5SZHB

Structure of human rab1b in complex with the bmerb domain of mical-cl
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
b'GHMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICAL C-terminal-like protein
molecule tags Endocytosis
source organism Homo sapiens
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
total genus 61
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5szhB00
1NG9A 1E2EA 4PO9A 4C0SA 2J1LA 2ZI5A 3K0CC 3U44A 1LB1B 2BMJA 1L2TA 2ORVA 4OK5A 4DBLC 2QMEA 2BHRA 1IY0A 1ONBA 2ZPTX 2J0VA 1AQYA 2Z4SA 3SJZA 3K70D 4L16A 4TMXA 2YJTD 4KJZA 1ZNYA 1VYUA 2W2TA 2O8CB 3K0CA 1XZPA 2FGKA 4NBSA 1AN0A 2O8EA 1FTSA 4CDGA 1UM8A 3FMIA 2DFKB 1E99A 1C4OA 3MWJA 2I1VB 2QMOA 3TUZC 5L3RA 2OM2A 4XSGA 2D3WA 2V8OA 5BN5A 4TZ6A 2JLYA 3QUSA 3R8CA 4C0HA 3PJRA 3ND9A 2VP4A 1VIYA 1N6NA 2FZLA 1HYQA 5GJWC 3M6AA 1YRBA 2CJWB 1NI3A 3WRYC 4A0FA 2A78A 2ZJOA 2Q0HA 3I5YA 1RZ3A 2HF9A 3GLIB 2QN6A 4CEIB 4IKEA 3ND8A 3DOEA 1P2SA 2G0TA 4L4UA 3B7GA 3O8CA 2FFHA 1D5CA 1R7RA 4M1TA 3DL0A 2W0MA 3CW2A 3MJHA 1JR3D 3ZIAA 3AVWA 4KLZA 3PXGA 4BRWA 3P32A 3HU3A 4ZCMA 3VR1A 1T9HA 2CVHA 1NMXA 3FMPB 2W2VA 3MFYA 2BEKA 4B43A 1KI8A 4G5SA 3GFOA 3IO3A 3AVVA 1Z47A 3SQXA 4V0LA 3K0AB 3KZ1E 4DLYA 1COWA 4D80A 5F3WB 1G5TA 1QG2A 3K09C 3H4MA 3IILA 1VCNA 5AJWA 4LV5B 1OFIA 1BYUA 2A5DA 1GKUB 5IDVA 4DSTA 2IS2A 1L8QA 5LD2C 4NYJQ 1PUJA 1ZRHA 4V0OA 1RIFA 2ANBA 2RB4A 3B1WA 2QMUA 4ACAA 1W4CA 2ZJZA 5D3QA 4URWR 2VP2A 3H84A 3QQ5A 2GILA 3NTUA 1TF5A 4F4CA 4ARZA 4GT1A 3VFDA 5B64A 3DDCA 4M1YA 4ASUD 4OJQA 3KTAA 3C14C 1N0WA 4LJ6A 3U4QA 3EPHA 4J0QA 3S1AB 2R6CA 3TQCA 4KAXA 3MJRA 4I4LA 3EZ2A 4M1KA 4ZDWA 5CDFA 3SYLA 4LBYA 3MLEA 4B35A 2XZLA 1MT0A 1DADA 1Q1QA 2ZRNA 4OHXA 1E0JA 4RZUA 4IFBA 4V03A 3D3QA 4ZKEA 3OZXA 4EPVA 2CLCX 2IYUA 2XITA 4PFSA 1NY6A 2ZRDA 4Q03A 1II8B 2FV8A 4FMCB 5CJPA 3ZIAD 5L3QB 4OL0A 2QAGB 1KZ7B 1DAFA 1HEIA 3L8ZA 1TU4A 2BMEA 1D9XA 2PX3A 1F60A 1KHTA 1P60A 1XF9A 3WMEA 4G5OA 1U8YA 5FBRB 4DIDA 5FPHA 3QY0A 5EP1A 1ZIPA 4TMWA 2GETA 2KJQA 3PIRA 4DJTA 4A0GA 1HUQA 5KSOA 4OYHA 4IXMA 1QHSA 4ESHA 4II7A 4HUQA 4TYYA 5HR5A 2AK2A 2P5SA 4JKYA 3QSYA 1WMSA 4QJ3A 3AH8A 1EX6A 2XB2A 1YQTA 8OHMA 4KFUA 2DBYA 4ACBA 4MA4A 3UPUA 3FWYA 5FOUA 3R9WA 3F3YA 1CULC 1NMZA 1WBDA 3AEZA 3ZS9A 2HDNB 1UKEA 1XCGB 3GLGA 1P5ZB 2RGGA 5CK5A 1Q20A 4P32A 1N5JA 4A6PA 1P2UA 1YZNA 3LNCA 1ZIOA 1JECA 1ZC4A 1E2HA 1NLZA 3AP1A 1M34E 1KI7A 3WBKA 1VKJA 3K9GA 1R5BA 1NJGA 2EU8A 4JBXA 1N6KA 1DVRA 3VX3A 2QQEA 2QENA 2ZR7A 3A37A 1U0HC 2EYQA 2RAPA 1HT1E 5KO2A 3VU9B 3T1TA 3BFVA 4YMSA 2B8TA 4ZI3A 1QHHA 1QVAA 2ONKA 4TSFA 3AV0B 3GJ8A 1KO8A 2XNDA 3LAWA 4LUCA 5AUNB 2Y8EA 2OXRA 4RFSA 2W0SA 2ZYWX 5EP4A 3R7WB 3CPJB 1KKLA 3EA0A 3KQHA 4KV9A 2N46A 3GJ3A 3KKNA 4B3GA 4LHXA 3VU9A 5E95A 1CRPA 2J0UB 2AFHE 1E1RA 2Q6TA 1MO3A 4O3MA 1S2MA 2O52A 4EJSC 4ZDKA 1JJ7A 3SYKA 1DO0A 4HSEA 4NCJA 2C2HA 2XB4A 2YWHA 3KKOA 4EPXA 2YV5A 4MGYR 5KDOA 1FMLA 2J9RA 1OFHA 1E4VA 3KQLA 5AJZA 1Z08A 5TDHA 4N3NA 4HDQB 3HYTA 1OXUA 4M53A 4JJKA 4DLSA 3ADCA 1KO5A 2J7KA 3GCGA 2ZJ2A 3IPXA 1OJLA 4LPKA 1II0A 4PC7A 3V9PA 4CT4B 4CZ2A 2YOFA 4E22A 3RC3A 1E79A 2DWPA 1CXZA 2IC5A 4M2LA 3UXMA 1GKIA 4EFLA 5JWHA 1DTSA 2JATA 1E2JA 3ZVRA 1Q3TA 1CJTC 4PZZA 4BLSA 3RS0A 3KFVA 2IYTA 1NVVR 3TVTA 3QNUA 4OK6A 1GL6A 1WDTA 1KSFX 3B85A 3X1DA 1N0VC 3DM9B 4ON9A 4B2IA 1R0YA 2C9YA 2OESA 1LVGA 4ILEA 4C4PA 5J4YA 3VR3A 1CJKC 5DHAA 4AI6A 2KSQA 3QKTA 2MSDB 3L8YA 5J4VA 1HE8B 1SKYE 1W0JA 4PC2A 2ZI7A 4TMVA 4BLTA 1K5DA 2LKDA 2NIPA 4JL8A 1GOTA 4MKFA 3VMFA 3LXXA 2QUZA 2FOLA 1E2DA 1E1RD 3BGWA 1R10A 1OH8A 2IF2A 3CB4A 2WIBA 2I3BA 2HF8A 1NVVQ 2J5XA 2XAUA 3QBTA 5EE9A 4ZDIA 3MUFA 5G3ZA 3KQNA 3THXB 3K0EA 2XJ9A 2FGJA 4FCVA 3BH7A 4XTCS 4OQLA 1P2TA 4PQYA 3FFAA 5C46F 1X6VA 3EZ9A 3LW7A 4IDPA 3SFZA 4AYTA 2WJYA 3NDPA 2JLWA 4JLDA 1DO2A 2RHMA 3TJZA 4E07A 4EPWA 2F3RA 4TSFD 3AVQA 4XWAA 3C5CA 4MRSA 1N0UA 4Q7LA 4MYCA 3C4JA 4TWZA 3F8TA 1GNQA 3NKVA 4US0R 1H8EA 2HXYA 2P6NA 2X2EA 4AURA 3DHWC 3WP0A 1P9WA 3B13B 1GIAA 1KI6B 1P61B 4NCKA 2GEUA 3EW9A 5FOSA 5FTKA 4Z1MD 2RGDA 2X19A 4QG7A 2J0UA 1T91A 4N1AA 5FFMA 2BOVA 3EWAA 3L0OA 4IVRA 3QEOA 4MUAA 4BFVA 5JBQA 4Q7JB 1WBBA 2CVFA 4HAUA 1OXXK 1UEIA 2ZJBA 2DB3A 3T61A 4FMDB 2BMFA 4Q48A 4MDEA 4LHWA 1UFQA 4HAXA 3AVOA 2F43B 1LNZA 1AIPA 1VCIA 1HQYE 3B78A 2WIAA 3VR2A 2ORIA 4HLCA 2R44A 2ZAOA 4E5UA 3RVBA 1Z0DA 1VDZA 2YC2C 3EZ6A 3VAAA 4PZLA 4M1SA 1VG0B 4R2IA 4PZYA 1AZTA 1WP9A 4EQ6B 4MRPA 2QP4A 1MV5A 1P4SA 4I1UA 1W2HA 1RE0A 5TVKA 5K8UA 3CO5A 2EYUA 4Q19A 1SVMA 1D9ZA 4K46A 1Z6YA 1ZUHA 3QXXA 1XPRA 4NTZA 4QGHA 3W3AA 4Q9LA 1G6OA 2GBLC 4ZCLA 4EIWA 3RRYA 4DCNA 4MGZR 4OJKA 5DI3B 2VF7A 4A9AA 1MO6A 2XOKA 2ZRGA 2GAOA 1E9BA 2RGBA 1F2UA 2IWHA 2KBEA 1ZNWA 1WF3A 4OI0A 2GDJA 2HXSA 5DSZA 4EAQA 2VO1A 1Z29A 2WTUA 1Z8FA 2XZPA 4HUTA 2FE4A 3GLHE 1R6BX 3NBXX 1OH7A 3B9QA 2ZRAA 1N5LA 4P31A 2WSMA 4TN1A 4ASUA 2WWHA 3L0SA 3CNLA 3FE2A 4HZUB 4AWXA 2IS1A 4PPQA 4NL4H 1EFTA 1JPNA 3EG5A 2NO6A 1E2PA 2ZRKA 4DT1A 1S3SA 3Q9LA 4P4TA 2VHCA 1DARA 2ZVPX 4ITRC 4A15A 2ZROA 1ANKA 3AKDA 3KUDA 1NLYA 1YR6A 2WOOA 3LWNA 4HAWA 2B21A 4GRAA 2LKCA 4GSYA 1QHXA 2QPAA 4LK2A 5J4LA 3V00A 2CCKA 1R0ZA 1COWD 1KGDA 3U4QB 2H57A 3SJBA 1C1YA 3RDPA 3D8BA 3U2QA 5CB8A 4YMVA 1IJEA 1CU1A 3I72A 2BIFA 2GK6A 1U9IC 3IGFA 1QHNA 3PFIA 2GK7A 3SU8A 2IS4A 1DG1G 1NVWQ 1JR3A 1NF3A 1P6XA 2W6JA 2QTFA 1GKYA 3ZQJA 1Z0KA 1RYHA 4RD4A 3P1JA 4NYIQ 5KSZA 3MD0A 2G9NA 2X8AA 2EQBA 3A1UA 5FOVA 1Q22A 4TYNA 1A5TA 5DYGA 1KK2A 2QRNA 4BEJA 5JSZA 3NBZC 1XBTA 1CF4A 3Q5DA 4PHHA 5FL7A 1PV4A 1E4YA 5CYOA 1AKYA 3SZRA 4C3ZA 3N70A 4KCGA 1LF5A 2CXXA 3A4LA 1XFAA 1HTWA 4MYHA 5H68A 3GLFE 2Z83A 2ZUBA 2ZI3A 2DY1A 1N5KA 3CLVA 4NMMA 3LD9A 2FF7A 2ODEA 2FPLA 3AQ4A 3O8DA 4US2R 4RCYA 3OFNA 2C04A 3WYFA 3RS5A 1QZXA 3LLMA 4A2PA 2BBTA 4Q7KA 2DFTA 5EP3A 1G6HA 3RWMB 2Q3MA 2ZSDA 4DDUA 4FWIB 4HDOB 4LC1A 2O0HA 1WQ1R 4PPFA 4WZ6A 2IXGA 4BE7B 1M1YE 2UZIR 4M21A 1SHZA 1FMJA 5AJYA 1F2UB 3SE0A 4NCHA 1YR8A 3BH0A 2IYWA 2F1RA 4XVQA 1E2IA 4FMBB 5F9HA 3LH5A 2ZRCA 5FL3A 2G88A 4LX0A 2WSSA 1U94A 2HJVA 4GMDA 1KYIA 2O8CA 4MUBA 1ZM9A 3L2OB 1G8PA 2Q9BA 1LF0A 3IDQA 3FHCB 4I81A 4C0BA 5FI0B 1OH6A 2ZETA 2AKAB 4EFMA 3T1QA 1IHUA 2FG5A 1CJMA 1UDXA 2QGZA 2QBYA 3O8BA 1NVUQ 4KSCA 4BLQA 3U3OA 3RS4A 4PHTA 3VHLB 1W48A 1JNYA 1EXMA 2VL7A 1N6LA 2KI5A 2OO7A 2W6IA 4O25A 1H8HA 5CLLA 3UWKA 2WJVA 1P3JA 1KDPA 3AKYA 1KO7A 4Q00A 3IUYA 5AUOB 2OCPA 3BB3A 4TTPA 4KLNA 1R8SA 2QM7A 1G4UR 1OKKD 1G5PA 2FA9A 1OXVA 4QL3A 3GJ0A 2QU8A 3QPVA 2Z6VA 3I3SR 4XH9B 2OAQ1 1SZPA 1UBEA 2Q21A 2QPTA 4NZYA 2ZS8A 5BXQC 1Z06A 2OEPA 2OFOA 3IIMA 4QHSA 2R62A 4ESVA 3I32A 1D6JA 3KTAB 3GJXC 4TMKA 4XOIA 1R0WA 1G7CA 3GPLA 4P3YA 3ZD7A 4JL5A 1UBFA 2JJ2D 3NWJA 1ETUA 1S1CA 1S9HA 1GUAA 2C5LA 4LZZA 4I99A 1KI6A 2PL3A 3CM0A 3EA5A 2RGNA 2FH5B 3P20A 2HJGA 4H1VA 4OQXA 5HZKA 2V1UA 3VKGA 4XIGS 4B75A 3RYTC 2WPDD 3W8NA 3KFXA 2JLUA 1IAQA 1XZQA 3MAAC 3V4RA 1FP7A 4LDJA 1KAGA 3KXLA 2EVWX 3VNVA 3U60B 1OF1A 5JRJA 3I4LA 3K09A 1KK3A 1YU9A 4JLPA 4ZCIA 3ZQ6A 1KI2A 5TB5A 2V3CC 2IL1A 3W3ZB 2IK8A 1G3MA 4W5JA 4IHQA 1FP6A 3J81k 2P6UA 4FINA 4IEIA 2ZSBA 4U7DA 4QM6A 2CL0X 5GADl 1TF7A 3ONWA 1J99A 3BXZA 4LV8B 3QG5A 2OILA 4OKSA 4C0KA 1XCPA 4TQAA 1S1MA 4B33A 5KDLA 4BASA 2XXAB 1TUEA 4QGAA 4KVAA 3EC2A 3IPYA 3UIEA 2O5VA 3C7KA 2F43A 3H2YA 1PLLA 3KB2A 2CHVA 1YZUA 4D81A 3GEHA 1CR2A 2BBSA 4U02A 1R0XA 4W5WA 1P62B 1MRSA 2GZDA 1W4AA 2BWJA 3C41J 3GLGE 1E9FA 2JLRA 2VP0A 5IRCD 3CRW1 2ZRMA 2ZYUX 4QJ4A 2JLVA 2ASEA 5E3HA 1OHHA 1GZSA 2CHQA 2QA5A 3ICEA 2IA5A 4B3CA 4IVPA 3CRRA 1G8FA 1G17A 4YMTA 4URUR 721PA 4B47A 4EJSB 3M1IA 4DCUA 4YMUA 3BFKA 2GAAA 1WE2A 1J8MF 2ODNA 3UMFA 3JVVA 1CEEA 1TNDA 4JKIA 4TT3A 4OHZA 2MMGA 5C2JB 4FWTA 4PHGA 2VIIA 4DDTA 5K8LA 1MR3F 1SVKA 1E9RA 5BQ5A 4QM7A 4D0NA 1JXMA 2OAP1 5FR2A 4LCBA 2ZM5A 2GXUA 1E9CA 3RRMA 1T5LA 1UBGA 1E0AA 2Q3FA 1E96A 2KB0A 3QKRB 1OFTA 3E1SA 2JAQA 2QTVB 3VR6A 4ZI2A 5JI3E 1IY1A 2IF0A 1NG1A 2R6GA 2XXAA 1OT3A 2Q9AA 4B34A 3WRXC 1XJCA 3CWZA 3SJCA 1Q1EA 3WP1B 3C5HA 2F1JA 3MWYW 3REGA 1CR4A 1VPLA 3IQXA 3QF4A 2C78A 2DCUA 1G8HA 2MSEB 4LOAA 3UK6A 2VPPA 4RFVA 4URXR 3U61B 3N2EA 5DGXA 3KJHA 4JJZA 1DAKA 1ZNXA 4FCWA 1CIPA 5JWRA 1AA9A 1PVOA 1U9IA 1UJ2A 2O8BB 1KMHA 4B32A 1PLKA 4LV6A 2JLQA 1XEXB 2OBLA 5DE3A 4DDVA 4X8MA 4EJSA 2V7QA 3QE0A 3LFUA 3P4XA 4DIEA 1KSHA 1QHIA 1XEXA 4LJ8A 1FPMA 5CJ2A 2OFWA 1JR6A 1GNRA 1T0HB 2BJWA 1J7KA 4YXWA 2ZAMA 5L8VA 1CP2A 4US1R 3AVPA 2X77A 1AS0A 3GEIA 4URYR 5E7JA 1OB2A 4KBGA 3TSOA 1W4RA 1P73A 4AG5A 5CDFE 1AM4D 4D4LA 2QAGC 1JQJC 3CZQA 3AVYA 4WVFA 2ZR0A 2ECKA 2G77B 1S3GA 3NEJA 1KTVA 1ZM2A 3A1VA 1JI0A 3OHMA 4ZO4A 1UEJA 2JCSA 2IHBA 1B0UA 1OXTA 2JLSA 2NO0A 4AKIA 1XTRA 3K0FA 4OHVA 4RVCA 3A6PC 1SGWA 4LYHA 5AK0A 2GCOA 2C9OA 3EWSA 2FU5C 1YHNA 3MG9A 4RD3A 2VLIA 2R6DA 2IXEA 4HI0E 2V4ZA 4RFSB 2G3YA 3RS7A 4Q4HB 4I1VA 2GCNA 5FOXA 2P6RA 4OHYA 2I1QA 1KK1A 1M7BA 4HLUC 1CJVC 1U99A 3W9YA 5A0FA 1N2CE 1W46A 2XTMA 2LCFA 3LX8A 2FFAA 3LY5A 3GQBA 5KNCA 3HR8A 2XGJA 3B1YA 4TZ0A 3PUWA 1W7AA 2HLDA 3P4YA 1DAGA 5B57C 3T35A 4O2RA 1KJZA 1Z6AA 4F93B 1T5IA 2GXSA 3QKSB 4Q4JA 5DO9A 4CEHA 1BMFD 5E4FA 1ZUNB 3ZGXA 3GD7A 3QIAA 1U90A 3T1VA 1IN6A 1X8KA 4BGDA 5FPKA 2WJJA 3ZLJA 1SULA 3H0KA 5FOWA 1MABA 4IDQA 4X8HA 3W6PA 2QG6A 3QF4B 1NBME 1YKSA 4KHZA 4B71A 5J4KA 4UNQA 2YHSA 4JVLA 1JB1A 1I4TD 2YINC 3IBYA 4JVNA 3U5ZB 5L3QA 1ZMXA 4TLBA 4UJ5A 1EFCA 2Z0MA 3PEWA 1F6BA 2OV2A 1E1QA 2CL7X 2E1RA 2C95A 5TXGA 1N6HA 4DLRA 2ZVQX 4QBHA 421PA 4A0RA 1IQPA 2ZRBA 1A82A 1ESMA 4R98A 3WYAA 3AVUA 3OE7A 2HUPA 4PPGA 2VRWA 2K5UA 2Z4RA 3NDBB 4D6PA 2A5JA 2F1HA 1UKYA 1A1VA 3K0AA 1Q21A 5FBWB 1V43A 2YWGA 3L0IB 4RD1A 4AK9A 3AGPA 4RZXA 1TQ4A 2QEQA 2B92A 2ZUDA 1E98A 5EE5B 3KJGA 5EP2A 5JI2E 2OXCA 4DRZA 3SQWA 2AX4A 3HYRA 3P26A 4GBMA 4Q01A 4JLVA 4UXHA 4OI4A 4BFTA 2OBMA 3MCAA 4A2WA 3PITA 1OYWA 3RSLA 1OIWA 3GLHA 4CEIA 4LYJA 4P4UA 3GLIA 4WBSA 4YQFA 2DWQA 3EZ7A 3OIUA 3PEYA 2AL7A 3U7EB 4D4JA 1KDOA 3UATA 2ODBA 3IBGA 1AGPA 4PSKA 4DCTA 1XRJA 2J87A 5CM8B 4URVR 4HLDA 3W5IA 3AM1A 4IEEA 1QVRA 1HT2E 4WIAA 3L82B 2CE2X 3LQRA 4D0GA 1G3UA 1I2DA 2WWGA 1YZKA 2NO1A 1Z22A 2BC9A 4KFSA 4QFMA 4Q4AB 3ZVMA 5FBQB 4CGZA 2QSYA 3PEVA 4B3FX 2JGNA 1MO5A 1ZD1A 2GEVA 2WICA 4DZZA 3L0PA 2R8RA 3I1FA 3WHKA 1V5WA 4ZDJA 1BKDR 2CJWA 4BEBA 1OYYA 2IYLD 3IEVA 3RHFA 3P27A 2ZSEA 1I4LD 3CR7A 2C96A 1N25A 1JBKA 1SVSA 2IUTA 3SEAA 3MRSA 4FMDF 2BDTA 4DLXA 3RS3A 1AJEA 1CLUA 3W90A 1JQLB 3CPHA 2GJAA 3BIFA 2VA8A 1LS6A 4C0QC 1NIPA 3MGCA 4XD7D 3EPLA 1PUIA 1RVDA 2ZJ5A 5SZJA 2PT7A 4XJXA 4P0TA 3WYGA 1S4QA 3FB4A 4A8JC 3ZDQA 3ECCA 2CL6X 4DVGA 2CNWA 4G01B 4F38A 1O87A 1G5RA 3BRWD 3IHWA 3T5DA 2AD1A 4FXPA 2N42A 4FN5A 2A3RA 1G8YA 2G1KA 2DR3A 5L3SA 3LVQE 1ESNA 3DMNA 2VQSA 5DH9A 4W5HA 2L0XA 2GTPA 4DSOA 4M8NE 3LV8A 1A2KC 1GDDA 4A1FA 4Z54A 4GFDA 3BFXA 2D2FA 3W34A 4TL7A 3KKPA 4OI1A 5BN3A 4RD6A 1SXJA 4DT1B 4K8OA 3VKHA 1W36C 5FTMA 4POAA 3THYB 2NGRA 2AK3A 3SBDA 2IW3A 3PUYA 1OLOA 3LQQA 5LBIA 1A4RA 3G5UA 4C2TA 1J8YF 2F1IA 2VSXA 3AF2A 4NYMQ 1RJ9A 1NN0A 2JIZA 1MO4A 4JLJA 2IUUA 3RANA 4DB4A 3NH9A 2GNOA 1CS4C 3CH5A 3PR1A 1XD2B 2R2AA 1KY3A 1W5TA 1RC8A 5DN6A 4OQMA 1NN3A 4XSHA 3FPAA 2HT1A 5DI3A 1GTVA 4LHVA 3SS8A 4W9MC 1GRNA 3UMSA 5K8IA 2GA8A 1AGRA 2HCJB 5HCIA 1N6OA 3G82C 3U7FB 3FGNA 2F55A 1E32A 3PQCA 2WAXA 4V0KA 2GZHA 3OEEA 2VHUA 1Z0FA 1X3SA 1T8UA 4DLVA 1SVOA 3REFA 1ZCBA 4HATA 5AJVB 4YLGA 1Z6GA 4ZIRB 2C98A 2GWHA 2PJZA 1XEWX 3R9IA 2C03A 3B5JA 2A9KA 4LYFA 2OCYC 2ZUCA 1OPXA 4DUGD 4NKRA 2BCJQ 4OQNA 4PTLA 3ZJYA 4WZAE 2E9SA 5FR1A 4D4MA 3X1YA 2D7DA 4Q9HA 5B30A 2EWVA 4B48A 2ZTSA 2C77A 2GJ9A 3FKSA 5J5CA 1KI3A 2A2ZA 4EDHA 2QT0A 3AKCA 3HU1A 4D82A 2F9MA 4Q4LA 2ZS9A 2BM1A 5JSZB 4W7SA 5AUQA 3U3RA 4DSUA 2C99A 3NC1C 1ZYUA 4K81B 3X1XA 4A2QA 3BWDD 5EUMA 5EE0A 4LBZA 4PANA 4RCZA 5ANRB 4B3XA 1NBMA 3OEHA 3PUXA 5KSPA 1GILA 4IFEA 4A6XA 5JFGA 1EX7A 2ZE5A 4IDNA 1JR3E 3ZYCA 1G3RA 3EPJA 4HB2A 2VP5A 2GVZC 1BOFA 3OAAA 1GL9B 5J4HA 3NHBA 4PPNA 2OZEA 3W5JA 2W58A 1N3BA 2WV9A 2FPKA 1NRJB 1MABB 4JT4A 4B44A 1Z07A 5B2ZA 4BPBA 2AKYA 3LBIA 1RRCA 1VG9B 4TL6A 4AG6A 2FSGA 3KUCA 4JIMA 2QROA 4LJ7A 1I4DD 4NYJR 4WXRA 3VKWA 5B58C 2V54A 4Q1BA 5JJLA 1G8GA 4V02A 3E70C 4F4JA 2W2XA 3QKSA 4Q4JB 3VHXA 1XTSA 1DEKA 2IT1A 3PG5A 4NHOA 4DLTA 3G0HA 1C9KA 4BRUA 4IDOA 5JEDA 4AIIA 2EFHB 5FUYA 5JZVA 3W8RA 4M1OA 5KPJA 2ZSAA 4IOKA 5KYKA 1KDTA 2V9PA 2ZI9A 2A5YB 4U00A 4AKGA 1W1WA 1UKZA 2IXFA 2D74A 2PLFA 4GP7A 4TTRA 4G5RA 3TNFA 4Q1AA 3AGQA 4QC2A 4R2HA 2RGXA 3FMOB 1EG7A 1QHHB 3R20A 3C15C 1TAGA 1IOZA 4N0EA 3B82A 2IWRA 3QXHA 2J7PA 3MWKA 3VX4A 4LBVA 1ZU4A 2JDIA 3X2SA 3FFBA 3RRNA 1ZJ6A 1G3IA 1M6NA 3ZZUA 2HV8A 2J0SA 2ANCA 1OB5A 3EPKA 2QE7D 1IXRC 2IEYA 2WKQA 4QKQA 3AVTA 1J70A 1HY3A 2NMVA 2QRZA 4HEJA 4Q1EA 4RZ2A 2QY9A 4GNKA 3CONA 4TMZA 4TMTA 1DBSA 1DELA 5LPNA 4Q9IA 3Q85A 4M9SA 3EAQA 4CW7A 2VTKA 3CX8A 4MKHA 5UKDA 1MOZA 2YC4C 5AR1A 3C16C 1SVLA 5IK2A 5JCZA 4IDHA 3KXIA 1E2LA 4KODA 2OCAA 2PZEA 2H1LA 1AS2A 3BE4A 3BK7A 5TARA 3TUJC 4LWZA 5KNBA 5JLJA 5FBLB 3KQKA 2GRJA 3K53A 2FWRA 4LJ4A 3D31A 2CCJA 2AXNA 2FFQA 5E7MA 5C4MA 5IK2D 2JJ1A 1ZCAA 2J46A 2VEDA 4L9SA 5KSYA 2Q3HA 1G21E 3JZMA 4WOPA 5GVRA 5JMTA 2ZREA 4Z8XA 1W44A 4NCIA 1VCMA 1X1RA 1DS6A 5E7IA 5JECA 3PV0A 2PZGA 4JLOA 2XZOA 1GITA 4YDHB 1TQ6A 4H9GA 4BFYA 4HLQB 2QE7A 4XVUA 3VQTA 1E2FA 3NIBA 1W36D 2XSZA 1GG2A 1ZD9A 2PCJA 1JXOA 1M2OB 3SN6A 3CF2A 5A5GA 2JDID 5CM9C 5EXXA 2J7PD 2WMOB 4M1WA 1KMHB 1AZSC 5HE8A 5DISB 4BFUA 1AKEA 2QPOA 1E3MA 1EFRD 1JAHA 1CR0A 3VR5A 1H65A 4MH0R 3BJIC 4Q9JA 5BYJA 5L3SB 2ZITA 3X1WA 1Z5ZA 4EKDA 4Q1DA 1IJFA 3H1TA 3EARA 3FMFA 4BZQA 3BD9A 4LYAA 2XTZA 5CIQA 1X86B 3THXA 2ATXA 4PO1A 4O0MA 3GLFA 4LJYA 3BERA 1IY2A 1PLJA 3UMRA 3A4MA 3IO5A 2PZFA 4L8GA 4RSGA 5EZ5A 3DPUA 3NVAA 1DPFA 5JS7A 5CLQA 2ZS7A 1TEVA 3NG1A 1ZVQA 4HUQB 2A5FA 1TX4B 4C0AC 1B23P 1EK0A 1US8B 1XMVA 4JSTA 4MYTA 5JRZA 1Q1ZA 2ZIAA 1FW6A 4KBFA 3ZZ0A 5A4JA 4QHTA 4UJ3A 5JHGB 4DKXA 3GJ6A 1ELOA 4WXPA 3QJYA 5HKKD 1JEDA 3RAPR 4O2LA 1NP6A 3ZVLA 1BIFA 2QAGA 5CIWA 2YNMA 3I8XA 4GOXA 3QG1A 4PXAA 4Q4AA 2ZSFA 3B60A 2FFBA 3ASZA 3HDTA 4EUNA 3E2IA 1IXZA 2D4HA 2YVUA 2QT1A 4R71A 1NVXQ 2ZRPA 1GFIA 5KHOC 3T1OA 3WY9A 3BS4A 5JWOA 2ZRHA 1NLFA 1G18A 2RMKA 4G1UC 1UDWA 4JBYA 2NPFA 2R6AA 3QXSA 1U98A 1XTIA 2CMKA 3BAFA 5C1BA 3OEHD 3I8SA 1NBMD 3OIWA 4LC0A 2CK3A 1XD9A 4V0NA 1N5IA 3DZDA 1ZP6A 5EQTA 2ZRFA 5JCPA 1G64A 3NHAA 1WXQA 2ZXUA 2PBRA 1J2JA 4EPYA 5HE9A 1E9DA 5TY0A 4OI2A 4KXFB 3X1ZA 4B76A 4WZBE 1E2NA 4JLBA 1SQ5A 5BN4A 2F3TA 1E9EA 4LI0A 3EX7C 2O8FA 2C9CA 2JASA 3AKEA 2PCLA 1W0KA 2WKRA 4HAYA 1LTQA 4MYUA 4OBEA 1T3LA 1KOFA 1HQCA 1UBCA 1XNJA 3I92A 4DUGA 1T3SA 2RGAA 2RH5A 4M22A 1XPUA 1LFDB 1XD2A 4C0JA 1DAEA 1CRQA 4NPHA 2QZ4A 1KI1A 1QBKC 2J3EA 3AUXA 2ZYTX 4HLUA 2OLJA 1S0UA 3ZVNA 5EXPA 1TPZA 4UXIA 1US8A 2BBWA 4NU0A 4Q47A 3KDSE 4FMCF 1XXHA 5FBVB 2HT6A 3THYA 2GESA 1Q12A 3UKDA 1KNXA 2QMHA 1LV7A 2OT3B 1NN5A 4PQFA 4B6EA 1G19A 2VH5R 4IW3B 1DAMA 3M0EA 2Z43A 1R5NA 1GL7A 4PC1A 3WNCA 5DN6D 3I61A 1KAOA 2REOA 3HWSA 4DSNA 3EC1A 2O8DA 2OFXA 5DYIA 4Q21A 4DLWA 4Q02A 3PVSA 4WA7A 5L3VA 2CHGA 4FI3C 3EASA 2H7VA 3LRPA 1IN8A 1W0KD 1EGAA 5KU1A 3CH4B 2PX0A 4YONB 1NY5A 1SXJE 3OIYA 4DCVA 4BFZA 3ZH9B 3ADKA 2CEAA 3AP3A 5JJKA 2O8EB 2H17A 4BWYA 1ZM3A 4BZPA 1F2TA 1XTJA 3HU2A 5HPYB 2QBYB 4LY6A 3UG6A 1UKVY 4KYUA 2EFCB 4TQ9A 3QI2A 1QF9A 3AF3A 3BC1A 3DKPA 1SVWA 1NN1A 3DEFA 3IHLA 3GLIE 2BCGY 2CK3D 1P72A 4LJAA 1E6CA 2GF0A 2ZRIA 4D0LB 5GJBA 1RFLA 1ZNZA 4RD0A 2DFLA 3EZFA 4DEYA 4P33A 2IYYA 5BWMA 2P0EA 1K5GA 3T5GA 4LRWA 4XWOA 4DXAA 4QJ5A 3QEJA 4XD7A 2IYXA 1T0JB 1KIMA 2D2EA 1AK2A 2H16A 2OG2A 4CEJA 3SHWA 3T12A 1Y63A 2B7BA 4JLAA 4R7ZA 2XJ4A 1II9A 4BFXA 2FEOA 3SNHA 2RCNA 4ZIRA 5BW8A 4IRUB 5HKKA 2QP3A 4KVGA 4OHWA 4D2IA 2YOHA 2DYKA 5FPYA 2FSFA 5KTYA 5JEEA 1G291 2X2FA 3D6TB 4B2LA 1GM5A 1TF2A 4CIDA 3WXMA 3W6OA 3GP8A 3NC0C 1NL3A 4DCSA 3M4YA 2FPMA 4HDCA 3AB3A 3E5HA 4M9QA 4NCNA 2GHIA 5EXTA 5AUPB 3D7MA 2WZQA 2JLZA 1XJQA 2BBOA 2ZR9A 2BKUA 3TSWA 1NSFA 1IONA 1J90A 2I4IA 5F9FA 3QPWA 3U6KA 4G3XA 1VCOA 3MMPA 3CBQA 3K8YA 4Q5IA 4QRHA 3DOFA 4GMXA 5GJCA 3OIVA 4Y0AA 3T06B 1IN7A 1EFRA 1YJ5A 4GOJA 3QVUA 2AN9A 3FHTA 3CNNA 1ZW6A 2YWFA 4RY2A 4JT2A 1P7CA 3TUIC 2FSHA 2VHJA 3LXRA 4TYWA 3B6EA 5FUVA 4G5QA 1Q1BA 2XSZD 2ZJ8A 1E9AA 2IYQA 1L4UA 1SXJB 2JEOA 2YOGA 4TLDA 2O0JA 2WBLC 1NNEA 2ZRJA 3WNDA 4OQFA 2IS6A 5FI1B 3TIFA 4QXAA 4PAOA 1NKTA 2FX3A 3GJ4A 3TKLA 3KXKA 4A36A 2WWIA 1Z2AA 3EIQA 1T6NA 4GZMA 3PCRB 4A82A 2IYRA 1ZU5A 2JJ1D 2NZJA 3OE7D 1S96A 4V0ME 4GP6A 5HZHA 4IVQA 1RPZA 3Q5EA 1R2QA 4CEHB 4C7OB 4MGIR 1QHYA 2V6IA 3WMGA 4HB3A 2IYSA 5LB2A 1F5NA 4Y0VA 1E1QD 1Z83A 2P5TB 1T8TA 2O0KA 1U0JA 1YZGA 5EXSA 4EPTA 2FDCA 4P4SA 4DWJA 2NG1A 4YDSA 2KE5A 5C18A 3VNUA 4CVNA 4Q4HA 1JALA 2QSZA 1WCV1 3LW8A 3SJAA 4QBIA 2AWOA 3IKJA 3WHLA 3B2EA 3TW4A 1N6RA 2QI9C 3NXSA 2RGCA 3RABA 3LLUA 4KYIB 4X8OA 1YR7A 2ZJYA 4HZIA 3RNLA 4AY2A 3RC8A 1XX6A 3HJNA 2P2LA 5AWFC 1CKEA 1VG8A 1OXSC 1P9RA 3IQWA 2Z5FA 5FTJA 4LPSA 5DNYB 1I2MA 1KZGB 1FTNA 1XP8A 3HP1A 2TMKA 2FSIA 1XDBA 4ZV4A 4ZPXA 5KOYA 1VYVA 4MKGA 3U3KA 2J0QA 1YE8A 1RKBA 4HB4A 5JHHB 3CX7A 3GLHB 4JYBA 3RWOA 1CJUC 4RKFA 4ZKDA 1HA3A 1HURA 3UANA 1ZM7A 2EFEB 3I73A 4A4DA 4F4IA 1G7TA 4HAVA 1CBUA 1TU3A 3HPQA 2CE7A 3O47A 5EE3A 1BYIA 2BJVA 3Q3JB 2B7CA 2QL6A 1EFHA 3AVXA 1VHLA 1G41A 2UZ3A 3TW8B 4LBWA 2PJRA 1QRAA 4Q7MB 4A8JA 1W5SA 4LHYA 1KMQA 2BEJA 1Q44A 2XNSA 4XTRA 1P9NA 4Z8YA 1YVDA 1R5OA 1CR1A 3WNBA 3TVDA 1UF9A 3OAAD 4BFWA 1PZNA 5D3MB 3EIHA 2PMKA 1FX0B 1VECA 2GXQA 2G6BA 1U81A 3LA6A 2QP9X 2P3SA 1D2NA 5FTLA 4URZR 1RW4A 1A7JA 1KK0A 2VP6A 3PUVA 1ZD8A 2ERXA 4LJ9A 4LSGA 4Q66C 2FMXA 1RRFA 3CZPA 5HTKA 4NYIR 1E2KA 1XWIA 1YZLA 4PO8A 4NONA 3GFPA 1W4BA 2GBLA 4MDFA 3SFVA 3DKVA 2ZE6A 3RS2A 2WVJA 4S35A 4UNRA 2H8KA 2SHKA 4F7WA 3QF7A 3QENA 4P4SB 3FKSD 4PSAA 2B8WA 821PA 3RSOA 3KKQA 1LY1A 3EIEA 2ZU6A 4CF7A 2WJHA 1SKQA 3THWB 1Z2CA 2IHYA 4EPRA 1XXHE 4TYQA 2R6FA 4KU4A 3K9NA 4QOSA 1KNQA 2N1BA 2BKEA 2GJSA 3TRFA 4PX9A 1R4AA 4BECA 3FOZA 3SI7A 1KY2A 1R8QA 2X1VA 1AS3A 2VSOA 3CRMA 4NYMR 1IXSB 3OEED 2PT5A 3KJIA 1UADA 3ADBA 1XEFA 4FD2A 3THOA 2BM0A 3BB4A 3CR8A 4TL8A 4TT3D 2REXB 3I5XA 1BH2A 4YC7A 5G41A 1W36B 3ZZTA 1JEEA 4GPTA 3KL4A 3SYNA 2PMDA 2GXAA 4DLUA 2FJUA 1KKMA 1ZM4A 1VG1A 1XCMA 1YRAA 2BVNA 2W83A 2WWFA 3BBPA 4WAUA 4HB0A 1N6PA 4TLCA 5J47A 1HV8A 1TMKA 2HYIC 2CDNA 1GNPA 1JPJA 2JIZD 4UXJA 3R7WA 1OHHD 1G20E 1Z0JA 1U8AA 2FEMA 3U3JA 5G40A 4D4KA 1KDRA 3U6BA 2WHXA 4PSVA 2A5GA 3DM5A 1L7VC 3CIOA 2P65A 2R65A 3F5FA 4I1SA 3TGPA 1NIJA 1EWRA 4GOKA 1IM2A 1SXJD 1U0LA 4PC6A 4QGGA 2FNAA 3SR0A 3MWLA 4RJLA 3I62A 4L15A 2YWEA 1A2BA 2GEDA 1DG3A 4Q1FA 4QGFA 1WB9A 2IYVA 4LGMA 4M4SA 2NTYC 1G3QA 2D7CA 2VF8A 3CUEF 4GI7A 5KDDA 5J40A 4LHZA 5SZIA 3CKLA 4NH0A 4Z51A 1TADA 3JVUA 1LW7A 1T3HA 1WA5A 2EFGA 2HCBA 3SOPA 4C0LA 4WW0A 3PEUA 2V6JA 2CNWD 4DHEA 2G1JA 2GVDC 1F2TB 2JA1A 4MQBA 2WOJA 3AF4A 1Y3AA 1Z0IA 3GFTA 4MITA 5FUWA 2WM9B 2ZU0C 4R9UC 3B1ZA 3N2IA 5FOTA 1GAJA 3FHOA 1U8ZA 1W47A 1FZQA 5CITA 1QDEA 2EFDB 1E2MA 2P67A 3B8HA 4JBWA 3TE6A 4JMPA 4FCTA 3IIJA 1XXHB 4HZUA 2JJ2A 4TQUS 1VYTA 3QKRA 2EW1A 1X8LA 4NE2A 3A36A 4BLPA 3RLFA 1K8RA 1OIXA 1SVIA 3S1AA 3IIKA 1GRQA 3UWOA 1E2QA 2GZAA 1ODFA 1VHTA 2VP9A 3SDZA 2BV3A 1EESA 1EWQA 4B3DA 4XVRA 3FTQA 5F98A 4MRVA 4DEXA 2D62A 4GZLA 2OSBA 2PEZA 4QBFA 5CYPA 4KITB 1H8HD 1Z3IX 4FW9A 2W6ID 2IX3A 2O8FB 2CLDX 3DMDA 1FUUA 2MMCA 4L5BA 1XU4A 4TLEA 3WMFA 1GRRA 1ZUIA 3SC3A 1Q57A 3OF5A 2ZRLA 3A58B 4EQ6A 2KWIA 1RRGA 1TTTA 1XPOA 1OFUX 2O8DB 1F3OA 3A8TA 3KQUA 5G53C 4RD2A 2DPXA 4UKDA 2DWOA 2F9LA 3CPEA 3CRVA 4V0MA 2GCOB 4MRNA 3TMKA 4IOJA 2ZJAA 4F92B 5JS8A 5TV2A 5LD2B 1AQUA 3SHFA 4U5XA 3WBJA 3GMTA 3TLXA 1Z28A 1YZTA 3EXAA 1JJVA 1KI4A 1G1MA 1OSNA 2JLXA 2AFIE 3R8FA 2KBFA 2ORWA 4C9BA 4DDWA 1FUKA 1MRNA 1SKYB 3C8UA 4GL2A 1DE0A 4Q1CA 4M9ZA 1G9XA 4AC9A 5FPTA 4BFSA 3QBVA 3QXJA 1E2GA 2GJKA 5EJEA 3FDIA 3KJEA 2WWYA 4M0LA 1HE1C 3VR4A 2XX3A 4UNSA 4CYMA 221PA 2AR7A 1KI9A 2H18A 2WKPA 3H86A 4I1OA 2BMDA 4B3BA 4PAQA 5IF9A 1XJ0A 3OFND 1NSTA 1D2EA 4BLOA 3QVVA 4JSYA 3GJ5A 3NBFA 4RZ3A 1GWNA 1VMAA 3CWQA 2VBCA 3Q7PA 1YR9A 1IN5A 2HEIA 1KO1A 5JJIA 4KFRA 5FL7D 1XTKA 1TEXA 5C4GB 2ONJA 4JL6A 5DIFA 3TK1A 1BS1A 1OW3B 1X8JA 3NH6A 4JLKA 4QHYA 5FUXA 4ERNA 1RJ9B 1PJRA 4GDFA 1D2MA 1BMFA 1ZINA 4MKIA 3FVQA 4X8LA 4JVMA 1DAHA 3U44B 3UG7A 1Z63A 3O8RA 1GSIA 2HLDD 4PHFA 5H1YA 3K9LA 3TSZA 1DAIA 4C30A 1E0SA 1WRBA 2PEYA 2ZI4A 3OESA 3TAUA 3DVLA 1YZQA 2ODWA 4CT5A 1JAIA 2W6JD 3N5CA 2AHOA 3QPUA 2QNRA 5M04A 1M7GA 3QOFA 1M8PA 3GLFB 3W6NA 3LO5A 621PA 3PENA 3U7GA 3CX6A 2WWXA 4NP6A 2OE2A 4TL9A 1TQ2A 2ZE7A 5IHPA 2D06A 1Z0AA 4KO8A 3ZD6A 1LS1A 2J45A 4DC9A 3F0TA 1G7SA 1MH1A 3TQFA 3A1TA 1GVNB 2OUKA 4F91B 4RKEA 3B9PA 4QNMA 1G16A 2ERYA 2QQ0A 4BZXA 2VSFA 3BH6A 1TQDA 3AUYA 1BO6A 5H8WA 1FFHA 1XMSA 3K1JA 4IOMA 4M9XA 3Q7QA 2NQ2C 5P21A 1D8TA 1E94E 4BLRA 5LB4A 1FL9A 3T34A 2WWWA 1NJFA 1KJYA 2DFNA 3IEUA 4AYWA 4BQSA 3LBHA 2QTHA 5G3YA 1G7RA 3KX2A 4YXWD 2CCGA 2A30A 2J59A 3K9HA 3L43A 4IJMA 2QAJA 3B1XA 1E9SA 2ZEJA 2EWWA 4A0HA 4B73A 5DI9A 3JZAA 3TH5A 4N0DA 2B6HA 2NO9A 2V7QD 3K0FB 5EZ6B 5F2EA 5SZHB 2XTNA 1CTQA 3A1WA 4HAZA 4A92A 2XOKD 5SZKB 4FIDA 3A1SA 4BUJA 3FKQA 4B2PA 2RKOA 1OIVA 5FTNA 4QBGB 5CB6A 3Q8XB 2ZYVX 1W49A 3U7HB 2DHRA 3T15A 4TLAA 3SBEA 4KI0A 3GEEA 2RHDA 3TBKA 4IOLA 3KB1A 1TL7C 4DLZA 2AXPA 4B6FA 2MSCB 2LWIA 521PA 4KFTA 2IBMA 2A7QA 1VTKA 2FZ4A 121PA 4DB2A 4NDZA 2WJIA 4AKEA 1XTQA 4E09A 5KPDA 3AP2A 1K6MA 2O8BA 4C7OA 3QKUA 4Q18A 2E87A 1S8FA 1Z6XA 2IYZA 1KSJA 2YZ2A 1SXJC 5GVSA 5EUQB 1IBRA 3DZ8A 3GLGB 1XB2A 1SHKA 1S9DA 3TAHA 2ATVA 2OCBA 1GP2A 2Q9CA 1RRPA 5AJXA 2UVQA 1EFUA 1VIAA 2GJ8A 4L9WA 5KUTA 4D26A 4S2EA 4HYYA 4PQRA 5GJVC 4PC3A 4Z1MA 4UNPA 1TUIA 1KO4A 3ADDA 4JLMA 3ETLA 2IEZA 3LDAA 1IN4A 1Z6TA 1L4YA 1FX0A 1H8ED 5D3MA 4G5GA 4JVSB 3AF0A 3PUZA 3CF6R 2VHTA 4MRRA 4G0NA 2UKDA 2F7SA 1XD8A 1FQJA 1Q0UA 3ASYA 1FQKA 4XWKA 1RYFA 3BOSA 1G4AE 4A8JB 1II8A 3HPRA 4JLNA 1F48A 3B1VA 2AD5A 2W00A 5H70A 6Q21A 2JJ8A 4AKHA 2WAYA 4JYCA 4MGKR 3AF1A 1UAAA 4UNNA 4QNRA 2WJGA 5ELXA 3THWA 2GKSA 4YMWA 2V1XA 3KKMA 1XEWY 4C2UA 5K8TA 1FNMA 2H5EA 2ZE8A 2RGEA 2J41A 2R9VA 1ZBDA 3TR0A 2NOAA 1W0JD 1XMIA 4IXNA 2ZI6A 5TMPA 3K70B 3A4NA 3BORA 3LBNA 2GCPA 4EFNA 5KNDA 2WPDA 4D25A 5CK4A 2YKGA 3BB1A 5FPSA 2HYDA 1M74A 4ARZB 2VYFA 3ZS8A 4CRWB 4CEJB 2QORA 1KSGA 3HR7A 1OV4A 2NPIA 1OH5A 2OHFA 1W2GA 2CBZA 1E0KA 2AWNA 1FOEB 2F6RA 1P2VA 3MSXA 2PH1A 1T4GA 1E79D 1QHGA 1XMJA 1ZAKA 2C8VA 1X1SA 3LVRE 2OBNA 2QM8A 1U2RA 5LDDC 1MKYA 4E03A 3V4FA 1OKKA 3GJ7A 2ZQ5A 4AYXA 5IT5A 2GF9A 4KSBA 2NO7A 2V55B 5BYKA 3K0SA 3DO6A 2VHQA 3CRQA 3NEYA 4PAMA 3TR5A 3U3MA 1Q3HA 3CF0A 4OK3A 2IUSA 4TYPA 5HCNA 4LJ5A 1HH4A 4UQOA 2FN4A 2RGNC 2XEXA 2OLKA 1P75A 3R9XA 3VTKA 1NKSA 3Q72A 1KJWA 3ICQB 1DOAA 1OE0A 4PR0A 1N6IA 2G83A 2WMNB 3RRZA 4M1MA 4Q9KA 1ZC3A 4JZKA 2ZANA 5EE1A 3K70C 4ABYA 4AD8A 2H92A 3CNOA 5FH9A 5DLQC 2NZ8A 4JS0A 5DHFA 1QG4A 2WSSD 2G0NA 2XNDD 1O3YA 1E69A 1UPTA 3FYHA 4TTQA 1M7HA 4B74A 2YYZA 4H1UA 1NMYA 3QXCA 3NBYC 1FNNA 2CLSA 2QGNA 2PLRA 2REBA 3LX5A
chains in the Genus database with same CATH superfamily
4RZIA 4C0SA 4FKMA 4QTZA 2RAUA 3D6FA 3K0CC 4ZRDA 2QN3A 4I0WB 1LB1B 5CDHA 4GZ3A 1L2TA 2IP4A 3W7VA 3TQQA 2HSGA 3IVGA 3WNZA 1SAYA 4CN9A 4OHBA 4UU1A 4BKRA 2J0VA 4FZ3A 3QEMB 3UAGA 3E4CA 4L16A 5AQEA 3MT7A 1UMCA 2YJTD 4KJZA 1JG6A 1ZNYA 1VYUA 2W2TA 1TK9A 3K0CA 3KWJA 1X80A 4NBSA 4PAWA 3I2IA 5IANA 4IQ4A 2CD9A 1HTBA 2HJWA 3PHIA 1RI3A 2W2LA 3UYKA 1C4OA 1SUFA 3DE5X 1UL1X 1KZ1A 2QMOA 3TUZC 2OM2A 4CL0A 5KWIA 2JIQA 2FPOA 2P6OA 1TA0A 2C4HA 1RM3A 1ZSYA 1OYVA 3NTVA 3QUSA 5F4BA 4C6TB 4HYTA 4UUOA 3PJRA 4DJEC 4C01A 1QGED 1N6NA 1AKUA 1KA9H 5GJWC 4OO3A 1RNLA 3B70A 2YJ3A 3SQOA 1NI3A 2FMIA 1SBQA 3VR5H 3R3WA 1QJCA 5E9QA 2Q0HA 4TWRA 3I5YA 2YHIA 2OZLB 2BI8A 1RRKA 3ZR4B 3GLIB 4GOMD 4KQWA 5BRJA 2XYGA 3V1UA 1ODKA 2I6TA 3DOEA 2G0TA 4L4UA 4LSWA 4CM1A 2YV4A 1U7HA 3O8CA 2OBYA 5A9RA 3TDNA 1L4MA 1U11A 3EOZA 2EX1A 3N2KB 4XQEA 4DLPA 3TINA 3MJHA 5JO0A 5K0CA 4PFJA 4KLZA 2LZ0A 3PXGA 2VJNA 4PINA 1UZLA 1F8YA 3ZQKA 3QYPA 1Q77A 3P32A 3HU3A 2J3JA 3LYAA 5GWXA 4ZCMA 1IXYA 5FA5A 3L07A 2CBXA 3MFYA 4B43A 2G7MC 3BHIA 2C7GA 3TFWA 1UDBA 4UTPA 2PLAA 3WSVA 1ILWA 4KO1S 3AVVA 5JCOC 4V0LA 1KVRA 3N3BC 1P1JA 2O7SA 4GBED 4IGFA 1G5TA 2QLLA 3MRTA 3H4MA 3IILA 3FTFA 1EBFA 3IVXA 1E6EA 3CVYA 4EYSA 3KOWA 3OOYA 4HRYA 4LNUB 4BKQA 1EE9A 5C8YA 1L8QA 3JD3A 3HUUA 1JXQA 1JYEA 3O93A 3B1WA 1F17A 2A88A 2ANBA 1OC2A 4N7RA 2XWBF 4R8KA 4ACAA 4ZGBA 4LRSB 2CWWA 4URWR 4RZSA 1DKUA 5FIUA 1TF5A 2QF7A 1W88B 4G67A 4QSMA 1KJQA 4F4CA 1XA3A 5BN4B 4XE5A 3KTOA 3ZTTA 4FUTA 4FYYA 2QVLA 4OJQA 2NTEA 1XTVA 1T36A 2NP7A 3O1HB 3HA5A 1K6JA 3MF4A 5EHNA 2WPNA 4HX2A 4LJ6A 4DA9A 1KYWA 4DWVA 3S1AB 4QARA 1Y34E 1ZH6A 1HDCA 4X61A 1EHYA 4I4LA 5JNRA 2X3FA 4JC0A 1QE0A 4M1KA 3C3BA 1K6XA 3DD5A 1YK1A 2HSEA 3AEKA 1LBIA 4LBYA 1U9JA 4ALLA 1BW9B 1D0VA 1P0FA 3FSRA 4OHXA 3QU7A 3T9BA 2FOIA 2PUHA 1F8GA 4G0OA 4IFBA 5ALDA 4DZRA 4G5HA 1RKQA 2Q4DA 3AMVA 3HM2A 3OZXA 3R6WA 1XRMA 2XITA 2LRHA 4L4SA 2XE4A 1UWLA 2FV8A 3UGTA 3ZIAD 3CEHA 3NQ41 4TM8A 5KNDH 2A8YA 1LSUA 2VJMB 2ZG6A 3R4VA 3TI9A 1E3EA 4I36A 2OHGA 3AEQB 3T3OA 5ALQA 4GR4A 1K0FA 2HLNA 1F60A 1KHTA 2M6KA 2IZOA 3BK1A 4QAQA 1T9AA 3O94A 4B6PA 3A10A 4DIBA 1U8YA 4QOHA 4CR7A 5FPHA 4M60A 3QY0A 5KQPA 4LMBA 3ISVA 3PIRA 4FX2A 4L6IA 3JD2A 3VSAA 1HUQA 5KSOA 3KZOA 1WD5A 2R8ZA 2Y66A 3AB7A 1KS9A 2BKAA 3NW9A 3IPCA 4TTAA 5A04A 4TYYA 4JKYA 4EY5A 1U2GC 1SU4A 3VPGA 4FGLA 3AH8A 4RVHA 1EX6A 1U3WA 1EFDN 2QD2A 1SIWA 1YQTA 3GDFA 4IMRA 3S5UA 4DV0B 1BE0A 1ZBQA 4DV3B 4KFUA 2CUTA 1ACMA 2DBYA 5SYMA 2W2LD 3TOXA 1WUIS 2OHJA 2H2HA 3DVAA 1JHVA 1OWOA 4RJJA 2HF7A 3AEZA 3D4PA 1UKEA 3ELWA 3PHCA 2R1TA 1JKJB 2PPLA 4G23A 2RGGA 4Y7DA 3V4SA 1Q20A 3VNSA 4MHTA 4RA9A 1ODTC 4EG1A 5KYUA 3LNCA 1T9BA 4Y2RA 1AB5A 2XDAA 2AFRA 3AP1A 1E1CB 3K9GA 3HMKA 1R5BA 4DQDA 2EU8A 4Y6GB 5AUPB 4JBXA 1KYXA 2EFJA 2VWPA 2SECE 3ROXA 3V4OA 2CVOA 3N7UA 2IIVA 1DVRA 5C37A 4R40A 3W7AA 3ETNA 4FD3A 3Q8LA 4LF4B 3ZWDA 4DQKA 2WSBA 4HNGA 1CQIB 3DLAA 4IV5A 1U0HC 2Y3IA 3AUJB 1ICIA 3G85A 1HT1E 3IODA 3GVXA 3GQBB 4IQGA 5M29A 5KO2A 4IWNA 1ULUA 2A4MA 2I6XA 3PSHA 1FVFA 3ASUA 1QVAA 1GPMA 2VZ9A 4OH1A 4OIMA 2QVYX 5B7NA 1KO8A 2EOAA 2VK8A 4MHSA 5EIFA 2PRIA 3PFHA 1K7CA 1KYZA 2JAOA 2WILA 3K8QA 2H2GA 5E6UB 5JROA 3GGCA 5DX8A 5NULA 4OREX 3R7WB 4B2YA 3R5TA 4QREA 4XR4A 3KQHA 1CSEE 5JQGB 3WYDA 3QFRA 1Z5OA 4LHXA 4LX8A 4WESA 1HLGA 1Y1QA 3VU9A 1BXRA 2HO4A 2X3UA 3LVBA 4O3MA 1S2MA 3PPWA 3FCUB 2PZ8A 1O4VA 3G2OA 3EVGA 4HSEA 5KREA 4YUZA 1H6CA 4ZOLB 3KKOA 2YYYA 1BH6A 5CM2Z 2R66A 4EPXA 3RTBA 2OP0A 3UHPA 2RBEA 3WLOA 1FMLA 2J9RA 2VXOA 2R6JA 3H16A 3OCYA 1TA9A 3OTQA 5AXAA 3WL4A 4AJKA 5EHQA 2V96A 3WIVA 3FCOA 3CG4A 1G1AA 2GRAA 3L3BA 3BJEA 2O1SA 4M46A 3EXFB 1QH9A 5DW0A 3MJSA 4M53A 5EKSA 1P7YA 4YCAA 1RAGA 2J7KA 2IITA 3IPXA 3ZE0B 1A04A 1II0A 4PC7A 3SOZA 2YTZA 1L7BA 4C7JA 4CZ2A 2YOFA 1ZJWA 1MB2A 1RQLA 1E79A 2GEJA 4HL6A 2C5BA 3PX3A 5CFMA 4I4IA 1FS5A 4TKZA 4HFRA 4M2LA 2PGDA 1GKIA 5K7SA 2JATA 1UBSB 3FNRA 3AB8A 1CJTC 1F6WA 1ZGBA 3J7TA 4NZMA 5FFNA 3FFWA 3QLUC 1H9AA 3WO1A 3I37X 3FR8A 1ZHOA 4XM2A 1BDJA 4OK6A 1DRWA 1WDTA 2HRBA 5HG0A 2SCUB 5JNTA 2QD4A 5EMNA 4X91A 2EP5A 1R0YA 1DBRA 1ODLA 3OIFA 5H3HA 1PF7E 2O8NA 3IPLA 2C9YA 3OOSA 1PZXA 4S1NA 2IX9A 4Z3DA 3DH0A 4C4PA 4AI6A 1ISIA 3B6MA 2EZ4A 5J4VA 4M0FA 4XFKA 1K63A 3PT9A 1L4KA 1N2CA 2ZI7A 3IXMA 4BLTA 1DG9A 1VJ5A 3RYIA 3UKOA 3FDFA 4AXBA 1I7LA 4CCYB 4JL8A 1GOTA 4HH0A 2RAFA 4Z4EA 3L1JA 4E2YA 4NMLA 3RUCA 4TXHA 2AOVA 3GBVA 1XDSA 3BGWA 1GQRA 5HFJA 1VM6A 2IF2A 5BSUA 1KBZA 1XAJA 5P8WA 1A98A 1RHJA 2G5GX 3ZX4A 4Q9DA 4ZJPA 1W2WB 2ZM6B 4YPFA 4PLCA 6GPBA 1MJHA 2P9EA 3FGOA 5C52B 2VDUE 5IC5A 3K0EA 2XJ9A 2ZTHA 1X6VA 1QVVA 4R1MA 2C7BA 3L05A 4OP3A 3HXLA 3L0CA 4QDTA 2CZGA 5THQA 2RHMA 3BEOA 4EHAA 2F3RA 4TSFD 4K6FA 4XWAA 5IVDA 3V7UA 2R5NA 5GP1A 3ED5A 3L1KA 3OX4A 4MV0A 4MRSA 3C4JA 5DULA 4A26A 4ZT4A 1UMKA 3PCXA 1WVMA 4J0DA 4J8PA 2WF8A 4JA2A 2HPHA 3TBFA 1KMMA 2P6NA 2X2EA 3U81A 3PA8A 2VUUA 5CVUA 1MB4A 3KKZA 5I4BA 3WP0A 1P9WA 1GIAA 1NDHA 3WLLA 4H6XA 2GEUA 4Z1MD 2X19A 4QG7A 5I8PA 3UUWA 1M2NA 2RONA 3HUTA 1IBLB 1G6Q1 2JFBA 2O2YA 2P8JA 2BOVA 3O82A 4BJ6A 2XODA 2DBRA 3QEOA 3K2EA 1JDBC 2NX2A 3NM4A 4BFVA 4MW0A 1YJAA 3SM9A 1X3LA 2DPYA 4BQIA 4Q7JB 4RPLA 2CVFA 1EXWA 1V6AA 2CLKB 1G21A 1VIDA 3QP9A 4JVOA 4MV4A 3T61A 2OV8A 2MYTA 2OZPA 2TS1A 2BMFA 2VJCA 4MDEA 5IYZB 4YBZA 1GQQA 3SC2A 3I1JA 4KQIA 3UMMA 4R41A 2TSYB 4C06A 3AVOA 1MB9A 1DXOA 2F43B 4AECA 1NYLA 3OECA 3QU9A 4BC0A 4ZYTA 1HQYE 2BFMA 5H9WA 3FMVA 5I47A 2DLNA 3DL2A 4GYWA 3RAEC 1KVQA 4QRIA 4BVFA 1WZ2A 1U2ZA 2ERCA 4JZYA 3VR2A 1VJCA 2NU6A 1TECE 5JH7F 1CZKA 4WFIA 2H1CA 3LT5A 4WUVA 1U02A 3ZCSA 1ZOSA 4YJHA 1VDZA 4DMMA 5EJ7A 1K1EA 3KOUA 3R44A 2YC2C 1LDEA 3SGLA 3QNMA 1W94A 2Q1SA 4M1SA 3LVFO 1YQ9A 4AMBA 1WP9A 4EQ6B 1A71A 2QP4A 2JLBA 4G4SO 4XW2A 3OM0A 1O58A 1RE0A 4UAGA 3V4VB 2AT1A 3CO5A 2EYUA 2II6A 4Q19A 2YBDA 4J2OA 1DNPA 4YFVA 1ZUHA 5ALSA 1AU9A 3QXXA 4PS0A 5MN6A 1V8ZA 1XPRA 2O57A 2IW1A 4KXMA 2YS7A 1GU1A 2XLBA 3KQOA 5EWJA 4Q9LA 1JU9A 1D07A 1Z39A 1MTOA 2OM6A 4ZCLA 4BVGA 4F4FA 2JFQA 1JH8A 3E9DA 1VRVA 1Z2OX 1CQXA 2ZAYA 1X7WB 3IVCA 3DE1X 4UAUA 3RUPA 1E9BA 3RC9A 3L6DA 2IDMA 4CDNA 3QJ5A 2KBEA 3DE7X 1FLVA 1T2AA 1T2NA 4O2BA 1WF3A 3UJPA 3PUIA 1KETA 2GDJA 1X7ZA 4EAQA 5IMSA 4OI0A 2D13A 1G20B 3HFGA 3NALA 4PNHA 1H0SA 1E5QA 2MSNA 3E58A 3NBXX 1R6BX 3WZ2A 1OH7A 4RMJA 1UXHA 3SDSA 3DFIA 4P31A 3TX2A 3ANNA 1E1MA 1M67A 1V4NA 2VJMA 3L0SA 3CNLA 4RTQA 2BGTA 2P2DA 1IQUA 2VEOA 2XB8A 4X5OA 4Z49A 4NL4H 4WCFB 4Z7NB 1MVOA 4BO9A 3F6YA 1JPNA 2NO6A 1OGIA 1IJBA 1UJ4A 4N6GA 1ZEJA 1VSVA 1YSCA 2OGSA 4RLFA 2QX9A 2ZT7A 3HSSA 4E15A 2IIPA 3ORHA 1QR6A 2VHCA 4P4TA 5TMBA 5FWXA 2AHRA 5BW6B 2J09A 5AM0A 5LUAA 3LWNA 3CKMA 4YGYA 4JX9A 5FQOA 4R84A 2OGUA 2BGLA 4AJLA 1Y82A 3V00A 3E9RA 1COWD 4JY7A 3OQOA 5JQWA 3RAFC 4JUDX 4RPJA 4RKRA 2IHNA 3PHHA 1TCUA 2ZXEA 1IJEA 4Q15A 3IGFA 4FYMA 1U9IC 4GM4A 2PHZA 1ADGA 1P77A 2I3GA 2QVBA 2IS4A 1FFGA 1JR3A 5LJLA 1P6XA 3UOWA 2W6JA 3GGJA 3L7NA 4OXQA 4FLEA 3P9KA 4N7MA 2XKKA 4X1OA 3AFIA 4LFAB 4COKA 1BXRB 2Q5LA 4IV0A 4O4HB 2G9NA 3H2IA 4U3JA 2IXDA 3E2MA 3E9EA 3CKKA 1Q22A 2B3DA 4TYNA 1SH7A 1A5TA 2O2ZA 1KU6A 3KE8A 3KPJA 4GX1A 1KK2A 4JDUA 2XUJA 1FFDA 1UBTS 4BEJA 3G3EA 1T0UA 5EHGA 1ATZA 2CY0A 4RE6A 4RA6B 4U0JA 1AZLA 2PZJA 2P0AA 4U4AA 4OAPA 1MC4A 2PR2A 1TM2A 3SZRA 1E58A 1OZ0A 3N70A 3IJRA 1LF5A 3OG9A 2ZRQA 5BVHA 2CLFB 1XFAA 5ALJA 5H68A 5CVTA 2UZ4A 3G8DA 3N2KA 2HJSA 3P2JA 2X8JA 5AICA 5BN3B 1EWKA 2H51A 2X0IA 3R3HA 2BFAA 3EAFA 3F97A 3FHJA 5JSFA 1JX6A 3HJFA 4C7MA 1U6JA 2C04A 2MIIA 3WYFA 2AJLI 4EELA 4ETWA 5BSGA 2EW8A 3I28A 4OEHA 3B52X 1M1ZA 1DKQA 2DFTA 1G6HA 4HFMA 4AUKA 4ZVRA 2O5CA 2HL6A 4ENQA 4HMPA 3THRA 1QFMA 1Z34A 1N2ZA 4AG3A 4WFJA 5DYTA 2B4TO 2CBGA 2FN7A 3LTEA 4BE7B 5KX5F 3HDJA 3IQHX 3U62A 3C1TA 4Y2QA 3X44A 4OA8A 3HV0A 1F2UB 4TLLB 3SQLA 4ERXA 2SICE 3DS8A 2G63A 2DC1A 4XVQA 2WU3A 3A2KA 3V8MA 3KD2A 4FM9A 4D8TA 4B83A 3ACBA 3Q87B 1MZPA 4LX0A 2WSSA 1U94A 3KKLA 3NNNA 2O8CA 4ARVA 1FUYB 2DOKA 1LDBA 4MUBA 1U04A 1C7EA 2FUNB 1JA0A 3IDQA 3K8OE 3FHCB 4OHRA 4I81A 3WHPA 3O4GA 2PSEA 1KAQA 1UBJS 1QWOA 1IHUA 1TTQB 2XMGA 3FM9A 2VZLA 1AHNA 1GGKA 2QRUA 4JI3B 2ID8A 4WCVA 3ROTA 3LLSA 4PHTA 3H97A 1DHTA 1EXMA 1RQRA 3M9XA 3IIIA 2JBAB 2W6IA 3UWKA 1PWYE 4O25A 2WJVA 1P3JA 4NCXA 2P4QA 1A7AA 5A3SA 4X65B 5BW5A 4Q00A 5AUOB 4ZZ3A 3EGXB 3L7DA 3I0NA 5E4TA 1G4UR 1OI7A 2C5EA 1X77A 2NPOA 2PU7A 1G5PA 4GYYA 1RABA 3X1JA 3R5SA 3ZHRA 1PEAA 3GG9A 3JQPA 3I3SR 5K05A 1K92A 1N1DA 1SZPA 2QPTA 1M2HA 3DXZA 2OEPA 4P34A 3VDRA 1NDQA 4QHSA 4AJIA 1ORHA 3LZDA 4BBPA 4ETMA 3L4SO 4XOIA 2CFOA 4ODIA 1WPRA 2PUBA 5CFNA 1F0PA 4QOJA 1UBFA 4K9QA 5IKOA 3M2TA 1NAIA 1GUAA 4KIFA 1T8WA 4FS3A 5BSRA 3EA5A 3OURA 4OBBA 2HJGA 5EQFA 2OV4A 1Q7BA 2WPDD 3W8NA 1F7UA 4QBTA 3VH4A 2ZCUA 3KXLA 4LNUA 4EKEA 4PQGA 3VNVA 1OF1A 2HWUA 2QRLA 1XKQA 4DCPA 4IVNA 2OCKA 4ZCIA 2PWBA 2YW9A 4RGBA 2IL1A 2EBWA 1R74A 2IK8A 4W5JA 4F6CA 1NU6A 4HF7A 2I8CA 3L7CA 4Y6LA 5G0TA 4FINA 4HPJB 2ZSBA 4U7DA 3JAMA 5BRNA 4JI8B 4LHEA 5GADl 3MWDA 4RESA 3JPWA 2XMCA 3NTQA 3DE3X 1C1HA 3DEAA 3L92A 2VTBA 1TLFA 4I4TB 1M3SA 4OKSA 3IE2A 1CZOA 3P96A 4IS3A 4B33A 4QGAA 4KVAA 3UIEA 3GRRA 3F5SA 2P4EA 2D5AA 4EJFA 2CL5A 2WSLA 4GEGA 1JB9A 1XTTA 3N5KA 3GEHA 1CR2A 4KPEC 4U02A 4TV8A 1R0XA 1R9NA 5BSVA 5TJHA 1MRSA 3TECE 3C41J 2BWJA 2VP0A 4UHDA 5IRCD 2Q9UA 2JLVA 1YQUA 3WLQA 2ASEA 1Y8AA 1N8KA 3JQFA 4FNMA 4OXYA 4Q6BA 3DYBA 1YCGA 4TXLA 2QA5A 4O02B 4B3CA 4Y9DA 1NJ1A 3BE5A 1J0CA 3KUXA 2Q50A 3G1TA 2QR5A 1SQSA 1WPXA 4EJSB 4PVCA 4L8LA 4UUNA 5EGSA 4DLLA 3KZVA 5GM2A 2GAAA 1WE2A 3MMZA 2WVGA 4NJEB 4FR0A 4TS1A 4LHSA 4RTSA 3UMFA 3JVVA 1TNDA 3HFSA 5CHYA 3AI1A 3OWHA 1QIFA 4WFKA 5C2JB 5K0EA 4I8XA 3EWIA 3QHQA 4PHGA 3EN0A 4D9MA 3RFVA 5K8LA 2AG0A 4DDTA 1SVKA 4KDRA 3RVPA 3GT3A 4D0NA 2OAP1 4LKRA 1WCIB 2B7LA 2GXUA 3EVTA 3RRMA 3TZLA 1T5LA 1UBGA 4S1TA 5KTPA 2FN9A 3D4IA 3U4HA 3G0DA 4D9IA 1TQHA 1Q1AA 4WDRA 3D1VA 2JRLA 5I7SA 3FCCA 4IDGA 3E1SA 3OOEA 1F4PA 1TLLA 5EIBD 4EW6A 4ZI2A 3OI7A 2IF0A 3ABOB 4N5DA 4A7PA 2XD9A 2FUG1 2NYRA 3MLAA 3B5EA 2ES4A 5KVSA 3ORSA 1A4XA 3CWZA 4AX4A 3WP1B 4CM9D 1XL1A 2F1JA 4RK5A 1E18A 3RJZA 3UICA 2BGGA 4NEQA 5AKEA 1FCJA 5K0BA 2QD3A 2AW3A 1C29B 3HY4A 4UBLA 3BAZA 3QWIA 3S68A 3C6ZA 4GU5A 2NU8B 3TLYA 3ZHCA 1JQAA 3PLAE 1N2HA 4JODA 3T94A 1NNSA 4RFVA 2I62A 1DAKA 4ZYLA 1Q92A 4UMVA 2IHZA 4ZXPA 1TCCA 1UKCA 3U4DA 1UC5B 2B1RA 5KOJB 2QNIA 4YRTA 1RRMA 1SNYA 1UFRA 1UJ2A 3DR5A 3MNFA 4JYAB 4AULA 1PLKA 2V45A 5KVAA 1NXOA 1U31A 2JNWA 1QU2A 3BREA 3ABQB 4DWWA 2XXJA 4L72A 3N0VA 1PX2A 3LIPA 4DYVA 6LDHA 5LP1A 4P0PB 3KDPA 1XEXA 1H2ZA 3H11A 1BXGB 4LJ8A 2EGHA 3G2PA 4QU0A 2V7TA 4RLQA 1TI7A 2OFWA 1G5HA 1YR1A 4FIZA 3TXXA 3IEKA 2VH1A 3U13A 1CD5A 1CP2A 2X77A 1AS0A 5E7JA 3R23A 4G0QA 4WWHA 3MTIA 3B7PA 3UB4A 3KSUA 4BNJA 4D3DA 5DX1A 4C7BA 5FUMA 3AVYA 2QQ5A 4PNPA 1X1DA 1MGPA 2ECKA 4DABA 5JBNA 1MQ8B 4KP7A 2H2IA 3V4PB 3V1LA 1ONOA 3NEJA 5B3JC 3B6ZA 4GNRA 1JI0A 5F77A 1CQIA 2FWIA 3OKPA 2GZRA 3FCXA 3UVEA 1EQ2A 2NV2B 2IHBA 2WTNA 4XUGB 4ZVMA 4WBXC 4BBAA 3RIEA 3QUCA 4Z6KA 5IN4A 5T4BA 2O3UA 2QLFA 5DM1A 4OYRA 4MGHA 5T57A 1SGWA 3W8FA 3AHGA 3T3MB 1I7DA 4LYHA 1GUFA 5AK0A 1PVVA 2C9OA 3WQRA 3TZBA 3EWSA 1Z7YA 1LK7A 2G82A 4K6HA 4ZEWA 2R6DA 4RFSB 2WRZA 4Q4HB 1JLMA 2HJRA 1P4HA 1ZDMA 3L7LA 2DULA 3L4JA 1LNQA 4FFOA 4FZJA 4ZQHA 5FOXA 4JLSA 3HUDA 1OA1A 4B7UA 4MW6A 5T41A 3AR7A 3W9YA 1B1AA 1IZ9A 4I19A 2NO4A 2R5WA 2JAPA 2BZGA 1R5JA 3CV3A 4A0SA 4BVAA 2ZK7A 4G4SP 3IR7A 4TZ0A 4I5IA 1GPBA 2HLDA 3I30X 4ENTA 5B57C 3H9BA 3LYHA 1Z6AA 4E14A 1T5IA 1UDRA 2HHCA 2BUAA 5DO9A 4CEHA 1O9BA 1JBQA 1ZUNB 3RHZA 2C29D 3KSZO 5CB4B 1OLUA 3FLBA 1X8KA 5FPKA 3JD1A 1SHLA 4U7HA 1V26A 1PZMA 2Q1UA 1MABA 3C3DA 2WFAA 3DWIA 4IDQA 1OVGA 3VC7A 3QF4B 4KZPA 1ABEA 4IGKA 4MZDA 1YKSA 2TMGA 4B71A 3KXPA 4JVLA 2ZGVA 3IBYA 5LIRA 3QU4A 4CKCA 1XPJA 5L3QA 3SK0A 2F00A 1D0IA 1W52X 4YP5A 1GO2A 1JHAA 1L3IA 1CY0A 1USKA 2OV2A 2WHEA 2Y9PB 2B8NA 4Y2HA 4ZGWA 4Y2YA 5EIEA 3I53A 5F12A 5IX8A 4C6RA 2O4UX 4B9EA 4BLUA 4A0RA 5ICEA 4XEUA 3G0GA 2HC9A 4KREA 4HO1X 2Q4OA 4R2KA 2O7NA 4U2KA 2BELA 1FP2A 1ZGCA 1YK0A 3C3AA 3GUYA 1QZ3A 4M0CA 4XDYA 2I7TA 1FS4A 5BMVF 3VJRA 3GW8A 1TD1A 4ND3A 1K3UB 3ZJUA 1EDEA 2PKRA 3I9LA 3JALA 3JYHA 1OVMA 4JUFA 4LOKA 3FXAA 1VP3A 1FLAA 1Q21A 3PBKA 3SXUA 1GKKA 1V43A 1QAQA 2YWGA 2J48A 3EZGA 3K4HA 3NX4A 3AGPA 3PRJA 4E2WA 1FFXB 1MLDA 1O94D 2QEQA 4MR8B 3DTYA 4QUEA 1ESZA 3BE8A 3II6X 4QWWA 2J9FB 5EE5B 4YV7A 5L4NA 3KJGA 4YROA 2G1PA 5CG1A 2HSJA 5CBPA 3HYRA 4GBMA 2E4ZA 3BMQB 4Z9AA 4HTFB 1B2LA 4BFTA 2OBMA 3MCAA 1V1RA 1L8LA 2CNOA 5DIZA 1OWMA 3W05A 1VJGA 4DXDA 4EUKA 1QGUB 4FR2A 5ER6A 4E51A 5HF6A 4TTTS 2HCFA 2Y9MB 3G5MA 4OGWA 2ZYRA 1F4LA 1I1NA 4LYJA 4MNTA 4JHLA 3JAWB 2XQVA 2X15A 1HQDA 3GCWA 3UATA 4D4JA 1XAHA 3PFWO 3IBGA 4AL4A 1R6VA 2CHUA 3DBHB 1UBMS 1PYGA 1NURA 3AM1A 3W5AA 4YRIA 1IULA 4IEEA 1DFGA 1GD1O 3KPVA 3LHKA 5AIBA 4F2PA 4URHA 1N34B 2H1FA 2JBHA 2Z8ZA 5FWYB 4DFDA 3IQIX 1G3UA 3CVWA 1I2DA 3NPAA 3OICA 3IT2A 3KJFA 4INOA 3EVNA 4DBZA 1W5EA 4ZCQA 2F67A 1VJRA 2AE2A 2BC9A 4KFSA 3ZVMA 4G0UA 4CGZA 1HX7A 4N3CA 2NU9A 2JGNA 1YTLA 2BFDB 2QMYA 3D2CA 3R5KA 5IS2A 3S44A 2WICA 4BWVA 5AKXA 1ZA2A 3LZCA 1U8UA 4ZDJA 1VI5A 4BEBA 3QELA 3OMLA 3IV6A 3P27A 1PNQA 1URPA 3MS4A 3CR7A 3DTVB 3T6KA 1AXRA 1SVSA 4D42A 1YA8A 2R4TA 3MRSA 2YXBA 2Z1NA 4FMDF 2ORYA 1K7XB 1KS2A 1CLUA 2B4RO 5F7JA 4L0CA 4B6RA 3IRVA 4E11A 2FZKA 1JQLB 2MDTA 3NT2A 2HPAA 3BIFA 3RS8A 1AHPA 1LS6A 1C81A 2B36A 4C0QC 4O6VA 2NVBA 4XD7D 1PUIA 3WYGA 4E70A 1FFWA 4QJ3A 5EIXA 1S4QA 3ZDQA 3ECCA 3KZKA 2OB1A 1G6KA 2QV7A 3TQIA 3GRAA 3BRWD 3WGOA 4MVXA 4X44A 2N42A 2R87A 3BM5A 3EG9B 3H5OA 3LHFA 4FN5A 2A3RA 2I5PO 1G8YA 4OHPA 1X87A 2CXQA 2LD4A 1ORTA 4H35A 3CY6A 1CYDA 3LVQE 3A9CA 4YRSA 3VV2A 5IJ0B 4W5HA 2FMUA 4E5KA 1RHUA 1GDDA 4L85A 3AL2A 1F4VA 2Y0PA 3GJRA 4HEHA 1HE4A 2I33A 4LCEA 4HVCA 1ZX1A 2EV9A 1CUCA 3OZGA 3RYTC 5ARBA 3KKPA 4OI1A 1YMUA 4ZVSA 4MUFA 3FSJX 5U1PA 4K8OA 4IJ6A 2AK3A 3UAWA 1MJGA 4ALIA 3KWFA 1A4RA 4RM3A 5A5DA 2DHEA 2HZ7A 2BJHA 3IV7A 3AF2A 1YBMA 4NYMQ 4RXTA 5L7TA 2XUDA 4HUJA 1KL7A 5GAJA 2M98A 3CLSD 4CKBB 4GO1A 2JIZA 1QV7A 3RANA 1EU1A 1FSZA 1UBHS 1WBJB 3AUTA 1XD2B 2YMPA 3E22A 1MN6A 4MK4A 1I5RA 3ZEAA 5ADUS 1SUWA 5FDFA 3HNOA 1SXQA 4LVUA 4OQMA 3PIIA 1RBMA 3KV3O 1NN3A 3E9ZA 2PYDA 4FOOA 1NONA 2OYCA 4MEAA 2HT1A 4I50A 3ANTA 4V3CA 4BATA 3JYQA 5KYXA 5J9FA 4W9MC 4CLDA 1UMDB 1B8OA 5GGXA 1KE2A 2DUMA 3N8KA 3RF6A 5JH7A 1A8IA 1AGRA 2YUTA 4TWIA 5C8XA 4HGPA 2F55A 1VMKA 2GBFA 3CPSA 1XCOA 3TX6A 2GN2A 2WABA 3PGKA 1TVKB 3PQCA 4PCLA 3AG5A 1B74A 2O5EA 3NIGB 2GBIA 3W2IA 1Z0FA 1P5HA 1X3SA 2PT9A 2Q3CA 4Q3OA 1SVOA 2JFWA 3GEBA 3WAGA 1ZCBA 1C7ZA 1M6EX 1PDWA 1Y89A 2HADA 3PHJA 4HATA 4B6QA 4EEXA 3O21A 1NU8A 2R1ZA 5AJVB 5TS3A 3C3JA 5FJIA 2C8LA 3FGZA 3GFFA 3K92A 1GQSA 4P6VF 3HLYA 4WINA 5WRFA 1I51A 3C3KA 2OCYC 5E2BA 4PHCA 4ZVVA 1GZDA 1CCWA 1OPXA 4N0QA 3R9XB 4D5EA 2JKZA 3JRNA 4ZEOA 4MR7B 3ZJYA 2PKXA 5FR1A 3AERA 3X1YA 2D7DA 2F8LA 2WVAA 2J9FA 3R09A 4PYJA 3KVRA 2EF0A 4Q9HA 1I6WA 1QIHA 2XGSA 4CR8A 2IPNA 3A3OA 4HDAA 5J5CA 1Q91A 3I09A 4E6EA 1USUA 4I50F 3FUVA 1T3ZA 3QI7A 4Q4LA 3QTLA 2ZS9A 2BM1A 4HVLA 3U1TA 3VU8A 1XA0A 1HOXA 4BQNA 2C99A 1OX4B 1E3TA 1C30A 4A2QA 5A4IS 1EVQA 5KVQA 1YWGO 4RV5A 3TXAA 2D1RA 5AI4A 5IVHA 5D1NA 1RYYA 3JTEA 3RGWS 3M6FA 4RCZA 2DUJA 1NBMA 5BV2P 4BNHA 3PUXA 3IEXA 1V96A 4U6NA 1GILA 4QYTA 4OCZA 3RVMA 3W0LB 2ZE5A 4IDNA 4DE5A 2V4MA 4MCAA 4Y2VA 2BGRA 2FUKA 3G2KA 2F4NA 4G1MB 2A0YA 2G07A 3ADOA 1BOFA 1C7JA 4XGRA 5CRIA 4U2GA 3OLZA 1JIQA 2OZEA 3W5JA 1Z73A 2W58A 3M6XA 1Q15A 5AKIA 1W35A 4WLOA 3QEBZ 5D2CA 4UZSA 1MABB 1B0PA 2XYPA 3PGLA 4ISBA 3HXOA 1NQ5A 1Z5WA 4K9RA 2BM8A 4HV4A 4W5OA 1NVGA 1M2FA 3H42B 4JIMA 3VKWA 1I4DD 5JJLA 4WOBA 4V02A 1A50B 3GMSA 1M8KA 3E70C 4K1XA 4JX8A 4F4JA 3SHQA 2HREA 2XI4A 2I4NA 1JW9B 4DLTA 4UARA 4EA9A 1H3NA 4MB6A 2PUEA 1EZZA 3U5TA 3IUBA 5FUYA 4UCQA 3FCYA 3W8RA 3Q4GA 2J5KA 4KO4S 5AVOA 5KPJA 4P53A 5DM4A 1L5HA 2OGZA 3OZAA 1JV2B 2YWXA 4CM7A 3BMNB 4I2VA 4U7PB 3B3JA 4ZVPA 4ETNA 1HLDA 4U00A 2D1SA 3MSCA 2H1IA 5DHUA 2D74A 1IEVA 4NFLA 1G20A 4GP7A 4AF6A 5THKA 4Q1AA 2Y0CA 2GZ2A 1E3WB 3UH1A 4XCVA 3PNOA 5HQ3B 5FP0A 4RGYA 2ZJ1A 1QP7A 4XJVA 3N76A 1X7HA 2VWQA 1IOZA 4EATA 4WPGA 5JXGA 4M8KA 4CV2A 3BTUA 3HACA 1MC5A 3I01M 3QX8A 4QYMA 3G68A 2JDIA 4J4HA 3URKA 2AN4A 3JV7A 2JAHA 1TOAA 4LQCA 4OB7A 1G3IA 4YCBA 4ZT6A 4B84A 2FR8A 5E7QA 1QIDA 2PSFA 3KTDA 2GHTA 2QE7D 1CB7A 2HRCA 2X8WA 4X7MA 1AQJA 1WXHA 3RFUA 3D54D 2P5YA 2HA6A 3OT4A 3AVTA 2DUWA 1BU5A 1J70A 1ZCZA 2D0DA 2QRZA 3HEBA 3VKFA 2ZB7A 4Q1EA 2G4VA 3FJOA 1L5MA 3GNTA 5JNSA 4Q4CA 2IU4A 1DTWA 2FETA 4MRMB 4XGKA 5H0IA 5H4HA 2W48A 3IR6A 3FYDA 4BGVA 3GRZA 3AY0A 2CZCA 4MPDA 3RT1A 1EXDA 2AFHA 2HU2A 3R5FA 4CW7A 3CX8A 5UKDA 2PBLA 1A7KA 1XG5A 3GZNA 1E5TA 3P0HA 4D79A 5AR1A 1TUBA 5JCZA 1AUQA 3KEGA 1AS2A 2M32A 1NLUA 2AR0A 3EULA 1LXCA 2Z3ZA 2R84A 3K72B 3QFCA 5DXJA 3SSAA 1CEYA 4Y3UA 1H2WA 2O3JA 1T29A 2WF9A 3UHAA 3D6HA 3E8MA 4KLCA 2CCJA 4IP0A 4XGNA 4ZVOA 5E7MA 4DRXA 5ALHA 4EBFA 4GH5A 5IK2D 2FSUA 2QRQA 3ZDAA 3GCZA 4YCNA 4E3WA 2IEIA 3KYDA 3TG8A 2I78A 4F2WA 1PSDA 4WOPA 4AY3A 5JMTA 3A6LA 1W44A 1Y7PA 2MOKA 4NCIA 4LGYA 3RF7A 1EK1A 1VOTA 1DS6A 1X1RA 1X7XA 5E7IA 4ESOA 1G8AA 3TLJA 4ARSA 4JLOA 4EGFA 3EE6A 5TGDA 1R3UA 1GQOA 3OO0A 5KJCA 5LYJF 1FW8A 1W1UA 1W8DA 4YPOA 5HIAA 4MA0A 4OHMA 1EXVA 1E2FA 2H54A 1X8XA 1W36D 4H3KB 1ZD9A 2C2BA 1YVUA 1DUVG 1CQJB 1M2OB 1JHUA 1TCVA 1X0XA 4BPRA 1A2QA 5A5GA 1LJLA 3U80A 1GQFA 1RLIA 1S2LA 1ZH4A 4M1WA 3TTUA 4X66B 1AZSC 4NZNA 5DISB 1GYPA 4H7EA 1EFRD 2HIAA 2I2AA 1OWNA 1J07A 1RMYA 4G09A 1UWVA 5K2MA 2VYQA 3V2UA 1CR0A 3VR5A 5BYJA 3BJIC 4R8RA 4F3NA 5ESWA 1PYOA 3DMPA 2OBXA 3HN7A 2VSYA 4KACA 3WB1A 2PRJA 1QX4A 1T2FA 3NHFA 3BD9A 2XCOA 4LSMA 5A05A 1YB5A 1MX5A 4WERA 5CIQA 4EHJA 1X86B 1ECBA 4FYVA 1H22A 3FVWA 1E9VA 3QZUA 5B3JA 4FYHA 3LPLA 4LJYA 3TIVA 2JA2A 1P44A 3GLFA 4U2CA 4MGEA 1IY2A 2JAUA 1Z2DA 4QXRA 5LYJB 1W88A 2C42A 1XHFA 3A4MA 2IODA 2VPXA 1MAUA 1WSBA 2GPSA 1QO0D 5CLGA 2Q7OE 1E3QA 3S2IA 2OXTA 3DO5A 1FVXA 4AS1A 3REQA 4ZYXA 1CLEA 4BQOA 4C0AC 5LBTA 1B23P 3F4LA 2IXTA 1US8B 1JSXA