5KWJA

M.tb ag85c modified at c209 by amino-ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kwjA00
3GELA 1CUJA 3HABA 2Y2UA 2G63A 4D9JA 2Y6VA 4Q3KA 1SCIA 2PSFA 1G5FA 1U2EA 1XZEA 3FBWA 4B85A 2WUEA 3NOXA 1FSSA 4W1RA 4UHBA 1J06A 3DOIA 3E4DA 2RHWA 4UHFA 2PSJA 5JAUA 1R50A 1MTZA 5IVHA 1FFDA 1JI3A 5HF5A 4DMKA 5D7BA 5CT5A 4EB0A 1VKHA 2ZYSA 3FWHA 1W75A 5AO9A 4ZRDA 2VAXA 4KYVA 2XI4A 4G4IA 4B7ZA 1VLQA 1DX4A 2VT6A 4H35A 4MJ3A 1Y7HA 2HFJA 1EH5A 4BAGA 3ILSA 1XKTA 2VF2A 2PSHA 3WMRA 2WFLA 4UFOA 4PF1A 1P0PA 4JYPA 5LZ9A 2BUCA 1MAAA 4J0JA 4BVKA 1RYYA 1CUSA 5AOCA 2HA5A 2HHAA 3QITA 3PI6A 4BRZA 3D2AA 4OPMA 2VJDA 4AZ3A 4KE9A 3SWWA 1MPXA 2WIGA 5HKAA 2DHDA 3ZLUA 3HEAA 3WKDA 2V96A 1J2EA 4K6GA 2G4LA 4A23A 4X92A 2HA3A 2VSQA 4KE7A 1BROA 4X85A 3WK4A 1LPOA 1MT3A 5FLKA 4HXFB 1G66A 3VKFA 5HKBA 1UWCA 2OAEA 3LLCA 1GQSA 5EHXA 5FOQA 2C58A 5C8XA 5H3HA 4FLMA 1LGYA 4BAUA 4G4JA 4JYMA 4DTCA 4LXGA 4PW0A 4E46A 5LZ5A 3WK5A 1BE0A 2XUIA 1CUIA 2XT0A 1CUYA 4P92A 5KREA 3DJYA 3ESDA 4G9EA 2OXEA 4J0IA 2X8BA 5AM4A 5A6VA 1HDEA 3LS2A 1XROA 4QWWA 4DNPA 2I3DA 5D6OA 3WK6A 1ACLA 3STXA 4PSDA 3DQZA 3WK7A 4DSAA 2CUTA 1IUNA 1L7AA 2WIFA 4H7JA 1EB9A 3IA2A 5HF6A 2OAGA 4X3CA 4C01A 2Q0XA 1MU0A 1CFJA 1DWPA 4J0GA 3G9TA 4PSCA 3AUKA 4W63A 5HK8A 5HFNA 1D07A 3W9BA 4UPDA 2JGEA 3C8HA 4AN1A 2B61A 4J0HA 2ZJFA 3H18A 3I2JA 1DT3A 4H7HA 4U2BA 1CUBA 4GI1A 4WFKA 3BJMA 2ZYRA 4YX9A 5HK9A 4U2DA 5ALHA 3B3QA 1YAHA 5K3FB 1QIKA 3AIOA 4W9RA 3O9VA 4X94A 3EQ8A 4QDTA 4G4GA 4LXIA 1VXRA 2ZYIA 5ESRA 3FYTA 5ALIA 3G9ZA 4FLFA 2XUHA 3O95A 3V1LA 5BWBA 3WKCA 5AI8A 5AKLA 2IIVA 2JBWA 2JGLA 4U2EA 2BAGA 3OG9A 1ZIXA 3STYA 1X2EA 2Z8ZA 2X76A 5EIHA 4A16A 1CUCA 2OGZA 3BIWA 4MWSA 2J3DA 2WIDA 3KSRA 1DX6A 2JIDA 1JMKC 1XZKA 3ZPXA 4BRSA 2WUGA 2FUKA 4NS4A 1WB4A 2CMFA 1THGA 4UBKA 2OG1A 3EF3A 3WKEA 5JD5A 4IO0A 1GPLA 3VDXA 5DWDA 4BDSA 3I6ZA 1FJ2A 1XQXA 4J03A 5EHQA 3R41A 4Q1VA 5A7FA 3F8SA 2Y1KA 3TGLA 1B41A 4IH1A 4QNNA 4BTLA 2WFMA 2WILA 5AM0A 4J0KA 2DQYA 2VJCA 2O2HA 2O7VA 4DMHA 5ISMA 3W9UA 3B12A 1AURA 4BDTA 1ZI9A 4CI9A 4HZGA 1QIIA 4Q05A 3L1HA 3W05A 1XQYA 1K6EA 3DL7A 4X6UA 3S8YA 5FV4A 2HFKA 1QIDA 2YYSA 4U2FA 2RAUA 3V1MA 5E4YA 2YASA 3VISA 1IMJA 4Y2XA 5AH0A 3WKAA 1QLWA 4G9GA 1MX9A 2ZVDA 3I1YA 1QJ4A 1E8DA 1K63A 1EX9A 3I6MA 4BZWA 1HQDA 3D0KA 1AQLA 1AZWA 2W6CX 1F6WA 4E14A 1W4LA 3AILA 4Q3LA 1LZLA 4Z49A 5DNUA 2WJ3A 3IURA 1K5PA 1NU6A 3WJ1A 2JF0A 2CJPA 1TCCA 2D5LA 1IZ8A 4RPCA 5I7UA 4Y2PA 4ZI5A 1UK8A 4N5HX 1TQHA 4CFSA 2Z3WA 2GZRA 1R88A 3C5VA 3A2LA 4WDRA 1VE7A 1DU4A 3R3XA 4CCWA 5C8VA 4WFIA 3PF9A 2GBFA 2DHCA 1R1DA 2XUDA 4B9EA 1YSCA 3G0BA 4BCBA 1CUZA 3FSGD 5ALWA 7YASA 2XB6A 1F0NA 2DQZA 3FYUB 1DWQA 1K4YA 2AJ8A 3GFFA 2Z5GA 2PM8A 4N8EA 3I2IA 4J7AA 3MGAA 3AZPA 3F9CA 1XRQA 1Z68A 4QLAA 3C70A 4C89A 2OLEA 4UHEA 1AGYA 5JANA 4L3WA 4KACA 5A62A 5CTAA 4PV7A 4INZA 2H7XA 2HM7A 1CPYA 2WG2A 1EVQA 5AK4A 3E1GA 3H1AA 3NGMA 1DWOA 4UBMA 1KU0A 4ITVA 2VTVA 1L7QA 2JGKA 3H2GA 2VEOA 5AP9A 1XLVA 1M33A 1QIGA 4QLOA 3HJUA 3RLIA 1XZLA 5CURA 1QO9A 3BXPA 3D2BA 1WPRA 1ZGCA 3C6BA 2WHRA 4RE5A 3E0XA 2R8BA 3A6ZA 4DGQA 1WPXA 4HXEB 4U2GA 3CN7A 4DNFA 2BJHA 3M82A 2XDWA 2PU7A 3C5WP 3OPMA 3WZLA 4HS9A 4QDZA 4WY8A 1FFAA 3LIPA 2WHQA 4K5QA 4L9AA 4XX1A 5C81A 4QWMA 3WA6A 1H2YA 4XIIA 1IZ7A 4HXGA 4G8BA 3QVMA 3N2ZB 6YASA 3A70A 3R3WA 5CT4A 1N8SA 2I3ZA 3FLAA 4UBIA 3LP5A 1ZICA 2PUHA 3HYSA 2H7YA 1FFCA 4OYLA 4M0MA 5AKHA 4AO7A 3FOBA 5ALQA 5JAHA 3I2FA 3BDVA 5K3CA 4X6YA 2C5GA 2XQFA 3I2KA 3K6KA 4ZXFA 1SCKA 3HZOA 1TK3A 3UMJA 2QUAA 1SC9A 2JGMA 3G0GA 2WKWA 4JH0A 1ISPA 4HRYA 4FWBA 3WWCA 1ZGBA 2WTNA 1VA5A 1UK6A 4M0EA 2Y2VA 5LIPA 3W06A 1BS9A 4Y2UA 1YB7A 3PF8A 5T4HA 3WZMA 5FDFA 3BF8A 1BRTA 5K3DA 2CZQA 1CR6A 5JASA 4G8DA 4BE4A 1HLGA 3IVMA 5JIBA 1HL7A 1BEEA 5ALZA 4Y9SA 1LLFA 1T2NA 2XUFA 5FP0A 3FCXA 3G9UA 5AM1A 4MYDA 4C4YA 3H2IA 5AJHA 3STUA 3BE8A 1EVEA 1WOMA 2XMBA 2GBCA 3R0VA 1NU8A 1TAHA 1VZ3A 2ZYHA 3IUQA 5IH7A 5ALEA 3O9MA 2ECFA 1P0IA 4G8CA 4Y2TA 4BATA 4WCVA 5CH3A 1BN6A 4K2AA 5CT6A 4KE6A 4TVKA 1EK1A 2JGJA 3SK0A 3JYHA 3WK9A 3WK8A 2V97A 4FBMA 3WL6A 2RGUA 3AZOA 3C87A 1SFRA 4CIAA 5EHNA 4FLEA 2ZSIA 3AIKA 1CUGA 2WHPB 4HAIA 2WG0A 1XZJA 5JALA 3O4JA 1O6FA 1RWQA 3B5EA 1FFEA 2XUJA 4AX4A 2IX9A 3HACA 2PBLA 2XMGA 3H2KA 3QPCA 1J07A 1YS2X 5ALNA 2ACKA 3STVA 5ALSA 1GXSA 4HRXA 4LYDA 4V2IA 1W76A 4EY6A 3FSGA 4BC0A 2QRUA 2QXTA 1JJFA 3BL8A 1GZ7A 4H0CA 4F5ZA 3U0VA 4FTWA 4ZV7A 4KAFA 1QGED 5IVDA 2VT7A 1QO7A 3CN9A 5AI0A 1QFSA 3WL5A 5DYYA 3QBJA 3DLTA 3QM1A 2GZSA 5AI4A 4ARAA 5AM3A 5AM2A 4AQDA 4OB6A 5JARA 5DTIA 1U4NA 1BN7A 2RONA 1XZIA 1ZD4A 5IVIA 3CCBA 5I9IA 2PSEA 4UBJA 2WIKA 1XRPA 4WY5A 3MVEA 3DOHA 2WJ4A 3QMMA 3DDUA 5LYYA 5K5EA 2XMQA 3KDAA 1KEZA 3QPDA 1QFMA 5AK6A 1CUFA 3FYUC 5AOAA 5JD6A 4UHCA 2PX6A 2EDAA 3WWEA 3FAKA 4UBNA 4X00A 1LZKA 1CQZA 4L72A 4OUKX 4QDOA 1N1MA 3EQ9A 2XLCA 3WIOA 1FFBA 4MWTA 4OYYA 1OXMA 2DCMA 5FKJA 5AKYA 1ORWA 3OTQA 2XLBA 3I2HA 4F0JA 3O4HA 1GGVA 1HKHA 4PQEA 1E66A 2BUBA 1R4ZA 4JUIA 1OCEA 4UBLA 3FLEA 3F67A 2QOEA 4F21A 1GPKA 2XMRA 3ICVA 4JNCA 3G0IA 2P8SA 1QTRA 4H7KA 2H1IA 4DLNA 3DS8A 5CH8A 1O6GA 5AOBA 3C43A 1R9MA 1TIBA 5D3ZA 2PKYX 2QT9A 2Z8XA 2EDCA 3DL4A 4B9AA 1MN6A 3D7RA 2OCKA 5CMLA 3WA7A 4BZZA 1DQYA 3FLBA 3K9BA 4KEAA 4P9NA 4AO8A 3H17A 5FUMA 4E11A 3PE6A 4X7BA 4E15A 4BP8A 3GZJA 2CBGA 1QTIA 5EI5A 4NZZA 4RGYA 3PDCA 5EHZA 1IVYA 4BTVA 1R3DA 2XUKA 1J1IA 1B6GA 3VVLA 3PICA 5KWIA 3KWJA 2HA2A 4KRYA 2HU7A 4H77A 3M3DA 3IUJA 5AI5A 1H2XA 1N5RA 3R3VA 4FDMA 1UXOA 2XQJA 4H18A 1ZOIA 4P93A 3VVMA 3ANTA 3IULA 4NVRA 3JW8A 3WWDA 4IHAA 1UK7A 1QIMA 2OCIA 5FXMA 4F60A 1YAJA 4Y2VA 3R3ZA 1XZMA 3I28A 3ESBA 3Q0TA 4ARBA 1N5MA 3KWFA 3WYNA 2XMCA 2HIHA 5EGNA 3ZV7A 1UFOA 2PPLA 5DTJA 4GBGA 4ZWNA 2I03A 1JJBA 1EDDA 4AZ0A 3VJMA 1I6WA 3M83A 3BIXA 3DKKA 1XQVA 3WYDA 4UFPA 4DMFA 1A8QA 4XVCA 2OQIA 3DYIA 3L1IA 5JADA 2GYUA 2QZPA 2VA9A 4JEIA 4UFNA 2DSNA 2H9YA 1E8NA 2B9VA 1JU4A 1VZ2A 5FPQA 1EDEA 1CUEA 2XUOA 4WJLA 2HU8A 1GQRA 2YH2A 4BC1A 5DJ5A 4BAZA 1WB6A 5K3FA 4ETWA 1A8UA 2HDWA 3A2NA 5JZBA 3TEJA 4GEGA 5JAOA 1TKRA 3SX4A 1XFDA 2HRRA 3AIMA 3PFCA 3IDAA 3D4LA 4IH9A 1BCSA 3LCRA 1XRRA 2D0DA 1PV1A 5AKZA 1YS1X 2J4CA 1Q83A 1VJ5A 3BF7A 3L1JA 2O2IA 3HLKA 5AK3A 1CRLA 4MQMA 1UT6A 4K6HA 1F8UA 2B20A 4EY8A 1UOOA 4Y7DA 4X95A 5AM5A 2QJRA 2C7BA 5LKAA 5LP1A 2B4KA 3TJMA 3CCCA 1R9NA 2AJDA 4AN0A 2XQKA 4QZVA 2HU5A 3I6YA 5LLSA 4W1SA 3X3HA 5J3JA 4B82A 3IB3A 5A7GA 2VJBA 1QE3A 2DHEA 2XQGA 4OCZA 3FVRA 1H22A 1EHYA 4CG1A 5BWCA 4J0CA 3WJ2A 1XZCA 4LIPD 2OPHA 1W6RA 5LZ2A 1MNQA 2K2QB 4Y2SA 3MUNA 5JYCA 1QIHA 4OU4A 5ALMA 2FX5A 1DT5A 2EEPA 3ICWA 4YK7A 3R3YA 4GXNA 3QMWA 4GW3A 2UZ0A 3HSSA 2X5XA 1ZD5A 1P0MA 3OURA 1LBSA 1UK9A 2VJAA 4EY5A 1C4XA 2QKYA 3VJLA 1YCDA 1GT6A 4OSEA 4OD0A 5LZ7A 3SC2A 5K3EA 1Q0ZA 5CBKA 4H7DA 4IQ4A 4MEAA 3I1IA 3V1NA 1CUVA 1TCAA 3EIOA 1BEZA 3UUEA 2NW6A 1YA4A 1WHSA 3OC0A 1ZD2P 1U8EA 4EY4A 2QTBA 4ZV9A 1XLUA 4A5SA 4LKOA 1DTEA 4QA9A 4K6KA 4FMPA 4BB0A 3PFBA 1EB8A 1SCQA 5HQ3A 1ETHA 5BOVA 5CXUA 3STWA 4I4CA 5DNWA 2ZSHA 3C6XA 4QDXA 5A71A 3KD2A 2XUAA 1G42A 2ZJ6A 5ALJA 2I78A 3FNBA 3PUHA 4RNCA 1SOMA 1W1IA 4DNQA 2J3QA 2OCGA 1ODSA 1Y7IA 3O4IA 5ALPA 3LIIA 4OU5A 3A2MA 4J3JA 4EA6A 2HA0A 4H7IA 1X2BA 3IUMA 4AO6A 5JAPA 4KE8A 4FFWA 4DIUA 3ED1A 5AKXA 4W1PA 1EXWA 4BE9A 1JT2A 3HC7A 3QZUA 4HVTA 3NWOA 3V48A 4YASA 1OILA 5ALFA 5I8PA 4TGLA 4CG2A 2AJLI 1GKLA 5CH5A 5DYWA 2JGFA 5FPPA 1DINA 5T4FA 1CUDA 4OB8A 1JFRA 3GUUA 1H23A 5CW2A 4EZIA 3MUOA 5HZGA 2QR5A 2C5FA 1EK2A 4B84A 2AXEA 1XZDA 4RE6A 3YASA 5CT9A 4BVJA 3FVTA 1LPSA 2PL5A 4DNOA 3RARA 3G9XA 2OGSA 3QPAA 1XRLA 3AZQA 4G1FA 5T4BA 1LPAB 1MNAA 1S8OA 2LIPA 1CUUA 4H7EA 4I19A 4G5XA 1A88A 1AMNA 1A7UA 1UKBA 1LPBB 3WLAA 3GA7A 1EA5A 3WL7A 5ALDA 1MX1A 3QMVA 2WSLA 5ALRA 3WL8A 2RHTA 4C4XA 2WJ6A 4WFJA 4Y2RA 3FYUA 4DM7A 1UZAA 4FBLA 3ZI7A 3H0CA 4BCCA 1QIFA 2WFZA 1ZI6A 3W04A 4BBZA 3H2JA 1UKCA 3E3AA 3WIBA 1Q0RA 1XZHA 2QJWA 3HXKA 2XUQA 1MJ5A 3D2CA 1E8MA 4LYEA 3C6ZA 4ROTA 2Y6UA 2O7RA 1IUPA 3PUIA 2OQVA 3WWOA 2WU3A 1JMYA 3Q8WA 4X90A 4FNMA 1AX9A 5SYNA 4FNGA 3KOOA 4EHBA 3WI7A 1TCBA 4BP9A 2DR0A 5ALVA 1XZBA 4L0CA 3WKBA 2WIJA 2CB9A 4B81A 3F98A 4N5IX 3HI4A 2VQ6A 4MEBA 4UHHA 1EI9A 3EQ7A 5ALTA 3ZLTA 4N8SA 1YR2A 1XZAA 4CG3A 2WM2A 5CT8A 4MQLA 1YASA 1UKAA 1CQWA 2XMSA 1KU6A 3KXPA 2HRQA 4IH4A 1LBTA 3H19A 5LZ4A 4AXBA 2W22A 2C4HA 5AI9A 4M0FA 3D5EA 1BU8A 1EDBA 1K8QA 1VOTA 3BDIA 5E2IA 1G4HA 4UHDA 5LZ8A 1XRNA 3ESCA 1Y37A 4C4ZA 2WQZA 2XUGA 3G0DA 4Q82A 2IITA 3C6YA 4KJXA 3UUFA 5YASA 4DYHA 1ODCA 1XZGA 1H2WA 1X70A 5HQ3B 2G5TA 2R11A 2V98A 4CCYB 1YB6A 1WB5A 1ZJ5A 3DCNA 4WDQA 2WTMA 3STTA 5AIAA 3IBTA 3EBLA 1E89A 5K3BA 1QIEA 4FOLA 1WM1A 5AHXA 1JJIA 2GBGA 4FHZA 5ALUA 4LHEA 3T4UA 4H7FA 5AKKA 5FRDA 2HA7A 4EBBA 1QIJA 5AKEA 4UUQA 1CVLA 4QEKA 5ALLA 3W2TA 2G5PA 1C7IA 1CUXA 1NX9A 3DKRA 3BJRA 3OM8A 3O0DA 1MO2A 2HA4A 4CIBA 5BV7A 1CUWA 3VJKA 1HBJA 4NMWA 1HPLA 1ZJ4A 4HTAA 5KBYA 5ALOA 3TRDA 1VA4A 5AIBA 1AC5A 5SYMA 5IKXA 4MYSA 4Q3OA 4QDUA 2FJ0A 1CIJA 1CEXA 2OCLA 1XQWA 1UOQA 2XUPA 2ONCA 5A2GA 3C45A 1XZFA 1MX5A 3G0CA 1Q84A 4BVLA 3GROA 4KRXA 2J4FA 4Y2QA 2AJCA 3K2IA 3NUZA 4GLBA 4FFVA 3G8YA 1U65A 3RKSA 4GECA 4Y2YA 2PVSA 3C8DA 2PSDA 3D59A 5HCUA 1IUOA 1GPNA 1UOPA 4FKBA 3U1TA 2WU4A 2WFLB 2WLSA 4LXHA 1LPNA 4I3FA 3RK4A 3F97A 2QS9A 2JEZA 4XWGA 1PJAA 2WUFA 1W52X 3M81A 3BWXA 2BGNA 4C88A 4BCDA 3D3NA 2ORYA 5ALGA 1CUAA 2QMQA 2BFNA 1QOZA 5HF9A 3FCYA 2DFPA 2XE4A 1E3QA 3DNMA 1THTA 4DSZA 3ESAA 1TRHA 5AKGA 3GBSA 2FJPA 4YPVA 4PO3X 4UBOA 4EUSA 1WCYA 3DD5A 2OGTA 3F96A 3HRHA 1USWA 3ZLVA 2E3JA 2V9ZA 4EY7A 5EIEA 4PSUA 2PU5A 4GHWA 1AKNA 3O4GA 4ZREA 4B6GA 2QM0A 3OOSA 2WHPA 1LPMA 5F4ZA 4Q34A 3RM3A 4B83A 4X91A 5DLPA 3ZWQA 1BCRA 3VXKA 2GYVA 3QYJA 2ES4A 1PFQA 4B80A 2JEYA 3DEAA 3QH4A 1F0PA 3IUNA 5K3AA 2HL6A 5IVKA 3S2ZA 1E5TA 2XMDA 3R3UA 2JGIA 2YXPX 4B0PA 2VATA 1AUOA 1RP1A 5E4TA 5DYTA 1T4MA 4P08A 5ALYA 4X97A 1P0QA 3AINA 4ZGBA 5AKJA 2ZJ7A 4N8DA 3V1KA 4PNZA 5AI6A 2C0QA 2BGRA 2C0PA 4KR0A 4X93A 2BKLA 1CLEA 4XJVA 1ODTC 5D3KA 2GYWA 1ZD3A 3ANSA 4KAAA 1C7JA 4KAJA 4GDMA 1GKKA 3G7NA 3WWPA 4W1QA 5AK5A 5HF8A 1XRMA 1XLWA 4AB1A 1ZIYA 2HA6A 2Z3ZA 2BCEA 4MXDA 3JWEA 4S0XA 4DMCA 5A7HA 1JKMA 1L7RA 2ACEA 4C6HA 3N0TA 4X71A 5C7YA 4J0DA 3CXUA 2H7CA 1CUHA 3H1BA 3R40A 5ALKA 3P2MA 2BUAA 1VE6A 2QVBA 2GBIA 3G02A 3WQHA 2CEKA 1DQZA 3I2GA 2HADA 1QZ3A 5DNVA 1YA8A 5EIAA 5T4EA 4C87A 5JZ9A 1ACJA 2QXUA 4AMZA 1VXOA 4X6XA 1ZI8A 2O2GA 5C8ZA 1MAHA 5AICA 2RIPA 5CXXA 2XQIA 2VAVA 5JD4A 1LNSA 5AKIA 1A8SA 4QE3A 5JZSA 1WHTA 1XKLA 1LPPA 2XMZA 2QUBA 2WG1A 2CKMA 1ORVA 3H2HA 4AMYA 4O08A 2RI6A 3AJAA 3DYVA 5E4JA 1CV2A 5EFZA 4U2CA 4TPKA 4B0OA 4CCYA 1QONA 4OB7A 4BYMA 4Y2JA 5KWJA 3T52A 5CRIA 1JU3A 5ALXA 4GWLA 1EINA 1H2ZA 3AFIA 3V9AA 5LKRA 3IIIA 5HFAA 5JATA 2AJBA 2PUJA 2WUDA 3H04A 2ROQA
chains in the Genus database with same CATH superfamily
1NBWB 2Y1LA 1J21A 4XYEA 2OAQ1 2IYOA 3JAMA 2RHLA 3HABA 5H83A 2X15A 3QUBA 4A26A 1QYDA 1MQ9A 2C04A 2G63A 4UCQA 4QG7A 4LC9A 1YMVA 3GD5A 3GN1A 4D9JA 3T9CA 2OILA 3FPFA 1RCTE 4RK4A 1J9EA 3W90A 4UTZA 2UZ1A 1MW9X 1XDBA 1C4WA 2RJNA 5LB2A 3GT7A 3N8GA 1G5FA 4MWOA 4PCAA 2I2FA 2WAYA 4HWGA 4UXHA 5F21A 4QO7A 1HK7A 3GVXA 2B82A 3SF8A 3W3ZB 1M2JA 2QVLA 2O0JA 1FSSA 3NOXA 4UHBA 4W1RA 1I4OA 2GN9A 1KZYC 2M98A 2VDVE 3QVGA 3L7BA 5KKNB 2AR7A 3DOIA 1JHUA 1N2SA 2IHTA 1QGUA 1J4AA 1B15A 1QQ7A 4L4SA 1XXHA 2O54A 5BPFA 1QDLB 1OVGA 5B36A 3I62A 1KC3A 2E1PA 3BXGA 4ITUA 1CW2B 4MJLA 1VM6A 2FW8A 1UMCB 1DZIA 1DKRA 2GESA 1KQNA 3BZBA 3T1TA 3AIIA 5KTOA 1EFPB 3RTDA 5C37A 3LLMA 5IG2A 1OB5A 4GOOD 1WNTA 2ECKA 5JXWA 1YZYA 2AN9A 2I8AA 3BGWA 1BQ4A 4RYDA 2D5BA 2DWUA 4B6OA 5IVHA 3EBPA 3W78A 1L7OA 2C5HA 3DBRA 1RBQA 1AB6A 2BFEB 4WXYB 2W4MA 1G9SA 1KO1A 4DMKA 4CKWA 1HA3A 5D7BA 2RH5A 2VDQB 1KXZA 1HFEL 1Y7LA 3KC2A 4PAQA 5FBVB 2IXFA 2GBLC 2X23A 3CQ9A 4W5RA 1V1RB 2QIPA 2ATIA 3ROEA 2GF9A 2PQMA 2JHAA 2A6PA 2NSLA 2WI8A 1DDIA 3NHBA 4HNAB 4JUAA 2EG9A 4G41A 1X6VA 4L15A 3FWHA 4R7TA 4DRXA 1EIWA 4C04A 4MCIA 2PLNA 1W75A 2WZQA 2ZSEA 4AJNA 4ZRDA 1UPBA 3O2NA 1N92A 3OFJA 4HSEA 4KZPA 2XI4A 3DCYA 4RVFA 1VLQA 4NAUA 3IMKA 1HT0A 1VECA 3GCGA 3KE9A 4JGGA 4AKEA 5IXJA 4O2BB 2QRZA 3QLUC 4IQ0A 4H35A 3LXMA 2WIAA 4XIYA 4MJ3A 3VTAA 1ODLA 1QXSA 1Z4KA 2DMRA 3W2FA 1N32B 1ULSA 4TV9A 2FE1A 3PDWA 1AQIA 1OYOA 3MXOA 2VF2A 2CXOA 3TLMA 2OVBA 2PSHA 1SUDA 2VP9A 4PF1A 2ZAOA 4UFOA 1P6UA 1T9HA 1JEQB 1Y8RA 4KQCA 5J5CA 4JSYA 1QCYA 4MVXA 1LRJA 5C8YA 3DEZA 1WXGA 1P1BA 4F9FA 4D9BA 3Q7EA 4R1SA 4ZQFA 1S96A 1SCJA 5BMOA 4BFLA 2GM4A 2VJPA 1ENPA 4YV1A 2RC5A 5CFNA 1EP9A 4DQLA 2HA5A 2HHAA 3JATA 1M6NA 1U2DC 1UMDA 1U1FA 4Y2GA 1MHTA 2FZ5A 4ZEWA 3PI6A 1H2EA 2C7PA 2DQKA 1NVAA 5AVUA 1OLSA 3SWWA 2MCFA 1GQOA 5BSMA 3S2EA 1SY7A 4TS3A 8AT1A 4FFLA 5CIWA 3ZGOA 4W5NA 5H3CA 1P0CA 2Q21A 5HKAA 1G5HA 2DHDA 5DGHA 3ZLBA 4A6DA 2GI4A 3KU1A 5DHRA 3ZDDA 4P0PB 1Z2NX 4TQGA 5IC5A 3IQXA 1UINA 1UXKA 4IIXA 4BLTA 2G4LA 4TWAA 5I45A 1FVOA 4PBSA 4MPTA 1GQ2A 2BFCA 1B0PA 4WKPA 2BYTA 2J5QA 1QHIA 4BQEA 1QHHA 3OE7A 1TAQA 1HGXA 1R0CA 4WNAB 2OWDA 5FLKA 1SWWA 3ETHA 2FNAA 3MOGA 2HB6A 3OQVA 1M66A 3ZHQA 3L0IB 1U6JA 3LLCA 3W4IA 1XELA 3R0IA 1KE1A 1WZNA 2VYCA 4K6FA 3T5GA 4U6SA 4B45A 1IY8A 3VZSA 2C4NA 1XPRA 3WLJA 4B3HA 1ENZA 2CHEA 2QORA 3QNUA 3I9V1 3LY8A 4R68A 2X8LA 3EFBA 5JE8A 4TS4A 3LGAA 1PR6A 4AIIA 3AI3A 4G4JA 1COWD 1NMYA 2C00A 2JARA 2ZCUA 1OFUA 4HLUC 2GSWA 1W36C 1HTWA 1GVNB 1NY6A 4N1AA 4UREA 3RC3A 4B2PA 2AA3A 4E46A 1BE0A 2XCLA 5G4KA 5L6MB 2YWGA 3U40A 1XWFA 3ZW7A 1CUIA 2O06A 1QFYA 1R8QA 1UBFA 5B1EA 2GUWA 2OY0A 3GCDA 3DJYA 2BSQA 1OY1A 4IJKA 2IS1A 4U8GA 4U5QA 5TPWB 4RA6A 2LP4Y 1A0OA 1DFIA 2E82A 4UVDA 1RYMA 1NAHA 3ZJ4A 2Z4TA 1E7SA 1JEYB 5AW9A 4O4HA 3Q2KA 4HQRA 1KZ6A 5BO5A 1JDBB 2ZRIA 3E4CA 5A6VA 3QJ5A 4JT4A 1HDEA 1B0ZA 1N9KA 1PG5A 1V1MA 1XB2A 2GEBA 2KM1A 4IIUA 4PO8A 3R6LA 4HPJB 4DNPA 2C9OA 1MAWA 2VT2A 3JYQA 5D6OA 4XD2A 3DZ8A 4A3SA 3A27A 1L5SA 5JAZA 5I8WA 4RK0A 1DIRA 5E6UA 2GJSA 2CUTA 1DC5A 1LDMA 3KEFA 4ZIRB 1HY3A 3CIFA 3QI2A 3X2EA 1R4NA 1DKPA 3UFBA 5MN4A 3JX9A 1L7AA 2W90A 1JECA 3NORA 4H7JA 4P4GA 3BERA 3LY7A 2JAQA 2GZHA 4BPBA 1XNRB 1YH3A 2AHRA 2R8YA 3V8QA 1K3TA 1KJ8A 2QUIA 2I5PO 2OP1A 2YY7A 4IF6A 3QEMA 2EW1A 4X3CA 3TNYA 4RVSA 1ULHA 5FOUA 1DWPA 2WZBA 4EG3A 3CCFA 2G1PA 2DUNA 4DCGA 3G17A 3NDBB 3G9TA 3AUKA 3LVQE 5HK8A 1KYWA 3DXFA 1JQ3A 2XUZA 4FILA 4FZ3A 3DZDA 1KKUA 3VPAA 3IX7A 1AQJA 721PA 2KX7A 4J0HA 4LN1A 1LRLA 3ZK9A 5AW6A 1FP2A 3KLNA 2Y0EA 3EE6A 5KCZA 1DT3A 4A10A 4XFJA 1P4AA 1P33A 4CQLB 1Z2PX 1DQPA 4FHCA 1YVRA 4FFBA 3KEOA 4RQUA 3LPCA 4UD2A 4EABA 3QVTA 2JLAA 3BRWD 1HE3A 1CNMA 1KPIA 1VMDA 1WDMA 3OOJA 5LCXA 4XW2A 1MRNA 3MS7A 5KOHB 2OZLA 3GJZA 3NEYA 4DBLC 3UMYA 4MAFA 5DZSA 3ZXXA 3QYPA 4IJQA 1V3UA 4HDNB 1W29A 3LUBA 4FIZA 1O77A 4PHFA 4UQOA 4F6RA 4W9RA 4P6VF 2BD0A 5D5HA 3HP7A 3RUPA 1SEVA 2PUFA 4P4TA 3DP7A 1ABFA 4XEHA 1SG6A 1KVRA 4C7XA 2CHQA 4G4GA 1ID1A 1ZL0A 4E88A 3BCSA 1VXRA 2ZYIA 3RUHA 5ESRA 2AYYA 1E4OA 1I4TD 2EF0A 4ND6A 3RHZA 3C7TA 1WKCA 5ALIA 4FLFA 2KBEA 3TTVA 4LYGA 4HSGA 3ILYA 5FHQA 3KTOA 1DEXA 4L6CA 3B48A 3V1LA 2CFIA 5KOIA 1CSEE 1KZ1A 1RS0A 3NIWA 1K5GA 4NDZA 1Z13A 5BWBA 5K51A 1AQNA 3QFHA 4O4IF 4AJ2A 1TTPB 3F6EX 2FUNB 1W0JD 1JF8A 2QMYA 3T3EA 2MINB 4MKXA 4B2IA 2X0FA 1OROA 3CVOA 1RXCA 1UFRA 2B8WA 2FF5A 3OG9A 3KZMA 4MJ7A 4BNYA 2YVUA 2BBTA 1Y82A 5F1OA 1O1YA 3STYA 4EYEA 5KYUB 1S2IA 1ZX1A 2XCSB 4OHFA 3L4JA 5MGNA 1POWA 4GSLA 5HGJA 1CUCA 4MWSA 4ER6A 1I2MA 2A1UA 3OIDA 2J3DA 3FSRA 2WIDA 1F2TA 1JHMA 4HX2A 2QV0A 2HK6A 5ESXA 4YPFA 2I9KA 3KLOA 4GZMA 4TM8A 1JXQA 4TZ0A 2AFVA 3SVLA 4KVFA 2Y1GA 3T9AA 1VDZA 2BTQA 4N0MA 3TS1A 3G23A 3V7NA 3USZA 1SXJA 2Z4RA 3A4NA 5EWLB 3KB1A 2NZVG 3MXTA 5HJEA 1IYZA 4K87A 3LYUA 1UQTA 4MYTA 2FG6C 3BBLA 1ZH2A 1L7BA 4CUZA 3NHSA 3OTHA 1FSGA 3VDQA 1QP7A 2FP3A 1J0BA 1CYEA 3O9ZA 4LXYA 1T0IA 1RI4A 2FUKA 1U3GA 4PX2A 3ZZUA 2HJVA 5CFLA 1DI0A 2CMFA 3VHQA 1KH2A 2XVZA 1OWLA 5EMLA 3IEVA 1NTRA 1I4DD 2ZAIA 3GP8A 1WR8A 1BTOA 2W7TA 4IPTA 4UTPA 5L7YA 2Q3DA 1K08A 1JPNA 4UU7A 3VR6D 5AUQA 2IU6A 1KS9A 3BE5A 3E1SA 5DWDA 4O2BA 4FNOA 2PRSA 1ZNYA 4XQCA 2NVUA 4PX9A 4BDSA 2Z6UA 1KRHA 2VTBA 2AEMA 3KPUA 1SKMA 4J03A 2HYDA 1OTHA 3FTPA 3BL6A 3U7QA 2Y1KA 5JC1A 4FJ1A 1Q0TA 4PG8A 4DRXB 3IAM1 3L7JA 3A11A 1V39A 1WDWB 3L7DA 4PC3A 1DQNA 3A04A 3WDKA 1K1EA 2R5NA 4EA9A 1CWUA 4OI0A 4ZD6A 1TOAA 6CHYA 3QFCA 3CLUD 4N0EA 4WERA 4IDGA 5DNAA 4XIGS 5FBWB 3RS8A 4XA8A 3BIFA 4IF4A 3PQ2A 3L43A 4LWOA 2O7VA 1ELOA 3LA6A 3OIUA 4DWVA 5ISMA 3TLYA 1CJUC 3RV4A 3VR4A 3TW0A 1ML4A 1ESDA 2I4MA 2XIJA 5I5GA 3KWLA 4C7OA 1F2VA 4M0KA 1LJ8A 1T3SA 3L1HA 1QR2A 3G0HA 1QCDA 3L6CA 3I9MA 4LDPA 1E2NA 2ZSBA 3OPVA 4KMOA 4ZEOA 3VUEA 4C4RA 1OBVA 2H8GA 3JVDA 421PA 4CT0A 2V59A 3DEIA 5LMUB 2F8LA 3PGKA 1NXQA 1QG4A 4OFXA 5JVDB 4K6MA 3UJHA 9LDTA 5FV4A 2HFKA 4EDFA 5KYYB 1N0WA 4O0LA 1N6OA 3HA3A 4X66B 5K45A 2YYSA 3FWPA 3AB8A 1IAVA 4DLXA 5GIOE 2YL2A 3F46A 1SVUA 4D4IA 3EMDA 2V7WA 5IKMA 3B85A 2EKDA 2YRWA 3KDSE 1O5IA 5CCBA 2QW0X 3AYXB 5T8KC 3VISA 4ML3A 1IMJA 4FCTA 1D09A 5AH0A 1S1CA 2FH5B 4OEHA 5DCUA 1QYXA 4XYBA 3LYLA 1OX6A 4JBGA 1NQWA 2IYUA 3DYBA 3LWDA 4HLDA 4RETA 1JFFB 4DR3B 1T34A 3VDRA 1MX9A 4HEA6 3RVJA 1QG0A 4OGFA 2ZVDA 5EPOA 2ZIAA 3PCRB 4D1YA 3BKXA 1E8DA 5EIBD 1NNI1 2LXNA 2QU8A 1EX9A 2XITA 4J0EA 3PEVA 2WVJA 4JBIA 2F1OA 2OM6A 3T5TA 1FFWA 3TLGB 5T41A 1DQSA 1TMKA 2FMUA 2OV6A 2JZNA 2UUBB 3E53A 3T3HA 3TR6A 4DQKA 4EFNA 3PFWO 5EA2A 5FBLB 4EZEA 2WY2D 4H4DA 2IYPA 3MRSA 4OLHA 1U8YA 3MQFA 4Z49A 4LF7B 2QLBA 4QTTB 5DNUA 2BC9A 4RTPA 3IURA 1NU6A 3WJ1A 4LJ9A 3N87A 3VNBA 2Q3JA 2JF0A 3SM9A 5IJ0B 5A3JA 2WEKA 1F17A 2FSUA 4ECEA 2PX8A 4F71A 4Z5XA 2CXUA 3SC6A 4X62B 3R6TA 4NC9A 4JP1A 4WIAA 1ZL2A 4Y2PA 4ZI5A 1JR4A 4CFSA 2HRZA 4GR5A 1K8XB 1R88A 2COEA 3GAMA 3LQ1A 4BWFB 1BWSA 2ZM5A 5JCPA 1VE7A 2B37A 3BWBA 4CCWA 4TLAA 2C4VA 2E18A 4QTZA 1N33B 2O8EA 2ARKA 1X80A 2GBPA 4UU0A 4YBZA 1IATA 3PF9A 4GGPA 1HWYA 1A69A 1RAHA 2CNOA 3UW3A 3EXAA 4EGJA 3A1UA 3QJYA 3OO0A 3TCXB 1LSOA 5KHOC 2XUDA 4B9EA 1Q14A 2J9XB 4G01B 3JQBA 2MU1A 4BZXA 2UXDB 2ZBQA 2W0SA 3ZKWA 4KZKA 1N1DA 1RHQA 5ALWA 2FK7A 1XTUA 2QU7A 2W6JD 2IYRA 3CLRD 3AHGA 3H2BA 1SVKA 1Y48E 1FXWA 1ZHOA 1PQPA 2PIAA 4NOJA 4X84A 4MRNA 3D6VA 2BT4A 4OLBA 2O8BB 1DWQA 2IV3A 1HT3A 3RASA 1ISRA 4F96A 1D2MA 1JGTA 5IJ0A 1OXUA 4QFCA 1G9XA 1UMDB 4G07A 4B33A 3I2IA 2Y66A 4DUPA 5KU1A 1EWQA 3OEHD 4J7AA 2CVFA 5K03A 3DKIA 3AZPA 5A5VA 1WSDA 1W4ZA 5EWJA 1XRQA 4NEHB 4QLAA 4UNIA 3VBCA 2JH3A 4UE2A 2OLEA 3ZBUA 1UDCA 5JANA 4M8KA 3D7NA 4Q48A 1I1OA 1VYUA 2R48A 1LFDB 1LRKA 2A84A 1QANA 1VCIA 2ZWMA 4FD2A 4XVQA 1RZRA 4KACA 1PR4A 1Y80A 1Q6YA 2DG2A 3CUSA 3G82C 2IUYA 3PQFA 5FLEX 4J7UA 4PV7A 1ZO8A 3BX1A 3LT5A 1CJTC 1SM4A 1J7JA 1G6Q1 1QRDA 2HM7A 2ZIWB 3CLTC 3SBOA 5AJVB 1TYAE 2QPTA 4BN5A 4MUBA 3KPYA 3DAFA 1LXCA 1K6MA 4QQRA 2GHTA 1VKNA 2J9ZB 2FHPA 3BKWA 3EB9A 3EHDA 3H8WA 4YRDA 4DCPA 4DIFA 3H1AA 4B17A 3OESA 3NGMA 2QM8A 4EHFA 4YMLA 1BX0A 2IS6A 1GYQA 3QLJA 2YIJA 1QYCA 2DJIA 5TQ2A 4LSMA 1OR8A 1VFNA 3H65A 5CM2Z 5C1DA 1ZIPA 4OHMA 3HYRA 2FW1A 3GJ0A 4RCYA 1ZC4A 4PQRA 4WSOA 1EU1A 2KB0A 3CGGA 1X7WB 4C21A 1AS3A 3RAPR 2RARA 1IOWA 1ZEJA 2RHDA 3EXFA 2B8NA 1DCMA 4R1PA 4AUNA 1G1MA 4NPCA 4W6ZA 1HZZA 2IOFA 2AOVA 3BGVA 1SVOA 3CG4A 3FHCB 1QHHB 3D2BA 3MMPA 4C0AC 1ZGCA 3C6BA 3W4JA 1AXGA 4HS4A 2WHRA 4HNGA 5B7NA 2OV8A 3L01A 4FQ5A 3RRFA 2DHQA 4P53A 1Z6ZA 4ONEA 4FYYA 4KLAA 5DNEA 3OEED 2BE7A 2N0SA 3CF4G 5C32A 2ZYDA 2D1SA 1PUJA 1RI5A 3I5UA 1W59A 1R4MA 3O3OB 1GV1A 2FPMA 2O5CA 4MX8A 1AGXA 1ONNA 1UADA 1YDMA 2AOXA 3LPLA 4M9ZA 5KYWB 3ZVMA 4E2ZA 1JBEA 2Q62A 2P9JA 4GGOA 2H1FA 4NZMA 3LAWA 1YVEI 1JFLA 1BH6A 2PU7A 2ZANA 4LZPA 1E2PA 2C5SA 1D4OA 1EP2B 3C4VA 5LUBA 2JLCA 1BGWA 1WU7A 4Q5IA 4JBYA 3UT5B 2HF7A 4R6WA 3C3MA 3GEGA 4JL5A 3KVOA 4J4TA 3RI3A 3WA6A 4XIIA 3GGOA 4L8WB 3LT1A 3NXSA 3VU1A 1XMPA 5IN4A 1F06A 3A70A 2H54A 3WRXA 2NU7A 3EGXB 1XZNA 3GNLA 4WY2A 5CT4A 2PZFA 3TECE 2ZRDA 1YHNA 3AERB 4UZEA 4D4MA 4P0TA 1KVTA 4P4UA 4UCWA 2PN1A 5BR8B 4UBIA 2V7BA 2RHMA 1NJ5A 5FR2A 3VVCA 5JO0A 4AF8A 1ZICA 5GJBA 1YJ8A 2PUHA 3AHDA 3HYCA 3IBYA 4KXXA 4OMCA 4OK3A 5KWVA 5LQMA 1FFCA 1ZEMA 1Z4MA 4KO2S 4QXPA 3T99A 4BNXA 1X7YB 4OYLA 4M0MA 1JA1A 3DEHA 1ZUNA 4EG8A 1NHWA 3ADKA 3DBHA 5JMWA 1KDTA 3L40A 2QUZA 3E7WA 3LDFA 1ACMA 3I2FA 2F3PA 3NDJA 1YQTA 4YJKA 2XQFA 5DGCA 2YJTD 4BU0A 3KQHA 3K6KA 2ODQA 3GRZA 2HGSA 3L8YA 2KQUA 1TEHA 1O3YA 5DH9A 4CQJA 1X1SA 3RFCA 3HZOA 1TK3A 1JB1A 1UKEA 2MMCA 3FFBA 4ACBA 4BQOA 1AKVA 3OZDA 2ZAMA 4OHKA 2RGYA 2EP5A 1OJ7A 2PD3A 2PV7A 5FPTA 3ILHA 2WKWA 1PQYA 5ELMA 2FCAA 1ISPA 2GF2A 1KEEB 2D62A 4HRYA 4B34A 3I30X 4L07A 4LMAA 2H51A 2XZOA 5AW0A 1DADA 3PC3A 4YDSA 4EKIA 1E79A 1UK6A 2GCIA 5A5EA 4LMPA 4BX8A 3HO6A 6GPBA 4XX0B 3RT1A 4NIMA 2R85A 4A0SA 5C5DA 3ZY5A 2JLRA 2JJ2D 4B6PA 1COWA 2AKEA 3EQ6A 3IPRA 5KX5F 3NFYA 4JB0A 1T2UA 2ZRGA 3T1VA 1BS9A 1WABA 3BK7A 1WV1A 1P2VA 4RGBA 5EYPA 1YB7A 5FR1A 4DAEA 1JJVA 2P1DA 3E27A 3D4BA 4F4HA 1PJ8A 1V11B 3ORRA 3OJFA 4FK8A 5IC6A 2BBOA 3N7AA 3TQSA 5IK2A 2XWJI 3H9BA 1L5WA 3HVHA 4C7MA 4JLNA 5TS2A 4JASB 1U2ZA 2JANA 4RTOA 4QOJA 1JWAB 3BF8A 1OV6A 1YRLA 1LX7A 1SVIA 2W11A 4O5AA 4G4SO 3BFXA 4I50F 1ZD9A 4RM3A 3U13A 3V1UA 1DS6A 1GEGA 1IRXA 2C2KA 1PD1A 4RD1A 5JQGF 4QU5A 1PYOA 3AOEC 4QPPA 3T15A 5HXAA 3EJ6A 3PT9A 4LJ8A 2PMWB 2ZRCA 4G0ZA 1FP4A 5IAKA 3K0SA 1H2HA 3W5AA 4BJ5A 1T2NA 1L4GA 3FCXA 4RJ2A 5ICFA 3S2SA 4TV9B 2ONJA 1L3IA 1QV7A 4C4YA 2CCKA 3AKYA 3K8QA 4WXEA 2QQEA 4J1NA 3STUA 1EVEA 4WN9A 1KBZA 2FZVA 2NO9A 4X64B 5J59A 4YAOA 3MJHA 5C8DA 5AWFC 3A4LA 1VSUA 1Z9BA 2REQA 3DE0X 4WKCA 3QSYA 1C3VA 5EMKA 3KDPA 3LU1A 1MVLA 1ZHHA 2Q29A 3OICA 3PR1A 3OLWA 2X58A 3CB2A 1B6TA 4ZK2A 1X7GA 4BX9A 5L3QA 4RGYA 3OQPA 4TX1A 2FPIB 2CL5A 3O9MA 1PNRA 2QJFA 3GLVA 4RADA 3DPSA 5FNVA 1P0IA 1KFCB 2FUG1 3VGJA 4BATA 2EYQA 1NRXA 1GU1A 2PUWA 1SCBA 3NOVA 2WKSA 4AJLA 2OCAA 3JQGB 1W48A 1HKUA 4K2AA 1DBIA 3E9MA 4KE6A 5COQA 5CH3A 4TTSA 3U6BA 3AVTA 2VT3A 3JYHA 5ELLA 3I3SR 4D2IA 1TTHA 2AMVA 1ADGA 1R5BA 2WUVA 4FBMA 3PEWA 4YV0A 3FDZA 5AUOB 2W4IA 3UC5A 1PK8A 3EVNA 3ZYCA 1SG0A 2C4KA 4PLTA 5DVZA 1PGQA 4W9NA 2XECA 1EUDA 3AF0A 4CIAA 8GPBA 2OFOA 3O2QB 4IFEA 2O59A 1DX9A 2QG4A 4AP5A 1OAAA 3AKEA 5EIBC 1U7UA 4O2LA 4RGVA 3GLTA 1XZJA 3D3EA 3KQNA 1GY8A 4QM7A 3CUYA 2ZJ4A 4B6EA 3REQB 2RAPA 3DXZA 4Q7EA 1YI8A 3IEUA 4C76A 3B5EA 2VRBA 3ZY3A 3DTVD 4JJ6A 4AX4A 2YHSA 4HBGA 2OA0A 2GCGA 3KLPX 4KNVA 3DL0A 5TF0A 3HACA 3QEBZ 3B6MA 3CF2A 4LXUA 1MJGA 3VR2A 3AHCA 1ZCJA 2J5BA 4AG6A 3AV0B 2Q1WA 1YS2X 3HVUA 2FSVC 3NBKA 2C2ZA 1N2EA 1ZBDA 3I72A 4GX5A 2O8NA 2ZRKA 2ACKA 1GPH1 1KMIY 4GX2A 1N2CE 4ZC8A 1E2LA 2YFHA 4EB3A 3IQIX 4DWOA 4RABA 2OMKA 4X24A 3AVQA 2AYZA 4Y9UA 1W76A 5C4IA 2AI3A 3FSGA 3HHPA 3MAGA 3RQIA 1RXUA 5IDQA 4RF2A 1N34B 2QXTA 3QXCA 4FEYA 1RAFA 3CONA 3P9SA 1AG9A 4LHVA 4OI2A 1XI2A 3ND8A 4UD6A 3BWVA 2UDPA 3Q10A 2C1ZA 1LD3A 3UWMA 4EGQA 3WHKA 1PR2A 3M3PA 4RELA 3U62A 2CE7A 3BK2A 1JVSA 3SU8A 1UP7A 3VNAA 1C4KA 2QY6A 2DKFA 1H2FA 4ZANA 1QO7A 4O4LF 3H83A 3OZGA 4PONA 4L5JA 3R75A 2DVMA 1I33A 3CNEA 3FYSA 1N3IA 3E18A 1S2NA 3DUFB 2X86A 3WL5A 5IFLA 4GVLA 4DWWA 4BIMA 1RD4A 1P9LA 3QM1A 3LZDA 3V8BA 4N7MA 1JYFA 2P4UA 1P7PA 2G7ZA 1ZN9A 2B1IA 3VKWA 3GN2A 3AH8A 4KXVA 4ZA2A 4WH0A 5H3LA 3ZH2A 4A15A 2IXBA 3KZXA 1PNQA 2Q1XA 5KNDA 3K7EA 4IJVA 2WM8A 3OKPA 1GV0A 1AU9A 1O6CA 3PRHA 1GKUB 3I01M 3P0HA 4W7SA 2HWYA 5JARA 3OX4A 5E9JA 4Q01A 4ZO6A 1QAMA 1ST3A 1U4NA 1TECE 3KR2A 3FPSA 4G36A 3UCEA 3REGA 3HCNA 1Q1AA 5H68A 3GDWA 3P4XA 4QNRA 4ZZ0A 3EMBA 1L7DA 4M6WA 4D46A 1MPTA 4PIMA 1RWXA 1E0AA 2B94A 2G9VA 4L9RA 4UBJA 1KYTA 1OX5A 5J47A 2OBMA 2PQ0A 3OZAA 1KY4A 2V58A 2B4QA 3MVEA 4BFTA 3C3PA 1ULAA 2ZK7A 4QQ8A 3LWBA 3QELB 1JL3A 1NBMD 1Z3IX 3DO6A 2XV1A 3JZDA 3QMMA 5JAMA 1YVPA 1JLHA 4X1YB 2JD1A 1DTWA 3JASB 1HH4A 3KJFA 3GGGA 2H9IA 3KDAA 4J1TC 2AQKA 3RDPA 4A0QA 3ND5A 4CGYA 2NLOA 5IN5A 3A1SA 5AK6A 1CUFA 1YR6A 4TLLB 1XDGA 2B6NA 4Y67A 2A7XA 3WGUA 1IQRA 1DAOA 2PX6A 3AM3A 5CA1A 1TVKB 4DKJA 1JXAA 4E0BA 2DUUA 3WWEA 3FAKA 3DDOA 4UBNA 4I7EA 3L0DA 4X00A 3SYTA 1FDUA 2I7CA 1LZKA 1Z17A 2NSHA 2NUPB 2R7KA 3T8YA 4LCEA 3LBYA 3IJEB 2XWBF 3L7CA 3QFSA 4QDOA 4YRRA 2VRWA 4MEJA 1SIUA 3NHWA 2W98A 4G5GA 4NJMA 4V3BA 2B25A 4RTNA 5C2JB 1NC1A 1IEVA 5ERXA 3Q9UA 5AESA 5BN1A 1FFBA 1USVA 1G291 4WECA 5B3KA 1ATZA 2D06A 4G67A 4IUCS 2ZJYA 3P0FA 4L57A 1T6YA 2RGNC 3OIVA 4LECA 3GGPA 1X15A 2LW7A 3IT0A 4WZZA 3MJDA 3Q87B 3OTQA 3QPUA 3MTGA 2XLBA 4ABYA 5EJEA 4QJBA 2IEZA 3O4HA 4OKIA 4R2MA 2GASA 5JCOA 2BUBA 3BSSA 3VYWA 5BP7A 1CIVA 4KUGA 4A5OA 3AP2A 1OGIA 5EKTA 3VU8A 1N2IA 3EC1A 3OZIA 4AJ9A 4K1XA 1GO2A 2E87A 3AWDA 2WNHA 1Q16A 5DI3A 3UWSA 3WIUA 4F21A 1PS9A 2BCGY 5BQ3A 1IZ0A 1KNXA 1XTTA 5MFPA 4JNCA 3UG7A 1H65A 4FJ0A 2I4RA 2IXDA 4DREA 4L8FA 1U0TA 3HSYA 4H3VA 4GZ5A 4MIEA 4XB6B 2CNKA 2AN4A 5A3RA 1FP1D 1RMYA 3GLHA 3GX1A 3UVEA 4TSFA 1E1QA 3DS8A 2AG1A 1LVGA 4MSUA 3GQBB 4UDYX 5CH8A 2I99A 2PYIA 5JCXA 3JARA 1RM3A 4H3KB 1KTIA 4ERXA 2Q50A 1KY5A 2AZMA 3F4LA 2CJYA 1A4XA 5D3ZA 3A4VA 2QD2A 5FBRB 4J1SA 5F1KA 4E09A 3HE3A 6ADHA 5HE9A 2QT9A 4M9XA 4KODA 1N6KA 1KAQA 3X1ZA 5KMGA 3SFZA 4XGQA 4MRMA 4KQEA 3BH7A 3WSVA 1HNWB 3EXEB 1XA4A 3ISVA 4Q3CA 4MQ5A 2PGOA 5EJ4A 3EXHB 3AFHA 3N76A 1U7HA 3A6JA 4BMPB 3WA7A 3A3KA 4BZZA 1JQAA 3WLOA 2GAJA 1AA9A 1A9RA 1U3TA 3FMFA 3F4KA 4BX2A 5JTTA 4MKGA 3JD1A 5ICEA 4F5DA 3RC1A 1NYLA 4LOLA 3WQRA 2IW1A 1Z0AA 6REQB 4B7AA 2O5EA 2VK4A 1T9CA 2GRUA 3DMFA 3GZJA 2NT4A 1FFYA 1YB2A 1YWGO 3EA5A 4KQ1A 1ISFA 4DMRA 4JL6A 5EN4A 3BWMA 2Y0DA 3D0OA 3PUJA 3R09A 5GZ6A 5TQVA 4UHJA 4B44A 2NYVA 1CF9A 3L8MA 4LYJA 1DG9A 1OI7A 2Q4TA 3DAGA 3G6KA 3MCAA 2JI9A 1LSJA 2C57A 2NO4A 4G5RA 3MM4A 4Q3BA 1BW9A 1G8KA 1LBQA 1B6GA 1NAIA 2GHRA 4LNAA 4II2A 4DABA 1SVMA 4TYQA 2MYNA 1RRKA 4JP2A 3PPWA 1GTMA 3KWJA 2ZUWA 3AKCA 2HU7A 2GR9A 1QOPB 4R2JA 2GN4A 1IXYA 1S4MA 2HIMA 3J81A 3AUXA 3LW7A 3LSYA 1BXGB 2MDTA 2OFWA 4H77A 3M3DA 3RF7A 3WOHA 4D9CA 1H2XA 1N5RA 2CXHA 1XNGA 3DE5X 2FPIA 1N2GA 2ENWA 4FDMA 2QZ4A 4KQHA 4H18A 5EHGA 1R5JA 1Z5OA 3AR6A 4GE0A 4P93A 4AROA 4ETIA 5LQCA 3VC7A 3ZDBA 4AKIA 3FA2A 2H2IA 3IULA 4JJAA 1CY4A 1L5HB 4PCLA 2ONZA 3A3PA 4K46A 2BFMA 4XVUA 5HJ7A 2PJRA 1DLJA 2C9BA 1EJ2A 4G1EB 5FD8A 1RJEA 4XXHA 3JCZA 4F60A 1LLCA 2V9PA 4CG1A 1ZISA 2PTHA 1G3UA 1M72A 2FU5C 1BSVA 2VYFA 3I28A 1RAAA 4RF3A 5EPEA 2A5DA 3WS7A 3HB4X 4DR6B 4UCXA 3AJDA 3KKMA 3HU3A 3KKKA 4GOKA 2P9FA 1SA0B 1NR1A 3R7FA 4AL4A 3UXHA 7ABPA 2BH9A 2GK6A 3KWFA 3DTVB 1NR5A 4FYXA 4RL4A 2IWHA 3O92A 2HIHA 3OTOB 3D6HA 1ZN2A 3KZKA 4QREA 5EGNA 1G7TA 2H1WA 2H1SA 3KEMA 1BE1A 2JFVA 4OHXA 2QA5A 2YOHA 3TZQA 5KNBA 4UU8A 3BEOA 3OEYA 5TGDA 2GM5A 4R40A 3O1JC 5DTJA 3N2NA 5HW0A 2VPWA 5DRYA 4GBGA 3UW1A 2A5YB 2PEZA 3EPKA 1JZTA 4D4LA 1SBZA 1PHPA 4BBPA 3OEEA 1NNLA 4FDTA 2TMYA 4FQ7A 2ON6A 3UEOA 5CPBA 1EDDA 4HAYA 3PFFA 3KSMA 2WMNB 2ZWPA 2SHKA 2VF4X 3CSSA 3PD7A 2BF4A 3ZCUA 1NIJA 2JFGA 3TUJC 1IBMB 1UT5A 4HDCA 1P8AA 3R2JA 1PWXA 1V9LA 2ZQZA 3OJXA 3LQ4A 4X1IA 3AQIA 1FBTA 5C1BA 3WYDA 2Q2QA 2J9RA 2OQIA 4FMDB 5JADA 1TC1A 1OFIA 3VU9B 2GYUA 2C82A 1US8A 1VYHA 5A3VA 1AO3A 4PCVA 4IEIA 3IESA 2BL4A 2DSTA 1N3LA 1U80A 2LCFA 4PYLA 4YQZA 4YRLA 1GARA 1ECFA 2PNFA 3D02A 3T5BA 2F1JA 3G3EA 3KSBC 1PJTA 1XTSA 3THYB 4FONA 1QK3A 1XTKA 4OLJA 4UUMA 5GONB 3A0UA 1E8NA 3GJXC 2JRLA 1UR5A 2FOIA 2HSDA 2R8XA 3JYPA 5IKOA 2ISSD 3A58B 1M2FA 1JU4A 1VZ2A 5M7EA 1HG1A 5AVVA 4RIFA 3VR1A 1Z8FA 1DOZA 4QX6A 2NIPA 1FYDA 3L4BA 3OPYI 4NJEB 4B35A 1T36B 4CF6A 5ERGB 1TQ2A 3GDHA 2AFHB 1U2GC 3HJHA 4HK4A 5CGZA 4XTRA 2Q5OA 3N0XA 4ND8B 3PNPA 3NTXA 3VGPA 2UXBB 4BAZA 1U28A 1YZUA 1GGHA 2BBSA 5CB8A 4R8KA 4A9AA 3U16A 1QP4A 3M6LA 4R1OA 4EZBA 5JDIA 1WD5A 3CLKA 1U28C 3A0RB 1T4BA 1B3RA 4GEGA 4YRNA 2YV2A 5ADWA 1IOZA 2HV9A 1NYRA 5EVJA 5GY7A 4PGMA 1TKRA 1QF6A 3KX2A 1D04A 2H5IA 5K4HA 3U44A 3F7OA 2WF6A 4DL9A 1LBHA 5LU9A 4G5QA 4PS0A 1LH0A 3VR3A 4AJHA 1J8QA 2XWSA 4IH9A 4Z0TA 2JCSA 3S27A 1LV7A 2YWBA 5DBOA 1XRRA 2D0DA 3S68A 3TPCA 4AJJA 1QNFA 1ZGZA 1PV1A 2JJ2A 2NADA 3WFJA 4MUAA 3NXKA 4DM3A 2GLXA 3IT3A 1FC0A 1QFZA 1YS1X 5EVCA 1YONA 3K1JA 1QH8B 2VSYA 2WZDA 1YRHA 1C5KA 1A4RA 1WLSA 3MUEA 3N2GB 3RBAA 1SIWA 1VJ5A 2CJXA 3BF7A 4RDXA 1MGOA 1GGEA 4BGVA 4R51A 3IQHX 3ETJA 2R1TB 5IZCC 1C29B 1YK1A 4K6HA 4EJSB 2R7MA 3VZCA 1F8UA 1QE0A 1ULZA 2B20A 1UOOA 4Y7DA 3NP9A 2YJ4A 4X95A 2IYQA 3N8DA 1WXHA 1SC3A 3FUUA 4QPNA 3WGIA 1FYWA 3O0TA 1WETA 1KQ3A 1T9AA 4WKBA 2H7VA 1I1QB 2J0VA 2QJRA 4GC5A 3HKBB 4RM2A 5DRTA 2JG3A 5EZYF 3H9QA 3JQRA 2F90A 2PG3A 3UJBA 1DXYA 2ONKA 1FIUA 2REBA 1E1KA 3TJMA 2VHTA 4G5SA 2G7MC 3PXAA 2HF8A 4MW0A 4OXXA 2WWRA 3UQZA 2HU5A 3SXUA 3TAUA 2C9MA 2HWWA 3DKVA 4PAOA 4JIMA 3TB4A 3AJEA 2IEAA 2XX3A 3NU1A 3THOA 4MVYA 4C6TB 1PL8A 1ZH8A 4NG5A 1VHJA 1VLZA 3GFVA 4E32A 2PNJA 4G9BA 1FL9A 2HPZA 1WY7A 2QB5A 3DDHA 4MQFA 5J3JA 2NVUB 5BPHA 4PICA 1N78A 3ZNNA 2QSUA 4ED9A 1FP7A 2OQ2A 2RDMA 3N59A 5A7GA 2IV7A 1QE3A 2PUVA 2FETA 4LGVA 1DQRA 5J4LA 2XQGA 4IOMA 1GL3A 4BBAA 3FPHA 1I2DA 3X2SA 2JS7A 1ADJA 3F9IA 3DEJA 2W6MA 2O9JA 1NATA 1M10A 4UMEA 1EHYA 4PYMA 4IGKA 2VHCA 2AE2A 4HB3A 4Q00A 4QOIA 4O2AA 3Q72A 4N7JA 4QXOA 1D03A 2HQOA 4J0CA 5E9AA 2UKDA 3N5CA 2HMTA 3TDNA 4C2BA 4DV0B 3AR3A 2W2TA 1H1DA 5J40A 4IGAA 1DO0A 3MTAA 4F9EA 5A4IS 1MQ8B 1ZM3A 2QEQA 4LOKA 4CV0A 3MWDA 4IS2A 4D3FA 3DOFA 5EP3A 4W6QA 2K2QB 2DRIA 5K6TA 1N2CB 4NCKA 2JLSA 3DV9A 3GO4A 1FDVA 1QORA 3DGFC 4HWOA 4KGXA 3MOIA 4OU4A 5LDHA 4TKZA 2FX5A 4M9RA 3ICWA 3PNLA 4LOAA 1Y98A 3E9QA 1M5TA 2HOQA 3QMWA 4M9CA 3HZHA 1A7AA 4YP9A 3PEUA 2ZRMA 1E1YA 3K0KA 4XKJA 3RIEA 3EOAI 4P81A 4C06A 4X1IB 4GZLA 4C0QC 1IPEA 1ZRSA 2VYVA 3ZDCA 1J70A 1P17A 3E7XA 3LX5A 4LMRA 1LBSA 3ST7A 2VJAA 3DBRB 1OKKD 3DFMA 3EVTA 3DZJA 2Z04A 4U2KA 1E96A 4BB5A 2J6BA 3TG2A 3IQGX 3ZVRA 4DNXA 3V2UA 1UQUA 1T4CA 2B7LA 2OYRA 4AZWA 2AQHA 5EJ5A 3SBEA 1TUBA 2O1SA 4TSRA 2H1LA 2ZE5A 4WE3A 3IELA 4JS0A 4Q1AA 4UNSA 3R74A 5LZ7A 3ROKA 5CA0F 3T5AA 4NU6A 1OI2A 4BCDA 4XFKA 3GFPA 2FMFA 3SZLA 3GFTA 4A36A 2G0AA 4H7DA 3ZHBA 1H4TA 3CLTD 3FMVA 1CP3A 2WVGA 2PUCA 3I1IA 3A7EA 2BV3A 1S0UA 1EUCB 2D54A 2J3MA 4DM4A 2C7QA 3I01A 5TGZA 5CIQA 5C80A 2A3RA 3UJNA 1YFLA 4I08A 4YV7A 3ETNA 3UUEA 3UMMA 1TYDE 1A77A 1AKUA 5F76A 3KT8A 3D7SA 4PN3A 3A4MA 2J6IA 3PBKA 2TMDA 2YNMC 4CM6A 3CZMA 3TK1A 4B8ZA 4BBJA 4C0LA 3RVBA 1JDJA 4RDIA 3C0KA 1GCUA 3ZS9A 3UV3A 1ST2A 5DGDA 5GM1A 1SGWA 2XE8A 3VZBA 5LN1A 2CV1A 1PD0A 4LKOA 5K6AA 3LHKA 3P27A 2IHVA 5DHTA 4M99A 1ESCA 1QAOA 4FMPA 4W7HA 4NH0A 1Z5UA 1C3OB 2H85A 4ZTUB 3OTGA 4G0UA 3SQOA 3LCVB 5TEVA 3CEJA 2CYCA 2YC4C 3PEEA 5BW5A 5HQJA 1FNMA 1TD9A 1RC8A 2O3JA 5CXUA 2NYUA 4JJZA 4WOCA 4ZOLF 4YT5A 3HYLA 4K1LA 4I4CA 5FNVB 2IH5A 4MTCA 3W6UA 3A7DA 3U7FB 4OQMA 2QIOA 3U7JA 5A71A 1UIRA 3EEIA 2XUAA 4AVYA 2CHFA 3GCXA 4I5FA 4Q9HA 1V2HE 1GZHB 2O2XA 4ZQHA 3IVXA 3UMGA 1GADO 2HWUA 1NQUA 2CLCX 1O8CA 4TT3A 1GR1A 4ZO7A 4CCAA 4DA6A 5L9AA 4PWZA 5CVCA 1CERA 3QKIA 1IY1A 3DM5A 4JMPA 4QOHA 1SU8A 5F1YA 4XWTA 4AF7A 2J5RA 2QD4A 2JBAB 2WF7A 3G49A 3GRRA 1G8YA 1P5JA 3QBVA 3SXJA 1M2VB 3Q4GA 3MMNA 3ZU5A 4A1FA 3CVUA 3BMXA 4KBGA 4MGZR 3IOCA 4P3XA 4AICA 1X2BA 2PX3A 3IUMA 5ILOA 3RAFC 1K5HA 1JDBC 3HDGA 4IR7A 4CM4B 2ZI5A 3A6GA 4NECA 4ENWA 1NN3A 4FFWA 1WMBA 4RHFA 4O4HB 3K71B 4YCDA 1J0XO 4FZJA 1GVHA 2VSFA 2NO1A 3DT6A 2QX4A 5AKXA 2G04A 2JAPA 2X8JA 4W1PA 1GZ6A 5EJGA 2QRVB 4S3MA 4TXLA 1RABA 1CE8A 4BE9A 1LW6E 1GTZA 3PWZA 1JEEA 1DPGA 3HJBA 3HC7A 1DIBA 1JP7A 3MN1A 5G4KB 2I67A 2IGBA 5EIOA 5IAGA 3P0EA 3FGZA 3PA8A 1P1JA 4XJXA 1HDOA 4D79A 2FDRA 4YASA 2CMHA 3IVAA 4Q47A 3K9FC 1EWYA 2QR3A 4MRRA 4ZPJA 3ET5A 1SKYE 3GARA 1L5OA 4E5DA 5ECYA 3RS4A 1GUYA 2O8FB 1V41E 4HAVA 3KKQA 4TMWA 5DYWA 1YF3A 2QTRA 1OH8A 3KQVA 4QUDA 3ZGNA 1IWOA 1WU8A 2JGFA 5FPPA 4DDWA 3C3YA 4TVBA 3VTFA 4F5YA 1CUDA 4H3HB 1P1KA 1HQYE 2Y77A 1NVTA 2G6BA 4G0XA 4XWOA 5A0VA 4J07A 3GUUA 1MG0A 3L49A 2GWRA 2Y1CA 1O54A 1YR3A 2JLQA 1Z0SA 2BFEA 4JCCA 4QQKA 5KSOA 2HF9A 4ACAA 1CJBA 4WACA 3LDUA 1FFHA 2C96A 3GFGA 1NVVR 2M1XA 2YIVX 5I9SA 1R10A 4LBWA 1NVUQ 2YQ5A 1A9QA 1ZSVA 3PE4A 1TO2E 2DWCA 4CLOB 1J25A 1K0UA 4A73A 4NBNA 4NENA 3HJGA 4PC1A 2VLIA 2GJ9A 1DBQA 4ZOLB 521PA 1O9GA 4BNUA 5KX5B 4O3FA 4EKNB 3EFHA 2CE2X 3BRWA 4DNOA 4HAXA 5TQ2B 4TQAA 2W37A 4BGIA 4C4TA 2ASEA 3E61A 4XD7A 2QAIA 3ASUA 3H0KA 2ZJ0A 3CLUC 1GPBA 1R37A 2XVYA 2Q7XA 4JI4B 1EGHA 3K8OE 3QPAA 4E2FA 4YVFA 4S0ZA 1BRMA 2C7VA 1J8DA 1CRZA 1MNAA 3U4GA 2MSWA 4ZT2A 3RRJA 3LUHA 4H7EA 3OT5A 1AMNA 2QD3A 3E82A 4NKRA 1UKBA 2E49A 3BXEA 1RM4A 3FB4A 1D6SA 3RWMB 4AF6A 5K8IA 2FMKA 3D9QX 5KQPA 1Z2AA 4WLOA 2B30A 2YY6A 4HMPA 1E77A 3L77A 1A3CA 4TYPA 5DMHA 4MS3A 2XXAB 2NQ8A 2PRZA 2Z56A 5AHKA 4EG0A 5A4DA 4GWKA 1JLRA 3KHKA 5DGIA 5ALRA 1C8LA 2ZG6A 3RGGA 3WL8A 1D4AA 4H17A 1X9GA 4D7AA 1ISSA 3NV9A 3GP3A 3ZE1B 4HZUB 2CBZA 4CXMA 1YMUA 2IS2A 4QAQA 3NH6A 1N8KA 2JLBA 4UOEA 1AZSC 2O8BA 4PXSA 4TTQA 2GPNA 4ZVOA 3EXG1 3V3TA 1L4UA 1NG9A 3NCTA 1O6BA 4UEOA 5EMHA 3QHPA 2A5FA 1MIOA 5T6BA 4DBZA 4BX0A 3MB8A 2WFZA 3NWEA 3ZI0A 5ARBA 1ZI6A 3W04A 4BBZA 1GPAA 1PV4A 4XAQA 2ZCVA 3E3AA 3H2JA 4PIPA 5JI3E 2WT9A 1FYXA 4BEJA 3ICOA 1KJNA 2OHXA 1Z33A 3B7GA 3EZ7A 2XCQA 1Y42X 3OQIA 3TW4A 2DUMA 3T7CA 4HI0E 3ZHOA 4YRKA 1B14A 1AK9A 1NP3A 1UJCA 1PT5A 5ED4A 1V5IA 5KYUA 3S7TA 3IALA 3LW8A 2YXBA 3OQOA 3IAUA 5HQTA 1EWRA 3OJLA 2OQVA 2QRQA 1FLDA 2VOEA 1V4BA 1ZA2A 1IN8A 2FQQA 3G2NA 3GU3A 2OEPA 4WA8A 1NUTA 2WP8J 4L4ZA 1K66A 4NR0A 5LMNB 2PUDA 5AYVA 4DDKA 2JFFA 2IE0A 1AX9A 2OT3B 1PT8A 2QLNA 4OKSA 5I4IA 2D1FA 4Q93A 1Z6XA 5CDGA 5LNK1 2JCXA 2DERA 1U5BA 3IQDB 4ZAFA 3WTCA 1B0AA 4F86A 4I9NA 4EHAA 2WPNA 5T64A 4ZQIA 2EEZA 3R1IA 3TX6A 1FDOA 1YDEA 2C2OA 3GGSA 3H5LA 4MCAA 5BW6B 3VR6H 4WBNB 2WIJA 1V3TA 1PK9A 1OWPA 2QSYA 2CMDA 3A1CA 3R9IA 4DR1B 4BVAA 5LA6B 3PHGA 4P4LA 3SF0A 3WLQA 4XWKA 3LCCA 4AY5A 3K8YA 3HI4A 4O4JF 4KPGA 1E1LA 1S2GA 2YWXA 3MGKA 2O1EA 4ZAGA 3EQ7A 1RLIA 4MIYA 3TNDA 1F14A 5EKDA 1YR2A 1M6HA 4B3DA 4CG3A 4ZHQB 1A8HA 4ZI3A 5DIZA 3V4FA 2XJ9A 1L6RA 2VHZA 1QHGA 5FOTA 4DA0A 2B2XA 1SOAA 1CQWA 1DJLA 4LK3A 2OO7A 3NMUF 1I5EA 4ME6A 2OR3A 4A2QA 3MIIA 1H85A 2IPLA 3QFTA 5FAXA 3U4DA 1P2BA 3FCSB 4NYJR 1BYUA 3EOBI 3VYSB 3PQ5A 3G9QA 3NWPA 1L4FA 1LBTA 5LZ4A 3KNZA 1IJFA 1YB5A 1WZ2A 1WSWA 2W22A 1VJGA 1M0EA 1RMTA 3RYIA 2DQSA 3LUFA 3D5EA 1E0DA 3E8SA 3LECA 3VC3A 4D98A 1BU8A 1EDBA 1K8QA 4RHYA 3BDIA 2QJOA 4HNTA 1G4HA 2JI8A 3PT5A 3TTYA 5TF4A 4D56A 4FFDA 3TTXA 4CETA 2RGDA 4I5DA 2X8WA 2WQZA 3CSDA 2IEIA 1PZNA 4NDNE 5KQRA 5IM4A 3GRAA 1QVVA 2ZUDA 3VSCA 2VNJA 4ND1A 4DJJA 1XYYA 3CA8A 1M2HA 1Y8ZA 1PQUA 3IE2A 3C6YA 3KAKA 3JRNA 3UUFA 4XI9A 4EYKA 1G5PA 1G6HA 2R8EA 3SZOA 2YINC 1ODCA 2GEDA 3S5JA 3X1JA 4AK9A 4HWTA 4P82A 1X70A 1HC7A 3LNCA 4GFDA 4MR9A 2NSYA 2HMYB 1FU7A 5KVSA 5DHUA 2IF0A 4ZEMA 3IE0A 4EJFA 5IFKA 2B0CA 1RJ9B 2B4RO 2W2LD 2QVYX 10MHA 2UZ4A 1EFDN 2P6PA 4J16C 1M1ZA 1T24A 4WZBA 1LB1B 3K32A 3EX7C 2A1UB 5E3JA 5JBQA 2QTTA 2WWXA 2IHYA 4X44A 4G2TA 2VZ8A 3RRBA 3IBTA 2MSNA 5J23A 2XRMA 5BYAA 1CULC 2RGGA 3JRXA 5K3BA 1YUBA 4CT4B 1NFRA 1IPHA 1QIEA 2JKVA 4FOLA 4V0LA 1MORA 2JIOA 2Z5VA 2QVZX 3V6MA 3VA7A 4BKPA 2F64A 1W8IA 5BSHA 1PR9A 3V55A 1BDIA 1FX0B 3RIMA 1GKYA 1XVTA 3VVBA 5B6IA 1AHPA 1FMTA 2F67A 5A0TA 4PSKA 3LZCA 5ALUA 4LXXA 2POCA 2XXBA 4ZRNA 1L5HA 2HA7A 2QYHA 3E3OA 3WIEA 5H8WA 2HJ9A 2HLHA 4R1UA 1HYHA 3K5HA 4JU9A 4XWAA 1HF3A 2F8SA 4J76A 2OXIA 3E22A 5EEHA 1AHHA 2PFKA 2JA1A 3F5QA 2Y71A 1CVLA 2B8EA 4ZTBA 3ACBA 5CYOA 4FX5A 3BWCA 1OX4B 2DP4E 2MR5A 2W2MA 3QF7A 1C80A 4U7WA 3W2TA 3S1SA 1A4IA 4M1EA 4PZDA 4B7XA 4DRZA 1LQ2A 3SJCA 1NX9A 2XNKA 7MHTA 3AEKB 2YX1A 1V95A 5FORA 5DPMA 4F4JA 2IP4A 5CYPA 4UNPA 3O0DA 2AD5A 1OHHD 3NBYC 1QFJA 4LNUB 2G88A 1JE0A 1U2SA 1RE0A 2FRXA 5A9TA 1XQ9A 1ID8A 3DZCA 3SE0A 1E2QA 5CHYA 5K99A 2W6IA 3ZV3A 1HPLA 2ZYWX 3N7UA 1L4EA 4M22A 5HTOA 3KJHA 1AH2A 3IMCA 1NXXA 1XMVA 3TQRA 2F8MA 5AIBA 1MC1A 1AC5A 4FI3C 3WO0A 1ZUWA 2O20A 2QD1A 3GPIA 2WNIA 1Z5NA 3O5AA 1KMMA 1RFLA 3UPDA 4YUAA 3BHMA 3KT6A 1QGAA 3BM5A 4Q1DA 4X41A 5IU6A 5IKXA 2VHXA 1IM5A 3NJ8A 4QLBA 1UC5B 1A82A 4B3GA 1QLJA 2D59A 1G21E 1M6WA 4J1QA 4EQ6A 1CEXA 2OK8A 1N9ZA 2QTWB 4V1CI 5KTYA 1XLTA 3ZIAA 4PX3A 1PZMA 2XUPA 2ZQ5A 4L5IA 4N7BA 1GNRA 4AJEA 3H9EO 1T9GR 1G5RA 2FFHA 1GSHA 1TEXA 2H1RA 3B1JA 1NW3A 3K2EA 1SC6A 4WNYA 4YO8A 4J49A 3AVWA 2X8JB 1Z7BA 2XDQB 2QAGC 5DX1A 3GEEA 3FUTA 2QGFA 5LQAA 1QGUB 1JG4A 3AB7A 2QYOA 5U1PA 3MINB 4IKEA 3VSAA 3BWYA 4B6JA 2Q5CA 5KTPA 1I9CA 2SBTA 4KP7A 3CRQA 4BVGA 3K2IA 3ORFA 4EMTA 3JSAA 4EH1A 1VIVA 2QQ5A 3UK1A 2ZTVA 3UOGA 1JSXA 3NUZA 4R8RA 1XPUA 1LSUA 2L2QA 2J30A 3N70A 1PWEA 3F6PA 4FFVA 4HTFA 2NUAB 3T4EA 1IMOA 1HLDA 4Q24A 4W82A 1A5AB 1U65A 2QVCA 2ZREA 4QFMA 4YGYA 2ERYA 4F3KA 4YCSA 5C46F 1N25A 3ZZMA 3QY0A 1KIMA 4I55F 4PQGA 1FLNA 1WBDA 4EG6A 1V25A 2PSDA 5BSEA 1AM4D 1FMCA 2Q2OA 1GPNA 4HYYA 4XDZA 5DGXA 1CX9B 3B6JA 1G98A 2P2GA 4OFZA 3OCWA 1JTEA 3UNXA 4MR8B 1I7DA 3U1TA 3ELBA 2C4TA 4I1YA 2Q5JA 1J9GA 1FRQA 2FEKA 3H5WA 3RBXA 1ZOOA 2WFLB 5IBCA 5JMTA 3JD2A 3HRIA 3PPYA 1YA6A 3K9CA 1XF9A 3MTEA 1UJ6A 1U7TA 3LWNA 4DY4A 1BXGA 4EKGA 5ITVA 2YYYA 1U1EA 2VYVD 2J0EA 5KC9A 3F97A 1L3CA 1O7JA 3A6KA 4QASA 1JBKA 3O8RA 3RRMA 3SIPA 4KXNA 4XWGA 3UJAA 4G86A 1R4MB 1AF7A 2W93A 4F11A 2NPIA 2KYRA 1A9ZA 1BMDA 5ITSA 5MGBA 2DLDA 4KXFB 3LXRA 4J90A 1A9TA 1U04A 2VG8A 3AJ9A 2BH2A 2B78A 1LK7A 4ENUA 5LJLA 4LFBB 1P4HA 5HF9A 4BU1A 3WJAA 5CTJA 4Z3KA 1IRIA 2VHWA 2IIQA 4LJSA 3TQFA 2VDRB 4F4FA 4Q4JA 2DFPA 5FYQA 5G0TA 1UDXA 2EWWA 3GJ6A 3OIFA 4KREA 3DNMA 4EHJA 2CDBA 4A82A 1USUA 1N4DA 3QPWA 3ORSA 1I3CA 3FOFC 1B8NA 3PIDA 3EEYA 3QRWA 1EE9A 3TOCA 3LF2A 4B48A 2Q5IA 1ES9A 1CY1A 3VNSA 4A0RA 4TWZA 2CHGA 2FJPA 2Y4OA 3DBIA 2WKRA 5DN6A 3CEAA 4MKRA 5EZ6B 5AVOA 1XEAA 4YPVA 1G21A 4CG0A 1WCYA 2CUZA 3DD5A 3KOYA 3TGWA 3F96A 1KEUA 3UAWA 2UUCB 2Z6AA 2XXAA 3MELA 4CM9A 4Q4HA 2AC7A 4A8HA 1D0SA 4L0DA 3FUXA 1V9SA 5F78A 2R96A 3TCNA 1NRWA 5H81A 2PXHA 2ZIVB 3RTBA 1H0SA 4LZJA 3BOSA 3GFOA 1MXHA 3KELA 5FTLA 4NMLA 2WJHA 2VVTA 2V9ZA 5NLLA 1KPHA 3T1NA 1DARA 1X94A 1SOVA 2GKSA 3MUFA 1T6XA 3P45A 1MC4A 3BQNB 4GHWA 2I1LA 1H3FA 2JFPA 3QG1A 3IRUA 4D6PA 4FHEA 2ZRBA 4CODB 2G0NA 1YGYA 3CLVA 1ZK4A 4GKAA 2JBHA 4LHZA 3ITDA 1Y1KE 2X1MA 3J81k 2C03A 2LKDA 3OOSA 2FR8C 5FUVA 2XXJA 4JBLA 4MVJP 4Q7LA 2FPSA 3TIGA 4FWTA 1L9XA 5K6RA 2N1MA 4BFZA 2YBDA 4Z2AA 1I0LA 3AG5A 1LPMA 4OJQA 4REMA 3O8BA 1XVAA 1YUNA 1ZHFA 3DCJA 5G2OA 4BQQA 1EK6A 4RK6A 4O25A 1PT9A 1SCUB 2WPDD 2B5OA 3EWSA 3A6DA 5FADA 5ITZB 4E33A 1SBTA 4M0PA 3VSDA 3ZBPA 2OGUA 1OFVA 3CPEA 2P3SA 4GP7A 4EPTA 3BA6A 2GYVA 1EFRD 3QYJA 1PFQA 4ANFA 4EA8A 4B80A 1YO6A 3JVIA 4DXAA 3R7LA 4HVAA 3H1TA 4OSOA 1H1TA 3UCXA 3CE9A 4RQBA 2YOGA 2ZIXB 3DE7X 4D8WA 4WK0B 3JR7A 3N3AC 2FAXA 2PGJA 5I9MA 5KWSA 4Z53A 1F0PA 4YJ3A 3CH4B 3VPCA 3W5SA 1XWIA 3CNNA 4UMVA 5FFFA 2WV7A 3RJTA 5IVKA 2Q9BA 4AZVA 2XMDA 3GXOA 3WNCA 1CZKA 4C1BA 2VATA 2PA3A 4DTIA 4YRMA 1C3JA 4F2WA 1G41A 2MJLA 3FB1A 1I10A 9ATCA 5T3YA 1RP1A 4JNKA 1M34E 3C3BA 2MSCB 1DAKA 1EESA 4P08A 2ODPA 3NATA 2GEJA 1B6RA 5ALYA 1KP3A 2GFIA 1J2JA 4YT8A 2X40A 2HQSA 1UJ5A 1MJNA 1RTTA 2YYAA 4M0CA 5FNZA 3BJZA 4CDGA 3AINA 4AS1A 3U9LA 1CVRA 1UXJA 3NT2A 4AZTA 2ZJ7A 3V1KA 2OYCA 4BXOB 3RQSA 2F3TA 4I2NA 1H1LB 5AI6A 4L8GA 4FZ5A 1ZVQA 2JI7A 4X93A 1N2XA 3H5OA 1JHAA 2A9KA 3NI2A 4HO1X 4HNVA 4L3VA 4RY8A 2BKLA 2OCDA 3HV0A 5IDVA 3DE6X 3JVUA 5JCZA 5K8UA 2VPPA 3V8EA 4EI7A 4LF4B 3U60B 2NTEA 4K0RA 4YCLA 3D3QA 1TADA 4DJTA 2XCRB 3VV2A 3KQWA 5FBZA 3IOBA 1YBMA 4B46A 3N2GA 1LQUA 2D00A 3HNPA 4DLTA 4I4NA 3HBAA 1WY5A 3ANSA 3OT1B 2CD7A 1PEDA 4C6TA 4Y1RB 4ZGGA 5I7RA 2F3UA 3UKOA 2GKGA 3LFHA 2WABA 2WYUA 1DKLA 5HF8A 4IIJB 1KJWA 1QYIA 3RK1A 4L76A 2BZGA 3X44A 2Q5QA 2PKQO 3ASYA 3T0IA 5CB4F 4L50A 1T3GA 3HDTA 2PS9A 3HCPA 1JNYA 4YT2A 2CLFB 4P7FA 1J1UA 2OXCA 1RWVA 1O2DA 3DXXA 4Q9JA 2P2ZA 2H17A 5JH7A 3BUSA 2HWKA 2EFGA 4HNUA 3JWEA 1PLKA 3KXIA 1PR1A 2FQYA 4K9RA 3EH1A 1CG6A 2I1QA 3K0AA 3RYHA 3FDIA 3UJCA 1WBBA 5K8CA 2XVXA 4LBVA 2FPWA 1COZA 4M4SA 1WCXA 4RMJA 5IT9A 4P33A 4X71A 5C7YA 1KMHA 2R2GA 3PQ3A 4AU1A 5JDCA 4HFNA 2H7CA 3GRCA 3ZUPA 3TQHA 1Q7RA 3IJ5A 1QRAA 2JASA 1DELA 3MT0A 2CVQA 4AT1A 4J94A 4YYEA 1IE3A 1LF0A 4EBFA 5CA1B 4LE1A 3R7BA 3N3BC 1SO8A 3OIGA 1W5AA 2P65A 3OPYA 5IDXA 1ZR4A 4ZDJA 4O2BF 5EUMA 1G8SA 3KYJB 4D0SA 2HLDD 1MMFB 4N40A 4NF2A 4UUBA 5DNVA 4QG3A 1P2TA 1Z28A 5IT4A 3HN7A 1V1MB 3BK1A 3HA5A 3ZCRA 1OMOA 4C87A 1Z5WA 2XGGA 1XYGA 4EELA 5JZ9A 4CEJA 3R7NA 4L5CA 4GZ6A 5KYXB 1YL6A 3K1AA 2GB4A 3ZWDA 4MUJA 1ZMBA 3M4ZA 3ZDYB 2AFIB 1W44A 4RHXA 3SQMA 4AMZA 1IXSB 4AS2A 2PFGA 4Z7NB 1KRWA 1MAHA 4YRSA 3OLZA 4YLYA 4U5XA 5CXXA 1O95C 2C07A 1Y4ZA 3GNQA 3WBJA 4GNKA 2Z58A 4YQYA 5JNUA 2K5UA 3B78A 3QQ5A 3FMGA 4HNAA 1Z7WA 3RU7A 1EX7A 1XA3A 1N6RA 3SZ3A 3KUUA 3OQBA 3MBOA 4PYRA 5IBPA 3VPBA 2WAMA 3I9LA 1NV9A 1GUAA 4Z0PA 5HNKA 2WWIA 3DXYA 4KO1S 4P4SB 3GRYA 5KQSA 5KNDD 5AW2A 1QPGA 1Z74A 5JS6A 1G20A 4HNRA 4UTOA 3VUFA 4AKGA 2X0KA 3HR7A 3H2HA 4HFJA 8LDHA 3B3GA 2OESA 1T8SA 2WJVA 4U7HA 4NESA 5JC8A 3X2FA 4YAUA 1EA7A 2Q3MA 1T6BY 3RYCA 3TWOA 4TTAA 4RIHA 3LZ6A 2FF7A 3S99A