5KWJA

M.tb ag85c modified at c209 by amino-ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kwjA00
3D2CA 4EHBA 1R9NA 3CN9A 5DTIA 4HVTA 2GBCA 1EDBA 5JALA 1BCRA 5AI0A 5T4EA 4E15A 1VXOA 3G7NA 4GECA 3H17A 3WA6A 4J0JA 5ALRA 1W76A 4DGQA 5JZBA 5FP0A 4BRSA 1ORWA 4XVCA 2WKWA 2NW6A 1MX9A 1UFOA 1XFDA 5BWCA 4RE6A 5LZ9A 2RGUA 4H7JA 4ZV7A 5FUMA 3EQ9A 4X97A 2JGMA 2AXEA 4U2EA 4G4JA 2WIKA 4QE3A 2XMZA 3OOSA 1QIEA 4PNZA 2I03A 1J07A 2VJAA 4BP9A 1CUGA 4TGLA 1ZGCA 4U2CA 2VJBA 1DINA 4Y2SA 4BC0A 3PE6A 1CQZA 1AKNA 3JW8A 2QXTA 4EY8A 5YASA 4UBNA 3EBLA 4ZREA 5CT9A 3TRDA 1WB6A 4L3WA 1HQDA 1L7QA 3GZJA 2PL5A 4GBGA 4DMFA 3IUJA 4FMPA 4UBJA 5DNWA 3WK6A 3WKAA 4HRXA 2HRRA 4EY5A 2VF2A 4C4ZA 4DMCA 2PSFA 1CR6A 3A2LA 5K3AA 2WFZA 2OXEA 5EIHA 3FVRA 3OG9A 2WILA 1AC5A 2Y1KA 5ALWA 2JBWA 3FCYA 4QDXA 3ILSA 1VA5A 1PV1A 1LZKA 2ES4A 3A2NA 1QJ4A 5EFZA 5AHXA 4AO6A 2P8SA 3PICA 3I6YA 3R3YA 3STTA 2O7RA 1YA8A 4ITVA 4BVLA 3QMWA 3AZOA 3ZI7A 3C5VA 4GDMA 1CQWA 1ISPA 2V98A 1MN6A 1CUJA 2BUAA 3WWEA 2ACEA 4BAGA 3WL7A 4BYMA 3IUQA 3DYVA 1UXOA 3RKSA 5ISMA 3PFCA 4Q3KA 4H18A 1EK2A 2WJ6A 4HRYA 1CUCA 3BL8A 3D2AA 4E11A 4ZXFA 2FJPA 3PF9A 4X6UA 1CUAA 5JAOA 3W2TA 4FWBA 1ZIYA 5HFNA 1GZ7A 3AILA 1R1DA 5ALOA 1LPAB 1D07A 4HS9A 2OGSA 1RYYA 4P08A 4UBLA 2XUPA 4B9EA 2CB9A 5DLPA 1N5RA 3Q0TA 2ZYRA 3H2KA 5HFAA 1DX4A 1EX9A 1VJ5A 4X92A 2GBFA 1P0QA 1CPYA 1R4ZA 5AIBA 1UKAA 3QM1A 4OB6A 4HXFB 1W4LA 3R0VA 3QPDA 4U2GA 1EHYA 3E3AA 2C0QA 1YASA 4M0EA 1THGA 5DYYA 1GPLA 4Y2QA 1T2NA 2RAUA 5ALSA 1NU6A 2GZRA 4BAUA 2WFLB 4BP8A 3BF8A 1X2EA 3WK9A 3B12A 5LZ4A 4N8EA 3W9BA 2WFMA 3V1LA 4AB1A 1ODTC 3NGMA 4OCZA 4DLNA 1BN6A 2RIPA 1WPXA 2R11A 4M0MA 3V1MA 3WZMA 5JD6A 5CTAA 1ZIXA 1TCCA 1J1IA 4W63A 3WMRA 4H7KA 3BWXA 5JAPA 3C6ZA 2BGNA 2BFNA 1IUOA 1EVEA 4E14A 5K3DA 4WY8A 4DM7A 1WHTA 2CKMA 2PBLA 5JAUA 5DWDA 2GYWA 3BJRA 1XZCA 4V2IA 2XB6A 3ZWQA 4JYPA 2XUGA 1LLFA 3SX4A 1DQYA 4PSCA 2O2IA 4MWTA 3G9ZA 2DHCA 2XQGA 4F5ZA 5FDFA 3HACA 3DKRA 5ALTA 4S0XA 1CUWA 1QIMA 2PU5A 2AJDA 4BDTA 1QLWA 1B6GA 4P92A 4UPDA 3STYA 5CT6A 5ALHA 2JGFA 3WWOA 5JZSA 2PSJA 2QRUA 1LPBB 2ZYIA 2RHWA 3V1NA 3WK4A 1XRRA 4H77A 4Y2XA 2JEZA 5FV4A 4FNMA 4ZWNA 1DWPA 3C6YA 1ORVA 2HFKA 2IX9A 4KRXA 3G02A 2X5XA 1W52X 4ZRDA 5K3FB 1CUFA 3FNBA 1XQYA 3KXPA 1FFDA 2Y2VA 1H22A 1U65A 4G8CA 4E46A 3IA2A 1MJ5A 5CH8A 4JUIA 4Q05A 5T4BA 2WFLA 1VZ3A 4K6GA 4UFNA 4KACA 5JAHA 2HU7A 5HF9A 1X2BA 1R9MA 3WYDA 1EINA 5AM4A 2VATA 1R3DA 1SC9A 2WUEA 1EVQA 4QZVA 4KAAA 4WFIA 2XMCA 2PM8A 1WM1A 3OM8A 2Q0XA 1AX9A 1TKRA 4WY5A 3H1BA 2WIFA 4QLOA 2C0PA 3H19A 4OU4A 3F96A 3KD2A 1ZJ4A 2WHPB 1QO7A 3NOXA 4OU5A 4IHAA 2YH2A 2FUKA 4JH0A 4P93A 1QIDA 4J0GA 5ALEA 1YAHA 4TPKA 5BOVA 5LKAA 1BROA 2XI4A 4C4XA 2ORYA 2C5GA 3ICWA 4HAIA 4LXIA 1SCQA 1YS2X 5LKRA 3MUOA 5CT4A 4DMHA 1MX5A 1GPKA 5IVHA 3MGAA 4X00A 1QFSA 2JEYA 4C01A 3KSRA 2OCKA 3WL6A 4PQEA 4PO3X 2ZJ6A 5EHNA 1Q0RA 3HJUA 3WWDA 3HC7A 4BE9A 4X7BA 3M3DA 4UBOA 4L72A 4FLFA 1R88A 2DHDA 2G63A 2JIDA 4QA9A 3WK7A 2WHRA 3H2HA 2G4LA 4BCCA 5CXUA 3I1IA 3QPAA 4G5XA 4OD0A 1UWCA 2PKYX 1WCYA 4QEKA 4CG3A 2ZSIA 1R50A 3G9XA 5CW2A 1CUZA 3C6BA 3VKFA 1CUIA 5JARA 3VVMA 4KR0A 4U2FA 1Q84A 3V48A 1AUOA 4A23A 1C7IA 3HI4A 2WTNA 4A16A 3TEJA 3BIWA 2G5PA 1YCDA 3AINA 4MEAA 5HKAA 1X70A 2EEPA 1DTEA 4B6GA 5JZ9A 3ED1A 1CEXA 4AQDA 2PX6A 4UHDA 5D3ZA 3A6ZA 5SYMA 1QIGA 4GWLA 4D9JA 1MT3A 2QT9A 2VT6A 1Z68A 3W05A 4ROTA 1AMNA 1S8OA 2IIVA 2ONCA 4CCYA 1YA4A 4W1SA 2VAXA 1YB6A 4B7ZA 2DQYA 2BUBA 1TK3A 1B41A 5LP1A 2HFJA 1ACJA 1SFRA 1E8NA 3WI7A 4N8SA 3AIKA 4DMKA 2EDAA 1KU0A 3C45A 1P0IA 5AICA 2OPHA 2VQ6A 1C4XA 2B61A 2V97A 1DU4A 4LXHA 4H7FA 1TIBA 5FKJA 1H2XA 2OGTA 3HRHA 4CG2A 1Y7HA 1HKHA 4X94A 1MAAA 4K6KA 5D3KA 4GLBA 1JI3A 2WU4A 4I3FA 3FYUC 1RWQA 4W1PA 5EIAA 2XMBA 3E1GA 2EDCA 2HHAA 1ZI8A 4C6HA 1XKLA 2DHEA 1HLGA 3P2MA 2RONA 3C87A 3LIIA 5CXXA 4AXBA 3F67A 1LPSA 4EB0A 3L1IA 3I6MA 4H7HA 5C8VA 3L1JA 4UBKA 3U1TA 4AN0A 3H0CA 3ZLVA 2YASA 4GI1A 3VDXA 3HABA 2GZSA 2WHPA 2LIPA 3GROA 4CG1A 3VXKA 4IH1A 3D2BA 4W1QA 4B84A 3JWEA 4FTWA 4JYMA 3HEAA 2BGRA 3OPMA 4G9GA 5E4TA 3VVLA 2QJRA 2PUJA 5HQ3B 3R3UA 2ZYSA 4KYVA 2JGEA 1K6EA 4YX9A 3C8HA 1UK7A 3STXA 5E4YA 3HSSA 4EA6A 4GEGA 2Z8XA 3LCRA 1E5TA 2J3QA 2CZQA 4AO8A 1KEZA 4UFPA 2JGJA 1Q0ZA 4UHCA 3IDAA 1ZGBA 2WG0A 5KREA 1ACLA 1BN7A 4NS4A 2XUQA 4DSAA 5EHZA 2ZSHA 3DKKA 1MO2A 4MXDA 5KWIA 1XZDA 1LPPA 1E66A 4HXEB 2WIDA 1EI9A 2QUAA 1FFEA 4KE9A 5K3EA 3EQ8A 2XUJA 2WM2A 2AJ8A 4X6XA 1VE6A 1YB7A 5AOAA 5LZ7A 3WZLA 2Y6VA 5AM1A 1FJ2A 5CRIA 5ALVA 3WKEA 5ALNA 2WU3A 5AI9A 3RM3A 1XZAA 4H7IA 3K9BA 2WJ3A 2AJCA 5BWBA 3QZUA 4EBBA 1QIIA 3ICVA 4KE8A 3ZLUA 4TVKA 4FDMA 2E3JA 4HTAA 4INZA 3FYTA 3R3XA 5IVDA 2OQIA 4F21A 2GYVA 4P9NA 1A8UA 2V9ZA 3L1HA 5A6VA 3UUEA 5HCUA 4BCBA 3GBSA 2JGKA 1YSCA 1JT2A 3FWHA 4QDTA 1DQZA 1USWA 4UBIA 2XUKA 3AZPA 5LYYA 4K2AA 4M0FA 4KJXA 2DCMA 2QOEA 4EZIA 3ZPXA 2I78A 3I2FA 3I1YA 1WPRA 4WFJA 4BCDA 4Q82A 3TGLA 1P0PA 1XZBA 2C7BA 4UUQA 5ALJA 2HIHA 3H2JA 3T52A 5F4ZA 2QMQA 5AI6A 4F60A 2PSEA 1ZJ5A 2UZ0A 5DYWA 2VJCA 1VLQA 4IH9A 5H3HA 1ETHA 3WLAA 3GELA 3IBTA 5ALMA 2HA7A 4UHBA 3EF3A 1LZLA 3E4DA 3FLBA 2QVBA 1XQXA 1AURA 3Q8WA 3FVTA 2VT7A 5DJ5A 3LLCA 4KEAA 4X95A 5SYNA 2BJHA 1F6WA 3WJ2A 4DYHA 5K3CA 3ZV7A 1SOMA 4PW0A 2HM7A 1VA4A 1QE3A 3IUNA 4QDUA 4DNFA 4AMYA 4IO0A 4U2BA 3HXKA 3QBJA 4KAFA 4WDQA 1J06A 4EY4A 4FNGA 3LS2A 2PU7A 1DT5A 4OYYA 4FFWA 2H9YA 3IULA 5I9IA 2QR5A 3KOOA 4BZWA 4J0DA 5LIPA 3DQZA 3G9TA 4Q34A 4BE4A 3C6XA 3UUFA 2VJDA 3O4IA 4NZZA 1IZ7A 4ZV9A 4J03A 1XZFA 2JF0A 3ESBA 5FPQA 2VSQA 3V1KA 5FXMA 4CI9A 4C87A 2OGZA 2PSDA 1QIHA 3FAKA 5A7GA 3D0KA 4LIPD 1O6GA 1QIFA 5T4FA 4LHEA 4RE5A 2RI6A 1BS9A 2W6CX 3A70A 1WB5A 5AOCA 4Z49A 1UT6A 5I8PA 5K5EA 3H2IA 1G66A 1ZD3A 4CIBA 3WKCA 1NU8A 3BJMA 5ALGA 2WIJA 3C70A 1CLEA 2QM0A 2XUAA 5EI5A 1THTA 2HU5A 3S2ZA 3FYUB 5I7UA 2BAGA 3ESCA 2DFPA 1XRLA 2DR0A 5HF5A 1EDDA 3ANSA 1A88A 3KDAA 1GXSA 3IUMA 3O4GA 4B85A 2WSLA 4X85A 3WJ1A 3FSGA 5AM0A 5C7YA 2YXPX 4BB0A 2OLEA 1A8QA 3W04A 4MEBA 2QXUA 2QS9A 1PJAA 1IMJA 3VISA 2O7VA 5HQ3A 4LYDA 5JADA 5C8ZA 2Z5GA 5ALIA 5AH0A 3G8YA 2AJBA 1GKLA 3M82A 1U8EA 3O4HA 2DQZA 2XUDA 4DTCA 3R41A 2VEOA 5CT8A 1CUDA 7YASA 5AKZA 3G0DA 4ZI5A 4FBLA 1VKHA 1JJFA 3PUHA 1G5FA 3GFFA 4Y2PA 1HBJA 4K5QA 4PV7A 1U2EA 1UKBA 3D7RA 5LZ5A 3WQHA 3BE8A 4N8DA 1G4HA 1QO9A 4N5HX 1Y7IA 4AN1A 5J3JA 3IB3A 4OPMA 4J7AA 5DNVA 1UOOA 1GT6A 1XZMA 3FLEA 2HRQA 2H7YA 5AI8A 3AZQA 2ZYHA 4MYDA 4Y2YA 4OYLA 1GKKA 1PFQA 2XMRA 4ARAA 1TQHA 3I2GA 5AK6A 5JASA 4ARBA 4W9RA 2OAEA 3R3VA 4RNCA 1EDEA 3FOBA 1W6RA 1DX6A 5JANA 2QUBA 2X8BA 3WK5A 3CN7A 2AJLI 3O95A 3VJLA 3FYUA 2CEKA 3LIPA 3DOIA 3B5EA 4X90A 5KBYA 2XUOA 5ALKA 3I2IA 3WWPA 2XT0A 5EHXA 1XROA 3I2JA 5ALUA 1MU0A 5FRDA 2HA4A 1JU3A 4W1RA 4B82A 2OQVA 3G0CA 5A62A 2O2GA 2Z3ZA 4PSUA 3GA7A 4B83A 4MJ3A 2WJ4A 5AK5A 1GQRA 3STWA 4FKBA 5JATA 1LBSA 1EA5A 3FCXA 3LP5A 5K3BA 5AM5A 5HF8A 3I28A 4B0PA 3F8SA 2B20A 1VE7A 2XQKA 1TRHA 1BRTA 2XMDA 4WDRA 2WUGA 5AIAA 4OB7A 3O9MA 4JNCA 6YASA 5ALXA 3DL7A 3CCBA 2K2QB 1CUYA 2HA3A 1SCKA 3AJAA 5EGNA 4UHHA 4AX4A 4QWWA 3WKBA 1H23A 4MQMA 5EIEA 3UMJA 3D4LA 3W06A 5AKIA 4G4GA 4Y2JA 3N0TA 1XQWA 2YYSA 3IIIA 3DNMA 5AKHA 3D5EA 2D0DA 5HKBA 1CV2A 2H1IA 5HZGA 1JU4A 4KE6A 4BBZA 2CUTA 1M33A 1UK9A 4J3JA 2WUDA 4H7EA 5CH3A 2ACKA 1RP1A 4KRYA 1ZD2P 2WQZA 3HZOA 2V96A 3QMMA 1XZKA 3M81A 1UZAA 2BKLA 1CUEA 5AKJA 1YAJA 4QLAA 1AZWA 1JJBA 2O2HA 3PUIA 4UHFA 1MNAA 5AK4A 4PSDA 3DD5A 5A2GA 4H7DA 3C8DA 3NWOA 4G4IA 4XWGA 2XQJA 4X6YA 3QVMA 2VTVA 4X71A 3CCCA 5CURA 5BV7A 1T4MA 4LYEA 5AKYA 4BATA 4Q3LA 4DNQA 2HDWA 1H2WA 1YS1X 3BDIA 3S8YA 1HPLA 1UK6A 4EY6A 3DL4A 1XRNA 4LXGA 2HA0A 3OC0A 4RPCA 4Q1VA 1WB4A 4C4YA 2I3DA 4FFVA 1QFMA 4U2DA 2XQFA 2GYUA 2J4CA 3R3ZA 3STUA 1EB8A 2I3ZA 5AKLA 1CVLA 4J0IA 3O9VA 1F0PA 3AIOA 5CT5A 4L0CA 1WHSA 2B4KA 5JYCA 2OCLA 1G42A 1P0MA 2XQIA 4AMZA 2OCGA 5AM3A 2OAGA 1BEZA 4IQ4A 4KAJA 4CIAA 4DSZA 2HL6A 2XMGA 3G9UA 4FOLA 1FFCA 3I2KA 4WJLA 1ZI9A 3G0GA 2ZJFA 3GUUA 3PF8A 2BUCA 4OUKX 1TCAA 5IKXA 4X93A 3K2IA 3B3QA 1EK1A 3F98A 3IVMA 1LBTA 1K63A 4N5IX 4RGYA 3CXUA 2D5LA 1QIJA 1N8SA 5AM2A 3DS8A 4Q3OA 2VAVA 4XIIA 5ALFA 4BZZA 1QGED 2JGLA 4AO7A 1FFBA 1AQLA 2Y6UA 1L7AA 5CBKA 5DTJA 4OSEA 1Y37A 3QPCA 5A7HA 4G1FA 1E8DA 1I6WA 1QOZA 3AIMA 3AUKA 4X3CA 2OG1A 2ZJ7A 2CJPA 3U0VA 5CMLA 1VXRA 3VJKA 4UBMA 5HF6A 1LPMA 4PF1A 3DJYA 4FHZA 4MQLA 4CCWA 3C43A 1K8QA 3M83A 2XUHA 4Y2VA 4GW3A 2XDWA 5E4JA 2OCIA 4BRZA 5A71A 4L9AA 4B9AA 1VZ2A 2ZVDA 2C58A 3BIXA 3G0BA 3VJMA 2FJ0A 4G9EA 4QNNA 2WUFA 2GBIA 1JJIA 1CUHA 5AI4A 3YASA 1BU8A 3HYSA 4AZ3A 4FBMA 2G5TA 3X3HA 5HK9A 1CUBA 3ESAA 1XZLA 1YR2A 3F9CA 2H7CA 2J4FA 1O6FA 4AZ0A 5AKEA 4DIUA 4UHEA 1ZI6A 4ZGBA 1N5MA 2HA6A 3AFIA 3NUZA 1GGVA 4NVRA 3C5WP 3WYNA 2XMSA 3D3NA 3O4JA 4J0HA 5E2IA 3DLTA 4MYSA 5A7FA 1VOTA 1UK8A 5D6OA 1ZD5A 3G0IA 4Y2UA 1EXWA 1K5PA 1XLVA 3EQ7A 3PDCA 2WLSA 4MWSA 2PSHA 3D59A 5C8XA 5AP9A 5AKXA 1ZOIA 1XQVA 2XMQA 3HLKA 3MVEA 5DYTA 4BTVA 1FSSA 1UKCA 2B9VA 2Z8ZA 1DWOA 4CFSA 5AK3A 3K6KA 2WG2A 4H0CA 3FLAA 3WIOA 3W9UA 1QONA 4K6HA 2ROQA 2GBGA 1OCEA 2XE4A 2W22A 1LPOA 1UOPA 1HL7A 2WG1A 2XLCA 4YK7A 1DWQA 5AI5A 1L7RA 1IVYA 5EHQA 4YPVA 1BCSA 4KE7A 4WCVA 3WL5A 5ALYA 4J0CA 2HA5A 3BXPA 2XLBA 4CCYB 3ANTA 2IITA 2HU8A 3JYHA 3KWFA 2VA9A 1EH5A 2PPLA 1W75A 1OILA 3TJMA 1XRMA 4BTLA 2WIGA 1BE0A 3R40A 1E3QA 1MAHA 1H2ZA 1UOQA 4I19A 3ZLTA 5ESRA 2ECFA 3R3WA 1QIKA 1XZIA 1N1MA 2WTMA 1U4NA 3WK8A 1K4YA 4OB8A 4BVJA 3N2ZB 3SWWA 3QITA 1MNQA 1F0NA 1ZD4A 1QZ3A 3KWJA 3PI6A 2XUFA 1E8MA 4Y9SA 1E89A 3OURA 2XUIA 4I4CA 2HADA 3SC2A 1H2YA 1Q83A 5JD4A 3QMVA 2C5FA 3RARA 3DCNA 3EIOA 1A8SA 1XKTA 4NMWA 1HDEA 4Y2TA 4X91A 4J0KA 3WA7A 2H7XA 5AOBA 4F0JA 3F97A 1ODSA 1DT3A 3PFBA 1CUVA 2PUHA 1QTIA 1JKMA 4XJVA 4QWMA 1CIJA 1GPNA 4UFOA 1BEEA 1TAHA 1XZJA 5LLSA 5T4HA 1AGYA 1A7UA 3DEAA 2HA2A 4Y7DA 2JGIA 5FOQA 4FLMA 5HK8A 4XX1A 5C81A 1XRQA 5LZ2A 3ESDA 1IUPA 2BCEA 1CUUA 4WFKA 3O0DA 4BC1A 5JIBA 4GXNA 5CH5A 3A2MA 2CMFA 2QZPA 4ETWA 4QDZA 1FFAA 2PVSA 1MPXA 1XRPA 1ODCA 3WWCA 4G8BA 4FLEA 4BVKA 3IURA 2QJWA 4QDOA 1CUSA 1XZHA 2FX5A 1XZGA 5AKGA 1EB9A 1XLUA 3WKDA 3FSGD 1LNSA 5AJHA 5D7BA 5IVKA 1CUXA 1ZICA 4HZGA 4B80A 1LPNA 3BDVA 2J3DA 3V9AA 5KWJA 4YASA 3STVA 5FPPA 3FBWA 4DNPA 2C4HA 2DSNA 4B81A 2Z3WA 2CBGA 4G8DA 4HXGA 1LGYA 3RK4A 5AKKA 1CRLA 3MUNA 5ALDA 1SCIA 1F8UA 5ALZA 1XLWA 2QTBA 3H04A 5ALLA 3E0XA 4EUSA 1MX1A 3SK0A 3DDUA 1QTRA 5ALQA 1CFJA 5DNUA 5AO9A 1IUNA 1MTZA 3H2GA 3BF7A 1C7JA 1JMKC 2Y2UA 3T4UA 1J2EA 3OTQA 3QH4A 4DNOA 4B0OA 1KU6A 4A5SA 4Y2RA 4JEIA 1TCBA 2RHTA 5K3FA 4GHWA 5ALPA 2X76A 5LZ8A 4LKOA 2QKYA 3I6ZA 1JMYA 4IH4A 1IZ8A 3WIBA 2R8BA 4C89A 4BDSA 4C88A 1OXMA 3WL8A 1W1IA 3DOHA 3H18A 4H35A 4O08A 3RLIA 3QYJA 4EY7A 5IH7A 2WHQA 5JD5A 4BAZA 3H1AA 3I2HA 3DYIA 1NX9A 5IVIA 1JFRA 1GQSA 1WOMA 1XZEA 5FLKA
chains in the Genus database with same CATH superfamily
3DG9A 4EUFA 1GILA 5CM9C 1FBTA 2XIJA 1SIOA 2A84A 2QRHA 3FTCA 4BLWA 1MH1A 4EHBA 3CGWA 3H3FA 4IJWA 1R9NA 2ZQYA 4D56A 3Q7PA 1YVUA 4HVTA 2A3RA 1YDWA 4X5OA 4LNHA 3GLIE 1T9CA 1JHAA 4QYTA 4RQAA 2C07A 2A9OA 4CPDA 3B5IA 1WMEA 5JALA 2O50A 4A9AA 3WQSB 4Q7MB 1HXHA 5AVXA 5I3CA 1VXOA 4H7PA 2HNKA 3C16C 1MC1A 4GLJA 3SOZA 5JRJA 1PFGA 3SYLA 3H17A 1LFDB 5JEDA 1HUQA 3EK2A 3CRNA 4FHGA 3I9OA 3Q7TA 5LM3A 4IXNA 2QJOA 4M1SA 3ZV4A 4MGZR 1Y1PA 2Y9PB 4HXYA 2F1HA 4X7PA 2C42A 5BN5B 4IWXA 2BVNA 3WLMA 2H59A 1FYEA 1UFOA 4IGKA 3ZWKA 5BMVA 2JLWA 4HDOB 3HDJA 3E22A 3MCUA 4IJQA 3U48A 4XRRA 1EFVA 5CX1B 1G1MA 5AVSA 1GTG1 2G06A 2W37A 2RGUA 4FDTA 4KGXA 1SG6A 5BVGB 5I7HA 3FZYA 4CJXA 3QE3A 3QU7A 2E9SA 4NFLA 3EQ9A 4MLDA 4RKRA 4MUGA 5BSRA 4U3JB 4Q3BA 4C7OA 4MINA 3DMHA 2HN9A 2Q5LA 1QK4A 2JASA 1V8PA 2WIKA 4OEHA 3ZJUA 2ATCA 2GO1A 1DQRA 3UK6A 1NNI1 4C06A 1XVIA 2YMLA 3OOSA 1QIEA 4G01B 2NPIA 4BQPA 3V2GA 3QK7A 5TEWA 2C3OA 6GPBA 1P29A 4OLHA 2D59A 4AIRA 4BP9A 1YB2A 3WO0A 3IMGA 4UUPA 2IQ5A 1GGEA 1U5AA 4OLJA 1S2GA 4KLCA 4IOKA 5DGHA 1EQUA 4GBJA 3PQ2A 1LTHR 1I4TD 1GFIA 1EFRD 3KSZO 1AS0A 3H5AA 1IBSA 4ALIA 2CLCX 3A11A 1AKNA 4PZDA 1QGUA 4WLVA 1MC4A 3B1XA 3C6QA 5HJ5A 2CK3A 4MVJI 2QYTA 4F5WA 5B3JC 1Q20A 1YNSA 2IHTA 3NQ41 1TO1E 3GJXC 1GGFA 3V1UA 5F12A 2L17A 3DV9A 1C4OA 1DBIA 1FSGA 3U7HB 1RHUA 4Y6RA 3IEVA 1WB6A 2OSBA 1GPAA 4Z99A 1ML4A 2X6QA 4Y9DA 3ONVA 1HQDA 4JP2A 4A73A 4EKYA 4G1VA 1L7QA 2OHIA 3RYHB 4QIHA 2Z8YM 1JKIA 1Z37A 2OO5A 3D3WB 3EX7C 3TDMA 1KC3A 3K32A 4H1VA 2IFTA 4GBGA 3ZJ5A 4EJFA 2P9CA 4FMPA 2VUSA 1Y5IA 4UBJA 1I3NA 3WQBA 4LVUA 1V5IA 2WINI 4NCIA 3BA1A 4MCJA 2R6ZA 4L28A 4YUVA 1LQUA 1PJSA 2F3PA 1NJFA 2PHZA 3OFVA 4DMCA 2XA1A 1TRKA 2X0DA 1CR6A 2PGAA 2YZNA 5EPEA 1VRWA 1PQYA 1Z4OA 3I8SA 2WFZA 2OXEA 3FPLA 4TKUA 2OCAA 3IQHX 3RF7A 3HO8A 4D8VA 5DHPA 4G25A 4DG9A 1ZH8A 1TYAE 4LHVA 5DMXA 3I12A 4IDFA 1P1JA 2JBWA 1KF0A 3BSYA 1A4IA 3FNIA 3U81A 3WYEA 2GJ4A 2ORIA 3TSOA 4Q9IA 1DIHA 2KBFA 5BWNA 4CUKA 1PV1A 1QG4A 2ES4A 2FZCA 3UFXA 1WY7A 4IIEA 5HP4A 4HWPA 1QJ4A 4U8HA 1EGQA 4P82A 1P5HA 1PJRA 4HZUB 3UC5A 3U0BA 3VR3D 4AO6A 4C4PA 1WABA 1NMSA 4OXYA 4YCCA 1GL3A 4DSUA 3P97A 5A5DA 2G9NA 1CSEE 2NXCA 2X7XA 5ECGC 1I7QB 2CVHA 4QL3A 2Q1WA 4BVLA 4C0SA 4RZIA 2Z09A 3SXPA 1ENZA 3AZOA 3EWAA 4WACA 2QROA 1Y8ZA 4BMZA 4LC0A 1Z75A 5D84A 5DASA 2P2CA 1YE5A 2BR4A 5FR1A 3WAKA 4ZEMA 1MB4A 4ZAXA 1CUJA 4URYR 3B8HA 3QIVA 3WWEA 4YMTA 2WVAA 5HILA 1JHRA 4I5FA 2NTJA 4HDKA 3OX3A 4B79A 1LKZA 2FNAA 4WY2A 3WL7A 2I7CA 4BYMA 1P81A 3DYVA 1DKPA 2IEAA 1YI8A 821PA 3HYLA 2AKAB 3FJYA 3BIFA 4H18A 2DPMA 3N2NA 4U6NA 8MHTA 4QTXA 2MMCA 2Z30A 2Q1TA 2N9UA 3GJZA 3KJXA 4A91A 3IQIX 1KJIA 3UC9A 3I01M 4ZXFA 4X6UA 4KWCA 4ZU1X 3ZDQA 1DV2A 4JGBA 4L5IA 4A6DA 4AF6A 4WLOA 3L79A 3AOEC 3WGTA 4Q12A 4G24A 1K06A 4R05A 3AYZB 3SHTA 4CF5A 3SI7A 1XPUA 1RC0A 3OECA 4ZGGA 4R1LA 2FFRA 3TB4A 3TOXA 4ZI7F 1O95C 4ZK2A 1HNXB 4LW8A 4KSYA 4K87A 2PUAA 3U3MA 2JS7A 1B43A 3KZXA 4CEHB 4WKBA 2R86A 1IAQA 1XNGA 2G6TA 2H17A 4MYUA 2VNHA 1T8TA 2ZCUA 2VHCA 3IRVA 2I29A 2AOUA 3KP1A 4HS9A 2R1TA 1UL1X 3ZWDA 4C29A 5JXGA 5LD2B 1G63A 3VNRA 1ZP6A 3HE3A 1CP3A 4KX3A 4AJIA 2GCOB 2WSSA 3AHFA 5K2OA 3HN6A 2C7RA 2H5LA 2XDYA 4ND8A 1BEUB 3KSUA 3O8DA 4N82A 4WKPA 4EK9A 2V7QD 2P5SA 4REMA 3I6QA 3TRKA 1VJ5A 2HCBA 1GZHB 2PPVA 4N9QA 2NO5A 1ZL2A 1GIAA 1K7XB 3IGFA 1JFFA 4O4LF 4KSCA 3T7DA 3SQXA 3L06A 3NM4A 2GS9A 1R4ZA 2V74B 2XB4A 4WZBA 4BZQA 2YHBA 3PNKA 2V7VA 1EJBA 2Q4EA 1UKAA 3QM1A 3AJ9A 1YBHA 4HXFB 1SPXA 3FWKA 1W4LA 4WINA 4TWIA 4E6PA 2NV6A 1CJUC 3E3OA 4I9GA 1VHLA 1P1IA 2G1KA 4FN5A 4N12A 3E3AA 3U3OA 1R6BX 4ANFA 2GEJA 4B4VA 1FUUA 1DMSA 2IYRA 2BF4A 2NP6A 1PN3A 1XMPA 2DULA 5FA8A 4AAYA 5BVHB 4CR6A 2ZM5A 2I54A 3AKYA 3N74A 5DDIP 1V1MA 1ZAYA 4D41A 3CLVA 4M0EA 4PRZA 2WWYA 4I8DA 2Q5CA 1SGWA 3TZ6A 5DYYA 1KQNA 2GCGA 3WFJA 3AG5A 5IX8A 1PFVA 2GHTA 2QG9A 3EW7A 4HQ6A 4P86A 4RVGA 4FWTA 2A9JA 1LI4A 3EXFA 2Q27A 4BJ1A 1V39A 3PXBA 1U3GA 4Y2QA 1H85A 1YNOA 1BC5A 2YYAA 4RVOA 3E8XA 3LOUA 3V5NA 3AFHA 3CT6A 4HAVA 2ZI6A 3R9IA 2Q45A 4ER7A 3BF8A 3OPVA 5CCXA 2I99A 4BASA 3DHNA 1RFGE 4IEFB 2WWTA 2CE2X 2JBAB 1EZZA 1QNFA 4ZZIA 4PXAA 5NULA 1RJDA 3V1LA 4JVMA 2NZXA 4LISA 4OCZA 1HNNA 2Q4DA 4DOMA 2FYTA 2HQOA 1GSHA 2NO0A 5KCZA 1OTYA 2W2LD 4MA0A 3TQCA 3V1MA 1U94A 5FUXA 4ESVA 2VPXA 3N1UA 1LW6E 4IWYA 1TCCA 2I8LA 5J2UA 1TEVA 1J1IA 3WMRA 1UDAA 1EM8A 2ONZA 4ZVOA 5FWXA 4YRAA 5LWHA 1F5SA 2Q3FA 3NATA 3BWXA 2CFIA 4AJOA 1W49A 4FS3A 4I0WB 4JJGA 5C0OE 2NPFA 4DKXA 1MZVA 4X8LA 1SD1A 4NX2A 3X2FA 2OV6A 3UH0A 3EVTA 1IBMB 4Q0MA 4KLNA 1Q5PA 4JBXA 1ZM2A 3SQOA 2WJGA 3AUAA 4NENB 2HZBA 3NT5A 3P2JA 1L4LA 1S02A 4DQ0A 3ZWQA 4BPRA 1V11A 4N0PA 4UUAA 5AXCA 5ILOA 3VAYA 1LLFA 4YJ3A 1HFWA 1YRQA 2O2XA 3MXOA 1QG0A 3JWHA 4R3NA 5KC9A 4ZYZA 1NPTO 5EZYA 1SH7A 3P71T 3X2SA 4MWTA 3EQ2A 3AESB 1J00A 1Q91A 2DHCA 4FXPA 4UTZA 3BCHA 1UMBB 3GJ4A 3Q3GE 2R48A 2PX0A 1Z9BA 2RBEA 1MQ9A 1OAOA 2ZYGA 1JE0A 2CMGA 2FUEA 4RF3A 4YP9A 1XTBA 1VHQA 1TVCA 4MZDA 3S8EA 1CUWA 1XEWY 4XLZA 4ENVA 2LDXA 3VPXA 3OIWA 1Y8RB 2X86A 4KPUA 3WLLA 3ZHTA 3D8HA 3GNSA 4TMKA 1UJ2A 4LGCA 4BBPA 3DF7A 4L85A 1D6SA 3UJPA 1K98A 2WNHA 3RTBA 3STYA 3T3DA 3VKWA 3VZRA 5CT6A 4ZCLA 3SQMA 4EHHA 1AQ6A 1LDMA 1HZZA 1G0OA 3GG9A 2JGFA 4Y6OA 5ALHA 5BQ5A 4V1CI 3L04A 1UKVY 3Q1KA 2FCAA 2CNLA 3ZVKA 2FUG6 4JLMA 4LMBA 1HEIA 4A8JB 1LPBB 4F6RA 4CLXA 2RHWA 1DAEA 3WK4A 4XUEA 5JDIC 2VYQA 2I4IA 4H77A 4BNYA 1C9JA 2JFGA 1QAOA 2ZUWA 2ZYWX 4GIBA 3EUWA 4JXKA 4H1UA 5FV4A 1A4RA 1BX1A 1G64A 4J1TA 4B1FA 3BCSA 3SVZA 4KXUA 1T43A 8GPBA 3BMOB 1KKLA 4KRXA 4NZNA 4F06A 3EXIB 3KSMA 4DMLA 3AVTA 1SUFA 4ZRDA 1CFZA 4U5XA 2ZRBA 3AJ8A 4PLWA 3KXPA 1FFDA 5CXSA 4BYGA 4D3DA 2BFPA 3QA9A 1C41A 5DTQA 4EQ6A 4LV6A 1RXWA 4MQ4A 3PXDA 2C2MA 4E46A 1PDWA 4MDEA 1LDYA 1MJ5A 2FOLA 2FWAA 1XCMA 2ZUUA 3SNHA 1J09A 5AW4A 4C76A 2RHBA 3PXEA 2XYQA 3L8EA 3MBIA 2UZ3A 1PK7A 4DLAA 4W7IA 3CIOA 1Y0BA 3AF3A 2OEPA 2HHLA 5KO2A 1XO1A 3KE9A 3NZEA 4BZXA 4GNKA 5AWFC 2AFHB 4NLLA 5KCMA 2AEFA 3EXFB 3H7IA 1C1HA 1EINA 2WYVA 3WYDA 2RG7A 3GN2A 1L5KA 2VATA 1NW9B 3LT4A 4E6EA 3KYJB 4BNHA 1ND5A 4L73A 3B6KA 1RNLA 2PM8A 3G2HA 1P74A 5TT1A 4XSHA 4YHBA 2QZZA 5TV2A 3G23A 1CHNA 2X1MA 3P2OA 3GAMA 3PPVA 3Q9UA 2BWJA 2E21A 4HNUA 4Z8XA 2Q0XA 2FRXA 4ONEA 2AYZA 1ZXBA 2X3UA 3W78A 3A3YA 3WB2A 1WHSB 3S70A 4RVUA 4BNMA 2LE0A 4MHOA 5FLEX 1Y1TA 2PZGA 2R6GA 3ENVA 5K8CA 4FEYA 2AHRA 3PQFA 2WIFA 4HSEA 1XD2B 4MV0A 5FOWA 1R15A 5G0TA 3WB9A 1HG1A 1UQRA 1N6LA 1N2EA 4ZYXA 2D4AA 3H19A 3EULA 3K71B 1EVKA 1S2LA 3HVJA 3KD2A 1PWHA 2VBCA 2WHPB 4L95C 1FDSA 1QH0A 1WUTA 2ZIXA 1K7FB 3T5DA 1DWUA 3QWIA 3VR0A 3I6BA 1SUIA 5C52B 2EW2A 2JC3A 4TTTS 4PPYA 2NXEA 4ZVKA 1WKBA 3ZY5A 1MO3A 4FGLA 5JO9A 2AJTA 2CL0X 2R3SA 3DVQX 4BJ5A 4TV9F 1NI3A 3HCFA 4JFAA 1C4KA 3KT8A 5CJJA 4LVNA 3ZE6A 5KS2A 5H8WA 5E1DA 1DJQA 2DGDA 5LKAA 3QUQA 4RTRA 2C7QA 3FF4A 3F3SA 1BU5A 2GLTA 4MIOA 3UHOA 2P0EA 3ZIDA 1NM5A 4DT1B 1CNEA 5K45A 4DCJA 4CV3A 4ZYVA 1AKEA 3JQDA 4NZMA 4M60A 1R5JA 2AZDA 1L5WA 2WKPA 3PEWA 4FONA 3JARA 1QH1B 2O3TA 3HKCA 4DLWA 1EFVB 1EWVA 1SCQA 3N8NA 2SNIE 1MORA 2XRMA 3NOOA 4KXFB 5CX1A 3VNSA 2WF7A 5DLQC 2PMFA 3DCYA 4KOAA 3FROA 4DMHA 3EJWA 4C03A 1IXRC 1MX5A 1EP9A 1NMZA 1EWRA 1Y3AA 2J0VA 2ZYUX 1E18A 3P27A 1J22A 4L0QA 3KKPA 2ICAA 4RYLA 1Z4QA 3LX4A 1RQNA 3L93A 2FPKA 2O1EA 5J2TA 3MGAA 3CPJB 2EJCA 1CG6A 2NUAB 4B3JA 3H1PA 3HZHA 1VJ1A 3TW8B 3FDXA 5K8IA 5LMCA 2X19A 2IQIA 2OCKA 4Q3AA 3SQNA 5JT1A 1M7BA 1ZK1A 1HE5A 2X1VA 2ZRKA 4UM9D 3UA4A 2ZJ6A 1HR0B 2JI4A 2OCPA 4P4GA 3RTDA 2E89A 2GEVA 2JVJA 3ZWWA 3MGGA 3M3DA 3IRUA 1OLSB 3A1NA 4I50A 2YYYA 3DDZX 1FU8A 2GSDA 1SZJG 2WV9A 3BWVA 5ECWA 3FOZA 4KO1S 1OTXA 4N7MA 3RYIB 4IYJA 2DVMA 2BTOA 4QPNA 1CR2A 2O8BB 4FWIB 3C74A 3HBAA 2AMLA 3V1YA 4RL4A 3VPAA 3BTUA 3W0LB 1NOJA 2HHJA 4HMPA 3UPUA 3ZD7A 2R7LA 3HM9A 1KDVA 1DC6A 4DC9A 1A50B 2V8OA 1AGRA 2XDQA 3F2VA 2AQ8A 4WK2B 5CXUA 1TADA 3W5DA 3QPAA 3QPUA 1R66A 1QB7A 2EZUA 2XZLA 1CZLA 4LDNA 3ITKA 1WCYA 2ZJ0A 3A4YA 3AF6A 4HGPA 4RVHA 4AVYA 2ORED 2UZIR 2ZSIA 3AFGA 3AQ4A 3IODA 1RBZA 1V3UA 2GK3A 2EU8A 3D5QA 4RLFA 5JSQA 6ADHA 3QVTA 3VPDA 3ZBUA 3NTOA 1FK8A 5CITA 2QTWB 4LTNA 3CF6R 1BE6A 1ZJYA 3W3ZB 3WBJA 4RXTA 4QNRA 3PGVA 5JNSA 1J39A 4RK7A 1E3EA 1I2AA 4U2FA 2CDRA 2Q5EA 5DGCA 4I36A 5J2UB 5HSGA 4ND1A 3WQRA 1ZOSA 4QUIA 4UJ5A 4AG5A 2X0JA 3FUWA 4JHXA 1AUOA 2R60A 1KSJA 2PWBA 4W6ZA 1UBTS 3KKEA 1UBEA 5F78A 2H1RA 2WTNA 3R5KA 2F3SA 4A16A 3N70A 3VOSA 1QCZA 1BDIA 1E2DA 3AKCA 5A6SB 2C77A 3F7NA 1YCDA 3Q4GA 5I8ZA 1P7PA 2ZE8A 3U3DA 3ZDRA 4KIUA 3WTCA 4N03A 3GAFA 2GD6A 1RQGA 3L4BC 4X41A 1TZJA 1KMHB 2GDZA 1FMLA 4MEAA 4E31A 5DKFA 3KOMA 3VR5H 3CJTA 5HKAA 1CEQA 4IDBA 1CZHA 1W35A 5COAA 4WBNB 3M34A 1T4CA 1XG5A 3P8ZA 3ED1A 3I52A 4JNKA 1CRPA 3GWGA 1X7HA 4MGYR 4UPVA 3THXB 4MVJA 3D3EA 3CKMA 3QI7A 3UAWA 4C2AA 4E0BA 5G0UA 5DGXA 2PS9A 3BH7A 5AT1A 4UHDA 3INTA 4IIHA 1T9HA 3A4TA 3UJNA 4MQFB 4R1UA 3A6ZA 4EL5A 1QIGA 4KIJA 4UAGA 4ZK6A 4FCWA 4B7CA 2IGTA 2PKWA 2QT9A 5L95A 2R85A 3W05A 5L3SB 5IUKC 3NHSA 3LHKA 4RK5A 3CU5A 4GEKA 2BH2A 4F4JA 3M6IA 3AEYA 2W5UA 3GNLA 3HJNA 3Q7QA 5DM1A 4EA7A 2YXNA 1KI6B 1ULAA 1BKYA 3JSAA 4U0KA 1YA4A 2B5WA 4CCYA 2BELA 2Z4TA 2VAXA 3QVKA 2NU9B 4B7ZA 3L4SO 4ZFNA 4QASA 5FF9A 2IS4A 4B2YA 3NDJA 4JA0A 5D3QA 2FZWA 1GAEO 4XIFA 2CV0A 2F3TA 4IGIA 4ZRMA 1C81A 1UEJA 1B41A 4FB4A 3AWDA 2FSFA 1J0CA 1B0PA 1SFRA 3IKLA 4IAOA 1VLLA 3DZDA 5ENVA 1E8NA 5IMBA 4J4TA 4F46A 1QVWA 2FPRA 4O4HB 1UBUS 4DMKA 2J9RA 1W34A 3FMGA 3GUHA 4L6AA 3QLJA 1UJ4A 2BHTA 1I7DA 3C45A 1WTCA 3BH6A 4FT4A 2AEEA 1J5PA 1Z73A 5EUQB 2DLCX 4QELA 1SVOA 3RWOA 5IHPA 5ITZB 2ZVQX 1ND6A 1EG7A 1ISIA 1PKEA 3BSSA 2V97A 1Y1KE 2WP8J 1NF8A 3JALB 4TMFA 2QGNA 3MMNA 1XRJA 3QE9Y 3L2OB 3A26A 3KO8A 4DR2B 3DE5X 4H7FA 1TIBA 5H3LA 4WAUA 3HYTA 2NUPB 1Y7HA 2FXVA 5EE9A 4RSRA 3A7EA 1VMIA 2JI7A 4K3UA 1HKHA 1T15A 2O7NA 2XCTB 3ZC3A 1NBOA 4K6KA 4CT0A 2NO6A 3RLFA 2VPYA 4RTQA 2XE8A 5FO1A 2Q62A 1ENPA 2X23A 5G1OA 4AWAA 2WB4A 1D2RA 3NBKA 3EGCA 1JI3A 3B3GA 4LGMA 4UD6A 1KSFX 2A33A 4AKHA 1I2ZA 2DCUA 3K9LA 5DT2A 4MUIA 4ZEWA 3BMCB 2O5RA 1G3RA 1F4VA 3E1GA 3P2EA 2F43B 2Q5OA 4TVSA 1YTUA 4BNFA 4UW9A 2HHAA 2A0UA 1E9SA 1DRKA 3HU5A 1Z0ZA 1ZI8A 3K5HA 2QYHA 3PXAA 5FWXB 3A6DA 3IQXA 2B8TA 4RHXA 4UDOA 2BMDA 3UV3A 1XKLA 3W5HA 4DPMA 3JATA 3EMDA 3IUPA 4BO9A 4X65B 2ZIUB 3A9UA 3FRJA 3L8DA 4EW6A 1YBAA 4RHYA 5IJ0A 1FTNA 1HE3A 5JI3E 1DARA 3OZTA 3EUFA 4DJ5X 2RONA 4II3A 4LBVA 3CJRA 2BGWA 4HWSA 1CX9B 1XP8A 2HBZA 3LIIA 4UU0A 1ULSA 1WIWA 4ZOLB 4BTEA 5CXXA 3DO5A 4AXBA 4A0GA 4MW5A 5B7NA 2FEKA 2P9QA 1I4WA 2W2OA 3CLSC 1S4QA 3H0EA 1L6RA 1CZOA 4I1IA 5DYNA 1PW5A 3DDWA 4HEQA 1J5XA 4Q66C 1VCMA 5DM4A 3K0HA 3FKQA 5CJ2A 1A82A 4YAFA 1VYHA 3WGNA 1V26A 2HIGA 1JHUA 3BCUA 2YASA 1LTQA 2BZ1A 4PYRA 1RZRD 4CI0B 1P7VA 3T3IA 3AVVA 2SECE 4JBIA 2CMHA 1NP7A 3GROA 3VKVA 3JQAA 1XPRA 2AYXA 3E84A 4CG1A 1Q7EA 2IRWA 1BHJA 1O9GA 1J8YF 4K9SA 1WRBA 2CNWD 4OJYA 1XSEA 2XVAA 4TT3A 3TKLA 4WA7A 1LI5A 1Z8DA 1Z18A 1IIRA 2EKPA 3GNTA 5H80A 5GZ1A 1EWQA 1V16B 3E03A 1X1SA 2VUUA 1IPEA 4PLVA 3BWYA 2QD4A 4NBSA 3UV7A 4JI4B 5A3SA 4P6VF 3LWDA 1QP8A 1W8IA 3OMLA 4DNXA 4QJ3A 3OPMA 4ZJYA 4TUYA 3KXLA 2EX0A 2OUKA 3WJ7A 4OHCA 4C0WA 1IAVA 2MR5A 3F7OA 5KYKA 3G2QA 1KZ9A 3VVLA 4P3PA 1U63A 3W5BA 1GGKA 2PUJA 3WBBA 2ZYSA 1K2WA 4JOBA 2ZAIA 5B36A 1H05A 3DLIA 3PCTA 5FLKA 4UEQA 5AVZA 3PQ3A 4HDNA 4D8YA 3MJ4A 1QHHA 4DLZA 4LZJA 4WNCA 4ZVNA 5KYXB 3NHAA 2IPMA 3U17A 5D5PA 1X1BA 5P21A 3W7BA 1X80A 3TQQA 3ZHSA 1BDMA 3GIDA 3FRHA 1J4AA 3H9UA 1E5TA 4P5DA 3WWYA 4Z7OB 4WKOA 1MH9A 1MO4A 2PSSA 4M8IA 1JEQA 2R47A 1KEZA 1QS0A 4P3KA 3ZWOA 2CLDX 4A0RA 2HPVA 4J49A 5CYFA 1KI8A 3T3GA 3BXHA 3UJ9A 1A04A 4ERXA 4GS5A 3ILYA 3TXAA 1HWYA 2PG3A 4EAQA 2J9YB 1Y7LA 4OY3A 4UCWA 3SYNA 4DCOA 1P9OA 2JG3A 4ZCPA 1HE2A 4M0KA 1R2QA 1A69A 4GX0A 2HTFA 3AM3A 1CDEA 1I36A 4DSAA 1GAXA 1IM5A 1OC4A 5EHZA 4RELA 1L8QA 2AOTB 2ZSHA 2Z6UA 4J6EA 3IBCA 4CKBB 3TRJA 2GUGA 4G0YA 4OBEA 3KV1A 3TMKA 1LPPA 3IL2A 1KYWA 2J3MA 2ZT7A 5CGZA 4IGEA 2ZSDA 1MB3A 3BFVA 2CBZA 2NU9A 1U0HC 4MSUA 2N3ZA 4H4CA 1GZSA 1I9CA 4ZO9A 2OD9A 5LFAA 3GO4A 4Q1CA 3G1TA 4OA8A 3TSAA 3QVJA 1AHIA 3GGGA 1ATZA 4DQXA 3OEHA 2EQAA 5AW5A 3PPIA 2BGMA 4I81A 3RS9A 2EIXA 2PRYA 2M2IA 3EZNA 1V5WA 1EGMB 3I5YA 4DIFA 2OXCA 5KAPA 2P5TB 1WZEA 4CGYA 3QHPA 1QFXA 3B6EA 2GRUA 4TXHA 2KW5A 4JLDA 1R27A 3BZUA 2QRNA 2IHBA 4RC9A 1NM5C 1E79D 2XCRB 3ZZ0A 4YCAA 2B1IA 2C9BA 4FCVA 4YAEA 4CL0A 1ZMRA 1Q0UA 3MNFA 2WWIA 3ADOA 5D5QA 1VC2A 1WY5A 3DKIA 4GGMX 2ADMA 1JHXA 2NXWA 3GH1A 3DEYX 1M1NB 5EIFA 2HNBA 1GPYA 1NULA 3OLYA 3ZWXA 4NICA 2I3AA 4KNVA 1GPMA 1ZISA 3OF5A 4MWGA 3FD8A 4RV5A 2NZ8A 3TTSA 1BAPA 3DC7A 3K5IA 1FW6A 4BO5A 4W9MC 2XA2A 4MKIA 1U0BB 2GWRA 1SBHA 5JTTA 3M4ZA 4MLZA 3RS7A 1JPJA 2HK7A 3S2SA 4D98A 1JEEA 4Q00A 5TQ0B 5T41A 1OJ7A 2C61A 4FDMA 4US0R 1PT7A 3VNVA 2X0EA 4INZA 3N58A 3PIRA 4GQIA 2AZMA 3T5BA 1EZ4A 2NGRA 1Q15A 4KMMA 2ZROA 3H4VA 3R3XA 4MJXA 1QHNA 4F21A 5DX1A 1GA4A 2IZ7A 4Y2HA 1ZCBA 1IPFA 2V9ZA 4N1AA 1JA9A 2H06A 1ICEA 2OKCA 5LUBA 5EJ2A 1UQTA 5A6VA 2WD7A 3FPFA 1I13A 5HIAA 4ZVUA 5FWDA 5BPHA 1Q1GA 2FPGA 1UDWA 2NIPA 4O3FA 5EJAA 2CUKA 5A5FA 2JGKA 1BW9A 2R00A 3VPHA 4HLUA 1PGJA 3OCUA 3DT8A 4TV9A 2Q8PA 4MAFA 2BTQB 3PEVA 4M9SA 4NAUA 2XUKA 4FX5A 1EJ2A 2R5NA 3AZPA 5C5DA 5IZ4A 5KTMA 4IXWA 4RTSA 3RE1A 3JRXA 2OXRA 1AZTA 4II7A 4E5UA 4UPEA 3WGLA 3AUUA 3NNNA 3JXEA 4P3YA 4OA5A 2QLMA 3AO0B 3I1JA 1M67A 3A06A 3I2FA 2DJIA 1IJBA 2OGWA 3IPXA 4R98A 5C4GB 3VO8A 1YIDA 4CN9A 3IMKA 4IR7A 5DXJA 4LWOA 3RS5A 4EH1A 2I7VA 2CCKA 2FPLA 3DP7A 2XEDA 4B3MB 3ELUA 3PR3A 2OM2A 3EXIA 5JFTA 3UJCA 4UUQA 4A0SA 1D7AA 3BRQA 3FKSD 2FSVA 4YJ2B 4ZDIA 3WP1B 3ZE0B 4HAXA 2DQSA 4BKQA 1N3BA 1B6RA 2GF9A 1HURA 2HIHA 3QG1A 3OO0A 4AZSA 4C3UA 3JYPA 2QVCA 3PK0A 1FPQA 3C15C 3H2JA 1L9KA 3GN1A 3PQ6A 4WZBB 1NLFA 1QNLA 5AI6A 3T7IA 3WB0A 2PSEA 4IH9A 5DYWA 4JI6B 4CM4B 3N6RA 2DG2A 3HJAA 4PZ0A 4M7RA 1ETHA 2AR9A 2I6QA 2P7HA 3KQQA 3WLAA 3WNBA 5AVVA 4PGMA 3IBTA 3H5VA 4F93B 4D3SA 3FYDA 4KIFA 3RNOA 4KSBA 4TXMA 4UHBA 3KPWA 3CURA 3E4DA 3LUAA 4WZAA 721PA 4HWGA 3OFSA 1GPH1 4GX5A 1ZR2A 1NXOA 4I1OA 5DI3A 1RXVA 2HMTA 3E18A 2ZBQA 5DJ5A 3LLCA 3OQIA 4BQQA 2QSYA 5SYNA 3WGUA 4IVRA 2GOYA 4M37A 2QE6A 4CLOB 2YDYA 2WIAA 3TG2A 1BJKA 2HSJA 2H2AA 5LOVB 2C83A 3GVHA 3NWPA 5K3CA 2YWEA 4OAPA 3ZV7A 1QG6A 3L18A 4D4GA 1SOMA 2IELA 4B3CA 4EZBA 2QTAA 1TQ8A 1BYUA 3GJ6A 3TQRA 3PTAA 4CMIB 3Q0IA 4NWIA 3RIEA 1V8ZA 1EDZA 4K03A 2Q4OA 1PJQA 1S2NA 4RVFA 3SZMA 4GR9A 3KBBA 3NDBB 1DXQA 4QHYA 2UVPA 4QDUA 3CX3A 4YP0A 3FKJA 3GEDA 2ZRGA 1LLUA 4U2BA 4WPGA 3UG7A 4PGAA 5ES3A 3BD7A 1HMPA 3HXKA 5IM4F 1WHTB 3VU9A 1VIAA 4IIFA 3OPYB 3IERA 2AXQA 3G82C 4KAFA 1TAUA 1DKMA 1RZUA 1T3SA 4FNGA 3TI7A 2WAYA 1LLQA 3NHZA 3H6HA 4XGQA 5CPBA 4C6TB 4Q01A 5LQRA 1NUSA 4OYYA 4Q4LA 1OXSC 2BT4A 3W6PA 2HYDA 4CF3A 1TEXA 5I9IA 2B8JA 4JQCA 1E2EA 3WGHA 3HSYA 2QV0A 3WGGA 3W4JA 2BR5A 2WJAA 4QRDA 1L5LA 3NBFA 1EE1A 2XYHA 1IHDA 3Q15C 5E2BA 3FMIA 1RWXA 1C7FA 2CC2A 2NO1A 4L1KA 4KXVA 4E5VA 1EFDN 3DQZA 4ZZ2A 2ZIGA 2YJ5A 4NCJA 4F5EA 5AUNB 1BOFA 2GRJA 4MVWA 3IAUA 2FUNB 1KDZA 3TNDA 1T0JB 4MQFA 4ITUA 1JZQA 1SEPA 4UCQA 5BYJA 2GEBA 1IOLA 1FDOA 1H0HA 3D02A 3LP8A 3PL5A 5JPCA 2NZYA 2DPXA 3VDMA 1T13A 4AY4A 4CTNA 3LT1A 3A3NA 2SCUA 1LF5A 3RUPA 1B4DA 2I7TA 3PC8C 1X9HA 2IU3A 2ADFA 3EVBA 1XZFA 4J03A 1GG8A 2IYTA 5IWAB 3A6GA 1P6UA 1DXHA 4U7HA 1KAMA 4RJKA 4JIMA 1KKMA 1PLKA 1E64A 3DMYA 3AP2A 5F9HA 1MABB 4V24A 3PPXA 4JB0A 4GXRA 2HCRA 4GOXA 1CZUA 3RKRA 2WAAA 1O6GA 1I4EB 1NATA 2E4ZA 2FOIA 4AKTA 2JJYA 2NSLA 3DP9A 1W85A 2LBPA 2RDMA 3KU1A 3SM9A 2O5CA 1WNTA 2R7AA 2GFIA 4C3ZA 3WRXC 4NJEB 2RI6A 3V55A 5BSVA 4RJTA 1LSJA 3G68A 4B87A 3A1TA 1SC6A 4OQ4A 4R9SA 4S12A 2XWSA 4UE3S 2CNDA 4RXMA 4Z49A 4GKKB 3PXXA 3L7CA 4ZDKA 5CYGA 5I8PA 3MWDA 3OY2A 1J2RA 1U4SA 2ASVA 1EFKA 1CVRA 2EBWA 3SZLA 1XYYA 1YUMA 5CEEA 2HJHA 3PDUA 1P1KA 3QEKA 2V0GA 3KYDA 4PXSA 4WVFA 3DDHA 4RHFA 4I14A 4F9TA 3KPUA 4JWTA 3Q3CA 3ZD6A 3KJFA 1AGPA 2YW2A 5ALGA 4C2UA 2HU2A 1Z0SA 3C70A 3GRFA 4DIDA 4EPRA 1RT9A 2AC4A 2XSZD 3HB5X 3EARA 2XUAA 1OFHA 2A9RA 1Z45A 5F21A 2F3UA 2VZ0A 4FXOA 1T8YA 3ESCA 4XDYA 1VCIA 2BEUB 3KUDA 2B21A 2OHOA 1ZGZA 1B3BA 1ZQ9A 3BXOA 4R69A 2DFPA 4HRAA 4UTOA 4BN0A 3DBRB 3ETDA 5B3AA 1ZSYA 5HF5A 1T34A 3ANSA 5DN9A 3TF5A 3T1VA 1A88A 2JAUA 1QTQA 1HYQA 3IUMA 1ZVMA 1G8PA 2X6TA 3D54D 4D1YA 4EJSB 4AD8A 1TZ2A 4WK0B 2BFFA 4UAVA 2DY1A 4GI7A 1O95A 4RD6A 1X19A 4O4JB 3Q3HA 2RHLA 4ISCA 1UJ6A 3KEQA 3NJ4A 3GAZA 3EIUA 3AOGA 2OV1A 2OBMA 2QRPA 3HCAA 3MZ0A 3GLIB 1A8QA 1QVRA 2V7TA 5GWXA 4BIIA 2KYRA 1L1FA 1ZA1A 1VPEA 2JLSA 3C5EA 1NT2A 2B1JA 2WMDA 3G79A 4CQJA 4HDSA 1KIFA 1KDYA 2X40A 3W5AA 2R1UA 3IT0A 4XB1A 3D7SA 4BJHB 1DCKA 1KI9A 1K08A 1E2JA 1ZAKA 3DQPA 1D8AA 3PEFA 1ZGGA 4RA9A 4TS1A 3L8FA 3UHFA 4QG3A 5K03A 2H29A 4EGCB 5ALIA 1N5OX 3FDZB 1W4BA 1Q22A 4YC7A 1I80A 5KX5F 1TKAA 2PS3A 3ZR4B 1HDXA 2G9UA 4G3XA 2AJBA 3GMDA 5K0ZA 4ND5A 4B3HA 1TJ3A 3HXTA 3SBEA 1QVZA 2O48X 2GM5A 4UASA 4ZODA 3AP3A 3TQSA 3JQFA 5E3HA 5L3SA 1PSZA 2FEAA 1MQAA 2PO7A 3NWBA 3HL0A 1Q1ZA 2XUDA 4RFLA 1CT9A 1P2TA 2JLCA 1XX6A 3B2EA 5KWEA 1D2CA 3L3BA 1JHDA 4NBKA 3IKMB 4QATA 4DCSA 2HSDA 3A05A 1YS6A 4FMBB 2IOFK 5JSFA 1YKFA 2VF8A 3GT0A 5AKZA 3U3XA 3W7AA 3GDGA 3G0DA 1N2IA 4FBLA 5J4YA 4F3TA 1MJGM 3V6LA 4BX9A 1M1ZA 1T8RA 4Z0NA 2HWXA 3T7AA 2EWMA 4YMUA 1U02A 3OOYA 2QE7A 4IIJB 1Q0QA 4IHJA 5D3MB 2WJZB 4FQ7A 4QO8A 3M6WA 1SBQA 4EUNA 1OUMA 1TB4A 1VMDA 2A67A 5ELMA 2WWRA 4H6XA 2G1JA 3D7RA 3MWFA 4LI0A 5LZ5A 1YFZA 2P27A 2KWIA 3MOGA 4N8DA 3NBXX 3CO5A 4V0OA 3EUEA 5F64A 4N5HX 5C8YA 4D0LB 4YAWA 1V8OA 1TEZA 1C0KA 1J56A 2BZ0A 2WEKA 3WRWA 3PZRA 4F3KA 3KIPA 2GAOA 5J3JA 3LC2O 2J5XA 3VSBA 3LRXA 1PUJA 1C0LA 2MSNA 2G17A 3RUFA 3MYYA 1N75A 4MUNA 4CT4B 4J7AA 5FH9A 5CIQA 4QU5A 2H48A 1DKNA 5FULA 4BBJA 2RGEA 2XB2A 2X8AA 4C6RA 2YNMD 3BGWA 5B3JA 1N2SA 2P2ZA 4HDCA 5AI8A 3TR5A 3AZQA 2IYXA 3KQYA 2VP5A 4IVQA 5JNLA 3EHDA 1D7OA 4DIBA 1NJ5A 2X77A 4Q37A 3SIPA 3A1WA 4MYDA 4LZPA 4OG2A 3U4CA 3L1UA 2A4KA 5LWQA 3EPRA 4K26A 2XMRA 4M54A 3WYCA 5AVOA 2B1QA 4ARAA 4M53A 3EWNA 3L6UA 1NVFA 3OX1A 4L5CA 2CZGA 3DEJA 4KW7A 1TUBA 3C6MA 3ONWA 1OD6A 3ORQA 4QRHA 5EJEA 4EAAA 3HXOA 5A9SA 1Y8RA 4KPUB 4NBNA 4QNMA 5E0KB 1K7EB 3D43A 1IYZA 4RHEA 2INGX 4NYJQ 5FWNA 2PUBA 2H54A 2QQFA 1BMFD 4JVNA 1CY2A 1SK8A 2IP2A 4Q3DA 2FWMX 4YO7A 1G3IA 1W6RA 5LU9A 3G85A 5I9TA 1DX6A 1PJBA 3RUDA 4FHDA 4EMTA 2Z98A 2QQ0A 4M7OA 5AVWA 1QF9A 2QMHA 2C4KA 1CQXA 4NBVA 4JV5B 1E1LA 2WIBA 1KEUA 5C1PA 1MZPA 2ZTHA 4KPGA 3LKVA 1MJNA 1EJ6A 4E4YA 1NVEA 1KYQA 2JIZA 3B5EA 2FEXA 3W90A 4HTFA 3MHTA 4CM1A 4IDNA 2PGOA 3DEKA 3I2IA 4LZNA 2BEVA 3HP7A 3V7NA 4AUMA 4BX8A 3D6NB 5L7TA 5A3VA 2G9QA 1HLFA 3GBVA 1XROA 2AI2A 2ZWIA 4YQZA 3I2JA 3MTAA 5HIJA 4CM4A 4UTRA 4YRNA 4KUGA 1MU0A 3DSRA 4PWZA 1JU3A 3WXMA 4W1RA 4QFMA 3SE0A 4PC2A 4CTJA 3HU3A 2IOYA 3T1OA 4QPCA 3DMRA 2IIQA 3U61B 1TM3E 4NG4A 3THWB 4LOIA 5DN6A 2AFHE 2Z3ZA 4XLTA 3UJAA 5CDFA 1JDUA 4TS3A 3ZK7A 4L6CA 2Y05A 1FMCA 1PGOA 1E1QA 1GQRA 5GQSA 3D7MA 1B6SA 3MQ4A 3EYAA 4RENA 5KVVA 5CM8B 1NSTA 1LBSA 4JUCA 4MEJA 8ATCA 3LP5A 1P5JA 5K3BA 5GONF 4FU0A 2D6FA 4R1QA 3AETA 3ZH9B 3AFNA 4MWOA 3ISTA 1A9OA 2HF8A 2VPIA 4YALA 5L6LB 5IAEA 4BXOA 4JLSA 5BOSA 4AM8A 1L1QA 2ZW9A 1VE7A 4H2DA 1X87A 4L75A 4JVSB 1FLVA 1BRTA 1FOEB 1NHWA 2WUGA 2R4QA 3FR7A 4QU9A 1T4CB 5AIAA 5LP6C 5L3QB 2O23A 2B8WA 3Q12A 4IOJA 3LMKA 2PD6A 5C46F 2C1ZA 4IUDS 3EXHC 3R6WA 4TZ6A 2A1UA 2QENA 4HLDA 2VC2B 3HS3A 3I62A 2UVDA 1D1PA 1OZGA 1XYGA 3SLRA 5KWSA 3GJ8A 3DA8A 3T06B 1YWGO 1OOEA 2QZ4A 3DWIA 5EGNA 1OKKD 4XWWA 3V32A 3K5PA 3P9PA 1SY7A 4IRXA 2QUKA 1U3DA 1IBRA 1H23A 2V5AA 4X45A 3SJ7A 1Q1EA 3A1VA 3ER9A 3TLEA 3PR1A 1G21B 2ZRLA 3D4LA 3OICA 1XEFA 2E82A 3B6ZA 1W4ZA 3K9QO 4Y2JA 4B35A 5BWLA 2AN1A 4CIYA 4CV1A 3IIIA 1ABBA 2P9TA 1Z5UA 3WIUA 3DM5A 4HH0A 4PG6A 1D2NA 1CV2A 2H1IA 2R8EA 4FI3F 3OIDA 1Z47A 2BFMA 3TNLA 2R7NA 1JU4A 2DM6A 1P9NA 3QBVA 4KE6A 4X8MA 2R97A 3IDQA 4B76A 1JFFB 4K9OA 4EG7A 2A0XA 3F6CA 1BGVA 1NKTA 2WUDA 5CG2A 2BF7A 1QKKA 2NX2A 2P2LA 3B3AA 3KJIA 4RKEA 2AFHA 3BJEA 3UY4A 3I37X 4ND8B 3WG9A 3OJFA 2FSHA 3CE9A 5ELXA 3PC6A 4Q9JA 4U7JA 2YJGA 2TMKA 1TYZA 1ZD2P 4ABYA 4MVJD 5IVPA 3JQ6A 3HZOA 1QQ6A 4MPDA 4OMUA 2ISSD 4NPAA 4XYMA 3UA3A 5BW5A 4UDXX 4I99A 1NNEA 4EHDA 2HMYB 4QJ4A 4RTLA 1KARA 3RC7A 5BSUA 1L5HB 4UXIA 4P3XA 5TGTA 5IPFA 2EXXA 1AK2A 3IAS6 1Z5GA 3WOVA 4CKZA 2X8JA 4NHEA 3OE5A 3UB2A 1YAJA 2PANA 3HO6A 4LF9B 2ZS8A 3NNDA 1JJBA 3PWSA 2MOKA 3QBEA 4RKWA 3O3CA 4U00A 1V1MB 1MNAA 3ZYZA 5AW2A 1KERA 1SUWA 2P11A 3DD5A 3C8DA 1KQPA 3KSDO 2AS0A 3BL5A 1ZJ6A 2Q6TA 3OT1B 1XBTA 2H92A 3QV1A 4AZTA 4E5SA 4Y6QA 1YZTA 5B2FA 1S3FA 5TMDA 2G07A 1KEWA 4EHKA 1DJNA 4ER5A 1JLRA 3RSFA 1H65A 3UMCA 4V3CA 1ZCFA 4HYQA 2VTVA 1PG5A 4RORA 1MIHA 3ZHZA 2QBYA 3QBDA 2UXBB 7GPBA 2PEYA 2DPGA 4IQ0A 1NASA 1T25A 2H51A 3DWGA 2TMYA 2Z4SA 2ZVJA 2J41A 3TRFA 3ZXIA 1T5BA 1Q7GA 2FP4A 3LRPA 1BX0A 4ZD6A 1XTRA 3GD7A 3K16A 2GILA 3DBIA 3K6RA 1PR0A 1E7QA 2IZ1A 2BDTA 3KLMX 4BATA 4Q3LA 2PFGA 1L5RA 4FYWA 1E4EA 2HDWA 5D1HA 3DBHA 4YRLA 1WPQA 2RGBA 2CHGA 3ND9A 4XD7A 1NF9A 1TA0A 1MLDA 2F2TA 4UM8B 4W7HA 1HPLA 2XKBA 3DL4A 4EY6A 1J0DA 1VECA 2HA0A 5KMGA 4QOEA 1L4YA 3IA7A 4EJSA 2XOKA 1TT5A 3QY9A 4M1TA 4QXPA 3F4KA 2H1CA 1FUEA 5DXFA 1WB4A 4HPWA 4AMVA 4YUZA 5JNRA 2GJKA 1QDEA 4UXHA 5EQFA 1ONNA 5IDVA 5T5QA 4C4YA 1PQWA 2RGYA 3ZZTA 1YRLA 1QFMA 2ZZKA 1V1RB 2LP4Y 2XF8A 1EXVA 5K0CA 1J33A 2J0UA 3I9NA 4CKYA 1FLDA 1L1RA 2II6A 3ND5A 4WOBA 3RGGA 2FF7A 3LUPA 3STUA 4DMRA 4FW9A 2BFBA 5AKLA 3RR2A 4AS3A 1N6PA 4A6XA 4U9HS 4J0IA 4OSPA 4A2QA 1XN4A 2QW0X 2ZETA 1EVLA 4LRYA 2C5HA 4FZVA 1X38A 3LQFA 3S1AB 3SX2A 1VHWA 2RJ3A 3CUTA 4ZHQA 1MB2A 3RYFA 1FS6A 1OBOA 3VVCA 5KOJB 2EZTA 3BRWA 4CM7A 3JD0A 3QLUA 2PH1A 3AF1A 2NTYC 4DMUB 3WLEA 2WFAA 4C2TA 4TTRA 2E49A 4I4IA 1KY3A 4ZQCB 4B8YA 3U3KA 1H1DA 3TTUA 1NQAO 1U98A 4I9NA 3SXUA 3ZN2A 1G42A 4AMZA 2XQIA 1AM4D 3AF2A 3IP7A 3EGOA 3Q5EA 5FL3A 4S04A 3MYRA 1XHLA 4G81A 1S3IA 1KYTA 1EXMA 1NQXA 1BEZA 2R1VA 5KSOA 2NADA 3K9HA 2XMGA 1Q11A 5FL7A 1CW2B 3BERA 4IF4A 4FR5A 3U39A 3ZHBA 1KK3A 3R3HA 4TV8B 1AD2A 1O96B 3W3AD 2V3CC 1PWEA 1Z16A 3G0GA 2BUCA 4IXMA 4M1YA 4OUKX 1TCAA 4D9CA 3DZHA 3EZGA 2BGLA 4MRAA 4BJ6A 2YMMA 1U8ZA 3HPQA 1MTOA 2B2CA 3RV4A 4JI2B 4QD3A 3I45A 4Y2TA 1SVKA 5TPWA 1EK1A 1YR7A 1QO0D 3L7AA 2IE8A 5BMVF 1Z74A 4BX2A 1Y9JA 1ZIPA 2Z6VA 4QM6A 4RGYA 3AEXA 1FDVA 5I3ZA 2Z5FA 1OQAA 3CXUA 4KQKA 1GYRA 1AS2A 2ZR0A 3ZU5A 1N8SA 2R1ZA 1DKUA 3ZU2A 1XKQA 3SGLA 4RD3A 1QQBA 1E58A 3VPSA 4KXYA 4B6PA 1V3QE 1EHCA 2KB0A 3HCRA 4IQFA 4J0FA 3T1NA 1ADYA 1UT8A 3EGDB 4JJ8A 3BB3A 1QRTA 2FRDA 3FHCB 2VXBA 2FAXA 7AT1A 4OI0A 1QGED 3U7RA 4EI2A 1SCUB 3WDLA 4ALLA 4MDYA 1HH4A 1PD0A 3QELB 2Y8EA 4IKEA 3ZDAA 3M4YA 2Y1EA 4PHCA 2WF8A 1PLLA 1AQLA 3AY3A 1OZHA 3MCTA 2Y6UA 4L5BA 3VOAA 1R4MA 4C0LA 1XKXA 4ND4A 1VJRA 3K20A 2E18A 2V45A 2NU7B 3OVMA 3P9QA 3ZLJA 2HK9A 4AJKA 2I4TA 3LHSA 2VL7A 3DFUA 3KFXA 2GH1A 4A36A 4LGVA 1H1LA 4IDAA 1E8DA 1I6WA 1QOZA 1NI4B 1T9BA 3AIMA 3NONA 2VHYA 4HB0A 4P5PA 2FWIA 3VKHA 4MR8B 3IALA 1Z33A 2QIOA 1QHEA 1OGIA 2VLBA 3PZBA 4PFQA 3DTVD 4J2OA 2C29D 2W7TA 5CMLA 3UQYS 4F3NA 5EKDA 1ONSA 5J23A 3DJYA 3NI2A 3REQA 2D5IA 3L0OA 2IXDA 4FHZA 4NL4H 2IVFA 1ULTA 4CCWA 3KLBA 1GSIA 4LE2A 3M83A 9ABPA 3O21A 1YJAA 3SICE 2V7PA 3LF2A 4KYIB 4C7BA 2QI9C 5E4JA 2ZBGA 1KQGA 2YIJA 4KYTA 3NBUA 3HZRA 4BRZA 1GNLA 4PHTA 2W6ZA 5A03A 4DUGD 3H99A 1VJ0A 3I9V6 4DPKA 3BIXA 2C58A 1JRLA 3G0BA 1PCXA 4Z7JA 2E7ZA 1H6BA 3JPWA 4RJLA 1RAHA 2YZGA 2DYKA 3KQPA 3U2QA 1I0IA 4E3ZA 1RQ2A 3REQB 1DQSA 2AI3A 4R40A 3R7LA 3PDWA 3BD8A 4AJEA 1EEXB 3E22B 2RB5A 2VCHA 3U62A 1KY4A 3S28A 3OZDA 3HHPA 4FFSA 1J70A 3W4KA 4QNNA 1CE8B 1PW7A 2WUFA 3EASA 4BFTA 3EXG1 1JJIA 5BSTA 2IYEA 2OMKA 2IPNA 5FTMA 4ZI3A 1AV7A 1IN5A 2C1EA 4XWTA 3GFQA 3G2NA 4EFNA 3PHLA 3QFSA 3H87A 1E5XA 4PO9A 5ANRB 1H3FA 4RCYA 4K0RA 4WOCA 2FVXA 4X1KB 4QAJA 2N1BA 2ZS9A 1S6YA 3F71A 4GXTA 3HKCB 3H6KA 1YDMA 1MIOB 2YY7A 2E4UA 2OQ2A 4YAKA 3IV6A 5B1IA 4F3CA 3TQHA 3F47A 2GJ9A 1ADBA 1RLJA 5HK9A 2WSBA 1CUBA 1EP1B 1T9DA 2Y1GA 3ESAA 4X1YB 1XZLA 4KR6A 1XTJA 4JL8A 1TGYA 3F9CA 3SJCA 4YUYA 5FI0B 3DDCA 4HDQB 5G0WA 4A2WA 2K7FA 1E5VA 5AKEA 4DIUA 4C4OA 5DP1A 3DCIA 3BUSA 2Q3BA 3BXEA 2P2SA 1ZKDA 2J9ZB 1N6OA 2D8AA 5GV8A 1N5MA 3CTMA 1AMOA 1G41A 1XMIA 3BA6A 2JFYA 3LPCA 1GGVA 3VNAA 1UAYA 2FW1A 4IDOA 4DARA 4MUAA 3JZFA 5FBRB 4PG5A 3Q98A 1O03A 3LBIA 2XMSA 4BIMA 4Q93A 1O0SA 3BGVA 3MWJA 4BNDB 4N0QA 3IUSA 2M98A 1FVOA 2PIDA 3AY6A 4GT1A 1BMDA 1T5OA 1G0NA 1Z22A 3D6FA 4RLQA 1H4TA 1SU7A 3REFA 1Z5PA 3FSRA 1J2UA 1TQ4A 3AW9A 3ONEA 1PGQA 4Z4QA 5C1OA 1DAIA 3FNQA 1LV8A 1QYIA 1VOTA 2ZBRA 4HI0E 2RI1A 3WIDA 2E4XA 2D2IA 2EL9A 3V2IA 2EYQA 1TM4E 4RMJA 1IEQA 3EB9A 3G0IA 1Z8HA 4GOOD 1GTVA 5C9ZA 3GJYA 3S3TA 1OFIA 1PL6A 4CF7A 3EQ7A 1TMOA 2GN1A 3MFYA 2FGJA 1IXKA 2PX5A 4HFRA 2D06A 4EHFA 1WLSA 4CETA 1L8XA 1PR5A 2V7WA 3FJOA 1UXIA 1JJAA 1ZHOA 2ETVA 4DJAA 4D81A 4MWSA 5J5AA 3RRFA 4C43A 2QORA 4JT2A 4M36A 3DMPA 5H5JA 3ZWYA 5AK0A 5EJ5A 2IWRA 4RKQA 3FGNA 3K1ZA 2PSHA 3BHMA 3OFNA 3HY3A 3OUZA 5C8XA 2OYCA 4PYIA 5AKXA 1DXOA 5J4HA 2BHLA 3PRKE 1LVUA 4A8HA 2QTGA 3I04M 1M34B 3HLKA 2FWPA 4IHQA 1DO0A 3MVEA 4O2LA 4XTCS 1JF8A 1FSSA 2GN2A 2PWAA 3AR9A 2AVNA 4GM4A 3A9VA 2B9VA 4G07A 4XPIB 3U26A 2ZDGA 4QFBA 4P4SB 1PUIA 4ZN6A 5D01A 1UPFA 1Y3DE 1OV4A 1L4GA 4FNOA 5JCJD 5AK3A 3I05A 2A30A 3GEBA 1ID1A 5DVZA 2AD5A 1WXFA 1PK9A 4V0QA 3V2UA 1J1ZA 3CPHA 4A0QA 5ICMA 4FSHA 3GJ5A 4H0CA 3FLAA 4R2IA 2EZ8A 2G40A 2H7VA 1BXRA 3FFXA 1GG2A 4LYHA 2P9FA 3VKGA 1JTEA 4K6HA 1H1TA 4A1OA 3COVA 3F2IA 3E82A 4I5DA 4XQ0A 1JDZA 4LXTA 5LA6B 1UC9A 3UJDA 4EJ2A 3ZE9A 3TAXA 2Z56A 3ZGVA 3W6UA 2XYVA 2XUZA 2IBMA 5EERA 1NP6A 2DHQA 2JCVA 5KNBH 3C97A 1SU4A 1XEAA 2I2BA 5KTRA 2F8SA 3G89A 3KXIA 4JGIA 4MTCA 4YK7A 1P2SA 3VRHA 4Z54A 5IHXA 3ZVNA 2F62A 2WJVA 4V3BA 5EIWA 3MF4A 3RTGA 3SZOA 2PX4A 2ZIFA 3ABRB 3OY7A 1L7RA 2PQ6A 2RAFA 3JD4A 3NVAA 5EHQA 1BCSA 4O2BB 3ZHOA 4HDSB 5AXBA 5L7YA 1CE8A 2PX8A 4ESOA 1TAQA 3BXPA 3NV9A 1DIOB 4XFDA 1SBIA 1DO8A 1J21A 2Z08A 1ESDA 3AHDA 2X2PA 2Z1MA 5BSWA 4M2LA 5CVVA 3GLIA 2CFCA 3CA8A 1HEUA 2X5KO 3M4XA 3JYHA 4LRUA 4V1CB 1WX1A 3D7LA 2QSJA 1KMMA 3FPCA 3JX9A 2A3NA 3CNQS 3OHMA 2XW6A 4Q1EA 4DC1A 1U5CA 4RDCA 2OV3A 1NWHA 2XYRA 3PNOA 1XRMA 2P3OA 3HBLA 3UMYA 1A9QA 1QS0B 2A86A 4NE7A 4B75A 4OI1A 1A5TA 2WIGA 3A4LA 4HNRA 4OGGA 5DLEA 5IK2A 3SQLA 2E4VA 4C7JA 4OYHA 3X1YA 1KAQA 1UOQA 1ZK3A 3OE7D 2YOFA 4FIDA 1E3DA 1SKYB 2AL7A 1SN7A 1DAGA 1DBSA 2X5JO 3F5SA 3MK31 4PC1A 4HVAA 1TX4B 1NBHA 1ZNQO 1QZTA 2V6BA 3UGKA 2JLQA 3K0CA 1QIKA 5DK6A 3MRTA 5BNWA 5KYUB 3NALA 4RTKA 1KOJA 2YX1A 5ESXA 1XTZA 4Z0HO 3O2JA 4UVIA 4BVJA 4DUZB 4M87A 2BH9A 5B1HA 1I1NA 4JENA 4D97A 4MV5A 3LYUA 4JR0A 1S2DA 1ZR4A 1YJQA 1X14A 5LP6B 3TW0A 2PLFA 1M34E 2EJUA 2OG2A 3WLHA 2UZ4A 4ILKA 3TUZC 4GKAA 1N3YA 3FPBA 1M2FA 4GF5A 1PR1A 1XIVA 1YFJA 2IXGA 2P9YA 3CZ9A 1Y6ZA 1MGOA 4Z5XA 1O2DA 1CQJB 2CLEB 4OFBA 4ZP1A 3SC2A 1RIFA 4CRWB 5JRDS 2OFFA 1ZPDA 1ZC3A 3NTUA 3SU8A 5KI6A 2DT8A 3LG2A 2Y76A 3BD9A 2GK7A 1GM5A 2YMPA 3QMVA 2QJTA 3AI7A 4LI3X 1S96A 1XA0A 1E4VA 2QX6A 1W1WA 1V41E 1A8SA 2CWDA 3SFVA 3AR8A 1VKJA 4DM4A 1NBEA 4S1WA 2EFEB 2VDWB 3QWAA 1HDEA 1SK9A 1ZG3A 2O0LA 3ETLA 3H4IA 3MMZA 3QUSA 1LRLA 1C0PA 1RXYA 3AV3A 2PDAA 5H81A 1H4SA 4X91A 5E0OA 3RSHA 3FFWA 2IP1A 1K7YA 2CN1A 2QV7A 2XNDD 2Y99A 4IMJB 3R7NA 4FYMA 4ZCTA 2GTPA 1WDTA 4OUDB 3EGXB 1OPRA 2C4NA 3OP1A 3ER8A 3M2TA 5DI9A 5BRAA 3KALA 4GRDA 3BIJA 3LQ4A 3C3YA 2D74A 1GPJA 3RK1A 2MSCB 4XJVA 4YRBA 2VRCA 1NFRA 3RVDA 1YD7A 1BEEA 2O8BA 1XZJA 2VDWA 1XCOA 3AMVA 3VHXB 5K8TA 2XVMA 1BA3A 1UAGA 4E5NA 1M2EA 5FUYA 3LAWA 3LTEA 3QVUA 4PR0A 4YV7A 1AGYA 1A7UA 2Q6IA 5C53B 2NOAA 1SXPA 4M9XA 2C82A 1ISGA 2HA2A 1MV5A 1TZMA 2JGIA 3E7PA 3HFSA 3CRRA 1MKYA 4UU8A 3ANXA 3QWFA 2O8EA 3HCOA 1RZ3A 5JYBA 2VAWA 4G1CA 1GA6A 3FW1A 3A1UA 3L4JA 1OIXA 2R6CA 5K4AA 1Y3BE 1N0VC 1VSQA 1BMTA 1GQFA 1PJ8A 3K0KA 4E32A 5CCBA 4W9NA 3PYLA 1IUPA 2BCEA 1JB9A 4WFKA 3QVGA 3MUFA 3SKXA 1JP7A 1AO0A 3TWOA 3O94A 4DA7A 1FFXA 5HE9A 5CH5A 1M0SA 4F96A 4IGFA 4QDZA 1VFNA 1NIPA 3ANNA 3UMMA 3COZA 3UCEA 3DBLA 3ZW8A 2EF0A 3COSA 3ZK8A 4G8BA 1NR7A 3SBOA 1V8FA 4KWIA 3DXZA 2J59A 2QJWA 4CQMD 1CUSA 1YR8A 4NCBA 2FX5A 4MV7A 1NOIA 2GK4A 4IMIB 3K0EA 1RTTA 2FSVC 4K2HA 4RF2A 5E38A 2C20A 5KQLA 4JSTA 1TKBA 4H08A 2QYSA 2OA0A 4MW9A 4OLBA 4UNSA 3AB8A 1HE8B 2J09A 2JD1A 5BR1A 2PMCA 1G9XA 2DPYA 1LNSA 5B1EA 1IOVA 3Q8LA 2EKBA 3PBKA 4R68A 3WK7A 4NY1A 1BFDA 2YN0A 2QN3A 4RMHA 1NGSA 4M1ZA 1DZ3A 5CG1A 3ISJA 1GNPA 1ZICA 2HF7A 2V4ZA 3W8FA 1MGPA 1VBKA 1L2TA 1LPNA 1TMKA 2IU6A 3NXSA 4UDYX 3TLYA 4BMCA 3BDVA 1NI4A 3O91A 3V9AA 4OXXA 1L5YA 2O8NA 1UM9B 3MC1A 2J9GA 2POQX 5CLFA 1ITZA 1QWSA 2YV3A 3STVA 2XPCA 2WYIA 1ENOA 1GRQA 4QGBA 3N7AA 3TFWA 3H4MA 3L84A 2CJWB 3CLTC 5T6BA 4DNPA 4YXWD 5BR4A 2BL4A 2SBTA 1OHHD 3JYLA 1EM6A 3GGOA 2WYWA 4NJMA 5U4QA 3RV3A 4B81A 4DV0B 2CBGA 3U4GA 1PNVA 3N86A 4G8DA 4HXGA 5LA6F 3FTFA 2P68A 121PA 1K0UA 2X0IA 3V3KA 3IVGA 1F8UA 4ZQIA 1NDQA 1NR5A 2O52A 3NVKI 5EYPB 3R6GA 5REQA 2QTBA 4CFYA 3H04A 2ZWVA 2DRIA 4S1VA 4MI6A 4RSGA 1W46A 3KEOA 1I6MA 2BE9A 3KHKA 5ALLA 3IOBA 2ZRFA 4GOLD 3VX4A 3BTOA 1BHSA 1MX1A 1EYZA 1JDSA 3OZCA 3VHRA 4BFCA 2VYVA 2WICA 1V9SA 3IAHA 1WCIB 2W98A 5KQSA 5JS7A 1Z3CA 1VRCA 5IS2A 4P33A 1FPMA 4GGPA 3G8DA 1XDZA 4PEVA 2IOFA 4KQIA 5AESA 3CVXA 3BXZA 1E2HA 4K9PA 3K70B 4AF7A 1SOWA 2AQKA 2JFUA 1XV5A 3MWEB 4MHSA 3M8KA 2M1ZA 1Y6RA 1C7JA 2IVZA 3EISA 1JMKC 3JVUA 3P7MA 4TMVA 2JB9A 2LV8A 1P4RA 4BMVA 5AFSA 3OTQA 2R5FA 3OWXA 1E2UA 1TW3A 4Y18A 3T0GA 5IC4A 1COWA 2CXRA 1QMGA 4NZOA 2NNLD 4PLFA 4MWBA 3EWIA 2CDNA 4I66A 5LNK6 1CEYA 2VHTA 2ZR8A 4TV8A 1M2HA 2WE7A 3ADBA 2LCFA 1SBNE 2MDTA 1X1AA 1I4OA 5BV8A 5I7WA 2FY8A 2RCYA 3GPIA 3PIDA 4LRXA 2VTBB 5K3FA 4IY1A 3AB7A 4CMHA 1VL5A 1ECJA 1LWOA 1X7DA 5LZ8A 3PNQA 5DMHA 2LCIA 4LMAA 4ZVSA 3TBHA 1JMYA 2PJUA 3LA8A 4IH4A 1KHTA 2GCNA 3VZQA 4FEGA 3PLNA 4QU8A 5KQMA 5TQVA 2A78A 3WIBA 2EIHA 1AQIA 2BI4A 1QGUB 3BWCA 1R8JA 1DB3A 1IN6A 1ECPA 2WYUA 3A04A 3ACBA 4N4AA 4PCUA 2G7ZA 1HDOA 4QUDA 3UAZA 3VC3A 4KO2S 4ZYYA 5HRAA 2I91A 2FE4A