5KWJA

M.tb ag85c modified at c209 by amino-ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kwjA00
2PL5A 3C8DA 1QIDA 4AB1A 5A2GA 1WPXA 5AKYA 3W9BA 5DNVA 4W9RA 4JYPA 3TGLA 3R3VA 1H23A 4PSDA 5ALSA 1LPSA 2QTBA 4L3WA 4FWBA 4P9NA 5ALFA 5ALTA 2G5PA 5DNWA 4M0EA 5FLKA 2XMBA 1A8UA 3I6YA 4LYDA 3HACA 5HFNA 2OCIA 1AUOA 4OU4A 4BATA 5LIPA 5AO9A 3AJAA 4OSEA 4DSZA 3LIPA 2XUQA 2C7BA 1Z68A 1DWOA 4XIIA 1IUOA 1UKBA 2DSNA 2YH2A 4F21A 5CURA 4C87A 3VJLA 1XRMA 1QIHA 4ARAA 5AOBA 3QYJA 2Y2UA 4RNCA 2O2HA 4CG2A 5D6OA 3G02A 3TJMA 3DOIA 2XQGA 3FLBA 4DIUA 1ACLA 1G5FA 2OAEA 5IVIA 3FYUC 1UK8A 2WQZA 3FSGD 5LP1A 4KE6A 3O95A 5JANA 3C5WP 3UUFA 5C8ZA 5EHXA 2QMQA 4J0JA 3STWA 4C6HA 3M83A 2C5FA 2DHEA 3WK7A 2WG0A 4GWLA 4X3CA 2XUOA 4FFWA 1W76A 1VE7A 3EQ7A 1HL7A 3ZLTA 4KE7A 4U2GA 3H19A 2HM7A 2QVBA 2ZYHA 1DWPA 5DLPA 3FVRA 1ZGCA 2VT6A 3FOBA 3OPMA 1PJAA 1A88A 3I2GA 1E3QA 2AJ8A 1YAJA 3B3QA 4QDZA 4B0OA 1UWCA 3IDAA 3ANTA 1RYYA 5JD5A 2WFMA 4EY6A 2DCMA 4ZV9A 3EBLA 1UOQA 2GYVA 5BWCA 5EI5A 5JYCA 2E3JA 2XUHA 4AZ3A 5JALA 2C4HA 2CEKA 4XWGA 1CUGA 3U1TA 4J7AA 1IZ7A 1UKAA 3P2MA 4BC1A 3MUOA 1QGED 4G5XA 1BRTA 3JYHA 1AGYA 4LXHA 2HA4A 1XZJA 4GXNA 2WHPB 1MPXA 4RPCA 3PE6A 2XLBA 1RWQA 4BDTA 2PM8A 4OPMA 4DNQA 2OLEA 3WQHA 3W06A 3IUNA 5AI9A 4L72A 3WMRA 4FMPA 2HA7A 4IO0A 4BBZA 5DNUA 1FJ2A 4RGYA 1CPYA 5CH3A 4X6UA 1LPNA 3DL7A 3H1BA 3SK0A 3JW8A 2WG2A 1K63A 1SCQA 4FFVA 5CRIA 5IVDA 5LYYA 1EVEA 2DFPA 2DR0A 5AKHA 1CQZA 3EIOA 1BN6A 2H7YA 5ALJA 4AO7A 4H7EA 5CMLA 3QBJA 1BCRA 4X94A 1MX1A 1TQHA 3O9VA 5AH0A 1JKMA 3FSGA 1F6WA 3R3UA 3HC7A 5JD4A 4DMKA 3DKRA 1DWQA 3WZMA 2JGEA 5I9IA 1GXSA 2WU4A 4BAZA 6YASA 2GZSA 2XQJA 3WL5A 1ZJ4A 1YAHA 2WJ6A 5JAHA 4H7JA 2VEOA 2VJCA 4E46A 3ESCA 4B85A 1AMNA 1K5PA 1QLWA 1VA4A 4UHHA 2XUIA 3D2AA 3X3HA 2JBWA 5A6VA 1C4XA 2OQIA 1WCYA 2XQFA 4KAFA 2XI4A 4FDMA 1ZIYA 3STVA 2DHCA 2CZQA 1AKNA 2J4CA 3VKFA 4OB7A 1I6WA 2PBLA 2ES4A 4XJVA 5ALVA 2BCEA 4EY8A 3CN9A 4DGQA 3Q0TA 3DQZA 1EK1A 3BL8A 3I6MA 1UT6A 3WKCA 1ZD5A 4LYEA 2WU3A 4QWWA 1AQLA 4RE5A 3V1NA 1QE3A 3F96A 4UHEA 3E0XA 5D7BA 4NVRA 4E11A 4EB0A 1XQXA 3ANSA 1DT5A 2RHWA 1CUIA 3FVTA 1TRHA 5LKAA 1MX5A 1VOTA 4UBJA 4X00A 2IIVA 3O0DA 5HQ3A 4G8BA 1E89A 3H18A 2ROQA 1DTEA 5K3FA 3AIKA 2FUKA 1ETHA 4Y2VA 3KSRA 1W1IA 4DMHA 1YA8A 2XMGA 4KEAA 4HXGA 3IIIA 4ETWA 1XLUA 3NGMA 4J0GA 2OPHA 5ISMA 3ZLUA 2P8SA 4QDXA 3BF7A 5AKJA 4EBBA 2JGMA 1YA4A 3D4LA 2QOEA 3G0DA 1EX9A 5HF6A 1P0QA 2Z5GA 2X8BA 1E66A 1O6FA 2XMSA 4EZIA 4KRYA 5AKGA 1JJBA 3O9MA 3VDXA 5AM1A 1LBSA 4OUKX 4AN0A 5JAUA 1JFRA 3DYIA 3IUMA 1CUZA 2ACKA 4QLAA 1WM1A 4QEKA 1UK9A 3KWFA 1VJ5A 4L0CA 4P08A 1QIJA 1A8QA 1DQZA 1JJIA 3C5VA 3ZI7A 2J3QA 2IITA 1IUPA 4PV7A 3OTQA 2O7RA 1DINA 2ZJ6A 2QT9A 5AKLA 5F4ZA 1CVLA 3G7NA 5ALNA 3GFFA 1JU4A 4MXDA 1QTRA 5ALZA 2AJDA 5KREA 4YX9A 2LIPA 3QMWA 2G63A 1XZKA 1YASA 2OCKA 2QXUA 2V97A 4CG1A 2JGIA 3WWOA 1K4YA 3WKAA 1W6RA 5A7FA 4LXGA 2Z8XA 2QS9A 5DJ5A 4J0KA 4KACA 3FYUA 3B5EA 3AUKA 1F0PA 4D9JA 1LGYA 1QIFA 1AZWA 2VAXA 5K3AA 4TVKA 1M33A 1ZD3A 1GPNA 5FOQA 1FFCA 1X2EA 3QMVA 5ALIA 5ALRA 3NWOA 5KWIA 1XZCA 3BJRA 3D3NA 2ONCA 3WWEA 1QO9A 2GBIA 3AIOA 3QPAA 1R1DA 2YYSA 4BZWA 2WG1A 2GZRA 3WKDA 1W4LA 3DEAA 3BWXA 3M81A 3VXKA 3I2KA 5ALPA 5JD6A 2HU8A 2H1IA 1U8EA 4DMCA 1EI9A 1JMYA 1GPLA 2IX9A 5HF8A 4ITVA 3BDVA 4IH9A 5LZ9A 4N5IX 5HKAA 3T4UA 2RIPA 4FOLA 4BC0A 4P92A 1TKRA 4B9EA 1H2WA 1FFBA 2PUHA 2JEZA 1ORVA 3H17A 1XQVA 3I1IA 1XZGA 4HRYA 2H7CA 3AZQA 1U65A 1ODCA 4Q3KA 3V1LA 4BAUA 2WJ4A 2OQVA 4KE9A 3C6ZA 4UHBA 3C43A 4INZA 2Z3ZA 4BRZA 1IMJA 2C58A 3RM3A 4X6YA 4I3FA 5I8PA 4IH4A 3D2BA 1HQDA 3MUNA 3G0IA 4HS9A 3PUIA 1T4MA 3LS2A 5DTJA 1CUAA 5T4FA 1A7UA 4Q82A 1YS2X 3CCBA 1EH5A 4N8SA 5ALGA 4X97A 1QIEA 3VJKA 3ZV7A 4W1PA 4JEIA 1CUXA 3KDAA 3U0VA 2FX5A 2XQIA 2I3DA 3UMJA 4Q34A 4UBIA 3G9UA 7YASA 4H77A 4H7IA 3I1YA 3PDCA 2WHRA 4BCDA 2QRUA 3OC0A 5AI0A 2JF0A 1GKLA 2PU7A 4GI1A 5AKIA 4N5HX 4BP8A 1PFQA 1VE6A 3WJ2A 4F5ZA 3V1KA 1LLFA 4CCWA 2QUBA 1N1MA 1ZICA 1E8MA 2YXPX 1P0IA 1CRLA 3QMMA 3QH4A 4J0IA 1UOOA 1CUDA 4AMZA 4YK7A 2CB9A 4FBMA 5E4TA 3MGAA 2PVSA 4QDOA 3N0TA 1J07A 4BDSA 2HL6A 1IZ8A 5LLSA 4KAJA 5HFAA 5ALLA 2CJPA 4HTAA 3E4DA 3G8YA 4BTVA 1TCCA 2WUGA 4DNPA 3HABA 2Y2VA 1Y37A 5AI8A 1CUSA 4MYDA 2ZVDA 2Y1KA 3UUEA 4U2BA 5HQ3B 2J4FA 1ZD2P 5FP0A 4UFOA 1R88A 1YS1X 5D3KA 3WK9A 4IQ4A 4X90A 3FAKA 3I28A 4W1RA 2HHAA 1DU4A 2XQKA 5C81A 4H7DA 2HADA 2PSFA 5AOCA 1HLGA 2VJAA 1QIKA 5H3HA 4K6GA 3FNBA 3V9AA 5AK3A 2WIKA 3H2HA 4QA9A 5AKZA 5K5EA 1K6EA 4CIAA 2WJ3A 3O4IA 4FHZA 1EB8A 4BZZA 5AHXA 5CH8A 1K8QA 2WFLB 4MWSA 3GROA 5AM3A 1ZI9A 4DNOA 1NX9A 4B84A 4H18A 4G9EA 3BJMA 3IUJA 2ZYSA 2PUJA 4X71A 5HK9A 4A23A 2R11A 1MTZA 1JMKC 4B81A 4EHBA 3W2TA 1UOPA 1L7QA 3GA7A 2RAUA 5DTIA 5EHZA 3R3ZA 4H7FA 4B0PA 5JARA 5K3CA 3HI4A 3ESDA 3HEAA 2RI6A 1FFAA 1RP1A 2C0PA 2EDAA 1VLQA 4C89A 2Z8ZA 2V9ZA 4WFKA 4G4IA 5CT6A 3R0VA 3WI7A 1AC5A 1N5RA 3WKEA 1R4ZA 4H35A 1ISPA 2OGSA 2AJLI 1T2NA 2WIGA 1CLEA 1J2EA 4KJXA 4U2CA 3T52A 4PSUA 5E4JA 1HBJA 4CIBA 1GZ7A 1EA5A 3HZOA 4KR0A 4WFIA 1C7JA 4Y9SA 1R9MA 3PF9A 1XZFA 1G42A 2WUEA 4EUSA 2XB6A 2WTMA 3NOXA 3EQ9A 2R8BA 4UHCA 5AM2A 5JZSA 1U2EA 4G8DA 4Y2XA 2WM2A 3PICA 2ZJ7A 4BE9A 4KAAA 2BGNA 3R3WA 1ZGBA 1CEXA 2VA9A 4OD0A 3H2GA 4O08A 4KE8A 4WDQA 4ZV7A 3R3YA 1LBTA 1Q0ZA 1UFOA 4C01A 5EHNA 4L9AA 3V48A 4OCZA 5IKXA 3WYDA 4B83A 5CT4A 3GELA 1P0PA 1XLWA 1QIIA 5CT8A 3RK4A 4LIPD 1GQRA 1XZLA 3WK4A 3I2HA 1MJ5A 3WYNA 4LHEA 1F8UA 1FFDA 1EK2A 4JUIA 4CG3A 3WL8A 3ESBA 2WUFA 2XUPA 3F97A 4OU5A 2OCGA 1MU0A 4EA6A 5LZ2A 3C87A 2W6CX 3HJUA 5LZ5A 5C8VA 1UZAA 1XRRA 2XDWA 3W05A 1TCBA 1KU6A 2VAVA 5A7HA 4AZ0A 1ORWA 1R3DA 4E14A 4C4ZA 2DHDA 4BB0A 1XLVA 2PU5A 5KWJA 3VISA 1VZ2A 3ICWA 5C8XA 2CUTA 2PKYX 4GW3A 3RLIA 1CUJA 1R50A 1BS9A 3G9TA 4U2DA 3D7RA 3SX4A 1J06A 1WOMA 4JNCA 4UUQA 3G0GA 4HVTA 3IULA 2PPLA 2XT0A 3WK8A 1UK7A 4ZGBA 5ALWA 4RE6A 2JGKA 4BYMA 4EY7A 5EIAA 1EINA 4UFNA 3EF3A 4A5SA 1YB6A 1XZBA 5CXUA 4PQEA 2VJBA 3IURA 4J0CA 3CCCA 3GBSA 3S2ZA 5KBYA 3KWJA 4TPKA 1YCDA 3TRDA 3DOHA 2BUCA 3C6XA 3AIMA 3BDIA 1HKHA 1W52X 4WJLA 1BN7A 3I2FA 5DWDA 1E8DA 1OCEA 4AQDA 4AO8A 1ODSA 4HAIA 2GYUA 3F98A 1BEEA 2V98A 1AURA 3HYSA 4W1SA 4X91A 3PFBA 1ODTC 4DYHA 2I3ZA 2WLSA 3RARA 1LPOA 3DD5A 4ZWNA 2QXTA 5AM4A 1CUCA 4ROTA 4X92A 1THTA 4J0HA 3AZPA 2JGLA 4F60A 1JU3A 2RONA 5AKEA 5SYMA 1HDEA 2PSEA 4CCYB 1EDBA 3C6YA 4P93A 1BEZA 3OURA 3FYTA 2W22A 3NUZA 5HZGA 1GPKA 2YASA 1GGVA 3EQ8A 1TIBA 1QO7A 4B9AA 4XVCA 2XUGA 3DKKA 1TAHA 1XQYA 3PI6A 3L1HA 1VKHA 4BVJA 2QUAA 2HU5A 1HPLA 3C45A 5AICA 2ACEA 4K5QA 2VJDA 4DMFA 4OYYA 4C88A 3C8HA 4BP9A 2PSDA 3M82A 2HA0A 5IVHA 5FPQA 2V96A 5ESRA 2WIJA 2HIHA 1QTIA 2UZ0A 5FV4A 4QLOA 1UXOA 1LPBB 3FBWA 5AK4A 1KEZA 1CUEA 1OXMA 1MO2A 1CUBA 4NS4A 3A2NA 4FLEA 4DSAA 4M0FA 4Y7DA 2I78A 3H04A 5BWBA 5AK5A 1CV2A 4Q3LA 4C4YA 1F0NA 3QM1A 2XUJA 4UHFA 3VVLA 1DQYA 5AK6A 1S8OA 4W63A 4OB6A 3KD2A 4Y2QA 5CTAA 5T4EA 1CQWA 1Y7IA 1WB5A 3YASA 1X70A 4FNMA 3N2ZB 1XRQA 3IUQA 4Q1VA 2QJWA 1SCKA 2ZSIA 4WDRA 4NMWA 5LZ8A 4YASA 2XUKA 1JJFA 2WTNA 4YPVA 2QR5A 2OGZA 4BE4A 3V1MA 2VQ6A 4TGLA 3WZLA 3QZUA 3W04A 4B6GA 5JAOA 3WL6A 5JADA 5ALQA 3WA7A 3KOOA 5FXMA 3L1JA 4ZI5A 4BRSA 2HA6A 4CFSA 2CKMA 4FLFA 1ZIXA 3STUA 1H2ZA 3G9ZA 4GLBA 4E15A 5K3DA 3HLKA 1L7AA 3CN7A 3H1AA 4H0CA 4ARBA 3QVMA 3I6ZA 5EIEA 4EY5A 1L7RA 4X93A 1XKTA 5LZ4A 1QOZA 3FCXA 5ALMA 5K3FB 1MT3A 3FYUB 2Y6VA 5A62A 5IH7A 3HRHA 1CUYA 3LP5A 3G0CA 1J1IA 1ZD4A 3F67A 1EVQA 4Q3OA 2BKLA 5CW2A 2B4KA 3HXKA 4J03A 5K3BA 1LPAB 1X2BA 3DL4A 2XMDA 1GKKA 2ZSHA 2AXEA 1U4NA 2CMFA 3WWDA 3F8SA 2OG1A 3GZJA 4GECA 4UBLA 4QWMA 5LKRA 2Q0XA 5AI5A 4CI9A 3DNMA 1BE0A 1XZAA 2XUDA 1Y7HA 1ACJA 1VA5A 3WL7A 5AIBA 4G8CA 2VTVA 3AILA 4Y2JA 1O6GA 1EB9A 4HZGA 2CBGA 3STTA 4X95A 4FBLA 4H7HA 3WK5A 1YR2A 1SCIA 3WWCA 3F9CA 3BIXA 1QFSA 1G66A 1MN6A 3FLAA 3WJ1A 5AIAA 1GQSA 2QKYA 1QJ4A 1DX4A 3MVEA 5ALKA 1E5TA 1QIMA 2ORYA 4LXIA 1NU8A 2ECFA 2XMCA 3Q8WA 2WKWA 4UHDA 2HU7A 5ALDA 4Y2SA 1WB6A 1IVYA 3JWEA 4CCYA 1WHSA 1B41A 1A8SA 2BUAA 5FUMA 2WIDA 1QZ3A 2G4LA 4XX1A 4AX4A 3FWHA 5EHQA 3R40A 2XMQA 4Y2YA 4WY5A 3ZPXA 5EFZA 5CT9A 1XRNA 2WIFA 5CBKA 4G4JA 3RKSA 5EGNA 4U2FA 1LZKA 1LPMA 4HXEB 3LCRA 3E1GA 3DS8A 4C4XA 2GYWA 5A7GA 3BIWA 1EHYA 2HA5A 4KRXA 3PFCA 3TEJA 3KXPA 3ILSA 4MQLA 4WY8A 4GEGA 2VF2A 1ZI6A 5ALOA 3L1IA 1Q0RA 4GHWA 4I4CA 1AX9A 4FNGA 2DQYA 4K6KA 2OGTA 1LZLA 4M0MA 5T4BA 1FSSA 3A70A 4UBMA 4PW0A 1UKCA 1ZOIA 3ED1A 3O4JA 3BXPA 2HRQA 5JZBA 1DT3A 1VXOA 2ZYIA 3K9BA 1LPPA 2RGUA 3OG9A 3O4HA 2D0DA 3SWWA 5K3EA 1BROA 1MNQA 2Z3WA 2J3DA 4AMYA 4QNNA 4BAGA 1ZI8A 1NU6A 2WFLA 3H2KA 3D2CA 4HRXA 1CIJA 3DJYA 4FTWA 2XLCA 4NZZA 1XZHA 2OAGA 3WWPA 1YSCA 2X5XA 4B82A 4ZREA 2VT7A 4FLMA 3E3AA 4GDMA 1SOMA 2JEYA 4QZVA 5ALUA 2D5LA 2JGFA 4Y2UA 4PSCA 5JASA 4MEAA 5JAPA 1PV1A 2QZPA 3A6ZA 1UK6A 4X7BA 5EIHA 5D3ZA 5FPPA 4UPDA 1E8NA 4AXBA 2NW6A 4IHAA 5JZ9A 2FJ0A 3W9UA 3WLAA 2C5GA 3D5EA 5AP9A 4X85A 4AN1A 5IVKA 5BV7A 3G0BA 2XUFA 4Y2RA 4G9GA 2WSLA 1D07A 1XFDA 3AZOA 4WCVA 2HA2A 3R41A 3O4GA 1CUVA 1TK3A 5FRDA 2X76A 3SC2A 2AJBA 1OILA 2B9VA 4QDTA 5AI6A 4J3JA 2JGJA 2G5TA 3D0KA 4G4GA 5DYYA 2O7VA 2EEPA 4J0DA 1XZIA 2WHPA 4JH0A 2WHQA 3QITA 2K2QB 1CUWA 5C7YA 1H2YA 2GBGA 3ICVA 5DYWA 4PF1A 3PF8A 3WIBA 2XE4A 1XKLA 4U2EA 3ZWQA 2O2GA 3H2IA 2XMZA 2ZYRA 4G1FA 3AINA 2B61A 3OOSA 2B20A 5HK8A 1QIGA 1WHTA 5AKKA 5FDFA 3I2JA 4B80A 1WPRA 2PX6A 4PNZA 5YASA 2HFJA 4F0JA 3S8YA 3AFIA 2VSQA 4A16A 4HXFB 3IBTA 1N8SA 4UFPA 4UBKA 4JYMA 4V2IA 4BTLA 1C7IA 2BGRA 3WA6A 2OCLA 4MJ3A 2XMRA 1W75A 3C70A 1Q83A 5ALXA 4OYLA 4K2AA 5I7UA 3G9XA 2WFZA 4ZXFA 4B7ZA 1ZJ5A 4UBOA 4ZRDA 5AJHA 2JIDA 1KU0A 1H22A 4K6HA 3OM8A 4N8DA 5ALHA 2GBFA 3VVMA 1CFJA 1IUNA 1BU8A 4EY4A 1B6GA 2H9YA 2GBCA 2HRRA 4BCBA 2WUDA 5CT5A 2QJRA 5AM0A 1Q84A 5AKXA 3A2MA 2ZJFA 5ALYA 1N5MA 1QFMA 1SC9A 1JT2A 1VZ3A 1WB4A 4BVLA 1MAHA 5LZ7A 5HCUA 5HKBA 1BCSA 2HA3A 2VATA 4Z49A 4PO3X 3PUHA 1XZMA 4I19A 1XRLA 4MWTA 1DX6A 2XUAA 2HDWA 4DNFA 2BJHA 4DTCA 3STYA 3WK6A 1CUHA 3K2IA 1XRPA 1QONA 4Y2TA 3FCYA 2H7XA 1XQWA 5HF9A 1VXRA 5AOAA 2HFKA 2OXEA 3ZLVA 4QE3A 4BVKA 4S0XA 3C6BA 5J3JA 4OB8A 5AM5A 2WILA 2DQZA 1G4HA 5AI4A 4DLNA 4BCCA 1MNAA 2FJPA 2RHTA 3HSSA 1USWA 2EDCA 2Y6UA 3GUUA 4W1QA 4X6XA 4LKOA 2BAGA 3LLCA 3DYVA 1H2XA 3IB3A 1YB7A 5SYNA 4KYVA 3DLTA 4MQMA 3ESAA 4FKBA 3BE8A 1XROA 3BF8A 1XZEA 1CUFA 3IA2A 3I2IA 5E2IA 1EDEA 4QDUA 1P0MA 5DYTA 3CXUA 1SFRA 2PSJA 1THGA 1EDDA 4Y2PA 3QPDA 1FFEA 3H2JA 3M3DA 1LNSA 1GT6A 2QM0A 1CR6A 5BOVA 4GBGA 4Q05A 3QPCA 1MX9A 5T4HA 2I03A 1MAAA 5ALEA 4MEBA 2O2IA 5CH5A 3WKBA 5FKJA 3K6KA 1JI3A 2PSHA 1XZDA 4WFJA 3R3XA 1TCAA 5E4YA 3STXA 3D59A 3B12A 5JIBA 3H0CA 3DCNA 3LIIA 5JATA 5CXXA 3VJMA 4N8EA 4DM7A 4IH1A 2BFNA 4MYSA 5A71A 2C0QA 3DDUA 3FLEA 1CUUA 2BUBA 3IVMA 5HF5A 4UBNA 1EXWA 2AJCA 4AO6A 1R9NA 3WIOA 3A2LA 4H7KA
chains in the Genus database with same CATH superfamily
2BHSA 2AL7A 4FI3F 4GP9A 4RZSA 4DMLA 2WWYA 2R7NA 3ZK7A 3CEMA 1W0CA 3MTAA 5CHEA 4B34A 4EI8A 2NUAB 3H05A 4H31A 3EAQA 4PO1A 4ZU1X 4BV2A 3D5TA 4ONEA 3NTQA 1KMMA 1CW2B 4RVCA 5LPNA 2HYIC 1U11A 2DERA 4YCLA 1ZCBA 3G2PA 4M49A 2WKSA 1ECPA 1ONOA 3LKZA 4D56A 1BZYA 3W9BA 2PJDA 5DNVA 1RWNA 3MQ4A 4CMEA 3EY4A 4TZKA 1JHVA 1UBRS 2RB5A 2XBLA 5FPKA 1NLFA 5LA6F 5KKAA 4ZYZA 5EXPA 2W6MA 5ALSA 4MV1A 4U9IS 5HRCA 1Q92A 1YC5A 5D2CA 3K9NA 3DXFA 4FWBA 2ADFA 1K8YB 3MUFA 4P9NA 3AEUA 1AMUA 5I3CA 5IYZA 5KNCA 2WUVA 3B5IA 3S1SA 4CKYA 4IMRA 3BXOA 5DNWA 4M0EA 3MHPA 1A8UA 1EXVA 4W6ZA 1J8YF 2GK6A 4GQBA 3AR5A 3V80A 1LBQA 2DY0A 1VE9A 4EUEA 3PG5A 1ZJ6A 4BATA 5LIPA 2AMVA 5AO9A 3AJAA 3L41A 3LUJA 4RS4A 1A50B 2C7BA 1MH9A 1NVTA 1TMGE 2Q5JA 1Z68A 2JAWA 4D4MA 1DWOA 1UIRA 3OBBA 1UMCA 3B85A 1OWNA 1NGSA 1XELA 2H4YA 4R6XA 1O6ZA 1DAMA 1W8IA 2JBAB 3I3SR 3V2GA 4UNRA 1BW9A 4B6RA 3AR6A 1UZMA 3I61A 4JLAA 3ZKAA 2DSNA 4F5DA 1NWHA 4J1TC 2I80A 1UFVA 5BOSA 2PH1A 2C61A 2YH2A 3ZWDA 1DV1A 4Z1OA 4ZEXA 1XRJA 2HRZA 3KAKA 2NVUB 2IH2A 5IM5A 1XK7A 3UAGA 3EOAI 3PEUA 1UL1X 3QRWA 5GVSA 1G4AE 4I9GA 4ZT4A 3UAOA 1QYIA 3DCJA 3N1UA 3TQOA 3PBKA 4D79A 3IV9A 4DC9A 2JFQA 3CVWA 5CH5A 3LPCA 3V4ZA 4XUGB 5LWHA 5D00A 3LY7A 4LXXA 5KO2A 1E9FA 1TIPA 4DZRA 3DOIA 2Q4EA 2ZK7A 3EVDA 2XTAA 1DCFA 4P3KA 4AJHA 2R1VB 4S24A 4A0RA 3ONDA 4L0QA 5DF1A 1M1YE 3OFNA 3RF7A 1SEPA 5JEEA 5IVIA 4F6CA 2DWPA 4LE1A 4XWYA 3FYUC 2WQZA 4JI8B 1TECE 3H42B 4QGSA 2VTBA 1A4RA 2PD3A 3S81A 1YB4A 4OJNA 4W7HA 2BONA 3B1ZA 3JASB 3REQB 3QE2A 5KU7A 4EABA 4KE6A 1RMQA 2A1UB 5DZSA 2Z2ZA 4C3VA 1CS0B 2J7PA 3ABIA 4LRXA 1B8PA 1BGXT 1DIGA 1ZXXA 4GM1A 4I2VA 4GPIB 4YO7A 3UUFA 3LHSA 5C8ZA 4ZTUB 4MDEA 3IVRA 2UUAB 5BV0A 1IXZA 1V6SA 2QJTA 4P0PB 4JY7A 4DLXA 4CLHA 4UTPA 1KIMA 3ZE8A 3HXTA 3STWA 4C6HA 3DDSA 1YL7A 4YV2A 1JQBA 3DHNA 2HMWA 4HRAA 1ZU4A 2J1LA 2ZS7A 3EXG2 3WLSA 4ZT6A 1MQ8B 4HZUB 2COEA 2DHEA 4PTZA 4YBRA 1GNQA 1U5BB 2J0EA 4GWLA 2X7JA 4IDEA 1W36B 1GGEA 4AN4A 3UAYA 4WACA 4B3SB 1W76A 4W4TA 4W8OA 4IKOA 5FB3A 1ZM4A 1HL7A 1NPTO 1LLCA 1L8OA 3ELWA 1NPDA 3TQFA 1U04A 1AQ6A 3H19A 3I5UA 4D0LB 2LDBA 4JVSB 1QVVA 1SK8A 1HEUA 1BU5A 2WSSD 4GKAA 4M7WA 5L95A 4IHQA 5CB4A 3FHCB 1ZGCA 4R6WA 1BWSA 3BEDA 1DE0A 1EQAA 3FNFA 3NASA 3ZNPA 4XASA 4KK4A 3WGUA 5BMOA 3ZDAA 2CFIA 3NPAA 4PONA 4EKGA 1N3YA 3LKBA 1K3FA 2E55A 2P5YA 4KO8A 4Q1AA 2N46A 3SICE 3GCXA 3IEUA 4LMBA 1Z6XA 2YJ6A 1S1CA 2XEXA 2Q8PA 3B3QA 5K51A 2O14A 3PRYA 2IA5A 2ZCUA 4X7PA 3SKXA 5FH9A 3QUSA 2GZ1A 4WPGA 4DE5A 3AETB 1RHUA 3ANTA 3A32A 4UE6A 5KMGA 1RYYA 5JJIA 4UVGA 2WFMA 1U02A 3H5VA 4JBLA 4RADA 2DUUA 2AVNA 4KQMA 1O6CA 3JYOA 3NT5A 4QUJA 4NZYA 3WRWA 1UOQA 5I9TA 3BL6A 5BSEA 1GPYA 3K1AB 4MINA 4AULA 4DMRA 2Q5HA 1J24A 3EBOA 5A4MS 3DV9A 4KIWA 3UKDA 2XUHA 2ETXA 4MIEA 2VRCA 4TUYF 3UAZA 2A9PA 2WWXA 1G8GA 3E70C 3H5TA 2CB0A 2N1MA 1VIYA 3MPOA 5IH3A 1IVNA 3RVDA 3U1TA 3GG2A 3WO1A 5BMVB 5EE0A 3ZV3A 2Y1DA 2ZSFA 3L1VA 4LTDA 4TKZA 4RACA 2W2KB 2Q9BA 5CK4A 1T8YA 2BHTA 3P2MA 4JBWA 3RYFA 3MUOA 3T7AA 3NHPA 1QGED 3OIUA 4K7JA 2TMYA 2J08A 3HRIA 4GQAA 3A1UA 1WDWB 4LX0A 3ENVA 4B3IA 4F7WA 1KQPA 1YDHA 2PNFA 3BCHA 3RUEA 4AJ1A 2FP4A 3G1TA 4DBLE 3EUEA 1ENOA 3AP1A 2WYOA 3SCZA 3SXJA 1VDMA 4YV7A 4WUVA 3SMQA 3SD7A 1T3ZA 1A9OA 3HDHA 2N47A 1T5LA 4ZOLA 1GPDG 3OP4A 1RWQA 2OENG 2C59A 4CDMA 2PJRA 4L8WB 4OPMA 2VDVE 3VV3A 3HXOA 4C7JA 3OEHD 2I91A 1TTQB 2OLEA 4NENA 4E09A 5K09A 3VJRA 4XX0B 5EJMA 4ZI7B 2ZSUA 4PYIA 3DTTA 5DU2A 1JEQA 1EXDA 3COWA 4BJ6A 4L22A 1XTQA 1E4OA 1PBNA 1PLJA 1SG0A 1KAGA 2Z9BA 3BWVA 2OGWA 4KBFA 4MVJP 5TRTA 4IO0A 5HZMA 4WKPA 5HRUA 2YHSA 1FE8A 3WP1B 1J8VA 4XRRA 1B1AA 3TDNA 1PBTA 1SC3A 4KC0A 5CH3A 4B17A 4WOCA 1Y1LA 1MC8A 5EWJA 4Q7QA 4IAOA 2VP0A 4IOLA 4HZIA 1PFGA 3SZRA 2Y4OA 1C7QA 2QDKA 1D7OA 3RREA 4ES6A 2B5VA 2VTKA 1ORHA 1G59A 1W581 3F1KA 3LCMA 4K8OA 4LCJA 2OO5C 3JQ7B 1KR5A 5DNCA 5AVUA 3O2JA 4PCAA 5B6JA 4C5BA 5CDUA 2GDZA 2H54A 4RGQA 4P34A 4P36A 3TB6A 1H0SA 1NWCA 3QQPA 5DHQA 4P4UA 4A8JA 4HYQA 3X2EA 1DAHA 1G16A 1TQHA 1MX1A 2Q5IA 2R48A 1YDGA 3FSGA 2PVCA 2P9CA 2CVZA 4TRMA 3VSBA 3L0PA 4P5DA 3DKRA 1J70A 4ZTZB 2TMKA 3CNLA 1UBUS 5E9AA 3M33A 1T1GA 1WU8A 3KNZA 5FD8A 1OFTA 2X9NA 2ZKLA 2CDCA 3BHNA 4BAZA 4MGIR 2DWQA 4AG6A 4HEHA 4G0XA 3CZPA 1Y81A 3P2KA 3RT7A 1OH8A 2V9CA 1BKYA 2GZDA 1QORA 4QTUB 1T9HA 4IFEA 4R84A 1KFCB 1O8BA 4LOAA 1UC4B 5FYQA 4P31A 3I72A 3TQRA 1CNFA 2F43B 4XQGA 5K2OA 4B3TB 4CLDA 3RU3A 4UD6A 3GD5A 4AJLA 3RAPR 2E49A 1RDFA 4FONA 2GZAA 1NRWA 1VC2A 2ZE8A 5JAHA 1P6QA 3EISA 4LRTB 4D0NA 2LTAA 8GPBA 3E15A 1E7YA 1I51A 3EXEA 4PCLA 1KP3A 1QCCA 5CYFA 3RYTC 1YZLA 1K5PA 1M1UA 3SS8A 1ISFA 1S2DA 5DLYA 2CJWA 5IPFA 2ZBUA 3DE6X 3ZW7A 3K32A 2ZITA 3RVKA 2W2VA 3DKPA 4BO4A 4DRXB 1SXPA 4HAXA 1YTUA 1ZD8A 4DNXA 2QQ0A 4EJFA 1HV8A 1C4XA 3CLUD 4XD7D 1S8FA 2P6PA 4JEHA 4FB4A 3A3NA 3AOGA 1U1GA 2VYCA 2XYPA 2ZDGA 2WE7A 3VU9B 4EF6A 2XYHA 1V1RB 2YWHA 1GV0A 4DQ0A 3DT9A 3RVJA 4JB3A 1NBAA 2X23A 3CNBA 4Z7JA 4PIMA 2VTEA 3JQEA 1P6XA 3MJCA 4MWDA 4R98A 5EMJA 5E9WA 4DCGA 5G3ZA 3L7MA 1FIUA 2PBLA 4YQYA 3IDQA 1B42A 2CVHA 3OCZA 4AP9A 5LBIA 3TAXA 3S1LA 2VYNA 3H97A 2RGNC 3DT6A 4CM9D 4ETMA 2OV4A 3UCEA 5A5GA 2NQ2C 2JAQA 2YV3A 3IPRA 3RV3A 3U39A 4DG5A 1DHTA 1QH9A 3HBLA 4DGQA 3AK4A 1MDBA 2PAAA 3HYCA 2FYTA 1EK1A 1QBGA 3I6MA 5AOVA 2BYTA 1JAYA 1UT6A 3Q98A 1ZD5A 9GPBA 3AHEA 3E5MA 1XOIA 2WU3A 4X8MA 3KKZA 4U0KA 4RE5A 1D09A 1MA3A 4DLBA 1MO3A 4V0LA 3V1NA 5HKOA 1WCIA 1B1CA 4N54A 3C3CA 3HU3A 5FAXA 1U0JA 4FS3A 3SHFA 4NV3A 5EZQA 2G04A 2RC6A 3SLRA 4DBLC 3P5SA 4E11A 4ENWA 4QJ3A 2YX1A 3MRSA 1SXGA 2FMHA 2Q1WA 4RA6B 1LLQA 2DX7A 3LBFA 3RHFA 4RD4A 2E6UX 1ZOOA 4YXWD 4IYJA 1BX1A 3I58A 4P7GA 1SXHA 1GVHA 1VOTA 5HQ3A 1OH7A 1NBEA 3RC1A 3T94A 5T41A 4JX9A 5KNCD 3EUAA 1F5SA 1NTRA 5EIOA 1C4KA 4N3CA 5BW8A 1BJRE 5IU6A 1R74A 1M74A 3QPUA 3QI7A 1E94E 3VI4B 1P72A 1TT5B 4HQLA 1P5HA 4RK5A 3E9NA 5DI9A 1R10A 4QBIA 4C0KA 2C9DA 1LF0A 5FHQA 2FUKA 1X1RA 5CG1A 3W5BA 3FZQA 2FR1A 1GUYA 5KIAA 2BMEA 2FW8A 2A9QA 3KSRA 4YFVA 4DWWA 3VX3A 3VTKA 4P32A 4PSKA 1S9DA 1XO1A 5ED0A 1V0JA 1JDPA 1HSOA 1YA8A 2JKYA 3PS9A 5BY2A 2BE7A 2O05A 2Q3MA 3ZHOA 4NENB 2JJMA 5E3JA 1FY2A 2ZT8A 4FZ3A 4DV2B 4J0GA 1L5YA 2BHRA 1FMJA 1JL3A 1DAPA 1Y5NA 1GSAA 5B37A 1QQ7A 4U5QA 3GPCA 2IHYA 1EXNA 1SVNA 3NHAA 2FZWA 2O23A 3ZLUA 5D3MB 1IBSA 3D8BA 1IMOA 4D96A 3Q8LA 4FB5A 2MU1A 4Z53A 3LX4A 3VRHA 3D3WA 4IHJB 4MVJI 3QE0A 2DPGA 5LJLA 1EX6A 2P3SA 3K09C 2OBLA 5K8VA 3SQMA 4EBBA 2HEGA 3MWYW 2OBNA 4NNOA 3LXUX 4P38A 2F17A 3O5AA 1AKUA 3TJZA 5BYAA 1WO8A 3T5BA 4CJXA 3KKMA 1UJCA 1TTTA 1NZFA 5IAJA 2G6BA 2Z5GA 3VR6H 4QECA 5ECYA 3KZNA 4Y0NA 1E66A 1O6FA 4YT5A 5B1DA 3OI7A 2W83A 1ZUWA 4U39A 3SC6A 1E1RA 4EZIA 5HJ2A 2FZ4A 2R8EA 3AHFA 2BFBB 2LDXA 4IRXA 3RG2A 4KRYA 4CE6A 1SCAA 2DKFA 3A9SA 4DV4B 3AUAA 4QEDA 3DMYA 3RYHB 3LT4A 1IJEA 4BNNA 1GNSA 2ORWA 2A14A 3LQ4A 1PHPA 3TRFA 5TS2A 4YP9A 4LZWA 5DI3A 2JB9A 2QIOA 2OP1A 3AETA 3L0BA 4V0OA 4C1NA 2AN9A 2B1QA 3P9XA 2F8TA 3G6WA 1Z74A 3UWSA 2JFGA 2FFRA 1LJLA 1PZFA 1O3YA 3B3JA 1KGDA 2X9GA 2YV2A 4Y98A 2BGTA 4H9GA 5IHXA 3KQUA 3VVBA 2ZRLA 1CERA 3KBBA 4R1PA 2OYCA 1Z4QA 1C9YA 3SSOA 1M34E 1CUZA 4AMBA 4BQSA 2PZEA 5DM1A 4HEA1 2RH5A 5COBA 3V4SA 1DBRA 3KWFA 2A33A 1VJ5A 3HKEA 2GPBA 1A8QA 1DQZA 3WLJA 3NLLA 2HSEA 2XWQA 3IUBA 2QRQA 3CX3A 4J29A 3OIDA 3FKJA 1KPHA 1U7XA 2C5LA 4OI2A 4DLWA 2DY1A 1RI4A 1CB0A 3CVOA 3DB1A 3ETJA 2VPXA 3E9QA 5F5XA 4TN5A 5E3HA 4D9CA 4JWKA 3P20A 1DAEA 3TE7A 3UH0A 3EXG1 1E3IA 2HWYA 3C85A 3FUCA 5IBRA 1H65A 3ZU3A 5KDOA 3Q8XB 2X8WA 3DXZA 3RABA 5KTNA 3FVQA 4KG7A 2VCEA 1T24A 4I8XA 4TKUA 5AKLA 2QQGA 4KDFA 4G01B 3A1FA 1S3GA 4YECA 1XF9A 5BV8A 2A4MA 3AR2A 4F85A 4ALMA 1B0AA 1DEAA 2DHRA 2LWIA 1SNYA 4MWZA 2J3IA 2YQ5A 2PWYA 3EMKA 4FJ0A 1CJMA 2ZBFA 1TM3E 5LWQA 4Q3EA 1EUCB 3QMWA 1FQWA 1Y6QA 1YASA 5AUQA 4PTYA 4Z4GA 4IJVA 1CY4A 2P4EA 2V97A 4CG1A 1GEGA 1HEIA 4HY3A 2JD1A 1RXSA 2IYAA 2POQX 3K0EA 1YJ8A 1M6YA 3ER6A 1XVIA 3NRBA 3SBDA 4EEXA 3FVVA 3T5PA 1HYEA 2Z6QA 1HR0B 5A7FA 2ZPAA 3DZIA 3IQHX 4BQFA 1X86B 1PWXA 2VF4X 3MWLA 3ZVKA 2XHEA 1IAVA 2ZUBA 4KWEA 3JQGB 4II7A 1GL7A 1R6DA 2QS9A 2ACVA 5MN5A 3A4VA 2OO3A 4GM0A 4BO2A 5M5BA 1DELA 2PR7A 5IM4A 2GAOA 3LUDA 2ZIFA 1T4CB 3FYUA 3JAKB 4WJKB 3WYFA 2JIBA 4L6CA 3AUKA 2WK1A 3C16C 5GP1A 2Y1FA 3PV0A 2PS9A 1VGVA 2JASA 1IOVA 4TXMA 4WEOA 3HJGA 2CBXA 4HLUA 5BWNA 3IQWA 1IHPA 1JSLA 1WTCA 1WU7A 4G0ZA 1Y98A 4HJXA 4O1IA 3CVYA 3T3HA 1CZHA 1UDCA 2I6UA 1FFCA 3NTRA 1R7RA 3BN3A 3C6QA 1XDBA 5GJCA 4JP5A 4DQKA 3RS8A 4CGYA 1U6KA 1IM8A 4OQQA 3W8FA 3GFOA 4GWKA 5ALRA 5AW3A 4BGIA 1NV8A 5KWIA 3BJRA 4IEIA 3W34A 3COZA 5BSMA 1O77A 3E8SA 2IKQA 3R7AA 3Q9NA 1SVIA 2YRXA 2JI6A 2QD2A 2Z83A 2KX7A 1FP1D 4L02A 4X24A 2IS6A 1R1DA 5HUQA 5BSWA 3RH0A 2XEDA 2HIAA 5GJWC 1GCUA 4JJ8A 1OB5A 1M8PA 3OOJA 4ND3A 3OETA 3T7JA 4X6LA 3I34X 1KL7A 5JROA 2IE8A 2DUMA 2PZAA 3QKRA 6ADHA 1K9VF 4FEGA 5J58A 3JXEA 1R15A 3WKDA 2RHMA 3CLSD 4DRXA 1YA6A 1OBVA 4MDFA 2ATEA 3DEAA 2JK1A 3ER8A 3MTDA 1BA3A 2IGTA 5I6DA 5EZYF 2RJNA 1A97A 3H9BA 2EBWA 2WSYB 1KDPA 3C8MA 4HLUC 1L3BA 4X7RA 4DIFA 3P71T 2WKRA 3RR2A 5C7OO 2P68A 4ZQFA 4CHGA 3F78A 5DW0A 3BT7A 1U7ZA 2VNKA 1NVUQ 1Y8RA 2VP2A 3DWFA 1ZK1A 3G68A 3GCZA 1P1RA 1QTNA 4WECA 4E5DA 1PYGA 4BLWA 4RH1A 4NZPA 4A8HA 1SZPA 5JNWA 1EGHA 1VBFA 4JFRA 3SM9A 5IMBA 4G0PA 5CDGA 4XD2A 1YOBA 4ITVA 2P9ZA 3FDIA 5JTUA 4P7BA 3B6ZA 3EVEA 3G0HA 3BDVA 4IH9A 1YDMA 2XE8A 4M7OA 4HX5A 1X42A 2HO5A 3E7XA 1TM4E 1XCGB 5EXSA 5EZ5A 3T4UA 3M6VA 4FOLA 3A1WA 2EYQA 3LSYA 5EIBC 4G2NA 4ZI7F 1TKRA 3KKQA 5I4KA 2XCRB 3TIIA 3UATA 3AM3A 4IDCA 3L93A 1M9NA 1FYVA 4JWTA 4ZT7A 3ZUPA 5A6SA 3SYKA 1PS0A 2W6QA 3GAZA 3QE3A 4ZQCB 3TM4A 1YIDA 4YCDA 3BC1A 2AT1A 4UVEA 4EMUA 4Y9UA 4RTMA 1FUEA 1U0BB 5K20A 1U3DA 2J6HA 1XQVA 2EYUA 2NMVA 2ODAA 2FEMA 1K86A 1Z4IA 3AR9A 4BNUA 3IEXA 4C5CA 1ODCA 2C3MA 4LNUB 1C9MA 1DKMA 2BMAA 4RSGA 3KJQA 2WVJA 3GBPA 4TKVA 2OVFA 5IEJA 3VKWA 2OV1A 2QLFA 4ND8A 2CHVA 5E6RA 4KE9A 1KVSA 4DR2B 2J45A 3GCGA 1I4DD 1U2SA 2F3TA 1QRSA 2JRLA 4CIWA 1UAYA 4KIJA 3FFXA 3C43A 4INZA 4G5GA 4CT5A 5ABPA 3ENWA 4CF3A 2ZCVA 2CJWB 4RF3A 3TW4A 3PNLA 4E32A 5HIKA 1NM5A 1M6VB 1YZTA 2C58A 2RG1A 1EUYA 1DMSA 3FYDA 1AA6A 2I6FA 3RVPA 4IW3B 3V8BA 1X7WA 2D13A 4HPXB 1GUBA 1NUQA 2CZGA 3K35A 4TXHA 1VHQA 1JG1A 1KNQA 1CR2A 4TZTA 1EJ2A 2MJLA 4ZI7A 5C8YF 4IH4A 4M0PA 1KR2A 5C46F 2JFZA 2IYFA 1JDBC 3G0IA 2QD5A 4KRGA 2UKDA 4HS9A 4ZO4A 1NJ5A 2GBPA 4BJ3A 4DA8A 5BQXA 1KNXA 5HOEA 1XPRA 5B1HA 2R84A 3L18A 4JAVC 3QWBA 2YVAA 3IMFA 2IYTA 4G85A 2PFSA 4KVFA 3W77A 1GAXA 5JOQA 5CEFA 3IELA 1PU2A 3B82A 2FUNB 3DBHB 4P35A 5EE5B 3K0AA 2CLSA 3H11A 1ZMTA 3I0ZA 5T4FA 4JYAB 2BJWA 4BZQA 3DF7A 1D2MA 4WCDA 1X15A 2VA8A 3FWPA 3LOPA 4Q9HA 5CA0A 1LSUA 1QIEA 4RHYA 4NOLA 4W1PA 1EVLA 1G20E 4HEA6 4LZJA 2XIJA 2O2CA 4COKA 5K0BA 5KPDA 5J63A 4UD2A 2XJ4A 3K70C 2AOVA 3AO0B 3NORA 1XFAA 2HPVA 3T95A 4Z3OA 2F8MA 3U0VA 3AEKA 1IBMB 2ETVA 3P7MA 1BVUA 4EEKA 1SVKA 2V8BA 3F8WA 3PXBA 1HDXA 3M1YA 2MSKA 4AQ7A 3ASUA 3L7YA 2XB2A 3B1KA 5L45A 3SHQA 3V3TA 4XCXA 2EP8A 1BYIA 7YASA 4F2GA 1SVLA 1P2UA 1PR0A 1Z5UA 3KSBC 4PBSA 5A3VA 4JROA 3ZZTA 4BCDA 2QRUA 4LYGA 4E03A 1ULTA 1WQ4A 1ZUHA 1VHTA 1NI5A 5AI0A 4FUQA 4GM4A 1U0OC 3R3HA 5AKIA 2HSWA 2A59A 2W93A 4LHVA 5CEEA 1F8YA 4PQFA 5I7RA 1PFQA 3AHCA 4ZJZA 5HTOA 3AF6A 1Q7BA 1HL3A 2Z58A 1FB5A 3VR5D 4DL9A 2Q1YA 1P2DA 3MTEA 3U26A 4RPIA 5FOUA 3H2SA 3V1KA 3GMTA 4RL6A 4L5IA 4XUEA 3D6MA 4XPIB 1FP2A 3MGGA 4BWYA 1X8JA 4IOKA 4DREA 1TU0A 2W2QA 3BHMA 3FPFA 1N1MA 4MRVA 4R16A 3T0IA 4HN4B 4J0FA 3U4CA 2NWQA 3AU8A 3ULKA 3ZE7A 4JLSA 2C8LA 4ADSG 2QSUA 1MIOB 4G5FA 5FR2A 3VTZA 2HRCA 1TB4A 2H2GA 3HCNA 4TTRA 2RGEA 3EPPA 4YK7A 1YC2A 2BEWB 4V38A 5DHAA 1U1IA 4URXR 5CFNA 1QU2A 2C8VA 3O8OA 2Y1OA 3H6HA 3N0XA 2C92A 5INTA 1VCMA 4DR4B 4D9GA 4FDAA 3FOAA 1NUUA 1D1TA 4PG8A 1COZA 3DNFA 4RJ2A 5I9MA 4E31A 3LDAA 5FUQA 4D6PA 5K01A 3QXSA 1KYWA 1ZN9A 1M8JA 4N7BA 3EYWA 2GAAA 5CK5A 4HO1X 3T3PB 1J07A 5I45A 3FB1A 5DN6A 3WS7A 4A0GA 1YB5A 2DFKB 3KLOA 1YBMA 2VNJA 5JHGB 3OQJA 3L4JA 3GJXC 2AQIA 3F46A 2GXQA 1CY1A 4R41A 5HFAA 3JSAA 1GXSB 5CU7A 3MGBA 4RMHA 1MV5A 5GZ3A 4QXMA 2YVQA 2FTKE 1MT0A 4QRHA 3B3AA 3HKDA 4JJEA 4HGNA 3CPEA 4XR9A 4ASUA 3AJ9A 3AHIA 3UUEA 721PA 4U2BA 4CKZA 2J4FA 4BKMA 2NSJA 4ZK6A 4TLDA 3TX2A 1FL9A 3GFGA 1DPFA 1RMTA 1YS1X 5D3KA 5ENDA 3C14C 4RYDA 3WK9A 5CAEA 1YFLA 4GKJB 4X90A 3GIWA 5U4QA 3TNYA 4NH4A 1PSDA 4Q47A 3P0HA 5C81A 1NE2A 3GZNB 1XNJA 2RI0A 4H7DA 4I6JA 4D80A 3ZQ4A 1I5EA 5KTSA 2ZDHA 3TSWA 1GO2A 1P2VA 1UWVA 3CR8A 1HLGA 1JU9A 1XD2B 2VJAA 3HCRA 3HN2A 4LN1A 5EMMA 5JVDB 3UJBA 3V9AA 1PW7A 2CFSA 4MR7A 3VGJA 5KKCA 1TF5A 5FBLB 1J7KA 1E63A 5B36A 4HUQA 4YAUA 2Q99A 1VTKA 4JOCA 3HBAA 4P98A 4C0HA 2R1UA 4C4SA 4URZR 4BEBA 1N9GB 2YS6A 2FZKA 2QI9C 2I34A 3BBPA 2AKYA 3D6FA 4QJ5A 1N1EA 1ZL2A 4REMA 1R0SA 4M8KA 2V59A 3RUFA 3WGGA 5K5EA 4G26A 1DL5A 4IIBA 4ARZB 1TKBA 4D8UA 5LR6A 2XWJI 5KUTA 5ER6A 5LLTA 3GLGE 1GAJA 4TWZA 4BZZA 1K8QA 2WFLB 4Q4JA 1GL6A 1SGWA 3U6BA 1EMDA 4PCUA 4QUGA 1YDEA 2FEPA 2NPIA 3BWBA 3BD6A 3GB9A 3X1ZA 3LWNA 2OC4A 5AM3A 1XZPA 4BNDA 3PFIA 4FWTA 2DPHA 4Z3DA 1X87A 4PGMA 1ZRHA 1V1MB 3JQFA 1RSZA 1H85A 3LVFO 4BFWA 1QQ5A 2WKPA 3BJMA 2IOYA 3MOGA 4NBVA 3FJ1A 4LQCA 3P9NA 5T7BA 1MZPA 2W2LD 4X71A 4TKMA 2XY4A 3PUVA 2UYYA 3DE5X 3HGMA 1N2XA 2BSAA 3THYA 2BTQB 1DJLA 2LGJA 4A23A 1YR9A 5BWOA 2Q45A 3AEUB 3INRA 4MA0A 2AEJA 3FBTA 4EHBA 1ZL0A 1UOPA 1I1NA 2IW1A 4Q21A 3WB1A 3LUGA 1BEUB 1W35A 2E48A 3MCUA 4OKSA 4PAOA 3C98A 2X4GA 2RAUA 4ZQIA 2VCYA 3HPRA 1H2RS 5EHZA 1OWMA 1VJ1A 3WRXA 5EOVA 3ZLBA 4B0PA 1ZJJA 4XWWA 4D6XA 5IAAA 1U90A 5K3CA 5AK0A 2JDID 5HDBB 2JKZA 1S02A 4DF3A 3GJ6A 1O9GA 1G41A 3F5MA 3JQBC 2GKGA 3HUUA 4ZQEA 3WB0A 3CRRA 4JUCA 3PX7A 4BUJA 1X14A 2QRVA 1YJBA 2EDAA 3ACCA 3CGWA 4NK4A 2Z08A 1ITZA 2DLDA 1VLLA 2R0QC 3ESQA 1C2TA 1XJWA 2Q4TA 3HFRA 2YJ3A 3ZE2B 1JXAA 2JHAA 2V9ZA 2Z1MA 1TLTA 1NXXA 2IUFA 2C9YA 1I6LA 5JWOA 2CLEB 3VOSA 1NY6A 3NBXX 3PD0A 1XL1A 2FY8A 2I9PA 3JQGA 1L5VA 1K97A 4DZTA 1O97C 4INAA 1UJ2A 3Q7PA 4WMLA 5D5HA 3S70A 2ZZNA 3M5DA 4XJSA 4XOUA 4B4UA 4YJ3B 4E2ZA 2AZXA 5EXDA 1PJ2A 2XDAA 4YRQA 2WIGA 1L4EA 2QJOA 2C8JA 1JX6A 4GZ6A 2DKOA 2FHSA 1J2EA 3L6UA 3LFTA 3NALA 4W9NC 4KJXA 3SDBA 4O63O 2DETA 2N1BA 4YIKA 3DAGA 1UWKA 4N6GA 1QJCA 3FI0A 1CEYA 1M7GA 4HLQB 2NYUA 4ME6A 3SYNA 2G8LA 2H1FA 1D2GA 1QVWA 2DPXA 2JI9A 2XNHA 4PZYA 1ZGAA 4ZDKA 1SXIA 5FPTA 4MR8B 4PN3A 1KOLA 1SUBA 4CMEC 1MC4A 1IN6A 2YCBA 2X86A 5BN5B 1KEWA 3LZ6A 4NBSA 1UAGA 5D1NA 1PL6A 4WFIA 3WGNA 1EK5A 1NR1A 1R9MA 2IEDA 5EWMB 5TE9A 3RTCA 1FFWA 1XDUA 1EVZA 3PF9A 2JIMA 1DRVA 3OIWA 1XZFA 4UMFA 3TTYA 5A4KA 5TS3A 4X65B 4PSVA 4EUSA 1PSZA 3A1CA 3I37X 5JCXA 1QK5A 2JC3A 2GO7A 1R0BA 2KBEA 1K5GA 2WTMA 3QVGA 4MRPA 4ALJA 1PYOA 2VH5R 4GSKA 3ZD6A 4QL3A 3SEFA 1UM8A 3KEMA 3RSQA 2O1EA 3OQ1A 4MUMA 1F5NA 5JZSA 4IWXA 1JFLA 1FFXB 4KGZA 4G8DA 4BE9A 3PICA 1Z4OA 1DIOB 3JWPA 5FV7A 3VGPA 4EYGA 3DPUA 2BZGA 1JHRA 3HE3A 4OLJA 3HVUA 1LW6E 1Y7TA 2ZE6A 1VECA 4ZVNA 2XXBA 4MAFA 3A7DA 3FX2A 4YGYA 5DCWA 4DOMA 2R97A 1A8PA 3IP3A 3H2GA 1KI1A 2CNLA 3K8YA 4OD0A 5EP3A 3R3YA 3NBZC 1WXIA 4D3XA 4DAEA 4U2KA 4BY9E 3O4FA 3NAQA 1UFOA 3BFKA 1Y8CA 1Z7EA 5TMDA 1KWKA 5EHNA 1I33A 1IK6A 1N0UA 1V7ZA 2XT9A 5JG7A 3U5TA 4L5JA 1HTBA 2IYZA 2EX4A 3MAGA 4M38A 1EWQA 2OD9A 2VSYA 3AH8A 1DGQA 3WYDA 4B83A 4BGVA 4ESOA 3FYHA 1TU4A 4WNCA 1KQGA 3HK2A 2XVXA 2FN8A 3Q7QA 4KPUA 1Y7LA 3L8EA 4AY4A 3EBPA 1G3MA 4X1KA 3DMHA 2ZRBA 4K9PA 3RJMA 3EVBA 3CLKA 1PRYA 3EXIB 5CT8A 5C5DA 5KCZA 2IH4A 4TSKA 1NLMA 3EGOA 4ZYYA 4V39A 3TLMA 3L8YA 1GQRA 3L2OB 1CVRA 4DCNA 4WHMA 4HB4A 5LQCA 3U1BA 2ZSDA 3QVKA 4RULA 1GCGA 1ULUA 2H4HA 4BWVA 1P5ZB 1JNXX 1TD9A 3B78A 1NHGA 1P7VA 2B8EA 3SNKA 5LUAA 1KJWA 4P0QB 3GLFA 1U1EA 1AT1A 4RQUA 1PWEA 1SK9A 1O0BA 5CVTA 1VL1A 4WEQA 3REGA 2C2GA 4MP8A 5DPMA 3WL8A 2I5PO 3PJFA 1TEVA 3WGJA 4CNQA 2WUFA 4R9SA 3GLQA 4OBWA 2PFGA 1MU0A 2PMWB 1QH8B 5DLEA 5IAGA 1Z4PX 4EA6A 5I7SA 2BBSA 1UODA 4E21A 5LZ2A 1FP6A 3EPLA 1J25A 3NAMA 4DFDA 1BE6A 1QCDA 3H4VA 1CK4A 3CKYA 3KOZA 4PWYA 4DDTA 1SCNE 2QTTA 1U9CA 1PQ4A 3IOMA 3ZGLA 3O8CA 2YWCA 4TRJA 4V0NA 1L4GA 4KO2S 5EUMA 4RDHA 3TMKA 3GZ4A 4F3RA 5CNKA 3HU2A 4MS3B 2DTDA 2ERCA 2ODQA 3W05A 4LDNA 1KU6A 4CG0A 1J8QA 4LDPA 4AZ0A 3WHIA 4BASA 1ORWA 1PEYA 1X6VA 1T2UA 4EA9A 4E14A 4MS4A 4HV4A 1M83A 3HVRA 1ESMA 3IESA 4TTQA 1J21A 5FBRB 1OE0A 1XLVA 3IP5A 4E6EA 5KWJA 3F74A 3KG2A 1C7ZA 4DCMA 4S1WA 2PBZA 4EO9A 3H11B 4QQRA 5TVKA 3VISA 5BWLA 2B83A 1RQGA 2RGAA 1TZBA 4XDGA 5G4LA 1R8XA 4B3JA 2Q3BA 4EVQA 2QMYA 5C8XA 3TZEA 4ZO6A 5CB0A 2CUTA 3CX7A 1FTWA 1KPGA 3ICOA 1FYDA 3NXSA 3PR2B 4L7QA 4KGDA 1AS0A 2P67A 1GU0A 4I0WB 1DMRA 1YE8A 3R5XA 4IDGA 4ND4A 4U2DA 3V6LA 3G5MA 3QMPA 4MPTA 4OF4A 4WBNB 2OYSA 4B2PA 1O9HA 1ZKDA 1HT2E 2Q8QA 5IDYA 3IULA 2PPLA 2C95A 3B9BA 3TZCA 1SKUA 4OHVA 2IUUA 5T5QA 3RFTA 2R6FA 3TOZA 3V6MA 4B3CA 1ECCA 1R4NB 4TMYA 1E7RA 1MCZA 4PGAA 3HWWA 3S2IA 2RGRA 1PE0A 1AUVA 2V5UA 4TT8A 2WSSA 1JRLA 2XNDD 4EY7A 1AKEA 4N7RA 1YJXA 2XW6A 4IRUB 4ENTA 2ZJ8A 4UFNA 3N8DA 1YB6A 1I30A 1ISIA 4PY2A 2C1XA 1VKOA 3T7EA 4BXOA 5FWYA 3CJQA 3KS9A 1G0OA 2OB2A 2FWPA 4LYFA 5KEIA 4J0CA 3GBSA 5IAEA 4YRNA 4A0HA 4WUTA 4U5XA 2YNMD 2NUPB 3NTVA 2QLJA 4AKHA 1UDRA 2OUIA 1Q77A 4I9FA 1GZSA 1IQPA 1KDOA 2BUCA 2P7HA 2R8PA 3DMTC 3EZ2A 3OLCX 2O8FA 1V11A 2H4ZA 3COSA 4KXYA 3C6XA 2D2FA 4DABA 1N6LA 4WXYB 3EXHB 3PTAA 3MINB 4LMAA 3ZX5A 4MWEA 4J0QA 2DM6A 4ZGWA 1R0KA 5DWDA 1E8DA 1OCEA 5LQRA 4AO8A 1ODSA 1FPQA 2J87A 1WBBA 1V43A 2UYCA 3PIRA 3UGJA 3KFVA 1ZK0A 4XB6B 1A71A 3T0FA 2VNSA 4E7PA 3RROA 2DUNA 2ZJOA 1FBTA 2UUPA 4LGVA 4Q4AA 5DHRA 3LT5A 3X1JA 1NJSA 1E58A 2C2XA 2GCPA 1RVDA 5HNKA 4JI2B 2E89A 2VTBB 1ODTC 2HBYA 2I3ZA 5D6NA 3RARA 5LC1A 3V00A 1P5FA 1R0LA 2X13A 4BHTA 3K1YA 4ZWNA 4Y30A 4TZ0A 3LQYA 2PKCA 3UJHA 1FNNA 3KOMA 3FUXA 3DLCA 3PUJA 1Q95A 3T7IA 5DISB 4NJEA 2YWXA 1X80B 5KTPA 2J5BA 1T9DA 3TGPA 4F2HA 1R00A 4P4NA 4CKBA 4J0HA 3AZPA 4I3GA 3ZD7A 2XDYA 1MC5A 4K9SA 5JUWA 4ZCTA 4F6RB 3JQ8A 4XLLA 3ZDFA 3FJYA 2ZSEA 4E1BA 2PD6A 4S1TA 3PQ7A 2HOQA 4UHJA 4AJKA 4F6LA 2QY6A 2AI3A 3CPSA 4RZXA 2I3GA 3AL3A 3BH0A 3ZWOA 2QRVB 2E18A 5SV2A 3WXBA 1WSAA 4PICA 2PSEA 1DAKA 5HIMA 5L3SA 2E5WA 2YJZA 1N6HA 1EDBA 1DIHA 4S1OA 4QODA 1P1FA 4KX5A 4PX3A 5ITSA 2ZB3A 5JLJA 1B8UA 2FEWB 2W22A 1M34B 4KDEA 3U2QA 3EAFA 4OH7A 3ZY3A 4Z99A 3J81k 1JQDA 3UKJA 3EDRA 3EY9A 3U7QA 2P27A 1EE1A 2H52A 3DR3A 1GGVA 5CUQA 3ZW8A 1U3FA 2AD1A 3C7AA 1G18A 3KPWA 4C7KA 4HCJA 1QO7A 1TUBA 3HBFA 2A5FA 3DQQA 1QHNA 1DKNA 2C5HA 4X41A 2G9UA 4R1OA 3ABQB 4FSDA 3TVDA 3CUVA 4AECA 4EFKA 1NMQA 2YHUA 1L7PA 2BGMA 4DLPA 2QUAA 1DZ3A 1U0TA 2GUGA 2EX1A 2FQQA 3ROMA 2G88A 2PGAA 1HPLA 3M9LA 1A3CA 1NMSA 3KQKA 3T5GA 5BNTA 2D1FA 3WLEA 2VJDA 1EE9A 4RFLA 3HJCA 1RXIA 5DTRA 1H4QA 3R7WB 3E1SA 5TT0A 4L7VA 2G0NA 2HA0A 2YWBA 2ZYDA 5D86A 2YTZA 5TX7A 2EFCB 2C82A 3CKMA 4HAZA 3GHHA 5ESRA 5FBZA 3MIZA 1ISRA 2C20A 1QTIA 2WIJA 3NHYA 4C7VA 3NONA 1L5LA 3NX4A 1MB0A 2B8WA 3KAQA 1UXOA 4ETIA 2IEYA 1RM4A 4L27A 5DSZA 5B1EA 2CV2A 3I83A 2O3UA 4GMKA 3VAZA 2C9MA 3C5EA 1KEZA 3MCVA 2ECKA 4YMHA 1C9DB 1OXMA 1OKKD 4NBRA 2NG1A 1MB4A 3PZRA 1E4VA 3M4JA 1CZLA 1XXHE 4EK9A 3CY6A 1FNCA 1VIVA 1CUBA 3HKCB 1THMA 4L75A 4RWZA 5ES3A 4FLEA 3RJ9A 3ADPA 2JLWA 3PD1A 3RHSA 3OZGA 3ETDA 3PR3A 3CZAA 1I3NA 1PNTA 2XA9A 3A1VA 3CUWA 4QUBA 4RC9A 3V1TC 2OZLB 5A4FS 2WYHA 5T8KC 1Z7WA 4MDYA 5BW5A 5KX5A 1H66A 2AYZA 3IHLA 3OOWA 1EZZA 1RKQA 2J0VA 5F9FA 1NURA 1ZWKA 1WPQA 1E69A 5IJZA 3GLUA 2D4AA 2I76A 3ZEIA 4ALNA 3USCS 2G7MC 2JFXA 4QIHA 4WBXC 4ZU3A 3NZEA 1O95D 1X38A 2B98A 4DW8A 2HNAA 2NOAA 2A2ZA 2BCJQ 4W63A 2OZEA 2DR3A 1KJZA 2QJFA 4WCFB 1RXVA 5DV9A 1XBTA 4C2UA 1M8FA 5CTAA 1F2UB 2C2HA 1HK7A 1QZUA 4MUAA 5T4EA 3RJTA 1CQWA 2ZDQA 3AUXA 4D74A 5EJEA 1ZHOA 1GSOA 2K4MA 121PA 4LJYA 2GN8A 1IDOA 2P41A 3I32A 2B25A 1QHHA 2Q5FA 2R25B 4GPAA 2FG6C 1SHUX 2DR2A 3WFJA 1N78A 3TVTA 2OV3A 3OOEA 5CITA 1QX4A 1ZPDA 1QU3A 1AHNA 2OFWA 3CPJB 5LZ8A 3AB3A 3EIEA 2B82A 2QGNA 3CSSA 3DSRA 4YASA 2FA9A 2SKDA 4N82A 4OQ4A 3W1VA 4YQZA 3JSXA 3AKCA 5HE8A 1CEQA 1QXSA 2HWKA 2GCOB 3BRQA 3SFVA 5CDFE 5KVSA 1YULA 2QR5A 1XTKA 5B6PA 1ICEA 1HT1E 3U3RA 1A77A 4B6GA 2PL9A 4H3SA 2WZBA 3KLBA 1N2GA 1Z5GA 3O21A 5BYJA 4DWOA 4RK1A 3F5DA 3FSEA 1ABFA 4WZAE 4MAAA 3TOCA 4U7PB 1T36B 3PA6A 4FN5A 4RZQA 2VDJA 2FEOA 5FXMA 3VTFA 3L1JA 3HB5X 2REXB 4JB2A 1EBFA 3AUJB 2RK3A 2HA6A 221PA 3KUCA 3IVAA 3QVTA 4FYWA 5I3ZA 4FLFA 4QYIB 1VDZA 2NAFA 3BWCA 2RBEA 4GQIA 4IHJF 3TN7A 4I4TB 4KMOA 4WBNA 3V8PA 5DM70 1TX4B 3C1AA 4XM1A 1ISHA 2O0LA 2DJ5A 3WBFA 4YC7A 4LI0A 1GLVA 3I9FA 1T5BA 4E4YA 2HH9A 1SU6A 1YZKA 2CHGA 4GLBA 3WRVA 1F1BA 2Z4RA 3GUZA 1DQPA 5LSAA 1JH8A 1OU0A 2ZBQA 1VG9B 3PQ4A 5HTKA 5TJ9A 3IPCA 1ULSA 3UYKA 4BX0A 4OQXA 5J1SB 3QVMA 4XOIA 1E2NA 3I6ZA 4UM9D 2DBVO 2R7KA 4EY5A 1WW2A 4BFCA 1N2SA 1NW3A 2A9OA 3K2QA 2VJOA 1E79A 1L7RA 5AVKA 3IVXA 2IZ6A 3RGWS 1UAAA 3IP8A 5LDGA 4AXXA 1S1MA 4MVJD 1Y9JA 2MHCA 1L1FA 4UTOA 2VPTA 3V4FA 4C4RA 2Q0HA 3PVSA 3EFOB 1GWNA 2R1TB 3GRZA 2ISSD 4K28A 4F5EA 3QELB 3AV0B 5BSHA 4PBTA 2YDYA 4E51A 2Z5VA 1E6UA 5IH7A 2FSSA 2OCBA 4DLYA 1GDTA 3F67A 4NFSA 1ZU5A 1B0UA 3NNSA 3UN1A 3OM1A 1KO8A 3FHTA 1KMIY 1DLIA 2I6QA 1DBPA 4ZC1A 5K3BA 2C7QA 4J2OA 2WVGA 2GF0A 3GNSA 1JA9A 3GT7A 4HDNA 1X2BA 1WXQA 2YQZA 1OLXA 1SUPA 1GKKA 3CURA 1H94A 2ZSHA 4D57A 3MN1A 1Y9DA 2HWUA 2H1SA 3GPLA 4ZGBA 2VCHA 5ICMA 1T3SA 2I2FA 2FOLA 3IMEA 1VJDA 3F8SA 4B3FX 1M2EA 3WV4A 3H3FA 2I2AA 4GMDA 4LRUA 4OHUA 3GA5A 2PK3A 1ATZA 5TR9A 2C31A 1Q0PA 5LKRA 2AOUA 1L5FA 2GN6A 2BPOA 1YKGA 2GZMA 2HXGA 4KW7A 4CI9A 1F1JA 2C83A 4JN6B 1T91A 1RRVA 1EK0A 1G20A 2QX7A 1C0EA 1JBEA 4KXMA 4N5DA 4GL2A 1JLHA 4GEKA 4MX8A 1OHHA 5A5DA 4RXUA 2X2OA 4F5YA 3WL7A 5JMWA 4GH5A 4EWLA 4G8CA 4KNWA 2VTVA 4TQUS 4D02A 1K0FA 3HKBA 5KTRA 5CFRA 3MMPA 2VEDA 5TXGA 4A36A 1JIKA 4IDNA 1EB9A 2BFOA 1CJVC 1ABEA 2G9NA 1I4EB 5FFNA 2AKAB 2FW1A 3NIWA 3K0FB 4L74A 4Z9YA 5IF9A 1M1YA 1QFSA 3BIXA 1ZYUA 3MC1A 1MN6A 3FF4A 2G9ZA 1F4VA 2QKYA 4GXQA 5IKEA 1NC1A 1QJ4A 1PIWA 3EXHC 4NONA 2YYAA 2YDXA 4TL9A 3C48A 1IHOA 2ECFA 1LK5A 2A58A 1X7XB 1V48A 3Q8WA 4PLHA 2ZTLA 5IARA 6PFKA 1YFJA 1J5EB 2O8CA 5GZ6A 4AG5A 2X0JA 3LF2A 1JQJC 1JLMA 2QLLA 3W3AA 2B5OA 2YWFA 1KAOA 3I6BA 3LDFA 4D9KA 4IDHA 1WB6A 4DMMA 3JWEA 4Z4FA 5JBIA 1QPZA 3UHFA 3HCBA 1ZK2A 4KFTA 4KFCA 3M4XA 2Q6IA 3KQOA 2TSYB 4MV4A 3VQTA 4JZKA 2RBGA 2XCSB 1HG0A 1U2DC 2INGX 2PN1A 4C06A 1SOUA 3DLHA 2H2DA 4IXWA 1D1SA 4GPBA 3ZDXB 4WK4B 1XAGA 4QG7A 3ICEA 1OWOA 3D7SA 4ZXPA 3BXGA 3MJHA 1MA0A 1TUBB 3PC3A 1OX5A 2CF5A 3PQ6A 2OKCA 4H1UA 4P5PA 4R5HA 2FPGA 4EDFA 1V11B 1SHKA 3L7KA 4BV3A 2GQ0A 1DFGA 2ZUSA 1P6UA 4JLBA 3KJFA 3VOBA 4RZIA 3U1VA 4D8TA 1AMOA 1NXWA 3ZWBA 2CXUA 2EIXA 2FF7A 2FZGA 1OYOA 2X9VA 4F4UA 2PJZA 5B3AA 1ZXBA 5T3YA 5BUQA 1Z4NA 2CJXA 3MB5A 2MSNA 3FWHA 5EHQA 1JWBB 2EW1A 1E4EB 1OROA 2XMQA 4GFDA 4C0SA 5KYXB 4XYBA 1ZW6A 1QKIA 1DO8A 2D0IA 5EFZA 3ZPXA 4AZTA 3BMQA 4MUKA 4JSYA 1ZVJA 4C3OB 7REQA 2PH7A 4Y1EA 3PNSA 4CM8A 4NYIR 4NESA 1U8TA 3FRJA 3QG5A 1RI5A 1WZEA 2RHOA 3V4PB 3IXQA 4EAQA 1ECJA 1Y1SA 1M66A 3MINA 1A7KA 4JX8A 3EW7A 3LCRA 4JKOA 1KZYC 3E1GA 1H1LB 4GX1A 5E2BA 4E6PA 1BOFA 3MB8A 3V8VA 4YRRA 4BO7A 3N2KB 3QE4A 5TGZA 4AX8A 4X44A 4UCWA 3HBNA 4CEIA 3K0AB 3TEJA 1RRKA 1O54A 1NVEA 3JVEA 5JZOA 4RJJA 2H1OA 3QNWA 3A31A 1QV7A 3N7UA 3OESA 4WY8A 1PD1A 5FOWA 4BJ1A 4FGWA 4WOKA 5DBOA 3RS0A 3ADBA 1VMKA 3BWYA 4FYMA 4UUOA 5GWXA 3M4ZA 1Z62A 3H5LA 5JS6A 1BSVA 4UCXA 2RHGB 3BH7A 5ALOA 1KAHA 3WIEA 3GOHA 3ZVMA 2A35A 1Q0RA 3ZCUA 4GHWA 4DT1A 3I04M 5D7NA 2MIIA 1S8NA 2C57A 4MOWA 4HPWA 1GRRA 3DLAA 3CKLA 3QX3A 5F7XA 4HNAB 3M6AA 4IILA 4ZI2A 2SNIE 3Q6MA 1QBKC 4TTAA 2DPYA 3NWBA 2PXXA 3FCCA 4M0MA 5FTLA 1LRJA 2G82A 1FSSA 4ZRMA 1VCIA 5T4BA 3A70A 3KUUA 1UKCA 2W4QA 2RDMA 4L76A 4GLFA 5EPUA 4DCSA 1VI5A 1NN3A 2AFHA 1GVNB 3IRVA 3PEWA 1NSTA 2M6LA 5JZBA 4GMFA 1KI2A 1S3IA 1CF2O 4LCEA 4ZHSA 3K5HA 1VXOA 2ZYIA 3AY7A 4IQ0A 1OLUA 1DXQA 1SIBE 1UBHS 4N12A 2HLNA 4O4HA 4JT8A 3MRTA 5EE1A 4MW7A 1T9GS 5I4CA 2D0DA 2ZBPA 3DQPA 3G0OA 4NQRA 3QQ5A 1YOVA 5BR1A 4BVGA 1X7ZB 1E9DA 2VHZA 4Q39A 4XZ3A 3RYIB 4BAGA 4FQ7A 1XD9A 6REQB 1NU6A 2YWEA 3R20A 2QP9X 1H2BA 1E6KA 4YMGA 1SCBA 3H8VA 4ZAGA 3B6EA 2QL7A 1KSFX 4JVOA 3HJRA 4M9ZA 3FPEA 5T3UA 2A67A 2YN2A 2BJVA 5HKLA 4FCVA 1GR0A 2DP4E 4FTWA 3TR6A 3VKUA 3O1LA 1E79D 3U7GA 5JJ5A 4D25A 4MP6A 1E2GA 1ZJZA 4YN3A 4WLFA 1IDN1 1WUJS 4MW1A 5BSFA 3OF3A 4NNPA 2OFOA 2ZE7A 3K1AA 2ZWIA 1TM2A 2WWFA 3CTPA 1PZXA 5KAPA 1FLAA 1SOMA 1RJEA 3R8CA 2Y1WA 3R6TA 3DC2A 3H3JA 3O47A 1Z8DA 1HSZA 3OTIA 2JEYA 3HCPA 4MI6A 2I62A 4PG7A 1P7PA 5JXJA 4BB5A 1X9HA 3JZDA 1ORTA 2D5LA 5BRJA 2JAOA 2ZR8A 2R1VA 5GAJA 3K9FC 1FMLA 1L3IA 3EIUA 4PSCA 5JASA 3ZJVA 5AW2A 4BMPB 5C31A 3DV2A 2IW3A 5IJ0B 2HLHA 2ECQA 2QYTA 3L05A 5FPPA 2VUTA 4X7BA 5FJIA 4NOMA 5G1OA 2P9QA 4LY0A 5TPZA 2R00C 1QVRA 3QLEA 5LVAA 2JJ2A 1E8NA 4KVGA 3WBBA 1ZOPA 4ZKDA 3QIVA 3SE0A 2VT3A 1ZH0A 3FHLA 5KI6A 1POXA 1TO2E 5BSRA 3EC2A 1JDNA 4AAYA 3QUTA 1SH7A 1VKNA 2G08A 3SSMA 5JSZB 2QVZX 5H59A 3IR6A 4YRTA 6CHYA 2C5GA 3OWHA 3K16A 4QBFA 2IXBA 2JFYA 1GCOA 2KS6A 3PNPA 3AF4A 3T6KA 3ME5A 3ZVRA 5AP9A 3ZHUA 1ZJYA 1AK2A 2VJKA 3DPSA 3AEKB 3P9SA 1XXHB 2IPAB 5EHGA 3W4JA 1Q3TA 4AZSA 1YE3A 2L18A 3D6TB 3KB1A 4GI3A 1XT6A 4B4DA 3OPYI 3IHWA 2H1HA 4Z54A 1A5TA 4LMPA 1N6NA 3OKPA 4RX1A 1Y4ZA 1EBBA 2XUFA 1OHHD 1T9AA 3G0BA 3L6EA 4G1CA 4XJXA 3ZDQA 3OEYA 3QUCA 2FPGB 4G9GA 2WSLA 3FZNA 1KIAA 4X20B 2QTVA 3Q5GA 4P0TA 4E88A 1AKMA 4R0MA 1GITA 1N7IA 3AZOA 1WDLA 4E2XA 2QTAA 2XAUA 4W5NA 3HADA 1M10A 4QXOA 3DZBA 4P4SA 3WO0A 1C0PA 4WCVA 3DC7A 3UK0A 3DEIA 1Z73A 4M83A 3DMGA 3N74A 5D8DA 4BNDB 2GJKA 2VTDA 1ZC3A 2WHYA 5DIZA 2AJBA 2D5BA 2QM8A 4J4BA 5AI6A 2DUWA 2HB6A 3NAZA 1NONA 5AW1A 1F06A 2I6XA 1J33A 3AYZB 1LRLA 3OZUA 4LVOA 4L5CA 4UOZA 5KMGB 1Q22A 5DYYA 4OBEA 1X1DA 2N42A 2O7VA 3G6KA 4OGGA 4P3YA 4Y18A 2A1IA 3BE4A 2ADMA 4BFTA 3VNUA 3OWXA 4DV6B 2XX3A 5EJ5A 1XZIA 1OTXA 1PZEA 2MWMA 1DCMA 2VXOA 4V2UA 3TMYA 3VR2D 1B26A 3UWKA 3DAPA 4GOOD 1HX7A 5JPCA 4JEUA 3EGIA 3K71B 4JH0A 1XN1A 3EEFA 1F8GA 2FPIA 3OT4A 1RD4A 5C8YA 1DAFA 3LC7O 4UW9A 1JHPA 2Q1XA 4MUFA 1L7VC 5JMTA 1WZUA 3GJ3A 4IV5A 4A1FA 3CZQA 3K8QA 1H2YA 2GBGA 3E8MA 1JAZA 4IXDA 4BEJA 1WXFA 4KFRA 2V3VA 4BVBA 3PF8A 1WQ1R 3ZGZA 4J1NA 1JYEA 3HKBB 4BB9A 4RKQA 3BREA 5CD9A 3TTWA 4S2UA 5DN6D 1IFXA 4G1FA 1LD3A 2PAFA 3WAGA 3OJOA 2AK2A 1BMTA 2VP6A 3DZKA 3EULA 2EFYA 2EFDB 1O5TA 1OVMA 1UCFA 3ISJA 1QHXA 3AEXA 2AS0A 4RIEA 5DCUA 4M8NE 4FOOA 5CA0B 1U7HA 2CXTA 5CIQA 1DAOA 3DKIA 4FDTA 5AKKA 4DR3B 4LDAA 3N6VA 5JNTA 3ZY2A 1T9GR 4C2TA 1G7CA 5FLEX 5YASA 1LLUA 4F0JA 4XAQA 3PWKA 3R0ZA 4G97A 4BFZA 1PFUA 2OV2A 2D74A 5HG0A 4L78A 2G4VA 4PLGA 5TMBA 1B8NA 4XFJA 1J5XA 2VZEA 2WYVA 3JWJA 4JYMA 3E35A 3UXMA 1VCOA 2X8JB 4R2LA 4GX0A 4EYEA 1OZFA 3IUPA 2DWCA 3PE3A 1CJUC 3RVBA 3DVRX 4Q4LA 4RD3A 2M6KA 1I0LA 1IBKB 3WA6A 3GLFE 5BVGB 2G7ZA 4XEUA 3WIDA 4GI2A 5D85A 4Y6OA 4OSOA 2XMRA 5GV7A 1EJ0A 1NXSA 4L07A 1FDSA 2JS7A 2P9BA 1W75A 3CNHA 1Q83A 1XTJA 5ALXA 4R1QA 2L69A 2W6ID 4OYLA 3D7NA 3IILA 3IIEA 4OUDA 5I7UA 1PWZA 3ONNA 4KO4S 4ZP1A 1TW3A 2Q2QA 4QAQA 3EWSA 2R4TA 1EFVB 5DP1A 5K4HA 2CK3A 1ZQ1A 3LUKA 2BMDA 2FOIA 3QFSA 4RPLA 4B7ZA 4PXAA 4EHDA 4FBGA 1QOPB 1X8LA 3N07A 2H2HA 5LIRA 5KDDA 1KU0A 1XTRA 2CXQA 1YFZA 2C3UA 2ODBA 2SCUA 2Z30A 2Q3LA 4RQBA 2JARA 2GBFA 2HMUA 4JELA 3BZBA 5ALHA 3WGZA 2IC5A 5DX8A 1IUNA 1BU8A 3TSZA 4EY4A 4I4NA 1B6GA 2V1XA 1EHCA 5IT9A 4DV5B 1A9XB 1JEYB 2P6RA 1JDSA 2W98A 3R3JA 3N2KA 4DPMA 5BNIA 5L40A 2WKQA 1R5BA 1UT5A 5AM0A 2QTWB 3GJ4A 3ZU5A 2IYNA 2PH5A 2EF0A 3KVVA 1UC8A 3A2MA 2YRFA 2MINB 2ZJFA 4TUYA 2O7SA 3HV2A 2IYSA 2VYND 8MHTA 2ZRFA 2YZKA 4XYEA 2IWHA 2BSXA 1KWGA 1L9KA 2QE7A 1SC9A 4WXHA 3EFOA 5EWJB 1Q74A 2BFCB 4MO9A 3WY9A 4B43A 1HZZC 3L8MA 1XD2A 5EJ9A 1MAHA 5HCUA 4KV9A 4I1PA 4OJKA 4RYLA 4A8PA 5EVCA 5DM0A 5AD1A 1TYZA 5J5CA 4KPGA 2IDJA 3FWKA 1P4SA 3NH9A 4K0RA 2HA3A 3KIPA 4PO3X 2IDKA 3K96A 3PUHA 4JQYA 3AGQA 2WP8J 3QSYA 3A0UA 1IHUA 1XZMA 1MOQA 2FZCA 1YIAA 1YOVB 3AWDA 4B87A 4MWTA 3RFVA 5CYGA 2OLKA 3FCAA 3SKYA 4NFYA 1DLJA 4NL4H 4TROA 4DNFA 3KZVA 3CMMA 1EGAA 3KJNA 4FFPA 4E2FA 3L07A 4GOXA 1UZLA 1YD7A 1BJKA 2QVLA 4KXNA 1IXKA 2GXUA 4KZKA 4O2BB 4E5MA 1HUQA 1W5FA 4YAIA 3LHKA 3OT5A 5EMKA 4R01A 2BV3A 4IVPA 4JC8A 4A2CA 4D3FA 2EJWA 3DW3X 1YRLA 3KK0A 4D8WA 1U28A 1CUHA 2CBZA 2AFIA 5A02A 1Z8FA 2QRJA 1XPOA 3AY0A 2Q9CA 5G0SA 2ASVA 3ODPA 3KT8A 4J7CA 2QRHA 1OY1A 1HQKA 3KCQA 4O0LA 4NYMQ 2H29A 3TFOA 4CUJA 1XQWA 4Q0MA 5HF9A 3OZRA 4LFCB 4MS3A 4YXFA 1BCRB 4JB0A 5BT9A 3GIDA 3OLZA 5HWSA 1DO2A 3BFPA 5E4FA 4Z5XA 1D8TA 3UW3A 5C4MA 4CKWA 5J3JA 2G8NA 5BYBA 3ZCPA 4ENUA 5E6SB 4OB8A 4QYTA 1C1XA 2G40A 4L9RA 2E85A 4BLSA 4R51A 4XQEA 3I12A 2ATIA 1E64A 4DLNA 2IVFA 4BCCA 5JR3A 2IBSA 4Z3KA 3PKZA 2HDHA 2N0SA 4YDHB 2AZMA 3DBRA 4F4DA 1ADGA 3EVTA 3LK6A 4BNXA 2NZ8A 3ZS8A 3S68A 2CFTA 2IEZA 3DH0A 1VPWA 1E62A 2Z8YA 3M8KA 2RHBA 1BTOA 1LKZA 4F3NA 1USWA 4R1TA 3VU9A 1GQFA 4BFUA 3RI3A 5L7WA 2IOHA 5EIWA 4U02A 2BD0A 1SBIA 3ZHQA 2CUNA 2G5GX 3KV1A 5FWXA 3MBIA 1K4KA 5I47A 4X6XA 4REOA 1SZCA 4Q5IA 3FCUB 5LB2A 4WTOA 4MQEB 3PITA 2BMWA 1Z26A 2I8LA 1CSEE 1YXMA 3H9JA 3PCTA 5IX8A 1YB7A 3CUKA 3ZE6A 2QBYA 2R6CA 3T4PA 4BV9A 2CWDA 3DLTA 4JUAA 4KYVA 4DCPA 3R9XA 5JE8A 5A4IS 1F9EA 3EF1A 1CJKC 2DTXA 3KZMA 3SYMA 5KSZA 4KPYA 4MQMA 3ILHA 3UXYA 3ESAA 4XARA 3HB1A 3MCZA 5CDSA 1FTNA 4JDPA 1QGUB 3PIIA 2PWPA 3A9CA 1YKFA 1C3XA 3MJTA 3VPXA 2ID8A 4EX6A 1M0WA 3PCRB 3ZQKA 1IOLA 4DJAA 2V7QA 2ZIAA 3PGMA 5KCMA 3UEOA 1T6ZA 2FPSA 2X5OA 1P77A 2Y93A 1FFEA 3GEMA 3H2JA 3QPDA 5DFAA 4US1R 4ANFA 4K0KB 1JVSA 2UZIR 1T35A 5LQNA 4I6GA 3ZTTA 3R24A 2IJGX 3WQSB 4WNYA 5J2UB 3QPCA 4YS6A 5T4HA 3UB2A 4CIVA 4D98A 4BBPA 4YCSA 5IYZF 1THZA 4LOHA 2JLYA 3QLUC 1QYXA 1KXZA 1YHNA 3HXPA 2J9FB 1Y1KE 4IJUA 4WJZA 4Q9LA 3CRW1 4GOJA 1BWQA 1A4UA 3PHHA 4U4AA 2GBLA 5HCIA 1JI3A 1DUVG 1K2VN 2PSHA 4U3JB 4LQLA 1XZDA 5F23A 2JCGA 2MYUA 3R3XA 1H1LA 1SMKA 1MO4A 4H1HA 4OP2A 4DDHA 3D59A 3GDGA 1GP2A 1J90A 1Y42X 2AZ4A 4R1LA 5BR7A 5JIBA 4E4TA 1CZUA 2W00A 5JBNA 1EP2B 2IPLA 4QOSA 3JARB 4QNMA 2PGXA 2ZYAA 1U4OA 2PKQO 2BCGY 1JHOA 3MNFA 1U9YA 3MS4A 4RZ3A 1JV2B 5CXXA