5KWJA

M.tb ag85c modified at c209 by amino-ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kwjA00
3E4DA 4BDSA 4V2IA 3WK7A 4D9JA 3FSGD 4TPKA 4Q82A 5AI8A 3IVMA 1H2WA 4EY8A 5F4ZA 1CVLA 4KE7A 1Y37A 2GBCA 1ZI6A 2E3JA 3DNMA 4PF1A 4CIAA 3D4LA 4OD0A 3WI7A 3BXPA 2BCEA 2H7YA 4A23A 1C4XA 2J4FA 2XI4A 2XMSA 3AZQA 3PF9A 4Y2YA 2DQZA 3NOXA 4Y2JA 4LXGA 1ACLA 1WPXA 2XLCA 2W6CX 2QM0A 3FVRA 1UK7A 2I03A 1DX4A 3GA7A 3MGAA 4C88A 2YXPX 2QKYA 4KAAA 3F96A 4EZIA 4G8BA 2ACEA 4IO0A 2WFLA 4BTLA 1AQLA 4H7IA 2VT7A 3O4JA 2XQFA 2PSDA 2J4CA 3KXPA 3OOSA 3BJMA 2CUTA 4ZI5A 2V9ZA 4BCCA 3IUJA 3WIOA 5KWIA 2GYVA 3B12A 4Y7DA 2HM7A 1TQHA 2V97A 4FNMA 2JBWA 2PKYX 3W06A 5HZGA 1N1MA 4G4JA 3HJUA 3F9CA 2VJDA 1XZFA 4G5XA 4Y2PA 5DYTA 2O2HA 3D3NA 3T4UA 5AI4A 2JGLA 5FLKA 1R9NA 4HS9A 1TAHA 4AB1A 1DWOA 3QPDA 3H2GA 3BIWA 3HEAA 3C43A 2LIPA 3PICA 2BUCA 5E4TA 5JYCA 3ANTA 4B85A 3FOBA 1YCDA 1AGYA 1CUHA 1A88A 3DOHA 2K2QB 1XROA 1BE0A 4UBKA 1MNQA 3W04A 4KACA 4BCBA 4LKOA 1BROA 1LZKA 3OM8A 4YK7A 1EB9A 5BWCA 2OGTA 1G4HA 5AM2A 4F21A 5JIBA 2PSHA 5D7BA 2B20A 4FBMA 4H35A 1GKLA 3RARA 2XQGA 4FLFA 4AZ3A 4EY4A 1GKKA 1YS1X 3M3DA 3NWOA 3WJ2A 4RE6A 2Z5GA 1R3DA 3ESDA 4F60A 3QYJA 3EBLA 4E15A 1N8SA 1YAHA 2XUHA 4KE9A 1BCSA 1WB5A 5HK9A 4AN0A 4MYDA 2ZJ6A 1YR2A 2AJDA 4JYMA 4BZWA 5LKRA 3NGMA 4L72A 3H0CA 1ETHA 4BRZA 5ALZA 5A6VA 2HL6A 1K63A 3M81A 3N2ZB 2VF2A 4LXHA 1JT2A 2JEZA 1KEZA 4X00A 1K8QA 3D0KA 1J2EA 5EIEA 3DLTA 1MX5A 1CUDA 5AI9A 3VJLA 1BEEA 2VEOA 3HC7A 3VVMA 4L9AA 2WTMA 2Y6VA 2J3DA 1B6GA 5DJ5A 3I2KA 1THTA 5AM5A 4Y2SA 5E4YA 3D2AA 3WWCA 3HZOA 4X6XA 1K6EA 5HFNA 1UOOA 4J0HA 4DNPA 3E0XA 1ZD5A 5ALWA 3WZLA 2VATA 1LPSA 1Q84A 3C87A 2DHDA 3SC2A 5IKXA 4B84A 3WK8A 4DMCA 1EVEA 1T2NA 2JGEA 4OB7A 5JALA 1SFRA 3O9MA 4OUKX 2C4HA 4KAFA 4U2BA 2XQIA 2GYWA 2C58A 4J0IA 4GWLA 4PSDA 1FFBA 1QO9A 2DQYA 5C8VA 4Q34A 4C4XA 4QLOA 4M0MA 2HFJA 5ALVA 5FP0A 1CRLA 1ZJ4A 1QFSA 2G5TA 1HPLA 1FFCA 4PQEA 5CH5A 3MUOA 2QXUA 2RGUA 1YS2X 1CEXA 1RYYA 3V1KA 4MQLA 3WK5A 4KEAA 4HAIA 3C70A 1VA5A 4Y2RA 6YASA 1QIDA 3BDVA 3R3ZA 4O08A 4K6GA 3JYHA 4MEAA 2OQVA 2GBGA 3FBWA 2XUAA 5T4FA 1CUFA 1A8UA 4DSAA 5AKJA 3V1MA 3R3UA 5ALXA 2WM2A 2B4KA 1U2EA 4FBLA 3IUMA 5CBKA 3ZV7A 3AIKA 4J3JA 1VXOA 3PF8A 4UBNA 5EFZA 3ZWQA 4H7HA 1HBJA 1XKTA 2BJHA 3WA6A 2AXEA 2XE4A 2O2GA 1IUPA 1QOZA 1AKNA 4L3WA 3I2IA 2CJPA 3WYNA 2I78A 4BVJA 5EHXA 4WFJA 1JI3A 5AOAA 2XB6A 1QIFA 1S8OA 4FWBA 4U2FA 4J0JA 1CUZA 2ECFA 2D5LA 4OB8A 3U0VA 3X3HA 4WY5A 1LLFA 5DYYA 5LZ5A 2H1IA 5HK8A 5K3AA 4BC1A 2O2IA 2XUFA 3G0DA 5ALLA 4GLBA 1XZAA 3U1TA 3ZPXA 3K6KA 5A7HA 3FYUB 4E11A 3R40A 2WG2A 1DT5A 1ORVA 5ALGA 5DNVA 4AZ0A 2VAXA 1LBTA 4BZZA 3LIPA 4BRSA 1NU8A 1ZGCA 2XMDA 4B7ZA 1AC5A 1W6RA 3PFCA 4RGYA 1SCKA 5ALQA 3CCBA 4YX9A 4A5SA 1IZ7A 3G0IA 1L7QA 4B6GA 4B9AA 2BAGA 3AZOA 2DFPA 2J3QA 1OCEA 2X8BA 5K3BA 5H3HA 2OXEA 1XLWA 5AI5A 3DYVA 1BRTA 5SYNA 4BYMA 1H2ZA 4EY6A 4UHEA 2JGIA 3O0DA 5DTJA 1YA4A 1TKRA 2W22A 1THGA 1UOPA 2D0DA 1FFDA 1XQXA 1CR6A 5T4EA 1QJ4A 4RPCA 4DIUA 5LZ2A 3L1IA 3V1LA 4Y2TA 3EQ7A 5IVDA 3AIMA 3I28A 1GXSA 5K5EA 1R50A 4MQMA 1ORWA 3I6MA 5C8XA 2PUJA 2HADA 5JZBA 1VZ2A 5CTAA 2GBIA 5AKEA 2XUKA 4UHFA 4CG2A 1JJIA 1ZIYA 1L7RA 3LP5A 2G4LA 3DYIA 5AO9A 1H2XA 2B9VA 1NX9A 1Q83A 4ARAA 5DNUA 5JANA 5AOBA 3DOIA 1CUWA 3DL4A 5HKBA 5ALOA 2RIPA 1Y7HA 1BN7A 4WDQA 5LZ8A 2XQJA 4G8DA 4IH1A 2HRRA 1AUOA 2C5FA 2PSEA 2JIDA 2UZ0A 1MPXA 2XT0A 1JFRA 3STWA 4IHAA 3WIBA 2XMZA 2VSQA 4AO8A 4WDRA 2VQ6A 3VJKA 3C6YA 2FJPA 5AH0A 4B80A 4CFSA 1VXRA 2QUBA 4E14A 3G9UA 4G1FA 3C6ZA 4QDOA 4AX4A 4WFKA 3C5VA 4UBIA 2Z8ZA 3M82A 4KR0A 3AFIA 4G4GA 4ETWA 2WFMA 4GDMA 4UBLA 5D6OA 3SX4A 1EK2A 4X71A 5DWDA 4B83A 4QA9A 4FKBA 1MU0A 4HRXA 5K3DA 5HQ3B 2HIHA 3R3WA 2HU8A 4UHBA 1A7UA 1E8NA 4EUSA 4U2DA 1DX6A 1XZKA 3JWEA 5E2IA 1P0QA 4GECA 3WWEA 1VA4A 2V98A 1OILA 1DWQA 3STUA 2XUPA 3I2GA 4TGLA 3WZMA 1X2BA 5SYMA 5JD4A 1H2YA 1I6WA 1UK9A 3HXKA 4Q05A 3KD2A 3BF8A 3R41A 4G9GA 2IITA 1GT6A 2HA3A 1JU4A 1MX1A 4ARBA 1ODCA 4QLAA 3ESAA 2YYSA 3TEJA 1PV1A 3AILA 2QTBA 1CUGA 5E4JA 2XMBA 3VISA 3WYDA 2RHWA 5ALHA 5IVIA 1GQSA 5AK6A 4DNFA 4BVLA 5ALDA 4FHZA 1UZAA 4G9EA 4H18A 4RNCA 2XUQA 4B9EA 4AXBA 4AMZA 3AJAA 4J0KA 3DKRA 3FAKA 2QUAA 4LYDA 2WJ3A 3WKAA 3OG9A 5JAPA 4BE4A 5CT6A 2I3DA 1XRPA 4FFVA 3F8SA 5JATA 2AJBA 4CCWA 2OAEA 2DHEA 3UUEA 3IURA 5D3ZA 2C5GA 3VXKA 1QFMA 4PSCA 2WILA 4BAZA 4C4YA 1EI9A 1ZD2P 3ESBA 5EHQA 1OXMA 4DGQA 5FXMA 5EIAA 1IZ8A 3DQZA 4WY8A 4BTVA 5C81A 1BS9A 3H1AA 2VJCA 1MJ5A 4XVCA 1XZBA 5I8PA 1FSSA 1UOQA 2BFNA 3QMVA 5ALMA 1SOMA 1JMYA 1B41A 1O6GA 3BDIA 1P0MA 1CQWA 5LKAA 3O4GA 3LLCA 4ZRDA 2JGMA 4AMYA 4FLEA 4W1QA 1XRQA 1Q0RA 5CT8A 3PUHA 4KJXA 1MO2A 3GZJA 5DTIA 4EY7A 2ZSIA 3HSSA 2IIVA 3WKCA 3WMRA 3V9AA 3O9VA 2EEPA 3EQ8A 4AN1A 3F98A 3A2NA 2BGRA 2Z3WA 2XDWA 4QZVA 3Q8WA 5DLPA 2WSLA 1AZWA 2OLEA 1WHSA 5BV7A 2ORYA 2QRUA 4H7JA 3H2JA 4N5IX 4LHEA 3GROA 1WB4A 4QWWA 2B61A 1XZJA 4F0JA 1JMKC 2RHTA 4KE8A 4WFIA 1CLEA 4DYHA 2XQKA 1LBSA 4P93A 5ALUA 3KOOA 4KYVA 1KU6A 5AIAA 2WU4A 2ACKA 3FLEA 4Q3KA 1QTRA 3I2JA 3WWPA 3G0GA 4GBGA 4GI1A 5EI5A 1CUXA 2EDAA 4BDTA 1VJ5A 4ZGBA 4X91A 1W4LA 4UBMA 4BATA 5CURA 3FYTA 5ALFA 3RKSA 4JEIA 4CI9A 4N5HX 5K3FB 4LIPD 3VDXA 3KDAA 3AIOA 1U8EA 1E8MA 4ZV9A 1QIHA 5ALKA 4ROTA 3H18A 1XZDA 3L1JA 4EHBA 3L1HA 4FNGA 5AOCA 3FCXA 1MT3A 2DHCA 3Q0TA 4WCVA 1BU8A 7YASA 3OTQA 5KBYA 1QIMA 2ES4A 4AO6A 3OPMA 2PSJA 5CT5A 4BE9A 5C8ZA 5ALPA 3O4HA 3HACA 3GUUA 2ZVDA 3FNBA 1JKMA 4XWGA 3A2MA 3I1YA 3EQ9A 2Z8XA 5T4BA 1P0IA 2OCKA 2HA2A 1AX9A 1R9MA 2QS9A 1ISPA 2WHPA 1QGED 4YASA 3FYUA 4BAUA 1CUCA 2PX6A 3QVMA 5EHNA 1EVQA 5K3EA 1TIBA 3A6ZA 1K4YA 4P9NA 3VKFA 2ZSHA 4BVKA 3OURA 4N8DA 4EBBA 2JGKA 3V1NA 1HL7A 3ILSA 5JD6A 4NMWA 2Y2UA 1LPMA 2DSNA 5FDFA 2OGZA 2QOEA 1E66A 4X7BA 3TGLA 1XZMA 2VTVA 3QBJA 5LIPA 2WG1A 1UFOA 1PJAA 1GQRA 2FUKA 2XUGA 5JASA 1ACJA 4NZZA 5JAHA 4UBOA 1GGVA 3QZUA 4CG1A 2ONCA 3K2IA 3MVEA 3HRHA 4UFPA 5CXUA 2WKWA 4JH0A 4RE5A 5T4HA 4DLNA 4BP8A 3MUNA 2X5XA 4W1RA 1QE3A 4OSEA 4X95A 1VE6A 4K6KA 5AK5A 3C6BA 1FFAA 4C87A 2QJWA 4AO7A 1IVYA 5ALYA 3UMJA 3DD5A 3LIIA 1WPRA 4EY5A 5FPPA 1LPOA 3C8DA 1UKAA 1CUYA 3H17A 4IH4A 4LXIA 4JNCA 5IVHA 1L7AA 1FJ2A 5LZ4A 1ZOIA 1QIKA 1QO7A 1ZGBA 5AKIA 1HLGA 5A71A 5JAUA 1QIJA 4Y2VA 1EDEA 3SK0A 4DMFA 1F8UA 1JJFA 4KE6A 5JAOA 1IUOA 1N5MA 4MWTA 1MTZA 1BEZA 1HQDA 5HF5A 2OCLA 4BB0A 4UBJA 5ESRA 3FVTA 2ZJ7A 4QDUA 1W52X 3I6YA 2O7RA 3STYA 2WQZA 1EHYA 2IX9A 5FPQA 1USWA 5I9IA 4C4ZA 3KWFA 4GXNA 3WWDA 3WL6A 1XRRA 1VKHA 5ALEA 1MAAA 4G8CA 1ZJ5A 1F6WA 1ODTC 2CMFA 2HA4A 2CBGA 2HA0A 4Y2UA 5AI0A 1X2EA 2BKLA 4ITVA 2C0QA 1KU0A 3ANSA 4H7EA 4BAGA 4MYSA 4QDZA 4W9RA 5A7GA 2WUDA 3I1IA 3BWXA 3F97A 5HQ3A 2C7BA 3WKDA 4HXFB 1XQWA 4JYPA 3N0TA 4J03A 2FJ0A 3WWOA 4K2AA 1U4NA 4J0DA 4N8EA 4H7FA 3QH4A 1GPLA 1NU6A 2WIKA 2CKMA 3P2MA 4UFNA 5AKXA 1R88A 2PSFA 5BOVA 3GELA 4Q1VA 5AKKA 4CCYB 5CH8A 1UXOA 5LZ9A 1J06A 5HF9A 3UUFA 2P8SA 3STVA 2CEKA 1PFQA 4X92A 1GPKA 4DSZA 2Y1KA 2WJ6A 4X97A 2WLSA 2WTNA 1DQZA 1LGYA 2WG0A 2WIFA 4QWMA 1CV2A 3IIIA 1G5FA 2G63A 2HA7A 4F5ZA 1W75A 4X94A 1WOMA 5AKHA 3R0VA 4U2GA 1XLUA 3DEAA 2VT6A 4UPDA 4HTAA 1R4ZA 1EINA 3FWHA 5C7YA 4QE3A 4ZREA 3FYUC 1W76A 1XQYA 4MJ3A 3DKKA 4Z49A 4Q3LA 3RK4A 3DJYA 5CRIA 1DTEA 5JD5A 3IUNA 2OGSA 3E1GA 3VVLA 4H7KA 1ZICA 2H7CA 5CT4A 1TCAA 2ZYIA 2DR0A 5A7FA 3DS8A 5AKYA 2JGJA 1YA8A 2H7XA 4UHCA 3TRDA 3WL7A 1QIEA 3WA7A 4PNZA 2ZYSA 1JJBA 3S8YA 3QMWA 1TK3A 2XLBA 3LS2A 5AM1A 3G7NA 1CUEA 2PVSA 5CMLA 4S0XA 2XMCA 5ALTA 5FUMA 1SCQA 4HZGA 5D3KA 4C6HA 1LNSA 3IA2A 2VAVA 2FX5A 2WIDA 2HFKA 2OG1A 3WLAA 3PDCA 4B0OA 1J07A 3FSGA 4QEKA 1YB7A 4FOLA 5HKAA 1WM1A 1W1IA 4L0CA 4FDMA 1XQVA 4ZV7A 3H19A 4X93A 2XUOA 3M83A 2HDWA 3BF7A 4FMPA 3IBTA 3EIOA 4OB6A 2OAGA 3QMMA 3C6XA 1RP1A 2X76A 1E5TA 3STTA 3CN7A 1SCIA 2G5PA 2ZYRA 4MWSA 1LPBB 1TRHA 4EB0A 5DYWA 2JF0A 3C45A 3FLAA 4CG3A 2CB9A 5AM0A 2WIJA 2Y6UA 4OU5A 3D59A 4B81A 4I4CA 2PBLA 4DMKA 4Y9SA 3YASA 2OPHA 3B5EA 4OPMA 5FV4A 2WFZA 4G4IA 5ISMA 3QPCA 3R3YA 2WUGA 3T52A 2RI6A 2RONA 2WFLB 3DCNA 3PI6A 3ICVA 4PO3X 1GPNA 4M0EA 1E3QA 3HYSA 3K9BA 1A8SA 2GZSA 3CXUA 3OC0A 3WJ1A 5LLSA 1BCRA 1MX9A 2QVBA 3HI4A 4J7AA 1LPNA 3TJMA 3S2ZA 5K3FA 3STXA 5AP9A 3ESCA 2WHQA 1A8QA 2WUEA 3O4IA 3IUQA 4DMHA 4XJVA 5FKJA 2HHAA 1WHTA 3F67A 4OYLA 1XFDA 1WB6A 4H7DA 2C0PA 5AHXA 4ZWNA 2VJBA 3CCCA 5I7UA 1AURA 2BGNA 1ZD4A 3D5EA 1DQYA 1CUVA 1VZ3A 2BUAA 4I3FA 1C7IA 4H77A 2XMRA 3WKBA 4OU4A 3RM3A 3BIXA 1C7JA 4OYYA 1CFJA 2Z3ZA 1YASA 3KSRA 3E3AA 4AQDA 3BL8A 4W1SA 1HKHA 3H04A 4Y2QA 3C8HA 2QXTA 1BN6A 2XMGA 4QDXA 3H2IA 4X6UA 5A2GA 1DU4A 1YAJA 2BUBA 1EXWA 3WKEA 3DDUA 4IH9A 1QLWA 3W9UA 1EX9A 1XZLA 1CQZA 1Q0ZA 1EK1A 2QJRA 3A2LA 3R3VA 4DM7A 1F0PA 1MNAA 5LYYA 2QT9A 3AINA 1VOTA 5ALRA 2OCGA 3GBSA 3I2FA 4I19A 3FCYA 1F0NA 2AJ8A 1XZEA 5FRDA 1DT3A 2Q0XA 4BCDA 1UKCA 3EF3A 1RWQA 1XLVA 1CUJA 3G0BA 5HCUA 4Y2XA 1O6FA 1XRMA 3G02A 3NUZA 2QMQA 2V96A 4TVKA 4UUQA 5CH3A 2JEYA 5ALSA 3WK6A 1ZI9A 4U2CA 4HVTA 5CXXA 4WJLA 3IB3A 3ZLVA 4PV7A 1DINA 4PW0A 1DWPA 4XIIA 1GZ7A 5AM3A 3KWJA 4Q3OA 1G66A 3G9TA 2OQIA 5DNWA 1VLQA 1Y7IA 3IDAA 1ODSA 1H22A 2WUFA 4W1PA 4DNQA 4KRXA 2WJ4A 4OCZA 4P08A 2XUJA 1TCCA 3WK4A 2HA5A 2EDCA 4W63A 4E46A 3QM1A 5JARA 4BP9A 2QR5A 1EDBA 4B0PA 5JZ9A 3D2BA 1CUBA 5KWJA 1ZD3A 5ALJA 3HLKA 1QONA 2PUHA 5HF6A 1UWCA 3RLIA 5AKLA 1D07A 5KREA 1MAHA 1UT6A 3QITA 4DNOA 2YH2A 5AK4A 1CUAA 2HU5A 2O7VA 2OCIA 1XZCA 2GBFA 4X6YA 2WHRA 4XX1A 4NS4A 1CUIA 1MN6A 4X3CA 3QPAA 1UKBA 2AJCA 5YASA 3ZLTA 4N8SA 1LPAB 4YPVA 4LYEA 3BJRA 1CIJA 1IUNA 1FFEA 3ICWA 4FFWA 2GZRA 2GYUA 2R11A 2ZJFA 3H2HA 5EIHA 5HFAA 1IMJA 3D7RA 1CPYA 1CUSA 5AK3A 4GHWA 2XUDA 1AMNA 4UHDA 2WHPB 4K5QA 2ZYHA 3ZLUA 3W9BA 4C01A 2Y2VA 4A16A 2PU7A 1H23A 2HRQA 4K6HA 2AJLI 4KAJA 4ZXFA 5IVKA 1Z68A 5AM4A 3FLBA 4HXGA 4U2EA 3A70A 5FOQA 3ZI7A 2YASA 3G9ZA 3CN9A 4NVRA 3W05A 4EA6A 3ED1A 1UK8A 5K3CA 1WCYA 1XKLA 2I3ZA 3B3QA 4UHHA 3WQHA 3BE8A 3H2KA 1JU3A 4CCYA 4IQ4A 3G9XA 2RAUA 2PPLA 4X85A 5AKZA 1E89A 1XZIA 1R1DA 3C5WP 3R3XA 5EGNA 3VJMA 4FTWA 2VA9A 2WIGA 1XZGA 4INZA 3IULA 1UK6A 2PU5A 1U65A 2CZQA 3HABA 3D2CA 5CT9A 4GEGA 4GW3A 4H0CA 1XRNA 1K5PA 1LPPA 1J1IA 1ZI8A 4P92A 5CW2A 1YSCA 2PL5A 4C89A 4X90A 2HU7A 2XMQA 2ROQA 5AJHA 3AZPA 5ALIA 4MXDA 4J0CA 4MEBA 4UFOA 2VJAA 4DTCA 4PSUA 1QZ3A 3GFFA 4QNNA 3V48A 3H1BA 2R8BA 1P0PA 2WU3A 3O95A 4CIBA 5JADA 4M0FA 5AIBA 3PUIA 1T4MA 3PE6A 3WK9A 1YB6A 5IH7A 1G42A 3LCRA 1X70A 1EA5A 4HRYA 2XUIA 2HA6A 3SWWA 5AKGA 5AI6A 1QTIA 2DCMA 1E8DA 5EHZA 3DL7A 1QIIA 3I2HA 1QIGA 3AUKA 1LZLA 3JW8A 1XZHA 1CUUA 1SC9A 3WL8A 1N5RA 5LZ7A 5AICA 1ZIXA 4KRYA 4B82A 1XRLA 5LP1A 3I6ZA 5JZSA 3W2TA 2H9YA 1EB8A 4BC0A 1VE7A 2QZPA 5ALNA 4BBZA 2JGFA 3WL5A 2NW6A 1HDEA 2PM8A 4FLMA 5HF8A 4JUIA 3PFBA 5A62A 3G8YA 1M33A 3G0CA 5BWBA 1TCBA 1EDDA 5J3JA 4HXEB 4J0GA 1EH5A 4QDTA
chains in the Genus database with same CATH superfamily
1R0YA 3R7SA 4BDSA 2FRVA 1Y34E 1F9AA 2OZLA 1VSQA 2GH1A 3Q3JB 2J9GA 4JQYA 4V2IA 3RVLA 3WK7A 3G5UA 4BLQA 4D9JA 5JY1A 1FNMA 4GSKA 1U2RA 4UMEA 2NU8B 5KNCA 4TPKA 1CQJA 1RLMA 4GR4A 3NBUA 3RC7A 2J5RA 2Q1SA 3G17A 5DB4A 3JARB 1LQUA 4JP1A 3RTEA 3DT9A 3NRCA 4NPCA 5IARA 4H1HA 2ZOSA 4BKQA 3GLGB 2A3NA 3NVMB 2I91A 1XVIA 5D1HA 3FDZA 3TBFA 4XX0B 1RBMA 2YDXA 4FHDA 2GBCA 4MIKA 2Q5IA 3DNMA 1WBBA 3D4LA 3NZEA 1E20A 4HNUA 3AEZA 4J1QA 3TLKA 2EFGA 4N01A 3FX2A 4Z0NA 3VZSA 2V1UA 2RGRA 1WJGA 1B16A 2ZYTX 3EH2A 3AHGA 1X7GA 2H7YA 3HJHA 2ETXA 4O4HA 1HG0A 5KVQA 4CU5A 1APBA 4CEJB 2WWFA 2H5EA 1C4XA 1L5MA 1EKXA 3D9QX 4IRXA 3G59A 5EJ5A 3U7FB 2IYNA 2GPAA 3EZFA 4JQCA 4MPPA 3S27A 1NL3A 2L42A 2AG1A 3PUKA 4KLNA 4LX8A 2LGJA 2VHTA 3EAQA 3HCDA 4K3UA 3B3GA 2WC1A 3F8TA 2XCTB 5CK5A 4M8KA 3C5CA 3HRIA 2CDRA 2OMKA 4Y2JA 5I9NA 1ACLA 4C2AA 1A7KA 4OKNA 4XM2A 2Y99A 2GARA 4I1SA 3FH0A 1B3RA 3GLHA 2ZI4A 1XCJA 3W0LB 4HX2A 3LWDA 5ILOA 3QWHA 1R7RA 4ZHQB 3LBIA 4LC9A 3H5WA 3O21A 4FW9A 4D8WA 1BIFA 4ENWA 2YR0A 3MGAA 1FTGA 4RC9A 5KTYA 4KAAA 3ASUA 3ODPA 1E79D 4YWHA 3ZGLA 1A9XA 3PJDA 1ZEJA 1ZLXA 3C3AA 3H3JA 1UBMS 5FAKA 4QPZA 3MOIA 3LRXA 5L6MB 2J9YB 4BTLA 5CNMA 2AHRA 1NQTA 5BT8A 2RAVA 4I2NA 2DE0X 5I45A 3DE0X 4MP3A 1JEQB 1WCWA 1NN3A 2YV2A 2Q4DA 3JQCA 4Q4HA 4OHYA 4HNTA 2QLBA 2V45A 4HQFA 1I32A 1MEEA 3DMHA 1BMDA 1XMIA 1BD4A 2CW5A 1U9IA 3IV6A 1HLDA 3CZ9A 1XB2A 3KZMA 1Y5NA 2W00A 3QIAA 2H63A 1ENYA 2FW7A 2EYQA 2PFKA 2XH8A 2YZNA 3W6OA 4BCCA 3WQSB 1YS7A 2JFOA 2BR5A 4LCEA 5D3MA 1B00A 1M54A 4OTZA 5DHSA 3SCZA 5KWIA 1U2TA 1BDMA 3DWGA 1Y1TA 1NKTA 4MVYA 3AGQA 3B12A 2GPYA 2FG6C 4IF4A 4Y7DA 5LUBA 2WD7B 1BDBA 1RLJA 1TTHA 2JGAA 2JBWA 1DRKA 2OXIA 4QUEA 5HZGA 4F12A 1E1RD 3D5QA 1L5FA 1DXHA 1OHHA 1JKJA 2NSLA 4Q66C 2GCEA 1Q7RA 4TRJA 4YT5A 2AE2A 2ZS9A 1SHKA 4M7WA 1Z7WA 3LQYA 1IHYA 3HFJA 1TLTA 1KBQA 2BFAA 4MICA 1WTAA 1QP8A 3OZXA 1ZGGA 1IL0A 1K7SN 4G0OA 4WAUA 1B93A 1ZHOA 3SKXA 4PLTA 2FPPA 5AW0A 1EZ4A 4IZ6A 4ZOLF 1OY1A 2PJZA 3SN6A 1TVCA 1CC1S 2IZ1A 3FOAA 3NFRA 2G17A 5K6TA 3CUTA 3H2GA 1FJHA 4ILKA 1ZGHA 1Y4AE 3BIWA 1YB1A 1ZK4A 4FD3A 3IAFA 4KQ6A 2LIPA 5EJFA 4JI3B 1A5SB 4MH0R 3WNCA 5HIKA 3HDQA 2BGLA 2IY9A 1PT5A 1I3MA 3GEMA 4B5LA 5NLLA 3SJ7A 2QL6A 4DXAA 1A4UA 4WZBB 1FMLA 1JKXA 1TIKA 1YCDA 1YQWA 2NYAA 4CHTA 2UUOA 3N6RA 1ADJA 4CN9A 1UXIA 1VHTA 1IQUA 1HMYA 1PG5A 2REOA 2ZI6A 4NF2A 4JWKA 3HWWA 2GZ1A 1QC5A 2FXIA 4TS4A 4JBYA 3GGGA 2E18A 2BEVB 2K2QB 3EF0A 4MCHA 2UZIR 4MS1A 2PWAA 5AW9A 4HRVA 4NBWA 3OPVA 4YAUA 3PQ6A 4KACA 5H16A 1NC3A 2AKYA 2VJKA 1U4OA 3IESA 4KXXA 3FJOA 4HNQA 4LHYA 3J80A 3GRFA 1BROA 4DR3B 3RPEA 1SH7A 4KDEA 1TAGA 3AVOA 3B2EA 4Q93A 1GPMA 1ZMBA 4MJXA 2OHGA 4V03A 2O8DB 1KO4A 3OIVA 4D0SA 1A1SA 1C9DB 1DL5A 2GD6A 4RIGA 1ZCBA 1D4AA 1DEAA 2IHZA 2QQEA 3BJZA 3L2OB 3RBZA 3B1FA 1VI2A 3BWBA 4KVZA 1IOVA 1FRFS 1TIPA 2VSYA 2F64A 1FXUA 1IAVA 1L4YA 1ZH2A 3OQPA 3S29A 2Z8YM 3DOOA 3AVQA 2O2ZA 1DUVG 4L4UA 1REQA 4EB6A 3Q6NA 3K9FC 1GKLA 3M4NA 3BXGA 4S2EA 1P2UA 3RARA 3DVRX 3JYNA 4ZVRA 3VHLB 1C4OA 4AZ3A 4AU1A 4RFVA 4EY4A 4NXMB 1GKKA 1VCHA 5A5VA 3WJ2A 5MF6A 2UXCB 4H6WA 1KI4A 1UJ4A 4C20A 4RE6A 4DF3A 1HOXA 3EE6A 5ARCA 2GD1O 3UICA 5E8JA 3DZKA 5HUJA 4DZRA 3PUVA 4G5OA 4X5OA 4BMZA 3USCS 2PQ2A 3DD1A 3VOBA 4F60A 3A1FA 3COYA 3IQIX 2IBSA 3VTZA 1KOGA 1PEKE 1E1CA 4BBAA 4PXAA 3RKUA 3CEAA 5ERYA 3RSOA 1N8SA 5H59A 2KJQA 1K5HA 1VKJA 2P0AA 4XPIA 5IJXA 4AY4A 1OH7A 1M73E 3V8BA 2DVMA 5JH7A 4BGUA 4UPVA 5HK9A 2Z2JA 1II8B 2B6HA 1WNTA 2ZJ6A 3QLTA 3O3MB 1OWOA 3I8XA 1WZEA 4HI0E 3M3PA 4HS4A 3BRCA 1X94A 1PFUA 1V8FA 3LFTA 5DX8A 5BW4A 1KWGA 2NM0A 2QDXA 4BRZA 5ALZA 3QJGA 2PV7A 4F2HA 3QI2A 1ODLA 4TYNA 1I36A 1U1CA 2FGJA 1UM8A 2HRCA 3K30A 4WECA 5ED0A 4EFLA 2M6LA 1E9VA 3GVXA 1KMCA 3KHKA 3QBTA 5CLGA 1UEIA 1WR8A 4LXHA 3NTOA 4YJHA 5TEWA 3BM5A 1PN3A 1KMHA 3GFOA 4BLSA 2EAUA 2VQSA 4KWEA 1LNZA 3D0KA 1I4TD 5JQWA 4GI2A 1T36A 1Z7BA 4IIYA 3L92A 1YTLA 2V7BA 3OZWA 4KN9S 1CUDA 1QMGA 2AMJA 2IYWA 2DM6A 2QL5A 3EGXA 1BEEA 2QTVA 1M75A 4ESHA 2RBEA 4TQUS 3BE6A 4DLRA 1NTOA 1DIHA 5JPIA 5F9FA 4QSHA 2WTMA 3K5WA 2YWFA 4E3WA 1BE8A 2BCGY 4A73A 5JJLA 4N0MA 2W9XA 4GT1A 4YRGA 3JALB 4G5GA 3JS5A 3MTEA 4JJ4A 3I92A 5IYZB 5AM5A 2X0JA 4RJKA 5J2UA 4JITA 3UTCA 1OFIA 5E4YA 1SEVA 3HZOA 3K1JA 1LDGA 4JKIA 3N58A 2QLFA 3V7YA 2GTIA 1KZ4A 3WLEA 2QT0A 4LJSA 4ZAXA 3WL4A 3OOWA 1CULC 3E0XA 1ZD5A 2GAOA 5IEJA 3FCAA 3WZLA 3G5TA 1J25A 3VAYA 4EYGA 5DV9A 1J2YA 2FG7C 2HO4A 2C4VA 2WAMA 4R2LA 3DZFA 3T9CA 3C87A 2AD1A 1C30B 2DHDA 3W5HA 1GFWA 1VJGA 1X1CA 2JL1A 1FDVA 1I9CA 4MW6A 4XD2A 2Y9MB 3W4JA 5IKXA 2WZQA 2CK3A 2A94A 1XMQB 3IVRA 1UAGA 1KAQA 1LNQA 1N2CE 2JIMA 1G6OA 2ZSDA 5D7NA 1IC6A 1ZITA 5I5EA 1VHDA 3IOBA 3D8NA 5K09A 3NFYA 2WUWE 2G36A 3DZJA 4Z9YA 5J9FA 3P0HA 2PUGA 1T5HX 1A82A 2CD9A 3CZAA 1T2NA 4IGKA 4WKNA 3RG8A 4F5WA 4BOYA 2RH9B 5JALA 5A5GA 1SFRA 3O9MA 1TU4A 5CTJA 2C4HA 4MVJM 1NP7A 5FR1A 4ZOAA 2G7ZA 4PYIA 2BEJA 4R3UC 4BNMA 4ZVQA 3CX3A 4ML3A 5C0OE 2W2NA 1EGMB 1IBCA 3VO8A 3LUGA 4UZFA 2YWHA 3BE4A 1QO9A 5C8VA 5CFLA 5JBQA 1KS2A 1UKVY 4M0MA 4GLJA 4DBZA 1X6VA 2HSWA 1CRLA 2H51A 2AFHE 3DBVO 3K8YA 1ZJ4A 4DEYA 1J21A 1SVKA 2MTBA 4NQRA 3KOWA 1SXJB 2I6TA 3A9CA 3LOPA 2CL5A 2Q3BA 3TZBA 3JV7A 5DGXA 2OV8A 1CVIA 1KZGB 3IO3A 3BFJA 3HB9A 4GWGA 1YT5A 4LHVA 4U6SA 5IBRA 2V7VA 3C1TA 3U80A 4CMAA 4C2TA 3L18A 4ZZIA 5AFSA 1IDN1 4BRWA 1UBFA 4DT1A 3SMQA 2OZKA 1E3DA 5CX1A 2PGXA 1EFCA 1YIDA 1EFRA 4PG7A 4LJYA 4LVOA 3SIRA 4YRIA 3TLEA 3C3DA 1C1XB 2CYBA 4FONA 4MQLA 2J87A 3UT5B 3C70A 2H1HA 3NT2A 2G04A 4ZCPA 4AICA 3UQYS 2PLAA 5C31A 1TCVA 6YASA 1LU9A 3BFPA 3GRCA 4KXFB 4ZU3A 3SXUB 1SQ5A 3BDVA 4D2IA 1M0EA 2J59A 1A95A 1Q74A 4L6IA 2ZM6B 2NO7A 1FLAA 1EFTA 3VKVA 4TMZA 2JLWA 1WU8A 4P3PA 5CDTA 3U3RA 1W30A 3IPLA 2I1QA 2Q62A 1VL6A 5BQ3A 4JJFA 1BMFD 2C4NA 5FBLB 1BXRA 2B2XA 1GLGA 3CNBA 2CFRA 5K6AA 5JOQA 3PXCX 3ZE1B 2XIJA 4BKOA 4DSAA 1F5SA 3LTNC 1EK0A 4UDOA 3W1VA 5HZHA 2Q1XA 1H4VB 1OSNA 2PCJA 4YRZA 4R1LA 5P21A 2INGX 3PPVA 3KSAC 1RMYA 2WYVA 4PVCA 3HBNA 3X1DA 1E3JA 3V8MA 4JROA 3Q3HA 4R84A 4C0WA 1V2GA 1RIFA 4R2KA 3ZV7A 2VDPB 4HD8A 3LL4A 2ZJBA 4D5GA 3SHTA 1UJNA 5CHEA 4LISA 5EFZA 3ZWQA 4TKVA 4H7HA 5EEGA 3FUVA 1HBJA 5K8JB 3L6DA 1A4RA 1IRIA 1YRQA 3ME5A 3C1AA 4RKEA 2QVYX 4FK8A 3HXPA 4PG5A 2YXEA 4HWOA 1YMUA 1V7PC 1LQTA 4EJ6A 3EFEA 3KZ1E 2HIAA 4KIGA 3ZZ1A 3U44A 2O2GA 1TEZA 2Z8YA 4GL2A 2XYQA 3I2IA 1JPJA 4JUDX 4US1R 4P2GA 2WF6A 5HWSA 2O2EA 4ZMSA 1PVOA 3HLTA 2I78A 3NUGA 4RY9A 5EHXA 1UMDA 4C3OB 4WFJA 1FP1D 3NEJA 4CLRA 1IOZA 1V26A 5AOAA 1L5KA 4J43A 4K6CA 5GVSA 2VP5A 4EENA 1S8OA 4J1TA 3EDCA 3K2BA 2Q1YA 3BTUA 4U2FA 4XWAA 2DFLA 5A0FA 4EYEA 1WDMA 1EPUA 4FT2A 2QD5A 4QJ5A 1UOEA 1ZMXA 2OM6A 3NCTA 3NHBA 3B78A 4JXKA 3TL2A 3TS1A 3WGGA 3X3HA 2NTYC 3DTNA 2QX4A 2CNKA 1N0HA 4MVWA 3V8NA 3WBBA 1WCIA 2OXFA 1KPIA 2L69A 2W8BA 5DYYA 1GPUA 2TECE 4C0QC 5CCEA 1W59A 1HLPA 1PD0A 5LZ5A 4E09A 1YFLA 1Q2UA 4QUKA 5A6SB 1MO6A 2P9BA 4KQFA 4QDJA 4W5HA 4WEOA 1Z3CA 2H1IA 1N6IA 4P84A 1P2FA 3MG9A 5HK8A 1G3RA 3AC0A 5HIIA 4PNPA 1W87A 5K3AA 5BWMA 3IDOA 3F6PA 2O7SA 3WGVA 4JOBA 3W5BA 1YV9A 1M1YB 2ZJAA 3MRVA 4PC6A 3PE4A 5H83A 3SBEA 5B12A 5DM70 1LLDA 1AUXA 4GLBA 3OQMA 3ZPXA 1GP2A 5A7HA 1B4DA 2C59A 2F1RA 5EE5B 5CM2Z 5TIIA 4BLVA 3Q3VA 2XV1A 4FPXA 5J4KA 2R1TA 3RVJA 1O2DA 5KINB 1DZ3A 4WN3A 3FPGA 3JU3A 1T8UA 1M8PA 3OJLA 4RK4A 3OIWA 1ZL2A 1ZM2A 2C83A 2JJ2A 1NU8A 3KLBA 4TXNA 3ZJYA 5HS4A 1ZGCA 2O2DA 2XMDA 1G9SA 3QSGA 1NPYA 3ZDBA 2B4RO 1AC5A 3PEEA 3Q7TA 2AW5A 3U4GA 4DLPA 1ISFA 4NKRA 1K3UB 2C9MA 2I6QA 3O5AA 5T57A 1Q77A 3GGCA 2WWVD 4I3HA 3SZGA 5BORA 4ZZ3A 2PEYA 4YMUA 1X80B 4QFMA 3CCBA 3DCJA 3JATA 3NBMA 4DBLC 3DQQA 4MKHA 1S8NA 5EHIA 4NEGA 4R1TA 2WICA 1KDTA 4BNZA 2HEIA 1WU7A 2I8AA 1P5FA 3Q3IA 2PE5A 1JDBB 4MKGA 2N0SA 3NBYC 1U0LA 1QJCA 5EZ6B 3V4ZA 1A7AA 3FPAA 3BB4A 2QUZA 1BQ4A 2OXEA 5C1DA 1XLWA 5BW6B 3C74A 4KP7A 2O3UA 5KVCA 3DYVA 3AVYA 5ITWA 5FTWA 1DBQA 4LHZA 4BYMA 5EJ7A 3F7NA 5TF4A 1NW4A 1ZM7A 3U49A 2YMMA 2Y8EA 2VJLA 2PR2A 5KNBD 1XHLA 1R3UA 5DTJA 1KI2A 3EXEA 5CHYA 1FDRA 5JMOA 5KPJA 1UDXA 3L6CA 4I0WB 4OHMA 5DZSA 3UT6A 1ZWKA 2V7XA 4E12A 2NUTA 4DV4B 3EXIA 3OQ1A 3KNZA 1THGA 4L1KA 1GFSA 4L8FA 4UNIA 3GLIE 5IKOA 3HO1A 1FFDA 4RL4A 1O95A 1PR3A 2QJTA 2RJOA 4YMSA 2BEUB 3RFUA 5LD2B 3AVXA 1V8OA 3HZZA 2VP4A 2ESRA 3TINA 1QJ4A 4MVJA 2EC5A 4YALA 5EL0A 5FIUA 5EQFA 1S8AA 2P0YA 4MZXA 2X4IA 2JJ1A 5LZ2A 3A4VA 2JJYA 4JD5A 3SLRA 4JI6B 3I28A 1TJNA 2HJ9A 1N57A 1WZIA 5K5EA 2XUZA 1OJLA 4CM5A 1RXUA 4MQMA 1ORWA 2C61A 2OAQ1 1BFDA 3SXJA 1PDWA 1GNRA 2X7HA 3IJ5A 3HQ4O 1C9EA 3QVJA 4DREA 4D3ZA 3E3MA 5EE0A 3DC7A 3MMSA 5C8XA 5CNKA 4ZO6A 4L5IA 4OFBA 1P2GA 2C1EA 2XBMA 2D2FA 3R1IA 2VRWA 5AW8A 4OQ4A 1T8PA 1WKBA 1UUFA 3O6VA 5CTAA 1NBHA 2O05A 1TJ3A 2GCIA 4WN9A 1NP3A 2GCPA 5DMXA 1FZQA 5IK2D 3OPQA 2P4QA 1O9GA 3OY7A 4I1IA 1THZA 4TMFA 3L7CA 5CLLA 2OFXA 4FYVA 4XUGB 3AM3A 2DYKA 5F7OA 1L7RA 2VN8A 3IQHX 3LP5A 4RVGA 5GINE 1RR6A 3CTPA 1V9CA 1H2XA 1RHKA 2B9VA 4UM9D 3BCHA 2HBQA 4ARAA 2TMKA 4NPAA 2C3YA 4ZXPA 1B1CA 2IUSA 2PXXA 4N18A 4Q37A 3TRFA 2L0XA 2QTCA 3BWCA 1JECA 2ZYAA 4P34A 4ZICA 1CUWA 3ZXYA 2NU8A 4G23A 2A9KA 3QFCA 5LDHA 1YVPA 3DL4A 1XXHB 4QEZA 5FI3A 1ZP6A 2YVAA 4JIGA 3JARA 4MTCA 4MQEB 3TVYA 2C3OA 3WB1A 3GLGA 4HTFB 1Y7PA 2XZDA 4YT4A 1BHJA 4QHTA 3KKPA 5B2ZA 2IS6A 1DOHA 3JXEA 3I3OA 2QLMA 1RZ3A 5BSGA 1JQAA 3ZCXA 4HX5A 3CS3A 2FZKA 2ECOA 2XQJA 2ODQA 3H8VA 2JD1A 2RMKA 3H8JA 4G8DA 5JHHB 4LGCA 4CEJA 2JFNA 3WBJA 2DUJA 4YBZA 1GRVA 2BP7B 2JIDA 2BMJA 4I6EA 2XT0A 1KYZA 2E1PA 1JFRA 1R6DA 2H8GA 3KQYA 1PI3A 2AC2A 3GDHA 4YTEA 5EZYB 3WIBA 2VSQA 1WMFA 2DECA 4LNHA 4FFSA 2G9NA 3KB1A 1VLLA 4EYOA 4NU5A 3FTNA 5AH0A 5T67A 1XL1A 1EFLA 3BD6A 2F3TA 3R8CA 3RTBA 4CBVA 1JHRA 1P2BA 3JD0A 3N59A 4OHXA 3HGMA 3CEMA 2AE1A 1Z2PX 1SR8A 1KORA 1JLMA 3UJ8A 3C6ZA 4ZHQA 3JQDA 2HN9A 1L5GB 1C50A 2GJAA 4LJ9A 1D9XA 2B1IA 3QQPA 4RENA 1RPZA 1OA0A 3C5VA 2GLTA 2JJ8A 5DBFA 5F12A 3GGJA 5HOQA 3IAXA 1HTWA 4H27A 1HYQA 2ZJ3A 4OQNA 4OSOA 4B7UA 4HNGA 4MHTA 4KH1A 2ZKLA 4MO9A 2WMNB 4TTTS 4YLEA 3NTRA 5EJ4A 4G26A 4F1JA 2VSOA 4O2AB 4UTNA 1JEQA 1RXVA 3O2JA 2GM3A 3EFBA 3KQVA 4MP6A 3D7MA 1CWUA 2VP2A 4MWZA 1FUYB 2JFHA 3KT6A 4QUBA 5IX8A 1KY3A 2RHOA 1P9NA 1QBKC 4OHFA 3KQWA 2Y1FA 1SUEA 1U8CB 4Y98A 5FX2A 3RIYA 1SBQA 1E64A 4B83A 3N53A 4FKBA 2QR3A 1FK8A 1MU0A 2B3DA 1KH2A 2GB4A 2Y1WA 5EC8A 3NHKA 4OVKA 1NW8A 1RQRA 1NTRA 4F84A 5F64A 3ZKAA 4AG6A 3HBLA 1CQXA 3EZ2A 4D81A 4UHBA 1NDHA 4XIFA 1RT9A 4EHNA 2X8AA 2ZB3A 4JT9A 5FORA 4HDOB 3NHYA 1DX6A 5IJAA 4EQ6B 4RXMA 3JWEA 4BX8A 1EVLA 1U2QA 5E2IA 1NRWA 4XB2A 3WO1A 4OBXA 2Z2YA 4BQFA 3TVTA 5KNDD 1JWLA 1W96A 4XLTA 3QA9A 3CF4A 1I0ZA 1F20A 1OKKD 3HWX1 4GECA 4G1VA 3KYJB 3WSVA 1JG3A 4WGGA 4ZIRB 1DWQA 4UDNA 3W2FA 3ZBUA 3STUA 3U37A 4QJ3A 2WVAA 3PGVA 4MCAA 1KTIA 3QX3A 1G291 2YRWA 2R00A 2H7VA 4HB3A 5I7OA 2XUPA 4TGLA 5COAA 3WZMA 1V71A 4KWTA 2FDCA 4WTOA 2GAIA 4R69A 5F23A 5TX7A 4LRYA 3L93A 1FSFA 2WZBA 5MGNA 1Q1QA 4JCCA 1I6WA 1UK9A 2EJCA 3UN1A 2WDPA 5J40A 3R41A 2O1WA 4U6QA 1DC3A 2BEVA 2QVXX 3GFPA 1VSVA 3BXEA 2IITA 1GT6A 1AIPA 2VCYA 1OBVA 3ELUA 3KB2A 4Y6LA 2OOSA 3AHHA 1YR7A 3TI9A 1KRWA 4QPNA 3UAVA 1MX1A 2XEXA 5JECA 1T1EA 3KQPA 5IW8A 4YHHB 2FUCA 1XEFA 3C3YA 3ST7A 4Q7EA 4E13A 4QLAA 1OIVA 1M2GA 1TPZA 1ACMA 2J9FB 2YYSA 3OZVA 4QYIB 4E88A 1W9HA 4J29A 2O20A 2C3MA 1DV2A 1CUGA 4NMMA 1G16A 3N0WA 2VBCA 2R8RA 2XMBA 2BFCB 2DP4E 3D43A 4O0LA 4XUEA 3JQPA 3Q11A 1CNFA 4MW5A 4CTJA 5ALHA 4ZJZA 2WYIA 3CVWA 1P1IA 2YJTD 3GZ4A 3TEMA 4BO4A 5IZCA 5LWQA 3URKA 3C3EA 3ZY3A 3P2KA 3U3ZA 4E4RA 4ZDJA 5K01A 3Q7SA 1V41E 4TMVA 2W0MA 2PH5A 1UZAA 1JHAA 4IIEA 3OEWA 2YMQA 1W5AA 4X8OA 3T3OA 2OTCA 4MARA 1M2NA 1KI9A 3D4PA 5GGYA 4QRDA 1N2IA 4H18A 3TXXA 3TNDA 4M76B 1NV8A 4B9EA 4AXBA 2HWKA 2WP0A 4EWLA 3DUWA 5F76A 5FA8A 1NYTA 2A1TR 2ADMA 2LR0A 1ULTA 2Q4BA 3LQ1A 4D4MA 4Y6SA 3GGSA 1FRQA 1NIJA 2CB0A 2ZUCA 1FP4A 3HP4A 2ISQA 4ND6A 4YRDA 3STHA 1I01A 1VGRA 3WBKA 2VHWA 5BR1A 4QOIA 1KNQA 1YQUA 3AJAA 2PX3A 4J0KA 4PHTA 1L8XA 4RPLA 3CWZA 4RSMA 4ZQIA 3GN2A 5ECDA 3VSBA 3DHEA 4J0FA 4YJFA 1DE0A 3CA8A 1T8WA 2X8JB 4G5YA 3ZBQA 3NEAA 4G1EB 4YCMA 3JZAA 1G8SA 3HKDA 1JJ7A 2WEKA 1ZIDA 1B43A 1TVMA 2C9BA 1JYFA 5IF9A 3CG4A 4M8LA 1Z74A 2C82A 1UXGA 3H7IA 1B1AA 1II8A 3HPQA 1EG7A 5M3BA 1I1OA 1IONA 1QAQA 2R65A 3FMGA 4TVSA 3LQ4A 4EY3A 1EFVA 3DZDA 2FEKA 1W5EA 3L8ZA 4URXR 1GYRA 1GV0A 3DZCA 3MS4A 4X1IA 1KMIY 5EMMA 4BE4A 4CIXA 3PWKA 1BGVA 2EFCB 3IR6A 5CT6A 5BSTA 1MG5A 1TKCA 2OZVA 1S9HA 2DR3A 4FDAA 1T5OA 4FFVA 2O54A 3VO2A 4TXMA 2JRCA 3BWMA 3F8SA 3LBNA 3DW1X 3FB4A 3F78A 5DKFA 1JMVA 4B3GA 4CCWA 1Y6ZA 5ABPA 1EWQA 1N0WA 3BYZA 4XJTA 5J23A 4WY2A 3U48A 3LP6A 4TLAA 2V6IA 4M7RA 1ZOOA 1LVHA 4K03A 3TQTA 4F3KA 3EVEA 4PZPA 2PUTA 1QFMA 3Q1KA 1ETUA 2I80A 3MTDA 4FB4A 3QKUA 4G1UC 5EHQA 3ESBA 3PSHA 1OXMA 2HT6A 3EVCA 3LLUA 3WLRA 4DGQA 3EPKA 1IOWA 3U7QB 3DQZA 4CI0B 4QHYA 3KQLA 4BLPA 2A0XA 4BTVA 4R1MA 4O4HF 3RC2A 5C81A 1HEIA 1C9KA 1F4LA 3Q10A 1YB2A 2FFRA 4PLVA 5K0CA 2GFHA 1MAWA 4O4JB 1ZJZA 5IYZA 1LEHA 4II7A 2CYCA 2NNWB 2DAPA 2VJCA 4TXLA 3VX4A 1EAYA 4QU9A 1XVLA 2I7VA 3PC8C 5HJEA 1GUZA 1IHDA 2AZTA 1XFAA 2IDZA 2X13A 1FSSA 4OXRA 3HUFA 4GXRA 2BVNA 1PYGA 3HKBA 1FP2A 4REQB 3ENKA 3S2UA 1SOMA 1JMYA 2R6R1 1G0OA 2ZIGA 3AT1A 4IOMA 4Q4DA 4YS6A 5F33A 1OIXA 1C30A 1STOA 4X3PA 1KYYA 4AK9A 4C4PA 1E7RA 1AUVA 4CM7A 2QGZA 3B1WA 3CUKA 4LXYA 5B6PA 5FPKA 5CD1A 2IH4A 1PTJA 2QZ9A 2A7XA 2GBPA 4HCJA 3P9NA 4BMPB 1K08A 3EUEA 1E4YA 3LXXA 1XRQA 3IT2A 3N8NA 1MO2A 4PC2A 1FIUA 1PR4A 1H8EA 2M6KA 3WB9A 2BFBA 4EY7A 4YMHA 1V48A 2QSUA 4PLGA 3RGGA 2ZZKA 3QUSA 3WKCA 4ZKDA 3UB2A 3H6HA 5CB6A 1WZNA 3H9BA 4M86A 4NG4A 3RRBA 2ZJ4A 1J20A 3LUCA 2B8TA 2CHQA 2ZTMA 2P5UA 2V4ZA 3RSCA 4LTDA 4CIVA 621PA 3JYOA 2PJUA 3SHVA 2Z95A 1WUIS 2XDWA 1VPEA 2V0NA 2XCUA 3Q8WA 1UQUA 5CJ2A 5DLPA 2VBGA 5COQA 1AZWA 3RVSA 4F2DA 5JYBA 2Q6LA 2P41A 3DL0A 4ZCRA 2VT2A 3LQ2A 5K2MA 2ZRCA 4ZEVA 1ZC3A 3FCSB 5BV1A 2B25A 4YNBA 5EY5B 1IJEA 1HORA 3K9HA 4HAXA 2CN1A 2OORA 2TMDA 3KQOA 1EGVB 4FOOA 4AUNA 3IKJA 3LUDA 1DC7A 2EU8A 4PQFA 4XH9B 1WB4A 2BGJA 4RORA 4KQGA 1J5PA 3KBBA 1AKYA 1UFVA 4YB8A 3LHDA 5K8TA 1B76A 1VCIA 1C1XA 2RHTA 4TMXA 4LRUA 1MV5A 1Q1GA 1F2DA 3U4QB 5ALUA 3UT5A 2PZFA 1P2VA 1P0FA 2PBRA 1NMYA 3B38A 3AFHA 1TZMA 4JVOA 5ICSA 2DBQA 4XGKA 1GRQA 5T6MA 3UCXA 3I5XA 3VR4D 2WSYB 3O8QB 2SKDA 3BIJA 4LJ6A 1UZMA 2P4EA 2GASA 3WJAA 1UADA 1XDDA 3DE5X 4I36A 4BHTA 4QBTA 3FLEA 1MCZA 1JDSA 1K6MA 1QTRA 3I2JA 1IZYA 4JX8A 4OL0A 4Q3KA 4ZAVA 3WWPA 2Q2QA 5TQ2B 1BS2A 4BO0A 1XAJA 4AY3A 1YK1A 1YBHA 3CURA 4ER0A 4GIBA 4MVJG 2XNDA 3CUYA 2EDAA 1QRRA 2GZ3A 2ORED 1SU7A 1TZBA 5G0VA 1ZIPA 3AR9A 4X91A 4Z3DA 3ZU4A 1BRMA 4IFEA 3OJEA 4UBMA 4YO8A 1L7XA 4LBYA 4P4SB 2Q1UA 5DTQA 5BN5B 3RNOA 3RYCB 3FYTA 1Q17A 2QA5A 4O0MA 2A8YA 3DNFA 3QWIA 2Q29A 5AR1A 5EP2A 1G64A 3L4EA 1EUDB 3OLWA 1JDJA 3QWBA 4JEIA 5TNXA 4B6SA 1YQGA 1BCRB 4CI9A 2KPOA 3H3XA 5H7XA 1NAIA 3DOFA 3K5HA 1PNRA 3HYNA 1Y3DE 4WIAA 4NX2A 2Z83A 2OQ2A 3CF2A 2HCFA 3KWMA 4LIPD 3E22A 5J1TB 2IJGX 4B74A 3KDAA 3BMCB 1PEAA 5JS6A 4B3TB 3FZGA 3AIOA 4Y9DA 4BTEA 1VFNA 1PFGA 3K4PA 2WRZA 4PG4A 4ZHSA 4TSFA 1QHIA 3DOJA 4ROTA 1XZDA 3VR5D 4MS3B 4C76A 4EHBA 4OP1A 5DBOA 3IRUA 5HNKA 3BPSA 4WXPA 1OVMA 2ZATA 1Y7LA 4AVYA 2PKQP 5AOCA 3VOTA 4B75A 1XEAA 5K0SA 2C2WA 3S1SA 1R4NB 4LHXA 3FCXA 4U3JB 5K2OA 3ZDAA 1XA4A 3OF3A 4OOEA 1N2SA 3L79A 1CE8A 1DFHA 4BB9A 1RZUA 4D46A 2WVJA 2XNJA 5KBYA 1QH1B 4TZKA 1V11B 1ESCA 4GKKB 2ES4A 1LCIA 5KDOA 1IJKA 5JCPA 2QRLA 1HFKA 1E58A 1MT0A 2RGXA 3DZBA 4AULA 4ZOQI 2X77A 3I3SR 3MLBA 4BFCA 4BE9A 1QRUA 3AM1A 5ER9A 2JFVA 5ALPA 5JO9A 4D8UA 2N42A 3LI2A 1HX7A 2JD2A 3E2PA 4JGGA 1CS4C 2PXAA 5EJEA 1SIOA 1VC2A 5DE3A 2RHRA 5D6NA 5E7IA 3ZGOA 3FPHA 4YP7A 1G8HA 1VIMA 4ZQCB 4ZQFA 1RLOA 4WESB 2HW8A 4MIEA 1MZVA 2ZVDA 3QWFA 3PKIA 1CETA 2GKOA 5TGTA 4C43A 1BTOA 4RH1A 3CHYA 1J90A 3A2MA 4FHGA 5A6SA 2Z9DA 2Z8XA 3EQ9A 3CLRD 3GUHA 3PR2B 1YJAA 4HSEA 5CUQA 3K3PA 4B46A 3N2LA 3EASA 3GZNB 4MAFA 1TECE 2O7NA 3N28A 1AX9A 1J2UA 2VSXA 3ONEA 3IVAA 4NDAA 1M1YA 4WBSA 5TR9A 2DPXA 3WAKA 2WHPA 4AYTA 4Z7NB 4YASA 4ALNA 2FVXA 3IXMA 1XN4A 2GKGA 3DDHA 1JV2B 4O1IA 1CUCA 4QRIA 1ZH8A 3BVPA 3SG0A 1W0KD 4ZU6X 1SGWA 1L7PA 4GOOD 3FCUB 1YRYE 2A5LA 4UVDA 3UMFA 4K26A 1E6EA 1EVQA 1LF5A 4QUIA 3REGA 3H6GA 1GZVA 1N1DA 5H02A 3NCHA 4EABA 3EZ7A 3T1HB 3VKFA 2PJRA 3IXQA 5C2JB 4A2PA 1FVXA 2DHRA 4BVKA 3J81k 3OURA 1NQAO 2AFIB 2HHLA 2O8BA 2GAFA 2JGKA 2XE6A 3H9CA 1QUFA 3PNSA 3IOEA 1HL7A 2D1SA 4FYJA 4RHTA 5DGHA 5G4LA 2XF2A 4EP1A 1XA0A 3GJ8A 4HV4A 4NMWA 4A15A 2QQFA 3KUXA 4IJMA 2JFFA 2A5GA 1XLTA 3OKPA 1SKUA 3W5CA 2GNOA 3LCMA 5DX0A 4L4ZA 2Y2UA 1X80A 4LOJA 2VHUA 2IBTA 2F48A 2QOEA 4G67A 4Z4HA 5KJFA 3AUFA 1Z82A 4FCWA 1KJNA 3L7OA 4U7HA 1NUUA 4X7BA 5J2UF 1RYFA 5GZ6A 3IUSA 2IYSA 2QRZA 3NWEA 5A9SB 1QHSA 2F8LA 4J3NA 1PJ8A 1PU2A 3QBJA 2H4YA 2NXWA 2VNJA 2CFCA 3LH5A 5ESDA 5AW5A 1JBEA 3INRA 3LWNA 2H1SA 3A8TA 3GFBA 1I13A 1NZFA 2FUKA 3H11B 4FGUA 3GT7A 3DHYA 4LI3X 3ZWPA 1NFFA 1LLCA 3ONNA 4M1EA 4Z2AA 2XUGA 3F71A 1UZLA 2VYQA 4XJXA 4K0RA 1O57A 2ZUWA 3FOFC 1ACJA 4RS4A 4I08A 1W44A 1D9ZA 1RACA 1M2KA 1OIWA 2PGNA 2ZDQA 3L04A 2BMVA 2AQKA 1SIWA 2EFEB 5T8KC 2O0MA 5JAHA 4QM7A 3EX7C 3FY4A 3PJRA 1Z37A 4UBOA 1AQYA 3I9V1 4PHFA 3ZQJA 1YC5A 3M5CA 4AYWA 1P74A 2GBLC 4DIDA 4D4IA 4LE1A 4MRPA 3FVVA 2F7SA 4LC1A 3HRHA 1HDIA 3HY6A 4JC8A 4OKSA 5DLEA 5HA5A 4DG9A 3CF4G 5CDFE 2BEUA 3FIUA 5KQPA 1YQXA 3LVFO 1TUEA 1YNOA 4PHCA 1JFTA 2V6MA 4JA0A 5MN6A 1J49A 2OHXA 4QBIA 4DLNA 4DAOA 1F14A 3HSKA 1OF1A 1E0KA 3E7PA 2CJYA 3N86A 4CMEA 3ELYA 4RNDB 1AB6A 1VYUA 3OIDA 2VZ9A 4PFQA 3IP8A 3CE9A 2AFVA 3GFTA 2RK4A 2V7TA 3LE8A 2GTHA 1Z47A 1BJRE 1GDTA 3DO8A 1PAUA 3WQQA 2E6KA 3IMFA 4J1SA 2EIXA 1IG3A 2WNIA 1RWMA 2C5HA 2ZXEA 3JSAA 4RK7A 1NV9A 3MT7A 3R7AA 1X1DA 2EOAA 1ND5A 2QD3A 2Q3DA 3BERA 1ES9A 1VE6A 1QZUA 3A1TA 2WWRA 3GBPA 3NT4A 4FDTA 4QNRA 3UAWA 2GVZC 4TM8A 3C6BA 4AO7A 5ALYA 2DWPA 2Y77A 1G4UR 1KRHA 2JDID 1RI4A 1LUAA 3HYCA 3L8MA 4CMIB 3MHPA 2AR0A 3DD5A 4RS3A 3S1LA 4PSKA 2AI1A 1PJ2A 1T2CA 2X7XA 4NCKA 2H08A 1AMOA 5C53B 4A6XA 3NM4A 3ETDA 3V9PA 2A92A 3EH1A 3OFSA 5LA6B 3UJAA 2I7DA 4FBGA 2HDHA 2TMYA 1R0BA 3FMFA 5EKDA 3INGA 2V6JA 4G09A 4ZCLA 2O0HA 4QT0A 2QP4A 3HPRA 3KDSE 3TD2A 1EK6A 4AJ9A 4LXIA 2ZRNA 1ZMTA 3TLYA 3L9XA 3PNYA 2VTKA 3U3OA 2HMUA 1PNVA 1W6UA 1NGSA 3KBOA 1NLFA 2V7QD 4JNCA 4U5QA 3TM4A 5LJLA 1KSFX 1XXHA 3AEKB 4XGQA 4HH1A 1QO7A 2VP0A 1ZGBA 3NHUA 4MQEA 2C2YA 2P11A 1SCAA 2XNKA 5A71A 1YJXA 2QQ5A 3L7YA 4HTFA 1EDEA 3FWZA 3H42B 4UQOA 4RMJA 4RF3A 4MR8B 1OYVA 2AOUA 1G6Q1 1QOPB 3HR7A 4MLPA 5IP5A 3M2PA 3SICE 4LV6A 3V8VA 4IBOA 1YR1A 1EFUA 3W5UA 4BX3A 2PWZA 3GH3A 2GYYA 2YC4C 3AK4A 2OCLA 2I76A 4FT4A 3ZKWB 4W6ZA 2QMUA 2R6JA 4HQ0A 4LRQA 1UBCA 1R5NA 3UWOA 4CFYA 2ZJ7A 1YBMA 4V3BA 5CM9C 4DLXA 4KIFA 4PO8A 4DIFA 2HR1A 1JFFB 2CF6A 1XU7A 3JQEA 4AJLA 3PD1A 4MA4A 3LKVA 3NW9A 1J0CA 3ZE6A 2EW2A 4YLGA 1USWA 2SCUB 3KAPA 1M6YA 1CZHA 1YZNA 1N6PA 3E5NA 1T9GR 1TT7A 3OETA 3UJNA 3FPCA 4II2A 4HK4A 3WWDA 1X7YA 3M5WA 4QFCA 1U7DA 1UC5B 2Z5FA 1W0JD 5CJJA 4V0NA 4LV5B 1SG9A 5CIYA 4OFXA 4PYJA 1T1IA 4IG4A 3OQBA 5EJ6A 4EVIA 5EXDA 4EG8A 4PYRA 1U4SA 1YHZA 4KO8A 4F9TA 3IMKA 1P3Y1 2WV9A 4JS0A 4YDRA 1VRWA 3GP8A 1KK3A 2YBDA 4B8WA 3TF5A 3P27A 4BUJA 1YZ3A 4IOLA 1DCKA 5JCJD 1QFZA 4JR1A 3TSWA 3ZR4B 4O2AA 4RCYA 1HE4A 1B23P 2C0QA 2J3JA 5EIBC 3BCUA 3TPCA 1CEQA 2WT4A 5I9LA 1BOFA 1HT0A 3IUYA 1P8JA 3LHSA 4W9RA 5IC6A 4YACA 1A5TA 4RGVA 3VYSB 4LQDA 3OAAD 3BWXA 3EFOB 3K96A 3CSUA 3Q5GA 2Z30A 5IFKA 3L6OO 4B6OA 3LQQA 4QFBA 3GGOA 2DPHA 1B8NA 3CKLA 1SZPA 4JYPA 1XQWA 1XKXA 3WKDA 3KETA 2C7QA 5J2TB 3QA3E 4RK1A 4BQOA 2IY8A 3GQVA 4B7CA 2Y1LA 3D81A 3D8UA 3O03A 3VNAA 1PLKA 1N8TA 1VLVA 4KSBA 3VPBA 4EQ6A 1GTVA 1NBME 3E3LA 1DJMA 3V1YA 4CUZA 4N8EA 5E8RA 3AOGA 4H7FA 1O6ZA 2H6EA 4ID9A 3GIWA 3V4LA 4H4CA 2P1ZA 4LJ7A 2VXCA 3P2MA 2ZAOA 4V3CA 3VC1A 1L8OA 1X8LA 1VKOA 3RQIA 3SI7A 2G1JA 4D1YA 5AKXA 4F5YA 4BVHA 1R88A 4HYQA 5JJKA 5JTTA 3BH6A 5AVOA 2CCKA 3SEFA 2K87A 2XCLA 3AYZB 5D86A 1ZM4A 5CFZA 3QFTA 4QGAA 3AEQB 5I4CA 1RYMA 4IVPA 2ZJ1A 1KC3A 2HRDA 3DBOB 4CCYB 4OJYA 3G7SA 2ZB7A 4GD3Q 1W4AA 2CNOA 2K6GA 2EL7A 1R4AA 2OEPA 3EEIA 1AKEA 5HF9A 5JRZA 3GIDA 3STVA 1L4EA 5JU6A 2ZT6A 1BOOA 1KFEB 1SMKA 2IK8A 2Q0QA 2C98A 3I4CA 4DSZA 4BS9A 4A6DA 3WGKA 3FNFA 1WE2A 3W77A 2Y1KA 2ORWA 4X97A 4ZO7A 2WTNA 5AVTA 1SXPA 1DQZA 1S02A 1WXWA 3VQTA 1DAGA 1MB0A 3LG2A 2J9FA 4QYIA 3VYUB 3Q1LA 1NRIA 1NYRA 3PC7A 1OA1A 2BKXA 2Y0PA 4QWMA 3UUWA 3VKHA 2BFCA 4D4HA 2OILA 4UEOA 3HCOA 1DEOA 1DKMA 1G5FA 1YBVA 1W25A 3REOA 4BVEA 2H85A 2XGOA 3EGEA 4QJIA 4CQJA 1G7TA 1SO8A 1Y1PA 4C0AC 1F8GA 1Y9JA 5BRJA 4QYXA 4LOAA 5CVTA 4TN1A 1TM5E 3ZUPA 5AKHA 5EVJA 3OQOA 4B3JA 2FUEA 4MVJF 4X9XA 2AMVA 3VR3A 2YMLA 3ITEA 2AH5A 3DFKA 3WLTA 5A3QA 3TK1A 2QN6A 4DV5B 1AN0A 5HJ7A 4OM7A 5JPDA 4TT3A 5IXSA 2CVOA 2O4UX 1JLLB 2W6NA 1JDZA 1EINA 2E1RA 2GGSA 4OK6A 1NE7A 3CZ5A 1UBRS 3M4ZA 3L5KA 4NESA 1DAPA 3K0CA 1UFKA 4Q3LA 1PGOA 2QRHA 4R6XA 1XXLA 1FFHA 1Z4OA 3DJYA 5DYGA 1HKUA 5KDDA 3J81A 1VIAA 2EBWA 5EIOA 2X8JA 2J1LA 3C2QA 4ERNA 2O5VA 3T3MB 4RTKA 2DSTA 3S3TA 5AW1A 1DTEA 4PRZA 4HP8A 1XSEA 1NW6A 3G2QA 3NQ41 3E1GA 1PZFA 3B82A 1O9BA 2PX4A 4EHLA 4Y1FA 3VVLA 4EW3A 4KW7A 4CG0A 2Q2OA 2XNHA 3IP7A 2I22A 4H7KA 5IULC 1G9TA 4NFLA 1JIQA 1MABB 2H7CA 2LDBA 3PNOA 4GEKA 2Z56A 4RD1A 2ZYIA 4RY8A 4TZ0A 2DR0A 1JPNA 3EPRA 4FNAA 4POOA 5A7FA 2WAAA 3LJKA 3DS8A 2R751 3RFVA 4DRZA 1L4NA 3ZV6A 2H7XA 2UDPA 3AM4A 2P90A 8OHMA 1JDTA 3KKQA 2ILVA 2Y1DA 2O9JA 4NJMA 4PNZA 1XTRA 2P9GA 3TLAA 3MGGA 1FRNA 1USKA 2ZYSA 3R77A 1WXXA 4U1RA 3UXEA 1H4QA 3LUAA 1M8FA 4QFDA 3ADBA 3D7NA 2XLBA 1NIPA 2EGUA 4BMVA 3ZDEA 2OCPA 4UTXA 2XGSA 5EXPA 5AM1A 3T4XA 4YJ3A 1EBUA 4QBGB 4BFVA 3EW9A 3OFJA 5AJZA 4WOKA 5CDSA 3U7QA 3OLVA 3CU5A 1KDYA 1YHYA 4S0XA 1B8VA 1DBRA 1XTVA 5B3AA 2PCLA 5KU1A 1SQGA 1E6CA 3VRHA 2ZWPA 1MZPA 5ALTA 5A3SA 5IDQA 1YOVA 3I9MA 5ERXA 1Z6AA 2G0TA 2FR1A 4HZGA 5F51A 1L8LA 1LW6E 4QOHA 4UM9B 4YCAA 1JEYB 1Z2AA 2Y9PB 3IA2A 1MHTA 4ZT4A 2WIDA 2VQEB 1IOLA 4F85A 3WTBA 4RVDA 1ZK3A 2W6OA 3I0NA 3PDCA 3TW6A 1RMQA 4REQA 4A0RA 3CVYA 5A0TA 4B0OA 5HIMA 1J07A 2ACVA 1XF9A 4QEKA 2VF5X 3B9QA 1GPDG 4E3ZA 3NJ8A 2CFSA 1AS3A 5K8VA 1WEKA 4LJRA 2XSZD 4ZHQF 3E9DA 1TZJA 3BMQB 2FW0A 4LBZA 1D2EA 2YV5A 2W4QA 4AURA 5I8WA 4XWWA 2PZMA 1ECCA 5EKUA 4RTLA 3O7WA 1SULA 1XQVA 3AU9A 3L7NA 3H19A 4FGKA 3UHOA 1R9JA 1AHIA 2XMPA 4X93A 5ER6A 3WDSA 5GONB 3M83A 2HDWA 4ZYZA 3Q41A 2JAWA 3EIOA 3UANA 3ZDXB 3QVTA 1GNSA 1OLSB 4GI7A 3L0PA 1T6BY 3TCKA 4ZYTA 1D1TA 2QUJA 1N9GB 1ADYA 3C6XA 1W581 1IYZA 3G49A 5BR4A 6GPBA 2IS1A 4TQAA 3IKLA 2OV3A 4IW3B 4FFBB 2R96A 1I5OA 2Z04A 3GLFB 3C7AA 2GRAA 3N2KB 4GL4A 4Y9UA 3BA6A 4EB0A 3NIGB 2NX2A 2JF0A 2NZYA 4GLLA 4JYAB 2ZI3A 1Q16A 1R0WA 3O2NA 5K4HA 1P73A 3R8XA 4CG3A 4Y1RA 1O6CA 1E79A 1GPWB 2CMGA 2P2LA 3I58A 3MJEA 1AVTA 4U63A 4WD3A 5AM0A 2OA0A 4BASA 4BV2A 1KO8A 2VBFA 4N3GA 4CNBA 4PPNA 2QNRA 3FMPB 3U4QA 1XC7A 1TEXA 3M8KA 5KJ1A 2HKIA 2C42A 2JVKA 2Y6UA 1S4MA 3EC7A 4FFLA 3PTAA 3KQUA 2DH6A 4B81A 2QYOA 2Z1DA 2WYHA 4MTLA 3O8QA 3X1WA 3HB0A 3KKMA 3TZLA 1FNNA 4CETA 3K31A 3QF7A 3CVXA 2UXDB 5CVJA 1UWKA 4Y9SA 1YO6A 5KWVA 2JFBA 1QH0A 2CVFA 3HL0A 4ZVKA 5TQ2A 2IOQA 1GY8A 3PKJA 5C5IA 4G4IA 4BKRA 3JPYA 1QGUA 4CQLB 2ZYUX 3TYXA 4MUNA 1P7WA 2W7TA 1AKQA 4IIGA 3GCXA 3FF4A 4KPFC 3KQKA 4CLOB 4HPJB 3ROTA 1TQ2A 2RONA 4NV0A 4E5NA 3G2LA 3LK7A 1E1RA 1MA3A 2J41A 2OBBA 2P6UA 3MJVA 4IGEA 2HQBA 3CW9A 4P4SA 3VO1A 3W5JA 4ZMBA 2J6IA 1TTTA 1AF4A 4BKMA 3JVVA 4PU0A 2HDNB 5KTKA 1GQOA 1QG2A 1EUDA 2GXUA 2ZQZA 1XTIA 3CXUA 5AUNB 3OZBA 3WJ1A 1BCRA 1OTYA 2VTEA 1X7WB 4YH1A 3VYWA 1NONA 5JJBA 2HI0A 1CY0A 1V1JA 2P40A 4ILEA 4I1PA 1EUQA 3EGDA 2D1RA 3PQCA 4MI6A 3STXA 3FOEC 1CJMA 3T9AA 3BMCA 2NQ2C 3E8SA 4JBIA 5BMVB 3UHJA 2PKWA 5CLJA 1MW8X 3U60B 3UOWA 2A33A 1SC3A 5A9TA 2Q5CA 4X64B 1A8QA 3O4IA 3SQMA 4MKXA 3I05A 4DTIA 1TM4E 5LFAA 1L8AA 5FO1A 3I2YX 3SR4A 1IQ0A 4MQ6A 4EGSA 3AR8A 4Z4GA 3R9XA 4LDPA 4EHFA 4JI2B 1SC6A 4LA4A 2OCAA 4R98A 2C2MA 4OAOA 4BNJA 1M74A 3WXBA 3QPBA 2AYXA 1R4NA 3GLTA 1A2BA 1IEVA 3LKDA 4CF7A 1QKIA 1SK8A 3FM9A 1Z5ZA 2WKQA 4OQQA 3BSFA 1M0WA 1QH1A 5JSYA 5B1YA 3F47A 1XO1A 2HTFA 4X20B 3TE7A 3C7TA 1UPXA 4H7DA 4QD3A 5B3JC 2PYDA 1UODA 1NYQA 2XGGA 3E9EA 1G8PA 1NVEA 4DQ0A 5AHXA 1ADCA 2E7ZA 2H1WA 1TOAA 1AXRA 5TS3A 1DQYA 4ZVVA 1DCMA 4C7XA 4R8RA 2Y92A 4RUKA 1JLKA 1QXSA 4WESA 3U17A 3K4HA 1C7IA 2B78A 3QOXA 2ON6A 4H77A 5C5CA 4HDAA 3QE3A 2VPZA 5JJIA 2Z3ZA 5TC4A 2FNAA 5KVSA 3R8FA 1Q0UA 1B0ZA 3ORQA 1SVWA 4U2KA 3E3AA 3ZCVA 4H9GA 1TDJA 4JX9A 2IV3A 1Y6JA 1M1UA 1C1YA 3HJCA 3V42A 1QG0A 1WXDA 2VP3A 4RIHA 3BL8A 2X22A 5EE9A 3K1ZA 2ARKA 4Z9XA 4JFRA 1QVVA 3H2IA 3IKTA 1H1DA 3H3FA 2C8LA 4RMHA 5A9RA 3B9RA 5IS2A 1KZHA 1TNDA 2BUBA 1YAJA 4Z9AA 1H0RA 1R5JA 2YICA 3WKEA 4DW8A 3DDUA 4DB4A 1JDUA 1XHFA 4IH9A 1RI5A 1ZEMA 1XZLA 1CQZA 2D0OB 2EG5A 2ZS8A 4HATA 3P32A 1IBLB 2AFIA 2FXVA 2QJRA 3A2LA 4CDGA 3DW3X 3ZTWA 4L51A 3BH0A 1F0PA 4X0EA 4HNAB 3WOVA 1JH8A 5LYYA 2XA2A 4TLDA 2CJFA 2QT9A 3T7KA 2YQZA 4YQYA 3LUKA 1QO0D 4JLPA 1LQ2A 3LPNA 1I2CA 1DAEA 1K98A 2SHKA 3VZDA 4AKEA 1PJSA 5HKOA 4IS3A 3G13A 5M29A 4HAYA 2ZWAA 3I2FA 3QF4A 5FA5A 2BLLA 1MVLA 2QQGA 5IYZF 2ZPAA 4GI5A 3KOZA 3C97A 4IJQA 5A9SA 5DEOA 4O3MA 3B1YA 1VB5A 3GNLA 4IHKA 4W82A 1NPDA 5TB5A 4V02A 4NMLA 3PK0A 4JC0A 1SUAA 4XQEA 5EINA 3AB7A 3H11A 4LMAA 5JNVA 3KLNA 3RSSA 1RWQA 1BG6A 4LS3A 4R2WA 4E2YA 2H2IA 4Y2XA 4C4TA 2PJDA 4PTLA 1O6FA 2V7EA 3G02A 3KSDO 4MWBA 5FUBA 4NZ9A 4RZHA 1ZVQA 2EWWA 3TQSA 2P4UA 1XX6A 1T1SA 4RTRA 2Z6QA 3B3FA 2H18A 4XYMA 1PQWA 4C6TB 4Z4EA 5ALSA 3GYGA 4LDJA 2CFIA 1JQJC 2DFDA 2F17A 3ITDA 3ZU2A 1MLDA 3LX4A 3EBOA 4N65A 5BWLA 3DM5A 1FFWA 4J2HA 1UQTA 3DFUA 4IX1A 3CBQA 4CCSA 3BIFA 4WJLA 3OZFA 4KR3A 1MO3A 1SXHA 1T10A 1G6KA 1TYDE 1YRWA 3IAS6 3IB3A 2I2AA 2CNNA 2PH3A 3IP6A 4IM7A 4J07A 3ILHA 5ICFA 5FTLA 1L4UA 1DWPA 4MHOA 4XA8A 1G5TA 2W2KA 3G23A 1SHLA 4AG5A 1XEXB 4H6PA 5AXDA 2CV1A 4KO3S 3HJNA 3BILA 1SRRA 3HJGA 1MC8A 1UP4A 4LY6A 2PG3A 3E7DA 3CH7A 1G63A 5EZSA 3TEFA 8AT1A 4F72A 3MCAA 4QGGA 3CNEA 3UZUA 2Z4SA 3L4SO 3KZXA 5DNWA 5E1MA 5H68A 4UM8B 3IDAA 3PKZA 3SJUA 2G83A 3II6X 2QRNA 2FJUA 1H22A 4W1PA 4DNQA 4KRXA 2WJ4A 1Z2DA 3NPAA 1MF7A 3PXBA 3UB4A 4IXTA 1GG9A 3OZIA 3L7LA 3TLBA 1OI3A 3CLTD 1OC2A 3DKPA 3FXAA 1QQ6A 2HBZA 3KOYA 1KR2A 3ZJ5A 3DZHA 3N2IA 3K94A 4CMIA 4UXJA 2WU8A 2JFYA 4ZC8A 2EJWA 1Y5RA 2I2WA 3G7UA 4P6VF 3QQ5A 5JO0A 4UEJA 2I8LA 3IIEA 3QFSA 3EODA 4LE2A 1E7SA 1AF7A 2PPVA 4XQ9A 4FYIA 5LA6A 3S2GA 3ZNNA 4AY5A 1BVHA 3IJPA 5G1NA 4C2BA 3RJMA 1T9KA 1XJ0A 3IFSA 2OENG 4HFMA 1SPXA 4PO1A 4X1KB 4Q7QA 2BFEB 5BNWA 4MRSA 4QOJA 5D01A 1YA6A 1U0RA 2OC4A 1ZUWA 2WR8A 4DB2A 3VR1A 4EB3A 1JG4A 2UZAA 2WABA 3AEKA 2RGYA 1BC5A 4H1UA 1AA9A 2PUHA 1UWCA 3RLIA 3HEMA 4MR8A 3CX7A 4R81A 4DNOA 1NJ5A 4B3XA 4C7VA 1JZSA 3BWYA 4U6NA 5FBZA 3TR0A 1PGQA 5AK4A 2ODPA 2ZTLA 4DQVA 1L4BA 1CUAA 2HU5A 1YE8A 2DMRA 2GO1A 2R48A 1Q1AA 3GJTA 1RYHA 4TLMB 4AFNA 3FOCA 4N3BA 4CUJA 4NTZA 4X6YA 3SHFA 1N3YA 3KK0A 2OG2A 5EE1A 2JAHA 3ZKWA 1VG9B 5BW5A 2Y0BA 1EESA 1A8HA 3D8RA 1JJAA 4G63A 3WRWA 1XL0A 3AERA 3DAPA 3IDZA 3TLCA 1YL7A 2E4AA 2R7KA 3O9ZA 4JC5A 4PYNA 1NBIA 5B3KA 3QPAA 4X3CA 4AL4A 1L7NA 4ARZB 5IHXA 3ZLJA 1E5XA 1ICEA 5CX4A 1BVUA 1NRJB 2IIBA 2Q3JA 2OLJA 4LYEA 1WDWB 4KXYA 3UOAB 5ANRB 1RYDA 2P2CA 3U9TA 4H6XA 3CNHA 4NATA 3T1OA 2Q6OA 3HCFA 1PJRA 2ZCJA 1Y4ZA 3DXXA 1BMFA 4RV9A 4XE5A 5EKTA 4KYUA 3SD7A 5F2NA 1NNLA 1BXGB 4KZKA 4D9BA 3D6NB 4KWHA 3PE3A 3BT7A 1GYQA 3OTGA 3F5DA 1DKQA 1O5OA 1M10A 3OJ0A 2B82A 9MHTA 1XJCA 3HUTA 4M9XA 2VHEA 3GCWA 1JHZA 1KVTA 1TQDA 3GK3A 1BFUA 2LNDA 3IQDB 1V45E 4AF8A 1IHPA 1JIKA 2MR5A 2PN1A 3SNKA 2YWCA 3LCCA 4BO9A 3UQZA 5FI1B 1UDWA 2P6RA 3JYQA 1CPYA 1J24A 1CUSA 2B5VA 3E2MA 3SHOA 3F5FA 3NS7A 5F21A 3U3DA 2MT9A 2XUDA 1OD6A 4OMUA 2G70A 4ZT5A 3R7BA 4BWVA 4UHDA 2V55B 1Y4UA 3DMTC 1EP3B 3TIGA 3JSXA 4IHJA 1DUSA 3EQZA 4L95C 3F6SA 2PU7A 3IBGA 2D00A 3PDUA 4TL8A 3JRNA 4EAAA 1KK0A 4GNKA 2JIZD 1N6OA 3PA6A 3HO6A 3U39A 4F2PA 3TZKA 4ND8A 4BO5A 3ODGA 2GK3A 2JIPA 5FAXA 1T2VA 1O94D 5J2TA 5IVKA 5FWAA 4HAWA 4RF5A 3IIKA 3IP5A 3KZKA 4DVJA 1Z68A 1M6WA 2YJNA 3FLBA 4I5GA 4HXGA 2B8JA 3EISA 3L3BA 3A70A 4N1AA 5AM4A 4AWBA 1CZRA 3ZI7A 4BBJA 2V6BA 2IQIA 4WERA 3U7HB 4MV0A 3UJ9A 2VQFB 2AXQA 3MWEA 1B6SA 3RV4A 1PRYA 2Y71A 3CN9A 3MTQA 4M46A 4ZEWA 1N2ZA 3ED1A 3T34A 4B7AA 1NMQA 1NQOA 3FPSA 3QU9A 4EFNA 1HQCA 5JMPA 5AVVA 1LDYA 2AG0A 2G6BA 1CG6A 2HSEA 2FFHA 2XYHA 3B3QA 4JKYA 3K0BA 4MSUA 4UHHA 3LPLA 1S2OA 2G3YA 3KFVA 3NAMA 4IV0A 2ZWVA 3BE8A 5DHRA 1ZSVA 1NXTA 1JU3A 3K09A 721PA 1MH1A 4HX9A 3MB5A 1R9GA 3Q5EA 4IQ4A 4CCYA 3KJFA 2RAUA 5DK6A 1W49A 1DKNA 1ULBA 2HNAA 5SY6A 3VTFA 4AX8A 3EA5A 2M98A 4MLCA 4RTNA 4D6XA 2VOEA 2RK3A 3AFGA 2QVZX 8ABPA 5J5CA 2HMAA 1QHEA 3A1NA 3CB2A 1R1DA 2IEYA 2XKBA 3O31A 5EGNA 3PNLA 5B5SA 5BVGB 4QECA 4KYTA 1S2MA 4FTWA 2AV6A 1GARA 3KVVA 4CKXA 4P53A 1O5TA 1IXRC 1UJ5A 1GNLA 4L8VA 4LRWA 4N6NA 3KU4A 4INZA 3WHLA 4ALKA 3VNSA 2QTRA 1SC1A 2A5JA 5IHPA 3IULA 3K05A 5DTRA 3AYXB 4KV9A 1UK6A 4UC0A 2PU5A 2GN9A 1U65A 1BGWA 1V8ZA 5IJ9B 3DTVD 1YOBA 3EG5A 3HABA 2HYIC 1T3ZA 4RKWA 2IT1A 1DKPA 2YVQA 4ZO8A 4V0QA 2IPOA 1OLXB 1TW3A 5DDIP 4WL0A 4ENRA 1ZR4A 3SZMA 1AXEA 2QVGA 4NV1A 2RCNA 2EW8A 1I0LA 2EL9A 2Z08A 3ESRA 4X90A 1AOXA 1GZ6A 3KHTA 4XTCS 3DOUA 3ZHZA 4AY6A 2QW1A 1T29A 4Q02A 3G79A 5JC8A 4OQEA 1H1LB 3B1JA 1HNNA 3GDWA 3MHTA 2MYUA 2EFYA 4EA7A 1AV6A 2HZBA 5KVAA 4O25A 1NX6A 4IGIA 3WYEA 2JCBA 1G4AE 1JQKA 1P4GA 1ZFNA 1KSHA 2PKCA 2R8XA 2VJAA 4MEBA 4UFOA 5IXJA 1QVZA 3LLVA 4WZAE 4PSUA 5T41A 1QZ3A 3WNZA 1PL8A 4GMDA 1Y9ZA 4QNNA 3T3IA 5FFMA 4IX9A 3PXDA 2IODA 3RVOA 4NNJA 3P0IA 1G5HA 1QHGA 3D02A 3H1BA 4H3VA 4OK3A 4F38A 5KNBA 3LUPA 3OX3A 2QM8A 1P0PA 2XVYA 1QWSA 1IAQA 4RCVA 2WU3A 3O95A 4GGPA 1FU4A 3S44A 2XCSB 3SY8A 3MRSA 4CIBA 3GXBA 3L7IA 4RY0A 1MABA 2YYYA 3IAAA 2CLDX 3KEGA 3WWYA 4EX7A 5K9ZA 3PE6A 2ENWA 2WJVA 3WK9A 3FLMA 3L49A 1R0CA 5IH7A 1G17A 1G42A 2Y27A 4BMOB 3T3DA 4TLLB 5DXJA 2QM3A 5IDWA 3NONA 4F5EA 4P7BA 2HA6A 1VPDA 1XVVA 1U7WA 1K4KA 2OKGA 1F5NA 3HA3A 5D5HA 3SWWA 5KWEA 2O3JA 4K40A <