1YK0A

Structure of natriuretic peptide receptor-c complexed with atrial natriuretic peptide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
400
structure length
394
Chain Sequence
ALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Atrial natriuretic peptide clearance receptor
publication title Structural determinants of natriuretic peptide receptor specificity and degeneracy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor receptor
total genus 138
structure length 394
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yk0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yk0A01
4MS4B 3IP5A 1JH9A 3N53A 4LE1A 1Z17A 4RXUA 4JASB 5I4CA 1CYEA 3HUTA 4JOQA 3C3MA 1DJMA 1B00A 4D6YA 5KC9A 2W42A 4MYRA 4F8JA 2JRLA 4IRXA 4ETNA 3L6UA 4EUKA 1PUXA 3F6PA 4Z4CA 3OQMA 1JBEA 2R4QA 1MB3A 1ABFA 3CU5A 1QMPA 2PJUA 3N75A 2A9PA 2R48A 5DTEA 5HM6A 2FW0A 3HM9A 4TLMB 1JYEA 1HEYA 3FFWA 4Z4HA 2YHBA 1DCMA 2MYPA 3H1FA 3QK7A 3W9SA 2GX6A 1A04A 1USGA 2PUDA 4IMJB 2A9OA 2FEKA 1YVUA 3F6CA 1TJYA 2HJ9A 1JLKA 4H3KB 1LJLA 1QNLA 3Q15C 4Q7EA 1EHCA 4W5TA 1BDIA 1FQWA 2E4WA 3MMNA 2FSPA 2B1JA 2ID9A 2N9UA 5KQLA 5JNUA 3HZHA 4OATA 4XLTA 3KS9A 1NY5A 2MSLA 3G85A 4G0QA 2FMHA 3CS3A 1W9HA 4OTZA 2PL9A 2VYCA 2JVKA 5B3JC 4MQFB 1JDNA 2H3HA 1ZESA 2Q5CA 4XFKA 1U04A 4MR7B 2P4UA 4RK0A 4EVSA 4Q6BA 4LZLA 2NZVG 4Z4FA 3CRNA 2L19A 1QP0A 4DN6A 3H6GA 2QW1A 2FTKE 4OG2A 3D8UA 1GLGA 1C4WA 1VRVA 3QEMB 1LJUA 1CEYA 3EAFA 3KCNA 1ISSA 4OLBA 2VUIB 4H3HB 3GA5A 1DP4A 2FMKA 2CHEA 4RSMA 4YWHA 1A2OA 4ZMRA 4D74A 4KVFA 5IUNC 3OMWA 2PUEA 2FEWB 1OXBB 3T6KA 3LOPA 4NQRA 1AB5A 1JF8A 3MIZA 4Z9AA 2FQYA 3O2JA 1MVOA 1D5WA 1L5YA 1DRKA 1JL3A 3F73A 3Q41A 4RY8A 1QP7A 4W5OA 2J48A 1YS6A 3OO1A 1U2QA 1EWVA 4N76A 1P8AA 3HS3A 4WT7A 5KC8A 5EWJA 4MLCA 3N8IA 4GPAA 4ZJPA 1JFSA 3DZDA 4ETIA 4MQEA 4KNYA 5B3JA 2HQRA 1D1QA 3VNAA 2KYRA 2XDYA 1DG9A 6ABPA 4WWHA 1DBQA 5EWMA 4RXTA 2IOYA 1BDJA 4F3TA 3TMYA 3DGFC 2WMYA 4NV3A 4MR8B 3FGZA 3K9CA 4E7OA 3QLUC 2P9HA 3RVJA 1YIOA 5TQ2A 3NNSA 4YO7A 4RS3A 3Q7RA 3B2NA 4JA2A 3OMXA 2RJOA 3G1WA 1FFGA 5EWLB 5IUJC 2CD7A 5TPWA 1LBIA 2QZJA 4PEVA 2RJNA 2TMYA 5DCLA 3HDVA 4XASA 3JPYA 4F12A 3O1IC 3E61A 3H5WA 2F8TA 4Z4IA 1A0OA 4MR9A 4YCSA 5IC5A 3CFYA 1QO0D 1VPWA 3LUGA 1GUDA 2PE5A 5CNIA 3LKVA 5TQJA 1K66A 1M2FA 3CZCA 3M9WA 3O75A 4RXMA 3JY6A 4EYKA 4KRFA 3JVIA 3LUJA 4LDAA 2IYNA 3CKMA 3H5OA 4KQ9A 1PHRA 1K68A 4KV7A 2PUAA 4L4UA 1Z13A 3DBIA 1SXGA 3EQ2A 3EQZA 5IBQA 3QELA 2WB4A 3P9YA 3CZ5A 1RZRA 1QO0A 4LDZA 3LTEA 4MRMA 3RQIA 4CBVA 3QLUA 3HV2A 1RXIA 2HQOA 2JBAA 3A10A 4YR7A 3EGCA 1GCGA 3CTPA 3EODA 3DLHA 2R25B 3A0UA 1KRXA 5BRJA 1EAYA 5F64A 3GT7A 1MIHA 4YS6A 3LUDA 4Q6WA 4YV7A 2QR3A 4MLDA 3RVOA 1USIA 4LRQA 4KFCA 1TM2A 4JB0A 5TE9A 1E6LA 2A9QA 2PUBA 4LE0A 5IEJA 5KQPA 1BVHA 1U8TA 3NNDA 2WJAA 2E4YA 4FE4A 2QVGA 3OM1A 5T7BA 1Z2DA 3N0WA 4IF4A 5DKFA 4RK4A 2MSWA 1U2PA 1R8JA 3JS5A 1SRRA 3N6VA 3S99A 4Y9TA 1NTRA 1U0SY 4MS1A 2HQBA 1DC8A 3KJXA 3LMKA 1ZHHA 3TB6A 1RPJA 3SAJA 4EYOA 1BAPA 1ZY2A 4P98A 2VUHB 2MYNA 2IKSA 3KHTA 4EVRA 3H75A 1PEYA 4RU1A 3KG2A 3Q9SA 4GNRA 4ML3A 3Q7TA 4XXHA 1FFWA 1D2AA 2L2QA 3NNNA 4RY9A 4N47A 1YK0A 3C97A 3TO5A 1QQAA 4KQCA 3NHZA 3IP9A 3ROFA 1DCKA 1MAVA 3E3MA 1P6QA 2ZWMA 3IPCA 2V0NA 3N0RA 1KGSA 5IULC 4Z4EA 1UDRA 3H5LA 1ZDMA 1YTUA 3HSYA 4PE5B 4PZ0A 3RVRA 4ZMSA 1RNLA 3JVDA 3HCWA 3FDFA 5BR1A 5FBKA 3DLBA 2OENG 4PICA 3HUUA 3O21A 5EWJB 3IDOA 4DQDA 3QLTA 1ZAYA 4MQEB 4KK4A 6CHYA 4G97A 4OBBA 3EDCA 1QP4A 2R47A 5EWMB 3CG4A 2FN8A 2HSGA 3QX9A 4RK5A 2I6FA 3QEKA 3GV0A 2PUFA 4S04A 4NICA 3SG0A 1NXOA 2AYXA 2L17A 1EFAA 1DCFA 3CG0A 5C5EA 2JVIA 5TQ2B 1CHNA 3RH0A 2FVYA 4LE2A 1Z12A 3KLOA 5PNTA 3BBLA 4TMYA 2B4AA 4EVQA 5TPWB 4W5RA 3MQ4A 4WXMA 3BILA 4HNSA 4RKRA 1JFTA 3T8YA 3M6MD 1DRJA 4RWEA 4UHKA 3H6HA 1Z16A 1KRWA 2PAFA 2GBPA 4F11A 3C3WA 1FSPA 1P2FA 3KTOA 3GBPA 1SXIA 3LUKA 4QYMA 3H5VA 4MR9B 3OO0A 5JNRA 3KKEA 2NT4A 4RK1A 4O1IA 3M9XA 1JDPA 2IPLA 2LP4Y 3GYBA 5D2CA 4YRZA 1GCAA 1LK0A 1D1PA 3ILYA 1E6KA 4MPTA 3RVNA 4E7PA 3OLYA 3Q7SA 2E4UA 5T3YA 1QQBA 4G0XA 5HQJA 5KQGA 4OLAA 3I42A 1NXWA 3SM9A 2HPHA 3D02A 3GWGA 2GI4A 4G0PA 3EJWA 4KK3A 5CNKA 3QELB 5DGCA 4W5NA 1ISRA 5HSGA 2ID7A 3LUHA 5IEBA 2GWRA 1Z2EA 4MRMB 1YS7A 5FWYA 1NXXA 3K4HA 2O20A 3I09A 1JHZA 5FWXA 4RK7A 2JBAB 1AB6A 3LUFA 3ROTA 5JS1A 3LKBA 1E2BA 1QKKA 3H1EA 4Z0NA 4MAAA 3OLWA 3OLXA 2YHAA 2VK2A 4FB4A 4NCBA 2GKGA 3H1GA 1XHEA 1L5ZA 2JCGA 5IX8A 2PUCA 3BRQA 4KZKA 1D4ZA 3HXMA 5CNJA 5KQMA 4G0YA 2PLNA 3KYJB 4RKQA 3F7NA 1JYFA 1M2EA 5KWSA 4LX8A 2E4XA 4MS3B 1RXEA 3VNBA 1JFVA 1J56A 1YMUA 3C6QA 1USKA 3HVRA 2IPNA 4IMIB 4RY0A 3HO1A 1NXTA 4D6XA 3I5AA 1Z18A 1DBPA 1ZH4A 1ZGZA 1Z26A 3GRCA 4QYWA 5JS2A 4G0ZA 1F51E 4ZYLA 5HKOA 5JNTA 3OLVA 4MS1B 3URMA 1NXPA 1SD5A 3FFXA 3QLVC 4Z9BA 4JAVC 2WWVD 4MS3A 4XARA 5C5CA 1PEAA 4TN5A 3H5IA 5CHYA 5JNVA 1IIBA 3FMVA 3MF4A 3GL9A 5FBHA 2FXIA 1ZVVA 2MYUA 1TVMA 4MS4A 3O74A 2WJWA 5IUKC 5ABPA 3MYYA 2RGYA 4O5AA 2FMFA 2LBPA 3UKJA 1XWWA 2JB9A 4YGXB 4JP1A 3JTEA 2LIVA 1NATA 3HJFA 1WETA 4RDCA 1VLZA 1ZN2A 3OLZA 2F8SA 4KREA 3EULA 2CWDA 5ED4A 1TMYA 3MA0A 3KLNA 5DLEA 2FQXA 1S8NA 2PL1A 2IPMA 3BREA 1M5UA 1JX6A 3T38A 4KMRA 3LFTA 3IP6A 3T95A 3L49A 2E4ZA 2JVJA 4WUTA 2E4VA 1W25A 4HNRA 2NT3A 1EWKA 4PYRA 1PNTA 4YP9A 4N0PA 1JWLA 2LUOA 4XAQA 3BRSA 4UHJA 4HNQA 3UK0A 2QV0A 3RVPA 4ETMA 3QLVA 2X7XA 1KMIY 1NXSA 4G86A 2AYZA 4FE7A 4QICA 3RVLA 4JB2A 3LUCA 4EYGA 3A3KA 2NZUG 4F06A 1P6UA 2RDMA 4O1HA 4N03A 4EYQA 3HDGA 3KSMA 5TPZD 3TD9A 2FEPA 3R0JA 4N0QA 2CHFA 3HK2A 4RK6A 1QPZA 5JNWA 2FLKA 2QU7A 3A0RB 4QPJC 2QXYA 1SXHA 3OQNA 2PUGA 3DGEC 4B09A 4WXEA 2FMIA 2DRIA 4Z4GA 1BA2A 4MQFA 4S05A 9ABPA 8ABPA 3C3KA 1Z25A 3IP7A 3KYIB 4MR7A 2IDMA 1Z15A 4G0MA 5TPZA 4RV5A 3CHYA 2A9RA 3SQNA 4KPYA 4IGAA 3NBMA 5TQ0B 3RVMA 3OQOA 1BDHA 4EY3A 1ZGGA 2FN9A 3QEMA 7ABPA 1TLFA 4N41A 1MB0A 3RVKA 2BGGA 3O2QB 2QSJA 5CNMA 4H60A 1Y1LA 1ZH2A 4IILA 3UUGA 5BQ3A 1ZITA 5BRAA 1VKRA 4EGSA 1DC7A 3H5TA 2NUBA 1M5TA 4RZSA 4MGEA 5E3JA 1APBA 2IPAB 2OQRA 4P1ZA 5FWYB 2ZAYA 3I45A 5FWXB 4L85A 4W5QA 3CNBA 5TQ0A 2WRZA 5JNSA 1NXVA 4WZZA 1EWTA 3RVSA 1FFSA 1XHFA 3O1HB 1I3CA 1DBWA 3ILHA 3OM0A 3QX8A 1H9CA 1DZ3A 3CLKA 1LBHA 1YK1A 2FKAA 3GBVA 5GQSA 2M98A 2LPMA 3MM4A 4NCAA 3LUAA 4M88A 1URPA 2JK1A 4TLLB 3HEBA 1GUBA 2PMCA 3RVQA 2H0AA 1T34A 1YMVA 2PKXA 3SNKA 4G0OA 4ZPJA 4HYEA 3O1JC 4Z99A 4DADA 2MSKA 1C0EA 4YLEA 5KI6A 3FFTA 3IPAA 1E6MA 3JPWA 2FLWA 2L18A 4MR8A 2WY2D 2FQWA 1F4VA 1PNRA 3N0XA 3TX6A 3SY8A 2M1ZA 1ABEA 3O2SB 1RZRD 1OXKB 5GOTA 3NHMA 2MYTA 5EWLA 2QVCA
chains in the Genus database with same CATH superfamily
1JTFA 3IEIA 3RS0A 2H1HA 4G5XA 2I6XA 2VHZA 5K3FA 5I4CA 5JXIA 1W6RA 1CLEA 3PJEA 4WXRA 4CNBA 4IDQA 4YA6A 4KMOA 1KBOA 3A9UA 2BKAA 2IU4A 1YVRA 1O54A 3A1WA 3RSSA 3I05A 2EYQA 1Q77A 4GQAA 4I1VA 1VM6A 1W35A 3LWNA 3UMYA 1ONOA 1KAHA 2YWGA 1P44A 3GR6A 3A6EA 2BEVB 2O0LA 1KU6A 2PRJA 4KLRA 5H4HA 3VR6D 5JPDA 1VIYA 1CY8A 3R3JA 4QUBA 1DQSA 5E9WA 1SCUA 1RZ3A 2A5DA 1JVNA 1WDWB 2AJ8A 3GC6A 3LYLA 4YUVA 4CLOB 1HV8A 1UQTA 4IVRA 1QFXA 1JPVA 2GD6A 1N75A 5DXFA 5B12A 2XB2A 3WL5A 2FFQA 3GDGA 3N86A 3CJTA 2B25A 1W47A 3K0CA 1VHQA 1G8PA 1QR2A 1Z0UA 3OZTA 1MDBA 1KJQA 4KCGA 1M74A 2BY4A 1VBNA 4P0TA 4Q4JB 3E81A 1P61B 4BQIA 5KNLA 4OA5A 2Y27A 3QXHA 2D0IA 4IMJB 1LV7A 3F6CA 3VR6A 5HTKA 2YMMA 3EVGA 4IJUA 1E18A 3RT1A 2QNIA 4S2UA 4TROA 5DSZA 3ROPA 3EIHA 1CYDA 1HE5A 1Z2OX 2DSNA 2V3WA 3T0GA 4ZGBA 2O1XA 9ATCA 1NN0A 2FY8A 1AU9A 3RUCA 3C8HA 5LQUA 2XBUA 1LX6A 4M37A 4PZZA 3Q0EA 4ANFA 3EC2A 2AFIB 4Z4QA 1XQ1A 2FWJA 3TQFA 1EXMA 4K86A 4OTZA 1M0SA 4MCAA 4FONA 2V4UA 5CTJA 5ICSA 3ACCA 3H3JA 2AIRA 3K70B 3UENA 1Z0ZA 2NZJA 3HRIA 5K05A 1JDTA 1E1RD 2FK7A 4L7QA 4OBWA 1PNVA 4TWIA 4DCSA 4RACA 2A33A 2O2IA 2M32A 5DT2A 1TYEB 4DN6A 5K3DA 3ZZ0A 4F9FA 4RA6A 1EUZA 3GEGA 2V3CC 5FR2A 2AOWA 3DMFA 4RQUA 4V0OA 3REOA 3VR5H 2VSYA 2H54A 3ESAA 2QRUA 4YX9A 1ISSA 1DRWA 1OAKA 4H3HB 5EZ6B 3S2SA 3SDBA 3GLFB 1G7TA 4JT4A 4M8NE 2EFGA 3HEAA 1XEWX 2W2PA 4AY6A 3QBDA 4J7AA 4GE3A 2B4TO 4CIBA 1E1RA 2JFXA 2MSNA 2BVNA 3QE3A 2PT6A 4LTDA 2Z3ZA 5E0OA 3WKAA 2C7QA 1P33A 3K35A 1N5MA 3MPUA 1FBNA 1R6UA 5G0SA 4Z9AA 4WN9B 3IP3A 2HHAA 1MVOA 4OO3A 2WKSA 4WCDA 5HFAA 4CRWB 5MFPA 3GPLA 3EPKA 2C8LA 5T4HA 3F73A 4IPTA 4DA8A 1N5RA 2IOFA 4FN4A 1RXCA 3PGMA 1BVRA 4LSMA 1NDUA 4Q01A 4H59A 4UEOA 1M0EA 5KC8A 4E12A 4N54A 4R05A 3BK1A 4HNUA 4DR5B 1JPJA 1XPRA 2FX2A 1B8VA 4CTKA 3SDZA 3VYTB 1XPOA 2NXJA 2P4SA 2R8EA 3ILVA 1IXKA 1XJQA 2A86A 3D6VA 3EK2A 5JIBA 1KJNA 4MCHA 2R6HA 1FK8A 4RXTA 3FTFA 1CHDA 2REXB 3RYFB 1UOPA 2IF0A 2OZPA 3BGSA 4QOEA 1M8PA 3X44A 3HSKA 4IXMA 3NGXA 2DU8A 3IHKA 4ZAYA 4WNCA 3RNOA 2VJNA 2WV7A 1FYFA 1ITZA 2IYVA 3GCZA 3N0TA 3O73A 2I9PA 1MC5A 4IVNA 5TQ2A 3B2NA 1SCDA 5D1HA 4X3OA 1M6EX 4WBNF 3Q8KA 1I5OA 2VN8A 5CBPA 3SNKA 2XR1A 3OFKA 2QZJA 3IS3A 5FWAA 4HGYA 1TK3A 3FJOA 1B6GA 4Q9AA 1VG1A 3QPUA 1IHYA 1M66A 2P2YA 3BB4A 5BQ5A 1GTRA 4DLNA 4FCVA 3VZDA 4KE8A 4Z4IA 2PZEA 1NVVR 2DJIA 2XZTA 3F1KA 3PPYA 1L3CA 4LGMA 4DPLA 4WXYB 2B8EA 4CMGA 5IZCA 4BVJA 4RKYA 4O2AF 3DM5A 4AURA 3F9IA 5DGXA 2VL7A 5JSYA 5T3UA 3R6DA 3WGGA 4KV7A 1K8QA 3WLSA 3UB2A 1PUIA 3L77A 1K3UB 1EB9A 1ZUNB 3TW8B 4UE2A 2XLBA 1SQ5A 3HDTA 5CGQB 3FA2A 3PXDA 3B2QA 1RI2A 1ESMA 3AW9A 5GM1A 4NOMA 4JITA 4OA8A 2HAEA 2PS3A 2VF5X 1UP7A 2PS0A 3GFGA 4EB3A 2DBZA 2G5PA 2P65A 4ENRA 3TOXA 1WWKA 2FPPB 1AV6A 1B23P 4R8SA 1RLUA 1V7CA 1GFSA 1T2DA 1R4NA 3HVUA 1EFCA 3ZWWA 5HKBA 4A8TA 4GH5A 2QMUA 3KTAA 3V7WA 1U3WA 4B9AA 2EIXA 1DAKA 5G0TA 1YB6A 1U1FA 2G1JA 3CF6R 1JGTA 2FPMA 2X7HA 2A35A 1JTVA 3PQ2A 4HG2A 1C3XA 3LUDA 2HHCA 5EFZA 4HMOA 5SY9A 4BQOA 1Z4LA 4G1EB 1VRWA 4YV7A 1NOKA 3K2IA 5IU6A 1SO8A 3E8XA 5MDHA 2ISQA 4YJ2A 2HMWA 3L1VA 1B8NA 4B35A 4GYJA 4G26A 5M04A 2HRZA 1VPEA 4HMQA 4ZCLA 4P36A 3DVLA 2XXAB 4TV9F 3ZCVA 2Z09A 1Q7GA 3FTEA 5AKYA 1V3VA 4E30A 1AD2A 1VLLA 4CM3A 3RIGA 4MQ5A 3TIGA 1IMOA 1Z2DA 4PC7A 1PR5A 2OVBA 3U4AA 2R60A 3BHIA 1BCRA 1XD8A 4Q4AA 5CLGA 2YZNA 3E9QA 3T3EA 1SRRA 2IRWA 5CTAA 4Y9TA 3Q12A 2HQBA 1A1SA 4AIIA 3KJXA 4FCTA 3JVEA 3ZCSA 4OB6A 1GAEO 5LLTA 1VYTA 4UCQA 4B6FA 1WULS 4LHYA 5A6SB 3DOIA 1X7ZB 3H75A 1MX9A 4EUNA 2I3GA 1FTNA 2AFHA 2YVUA 3EFEA 3PZBA 5DX1A 3ZDEA 2VTDA 3LCMA 3OOSA 1J1UA 3C74A 1YR9A 1TZMA 2HF8A 4A8JA 1C9YA 1NFRA 4NCIA 1QQAA 3R9KA 1PIWA 1J21A 1MKYA 2Z9BA 3RSOA 1FMTA 3GVIA 3ROFA 1J2UA 2P5YA 4J1NA 3I0ZA 3QVGA 4IZOA 1EK0A 1FFXB 4EB0A 2GBLA 3IKVA 4HPXB 2XUPA 3N0RA 1KGSA 4PO8A 4NJMA 1P1IA 1IXSB 1UDRA 3ILSA 4P3KA 4R1NA 4PZ0A 3RVRA 3CLTD 1C9EA 3DYBA 1H0KA 1MB4A 1UWVA 2OENG 3B85A 3GRUA 1RCUA 4RJKA 3VC1A 3IDOA 4BVFA 1IHDA 5J63A 1YDEA 2BF4A 2IYTA 2AUNA 5DX8A 1JUDA 3WYEA 2Y77A 1YCDA 2OBBA 1ZI9A 3QVKA 4O4LA 1CY2A 1NT2A 5DCYA 1Y4UA 2I6FA 1HR0B 2C9MA 4MMXB 4RE5A 4I6GA 4XB1A 2A3RA 2HA7A 3GDOA 4QRDA 1SUWA 1E2FA 3CG0A 2Q3FA 2OOSA 3C3CA 3F8WA 2Y1XA 1IN4A 4D3FA 1NUQA 1ORWA 4E31A 2Y0EA 1BE8A 1F8GA 2WV9A 3FRIA 4YDHB 1T3GA 3PLRA 3QOYA 3TTVA 1E5DA 4OHFA 3OUZA 2GXUA 5EAIA 3UYLA 2IHZA 3KZVA 4XR4A 4HNSA 4IQ8A 4JJ6A 4F1KA 4CFSA 1Z16A 3C4VA 3HBAA 3RSHA 4S12A 3ZWPA 3GG2A 4Y1RB 1GARA 2D1SA 4WEOA 2ZRLA 3RC2A 1OFUA 2VP2A 4BBPA 1QWSA 4FGZA 4P38A 3VOBA 4CIDA 2FE1A 4LXQA 3D8BA 3FIJA 4O1IA 2VDJA 1T6YA 4JS0A 3GRPA 821PA 1MD9A 5IYZF 1A9YA 3N2YA 4AKTA 4B2PA 4LYAA 1W96A 3NAGA 2GNPA 4L76A 5ALVA 1ABBA 1T3HA 1C7EA 1TKBA 2BUAA 1R6VA 5HQJA 3ESQA 4TKMA 2XHZA 3NI2A 2E18A 1WB4A 421PA 1JSLA 4G0PA 1EB8A 4AF8A 4TM8A 3QELB 4NZZA 4AL4A 3IQFA 5BVHA 5K0EA 5A0FA 3ABSB 4JI8B 4LMAA 1S6YA 2I6SA 3ZBUA 1NF3A 2D00A 2WMOB 2DWCA 4ENPA 4L27A 1T6ZA 1GZDA 1KKLA 2CXXA 3KSDO 1E2BA 1JEEA 3S44A 3BMCB 1ZFNA 4B6GA 1RHRA 3L41A 4D46A 3OFNA 2QGZA 2FHPA 5U1PA 5HUHA 1NG9A 2VKQA 3SVTA 2VJQA 4IEEA 4Q00A 4A3SA 1WXGA 3RJTA 1E2QA 2B9VA 4JI6B 2JCGA 3B9PA 4R2IA 1TAGA 2IKQA 4KXWA 4K6FA 4JJ4A 4J2TA 4PU0A 5COAA 4E4TA 2X5JO 5F9HA 4UARA 3RTEA 5AOBA 4C2BA 1W4ZA 1ZK1A 3AH8A 2R751 1L5HB 3L4SO 4G1CA 3G2MA 4PG5A 1JJ7A 1M6WA 4YQFA 2ZJOA 4W9MC 2DT8A 3SHTA 4DJEC 5ALNA 2UZ1A 4XRRA 2GRUA 5TNXA 1A8SA 3UWPA 2VA9A 4C4RA 4RQBA 4C4SA 2AEJA 3RTGA 1E7SA 1VSTA 3ZHRA 4R0VA 3GRCA 1OLUB 4MWTA 2JGNA 1LEHA 1UM9B 4MS1B 5CW2A 5ESWA 3CXRA 1CUVA 2AHRA 3G0DA 3ADOA 4PGFA 4QNMA 1H2YA 3FMVA 4EH1A 1TO2E 2OO7A 4N9WA 1HE1C 3MLBA 1UBJS 1CPYA 1K6XA 4XIYA 2FCRA 2JFYA 3V4LA 5KVVA 2CNKA 3MWLA 4RJTA 5ITWA 4O6VA 3PGLA 2DLDA 1TTPB 1L7BA 1MN6A 4RVOA 2QHXA 4MWZA 5ABPA 5B7QA 3K4PA 3EH1A 3BFVA 2WZDA 4PXAA 3MMSA 4L51A 4Q34A 3T61A 3OPQA 1F8XA 4DXHA 3RRXA 3HJFA 1ZN2A 2NM0A 2E5LB 3EULA 1GTG1 2DEUA 1T1JA 2OA0A 4KSBA 1SCQA 5HF8A 2WTEA 3SKXA 10MHA 3L6BA 5JHHB 2AXEA 3F5FA 3O7MA 1HQYE 1U7XA 1EX9A 1WTCA 1PD0A 1HKHA 1Y3BE 1YGPA 4HTAA 3PPWA 2FSVC 3ENZA 1LNQA 1A76A 2DPHA 4Z3DA 4H6PA 1P2DA 5K9ZA 1NPYA 3FPCA 3KZCA 4R1SA 3CUSA 1XTTA 2OHFA 5MGNA 1OGJA 2CUNA 2F3QA 4URWR 3QX3A 1IHOA 4LC9A 5B36A 1PR2A 2I1WA 2QX6A 2ZI5A 3AHJA 1PFKA 1UKVY 4M36A 4OU4A 5DYGA 3A3KA 4FR5A 3NM4A 3IJEB 3RTAA 2Y0CA 3T0FA 3D5TA 1QHGA 5F3WB 3OTQA 3T1TA 3KYDB 4XDHA 1Q2XA 2XVMA 3PC8A 1XCLA 5DT9A 1T9GR 3X1JA 3V1YA 4UM7A 1YV9A 4QPPA 5JROA 4BO2A 3DA8A 4J1TC 4YMSA 3VR1A 3LQFA 4DV4B 4LF4B 3PWKA 5HIKA 1WABA 2AJLI 4XEUA 1FXUA 4O29A 4Z4GA 3KB8A 3R7WB 2D3TA 1YA4A 3MBIA 3FSRA 4X7PA 4XDYA 1GQSA 3FHLA 2HCBA 4DMLA 2EG9A 1QHIA 4Y0NA 2BGUA 1WOMA 4EBFA 1SXJC 1GSHA 1ORRA 1IFXA 1U02A 4Y9DA 3UZUA 1DO8A 2BBSA 2AUMA 2XGSA 4ZVTA 4IGAA 4QU9A 3SVLA 3PZRA 2VXCA 1B93A 3AR2A 3TDKA 2PKWA 1KO5A 1VI5A 2E82A 3TTUA 4EKGA 4CKZA 3FPEA 4ND1A 3TE7A 3KB6A 4BNYA 3U7GA 2PQ2A 2AFRA 4BJ6A 3HM2A 3PUZA 2ENWA 3WBKA 2H4WA 1ZUIA 3L4EA 4L8GA 5BN5B 4DQLA 4J90A 3WFZA 4EY4A 2XUQA 3LYAA 2P69A 2N46A 2O2ZA 5FNVF 2WQ7A 2DCMA 2WTNA 1QJ4A 5FWYB 1EUDA 1KYTA 4OMUA 5IT0A 3VU0A 1Z9BA 2AG6A 1N8NA 1VBKA 3CNBA 4MQ6A 2AN1A 3PX7A 2P91A 5ALDA 1WM1A 4GNKA 3C85A 5E8JA 1EFLA 1EWTA 1P2VA 1ULUA 1FFSA 2RK4A 3D0QA 3O1HB 1ECFA 3EBOA 4B4UA 2H48A 4DIDA 4EHLA 4WBNB 3LPCA 3BWDD 1WSBA 3REGA 3OZIA 4BO8A 3NX4A 5EJ6A 3ENQA 3H19A 3OIVA 4WZBB 5FYQA 2OBXA 1KQFA 2Z6AA 3BD8A 4IJ6A 5CDUA 5EIOA 1TJNA 2CYCA 1G8HA 1ZIDA 3FCOA 4F5ZA 4A26A 4V0MA 3IELA 1ISPA 1OFIA 2GD2A 3JQBA 1Z37A 3DZIA 1IB0A 2YYZA 1OBHA 2YIMA 3JD3A 3VKHA 4A4DA 1TI7A 1QS0A 2XWQA 4LJ6A 1P62B 2H8GA 2CDCA 8ADHA 2JJ8A 4O2AB 3A9VA 1VE9A 4QJ4A 1RZRD 5FR1A 1NVXQ 4YTEA 2I7XA 3EXIA 1P3JA 3NBFA 2W8BA 4DTIA 4D3YA 1C29B 1XRPA 5AW2A 1WLYA 1LW6E 2VNKA 1RLJA 4LJAA 4PZYA 4Q18A 3URKA 1SCNE 3S29A 2HYIC 4HZUB 4WY8A 5FO1A 3ZNPA 5I4IA 4JOQA 4UUNA 1QO7A 3I9MA 4RF4A 2GNAA 4XWKA 1Q1GA 2W42A 1HYHA 1Z08A 4IIGA 1K89A 1KU0A 1KYYA 2B8WA 2A0UA 3AP1A 3C5VA 1MP0A 1L4UA 2FCAA 3E18A 4LDQA 4QYTA 4DIBA 2QX9A 4YP6A 2Q3EA 3ICOA 4ON9A 4HX9A 1H23A 1Z8FA 3CKKA 4Z0TA 2X6TA 3FLMA 4JU8A 4II3A 1PJZA 4H9GA 3INRA 5AJVB 3QI2A 2BDTA 4KXMA 5E6RB 4B6OA 3PKJA 3QMVA 4JWKA 2H1SA 3E8MA 1E1DA 1DIRA 1P45A 4CL2A 1S3FA 3IIMA 2ZRQA 4L74A 5BXYA 2F1OA 1II9A 1LA2A 1PR9A 3PFBA 1QCCA 4TV9B 2G4LA 2Q7XA 4J0JA 4BN5A 1OHHD 1VXRA 2CB0A 2GN1A 1UL1X 4OXXA 3ZDAA 4RE6A 2G0NA 3B6MA 4A0HA 3H1AA 2RHRA 2CJFA 5LOVF 1DJOA 5EGNA 5BSWA 1OXVA 1IPHA 1WBJB 1BFKA 2ECFA 4H3KB 1R6XA 4HWPA 4XJXA 3PXEA 4YFVA 3RS2A 4LVNA 5TS3A 4UHBA 3T1QA 4QUDA 1JLLA 3TK1A 1KEKA 4RTRA 3UMSA 3AHCA 1E5XA 1F8YA 3COVA 4UVIA 1GRCA 5EYPA 3T3DA 4X7MA 3MRVA 4PYJA 5CFOA 2WWGA 3GNSA 1QFSA 2IS2A 3LU1A 3UG7A 1CUXA 1GN9A 3WL6A 2NYVA 4G0QA 1NY5A 4YXWD 1HDZA 1OHHA 3G85A 3GDHA 5KVCA 1J24A 4HNHA 3FFAA 4J0HA 3DFMA 1KNXA 1KK3A 4OQQA 2QNBA 4ZVQA 3UMMA 1N1DA 4NG5A 4OM7A 4YT8A 2G9RA 3A1VA 2JIOA 4HGRA 6YASA 2HBZA 3CVUA 2XCSB 1FDTA 4QTZA 1U5BA 3D43A 4ZFNA 5KOYA 3IQZA 4EVSA 2AH5A 1JBKA 4DEYA 4R1QA 1V0JA 3R6LA 1RE0A 3NBZC 5BR7A 1JKFA 2FSSA 3MPOA 4YXWA 4C5CA 4EG3A 3H8VA 3I2KA 3ONFA 4J2OA 1WXIA 3LDHA 2CJYA 3OWXA 4BGUA 3ORSA 3DVAA 1IJFA 1W48A 4TT3D 3LWBA 3AMVA 1TK2A 4EUEA 4UQLA 3A4TA 2ZI6A 1TO6A 3L9WA 4WCFC 2OG2A 1P1RA 5A4FS 1AB5A 3PDIB 3CF4G 1RJDA 3CNEA 2P9TA 3MMXA 1NRXA 1R66A 2H4FA 4QLAA 3L8CA 4U5XA 2YY6A 5ERGB 2ZWAA 2ZE6A 3QE4A 4AZSA 3O26A 3LAWA 4TT3A 2FPSA 4DJTA 4GP6A 1DKUA 5EJIA 3WJ2A 3V6MA 2OHHA 3GUCA 3KBBA 2ZUWA 3NVAA 5CCBA 3ZIAD 3M89A 4GPAA 3OE7D 3VR4D 4B3MB 1SUEA 4MQEA 2IYZA 2ZYRA 3P94A 4WZBE 2ZJ8A 4XWOA 1C81A 4HXYA 1AKYA 1JH8A 1VSVA 2D74A 4LJKA 5ALZA 5E1OA 5TJHA 1DG9A 3NM5A 1KQ3A 2QUJA 3OCWA 2YIDA 3U44B 3U9LA 2G04A 3G0BA 4BTVA 4ZCMA 1RQ2A 3ND6A 2JGDB 4WESB 1I51A 4L5BA 1IY9A 4X1KB 3KYCA 2GDJA 2JGEA 2XWBF 3FTQA 3KVRA 3P2EA 4NBTA 5G1NA 3ZIAA 1NP6A 2VZLA 2QP9X 3BF7A 1XV5A 3OE7A 3OUUA 1YQEA 3JQ9A 4ZPXA 2JLYA 4PYNA 2ZREA 3ETDA 4P4TA 3WIVA 1SUAA 1FP1D 3G1WA 3F7MA 3ZV3A 3OOYA 1A9RA 2QRQA 5EUQB 1YL6A 3LKDA 1N2IA 2ATIA 3RK1A 4DQUA 1Z28A 2ZR0A 4YH1A 3DWEX 3IE2A 2WNIA 2HTEA 1MT3A 1J20A 1XTRA 1G3UA 2W2MA 2Q07A 2AXPA 1WD7A 4RYDA 2VJLA 4XEHA 5H16A 4UXHA 5IC5A 3A4YA 2W98A 4B4VA 3IIJA 3SIPA 1QYRA 3PF8A 4RXMA 1PDVA 2B7LA 3G0GA 2C98A 4XE5A 3LUJA 1EP3B 1TU0A 3GZNA 4LDAA 5CIYA 2OM6A 2QN6A 3ANLA 4KQ9A 1YFKA 4GI7A 4BNKA 1QTQA 3FKSD 3FOWA 3V7YA 1A9SA 1SXGA 5IBQA 3QFFA 2ABWA 3GIWA 4K05A 1BEZA 1QFMA 1X2EA 3P9YA 3QU2A 4UW9A 1JR3E 5DEOA 1QHYA 1U8CB 4BASA 2BTEA 4MRMA 3QG5A 3VSEA 5DX0A 1M2VB 1UQUA 2QTRA 1D03A 2YWJA 3K05A 1AQLA 1VB5A 2VF4X 1RXIA 3KQMA 4URHA 5SZKB 1JDSA 3ZW7A 1PZEA 3O95A 4JUDX 1IEQA 3E2IA 3F90A 3B1YA 3LL4A 4NR0A 2R65A 3EODA 3DLHA 2Z5LA 4QHTA 3FKSA 5IK2D 4J94A 4O4HA 3UBTA 1LPNA 5CCXA 2HUNA 3SFTA 1WPGA 3K32A 1SK9A 1ULAA 2WWRA 3I8SA 4FW9A 4OQPA 4A73A 4AWAA 2XODA 1G19A 1PNQA 5HF5A 2EJUA 3W6UA 3LJKA 4IZHA 1N8KA 1DQYA 2CF6A 4PZCA 2OCXA 2F3PA 5I51A 1L8XA 3AHFA 3MOGA 5IEJA 5JSUA 4V0RA 5BWLA 2PUBA 3EIUA 3W2IA 9LDBA 3PJGA 4PAMA 2C97A 4X94A 3QUCA 2O8FB 2B7BA 3KQKA 2Y76A 8AT1A 1Z3CA 3ZVRA 1FDVA 3C8ZA 3UIEA 2CFIA 1NVFA 3N6VA 4IYRA 3HJGA 2QRVB 2R9VA 4Q05A 3FYHA 5TJ9A 1WCXA 3Q4GA 1KY5A 2DPXA 3O3NB 1MO3A 1GP2A 5B1IA 1PWHA 3B36A 4ZIRB 4FHEA 2WWTA 5JWRA 4OQMA 2I7TA 4P98A 3GJYA 1VB3A 2MYNA 2VT6A 2I54A 3VHQA 4IOMA 3LG2A 3GLKA 2UZ4A 5C8XA 5DNYB 4C7OB 4KQXA 2TS1A 4XUEA 1GTMA 4QPNA 4XD7D 3TL2A 1YBHA 1CNFA 3U7HB 1C8LA 2QEQA 3BCSA 1ST3A 3HWSA 1ZHOA 4OHMA 1KMNA 4OUDA 4Q5IA 1P9RA 3T4EA 4LHSA 4XZ3A 3DOEA 4QJ3A 1YDFA 3LBIA 4Y18A 3DFFA 4H1UA 4KFSA 1CJCA 4PSDA 2OO5C 3OT4A 4HDNA 4WGGA 1FNCA 4UMDA 5K0GA 4AD8A 3TZEA 5IN5A 2C9OA 4A0GA 1BH6A 1JJVA 1H5QA 1EAMA 2YJ5A 4J91A 2GM4A 3CJRA 3VNVA 4TKVB 1J2EA 2FPRA 4DQDA 5LMCA 1SCIA 4Y7DA 2GZHA 3AFOA 4E03A 3GP8A 1PEKE 4I1RA 4GZ5A 5F2NA 1U98A 2D0DA 1D2HA 1U0FA 3MYRA 3T7DA 2DUMA 3FAKA 1Q0ZA 2A9FA 1LTHR 3ANSA 3LT0A 2P40A 1QZUA 4FMCF 2DPGA 3CRZA 5D5HA 3HKEB 4NZMA 1RWVA 1A8HA 3FZYA 3IYLW 4A0RA 3GD5A 3K1ZA 4TRJA 4DLRA 3ZLBA 4OJQA 4CDMA 4EHDA 4Z9YA 1KIMA 5BWMA 3FY4A 3R5TA 2O1EA 1YI8A 4R9VA 4YNBA 5ICCA 1TUGA 4IAOA 2G7MC 1FSZA 4LI3X 4CG0A 1KORA 4ALLA 5T57A 4DMKA 1JSXA 4TMYA 4W5RA 1FCJA 2QVLA 1UEIA 3B1JA 3CT6A 3CEJA 4UVDA 5LZ9A 1SPXA 4AMUA 1JFTA 1GPAA 2VYVD 3AR6A 5FNVB 3OA2A 2JDID 3DL0A 1CDZA 4GOXA 4I4CA 4MTLA 3P32A 5JZVA 3IT0A 3UHAA 1W59A 3AY3A 4MVJA 3FUWA 4Q9JA 3ZX5A 3FWYA 1XTPA 3BJRA 1G20B 1LSOA 1A82A 4QBFA 5AUQA 5JWHA 3JQFC 2VCHA 4BLOA 5K0TA 1C3OA 3M9XA 2AKAB 1DT5A 1RLMA 2PMKA 3SC3A 3NQ41 4D98A 4WJLA 3AL2A 3MINB 3ILYA 4X66B 2QWXA 2X5OA 2QYHA 2FPXA 5C2JB 4LZOA 1QQBA 4FGUA 2JDIA 3HVHA 3I42A 5KQGA 1UBGA 2HPHA 3PNBA 3EJWA 3F4KA 4J6EA 2DXIA 3ELUA 4PX5A 3TUIC 1US8B 2V7EA 3AEZA 1EMDA 5IEBA 2O1SA 5ELXA 3K0HA 2QE6A 3CONA 4LIPD 4D8TA 4EG0A 4PXYA 4F4JA 1C3VA 5JLAA 2BELA 4AZ0A 2XCOA 5IKXA 3ZHCA 1BMFD 1VHWA 3R7AA 3OLXA 4MEAA 4MROA 4E22A 4RANA 1RQLA 1X0VA 1ZWKA 2H7XA 3AC0A 2LW7A 1SHJA 1JDBC 1K7EB 3J81k 1KO1A 1XO1A 4JLBA 5KQMA 4XJVA 1HFEL 4FI3C 5J43A 2FE4A 3KKQA 2FF7A 2WTMA 4G5FA 3QOFA 4U4AA 1ZD1A 3REQB 2NSLA 3ZXUB 2HU5A 4WKOA 2GOYA 3EC7A 5FUYA 3TGLA 4MVJP 2X0JA 4A8JC 5KYWB 2DUUA 4GVPA 5F73A 4B5LA 1BMFA 1C7ZA 5FTNA 4EPTA 4FMBB 3PIIA 1U0HC 5JE8A 4QYWA 1BROA 1DADA 1Z26A 1Z4JA 2GETA 4YCNA 3M83A 2ZI3A 3WL3A 5JS2A 3NCTA 2XKKA 4ZYLA 2QP3A 4HADA 1N0HA 1N2CB 2F1JA 5IS2A 3L7AA 3U9TA 3UJ8A 4EFNA 1Z8HA 2WWVD 4MS3A 1N33B 1OAAA 4TQ9A 1I3OA 4TOIA 4KO1S 4EABA 4U7DA 3GK3A 3G2NA 3G5TA 3GI1A 4ENUA 3WNDA 3K94A 4A36A 3O74A 3DEJA 1KEEB 4B31A 3MYYA 1FX1A 1MVNA 3TKLA 4EYEA 3DDHA 2FMFA 4IWNA 4B2IA 1NW9B 1ZH8A 4HRYA 1N5OX 1PJQA 2HU2A 2JB9A 2R6FA 4DHWA 2GAJA 3AIIA 3DPUA 5IABA 2VQEB 3LHSA 3CLTC 3NVKI 4JJZA 1VMIA 1OZGA 2JC3A 3DTVD 5ED4A 2JCYA 1UMBA 1K3FA 3CE6A 2R2AA 3PRYA 3DXFA 1GKYA 4PV7A 3L8MA 4B17A 4DLZA 2CE7A 3HYSA 4UBMA 4PAGA 1NR1A 2CXRA 2YYAA 2ZYTX 4KMRA 1PBNA 4IV8A 4X20A 2ROQA 4US0R 2G36A 3IRUA 3W2HA 4HAZA 3CUUA 2VYFA 4L75A 2OV1A 3OQ6A 3W5SA 4HB0A 1MFZA 1GPLA 1MUUA 1VKJA 2XDWA 4MICA 4Q82A 4QTTB 3SI7A 4E70A 5LQAA 4MUEA 3JRXA 2PJDA 1G3MA 1U2ZA 2PY6A 4XJTA 4GGPA 2PXXA 3OT1A 2XMDA 1A3CA 1MAUA 2PZLA 3KT3A 3CO5A 4YQZA 2FFRA 5FEMA 4YRQA 1OJ7A 4B6SA 4KO4S 5CVDA 4EJFA 5DI3B 5GZ3A 1CLUA 1VI2A 3JWIA 3IE0A 4MMZB 3KQSA 4QYXA 1KAGA 4I6JA 4WZAB 3B5JA 4L1KA 4BGDA 5ED0A 3IXMA 2QG6A 4C88A 5DIZA 1X3SA 3L7DA 2EFDB 3BMQA 3OTIA 1JZTA 4MGZR 1GT91 3LPLA 5TSDA 3ROQA 3LHFA 1E60A 3GPCA 4HDMB 4F91B 1SOWA 4TL8A 2VP4A 3KP1A 4M0LA 5AVYA 3NPAA 2GA9A 3CHYA 3W1EA 3WVNA 1G20E 1YHZA 3L1IA 4KAFA 4WY5A 2G5TA 1FFAA 3SQNA 4NZYA 3ND5A 4UTXA 1F1BA 1ZGGA 3U40A 3OM9A 1T0BA 3EHEA 3LQRA 2VZ9A 3EF3A 1HMPA 3H5AA 2I87A 4RCVA 1YB4A 1CU1A 3PUHA 4DEXA 2IXFA 4BNMA 5DHSA 4KUEA 1H2RS 3P96A 4P1ZA 1D2NA 3IMCA 4PZLA 2V5VA 4NQZA 1UC9A 4HEQA 4OYYA 2WD9A 4RGBA 3RVSA 1EM6A 1J49A 1XHFA 2B20A 3T5TA 4PO9A 1Q0QA 4JVMA 5KYTA 3D4IA 3QXCA 1KK0A 3LGXA 3CLKA 4GPZA 5LNK6 1GTSA 4KQJA 4K87A 2M2IA 5FPPA 3EWAA 3UFXA 4B1FA 2FR8A 5IVPA 2NPIA 1OZAA 2X8LA 1HDRA 2ZIAA 1YE5A 1GSIA 2YW2A 4JODA 1IDOA 2C9ZA 1GJRA 3O8QB 2RKOA 1IQUA 1HSOA 1YC2A 1P5ZB 5C8YF 4XWTA 2Q9UA 1QRTA 2B69A 1E8MA 4H7FA 3J81A 1DCTA 4HYEA 1XUOA 5HILA 3TNDA 5KWEA 2YICA 4DRXB 2D5IA 2DQSA 4BO9A 1XTJA 3W5VA 4MUKA 1C8KA 1Q12A 2FLWA 4U2BA 1AUQA 1CJTC 1UBHS 2FQWA 4K3UA 4EJSC 5AVWA 1Z75A 3GLQA 2Y8EA 5HF6A 1EEXB 4KQHA 4TTSA 1QUEA 3TX6A 3X2EA 3ULKA 4IIJF 3R5SA 4CIXA 2B6NA 2AG0A 3EARA 3WKCA 4AP5A 3U4IA 3BXZA 3QTBA 2CHVA 1N2CE 1NW8A 3RS3A 4DC0A 2QVCA 1M8FA 1TYBE 2JGKA 2WYUA 1NX6A 5AVUA 1RC8A 2Z6QA 4LOIA 3N53A 3BE5A 2FLVA 4ZZ2A 3QFSA 3C3MA 3TZHA 3ZWAA 1SCUB 2XNHA 1BGWA 3IUSA 1QK3A 1EWRA 1J22A 3PHBE 1GPH1 2YYYA 2CWWA 4FC6A 2HO4A 1KSFX 4NH0A 1XTVA 2FUEA 1YC5A 4HWGA 4KLAA 4NMLA 4MUYA 1O5OA 1Y1PA 4JL6A 3OD1A 2CEAA 2WPDA 3PKIA 4N49A 5G1PA 4BZXA 4NU6A 5AW6A 1X80A 3KQTA 2HDNB 4Q3AA 2Q3MA 4ODIA 4CF3A 3AUJB 2PUHA 1M6VB 4ZO6A 2WJVA 2C7PA 1JLMA 5DSTA 5DNDA 3ZY6A 1FRNA 2P2GA 5CHEA 5DTEA 4CUKA 1J0BA 1N8TA 1HEYA 1SY7A 2Z2XA 3P2MA 3ROMA 3ITEA 3QBEA 4KYVA 5CXSA 3IHTA 1B1CA 3QK7A 4G09A 2FG7C 2PGLA 4OL9A 4CZ2A 5JEDA 2V6JA 5LDHA 1P7VA 3L7JA 1DOHA 1PT9A 4MJ7A 4GXNA 2C1ZA 2FSFA 3B1VA 5HNKA 1KVSA 5DMXA 1QSGA 2PUDA 1KBZA 1BRTA 1CIJA 3DBLB 3FBGA 4C3ZA 1XX6A 2FP4A 3PTZA 4JC8A 4PN7A 2YV2A 3HJTA 4JVNA 4NCHA 4ZT4A 3CX7A 4FEEA 2TMDA 2VJAA 3WDKA 3GNQA 4M53A 3NXSA 2O2DA 1BDIA 5AM3A 3EMBA 4QXAA 2HZ7A 5D51S 3SC6A 5HA5A 1IBKB 3FCCA 1H3FA 1VMEA 2C5HA 4MDYA 1ULBA 1N1EA 3KS9A 2MSLA 5FL7D 1UOOA 3UAWA 4RA6B 5G0VA 2WYHA 3SXPA 1JVSA 3WNCA 3X1YA 3O3OB 3A3PA 3EGEA 4WZAE 3HVIA 3KZKA 4BVLA 4F2HA 4C4AA 2FFJA 1R74A 3KRTA 2CN1A 5DOVA 4MQFB 3PXUA 2QI9F 4RWZA 4W4TA 2P27A 3KJEA 4TXJA 2Q1TA 3IBYA 1JALA 4NY1A 3QFCA 1CF9A 5FFMA 1NC3A 1YOBA 2PFKA 3LLMA 3ITNA 2NPFA 4QBHA 2HIAA 1KIAA 4G85A 1HF3A 2EWWA 1K88A 4IOLA 4ZTUB 3AR7A 3R7FA 1H0HA 4Y2XA 1DP4A 4ZO8A 4EUSA 1A2OA 3EVAA 1BWRA 3DWFA 5FD8A 5B4TA 5JXGA 2XWJI 4O2RA 4BUZA 4FMCB 4CQJA 1CQIA 5K4HA 2Q2QA 2GPSA 4I9GA 3JAKB 4ZT3A 2BIFA 1UAYA 3H9EO 4C6HA 2B9EA 1MQ9A 1CZLA 3DT8A 5GIOE 3T9BA 5BWCA 5JALA 4DR1B 5ARDA 1PZXA 1YJBA 2IBMA 3ASUA 4P2BA 5EC8A 3JQPA 1RAEA 1XELA 1K4MA 1XLTA 2ET6A 3DE5X 2IXAA 1YH3A 1KGDA 1ADYA 3PEVA 4Q3EA 4FTWA 3BMNA 1OZ0A 4FXPA 3TW0A 1VJCA 3QVSA 3KZXA 1V11A 3N8HA 4IR7A 1G8JA 1GFZA 1NAHA 4Z7OB 1FLVA 3K09A 2VDRB 3L92A 2QD4A 4O3MA 2Q3HA 3MVEA 3B6ZA 4OXRA 3P9SA 1P4RA 1QDLB 3PB3A 4QAJA 3SEAA 4AQDA 1BSVA 3QLUC 3BJMA 3TQCA 4F1JA 3D4NA 5I47A 1WCWA 1L7MA 1ZNQO 3ZDXB 1WIWA 3ETEA 4KDEA 4BQNA 5JY1A 2KSQA 5EJ4A 3FNHA 3K2QA 4AG6A 1IB6A 3EEOA 3AF2A 1AN0A 1RYEA 2H2WA 4PNHA 5TPWA 3RUHA 1Z34A 3STVA 3GNTA 2R1VA 3T5GA 1L8OA 4RHEA 1D6JA 2HM7A 3BH6A 1U4OA 2TMYA 4HVTA 5HKKD 5IAOA 1KYVA 5K3OA 3HDVA 1RHMA 2EJWA 3SSOA 3IAAA 5CYOA 3UMBA 2C77A 1PWXA 1YXMA 2OHOA 1B16A 4AQ7A 1E9RA 3WB9A 1G8YA 5DLPA 5KX5A 1U0GA 4FYYA 4OXKA 3ZOZA 2PO5A 3STHA 3ADBA 4GX0A 3FJ1A 2H85A 3CZCA 1HWYA 2XQFA 5C18A 4EJ0A 1QHEA 1RJEA 4R71A 4KTTE 5HKKA 3SBEA 3P4UA 5I7RA 4Z9FA 1L7OA 1WHTB 4KIWA 1Z13A 3NT2A 2JEOA 3TRHA 1MO4A 3LD9A 3DS8A 4Z54A 1JIVA 4J3FA 1XZEA 1KXZA 4YCJA 1I14A 2DTXA 1F14A 1ADFA 3W3ZB 4P7JA 3HNOA 3Q0TA 4MKXA 4PLCA 1CG6A 2GVDC 5BNFA 1PGOA 3L6DA 1EFPB 1T4CB 2A6PA 3K30A 3DZGA 2FEAA 1G63A 4XOIA 2I4NA 4KXYA 1J90A 5CDTA 1B26A 2EBHX 1O6CA 4R3NA 3VU9B 2JEZA 2WILA 2WJYA 3OJXA 1CZRA 3A0UA 2A5JA 3OX1A 1KQPA 1D2EA 3D31A 4GZ3A 2C4UA 3CNNA 1DEAA 5A2QA 2PT9A 5NLLA 3I32A 3UXMA 4MLDA 3T99A 1FUEA 2OFXA 3I04A 4IDHA 5G41A 1N6KA 4KFCA 4Q7KA 4MZDA 1DLIA 2Q3JA 1HSZA 5FHRA 2OFOA 2AQHA 5MN4A 2QVGA 1X77A 4I1SA 4MSUA 3P9XA 5E7QA 5I6DA 3GCGA 3ZHUA 1SVMA 1Y82A 4J2HA 1K9SA 2A0FA 2OCYC 4NOLA 1E89A 3OVMA 5K8LA 4B84A 5FDFA 1VJDA 2D1QA 3GAFA 3Q7QA 4KO8A 2XKBA 2AG1A 2NUPB 4WECA 5A4AA 5LPNA 1N5JA 4N6NA 3AVWA 1GFWA 4JJKA 3I0NA 3SAJA 1S4QA 1SK8A 4EYOA 1WU8A 1BTOA 1ZKMA 5C34B 4ZYUA 4AJ1A 2R85A 1DEKA 3VBCA 4YP0A 3BULA 1QZXA 2JGIA 4JI4B 4G1UC 4H0CA 1YZNA 4EPXA 2PANA 1G3QA 4XFDA 5FHQA 1W1IA 2AJCA 2BH2A 1D8TA 1HZZA 1THTA 2C5AA 4R0NA 5J58A 1UZAA 3C0KA 3L4BC 1TZJA 2FEMA 1PZFA 1AGRA 4GYWA 5AD1A 1I7PA 1ACMA 4US1R 1JILA 1SPBS 1A9PA 3JQ9C 2ECOA 4R6WA 5DM4A 3QE9Y 3O92A 4PFSA 5H82A 2EW2A 3C16C 3LXMA 2AI2A 2DFVA 2HK6A 2RBGA 5FBKA 3OEHD 4JU9A 4O25A 1MRSA 2M6SA 4OQ4A 1KMHB 1W49A 1L4MA 4MW4A 5H3LA 1HNZB 1J70A 3JVUA 4MYCA 3CXUA 1YASA 4FQ7A 4DFDA 4JH0A 4AJHA 3L8DA 4I55A 2WFLA 3WYGA 4U3JB 3TAXA 4II7A 2XGOA 2HSGA 3TZBA 4RK5A 3VTKA 1IOZA 1V4BA 3GV0A 4UVHA 2XTMA 4WBSA 4JXXA 2YY5A 5CXQA 1AKMA 4YJFB 4IFEA 3M1AA 3K1AB 4EMSA 3QEAZ 4LJ4A 1N5DA 3OEHA 4KWEA 4PW0A 4OLJA 4KSYA 5F5LA 5I7UA 2YV4A 1Y6QA 2CW5A 1HLPA 5JYDA 4LE2A 4DSTA 2V1XA 3S8EA 2GEBA 4G3XA 4MV7A 3IL2A 2ZIWB 2ZFUA 1RFLA 3OQHA 1L9KA 1J0XO 1FSSA 1HG1A 1HT0A 3A3YA 3BILA 2Z5VA 4CM8B 1QVZA 2W9XA 3QWAA 4RWEA 4RY2A 4UHKA 4XJSA 1P18A 4IJMA 5BSRA 5KYVA 1W5EA 1GAJA 3ZE7A 4GG1A 4D9IA 2ZE7A 3EFOB 2OC9A 3JD1A 3KD2A 1FSPA 2HA0A 3GO4A 3RTBA 3TSAA 4LISA 4Z49A 4UPEA 4UUOA 5BVHB 1U2RA 1G1AA 1CVLA 1RVDA 2B6HA 4LY3A 3KKEA 4QUIA 5FJJA 3W2FA 2NT4A 3GFTA 4GLOA 4E11A 1EXDA 3KL4A 4R3UC 3GYBA 1SNYA 4NYIQ 1JSCA 2WSYB 2ZETA 3T1YB 2Q0SA 4Q9IA 3B82A 3HCCA 4XPIA 2P2NA 4R8MA 5THQA 2UZ3A 4GOND 1CDOA 3N74A 1AKTA 2W6PA 3I4CA 1GQ2A 2GI4A 3KFVA 4HPJB 2QYSA 4JP3A 5DGIA 1VGQA 4MYDA 5AW5A 1E32A 4DJAA 1ZVQA 2P35A 3N7UA 3NHBA 1NSFA 1TQ2A 3QU5A 4QTUB 5FQOA 2VCYA 4H35A 3W3AD 1B3RA 1NXXA 2QX7A 3P9QA 4BNXA 1V9LA 1B3BA 3I09A 2X8WA 1WOYA 1V45E 2JBAB 3EGWA 3LUFA 3ORYA 3R3SA 5EZ5A 1XK6A 3ROZA 2HBQA 5KWIA 1N2EA 1KI3A 2B8TA 1Z5VA 1OFVA 3HB5X 1SKMA 3OJCA 4KN6A 4E1AA 4EHNA 4JXZA 4J16A 3PWZA 1VL2A 1KEWA 2GTHA 3M5WA 2SCUA 4HXFB 4JGBA 4Y67A 1U2DA 1X9HA 4B75A 2IBSA 1FP6A 3BRQA 4AROA 3HXMA 2PUWA 3D5QA 3KT8A 3W3AA 4P31A 3ZQJA 3T7RA 4DJDC 1EVZA 1NNI1 3PX3A 4O4JA 4LYGA 4EKEA 4LRXA 2VDVE 5TV2A 4PF1A 1Q91A 4J0GA 2COUA 2GJKA 2Q1YA 3EAQA 3IILA 3PHIA 4L57A 4DMRA 2JH3A 2Q4EA 4KIFA 2PU5A 1K2VN 4M7WA 2VA8A 1E2DA 2E55A 5KOIA 1ZGZA 2WHPB 3CN7A 1UBEA 1JHDA 2OBLA 3S68A 2YJZA 1KL7A 3D7NA 3O6VA 5BWNA 3CRW1 1YSCA 2AFHE 3NOXA 2GEUA 3LPAA 1SIWA 4V2IA 4XLZA 4L7VA 4L22A 1MAAA 1U7UA 2OFFA 1OBOA 5C5CA 4TN5A 1C14A 2O8NA 1GPJA 1JIXA 2OZEA 4P54A 1THZA 2M1XA 4BVGA 1SC1A 2Y1OA 3EIEA 4MS4A 4FHGA 4FMDF 4P92A 2OP0A 2QAGC 1OXTA 1V5IA 4L5YA 3W34A 4P86A 1EX1A 1OI3A 2QQ5A 4XQEA 4B83A 4ZMBA 2G67A 1FTSA 1PGPA 2QQ0A 3PGXA 5H5JA 2G71A 1TUIA 4X61A 1FUIA 5FUWA 3L01A 3PC6A 5FI0B 2ANCA 2LIVA 1RRFA 1NVKA 5KKAA 5DXJA 2XCTB 2YJGA 1IUPA 4QKQA 1XRNA 5F4BA 1G8FA 5CR9A 5JLJA 3KLNA 1U3CA 4KQWA 4WNYA 2XMCA 4A10A 3RSZA 3P9KA 3S1AB 1XWFA 5LDGA 3IP6A 1B0AA 2XYVA 1INLA 1NXQA 3GN1A 5C53B 4HNRA 2ZRPA 1HYQA 1HURA 3NHJA 3HDHA 4UBNA 2F4NA 1JWLA 2G9UA 3D6UA 3HJAA 5BN4B 1XPUA 1YO6A 4FZJA 2CLFB 4UHJA 2QV0A 1OXUA 3JD4A 1NASA 3PDHA 3RG8A 1ZJZA 2PNJA 3IDFA 3CW9A 5LZ5A 2NO7A 4OFBA 4GMDA 1KJWA 4J1QA 1I2CA 1KR5A 3VUFA 1RP1A 4Z51A 2OQVA 4FT4A 1FRZA 4DGSA 3KEFA 1P4HA 4N03A 5FOUA 1C7FA 1G5IA 2A92A 3KSMA 3IA7A 3R3ZA 4INJA 5AVZA 3R0JA 3NAMA 3T9FA 2JLQA 4MGKR 4KITB 4DLPA 1P1CA 3W79A 1KO8A 4HY3A 1EZ4A 3ZYZA 4MVCA 4B79A 3CWQA 3F5MA 4HLCA 4DRYA 5H02A 2UV8A 4K9RA 1YBVA 3P2KA 4FBGA 1X92A 1Y8RA 1GZSA 1VRCA 2J46A 2MU1A 2NOAA 3CZ4A 3E9MA 3DGEC 1OJLA 1ESNA 4I4TA 3NEPX 4D9NA 4FHFA 1Y9JA 4CGZA 2X3YA 1YB1A 4BMNA 1VG9B 3QLJA 1M2KA 2V9CA 4M55A 5EZYA 4HFMA 3U7RA 4BNZA 3CVWA 1L8LA 1P5FA 1L5FA 1FU4A 3DH0A 3M5PA 1RM0A 2OYCA 3HKBA 4AS3A 1M34A 3PQ3A 2WWIA 1Q5PA 3DE3X 4MKZA 3SN6A 3GJ3A 3UCFA 3A7EA 3K3PA 3AESB 4LNUB 2IXBA 3B3JA 4LBWA 5AJYA 3PI6A 1BS1A 2J9ZB 1PZMA 1I6MA 3NHUA 4OKSA 4ZYTA 1OLSB 4JI0B 2YCLA 2G88A 3O2QB 1KZ4A 2PL5A 3M3HA 5AXDA 5TEVA 3ZV6A 3ZJ4A 3O38A 1Y33E 4ND2A 3H5TA 3OEEA 4IRUB 4F4UA 4MGEA 3I5YA 3NMUF 3AINA 4N40A 5KPJA 4YASA 1GIAA 5C8VA 4YHBA 3A6GA 4E5SA 1GUFA 1NXVA 4K3VA 2DUNA 4WZZA 4KODA 1CP3A 3C6YA 4LCJA 1W0CA 4AJOA 3RKRA 3KUXA 3OESA 4QIHA 3CZRA 4X6YA 5DLDA 4EZEA 1Z83A 4AMGA 3FMOB 4ZZIA 5KHLB 4RNCA 2FOXA 2Q0QA 1ORTA 4LZNA 1JHRA 3L02A 3VI4B 1V8PA 3LUAA 4P7GA 3KPJA 2NO4A 4UBIA 3GXOA 1Q0HA 3U0VA 3VH1A 3N7AA 4EK9A 4QD3A 1GPWB 5GY7A 1OC4A 5CDFA 3VXKA 1U1GA 4TZ6A 4JEUA 2QMZA 1JN0A 2D54A 4S1TA 2CLMB 2VCEA 3EXIB 3PUWA 4G0OA 1VA5A 1H6BA 1Y37A 3H8WA 1QRDA 1UANA 2ACEA 3DEAA 1Q11A 3FUVA 4EZIA 1I2MA 2BFEA 1R16A 1S1CA 2ACVA 3BTSA 4DXDA 3EIFA 1H05A 3KVVA 3LBYA 3OIDA 2J3IA 4GR5A 5KI6A 5C81A 1NVVQ 3IX7A 3I0MA 4OHBA 1EFUA 4DLWA 5KOHB 2XMZA 4EJMA 3GT4A 2E5WA 2HBYA 1XBTA 1PG0A 3BBPA 4HNAA 1UKEA 4TXLA 4RMHA 2OD2A 3ZXXA 2OECA 3KPYA 4WK2B 4UM9D 1QE5A 1BVYF 2F43B 3E7WA 3FM9A 3RR2A 4QTYA 5LIRA 3SX4A 2WHQA 3ZZTA 1IYZA 1B76A 3G2HA 4DYHA 3LBHA 2FZ4A 2WM8A 4M87A 3R7LA 2FSHA 4L02A 3U6BA 4IG4A 3RUIA 1AVTA 1SIOA 1F0YA 1EE9A 1Z2AA 3CH7A 3E22A 5CYFA 1E61A 4IVQA 1CUFA 1VCIA 2RFLA 2RK3A 4UHCA 2PMEA 1T0HB 5BSUA 4RPCA 1HYGA 1P1JA 3RHSA 3K6KA 1PUXA 3F6PA 1QF9A 3IOBA 4R54A 1KAOA 3V1LA 1MO2A 1J09A 1NMEA 4O4IA 1T5OA 3A2LA 2JGJA 4UU8A 1R6BX 3I1JA 4V39A 4RVGA 1X2BA 1I9CA 5DHRA 3AQ4A 1JE0A 1TCVA 1CZUA 1E2EA 1XZNA 3MJSA 3UJNA 2Y1WA 3CPSA 3COPA 4JN6B 2ZW9A 4GS5A 1EJBA 5FADA 1UJ6A 4XPZA 3CF2A 1F48A 1J0AA 1MW8X 1WZ2A 1A7AA 4ZZ0A 7REQA 1JHMA 1RLTA 2P9ZA 3AUYA 3VPCA 1Q84A 2REQA 4PHHA 2VRBA 4UUMA 4H6WA 4O33A 2C2GA 4H0FA 1YDHA 4XCQA 4BNIA 4JI2B 1ORIA 4RDXA 5HRAA 3LXRA 1FQWA 4K9PA 2WZBA 3PGKA 1TA0A 1UMKA 2J4FA 1M2OA 5SYNA 1H1LA 3WB1A 1M83A 1VFPA 4OATA 2ZBVA 2DHEA 3OU2A 5DULA 4BTLA 1Q1ZA 1VPLA 4CV3A 3MOSA 3A3NA 3AUSA 2ZYWX 2WSBA 3QOWA 5L53A 3KX2A 1XZKA 2AD1A 1UOEA 3VPBA 4P4UA 1N2GA 3C3XA 1TJ5A 2QV7A 3U1TA 2BFAA 1Q2UA 4WD3A 2Q5CA 3BIFA 1KY3A 3UJ9A 1WVGA 4MIKA 4ZV9A 5IJAA 1WBDA 4RK0A 3COJA 3DNMA 1JV2B 1SCKA 1UK8A 3MCZA 3MTJA 4NFSA 3FW1A 1QX4A 1SKUA 5COQA 5BSKA 3AZOA 3QKRA 4IIDA 3SJZA 4DT1B 3GFVA 5C4IA 1JNYA 2VLIA 3TECE 2AKEA 2C59A 2PSHA 1EE2A 3GJZA 2EZ9A 1TVKB 4YT5A 4RORA 1T2EA 1O95D 2J09A 3CZQA 3IUEA 4JNCA 2ZRJA 4L8FA 4MP6A 4YWHA 2AVNA 4EHFA 3V9AA 5C5IA 4OGWA 5T6BA 5IUNC 1MEOA 4QOGA 2QL6A 1NGSA 2O50A 2H31A 1AKVA 1CUIA 3E23A 5ALFA 2C2KA 3F9RA 3U2QA 1N3IA 4KJXA 4OHUA 4LXYA 1EIZA 2GCPA 3OZCA 5F51A 1MRZA 4IV0A 6AT1A 1V16A 3P9ZA 2ZTVA 3NBQA 4MYHA 3HS3A 3NHKA 3WO0A 4UD2A 4KO2S 3J80A 1CD5A 2CNBA 3A1UA 1GADO 4X1YA 4PCLA 4RGVA 2O8BB 2PQMA 2E9SA 2GUWA 5COBA 2EHDA 3UHJA 1NY6A 2AWNA 4KR9A 4B6PA 1U9YA 5IRCD 3FNIA 3RYCB 1GDHA 2CUKA 4CKCA 3HLYA 4UREA 4QXPA 4BLTA 1QFZA 1V7PC 5ICGA 1GGVA 2O05A 3P0HA 4P84A 4BB9A 3OJFA 4IF6A 4CMEA 3OKPA 3QENA 1KZ9A 1RJ9B 3GY0A 1IZ0A 1Q74A 2GTPA 4V1CB 5EFOA 1V2HE 3KK0A 2Z30A 4UBKA 3N9IA 3RYIA 2P2CA 2RJOA 2ZB2A 2C07A 2GM3A 5EWLB 1XE3A 1K5HA 4KNWA 1XNJA 4LWPA 3B8HA 3HGMA 3DEKA 4Q4LA 3LY7A 3C3PA 4DA4A 1XL0A 2VK1A 1P4JA 3JTMA 3C6ZA 1MA3A 4FYPA 2C7OA 4E0BA 2IYWA 4X6UA 1ZJ6A 3PUVA 1W0JD 5BPHA 4DV5B 2I99A 1D2MA 1SVKA 2H0RA 3EPLA 3IH5A 3PR1A 1NU6A 1Z4PX 2PGXA 1FP4B 3Q3JB 4XDZA 5KTSA 4IIHA 2PE5A 3H1BA 3W6OA 4DAOA 3MT9A 3W5CA 3GT0A 3VR0A 1C1XA 2PIAA 5CPBA 5EMMA 2J0EA 2HSZA 2PFGA 1R27A 3AM5A 4GE0A 4M6WB 4X44A 2HW8A 4OI1A 2IYNA 3CKMA 2ECPA 5H9VA 5IJ0A 1FDOA 1MJFA 1Y9EA 1EDOA 1SBCA 3KPUA 1G6KA 3DBIA 1I6WA 2K6GA 3OZBA 4R1LA 5A7FA 4OJMX 1W0JA 3NEAA 3AY6A 1IJKA 2GN6A 3QVWA 3DDSA 5LCXA 4JUFA 1P9WA 5DGHA 5G02A 4JROA 2FJ0A 2IXDA 3THXA 1PK7A 1CRQA 2FDXA 2JAOA 4CLRA 1ADCA 3A10A 1SD2A 2H4HA 4AZVA 3EGCA 1N25A 5C1PA 3RODA 4DZZA 4KPUA 3QF7A 1XXHB 1S3SA 1K1EA 1GU1A 5CH5A 1TF2A 2REBA 4ZEOA 1E8NA 2I6UA 1TU3A 1VGVA 2IYAA 2J7PD 1KO7A 4PPQA 1YQ9A 1L5LA 2XE8A 1TQ8A 4L0MA 4LMPA 4FMDB 4WTOA 1TAHA 1JAIA 2I2BA 5LP6C 1I3NA 3GUYA 3LYHA 121PA 2VYNA 4JC0A 4IIEA 3F3MA 3IFSA 1IJBA 3BRWD 2CZGA 5KAPA 3WLKX 1ZGAA 1JHUA 2ZJBA 2WKPA 2W6QA 2XUHA 5BSVA 2G6BA 4CM5A 4QU0A 3BIOA 2IHBA 4E1BA 1M76A 1NZDA 2J7PA 4HP8A 2SBTA 1DFGA 3JWJA 1U0SY 4HDSB 3H6KA 2YVKA 1Y8AA 4OUDB 2JIMA 3LMKA 1HH4A 4M0EA 3RREA 3IXQA 4YJ3A 3C3JA 4F9GA 3B5EA 1UXIA 5F12A 3C5HA 3GZ4A 3KV1A 3BRWA 1PEYA 3DOHA 4G24A 3ZS9A 1J1IA 1TC1A 2FUG1 4I36A 3DAPA 1Y1RA 5AIBA 2AD5A 5DDIP 4TKUB 2ZUFA 4RL6A 3PXCX 1QP8A 3W7AA 3PV0A 1GGHA 3DLAA 1JJAA 3TRDA 3ZWMA 1DEXA 1N3LA 1TPYA 3NYIA 5YASA 5BYAA 1TYZA 2M6LA 3EWSA 4JIGA 4OAOA 2ZVJA 4ENVA 1PUJA 3F7TA 4M46A 2C4NA 3MWGA 4MW0A 2I2FA 5CW1A 1OU4A 5HUQA 3AUTA 4NJEA 4E09A 3QOXA 3VAYA 4D0SA 3A36A 1NV9A 1KK2A 3TQSA 4BGEA 4ENTA 2X40A 1WKCA 2W71A 5JAUA 1TMOA 1HYBA 4HBZA 1TEHA 2BHNA 1CJBA 3QVJA 4RM3A 4ALJA 3C43A 4HAUA 3LC2O 1LS1A 3PNKA 2ZUCA 3AU9A 2EOAA 4LRTB 1XT6A 4WACA 2J67A 1PQUA 4UAJA 2FN8A 1X15A 3TSYA 1PT8A 3QQ5A 1A88A 2IDZA 3OWOA 4GBGA 1IN7A 4GC5A 3J7AC 1B43A 3EISA 4B2LA 4LC0A 1UJ2A 5J2UA 1H93A 1PF7E 1CUAA 4UAGA 4CQMD 4FYVA 4YCCA 2FVYA 1X1CA 4MW2A 4MB6A 4LSGA 4CEHB 2OB2A 1F0NA 3BBLA 2VK8A 3I9V1 1F2UB 4CVNA 2WWYA 4WXMA 4ZHQA 4FZ3A 3C98A 4IUDS 2PAFA 1AKRA 1B6TA 5EGSA 3BMOA 4D8YA 1NI5A 3LUKA 4GHWA 5HUJA 1SUSA 4MR9B 4CQMA 2Q6VA 3EXG1 3DOFA 2RHTA 3LS2A 2AG5A 4BZQA 2PMDA 2JIRA 4NV1A 5KYYB 4O08A 4BOYA 5L7WA 1H8HD 2PRSA 3DJFA 2VNIA 4LBVA 2JD2A 3MZ0A 2W6MA 3C8MA 4KGDA 4AZ0B 5A9SB 3G2IA 3D1JA 3HA5A 2IC5A 4RVHA 1L1FA 5T6MA 2GXQA 3N2GB 5CIQA 1XEFA 1PL8A 3RGWS 4W5NA 1YUBA 1O96B 2RHDA 1PR1A 3E58A 4F46A 2V7QD 4CKEB 2IBTA 3SS8A 1W5TA 1Z4MA 2PX2A 3K4HA 2J41A 4MV0A 4RK7A 3I4FA 1H8HA 4BPRA 1E63A 3FCXA 2PVSA 3QZUA 1H2ZA 3E6AA 4MAAA 3V4OA 2HF2A 3AVOA 1PAUA 4EKYA 2FSIA 4JKIA 1L5ZA 5EN4A 1TAQA 1XXHE 2AG8A 3UC5A 3EMDA 4WERA 4MRNA 1GZ3A 4HRVA 2C5GA 1OQAA 2W2KA 5HQ3B 1Y6ZA 4CU2A 5EXSA 3RWMB 1DTEA 1V43A 3BQ9A 4Q9NA 4X0EA 1JTEA 2QORA 2NZWA 1ZNWA 3UW3A 2HA4A 4MS3B 5TF4A 2G5CA 3A27A 5I7FA 1J56A 2XCUA 3AYZB 3L7KA 4HAWA 2DMRA 4FDVA 5AJWA 2PYZA 4LW8A 2FGJA 4CM6A 4P3YA 3B13B 3E5NA 3JALB 3W8NA 1Z6AA 5F7JA 3V34A 5JMWA 4YLYA 3WK4A 1T2NA 4UE6A 1XNGA 4OI2A 3UK2A 5CA0F 3NW9A 2ODWA 2OYSA 3URMA 5HCUA 3JYOA 1DIBA 3FFXA 1ZSNA 3QLVC 1G7RA 3FOFC 5EMJA 4R8LA 3U1BA 4RZUA 2NO5A 2V5UA 4UNNA 4F7WA 5DFAA 3BDIA 1ZL2A 3LKZA 4DIFA 3KB2A 5AI5A 3EXHA 4KBFA 4KQIA 1P2UA 2JAPA 4LA4A 1I3LA 3DEHA 4UHDA 5D87A 3ZV5A 4KU4A 1E77A 4JELA 3OF3A 3R6WA 5DTRA 2G4CA 1SVWA 3ANXA 4L5JA 2XWSA 3E05A 3HUFA 1B6SA 1U9IA 3QE2A 4HAVA 1N2OA 2EP8A 4XQ9A 5JNLA 4DUPA 2VPQA 3WB2A 4ALIA 1H4SA 5CB4A 2A30A 3QVTA 5JASA 1QH8B 4Q1BA 4KACA 1NOIA 1AF4A 2QXTA 2X4GA 4R4JA 4OYLA 2VPYA 5EY5B 1JQBA 1LLCA 3OJ0A 4IVPA 4OMCA 1PNTA 2DCUA 2VPWA 3BA1A 2P1RA 2QTGA 5JFTA 3BRSA 4ZEWA 3WSTA 3ZD9A 2YZ2A 1G3RA 1TM4E 3BCRA 2VJKA 4JQYA 4Q1DA 4AZ3B 3AHEA 5U4QA 3UXYA 3WO1A 3F46A 4J0FA 3EQ7A 4UXJA 5DB4A 3UUFA 4EYGA 4R8RA 5FAKA 1K8RA 2O6LA 4LPKA 4ZA2A 3T5MA 1UZNA 2CLCX 2RDMA 2Y0DA 4HYQA 4ARAA 4K6GA 1BXGB 4LWOA 1OYWA 5BW5A 4MA4A 2HHLA 3KIPA 3WP0A 4MVJE 1XYYA 3I6BA 4EPRA 1E7YA 1DBSA 1TM7E 3NB0A 4LOHA 3VC3A 4AJJA 5AW0A 4TMKA 2C2MA 4LZAA 4NENA 2IH5A 1KIFA 1ECGA 1MJNA 5LNK1 4CLDA 4QBKA 4CQLB 3D4BA 3MS4A 2WZCA 3TYXA 5ER9A 4S05A 5CP8A 1AF7A 2R11A 3U4CA 1LRJA 2EP5A 3C6BA 1Z25A 2C58A 1RMQA 3IAUA 1XSEA 2WT4A 3AG6A 3BDAA 4ZARA 3DZBA 1LPOA 2C2YA 4UNPA 4FFDA 5F2KA 1C9DB 2GLUA 3L7YA 5LYJA 4GPEA 4D9EA 3W9UA 1KFKB 1ZI8A 1U2DC 5G3YA 1J5XA 3DMDA 5GGYA 4EFLA 1TF7A 1YZVA 1ZNXA 3KWFA 1GNTA 3LA6A 1II8B 1QHXA 1TLFA 2FWIA 2VDKB 5IN4A 1KQGA 1LLDA 3GRFA 4KL8S 3MCWA 4NECA 3IUPA 2F3RA 5I7EA 1JA0A 1MAHA 4GUDA 4D43A 4XUDA 3I5XA 1RKQA 1SG6A 1QB7A 1U1EA 1YONA 3NIGB 4K03A 3TLEA 4D4MA 4EGSA 2XB9A 4AP6A 3RKUA 1CR4A 2O4UX 3GP3A 3CTMA 4MI3A 2AZMA 1SGWA 2I7CA 3I45A 4BNTA 3HNRA 1MXFA 2F8LA 1A9XA 2CUZA 3IRVA 3LGAA 3A9TA 3EBPA 2IEGA 4QSMA 4CPDA 1BKYA 2G80A 4R2JA 2H1OA 4WDQA 3WI7A 2O3RA 1LBHA 4JI3B 2FKAA 2HBRA 2CBZA 5CURA 4CCWA 4RTJA 5EE0A 1S3GA 1Z62A 3LC7O 3MEQA 5A4MS 2MSCB 3LQ2A 5GJBA 5DYWA 5AW8A 3W5HA 2PMCA 4R16A 1BMQA 1DV2A 2G0AA 4JZYA 5CXXA 3IPRA 2BMFA 5A5DA 3MJEA 3FDJA 2EGUA 2UVPA 3NVDA 3PC2A 1T26A 1YCHA 2QLMA 2QENA 1QYXA 1FX0B 2ZBUA 4Y6LA 3MB5A 3PT9A 5DBFA 4ITUA 4JXKA 1TCUA 2KQUA 1U4NA 3EGDB 4ZU1X 4CV1A 3AO0B 3TZ6A 1LRKA 3I34X 4CLXA 1JFLA 5TDHA 2JLAA 2RIPA 3ZJYA 4MINA 1A8PA 4DR7B 4TSKA 3A04A 3U7JA 1NJ1A 1XCGB 2CDBA 2MYTA 3KR9A 2BAGA 1FB5A 1TYCA 1J7KA 1D6MA 3EASA 4QASA 3F7OA 1E3WA 2VSXA 3GJ0A 4MCIA 3SXJA 3H4VA 4JL8A 5JCOC 5FBLB 3ODPA 4PX9A 1M1UA 3MRXA 4MLPA 3A11A 4ND5A 4QHYA 4ITVA 4TYPA 4UPVA 5CLHA 4ZV7A 4A0SA 5EE1A 3WYBA 3QFHA 5EIAA 1SHTX 2XSZD 3INNA 4UVGA 4D45A 4EFDA 2YBEA 2HD4A 3ZPXA 1PX2A 4LSZA 3ORFA 3MUFA 4Q3CA 3CU5A 1Z68A 3KOXA 5AIAA 4RF3A 1IXRC 1DWPA 1CY1A 4LXXA 1UEJA 4BMCA 2YWDA 4C3VA 2V7TA 1UPUA 3NEJA 2X5KO 3RK4A 4E1VA 2VI5A 5LP1A 1VIAA 1OR8A 3K16A 3ZKAA 4X85A 2RGWA 2I3ZA 1VJ1A 2JZOA 2ZVQX 2FZLA 3K8QA 3HHEA 4W9RA 4UDYX 2HDOA 4XX0A 2BMEA 2R8YA 3WA6A 3KUUA 2RGBA 1GV0A 5T8KA 4PBRA 2PH3A 1H2WA 1XAHA 1MORA 1Q1AA 3KKKA 5JYCA 1YA8A 2FHSA 4CEJA 7YASA 3S2EA 3VA7A 1QIIA 4OF4A 3TVYA 4PGMA 4A1FA 4W5TA 2X8JA 4MKFA 3I8OA 4UMEA 5TVKA 3WWYA 4HFNA 1BDMA 3ZQUA 1I94B 3HWX1 4XW2A 3GLIA 3H8SA 1RSZA 3NLLA 4P53A 4IUCS 2SECE 4M1QA 4LQCA 4BVKA 4Q39A 5THXA 1ZX1A 2I1QA 4FFLA 3IJPA 1JJFA 2XUDA 3I9LA 4CEIA 3HYTA 3I01A 1BYUA 2CK3A 1TO1E 4M54A 4M89A 4Q3KA 3ZE0B 4EM6A 3OA0A 3Q3VA 2POCA 3HCFA 5I9TA 1U1DA 3F71A 2HV9A 3KV3O 2ZYAA 4FR2A 4MR7B 2B94A 2GK3A 4GKBA 1COZA 1CK4A 3CRNA 1F60A 3H1TA 3L04A 1NW3A 4Q15A 3ROEA 4CKYA 3F4LA 5JDIA 3E1SA 3UUEA 3VSAA 1QK5A 1NM5A 2PPVA 5DF1A 3KCNA 4OFWA 2VUIB 3FDIA 1HQKA 1BH2A 1DE0A 3PC7A 4R9SA 2KX7A 1A1VA 4TV8A 4HRXA 4WADA 4EA8A 1E2HA 4IG9A 1B4DA 4KAJA 5TEWA 5BPFA 4LHWA 3OMWA 1O97C 2AGVA 3LNTA 3B1KA 1DHRA 4YP5A 1BQ3A 3E15A 4HGOA 2DWOA 1JEOA 1JKMA 3IEVA 5IT4A 4H6XA 5KCZA 2W90A 4I0WB 3CVYA 4KE7A 4YAWA 2O5VA 4YJKA 1CF4A 4UUAA 1XC7A 4UJ3A 3GJ6A 2C3YA 4Q47A 4GDMA 2OYRA 2J48A 2N1BA 4W5OA 2P4QA 1Z45A 4YUZA 1UC4B 3H16A 4GOKA 4IIXA 2EGHA 1F5SA 3HLTA 3VPSA 5ICFA 2WSIA 3O8BA 2ZS7A 4R2LA 4H1WA 1ZN8A 2VWGA 4QVIA 2QVYX 2OXRA 4Z3KA 2HQ1A 3OZ7A 4LF7B 1LXCA 2VTKA 2ONJA 5AM4A 3S70A 3HY4A 1SXJB 1U8AA 1BDJA 3AL3A 4B80A 3G0HA 1NNLA 5L7TA 1T25A 5AQEA 2F8MA 2Z2IA 1ISIA 2OGZA 4IDPA 2PZJA 4IS3A 1ZOOA 3WICA 1X1EA 3K9CA 1SC3A 5CM2Z 2GRAA 4FJ1A 4BKPA 5DM60 3VR4H 4BECA 4DJ5X 2E1RA 1KO4A 3DB2A 5BWOA 1ZR4A 4O1MA 4BX0A 4UFNA 3EPJA 1LC0A 1NWCA 1U2GC 2GK7A 2MT9A 1AHHA 1NU8A 4YC7A 4BVAA 2CHGA 5BQPA 1ZQ9A 2A4MA 2Q99A 3C7CB 3O4VA 5IT5A 1FMLA 5EKSA 3BK7A 4XASA 2QRJA 5JEEA 1U3DA 3PNQA 2GYUA 4N5MA 2GN9A 1DAFA 2CXQA 1WXHA 3L7BA 2PWPA 2NVBA 5BVGA 1HL3A 4WNAA 1F2TA 3OJEA 2I22A 1QO0D 2H1CA 5K1ZA 4RD3A 2GPNA 5CNIA 3STWA 4DQXA 3WK5A 3O4HA 3TLMA 4Q4HB 3O75A 2EW1A 3WZMA 3Q85A 1LVHA 3JVIA 1OIWA 2APJA 2QTBA 1GXSA 3VZPA 2PUAA 4QUAA 2X9LA 4E2XA 1XVIA 2AB0A 2YZMA 3WR5A 1T35A 3U4DA 5IJ9B 2IIQA 4E14A 2P2ZA 3EQZA 3QLEA 4IHJF 5E1MA 4RTPA 5D3QA 2AC7A 1QIGA 3IPXA 4HJRA 4E5DA 5JECA 4OEHA 3HB4X 2VO1A 2H63A 1IUOA 1U1CA 3I6QA 5C52B 1QO0A 1NHWA 4KAXA 1UMDB 1AQJA 1CXZA 1RQ7A 3D0OA 4BXOA 1DFIA 4YJGA 2PBLA 5KOJB 4FYHA 2WTUA 2CZQA 3CTPA 1YR6A 5CFMA 2PYDA 3K2BA 5T4EA 2R6DA 3G2QA 1FUYB 4IZ6A 4N9QA 4QJIA 3AEKA 3VKWA 1N4DA 1U7DA 1YZUA 2D2IA 4EY7A 4FI3F 3CPHA 2R8OA 2OAQ1 5AKXA 2ZU0C 4MUGA 3WLRA 4GBMA 3DLCA 1GUZA 2BGJA 2LDBA 5KNBD 1XNQB 2QR3A 4B45A 1MR3F 4LVUA 2W2LA 1K08A 1JG6A 1SHLA 2E49A 1F4PA 3IVRA 3D6AA 5TE9A 3WGLA 1ZLYA 4KXXA 1N8SA 2REOA 3VRHA 5FBZA 4EO7A 4NS1A 5T7BA 4M2LA 1SELA 2CYAA 2PPLA 3MBKA 1V3QE 2IV3A 4ASUD 5AUPB 2X14A 3TTSA 2CV0A 1R8JA 1X1SA 1Y6RA 5EKTA 4MUNA 3PI7A 4ROTA 1WW8A 2BFDB 5G0WA 1XD2A 5P21A 1O95C 3I62A 3QBJA 4YRRA 5I48A 3CUVA 1IL0A 4DLKA 3QY9A 2AUTA 2ZE5A 5EL0A 5B64A 4UC0A 2BEWA 4WL0A 4XOUA 2HB6A 2JLVA 3ZIDA 2JBHA 1DQRA 3GGDA 3Q7TA 1EH5A 1NFFA 1D2AA 1FY2A 2IIVA 2JFHA 2FSUA 2IQ5A 3C97A 3MJ4A 4KQCA 5DZSA 1R2QA 3GLTA 1MAVA 4I55B 4KXQA 4YJHA 3RS9A 3WKDA 5KREA 1WDMA 3WMXA 3RQSA 3CLUD 3M3PA 3K8OE 3H5LA 4CT5A 5K8UA 3EGOA 3CBQA 1KSGA 3JU3A 4BO6A 1ZUWA 3O9VA 3I37X 3IOCA 1OWNA 1H22A 2GCOA 3UT5B 4EATA 2RBKA 1ZAYA 2YYSA 2IXEA 2V96A 4NE7A 3PF9A 3BF8A 2DERA 1X7XB 3GT3A 3I73A 3RLFA 2R47A 3CG4A 3H2SA 1MCZA 1GOTA 4QFMA 3TCNA 2Y2UA 3VKVA 2OZLA 1TTQB 3FCUB 3IEMA 2PUFA 4XRGA 3DBHB 1DXHA 1T5DX 1V25A 1NT4A 3GJ4A 5D3MA 3VTFA 4E5KA 2BOVA 2EQ5A 1JIQA 4FHCA