 2JGKA 3QPCA 1Y7IA 2C0PA 4OB7A 5C8ZA 1JMKC 1CUIA 2PSEA 4PSCA 3M3DA 3RK4A 1DX6A 1C7JA 2PM8A 4HTAA 1HBJA 1UOOA 3G02A 2VJBA 4Q05A 3LIIA 4H35A 1WB5A 2WHPB 3STUA 1GXSA 4H7JA 5HKBA 4A23A 5HKAA 4L3WA 3ZWQA 2DSNA 3IUJA 2JGMA 3I6MA 4W1PA 1W6RA 3K9BA 5ALFA 2C7BA 3V1NA 4UBMA 2OGSA 1XZBA 1A8SA 2ONCA 4C6HA 5CURA 1U4NA 3WWOA 4QDOA 1B6GA 4UBJA 2GYWA 4ARAA 1CUVA 3WA6A 4BATA 4I4CA 1ACJA 4C4ZA 3FAKA 2OG1A 1KEZA 4C01A 4CFSA 1X70A 5DNWA 1CFJA 4K5QA 1XLUA 2QKYA 1XROA 3KD2A 2B20A 4XX1A 4Y2XA 5A7HA 2CMFA 1ZI9A 1B41A 2AJBA 3X3HA 2XQJA 3HACA 2Y2VA 3PUHA 1QTIA 1W75A 1CUYA 3N0TA 3NWOA 4GXNA 4J0CA 1MAAA 4DSAA 4N8DA 4O08A 1G66A 4QDUA 3QVMA 4EY6A 4KAAA 2XLCA 1MT3A 3AINA 1WPXA 2WJ6A 5AKKA 2HA2A 4IH4A 4E11A 4Y7DA 3D2BA 2HRRA 4MEBA 5K3EA 4KYVA 5AM2A 1THTA 1M33A 1E8NA 4N5HX 4CIAA 4EY7A 1ZI8A 5DNVA 4JUIA 2VF2A 3ICWA 4HS9A 3QH4A 2HA0A 5ALSA 2WU4A 1QJ4A 4U2GA 3G8YA 5AIBA 1CUZA 4KJXA 5EI5A 4X7BA 3VISA 3BDIA 5CT5A 4UHEA 1EB9A 3G7NA 2ZJ7A 3CCBA 1CQZA 1GKKA 3DCNA 3BWXA 5D3ZA 4X00A 3EIOA 1Z68A 4BVKA 2PL5A 2WUGA 5DTJA 1VA4A 1G42A 3DD5A 2O7VA 3E0XA 2V97A 1UFOA 1JT2A 5CT6A 3QITA 4Y2RA 1DU4A 5ALMA 3B3QA 1EB8A 2AJ8A 3BJRA 3A6ZA 1YB7A 2PX6A 3PICA 1YR2A 1MX5A 1N1MA 1TAHA 4DLNA 4U2CA 3CCCA 2O2IA 5A62A 4JNCA 4Q34A 4OD0A 4B6GA 2QR5A 1EDDA 1HL7A 2ZYHA 3IIIA 5CXXA 1H23A 1XRQA 4ZV9A 3D4LA 1Q0ZA 1SFRA 3WK9A 3AIMA 1FFBA 1H22A 4G4GA 3OURA 2XMCA 3WKBA 4V2IA 3L1HA 4U2DA 4BZWA 1C4XA 2O2HA 3I2GA 5E2IA 2PBLA 1QIFA 4C4XA 1TCBA 5DTIA 1YSCA 4FNMA 5DLPA 1T4MA 5AK4A 2P8SA 1N5RA 1R4ZA 3G0IA 4TGLA 5AI8A 5LKAA 2OGTA 1CEXA 1WHSA 1XZCA 2LIPA 1AGYA 5CT4A 2JF0A 1XQVA 3ED1A 1BN6A 1LPBB 2B4KA 4OYYA 4CG2A 3H2GA 3G0CA 1GZ7A 5AKXA 1BEEA 4FHZA 3B5EA 2ZYIA 5ALDA 2XDWA 3PUIA 3Q8WA 4NS4A 2VA9A 5JAOA 3HRHA 2WIFA 2B9VA 4AMYA 1QO7A 3OPMA 1J2EA 2J3DA 4H7DA 1WOMA 5AO9A 2WUFA 3I6ZA 3PF8A 1J07A 1P0IA 4GECA 2VJCA 3GA7A 5A7GA 2XUGA 5IH7A 1XLWA 2DQYA 2H7XA 2XMSA 2D5LA 5DYWA 4E15A 1UOPA 2ZSHA 3W06A 5DYYA 1XZFA 2ROQA 1CIJA 4G9EA 4XJVA 1P0MA 3DKKA 3EQ7A 1DINA 1HDEA 2VAXA 3AILA 1E66A 4F60A 5T4FA 2XUDA 4G4JA 2D0DA 4WFIA 1EK2A 2XQGA 1SCKA 2CUTA 4AB1A 4UBOA 2GYUA 5ALUA 5I9IA 5EFZA 4F5ZA 1DX4A 1EDEA 2CJPA 1QLWA 4X93A 3IURA 1LPPA 4G8DA 3PE6A 2I78A 3ESCA 4QNNA 5ESRA 4Y2TA 5A2GA 4BCCA 3A2MA 3W9BA 2AJDA 4Y2UA 4Y9SA 1XZKA 3I2IA 3NOXA 5JAUA 4OSEA 5IKXA 2DHEA 5AKZA 2OQIA 4GI1A 2WHRA 3TEJA 1QONA 5C81A 3QPAA 2C5FA 2ES4A 3H04A 1DT3A 1ZJ5A 3BIWA 2BFNA 1QIEA 4RPCA 3GZJA 3IDAA 2HFJA 3LLCA 1DQYA 1A8UA 4F0JA 1XQWA 2ACKA 4H0CA 1Q84A 3O95A 3M81A 5AI5A 4FLMA 4P93A 2ZJ6A 4PNZA 3EBLA 1PJAA 4ZREA 2XMBA 3S8YA 5IVHA 1FFEA 5AHXA 4GW3A 1MNAA 2GBCA 2PSFA 1CRLA 2PSJA 3STWA 1E3QA 4KAJA 5AICA 5AK3A 3E4DA 2CZQA 3ANSA 4E14A 3F9CA 1XRLA 1LBTA 4Y2VA 5FUMA 1U8EA 3MUOA 4N8SA 2RHWA 3FVTA 3WJ1A 2HIHA 3VDXA 4WFKA 1QTRA 2QXUA 4QWWA 1BCRA 4WFJA 2V98A 2RHTA 1AQLA 5ALEA 4QDTA 5LZ5A 1RYYA 1PV1A 1XFDA 4LXGA 3C6ZA 4LYEA 1MPXA 4CG1A 1F6WA 2I3ZA 2GBIA 3FWHA 3QMMA 2WFLB 3IB3A 1CUDA 2QM0A 5FV4A 4UBKA 4W1SA 1JJIA 2OAEA 4ZV7A 4Z49A 4GLBA 2BGRA 4BDTA 1CUCA 1CR6A 1TK3A 2HL6A 3WK7A 3HABA 4JEIA 4ZRDA 5LP1A 1SCIA 1DT5A 3DYIA 4DMHA 2BAGA 4X3CA 2DHDA 3JWEA 4MYSA 3IUMA 4BC0A 3C6XA 3D2AA 4X71A 3V1LA 3T4UA 1VA5A 4AN1A 2DQZA 3EQ8A 5JATA 3R41A 1EVQA 1L7AA 2QUAA 5T4EA 3H2HA 2WQZA 2WTNA 4QE3A 4FBMA 4BCDA 3WKAA 1NU8A 3M82A 5HF5A 1LNSA 2O2GA 1UK8A 3O4HA 5E4YA 1XZHA 3RARA 3WL5A 5AOAA 4AO6A 4EB0A 6YASA 5LLSA 1WB6A 1CUXA 2G5PA 2XUOA 5K3AA 5CH8A 1SCQA 1YS2X 2QS9A 2ZSIA 3LS2A 3WI7A 5J3JA 3C87A 2Y1KA 3H1AA 2PU5A 5HF9A 4EY5A 2CEKA 1R50A 1WPRA 1XLVA 5ALOA 5K3FB 1GGVA 2O7RA 1UK9A 4K6HA 4Q3OA 4OB6A 5D7BA 5AOCA 1CUUA 1L7QA 1R3DA 2XUHA 1HKHA 1WCYA 5JAPA 5AKGA 1GPLA 3SC2A 1ETHA 3I1YA 2WM2A 4FDMA 3L1IA 2XQKA 2HDWA 3WKDA 3A70A 3BDVA 4Q3LA 4PV7A 1Q83A 4UFNA 4B82A 4BVLA 5AI4A 1CUFA 4KACA 3FBWA 1ZIYA 4QWMA 1CUGA 2HADA 2X76A 4MQLA 2H7CA 1BRTA 4B80A 4B9EA 4FWBA 2XT0A 2I3DA 5FPQA 3I6YA 3PFCA 5LKRA 1CVLA 4C88A 3I1IA 2Z3ZA 1QIJA 1QGED 1XKTA 1SC9A 2FJPA 2GBGA 4LIPD 1VXRA 2BUAA 4MJ3A 1LGYA 4NVRA 4OYLA 1XRPA 3ZI7A 1SOMA 1OXMA 3ESBA 4OU5A 5D3KA 5LZ4A 5FRDA 1ZICA 1N8SA 1JMYA 1FJ2A 5F4ZA 4JYPA 2XMZA 4CCYB 1YS1X 4B81A 1UKCA 2RIPA 3C43A 4XIIA 4X94A 3VVLA 3ZLVA 3KWJA
chains in the Genus database with same CATH superfamily
4G85A 1S2GA 4JJIA 1LDBA 5EWMA 2GEDA 2GEFA 1YWGO 2VHTA 1GN8A 2BGMA 5EIHA 3OU7A 1AQIA 1R6BX 4NDAA 2H92A 4TRNA 4N47A 3AEYA 4NLLA 2BN4A 5T4HA 4JWKA 2XA1A 5JRDS 4FHCA 5E6RA 5EIBD 2WUWE 1NQWA 2ZS9A 3ZI4A 1P7VA 3H5OA 4INPA 1D2NA 3WMFA 5LZ2A 2FMTA 1YJ8A 1FUIA 2G88A 2NU9A 3K9HA 4FN4A 4N0MA 3VZBA 4P2BA 1UINA 3D3EA 3DBLB 3KQVA 3TTSA 1C0LA 1YUMA 1VMDA 2FEKA 2QTFA 2YV4A 3VR5D 2CB0A 2PKQP 3UY4A 3RT7A 1GQRA 2V6FA 5H1YA 3RYFB 1E2BA 4WVFA 3IFSA 3C6YA 3VJMA 4ARBA 4CI0B 4PBSA 4CLRB 1WVGA 3OSUA 3R3WA 4YAKA 3IIMA 5CGQB 2XXAB 1ZY2A 4RF2A 1E2UA 1IFXA 1PFVA 2FYTA 2Y99A 2QJTA 1KZYC 1I4DD 3HLKA 4HN2A 1JIJA 2WYVA 4J0EA 1XL0A 1UWCA 5LSAA 1FLDA 3KB1A 2KJQA 1JVSA 4Q9JA 3LYUA 3NTQA 4F2DA 1UC5B 4FCVA 3GRZA 4H6VA 4FIZA 4E4TA 1Y3BE 2J59A 1EX1A 3JARB 2ERYA 3ACCA 3CSDA 3NYQA 4JT2A 4KG7A 4MVJE 1DV1A 4Q18A 2VC2B 3FFBA 3HUUA 2OFOA 3ZE1B 4FNAA 1HDIA 2W6ID 3BXGA 3T3GA 3BXEA 4ZQHA 1M1YB 2BTEA 2I6UA 5CDYA 1DOZA 5K3SA 2PWAA 3BE5A 3B7PA 1YOVB 4PLYA 4WOPA 2ZSBA 5HIMA 1FPQA 4CLOA 4B3GA 3OJOA 2YVLA 3KQSA 3B51X 1NAIA 2LP4Y 2RGYA 3R0VA 4ERNA 1SXJC 2LDBA 3JX9A 5CPBA 5FBZA 3RD5A 2RAVA 5HJ5A 2ZRGA 3GUHA 3J80A 3IP6A 3C7DB 3C7TA 4B2IA 2UUBB 3CX3A 1K1EA 2A3NA 2H5IA 4C04A 2UXDB 1K8XB 2EIXA 4NESA 2H2FA 4H7EA 2O2ZA 4G97A 1RXUA 2X3FA 2GBFA 1SULA 2I4OA 3C3XA 3LCJA 3RVPA 4CTJA 1UWLA 1DJOA 3Q7PA 2FP3A 2XE6A 4EKDA 2P9ZA 1NUSA 1V7PC 4LJAA 4RPJA 1JQKA 3SFVA 3D1LA 3NHFA 5D87A 3O9ZA 3GGOA 3LWZA 5FQNA 3FTDA 2W8BA 3LHKA 2Y27A 3NIBA 3DZKA 3QBJA 1WZEA 3B5JA 5JALA 5EWLB 4V0ME 4QUBA 4LNUB 4X85A 1ZNXA 1U3TA 3HBLA 2GVDC 4OUKX 1NP6A 2OVBA 4LY3A 4FM9A 2J1LA 3HUEA 2O2XA 3QWHA 2Y0DA 1ZVQA 1DI0A 1A5BB 1TKBA 3DDNA 1R0ZA 4OHUA 5TRTA 1YQXA 3S6JA 1U0HC 4O2LA 4BKPA 1CUHA 3B3AA 5A06A 4CU5A 1IHYA 1SXJB 1JU3A 2YQ5A 3UK1A 3V8VA 4ASUA 3FVVA 1ZNZA 3P0JA 5JSUA 3F97A 1SBHA 2O3UA 2X5KO 3SHVA 2Y68A 2O0JA 4LYAA 4DT1B 1ZGAA 2I6GA 4ZYXA 2A5GA 1ESNA 3MJSA 1MX3A 3KZCA 2J67A 2XVYA 3QJYA 2R1VA 3VDMA 3DWGA 1S3IA 1E6UA 4WINA 1ZM4A 4YCMA 1PAUA 4H7PA 1MABB 3LF1A 2G67A 1QXSA 2FPUA 1HRDA 2QTVB 4XEHA 1BFUA 4LBVA 4QXQA 3TGLA 3K0SA 1CRQA 5TJHA 1A77A 2HHAA 3FMGA 2YWHA 3FPJA 1YAHA 5CCXA 3PEFA 1ZJZA 4CR8A 2PYIA 1GQOA 2C3OA 1RXVA 2A88A 3KJZA 4UAJA 3VU0A 3VNVA 4XB6B 3KPVA 3OMLA 1ZM3A 3QU4A 1JG7A 2ZRMA 4WN9A 1HLPA 2UUCB 1U3GA 2WJHA 1W35A 5SYMA 2YN2A 3R5KA 1KAGA 4AY6A 1TECE 1N5DA 3O4GA 1ZHFA 4MLPA 4YFVA 3ZR4B 3ZWPA 4XYLA 1EWKA 3FPLA 2GWRA 3U60B 1VSBA 3WWCA 1B26A 2R5NA 2P7HA 4YP0A 3I28A 4KWEA 1YZNA 2HJRA 4CT4B 4GO1A 1FQOA 3P5BA 4CQMA 4EHKA 5M7EA 4K3UA 4R83A 2HIAA 2OV2A 5AXBA 4RTPA 3TAXA 2ZUWA 3U3MA 1P7CA 3KJXA 3U44A 2D06A 3FFWA 3L40A 4M0PA 3UJ7A 1H2XA 1VYTA 3FYCA 4KQFA 1S8OA 1MG5A 2XDQB 4O4HB 1F2UB 1T9HA 4KQEA 4Y1RB 5HEKA 3OCUA 2P9TA 1GAJA 1MUUA 2Q29A 3PRHA 2XHEA 3S1AB 1XTVA 1VZ3A 5EG5A 1CDDA 5J5VA 2Z5LA 1S8AA 3RYIB 2B7LA 2PBRA 4DSUA 2BC9A 1D5CA 1AF4A 3LVQE 3OM1A 4IOKA 4HPXB 4Y1FA 4RCVA 2CBXA 3I6IA 2FWPA 1H3EA 4C1NA 4EY4A 3FBGA 1RRPA 3A9SA 3HADA 1NOIA 2CLCX 2BY4A 2OZKA 3NEPX 3L18A 5CTAA 5LP6C 4LSWA 4KPUB 1D2AA 3ZCVA 3IJPA 2EKLA 1ZI6A 3FDIA 4JJEA 5ICGA 3HR4A 4J6FA 1UBEA 3HNPA 5BUQA 2ERCA 3EVZA 5EQTA 3LUPA 4HATA 2VHQA 5DBIA 5DGTA 1VBFA 1SHJA 4FGJA 1EA5A 1L7EA 5G4KA 1F0KA 1SCUB 4DG9A 5GADl 5LYYA 3U7GA 3CX6A 3GFPA 1P1JA 3BD9A 3HDJA 4RD2A 2QEQA 1O03A 4PYKA 3SR0A 4MR8B 3TB4A 4R6WA 5B58T 5BMOA 3FB4A 4S04A 1VCMA 3VNUA 3GZNB 1A69A 1NVTA 4G8BA 1L7NA 5D6NA 2B8EA 4P5DA 2ZU6A 3ROPA 1MGPA 2HF9A 3S55A 4TVSA 2OZVA 4P80A 3H86A 3V48A 5CT8A 1R4NB 1VKOA 2VZLA 2VXYA 3FYHA 5LUBA 1HQYE 1XNQB 1KVTA 1MG0A 5C4MA 1V5EA 4I0WB 5A4DA 2IHJA 2XIQA 3RV4A 1JBQA 1CNFA 3EOBI 1CULC 3OTHA 4O4HF 3SLKA 3NH9A 4HXGA 2IZ5A 2YVUA 1WTCA 3SYTA 1P60A 3NGMA 1MB4A 2R751 2J8ZA 4BFLA 1HLDA 3REGA 3BWYA 3QVOA 1H2RS 2DUUA 4ETMA 1PZHA 5CVUA 3B2NA 4HAVA 4E12A 4URFA 4CQLB 3LWDA 2UYGA 1R6XA 2K5UA 1NWCA 5IZCC 2IE0A 4LYFA 1DJLA 4AK9A 1A9QA 3DZFA 4DJAA 1J8FA 5K7SA 1AO0A 1UXIA 3CLSC 1H8HD 2VK2A 1WP9A 1T34A 4N7MA 5MGNA 1M2EA 1XE3A 2IXFA 1BG6A 4G4SP 1PL6A 4EQ6A 2PUVA 3CVYA 4QATA 2DFKB 5A6SB 4DV1B 1OREA 1A7AA 1Z2DA 4KGZA 4FFVA 4J3JA 1CPYA 4MHOA 5BNFA 1F0YA 1UDRA 4G5RA 1T9ZA 4DQDA 3ZDCA 3O4JA 1NXTA 4JJ7A 3U62A 5PNTA 3FLBA 3OZBA 4N7RA 5FA8A 1IE3A 2Q6KA 2IOQA 3IKLA 3RJ5A 3ZBPA 5ELXA 6LDHA 2B8JA 2I4RA 1BGWA 3PNSA 5CM2Z 3BD7A 2HQOA 1IXSB 3IVCA 4UW9A 1E7QA 3LX5A 3KB8A 4PRYA 3FOZA 4IZ6A 4AWAA 4F12A 1OKKA 3AR4A 4ID9A 3BKXA 3ZVLA 3OZFA 3G2HA 2ZTLA 2PKEA 3DE6X 4D4KA 1MV8A 3LQYA 4G1BA 1ISGA 1AZWA 4LNHA 4P35A 2GZHA 1YOBA 4ITUA 4B3SB 3H17A 4Q4LA 2I29A 3INGA 4OFXA 2H52A 1GPNA 5CH3A 5FHRA 3UMCA 3OZ7A 4PE5B 1SCJA 3PE3A 3DL4A 1Q22A 2QTHA 4K9NA 3AWDA 3UYLA 3V2GA 4Y2PA 4PCAA 2O1WA 2DFVA 5DX0A 4L8VA 3W3AA 3GAMA 3RTDA 1TQ8A 4KQ6A 2H9YA 1DWOA 4YHBA 2YMQA 1TO6A 3AETA 5FORA 1Q0RA 4OB8A 1S2DA 2NQTA 3IAUA 5CITA 4ZCLA 1RM5A 1EBUA 4RKWA 4A8JB 3TEMA 2R68A 5KU7A 1YAJA 2OILA 4BFCA 5LLDA 4UZSA 1XZDA 1TKAA 5AI6A 1EI9A 3F6YA 4OJMX 1KJNA 5J4LA 4NWIA 2W22A 1Z4OA 3DPSA 3UH1A 4B5LA 3HCDA 2JGAA 2GVZC 4MPDA 5A5VA 1J06A 5G53C 1Z4KA 1BDJA 5HFAA 2BKLA 5BOSB 4ZEXA 1UBNA 5AKHA 5HK8A 3I61A 2DJ5A 4I8XA 4F56A 1JQJC 5ULLA 2VHJA 2ZT8A 3HU2A 3A06A 1PUIA 2AQHA 2B34A 4BV2A 3K6SB 1HEUA 1K92A 4Q4AA 2P4SA 4XI9A 2UVPA 3AEQA 5KS2A 1WKCA 4DILA 3JALB 1FFWA 3FSGA 4M89A 2CK3D 4TS9A 3BJMA 4F5EA 5EJ5A 4WTOA 1W52X 3AL3A 4FSDA 2P4HX 4TOIA 4AMZA 5IDXA 3IEMA 1EUDA 1TC1A 3H2BA 3SMVA 2PWYA 2QR2A 2Y1CA 2ZJFA 3CO5A 2WWHA 3G79A 4HUJA 3LXMA 2Q8NA 1X0XA 1OAOA 3ISTA 1SZJG 3N8HA 1KMHA 2IPMA 2KW5A 1Y6FA 4X7MA 2N1BA 3A28A 2AOUB 1X74A 3F3MA 2H1SA 3TDMA 3W7BA 4DMGA 4HLNA 2YR0A 2AYXA 4TZTA 4C5AA 4I8DA 3D7LA 3W2GA 3IEPA 3FKSD 2CFCA 2GJ8A 5DCYA 3K92A 4K9KA 3U4AA 4HO1X 5D1NA 1DKMA 2Z0MA 3WDMA 1BWSA 1NW6A 1U04A 1Z2EA 1EK1A 2X40A 7REQB 3A10A 3BCSA 4QODA 2J3JA 4LI3X 4PNHA 4LF5B 3M2PA 1DC6A 1HPLA 3OEEA 3DAPA 3LAWA 4J7CA 2H1IA 5EZQA 4CMBA 2ISSD 1X1CA 6NULA 3BFPA 2VZ8A 1XHFA 4NZYA 1UXKA 4Y9UA 3V1UA 2BGUA 1NLUA 2X5XA 5DPMA 1OBFO 2V96A 1EVYA 4A10A 2YJGA 4EA7A 3TIFA 2NTYC 4QYWA 1FFAA 4YMHA 2YVKA 4H2DA 4Z4EA 4FEEA 1N4DA 4PZDA 2YOHA 4BO7A 4WK0B 5HZMA 3WNQA 3S1SA 4PTYA 1SVIA 2REBA 3F90A 5H7XA 1BXGB 4AJEA 1D1PA 4EI8A 4MGYR 4V0SA 3X1DA 4B4DA 4UZFA 3GBSA 3WICA 3I73A 2EBFX 5CA1B 1IY1A 1CVRA 3Q9SA 1F6BA 4PR3A 2I7VA 3ZWCA 2L69A 1ST3A 4OU4A 3G2NA 4MVJG 1E6WA 3A27A 5LMCA 4RY2A 1B23P 3Q88A 2VSFA 3RIGA 1RXSA 5D84A 3PGJA 3O1HB 1BROA 1ZW6A 2HJVA 3RSGA 5IARA 4C0KA 3SWWA 1OILA 2A9RA 2PO7A 2R00C 3F96A 2Z2YA 4EGQA 1ZS9A 1Z38A 5EMJA 4KH1A 2BR4A 1FDIA 2HA5A 1U6IA 3U49A 4YUZA 1M74A 5DU2A 5GPBA 3PR1A 2GN1A 3CUSA 1ECPA 2IDZA 2LKCA 2SCUB 2XSZD 3H9UA 3JWHA 4K6GA 1ZVKA 5KTTA 4L9AA 1DKRA 4Z7QB 1BJTA 5EIXA 2QN8A 4Q1BA 5DLQC 3MUFA 3ICQB 3W4JA 4R01A 1NMYA 1THZA 4BC1A 2I4MA 2RAUA 3L6OO 1X1DA 4C30A 2AEEA 1PZXA 2O23A 3UAYA 5I01A 3HJBA 5JEDA 1N34B 4TL9A 1KYYA 1WKBA 2VL7A 1UEIA 1IPHA 3IQZA 3G17A 2GN0A 4EF4A 3VXKA 5J4HA 1JHQA 1Y8RB 4NFHA 1OI4A 2NSYA 4KO2S 2E5WA 1SHKA 3W1EA 4TYQA 3IE1A 1HYQA 2PKWA 4IJKA 2FQ1A 4Q4HA 4WCDA 2ONJA 3IUBA 3UMVA 2PH5A 3UPDA 1N2EA 5KKAA 2J7PD 2XQFA 2CWDA 1QCYA 1QGUA 3HS3A 1T0IA 1L9KA 3PIDA 4KQMA 2JG3A 1UM9A 3L04A 3SEFA 4RKRA 1INLA 3H4TA 1A8PA 2HA6A 3IAS1 4IGEA 3VZRA 2OLJA 5CA1F 2CXNA 1WVIA 1XP8A 3NRJA 4B43A 5CX1B 1RM0A 1XL1A 1TZCA 2F3TA 3RB8A 2WEKA 4AYXA 5HQ3B 1RDFA 3D02A 3EW9A 2WZDA 5B1DA 3V2HA 2FRVA 4UEOA 1M67A 1I7SB 2AD5A 1R4AA 5ALJA 3WIVA 1OV4A 3OT5A 4IJWA 3UCXA 2AV6A 2VSOA 4ALIA 1OFTA 3PCXA 3TQOA 1HG1A 4LC1A 4MRPA 1CUEA 2EP8A 3D6FA 2WZQA 2NZVG 1CQWA 3M49A 5JS2A 2DYKA 1NTOA 2PRKA 1WQ1R 2ATEA 2JI6A 1N3YA 1WDWB 1XJ0A 2WWWA 3GROA 3NNSA 2ZYTX 1DG3A 5TNXA 5DIFA 5LWQA 1QQAA 2Y0EA 3FNEA 1NF2A 2FW9A 3OLZA 1HY3A 1NV8A 5KX5A 1EXMA 4F3TA 1A9TA 1KSFX 1S2IA 3NBYC 3TSCA 2VH5R 3Q10A 3FTNA 5CYOA 4BRSA 1WETA 5CLLA 5I45A 2H59A 1T24A 2HAEA 2VJKA 3BE4A 3FW1A 4DW8A 3IOCA 3ZLTA 5LBUA 1T9AA 2VNAA 2ZT7A 3E0QA 2LE0A 4CLDA 3T3EA 3EDQA 3DC2A 3DCYA 3QYFA 4D8XA 2H16A 3IAXA 4BMDA 3KK0A 4LG1A 1IEXA 1MD9A 1OFHA 2VKQA 1H9AA 3L9XA 1IB0A 3LCMA 3QF4B 4GZ5A 2ZDGA 4EABA 6ABPA 3OTOB 1ZAYA 1MHTA 1VYUA 1MNQA 1XPUA 2FR1A 2ZSJA 1CY6A 2ZR7A 5G0TA 2VT3A 3U4QB 5TPZA 4F4UA 1A5SB 1YB1A 1F8UA 3GARA 1ZITA 3GRUA 3Q5GA 4N18A 1UBGA 3RT9A 4AG5A 2OV4A 2YZ7A 5U1PA 4LDNA 4OVKA 2ECFA 2OXIA 2AH5A 2VYVD 5ES3A 3TNFA 4CM4B 4DSOA 4PSDA 4XJXA 3IT0A 5GQSA 5F1PA 1WDKA 4YP5A 1PUJA 1XMVA 1UT6A 3GJSA 3A14A 3FA2A 3EPKA 1X14A 1C7QA 3FUVA 3NOQA 1KJZA 2GD2A 3PEWA 4D99A 2NP7A 3HFRA 4M0CA 1MX1A 2VP3A 4Y30A 3CT6A 1BGVA 1VRVA 4OUDA 1A2OA 4MVJI 4MA4A 2GD6A 1RBZA 2P1RA 3DBVO 2CHGA 3ET5A 3DEYX 3NBAA 3PG5A 4LCBA 1Q74A 4MWGA 2CKDA 5M3BA 1XP5A 2WZBA 3CGGA 1SEVA 5F3DA 1G18A 3ISJA 3RBZA 4B3RB 4NC9A 4DR1B 3H2KA 3JQAD 1PEDA 1HDXA 2CYBA 3GLKA 1OWPA 3Q7RA 3UK0A 5JFTA 1T0HB 2OP1A 3B85A 1ABEA 2GBLC 4J4HA 2PGLA 1UBTS 2RHDA 1W36C 2QVLA 4HCJA 2N9UA 2FQYA 3X1JA 1XRNA 3JQGA 5SYNA 4IHJB 2BGIA 4NYIQ 3DOEA 4FQ8A 3RYHB 4OQZA 1E6MA 5HIKA 4ONEA 4WY5A 4JHXA 1KGSA 3OE1A 1WZ2A 1V9LA 1C4OA 2X1MA 1USWA 4DB2A 1KEUA 1I3CA 3U7FB 3AKZA 1IZ7A 1FMLA 2RIRA 5GM2A 2IPOA 2W90A 1F4VA 5DYNA 1W2GA 1GPAA 2XZDA 2VBIA 4RTSA 4IIXA 3S2EA 3STHA 1W76A 2QUJA 5JSQA 1YZFA 2OV1A 4RNCA 4KFTA 1PR6A 3LC7O 5AM5A 4A9AA 1GXSB 1JSXA 1JIXA 2B9EA 3OJ0A 4FGKA 4HLUA 1C9DB 1NFQA 1PQWA 1JLRA 1RWWA 2BP7B 3IQEA 1BX1A 2IYNA 2EKDA 1C9KA 2FFJA 3EZ2A 4I9NA 1O1YA 4LX8A 1KQGA 4JP8A 4AG6A 4P7BA 5AW1A 1QM5A 3IMKA 4GX2A 3V1YA 4MW6A 3ZGZA 1W36B 4E2WA 2NT3A 4YALA 2GZ1A 3VGJA 2V7BA 1QIMA 4PZCA 1E3MA 2I9PA 3C15C 3THSA 1KZHA 1GVHA 3TTTA 1QB8A 2HO4A 4DMFA 1BYUA 1M6NA 1Y8CA 2FOLA 4GI3A 2DBQA 4N6NA 1GG8A 4OY3A 4CDMA 1QRTA 1BH6A 4P92A 5ECDA 3U2QA 3UN1A 2ZE5A 2F4VB 1E9EA 2PRIA 2D7JA 2W0SA 1XR3A 2XNKA 5F7OA 5H3CA 5I7VA 2WP0A 2RG1A 4B3TB 1RMYA 4L28A 2BUBA 4M9SA 2Q3LA 2Q21A 4G37A 4PHCA 4RVOA 3S7ZA 4E2YA 1N6OA 4IHJF 3FF1A 1F1JA 3P97A 1MEOA 4NE9A 3VOAA 3TE7A 1A5AB 4XA8A 4XVHA 3KFLA 1E98A 1FYXA 1QGAA 1BKDR 2G06A 4IMIB 4MQ6A 1C8BA 2DVMA 2JGLA 3BRWA 3R5SA 3ZJ4A 5J4KA 5K03A 9LDBA 4UTRA 4ZZ0A 2EERA 4LFAB 1UBOS 2P3QA 4P34A 3WL7A 2XMQA 3SR4A 3ZHOA 3CH7A 3RYFA 3QLUC 4MW4A 2PH1A 3ZLBA 5HSGA 3FOEC 4GLFA 1K4KA 2GZ2A 1XIVA 5HZKA 4WZBA 3RQIA 3LPCA 2WB2A 4KN5A 2VP9A 3OPXA 3AB3A 4UMFA 2XXAA 1PK9A 1AJEA 1DEOA 2NNWB 3QX7A 2NQ2C 2C20A 3RF7A 2XODA 2EG9A 3SKYA 1E1CB 4RD6A 4X45A 4EFLA 1WMFA 4KK4A 4AY2A 1F3OA 7MDHA 1IY9A 5JNWA 3MUNA 3EZLA 1MC8A 3NFRA 4XGRA 1Z5VA 3E03A 3O73A 4GM1A 4IIHA 4NV3A 2FW8A 1TQ4A 3BTOA 1Q57A 3TZLA 4E5NA 3FXAA 4D8YA 4F86A 1QV7A 5JMTA 1ENYA 3LIPA 2PTGA 3ILSA 4ZRMA 4A15A 1PJTA 3DQPA 5IBRA 3ZZTA 4RJKA 5CBPB 2J0UB 1I2ZA 1ZLYA 5FLEX 1M1YA 2Y0CA 1Q1ZA 1CF2O 3A4TA 3OTQA 5K3CA 3D4BA 4EDFA 2FFHA 1XLTC 2Z8ZA 3X2FA 3CNEA 3ZHXA 2D2VA 3IODA 1IBRA 2AFHE 2Q2QA 3ELBA 3LYHA 4G5GA 1BU8A 4YJ2B 1TUIA 1YOVA 2FK8A 2OAQ1 3GDOA 1UXGA 2O5RA 4FOLA 4JL5A 3STXA 3TO5A 3VVCA 3WIEA 4CIDA 1ZJ4A 2FEWB 3E9EA 1Z6QA 5L40A 1TMOA 4JSRA 2FOXA 3KDAA 1HQKA 1Y37A 3N6VA 5IVKA 3PDJA 1KO7A 2Y1XA 3D9QX 4QXMA 2AN1A 1T4BA 4QUJA 3RIMA 2ZQZA 3C1OA 3ZCPA 5I9LA 4PLHA 1J42A 1GG5A 1OSNA 2HMWA 2PZMA 3KHUA 4MW0A 2P30A 2YZMA 5KPDA 1L7XA 3T38A 2OGWA 2NUAB 3IPYA 1AS0A 5JISA 1FXUA 1EM6A 5IWCA 4A2WA 3DFIA 3WLJA 3OI7A 1EUYA 3WZLA 1DJQA 1GPDG 2IVFA 2G7MC 4PW0A 3R3YA 4N0QA 2VP4A 5BN3B 3T1TA 1FX1A 5B5SA 5HILA 5BSKA 1CWUA 3DS8A 4OEHA 1JIKA 4UARA 4FNGA 5CFMA 4AKGA 4CLHA 2PEZA 4D3YA 3N7AA 2XE4A 4LNUA 5JECA 4KXYA 4G0WA 5AW4A 1G8HA 4JQCA 5AI0A 4RCZA 3OY7A 1E2FA 3RGWS 1REQB 2DFPA 5L3RA 1NNUA 1ZFNA 5FB3A 4CVNA 4DJJA 2C58A 3JZIA 4PSUA 4B84A 4CBVA 4ZI5A 3U31A 3P9RA 3M4ZA 5CVVA 2XT6A 1RLMA 3H5TA 2GXQA 1SXJA 3W8FA 3MPUA 1GGMA 3N87A 2YWJA 3GFGA 2IYTA 4TT3D 1GTSA 2AK3A 2UYHA 3CNQS 4OQXA 4X60A 4DT1A 1U5BB 1NF8A 1GL9B 4YJ2F 1U2PA 3BCRA 4FT2A 4UU7A 2NTNA 1JPVA 3GEIA 1S3SA 5ILQA 5L4SA 2PUHA 5LZ7A 4BN4A 1Q0PA 1WHTA 5EHXA 4P36A 2DWOA 2WKWA 3PVSA 3N5KA 3TIIA 1IG3A 4TX1A 2G71A 3KJFA 1VG1A 4KX5A 1EWVA 3RSCA 2J0QA 3B89A 5L3SB 5ALQA 3EZNA 1PR1A 1YJCA 1D4OA 2IZOA 4IZIA 2WA1A 2VH2A 5KOYA 3TQSA 1JHAA 2WFZA 3OG9A 4XIGS 5ER6A 5G0UA 2JK1A 3R4CA 1V4VA 1MQSA 1L5WA 1R2QA 2REOA 5BVHB 4NAUA 1RJWA 3VYVA 1J9EA 3ROKA 4F9EA 4MI6A 1AURA 1C9YA 1CKEA 4ROTA 4AWXA 2X7JA 1DX9A 1KU6A 2AMYA 4MIOA 3LHIA 2PKCA 3YASA 1M2FA 4BP8A 3EDRA 3PEVA 4EP1A 1QCZA 4ZOBA 1ZVVA 1ZQ1A 4NE2A 2EOAA 4F1JA 1GT6A 1YCDA 2PYZA 2AUNA 4NNJA 4G8CA 3TCKA 4ZCIA 5KIAA 4M1ZA 3L92A 3ZH2A 1YH3A 4YT2A 3OWHA 3KCQA 4R2WA 1SD5A 1H2FA 1NBMD 2J9RA 2O9JA 1FRZA 1NW9B 3TI7A 2XDQA 3EF3A 1F2UA 4RHUA 1AMUA 4MP3A 4DV2B 1TPYA 2O20A 4NCJA 2C3UA 3LU1A 3C5CA 1TFRA 3S1AA 3TUIC 1AQJA 1NMXA 3MJVA 4GLOA 5C8XA 2X1VA 3TQQA 4YJGB 2IEDA 3AKEA 1KC1A 1NJ8A 2Q5FA 4X63A 3BOSA 5CW2A 2UZ4A 3CIOA 1L5SA 1TA9A 3O21A 2N47A 4TMTA 4EGAA 3VO1A 4F04A 5IAOA 3C3WA 1BDBA 3ETCA 1BFKA 3O8DA 4MS3B 3RTEA 2IJGX 3AFMA 4OCZA 4PYQA 4Q9DA 4XCQA 1QP8A 3PNVA 5FCDA 1QIDA 4U2EA 1KI3A 2EVWX 4GUAA 3QU5A 3QTLA 5BWNA 2GZRA 1GLNA 2XOXA 3CHYA 2NP6A 2NXWA 3N5CA 3WP0A 2GPJA 2CXSA 4WPGA 3VZCA 1DC8A 2BDEA 2IGBA 3JQ8B 1XZMA 3N3AC 3E48A 3SBXA 3BMCA 3UMJA 2OUIA 2NPIA 3O4RA 4ZHSA 3EXEB 1P2DA 3DXYA 3N0VA 4G1UC 4IDFA 3G0BA 3K1ZA 4MR8A 3K9WA 3PXXA 4M0KA 1O5IA 4AF8A 2HLDD 1IRXA 1K3UB 2TMGA 3GZNA 1PN3A 4P84A 4W6ZA 3VU9B 2NPFA 3OETA 4IV5A 2N3ZA 2B5WA 5ES4B 2YCLA 2EIHA 3C7CB 3BHMA 2XYGA 4ZVTA 6AT1A 4PO8A 1XZGA 4PQFA 1JYEA 2ZS8A 1R4NA 2YY7A 4B6JA 3O9VA 4GM4A 3AP3A 2AOTB 5FL7D 3ZV4A 4Y8VA 1AQ6A 2R47A 1HYBA 4BYMA 1VP9A 1PV2A 1FMTA 4QELA 2OXRA 3CZPA 3Q2OA 3ZHUA 4FC7A 5CVEA 4IXNA 1QIGA 2JIDA 2BH2A 3VPHA 3F78A 4QPZA 1XRSB 4URUR 4MR7B 2HHHB 3SG0A 1ODKA 1PQYA 4ON9A 1AKWA 4CZ2A 5LP6A 5DTRA 4YRSA 1Y5NA 1KEKA 3C3KA 1YTLA 4B34A 2I34A 4M49A 5JYBA 4ATNA 2P4EA 1AG9A 1HSZA 2XMDA 5JJBA 4N03A 3Q7TA 3LHDA 3I8SA 3QMWA 4M1KA 1GUYA 3CX4A 3FNQA 4MWZA 4QJIA 5HIJA 4FMPA 3NOOA 4GHWA 2DPLA 2XBUA 4DIEA 5A6SA 2Y0BA 1ID8A 2J41A 5C0OE 3VNBA 4BGIA 5ADVA 5JADA 1SOWA 2CHQA 1GFZA 3VJRA 1PG2A 1KMNA 2BFWA 1KWGA 1JR2A 4QT4A 3AFGA 3DA8A 3PDIB 4KTTE 4RGQA 1C80A 1T9CA 3IX7A 4RHCA 2QM7A 2V8OA 3WRYC 4DIBA 1VL0A 4IDHA 1L8LA 1Y5IA 4TPKA 4UNPA 2BM1A 1KFBB 3TQFA 4D9BA 4UE2A 1W5TA 4BBZA 3CKMA 4NRDA 3V42A 4UZEA 1P0FA 4YT8A 5E6UA 2C54A 2FEAA 1Z7YA 3NHPA 3R1IA 4R0VA 1V8FA 3RBVA 1QYXA 1JI0A 4P22A 3G9UA 4BO2A 3GT4A 1SU7A 4Q3AA 1RLJA 4YUVA 1DBQA 2PT9A 1WCWA 2PZLA 2D3TA 3C8ZA 4GEKA 1LZKA 2QW0X 2EKQA 4TTIA 2J3IA 2WHEA 1O6GA 3TCNA 4BNVA 3FGZA 4Q12A 3E9MA 1V2GA 1YR6A 2V4UA 3BWDD 5B37A 4ZFNA 4KGXA 5IZCA 2P9FA 2Q5EA 2V7QD 5B2FA 5JDIC 5LQUA 4F5YA 3T12A 2AC2A 3WK8A 5BPHA 1V9SA 1FFYA 5HW0A 3VDNB 4OKSA 2AB0A 4II7A 3EEQA 1DKLA 3HG7A 4JJ6A 4Q7JB 4KNVA 1NLFA 1DPFA 1UKAA 4Z9BA 3HNRA 5DYGA 2Z3VA 4UD2A 1R9MA 3H3FA 5IBCA 2Y1WA 3T99A 5E4JA 4GBGA 2KM1A 2FN3A 2A9FA 2EKPA 2IRWA 4B44A 1CP2A 2WV9A 2B7CA 1GPBA 2HGZA 3H8VA 3ORQA 5IZ4A 2R60A 2E7ZA 4Z9YA 3UO8B 1IN8A 3BXHA 5KKCA 4B6FA 4HVLA 4CI9A 4DDVA 5KTYA 1JB1A 2V7PA 5T8KC 3N6RA 2VPWA 1H05A 4G0ZA 1G2PA 3T34A 4J16C 2BFCB 3OMXA 2DUWA 2VJDA 2YFQA 3TNJA 3ETDA 3P4YA 4M38A 4CQMD 3MW8A 4DANA 5FWXB 1XGKA 1Y4SA 3ZDQA 5KQLA 2XZOA 1MW9X 2WP8J 3O9MA 1X15A 2VRCD 4Y6SA 5EHQA 2Y1LA 5G1PA 4HDAA 1DOAA 5BORA 1W30A 3HMQA 5ERXA 2G1PA 1UH5A 1OR8A 1W9MA 4OO3A 3UJPA 1VECA 2F4NA 3JALA 2A9OA 3C5EA 1G0NA 5BW5A 5LNK1 3ETHA 1RRVA 2WT8A 3RT1A 1LVUA 3TIXB 1AZSC 1F8GA 1GGJA 4IDGA 1NZFA 4DPMA 1P4JA 1Q1GA 4X41A 1SG9A 1X42A 1YTUA 1ZESA 4BO5A 1AKNA 4XDGA 2GLUA 2G17A 3L6CA 4UUPA 3P5SA 4C87A 4UUMA 3U48A 4NZ9A 4Q6WA 1T8TA 3ML1A 1U0BB 2OKGA 3IYLW 3SX0A 4ARVA 1Q21A 2FWMX 2J3HA 3W6PA 3OC0A 4MKHA 2AQKA 3RI3A 3O8CA 4R3WA 3WL8A 4D57A 2HRQA 3R44A 4HNTA 5IC4A 1FYWA 3RR2A 4AZSA 3EPJA 4WQMA 2Y9MB 5EVCA 3JQQA 4BBJA 4MUFA 3H9CA 1PGJA 2AFHA 5K09A 4QASA 1I4LD 4GKAA 3ICOA 1YHZA 3V00A 2WUVA 3OT1B 3DCJA 2FPKA 4KR3A 3IHWA 3NTXA 4LKOA 3UGJA 2PKRA 2PX2A 3A37A 1SD1A 4S1NA 4F2GA 1P8AA 1DC5A 1M6EX 4JYZA 3ZE7A 3DE0X 1UC8A 3TDKA 4KI0A 3WNCA 2WSBA 1AGXA 1TX4B 4JVOA 2ASVA 3JRXA 3ER9A 2MJLA 2C5HA 4RH0A 3O47A 5EWJA 1QF9A 2P1DA 3UV6A 5ADUS 1BXGA 1D6JA 3PGVA 4DCNA 4N76A 1ZMTA 1GPMA 3PDCA 1JEQA 4IDDA 4I6GA 3MWEB 4TTAA 4U7FA 5CA1A 1W73A 3H2JA 2RH4A 1M6VA 1KXZA 1ZONA 2ZREA 4B1FA 3EZ7A 5F23A 2O19A 2ZVDA 4EYGA 2J3MA 1OH8A 3S1LA 3JZAA 1Y5RA 1T10A 2A84A 1VJ1A 4D3SA 4DNFA 1XZIA 1XOIA 4TXLA 5AW0A 4S3MA 4C6RA 5HA5A 1A76A 5MN6A 5FTLA 5FPTA 3AIOA 3RROA 4L9RA 1E5LA 4OK3A 2Y2UA 5F21A 2QGZA 4DA8A 2GCOA 2ZUCA 1R66A 2Q4TA 4Q1CA 5AM4A 1WVMA 5TY0A 1UODA 3DDOA 3IUPA 4J7XA 3UUFA 3Q85A 1RADA 4IMJB 1E0KA 3QEOA 1VCIA 4L7QA 3LCCA 3VR4D 2E48A 1GGNA 1Y1RA 1MV5A 3TW4A 2HA7A 3WFZA 2SCUA 1F5NA 2E4YA 4C2UA 2C61A 3CZ5A 4Q3EA 1IWOA 3K8OE 1ZCFA 3OP1A 4A91A 4R7TA 2D6FA 1SRRA 4LDJA 3DKIA 2XHZA 3R8XA 2AK2A 4DGSA 2VDLB 3JXEA 3LP8A 4JI7B 2W2PA 5AHOA 1KTIA 2FETA 3AM1A 3QWFA 4MKIA 4NENA 1NC3A 1Y8RA 3M4YA 4UQOA 1A1VA 4M21A 1VTKA 2W6JA 1V96A 4M1OA 1N0WA 5EFOA 3O7MA 2FX5A 4HBZA 5HP4A 3EFOB 3L77A 3HK2A 1QQ7A 2P5SA 5KQPA 1JFTA 2WT9A 3S0JA 5BWCA 4DWOA 4EBFA 3RBAA 2XE8A 3BERA 3E3LA 4GE3A 4ECAA 3SCZA 2Q07A 4KBFA 4LXTA 2UYOA 1NXQA 3UWOA 3FI0A 5KNCH 2R00A 3ILVA 4AY3A 2YUIA 3R4VA 4L6AA 3V4PB 1Y9EA 5CX1A 4GP7A 3ICEA 4LRQA 3N8GA 4FMBB 3OZRA 4JX9A 4N01A 5CIWA 2DKNA 1AS2A 1F0NA 2G9ZA 2AI1A 5D6OA 5HQ3A 2FI1A 1FUKA 2Q2VA 4R05A 1OWLA 4KVFA 1AXRA 3I64A 4XASA 5AM0A 3VHLB 4BE4A 1UQUA 1ZSVA 4Y6OA 1FS6A 2BI7A 2XMRA 1ST2A 4F7DA 1C3XA 3DZHA 1ESCA 2QG4A 2IS4A 4TWBA 3EAQA 3DMFA 1BCRB 3L8YA 2GDZA 5FUQA 1Q0LA 1U0RA 2F67A 3EDCA 4KRGA 4OM8A 4PQYA 4Q82A 1QIHA 3MT0A 1KSGA 2G72A 2IHUA 5JS8A 1MP0A 4U7WA 2PVPA 3D1JA 4B5KA 4RJTA 7YASA 2VNSA 4IJ5A 2FLKA 1I1NA 4DLKA 1YGPA 3U19A 1F6DA 2Q0QA 8LDHA 1YL7A 4RK4A 4V3CA 2H54A 1ZUD1 4W63A 4PSAA 1DO0A 3GGSA 5EY5B 5JCJD 2NV0A 1KAOA 3IC5A 3THYA 1KPHA 3A9UA 1WXEA 1SOAA 1PQ4A 1ZGGA 2FN7A 2FX3A 2GEUA 4AJKA 3GUUA 1K7XB 4QBKA 1QGOA 2HV9A 3EIXA 4O0LA 3RFVA 4DUPA 4HEA1 1GNQA 2AG8A 3CR8A 4AXBA 4QT0A 1KI8A 1KR2A 3AVPA 3QF4A 2IZ6A 2BIFA 1GGFA 1QFZA 4P98A 3WZMA 3PIIA 5CYPA 3TQCA 3AWIA 3UGKA 4BL5A 4CHGA 3JRWA 2CDCA 4NCAA 3NHBA 2AT1A 2Z1MA 3AHJA 3REFA 5AUQA 4ER6A 3LP5A 4BDSA 4Z54A 2IU6A 5LD2C 3PX2A 4P7JA 1TQ6A 3O2NA 4MCAA 5G41A 3U4QA 5WRFA 5AUNB 3KSDO 2CLIB 4TYYA 5T4BA 4BX0A 1VRWA 5H5JA 3DOIA 1KEWA 5FFNA 4WESB 4IDCA 4A92A 3U09A 4Z4FA 1DJPA 2Y77A 3HNOA 3KQTA 4PFSA 4CM4A 5C7IO 1FVHA 1SK9A 4KR2A 2VHZA 2FPGB 2XWSA 1IDN1 4RGYA 4CEIB 1BYIA 1II8B 2QN2A 3NIWA 3PKJA 1FSFA 4BASA 1ISSA 4Y6LA 8OHMA 2ZIUB 2A1IA 2DFTA 4WGGA 4EB3A 1XG5A 4YYEA 2YHBA 1SKAA 2E21A 3M6XA 1VCOA 2VHXA 3DL0A 4IDQA 3A31A 2IZZA 1Z28A 4BVBA 1SOVA 1ZOIA 2B4TO 3BSYA 2P69A 3MT8A 3DLBA 2PUEA 3K16A 3OCYA 1TF7A 1QOZA 5I7OA 4NV0A 3ZW8A 1IG0A 4ICIA 5ETJA 4KIUA 1BWPA 1WUKS 4GH5A 4I19A 1K27A 4DA0A 3LKBA 4BLWA 1ZW1A 3VUFA 2ZUDA 5EYPB 3JATB 2GZAA 4JI1B 4DCSA 1U3DA 3GW8A 4WBNB 3QXJA 2IHTA 1DC7A 1OAKA 3HJGA 1N25A 3QVTA 4MQFB 3TD2A 3QTBA 2P0AA 3VR5H 4EMSA 2CDBA 2PKQO 4XGKA 3GOHA 3RKUA 3VNSA 1JXAA 3QPCA 3V9PA 4JLOA 3WNZA 2IIPA 1EP3B 2VK8A 4YR9A 3OF3A 3HO1A 4TTJA 3RYHA 4IO1A 2V5VA 1Z7EA 4HJXA 4JENA 4OB7A 1ZCZA 5JQGF 4ZVMA 5B4VA 5C8ZA 1V39A 3K73O 1CUIA 2QSYA 3THRA 4D9NA 4PSCA 3KQWA 3ZWNA 4B6PA 5I4CA 4HAWA 5EMLA 4BMZA 3TGPA 2C7RA 1P62B 5CYFA 3F2VA 1JAZA 3CW2A 2A4MA 3FH0A 4YQZA 3QRWA 3WLSA 4AUMA 5F3WB 3RS0A 1T13A 1RYMA 3ZY4A 1YDEA 1Z6AA 4YGXB 5EHGA 3DEIA 3PC7A 4AJ9A 1HBJA 4P7GA 3OQMA 1YI1A 3KSMA 2CNNA 3CVUA 4Q05A 4QD3A 1VKNA 2BEUA 1CR4A 2R8YA 3LIIA 1RAGA 3JR7A 1WB5A 2PD3A 2LV8A 1GXSA 3MF4A 1NVUQ 1YZVA 3PNYA 3STUA 3V4LA 4EX7A 4OF4A 4AQYB 2OY0A 1QO0A 3UKDA 5C46F 4A23A 2BP7A 5JD3A 2GK4A 3T3OA 4H60A 3CU5A 3GN2A 2EKZA 3OWXA 4HMQA 3ZWQA 3TZEA 2A5DA 1G5PA 1LV8A 1W0JD 4WNCA 5C1BA 2VO1A 1GSIA 2X9VA 4P7FA 1E9CA 2GEVA 1SPBS 1RXEA 2GBLA 3EVAA 3GVPA 3I6MA 4WZAE 5A0TA 3LLMA 3H5WA 4W1PA 3KKOA 3SHOA 4RF5A 1KHHA 3R9IA 1JDJA 2V7GA 5COAA 2Q1UA 3ZU3A 1KFKB 1JYFA 3DDCA 5GAJA 4XYGA 2QN7A 4EG0A 2IYOA 3PXAA 3DR5A 2UZ1B 2MINA 1PVVA 2OGSA 1DG9A 4WBNF 4ZYTA 4GPEA 4I46A 5HUJA 2OCBA 4N7JA 5ARCA 1V2HE 2PT7A 3ZEIA 4A1OA 5IXJA 2DZDA 5COBA 4PLFA 3FKJA 5EIWA 4LI0A 2ZIEA 4E4YA 3QIAA 2GYWA 1UFQA 2C82A 4X24A 2CLFB 2FUG6 1TEHA 4JL8A 1BMQA 3AW8A 5DBOA 3EXG1 1GPUA 3H65A 2CVFA 2E82A 3WA6A 1NATA 4R2JA 3ZCTA 3JAWB 3RTGA 3SEAA 3SC3A 1CJTC 1XF9A 1I7QB 4C4ZA 1P7WA 1OZHA 1OFUX 3L6RA 3LX4A 4YDQA 4HYEA 2PMKA 4LE2A 2P9CA 1E1CA 4HGNA 1GPH1 1G6HA 1BRMA 3U4IA 3K8YA 1SCDA 4BUCA 4E33A 4ESEA 3GLGB 3VU1A 2R8PA 3SM3A 3K4HA 4Q7KA 3SBOA 3AOEC 2P9YA 1XEFA 2B20A 1E79D 3H8WA 4Y2XA 3U3DA 1YQ9A 3GXOA 1ZI9A 3HVRA 1U1IA 2AJBA 1NPYA 5TJ9A 5JXWA 5KJFA 3UXMA 3OJXA 4AP9A 5CBPA 2AX3A 3DF9A 3IAS6 2XQJA 3HACA 2Y2VA 3KD3A 4XYBA 4BLOA 3KB6A 2ZIGA 1NJFA 4J6EA 3QG5A 3TAHA 2CJXA 4EEKA 4M76B 4N0PA 1K68A 4Q3CA 3N8KA 1QTIA 4XIJA 1RCFA 1W75A 1CUYA 1G5HA 1D0IA 3N0TA 5EPOA 4GE0A 1FQWA 2Q6LA 3OIGA 3FR7A 1D8TA 1BW9B 1Z88A 3AYXB 4YJ2A 2ZB3A 4WK2B 1W6UA 2IY9A 2QTZA 3ABSB 4O1MA 4I9GA 3NDIA 4J94A 4KO1S 3ZKWB 5HQJA 1PW7A 3CCFA 4N12A 4O08A 4S1OA 2PR7A 3QLUA 5J2UB 1GNTA 2FMFA 3ITNA 4QDUA 2PJRA 2ZYUX 2PT5A 1FP1D 2YYYA 3RYTC 2C77A 4XXHA 1DBIA 5BYJA 1OH5A 1MJGM 3INTA 1KH1A 1R10A 2NZWA 2DH6A 2OSBA 2V6GA 2VP6A 1L1RA 2GRAA 3ZX5A 3CKLA 1WPXA 2WJ6A 3COJA 1XTIA 3I42A 4UEJA 4W8GA 1P91A 2NO9A 5IBPA 3D2BA 2FEMA 3EXFA 5JJKA 2HRRA 4BLQA 5BN3A 4KYVA 3UOGA 3AF4A 3EIHA 5K8TA 2JRCA 5EGSA 1Z4JA 1C3OB 2C92A 3LPNA 1V47A 4NBWA 3B7WA 2V7EA 3QQ5A 3IT1A 3MRXA 3EDOA 3RHFA 3EFHA 2IOFK 4IIUA 1OLSB 2CLMB 4Z51A 4RM3A 1EG7A 1XLTA 2RK6A 1REQA 3KQHA 3ITDA 1L5KA 4YCSA 1RC8A 4TV9F 1KDRA 2BTOA 2BZ1A 1ZR2A 3IDZA 3ICWA 2FZ4A 1Z2OX 1NBAA 1WZNA 1Y81A 2ZXEA 3OUZA 4TMYA 4F9TA 4C7OA 2DGDA 5ALSA 1Z0IA 4QOHA 2Q9AA 1CERA 3FRHA 5B1YA 2V5UA 3THXB 5IN4A 1VJCA 4KJXA 4XCXA 3H1FA 5EI5A 4X7BA 4Y3UA 2VJNA 2DKOA 2DULA 3JQEA 3VISA 4Q7EA 1U5BA 3JWPA 3DFZA 3FMPB 4U6QA 1PJQA 2A7QA 4OAQA 5CX4A 4F8EA 1G7SA 1ZOLA 2EV9A 4IDAA 3SIWA 4PR0A 4ZPJA 4PRLA 2FWBA 2WAOA 5C3MA 3BDIA 5CT5A 4UHEA 1C1HA 4C21A 1ZD8A 1GEGA 1SAYA 2PZKA 4NU5A 2ZJ7A 1Z4PX 3BBLA 1CQZA 3V4VB 2XF8A 3P2EA 5J2UF 1PV4A 1W44A 5JSHA 2VTKA 5L3SA 2Y93A 2O7QA 4JT4A 1M2HA 3TCXB 5DNYB 3DEJA 1GA4A 2KWIA 4RKFA 1Z74A 4RUKA 4Y9DA 1B2RA 1PK7A 5I48A 4ARIA 3WYFA 5BVHA 2XJ9A 3RVBA 4E08A 2J30A 2C8LA 1CS0B 3T0FA 3UJNA 1DTWA 2FMIA 2ZJ2A 1IH8A 1UDCA 2PV0A 2XTMA 2W2QA 4G0XA 2JCYA 1VDZA 3HYLA 3NHJA 2BSXA 4GGOA 1DRWA 4BBAA 1IUKA 4G0OA 5K0TA 5DTJA 1U2SA 5DGIA 2NNLD 4LRSB 2OECA 1MO5A 4JR2A 4LECA 2O8FB 5KSYA 3LC2O 3ANMA 1GTVA 5C51B 2JZOA 1ZSNA 3ENZA 2RHRA 3FCSB 4QARA 2AMVA 3AUTA 3E0XA 3RRXA 3SQDA 1P4HA 1SKYB 4EG3A 3G8BA 5KVAA 1FVFA 2DQSA 4KDFA 4DBZA 1DXYA 5CFZA 1DU4A 3HGMA 1EB8A 2AJ8A 4Q0MA 4PFQA 3CWQA 4NYJQ 1M1NB 3D8BA 4YJGA 5KNDH 1AGPA 3LQQA 1C1DB 3KLMX 1E4OA 2PX6A 3PICA 1JHUA 1VPTA 4OJYA 1YR2A 4WH0A 4EB6B 4XRGA 2G09A 1N1MA 1G20B 1Z06A 2C5EA 4MDFA 2YZGA 1T36A 2ZP1A 3DOJA 4DLNA 1LRJA 2IY8A 3CCCA 1LX6A 1ZMXA 4MI9A 4EFKA 1OXXK 4JNCA 2ZUTA 3MIIA 4XWWA 1RCUA 2ZSKA 4KDCA 3BXXA 3K70C 2E6KA 1QLJA 2DBRA 2VHYA 3GQVA 5AJTA 5FOSA 4DR7B 3C98A 5DEOA 4GVXA 2NGRA 3BK7A 3H3JA 1GRVA 1HEYA 1M6YA 2ZYHA 2X42A 1XMSA 2BFPA 3IIIA 3JQ8A 4E5DA 3E35A 2W6NA 1XRQA 1FBTA 1VCHA 4ZV9A 3EVEA 2ZVPX 1FYEA 2GM9A 3RVLA 3CM0A 1X77A 1N5JA 1Q12A 2R4TA 2ZAOA 3D4PA 3PYXA 4IMRA 4C4AA 5KB3A 1M2WA 1TAUA 2BMVA 4DJTA 2J32A 1FXSA 2C3PA 3M6WA 3EC7A 2QX8A 3VU9A 2E6UX 3AIMA 2BJWA 4G6ZA 3OIWA 4KLNA 1BTOA 1CQXA 1W85B 1LVHA 2XY4A 2G9UA 4UVIA 5AW5A 1A0OA 3ENQA 1KZGB 2CHUA 1RJDA 2YINC 4N0EA 4NYMQ 3SNHA 2XMCA 2Z5VA 3BRSA 3RS9A 3QNWA 1KY2A 3WKBA 3OCJA 1A9ZA 4QXAA 3EB9A 3M0EA 4QRHA 1TTPB 2AOTA 1X7GA 3QXCA 4MKFA 4C7KA 5PGMA 1HRKA 1PNOA 4MKRA 5CU7A 1QIFA 5E7MA 4B75A 4C4XA 4M9RA 1RW4A 3KYDB 2V59A 3PDWA 1AKRA 3SMQA 3ZXSA 4ARUA 1E4EB 5DTIA 3ZWDA 3EWIA 1SC3A 2GNAA 2IUTA 1YSCA 4CKZA 3ECCA 4CV0A 4FNMA 4MR7A 4RACA 4EGSA 4L22A 4YHHB 5DLPA 3ZHBA 1P6XA 3CE9A 5JSKA 1FW8A 4DV0B 4GQAA 4N49A 2VQFB 3K70B 3LUDA 2O8BB 1H6DA 2V1XA 4DJFC 1XYGA 1R4ZA 3ZXUB 4M7OA 3AUAA 3N53A 1RRKA 4TGLA 1IQ0A 1G21B 1X8JA 2CN1A 3QY9A 3DAHA 1EFRD 1I4WA 3KT8A 1E1LA 2OMKA 2O3SA 5ARBA 1ZO8A 1XZCA 1DAGA 5TS2A 4M3NA 5BWLA 3NO4A 3GEEA 4LE0A 4P86A 2X14A 1P3Y1 4P2GA 1SXPA 3THOA 1OC4A 2GWHA 4EJSC 4QSHA 4OJTA 1TIPA 3ITKA 1QNFA 3PDIA 1XQVA 3SYKA 4AJNA 4CF4A 4JR0A 5BMVB 1YZQA 2NQ8A 3HKEB 3IIJA 4D3FA 1K0UA 3Q3GE 4WXMA 4E51A 4EJFA 4L4RA 1I4OA 5F7JA 3F7OA 2CEAA 1R8XA 1V48A 5AKXA 3VDQA 3OO0A 4FHZA 1RRGA 1BX3A 1H4SA 1PR9A 3LNCA 3AERB 3GV0A 5H0IA 2YNMC 2ZUVA 4V0RA 1K7SN 4OATA 5KYKA 4RH1A 1T29A 2PL3A 2B9VA 1IM8A 4AMYA 1E1QA 4YAWA 1OH6A 3I5XA 3VR3A 4W5JA 3W8RA 3BFVA 1AV7A 3OJWA 3OPMA 4OREX 2WAMA 3S2IA 1YFLA 1FNDA 4S05A 2J3DA 4YRIA 1KJJA 4LF6B 2YV5A 3GCGA 5IHXA 1NUTA 1O0BA 1VE3A 4CNQA 3T35A 5DGCA 1EZZA 1SR8A 3A6JA 5TIIA 4BQNA 2Q1WA 4HDQB 1QFYA 4DA9A 5A7GA 5EINA 3VZQA 4GMXA 1XLWA 4QUIA 5EKXA 5ICEA 3MTJA 3ZU5A 2XCLA 4WZAA 2I7CA 1P61B 2P7IA 4ZI2A 4TUYB 3NAZA 4FGSA 5A0FA 3NVDA 2JFOA 1L4YA 4WWHA 3TG2A 3T5MA 4QOJA 4E15A 3Q5DA 1UOPA 3AI7A 3GF4A 3WRYA 2ZSHA 3P45A 3CB2A 3W06A 4B79A 3TXAA 1Z37A 3V4FA 2HRBA 3RRMA 1GO2A 1YNSA 4AKIA 2WM8A 1OZFA 2A4KA 2AHOA 3A1EA 2BFCA 4RS3A 3QFSA 3CEMA 5J59A 3R3JA 5FWXA 5CLJA 2FLVA 3ZQ4A 5BMVF 5KC9A 4J1TC 1O3YA 4EO4A 2J33A 1I2MA 1KARA 1QQTA 5J9FA 1PLJA 4LOAA 1LQ2A 1TZJA 3DKKA 4NU0A 3BH6A 2E4AA 2Q0SA 4QBIA 3EQ7A 1DINA 4FNOA 1PZFA 4PAOA 4BGVA 3AILA 1QPZA 3IQXA 2IZ0A 4G4JA 4C76A 5JDIA 3TLXA 3FUWA 4WFIA 2GLTA 4K9DA 1UJBA 4PAGA 1XK6A 4EELA 1SCKA 1UXHA 1VHTA 2RHMA 2HJSA 4GWKA 2D1SA 5IT9A 1E3WB 1SRQA 5ALUA 4HH4A 1N8TA 3L05A 4ND7A 4ZDWA 8GPBA 1HI9A 3D5TA 1P9LA 1XZPA 1R4MB 3IKMB 1QLWA 2XXBA 4G0PA 3EQ6A 1YB4A 2J85A 4MCJA 1Y3AA 2QV7A 2RK4A 4YRLA 1JQLB 1YQDA 3T7CA 3HL4A 1MAUA 4FE4A 4FSHA 4XZ3A 4GVPA 3MINB 4KVGA 2AF3C 2P2NA 1L8OA 4G8DA 4IF6A 4TUYF 5T8KA 1OB5A 3ZDBA 1SELA 4J16A 3KEQA 5A2GA 1E96A 1R0CA 3AB8A 2C5AA 2A1TS 2FFRA 2BRUC 1RPAA 1XZKA 4DA6A 5K0NA 1AA9A 2ZUUA 5DHPA 2PZGA 2WICA 5F5XA 3IBSA 1FMJA 2JAPA 4YJHB 5CCEA 1X1RA 1G2QA 3PXDA 2OQIA 1WMSA 1B8VA 1E32A 4E5UA 1JLLA 3SJAA 2WHXA 2QRGA 3TEJA 4QU8A 1OU4A 1DAIA 2JI4A 2QAGB 1WY7A 2VDWB 3MWEA 3WOVA 3ZHSA 4L8YA 4DQUA 1JNYA 5LN1A 4P0TA 5T6BA 5K20A 1ADCA 5CA0B 4JI5B 1EFTA 5CK4A 3IQIX 4MB6A 2YIMA 4BFYA 2YZKA 2H9AA 2QE6A 4O0MA 4V0KA 3WE7A 1VBMA 3EJWA 4II3A 2I8AA 5T41A 2FRDC 3GJ4A 1B1CA 3IAM6 4X1YB 1JDVA 1GL6A 3K32A 3GL9A 1DQYA 1E20A 1E2NA 3D0OA 3H9JA 4MLDA 2ZWAA 2JD1A 3MK31 4NHEA 2IZ7A 2PXXA 1XJQA 2WY2D 1NKTA 3T9FA 3T94A 5KJ1A 4OLHA 1Z0JA 5U9CA 1EQAA 1HE3A 3ZOKA 3UF0A 2JIPA 2XA2A 3L7NA 4FLMA 4BO1A 1TYBE 5REQB 3IDOA 3SJ7A 2HY7A 3QU7A 4NZMA 2H5JA 4XOIA 1RC0A 2XMBA 3S8YA 4PGMA 1FFEA 1XD2A 5FR2A 1EFHA 3RS4A 4D4LA 5EJEA 3PTAA 2ZI5A 4H1TA 4ANFA 3IRUA 1OZAA 4PAWA 2ZATA 1HYGA 3LGXA 3TTXA 1CB0A 1RE0A 4KGDA 4BO4A 5B7QA 4UVGA 4IS2A 5AHXA 1VYHA 1YR8A 4HNHA 3EFOA 4MV0A 5I9TA 3I83A 5LA6B 4DQVA 1DNPA 2B69A 3SF8B 3V46A 1NSTA 3D6UA 3NAGA 1OX5A 5IJXA 1E3QA 1DMSA 3QVJA 4CDRA 5IU6A 3GGGA 3MYRA 4M8KA 1DZ3A 1UJ5A 1XKXA 3G5LA 3K09C 3BREA 5AK3A 4RHYA 4BLSA 3JQ9C 3DHEA 1ZCBA 1U11A 4PBTA 4E14A 4XD7D 5GM1A 3I9KA 3MTGA 4I1SA 4D44A 1W5EA 5FUMA 5CA0F 1ILWA 2JFQA 3WL3A 3MCVA 2IXGA 3MUOA 1JSRA 2VI5A 2D2IA 3G9QA 3K31A 5F51A 3CPJB 4N82A 4NBKA 2MSNA 2PYDA 4Y1GA 1QDEA 3VDXA 3FZQA 1SKYE 2C1ZA 3AHFA 3GGDA 4DPKA 4FK8A 1HDGO 4R9SA 1WZIA 2OEPA 1X3SA 4YB8A 4MP6A 4QWWA 1B8UA 1BCRA 3H11B 3JQCA 4PTZA 5DP2A 3T5CA 2QX6A 3OU6A 1SZCA 4O02B 5JPIA 3CF0A 4YLEA 1WSWA 2CXQA 2ECKA 2PA3A 3DTVD 5ENVA 2JVKA 3N2IA 1AQLA 1LW6E 3F3SA 1Y34E 5DTMA 3KR1A 4QDTA 5LZ5A 4FGUA 1T2EA 2G83A 3KXDA 1FNCA 1XFDA 3UENA 2GT1A 1W2WB 1XTBA 4HADA 2Q6OA 4P3NA 3WQSB 1WY5A 1IIRA 1XPJA 2ID9A 4CG1A 5C52B 3QEBZ 3JASB 5JQGA 1N6IA 1D9ZA 4YT4A 1F6WA 3R9WA 2VDOB 2FQQA 4RQBA 2O5CA 4EARA 3SEQA 2Z6AA 1TM4E 4KV9A 5LA6F 3OZDA 1XAGA 4U8HA 2B7BA 3IB3A 3W5BA 4L2IB 2K87A 3IR5A 3TVDA 2C57A 1F8YA 4F3YA 1T2UA 2ODTX 2A0WA 2G8NA 3OD5A 1FJHA 1FRQA 2QM0A 4WESA 3TLGB 2I2XB 3P8ZA 2FVYA 2ODNA 1SB8A 5FNZA 2WWXA 3WLEA 1UCFA 4W5OA 4ZV7A 1PFUA 2FPGA 4ZP1A 5ITVA 3IKTA 1RLTA 2GK7A 4CEIA 2XNDA 1II8A 2PH7A 1EAMA 3GDWA 3PHJA 3L02A 4WFQA 4BDTA 4PN7A 1E6KA 2DPYA 4J8PA 5CFOA 2X15A 3WK7A 1RMTA 3HABA 4ZT6A 5TEWA 4ENPA 4MB0A 5LP1A 1WMDA 2W00A 1YCHA 2HMSA 5BURA 1BXRB 1BZYA 2BBOA 2QNIA 2HCBA 2I7TA 4HMPA 5E1OA 2DHDA 3JWEA 1GN9A 1KS9A 2WKQA 4N3CA 3IUMA 4X9XA 4C08A 2W6ZA 5BPFA 4YCCA 1VSTA 2P9JA 4R4JA 1KIAA 3FTCA 1M0TA 4KLAA 5IRCD 2REXB 3C6XA 3D2AA 4X71A 5EYPA 4DQ0A 2FCAA 3FOCA 4MQUA 4WBNA 5I9BA 4JB3A 2QN1A 3F49S 3PUJA 3QKSB 1Z13A 3K96A 1YS6A 4LCJA 4MQFA 3NIGB 4WEOA 4C05A 4X44A 3QXHA 1U8UA 2G4VA 2ON6A 3K0CC 2MSCB 3PNMA 4EHLA 3JAMA 3R41A 3RJ9A 5EQJB 5EQDA 1NBWB 5G4LA 4EG6A 1C4WA 1KMCA 2BTQB 1Z12A 1VHJA 2D59A 2W6MA 1D2MA 1QE5A 2WD7A 4BCDA 3OLWA 5CDHA 2CCGA 1Z39A 4JVNA 4M83A 4KOEC 2O2GA 5EJFA 1RLUA 1U02A 4CE6A 3QBVA 3HV0A 1ZMRA 3IOBA 4CM8B 1UF9A 5IK2A 1R18A 3DV2A 3EUEA 4K9LA 3IPRA 4KI7A 4KUEA 2ZJ3A 1NI4B 5E4YA 2O2YA 1Z15A 4G86A 6REQB 1XZHA 1RHJA 1LSJA 2YWGA 2ZI4A 3BH7A 3L43A 5AOAA 1O95C 2JH3A 5BN4B 3CZ9A 4YQFA 2GARA 1T9DA 3PQ8A 4EB0A 1Y3IA 2C42A 2PX0A 1Y5LA 2GHIA 1PGNA 3F5QA 3PIRA 1U1FA 5KVQA 2RG7A 1ZA1A 2NUTB 3AVUA 4BNUA 1SQ6A 2EL9A 4BFVA 4CUJA 4N5LA 2YY6A 2XV1A 5K3AA 4OK6A 1K3TA 3UHJA 5CH8A 3RAJA 1YS2X 3LS2A 1T26A 2C2XA 1FDRA 1VPDA 4MW1A 3UMBA 4TYNA 2OBXA 5LMNB 1NJ1A 5HF9A 2EFGA 4I4TB 1XWWA 1TAGA 2WKPA 4QPDA 1HNZB 3E3OA 4RZIA 4NV1A 1H1DA 3ZZ1A 4K81B 2UZ1A 1XLVA 2WJPA 3KQNA 1IWPB 3QUAA 2V4MA 5DBEX 4JLSA 3AO0B 2GN8A 4ID3A 4PLPA 4HB3A 4NCHA 3E6AA 1R5OA 1VE5A 3A3KA 3AI1A 1BIFA 1EZ1A 3H84A 2BI8A 2YJNA 1Z47A 1JWBB 2QRHA 3H1TA 4K6HA 5TF4A 3OUTA 1UEJA 1IC6A 2INGX 3NKLA 4NPAA 4EJMA 1R3DA 2YHUA 4AT1A 3VR1A 4R98A 4LN1A 3ZX4A 4Q9KA 4QTXA 2X4IA 3GVCA 4OLJA 3T4PA 1HNNA 1Q6ZA 1B6SA 2BGJA 1GPLA 4Z8YA 3I1YA 3RPEA 3UT5B 4FDMA 3UICA 1TTQB 2GQ0A 3DTVB 3E15A 3PFFA 2P1ZA 3NHKA 3B20A 1V8DA 3MCUA 1GRCA 4BGUA 2R8ZA 2XQKA 4FC6A 2HDWA 4LJ6A 3PPYA 4FUTA 3R9KA 4DCUA 4ENQA 3ST7A 3LRXA 1NE2A 3KWLA 2UZAA 1KRWA 3LECA 2OO5C 1PR0A 1O94D 3LWNA 5CNIA 4EENA 3I9OA 3EIFA 1QS0B 1EP2B 3NHWA 1B1AA 1JJ7A 3QSGA 4IJUA 3K7EA 4TV9A 4WIAA 2A1UB 5FO0A 4WY2A 1M76A 1H3NA 1F17A 1PFYA