5SZHB

Structure of human rab1b in complex with the bmerb domain of mical-cl
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
GHMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords MICAL C-terminal-like protein
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5szhB00
3MD0A 1JECA 4LJAA 4D6PA 4HZUA 1E79A 2D06A 2FPKA 3CR8A 2GKSA 3BERA 3HDTA 2PX3A 2YWEA 2ZJZA 2Q3HA 4R71A 3OFND 2MMGA 4M1OA 1Q3HA 5K8UA 2R62A 4OHZA 2WWXA 5KTYA 4TTRA 1Q1ZA 1I2MA 1AZTA 5KO2A 1FNMA 4M21A 1YZLA 1OH5A 1E79D 1HEIA 5DI3A 3QPUA 1QHIA 1WCV1 1E2MA 1TUEA 3X1WA 2ANCA 3GQBA 2QAGC 4X8OA 1RRGA 2ZVQX 3U6BA 1SVLA 3JZAA 5KSOA 4K8OA 1OHHA 2F55A 4DUGD 3O8RA 1WB9A 3K0AB 3U7GA 1R5BA 2NO0A 3LVQE 1VCMA 3OIUA 4NYIR 2QEQA 2WKPA 5DGXA 1P62B 2CCGA 4MH0R 5FR1A 3B1XA 3A1SA 2ZRCA 5HKKA 3DZDA 1D9ZA 3RSLA 3P1JA 2ZM5A 1OHHD 2GVZC 2VLIA 3LBHA 4A0FA 4BUJA 1TADA 4MRVA 4LPSA 4B73A 8OHMA 1KI6B 4M1MA 1GM5A 4ZI2A 2GNOA 1CJUC 3GJXC 3KX2A 3CRMA 2WJGA 5JECA 2ATVA 3IHWA 1A2KC 3FTQA 3L0PA 1FX0A 1VDZA 5HKKD 2J0UA 2GCPA 2CVFA 3GPLA 2WSSA 3B7GA 2P67A 1C1YA 3BB4A 2DFTA 3CWQA 4GOKA 3REFA 2F1HA 2ANBA 3NWJA 2IYTA 4BLSA 3KKNA 1E2GA 3T35A 4KITB 2C03A 3CONA 4QNRA 1BO6A 3AVYA 4AYWA 1SKYB 1E9DA 1P61B 3EG5A 4F4JA 1IN4A 4JMPA 1XEXB 3CX8A 4B32A 3FYHA 3ADBA 1G8FA 2OV2A 4DCTA 3HU2A 1W2GA 4DIDA 1XD2B 4IDNA 4WZAE 4M8NE 3GLIA 4XTRA 3R7WA 2RGAA 4PZYA 3A1TA 1J7KA 1UDWA 1E9CA 4A2PA 4US1R 3T1QA 3PVSA 3ZIAA 3ICQB 3T15A 4YXWA 1W5TA 1ZNWA 1R10A 3QF7A 4LYFA 1G9XA 3U3KA 2ZSFA 4B6EA 1Q44A 1DVRA 3NKVA 2HLDA 4LYHA 2FN4A 3ZIAD 3I92A 2PCLA 1OXUA 2AKYA 3P4XA 4YXWD 2G6BA 1H65A 1NLYA 2J59A 4TYWA 1G5RA 3ZVLA 5EZ6B 1JAIA 4LI0A 3IEVA 3WMGA 2FSFA 3VKWA 3W6PA 3ZGXA 1COWA 3QNUA 3CO5A 2VP4A 3KXLA 4KFTA 1VCIA 1XRJA 5JI3E 4R9UC 2O8BA 2IHBA 3KB1A 2BKUA 4NMMA 2PJZA 2OG2A 3KKMA 4L9SA 1P5ZB 4CT5A 1F48A 4V03A 2Q6TA 1XJ0A 3QBVA 2QTHA 3CNOA 3AVVA 1UKYA 3EWAA 4OHWA 4HZUB 4JVSB 4DWJA 1COWD 4GOJA 4UXHA 4EIWA 3IO5A 2OAQ1 2PX0A 2QSZA 4JT2A 4MDEA 3CPJB 1E9EA 1UPTA 4NONA 4TMWA 1W0KA 1P2VA 4LJ5A 4LJ6A 1KDOA 2QORA 4K46A 5DI3B 4DEXA 1NF3A 3BH7A 4DLVA 1E0KA 1U99A 3TVTA 5EXPA 4EFNA 3LW8A 2ZQ5A 1WBDA 4IFEA 1S9DA 2J9RA 3KQKA 1L2TA 1G19A 1W0KD 2B8WA 1G3QA 2K5UA 1OFUX 2JJ8A 5FPHA 3KKPA 2D62A 4RD6A 4D2IA 4ARZA 4C0HA 3QPVA 3IBGA 1J8MF 3FKQA 4NCIA 4POAA 3ZVNA 3TUZC 1ANKA 1QHXA 4PAMA 2YC2C 1HUQA 4TQUS 4B76A 3A36A 2R44A 4ZDIA 1L8QA 3G5UA 1WRBA 3C8UA 5J4YA 4WW0A 5DISB 1FX0B 5IRCD 1KMHA 2J0UB 4XIGS 1BYUA 2CL7X 4NL4H 1WXQA 3LQRA 4ACBA 4KO8A 5JS8A 3QBTA 1N5JA 4NYMR 1HT2E 4W9MC 1U9IC 1TEXA 3SI7A 1O3YA 4D0NA 2CVHA 2GK6A 4LRWA 2ZAOA 3U60B 3DOFA 2J7KA 1U98A 3C15C 1TL7C 4KVAA 3H2YA 4Y0AA 3CBQA 3RRZA 3U5ZB 2J0QA 2C99A 1YHNA 2OSBA 3MMPA 2W2VA 2VHQA 1XTIA 2QPTA 3GLIB 4Z51A 1E99A 2QQ0A 2W6IA 3QEJA 2A5FA 2O8DA 1KJZA 2ZUDA 1GVNB 2AN9A 1RYFA 1KAOA 5CLLA 2O0JA 3CX6A 2OO7A 4Q9LA 5TARA 1KK2A 1YR6A 3AKCA 2GJ9A 1N6NA 1GNRA 3BH6A 3BFVA 1T8TA 4MGYR 1RJ9B 4XSGA 3VKGA 3PR1A 3HJNA 1I2DA 3A4MA 2W6ID 5CIQA 3U7FB 1NMZA 4OQFA 1ZM3A 1ODFA 3C41J 1NRJB 1NBMA 2OBMA 1CR0A 3O8BA 4JL5A 2PT5A 4V02A 5AJXA 1KZ7B 1JQLB 1GNQA 2CL0X 3BBPA 4B48A 3B1YA 2RGDA 5JHGB 3WY9A 5KDOA 4LJ4A 3ZVRA 2LKCA 3OEHA 2MSCB 3SS8A 4PO8A 1QZXA 1Z47A 4AI6A 1FP6A 1YZUA 4S35A 4KFSA 2XZPA 2IS4A 3KQNA 1CU1A 2DWQA 1S3SA 1NBMD 3LD9A 2ZRDA 2BM0A 4JLAA 3KQUA 5JJIA 3PUXA 4GPTA 3TJZA 3OEHD 1MKYA 2OFXA 1XXHA 3DPUA 1KKLA 1SKYE 4JLKA 4KAXA 1OB2A 3I8XA 1R7RA 2CLCX 1F5NA 2WIAA 2ZU6A 3CLVA 1MRNA 4MUAA 1PLJA 4GMXA 4BFUA 4KBGA 3WP0A 3KZ1E 2VQSA 1W2HA 3T1OA 3U7EB 3ZZ0A 5FBRB 5IK2D 1K5DA 1X6VA 2KB0A 5GVRA 4Q9JA 2EYQA 5JI2E 5CM8B 1S3GA 2ZSEA 4BLQA 4HYYA 3BGWA 3LXRA 2QMUA 4AK9A 1UBFA 1NL3A 2H18A 3T1VA 3WRYC 2EFDB 2WIBA 2OFWA 3MG9A 1XB2A 4IXMA 1YQTA 2ZUBA 1NLZA 4HAYA 3MJHA 2GZDA 2QTVB 1IXZA 1E9BA 1U2RA 1N0WA 1GKUB 4URYR 2JLYA 3GCGA 1GAJA 2GEVA 1P7CA 2EVWX 5SZJA 1NKTA 5FBLB 1G291 3X2SA 2OUKA 4QBFA 5AJYA 3K0FA 1Z0IA 4LC1A 4ARZB 4DCSA 4CEJA 2BCJQ 4H9GA 3BAFA 1PJRA 5HZHA 1PLKA 4B3DA 3BORA 1W5SA 2ZRMA 5L3QA 2EQBA 4XTCS 3H1TA 4RD4A 1F6BA 3D3QA 2IF2A 2W83A 1B23P 3NBZC 1GL7A 1ZCBA 1ZMXA 3AKEA 3QQ5A 1Y3AA 1Z0KA 2Z4RA 1DTSA 5FPTA 4DBLC 1KMHB 4M9QA 2HXYA 3K0CA 3MFYA 4UNPA 4BFYA 1E9RA 2QPAA 3B1WA 1E1RA 2G77B 3JZMA 1JPNA 5KOYA 2J5XA 3MWJA 3VU9A 1GP2A 2ZRNA 1ZAKA 1ZNXA 2QGZA 1VHLA 2DFLA 3GEIA 2XNSA 1DPFA 4P4SA 4ON9A 3EIEA 1UKZA 2FH5B 3THWA 1JXOA 1E1RD 1SGWA 2YZ2A 4QGHA 5EUMA 2H17A 1AKYA 2A9KA 2O8DB 4PO1A 2EWVA 4B74A 1KKMA 2OE2A 1CLUA 2WM9B 2A30A 1HTWA 3ZD6A 5C4MA 4OL0A 4LJ9A 2CNWA 1LS6A 4QOSA 1Z28A 3B1VA 4D4JA 3RLFA 2RGNA 3DHWC 4RY2A 2D4HA 3L0IB 5IT5A 2DWPA 3A4NA 4PPQA 1OH8A 1VCOA 2P65A 3E5HA 1K6MA 4QFMA 4QG7A 1NIPA 1AA9A 1E98A 2J45A 2ZXUA 4HAZA 1WQ1R 1I4TD 1HH4A 2ZI5A 4LHYA 4XVRA 2CNWD 1US8A 4EQ6B 2XNDA 1RYHA 2IL1A 3RS2A 4F38A 3N2EA 2FFHA 3L2OB 4OHVA 1G8HA 2GVDC 1P2TA 3I3SR 4E09A 4TL8A 2F3RA 1FUKA 4KFRA 1RRPA 1UDXA 4RD2A 4TMXA 4NU0A 1P60A 2QM7A 3D7MA 5H8WA 1XEWX 2HV8A 2AR7A 1G7TA 5G40A 3H84A 2XNDD 3LX8A 3HYTA 3WNDA 1IXRC 2A7QA 2ZETA 3ONWA 4LBVA 1XXHB 3LQQA 3ZDQA 4L15A 4IKEA 4E5UA 3CZPA 3WP1B 3J81k 2R6FA 3UWKA 4EKDA 1DAIA 2D74A 4W5HA 4HUTA 3FMFA 3T12A 5DE3A 1KO1A 4FMCB 2BMFA 3SQXA 1IM2A 3KB2A 4E03A 2CLSA 4EUNA 1E2LA 3CR7A 2D2FA 4MGKR 3CUEF 3TGPA 1P73A 2GWHA 3C4JA 4ITRC 3NBYC 3TVDA 1YR7A 3SYNA 2J1LA 5AUPB 4IVRA 2IYUA 2XZLA 1CR4A 1CR1A 2FFBA 2ZIAA 3FE2A 5DO9A 5JZVA 5IDVA 4BQSA 4NKRA 4MYTA 4UNNA 3UK6A 2L0XA 2FV8A 3W3AA 2ATXA 2HDNB 2J3EA 2ZRJA 4OJQA 3RABA 3QXJA 2GETA 2NZ8A 4B3CA 3QXXA 4L8GA 2I4IA 3PITA 1GRQA 4C0BA 2OZEA 4TL6A 1UKVY 3K0FB 5FOUA 4CEJB 1UEJA 5E7MA 1Z0JA 4AKGA 3AB3A 3CB4A 4AC9A 2VTKA 1S96A 4LWZA 4M1TA 4F91B 5L3QB 2RB4A 2PEYA 3AF4A 4C2TA 3M6AA 1VHTA 4YMWA 1XBTA 3HR7A 3TQCA 1AJEA 4Q4HB 3GEEA 4FWIB 4LC0A 4DEYA 3Q72A 3TIFA 1Q12A 3NH9A 1KY2A 3FHCB 4MRSA 4KBFA 4MGZR 1Q1QA 3VU9B 3GJ3A 2RKOA 3I61A 1N0VC 3R8FA 2B8TA 1G16A 2GCNA 1W44A 3T5GA 1GFIA 2P3SA 3EZ6A 4JZKA 2ZRFA 3CX7A 1XTRA 5E95A 4P4SB 2OLJA 3B78A 3I72A 1G18A 2O5VA 1GL6A 1P9NA 4BFZA 3THWB 4OK5A 3EPJA 1DAKA 1WE2A 1NY5A 4MKHA 1DBSA 2WWIA 3OIVA 4IEEA 1Z83A 4PC1A 3B82A 2WJVA 2EW1A 4JLPA 4BLPA 1ZM2A 3SN6A 3U6KA 4Z54A 5BYJA 2QA5A 2HEIA 2JLXA 3FVQA 1IN6A 2UKDA 1NMYA 1SVIA 1ZW6A 4CVNA 3SU8A 4HAWA 2ZE6A 5JHHB 4HLQB 2VPPA 4ZDKA 4GOXA 3K0EA 4LHXA 1AN0A 4DT1A 1CS4C 1ZC3A 4M53A 2GEDA 2X77A 4HLCA 4AKEA 1JEDA 3NDBB 1SULA 3KJGA 3TH5A 4OQLA 2YOFA 3AF0A 4F92B 4DCVA 2F9MA 2FGJA 1FUUA 1FMLA 3EZ7A 3QKSA 5FTLA 1U0LA 1Q57A 3K9GA 2ZJ5A 2R9VA 4MRPA 4N3NA 4RJLA 3W34A 1VIAA 4Y0VA 5FUYA 2VYFA 2KSQA 2ZI3A 2CK3A 2FF7A 1XPUA 4M1KA 1XPRA 2B7CA 1VYTA 3RAPR 3B9QA 4TYQA 2FX3A 2R2AA 2ZITA 4A2WA 3BE4A 2O8CA 2ERYA 4TYNA 3AVPA 4KU4A 3REGA 1MO6A 1OW3B 1TU4A 2ZPTX 4DDUA 4X8HA 1OFTA 2CK3D 4QGAA 4DLZA 2OLKA 2P6NA 3Q7PA 1DS6A 4LJYA 1D2MA 5HCNA 2XZOA 1KSFX 3MWKA 4M0LA 4AYTA 3I5XA 1WF3A 4M4SA 1QVRA 1G3MA 1A7JA 1Z0AA 2RHDA 2W0MA 3IILA 1KI6A 1E2DA 1Q21A 2QRZA 1Q3TA 2ZYVX 1TQ6A 3WNBA 3UXMA 2NO1A 1FL9A 5ANRB 1U9IA 2QENA 4LGMA 2KJQA 1T9HA 1IY1A 5AUNB 3GP8A 4D0LB 3WYFA 5FUVA 2XGJA 1Z22A 1OLOA 2V54A 1WMSA 2ZI6A 4PPNA 4Q21A 1Z5ZA 1XP8A 4BEJA 2CE7A 2ZRPA 3I73A 4Z1MA 1J2JA 5KYKA 1TF7A 5HE9A 4P32A 4B6FA 3AVQA 3FPAA 3LY5A 5EE3A 3O8CA 2D3WA 2NQ2C 4RZ2A 4PFSA 5TV2A 2WKQA 2Q3FA 4US2R 5AUQA 1S9HA 4BGDA 2C5LA 3UWOA 4B3FX 1XXHE 3P26A 5EJEA 2GK7A 4V0LA 3D31A 3IO3A 2H1LA 2QT0A 3RNLA 4IDPA 2GF9A 1FP7A 2YINC 1T4GA 2G88A 1Z6TA 1HY3A 2J0SA 4TT3A 5E3HA 4FN5A 1QVAA 3K0CC 1MV5A 4GFDA 4C0AC 3I4LA 4Q1EA 3ZZTA 5H70A 5CIWA 1G4UR 3BFXA 4Q1AA 3SEAA 4IDOA 3DM9B 4TMKA 1E2FA 1IN7A 5HE8A 1TQ4A 3AUXA 2XEXA 4TT3D 1ZM4A 3RWMB 5AUOB 4CYMA 4HB3A 4H1VA 4OQMA 1AS0A 5J4VA 1UADA 2NG1A 3FHTA 1ESMA 5DIFA 2UZ3A 1GL9B 4V0KA 2YOHA 4LSGA 2ZSDA 2QSYA 4JVLA 5JS7A 1R5NA 2VHCA 4GSYA 1JNYA 5FOXA 1E9SA 3K09C 1DELA 3T61A 2VF8A 4CDGA 4B34A 3K70B 2YNMA 3PIRA 1V5WA 1YJ5A 3F0TA 3TE6A 4P3YA 4DT1B 2FGKA 4IRUB 4KXFB 2RGNC 4LZZA 5GJCA 4G5OA 2Z83A 1GTVA 2BJVA 2ZS8A 1OB5A 4Q9IA 2ZRGA 3QKSB 2PT7A 1XX6A 1KI4A 2IYLD 4OI0A 1NP6A 2A2ZA 1Q0UA 1ZD8A 2ZR9A 3ZS8A 5GJWC 4TLCA 4Q7LA 4DDWA 2OAP1 5IHPA 3W5JA 2P2LA 4DRZA 1ZINA 4FMDF 5B2ZA 2WICA 3A58B 3IUYA 3X1ZA 1C9KA 4HLUC 2O8CB 2GDJA 1LF5A 2PEZA 1QHYA 3LRPA 3GMTA 4FIDA 2C98A 1HYQA 1KI9A 1AK2A 2OCPA 4PC7A 3PEYA 3KDSE 1IBRA 4GRAA 4D4MA 2IA5A 3D8BA 4RCYA 3V4FA 5CDFE 5GVSA 4KCGA 4RFVA 4MKFA 1XF9A 4JT4A 1GSIA 4M9ZA 4NE2A 4BZQA 1L4YA 3C7KA 2XXAB 3HR8A 1M7HA 3H4MA 2C96A 4BZPA 1UKEA 5FOWA 2AD1A 4LJ7A 4HEJA 3KJHA 4A6XA 1OF1A 4N1AA 4AG6A 1KI1A 1QHHA 4PHTA 1KO4A 5JWRA 2FMXA 2UZIR 4A15A 2WWWA 4IOKA 5J40A 2WWFA 3BK7A 4P31A 2RHMA 4JL6A 4FCWA 4XJXA 4LX0A 1U0HC 1ZC4A 2BM1A 4G0NA 1ZBDA 1OFHA 1X8JA 1TQ2A 1P6XA 2OXCA 1SZPA 3SR0A 1E2PA 3VMFA 1W47A 4LY6A 2H57A 2RH5A 5FTJA 5EE0A 2WSSD 3FKSA 1KK0A 2AX4A 1U8ZA 5A4JA 2QMEA 2OHFA 4MGIR 2WAXA 2ZS7A 1ZUHA 2P6UA 3VAAA 2RGBA 1RJ9A 3HPRA 5TB5A 3FKSD 2H92A 1DG3A 2WWYA 4PSVA 3QXCA 2Q0HA 3U3MA 3JVUA 4CZ2A 4RKEA 3RS0A 1LB1B 4LYJA 2ORVA 3BH0A 2HJGA 1XCGB 1GNPA 3CZQA 4GZMA 1CTQA 1MO4A 3IQWA 5FTMA 5L3RA 1W4CA 2JLVA 3VR3A 1TU3A 2QP4A 1P9WA 3NHBA 5HTKA 1A4RA 2W00A 1YZNA 2GZAA 3AGQA 5AJZA 4GDFA 1KHTA 2HF9A 4NYIQ 1IOZA 5EP3A 5LBIA 2QBYA 3TAHA 2HLDD 1N6LA 4HDOB 1R2QA 4A0GA 1G5TA 4A36A 2SHKA 1VYUA 1G20E 4YLGA 5GJVC 1NVVR 3X1XA 2WOJA 1IY2A 3Q5DA 2JLRA 4MYCA 2CJWA 4Q01A 2ODBA 1G5PA 2VP0A 3GJ0A 4PC2A 4Q7MB 3RDPA 1N5LA 2IX3A 3B6EA 4WIAA 2WSMA 4KYIB 2Q9AA 4UKDA 3VHXA 1R5OA 1G41A 4PSAA 1XU4A 1G64A 1T8UA 2YVUA 4TWZA 1MT0A 1OT3A 5EP1A 3F3YA 3K70C 1GKIA 4KI0A 2RAPA 4JLBA 2HYIC 1R0XA 4QBHA 1RIFA 4CW7A 1GOTA 4DLWA 2CCKA 2F1RA 2ZU0C 3LLMA 2BMJA 2VP9A 3Q9LA 1LFDB 1UFQA 1KJWA 4IFBA 1AQUA 2EFHB 5KPJA 4B3GA 2G1JA 2XTMA 4TSFA 2AHOA 4BRUA 1JB1A 4BEBA 1TUIA 3C5CA 1E2IA 3X1YA 1XCPA 3H86A 1BOFA 3EPKA 3HWSA 3VR1A 3V9PA 5C2JB 4DLTA 4ZKEA 3DDCA 2ZEJA 4TLBA 1Z07A 1II9A 2ODNA 1RRCA 2IXGA 1NLFA 2OCBA 3UATA 2R8RA 3THXA 1XMIA 4DLUA 2A5JA 4YMVA 3GJ4A 1II8A 4ZIRA 2C2HA 1QHNA 3MGCA 3AQ4A 1QHHB 2G83A 3KKQA 4HDQB 2JLZA 2OCYC 3PEVA 3U3OA 4C0JA 1N5KA 2DCUA 2ONKA 3OHMA 3MJRA 2KWIA 2A3RA 1UBEA 121PA 3VTKA 2V7QA 4ZCIA 1TTTA 4BPBA 4B2LA 2GXQA 5DYGA 5CJ2A 4RFSA 1NKSA 3GJ6A 4TLEA 3ZD7A 4PAOA 4FCVA 2FPLA 4M9XA 3W9YA 2A5DA 1L7VC 3P27A 4N0EA 2V7QD 3ZYCA 1NJGA 3CKLA 3TR5A 1NVUQ 5DN6A 1G8YA 1U90A 2W0SA 4DSTA 5H1YA 4JLVA 1JQJC 1W48A 3RANA 1OE0A 1P4SA 2W58A 2RGEA 4KVGA 5BQ5A 3LVRE 3UMSA 4KV9A 1X3SA 3QF4A 4IDQA 2OESA 2QG6A 1N0UA 2J41A 1E2EA 4A2QA 2BBSA 1NIJA 2ZJ8A 5D3MA 3THOA 1XEWY 2OEPA 5DN6D 3ZS9A 2VIIA 4NCJA 3AUYA 3RSOA 2Q21A 4E07A 4QRHA 2GESA 4QHYA 4AG5A 4EQ6A 3MUFA 1Z2AA 2E9SA 3SYKA 2WJYA 2PLFA 2ZI7A 3U4QA 3DM5A 1E0JA 2ZRLA 1YZQA 3BOSA 3CF6R 2R6CA 3AKYA 3GD7A 3PUVA 1E9AA 4OQXA 1E3MA 2NIPA 4EPXA 4ZDJA 2QBYB 2AKAB 3OF5A 1YR9A 2IEYA 3EC1A 4WVFA 4CF7A 2Z4SA 3DOEA 4PSKA 1Z2CA 1AGRA 3B8HA 1E4VA 2IYRA 1MOZA 1ZUNB 2ZE7A 2CJWB 2PBRA 1Z29A 4LV8B 4TTPA 1KDRA 4JLMA 2WTUA 4QKQA 1R8QA 3CRRA 5B64A 4MRRA 4J0QA 2WZQA 4PC6A 2PMDA 4W5WA 1RE0A 2PCJA 1F2TA 1VG8A 2CBZA 3BWDD 4Q9KA 3TLXA 3AVUA 1AZSC 3P32A 5G3ZA 3C16C 3U7HB 4EJSC 3KQHA 3FDIA 4NYMQ 1RRFA 5J47A 1BS1A 1HA3A 1E2QA 4DIEA 1Z6XA 4G1UC 3UANA 4QGGA 3N2IA 5TXGA 1EFHA 2JEOA 1NI3A 5AR1A 2AFIE 4ASUA 4JS0A 1X8LA 1Z0DA 2TMKA 4CEHB 5CK5A 5CYPA 4MYUA 4KFUA 1YZTA 3KUCA 2IT1A 1ZD1A 1VG0B 2D7DA 2Z6VA 1G6OA 4KHZA 1TNDA 3THXB 1OIWA 4DDTA 3IGFA 3IIJA 1N6OA 4ASUD 4B44A 2FSHA 2AWOA 5BN4A 4IVQA 1II8B 4ZIRB 1Q20A 1MO5A 2H5EA 4Q4HA 3QKRA 1OH7A 1KO8A 3TRFA 3GLHA 1VCNA 3SBEA 3AEZA 2HF8A 2NPIA 2KE5A 1A1VA 3RC3A 1XWIA 4XD7A 1U0JA 4PQYA 1TF2A 5JWOA 2RCNA 4PX9A 6Q21A 4QHSA 4BE7B 2MSDB 5UKDA 3IHLA 1DO0A 4L4UA 3MSXA 4RFSB 4R2HA 3GFOA 5FBVB 1SVOA 3K1JA 1ZNZA 5JCZA 3QY0A 3UPUA 2ONJA 4DKXA 1KI2A 5CDFA 2FEOA 2RMKA 2D2EA 4C0KA 4IXNA 3LAWA 5KDLA 3VR5A 2GTPA 2V1UA 1U8YA 1IJEA 3LWNA 4XVUA 1Q22A 1QDEA 2QPOA 3K09A 1GILA 5KUTA 3QF4B 4G5SA 5AJWA 2YWGA 3QKTA 1M7GA 4JBXA 5FL3A 1KI7A 2JA1A 4NP6A 4XVQA 3NIBA 5D3MB 3EA0A 1T5IA 4QL3A 1M7BA 2REOA 1T6NA 1FZQA 3TAUA 3VX4A 4D4LA 5K8LA 4MUBA 2JLQA 5B57C 3MRSA 4I1OA 4ZCLA 3U4QB 1Z8FA 3N70A 4P4TA 2OBNA 3RRMA 2WV9A 4NYJR 1W0JA 3EA5A 3CF0A 2BCGY 4HLUA 4X8MA 3QKUA 4YC7A 4GL2A 4BLRA 4RZUA 2O8EA 2F1IA 5EE1A 3VNUA 3ASYA 3HPQA 2JAQA 1DOAA 1XD8A 3PUWA 4FCTA 1W0JD 4C30A 1T3SA 2VH5R 4DVGA 2FZLA 4F93B 5TMPA 4C9BA 4D25A 3LBIA 4QC2A 4LPKA 4ZPXA 4KYUA 3C5HA 1CEEA 2ZTSA 1XFAA 1E96A 1F2TB 3LW7A 1UJ2A 3LX5A 1E94E 2AL7A 3EPHA 5FL7A 1ZM7A 3OIYA 2IYYA 3RHFA 3U3JA 2GZHA 2VSXA 1LY1A 1PUJA 5J4HA 3LA6A 3W90A 3KXKA 1FTSA 5JJKA 2JLSA 1XZPA 1XMVA 3RS3A 2XSZA 5JEDA 1G6HA 3NBXX 1R0ZA 2X19A 3PEWA 1LF0A 2DPXA 3U44B 4URXR 4LHZA 2ZR7A 2YV5A 3EZ2A 1E32A 3L8ZA 5FL7D 2B6HA 2G0NA 3IIKA 4DSOA 4C3ZA 4DZZA 4Q48A 4ZO4A 5FOTA 3AF2A 3ZH9B 1HE1C 4I4LA 2FZ4A 2GHIA 2XSZD 2IUUA 2GXAA 1UAAA 3O47A 2NOAA 2DY1A 4G01B 4A8JA 1RVDA 3R20A 5SZKB 5G3YA 1W46A 2FG5A 3GJ8A 4Q1CA 1W7AA 2JDIA 1T3LA 1EGAA 4RZXA 2AFHE 4BFTA 3QKRB 4AKHA 2FOLA 1PZNA 2QMHA 4Z8YA 1N6KA 3GLHB 1A82A 1H8EA 1KJYA 1KNXA 2O0HA 3L0SA 1SXJA 3NHAA 1EFUA 5DHAA 2JDID 2CL6X 2BBOA 1ZJ6A 1N2CE 3PG5A 1OSNA 2YJTD 3BIFA 2NZJA 3CH4B 5FTNA 4I1SA 4HAVA 3MCAA 3UIEA 3GFTA 3SZRA 1H8ED 4YDSA 2ZVPX 4TLDA 2IWRA 1KO5A 2ERXA 4BWYA 5J4LA 4RVCA 1XTKA 2VEDA 2NPFA 1XTJA 4A82A 2IS1A 4LBWA 2QTFA 3EWSA 1Y63A 4UNQA 2R65A 2VHJA 2X8AA 5AJVB 2ZYUX 2IK8A 2EFCB 3GEHA 2YWFA 1MABB 1TAGA 2QAJA 4P33A 3SDZA 1G3RA 4BRWA 1QG2A 2NO6A 4S2EA 2XB2A 3E70C 5FPYA 2CCJA 3WBKA 4AD8A 2WJHA 3CRQA 1KO7A 4OHXA 3Q3JB 2ZE5A 1XMJA 3NC0C 1NSTA 3I1FA 1JXMA 2CXXA 3T5DA 1CF4A 1E69A 3DMNA 3CIOA 1ZVQA 1M34E 1YE8A 4EFLA 3WNCA 1ZUIA 3B9PA 4L9WA 2G3YA 4Q4AA 2QI9C 4WOPA 1IY0A 1DARA 4ESHA 3A6PC 1D2EA 3NC1C 5EQTA 4XWKA 2GILA 5DI9A 5GADl 3AGPA 1KNQA 2QP3A 3DKVA 4YMTA 3K70D 1W4RA 4M1WA 3ZJYA 2V55B 5HR5A 4AKIA 4D4KA 5E7JA 1GKYA 1D6JA 2O8EB 3HYRA 4FMDB 2GAOA 1JI0A 1M74A 4WZBE 3GJ5A 5DSZA 2BVNA 4HI0E 4DCNA 1ELOA 2AK2A 2Q9CA 4LBZA 5TDHA 1JALA 4NCKA 1MR3F 2VA8A 2RGCA 1NVWQ 1XJCA 2WWHA 621PA 1R6BX 3CH5A 4EPVA 1E2NA 2V8OA 1QBKC 1H8HA 2Z43A 1UM8A 4U7DA 2N1BA 1NN1A 5ELXA 4M1YA 4JKYA 2XB4A 1XDBA 1CJKC 4DSNA 1EWQA 1RFLA 1D8TA 3TK1A 1E1QA 3ZQ6A 1J8YF 2G0TA 2XXAA 2QE7A 1CULC 2RGXA 3CRW1 3AVWA 2J0VA 5LPNA 1SVSA 2PL3A 2JLUA 3BC1A 4XSHA 2PJRA 3AVXA 4UQOA 1P2SA 3CWZA 3NEYA 2IW3A 4FXPA 3EZFA 4LUCA 4C0SA 3EASA 2JCSA 5A0FA 421PA 1OXVA 3TKLA 3FHOA 1KSJA 1EFTA 1N6HA 2QE7D 2DFKB 1DAGA 1N5IA 2REBA 3AP1A 3EW9A 4GBMA 4D26A 3K0SA 3V4RA 4OI4A 5EE9A 5FOVA 4PHFA 5L3VA 2V9PA 1NSFA 2IWHA 4A8JB 2H8KA 4BASA 4C7OA 2GXUA 1JEEA 4Q18A 2XX3A 5EXTA 4Z1MD 5F3WB 3PEUA 2WPDA 3ECCA 4F7WA 1OIXA 5BN5A 3U61B 2N42A 4A9AA 3GFPA 1W4AA 4R98A 1SXJB 2GBLA 3IDQA 5CM9C 1T3HA 4M9SA 4DLSA 3HU3A 3BRWD 3PJRA 1DEKA 4CIDA 3NH6A 1AS2A 3UMFA 2IBMA 3WYAA 2ZRIA 2WPDD 2X2FA 5E7IA 4B2PA 4IOLA 4L16A 4CEIA 3IQXA 2ODWA 4C2UA 1NN3A 4US0R 2O8FB 4HSEA 4URUR 2FWRA 1D9XA 3M4YA 1CRPA 3AVOA 1FFHA 2XITA 4A92A 4URZR 4TZ6A 4NHOA 1IN5A 1LNZA 2J87A 4DB2A 4Q00A 2C9OA 3FWYA 2GJAA 2QM8A 4C0LA 4Q5IA 4JVMA 1QRAA 3TQFA 3FFBA 4I1UA 1FQJA 5FFMA 4MKIA 2OFOA 2R6DA 1YR8A 1EFRA 1WDTA 3TW8B 2N46A 3BB1A 4P4UA 1GDDA 3MLEA 3Q8XB 2QN6A 1VTKA 2IYXA 1ESNA 3U2QA 2EYUA 1XPOA 2CHVA 1LV7A 1IQPA 1SVMA 521PA 4BFWA 2PH1A 3LO5A 1TX4B 3DO6A 3W3ZB 1JR6A 4NZYA 1ZD9A 2XTNA 4Q1DA 1C4OA 1EFRD 4KSBA 4HAUA 4EJSA 2DYKA 4Q4AB 5FPSA 1A5TA 2IEZA 3VR2A 3R9IA 1LS1A 2O52A 2A5YB 3GLHE 1IONA 3QVVA 4F4CA 3KL4A 1PVOA 4PQFA 1MRSA 1VIYA 1OFIA 3VFDA 4AIIA 2VP5A 4QGFA 5EP2A 4A4DA 2FNAA 4BLOA 1S0UA 2JGNA 5BYKA 2ZYTX 4TMTA 4B43A 1R8SA 4KODA 4TL7A 1GITA 5E4FA 3ETLA 5LDDC 1VYVA 1HT1E 1S1MA 5DLQC 4B3XA 2J46A 2VSOA 4HDCA 1GRRA 3H0KA 2DWOA 3SHWA 1OPXA 4GP6A 3S1AA 4DUGA 2PLRA 2IS2A 1UBCA 5CITA 2QROA 2ORIA 2V6IA 3GLGB 4ABYA 2WHXA 3W8RA 2ZANA 4HZIA 1AGPA 1CP2A 1FPMA 4WZ6A 1EFCA 4O2LA 1LVGA 5JRZA 2VHUA 2VF7A 4NTZA 3FMPB 4I81A 4P0TA 5M04A 4FWTA 4BFXA 3WYGA 2GJSA 3AP3A 2LCFA 2HCBA 3EIHA 1T0JB 4RKFA 1G8PA 1ETUA 1FQKA 4GI7A 4LV6A 2ASEA 4Q02A 721PA 3SC3A 5CYOA 1N6PA 4PO9A 5EUQB 5JCPA 1KMQA 2FSGA 1P75A 1BKDR 3MWLA 4FINA 3RS4A 4B3BA 1TMKA 3VR6A 5FOSA 4C7OB 3L43A 3VKHA 4QBIA 4LHVA 1E2JA 3K9HA 4LOAA 4V0OA 5CJPA 2ODEA 1SHKA 5LB4A 1Z63A 4A8JC 3RS5A 1U8AA 2F9LA 3A4LA 3DL0A 3TSZA 4MQBA 2ZE8A 3E2IA 1P72A 2XJ4A 3O8DA 3FB4A 5EXXA 2CHGA 4YQFA 4OKSA 1P2UA 2QP9X 2JATA 4JJKA 4CEIB 1VECA 3R9XA 1SXJC 4LBYA 1N25A 4IW3B 1FW6A 2GA8A 1E6CA 3QE0A 1YZGA 4QNMA 4PPGA 1QG4A 3AF1A 4UJ3A 1DAFA 3T06B 3CNLA 5HCIA 1EXMA 3RRYA 2ZREA 5AK0A 2ZROA 4AYXA 4BFVA 4V0ME 2NMVA 5B30A 2HCJB 2Q3MA 1E0SA 4XWAA 1X8KA 3PUZA 5KSZA 5FH9A 2GJ8A 4HB0A 4PXAA 2GF0A 1YRBA 1RPZA 4Q4JA 4W5JA 4CGZA 4LDJA 2E87A 1G7RA 2GEUA 4MKGA 1JBKA 2HJVA 2MMCA 2C04A 2FEMA 1KIMA 3DEFA 3OZXA 4EJSB 3AM1A 5HPYB 2HYDA 1HV8A 2BMDA 2NO7A 4XH9B 2KI5A 1UF9A 1KK1A 2VP2A 3DVLA 4BFSA 4R2IA 1AS3A 1UEIA 3SFVA 4MITA 3LNCA 1SXJE 1Q1EA 2WWGA 3ASZA 1BYIA 1E2HA 1OXSC 2W2XA 4JLNA 3PQCA 2ZJ2A 1CJMA 4TMVA 1DADA 2ZAMA 1G7SA 3W6OA 4HB4A 3Q7QA 5HZKA 5DYIA 4PC3A 1J90A 2OM2A 4JIMA 5EZ5A 1CR2A 2C9CA 3KUDA 5EE5B 5KHOC 3IPYA 1TF5A 1JAHA 5CLQA 2FJUA 4CEHA 2IXEA 3CW2A 3KTAA 4HUQA 3KJIA 1E2KA 2QGNA 3S1AB 2ZRBA 4W7SA 4D82A 3Q5EA 2DBYA 2IUTA 1WP9A 1XNJA 2Z0MA 3HU1A 2IYZA 3TBKA 3B85A 3QSYA 4OJKA 3SE0A 3K9LA 4TSFD 1RZ3A 3L0OA 1W49A 1KTVA 1KSGA 1Z0FA 3ND9A 4DLYA 1M8PA 3AVTA 1EX7A 3DZ8A 2B21A 2DFNA 1G17A 3W5IA 1DAMA 2KBFA 1KI3A 1F3OA 3SJAA 1E4YA 4CT4B 2BEJA 2PMKA 2WMOB 1CJVC 4PZLA 2ZI4A 4F4IA 2PZEA 3PFIA 3LLUA 1KI8A 4H1UA 4XOIA 2BIFA 5TY0A 2IHYA 1G7CA 1ZP6A 1GZSA 1X1SA 3SJCA 5KDDA 4JBWA 2Y8EA 1EK0A 4ILEA 1SVKA 4PHHA 1DAHA 2BMEA 3EZ9A 3ZQJA 3T34A 5IF9A 1NVVQ 1G3IA 1DG1G 5DNYB 3N5CA 1S8FA 1VG9B 2R6AA 3QVUA 4UJ5A 2DR3A 1ZCAA 1SVWA 3IIMA 2HT6A 4O0MA 4NPHA 1OV4A 3B1ZA 2EU8A 2YKGA 1G3UA 2IYSA 4OBEA 1I4DD 4L5BA 1MH1A 1S2MA 2OILA 2ZRKA 3RWOA 1RKBA 3KJEA 4V0NA 1Z08A 3LV8A 3B5JA 2QRNA 2GBLC 4RSGA 1YKSA 2AK3A 2D7CA 3GLGE 2P5TB 1D5CA 1OXXK 3BD9A 3FGNA 3F5FA 4UXJA 3Q85A 4ERNA 4ZV4A 5FI0B 3QENA 3W6NA 3R7WB 1KGDA 2ZR0A 5L3SA 3MAAC 2H16A 1YU9A 4URWR 5CK4A 1NVXQ 3B13B 3QPWA 3SNHA 1R0WA 1VKJA 4D81A 5JFGA 4ZCMA 2BBTA 1T5LA 5K8IA 2YYZA 3A1VA 4TL9A 5FR2A 2GXSA 1W4BA 4QBGB 5C4GB 1FMJA 1J99A 4G3XA 4OYHA 4QJ4A 4B35A 1AKEA 1V43A 4LJ8A 1ZIOA 4HAXA 4Q4JB 4NDZA 5EXSA 3ADDA 1W36D 1Z6YA 2ZYWX 2REXB 1KYIA 4OQNA 3WHLA 1TEVA 2R6GA 3NBFA 5F2EA 2QUZA 1HURA 2FFQA 2KBEA 4HB2A 1KY3A 4MYHA 3MWYW 3TMKA 1NY6A 2BDTA 5FPKA 1SQ5A 4WA7A 1UBGA 2W2TA 2BOVA 1N6RA 2EWWA 1I4LD 3HP1A 3NXSA 4TYPA 5KNBA 3QG1A 2CEAA 5J5CA 4GNKA 5IK2A 1GRNA 2CHQA 4OI2A 2O8BB 1XEFA 1KDPA 1OIVA 5BXQC 4EAQA 1XMSA 3B2EA 1F60A 1XJQA 4DHEA 1Q1BA 4G5GA 2QZ4A 3QXHA 4ESVA 2ZRHA 1CKEA 2FDCA 3P20A 2A5GA 4FD2A 4EFMA 2AD5A 2I1QA 1DAEA 2Z5FA 3U44A 4EPRA 3JVVA 3QIAA 4GMDA 1ONBA 4OK3A 4TTQA 4BECA 3QI2A 3QOFA 4YDHB 2IS6A 2XTZA 3KTAB 3LXXA 4HUQB 2WMNB 2WJJA 4I99A 1R0YA 1IHUA 4B33A 1OYYA 3QJYA 3GLFA 1JR3E 4JL8A 2EFEB 4IVPA 5JJLA 4U5XA 2X2EA 4ZI3A 3AF3A 1NG9A 5BN3A 1XTQA 1EG7A 2IYVA 1Z06A 5CB6A 1XD9A 4RD3A 2WKRA 4MA4A 2DB3A 2AXPA 4IHQA 4ACAA 3IPXA 1NG1A 1EESA 3D6TB 2BBWA 1DE0A 3KKOA 4C4PA 4EPWA 3PXGA 4OHYA 4IOMA 3SBDA 2GCOA 5SZIA 1KOFA 4TLAA 2C95A 4A6PA 1Z6AA 5C1BA 4CRWB 2VHTA 2YWHA 3QXSA 1CIPA 4PANA 4HLDA 4YONB 3EPLA 4YMSA 3G0HA 1KDTA 3KXIA 4G5QA 2C78A 3UG6A 2FPMA 3BJIC 4XD7D 4IDHA 1KZGB 5FUWA 2OT3B 2LKDA 2V1XA 4N0DA 4UNSA 2BC9A 3THYA 3EC2A 1B0UA 1L4UA 3RRNA 4URVR 1P3JA 3X1DA 4O2RA 3SYLA 1MABA 3I5YA 2LWIA 5LB2A 3OAAA 4DCUA 1WBBA 2HXSA 4OI1A 3NTUA 3FOZA 3I62A 2ZRAA 1ZRHA 2B7BA 1HQYE 3CRVA 4PHGA 4Q7KA 4TZ0A 3SOPA 4D0GA 2DHRA 3BB3A 3G82C 4LYAA 4WBSA 5CB8A 4K81B 2JASA 4WXPA 4DJTA 1ZYUA 5J4KA 1EX6A 3AP2A 1GWNA 2GAAA 3OAAD 4EDHA 5P21A 3OE7A 2AXNA 2ZJBA 5FI1B 1VG1A 5L3SB 5TVKA 1RW4A 3ICEA 3A8TA 4KSCA 3TW4A 2IYWA 5BWMA 3LH5A 1W36B 2BKEA 3EX7C 4O3MA 4GP7A 2XOKA 1W1WA 5C46F 4Q19A 4HATA 5D3QA 3BXZA 3OE7D 4IJMA 3CNNA 2PZGA 1N3BA 2XJ9A 4B71A 3I32A 2WVJA 1GUAA 4BLTA 1CRQA 1U81A 3OEEA 1LW7A 4QXAA 4TN1A 2NGRA 2XOKD 3QUSA 3NVAA 4PQRA 2JJ1A 3RC8A 4A0RA 3GJ7A 3F8TA 2ZS9A 4KLNA 2X1VA 1ZU4A 4GZLA 3PCRB 2QAGA 3NDPA 3OEED 1ZM9A 3VR4A 2B92A 4M2LA 4Q47A 2IUSA 1F2UA 2UVQA 3TUIC 2E1RA 3AKDA 5G53C 2JJ1D 4JLJA 4Q9HA 3AH8A 3ZLJA 1BIFA 4G5RA 3C14C 4D80A 4DLXA 3VNVA 1S1CA 2FE4A 4M22A 3LBNA 5JWHA 1GIAA 1FTNA 3QEOA 2FSIA 2MSEB 5JSZA 1BMFA 5LD2B 3GLIE 2CMKA 4LK2A 2QQEA 3L8YA 4AURA 3BFKA 2F43A 4YMUA 4V0MA 3TSOA 2HUPA 3NG1A 2QNRA 3A1WA 3SJZA 1OJLA 2EFGA 2F7SA 3GLFB 2V6JA 4NCNA 3M0EA 5KNCA 3ZVMA 4JYCA 3SFZA 1BMFD 4PTLA 3TNFA 1E9FA 4C0QC 3OESA 5FUXA 5KPDA 2YOGA 4XWOA 1NNEA 3R9WA 3A1UA 1HE8B 5BW8A 2GRJA 1K5GA 4O25A 1G1MA 1II0A 2QU8A 2VRWA 3ND8A 4RCZA 4TQ9A 1O87A 2YHSA 1M6NA 4BZXA 2RGGA 4PAQA 2O0KA 1FOEB 2GCOB 4JYBA 2ZSAA 3AV0B 2VP6A 4B75A 1M1YE 1ZIPA 4NYJQ 3P4YA 3EARA 2JIZA 2NTYC 2O8FA 2I3BA 1KSHA 2ZSBA 1IJFA 1Z3IX 3LFUA 2HT1A 1SXJD 2IXFA 3DKPA 4TQAA 1DO2A 1JPJA 3PV0A 2AWNA 3K9NA 3THYB 5DH9A 2JIZD 1IAQA 3ADKA 4X8LA 3SHFA 5JLJA 4DXAA 5K8TA 2VSFA 1TPZA 4LV5B 2WOOA 1R4AA 2F6RA 3I8SA 4ZKDA 5KSYA 2NO9A 4DB4A 5H68A 1VMAA 4Q1FA 2VO1A 1VPLA 2C77A 2BJWA 4JSTA 1M2OB 1JJ7A 1YZKA 2FU5C 2YC4C 3WBJA 4B47A 5F9HA 3WXMA 4MRNA 3WHKA 2CDNA 3RYTC 4A1FA 4GT1A 2BHRA 4I1VA 1SKQA 3CF2A 4JLDA 1E0AA 2G1KA 1G8GA 1KAGA 4MDFA 4Q1BA 4NCHA 5JEEA 5B58C 2JLWA 3RVBA 2PZFA 4KLZA 3RS7A 2BV3A 1NJFA 3M1IA 5F9FA 2WAYA 5A5GA 1NN5A 4UXIA 3DMDA 1SHZA 5JBQA 2OBLA 3U3RA 2ZJOA 3K8YA 3V00A 3VX3A 1W36C 4WXRA 1OKKA 2C8VA 2Q9BA 4AWXA 5DHFA 4A0HA 1K8RA 3PUYA 1US8B 4QJ3A 4QM6A 1X86B 2C9YA 3L82B 4JKIA 4Q66C 4EPTA 1LTQA 1MO3A 3T1TA 3UG7A 3PENA 1G21E 1PLLA 2QAGB 1QHSA 1OKKD 1ZU5A 3GLGA 2V4ZA 1QF9A 3WRXC 4DLRA 5JRJA 1F2UB 3IKJA 2GJKA 2CLDX 3ZZUA 4NBSA 2BWJA 1H8HD 1S4QA 1BH2A 3QG5A 4JLOA 1EWRA 2I1VB 5AWFC 2IYQA 5JMTA 1IXSB 3IEUA 221PA 1A2BA 1XCMA 3K0AA 2F3TA 3EXAA 3LDAA 3WMFA 5JSZB 5FBWB 2G9NA 3W8NA 1AIPA 3IBYA 1NN0A 4U00A 4ZDWA 4FMCF 4Q4LA 1E1QD 2F43B 1XZQA 4B2IA 2P6RA 2QT1A 4Q7JB 4TMZA 3FMIA 3K53A 2FA9A 2CE2X 2ZI9A 2XAUA 4DDVA 2OCAA 2H7VA 1IN8A 4PZZA 5FTKA 4U02A 5LD2C 2ORWA 3FFAA 1FNNA 4QJ5A 2ZJAA 3TSWA 1AQYA 1TQDA 3NEJA 4M1SA 1CXZA 4OK6A 4WAUA 4AY2A 3SQWA 3TR0A 3SJBA 3R8CA 3E1SA 3UMRA 4FMBB 3VQTA 3KQLA 4EPYA 2ZJYA 2FFAA 4RD1A 2W6JA 2BEKA 2WJIA 1NBME 1YRAA 3BS4A 1PUIA 1N6IA 4R7ZA 3CPHA 2IC5A 2P5SA 4PPFA 4NH0A 3UKDA 1T91A 3CPEA 1P9RA 2VL7A 3CM0A 3FMOB 4TYYA 1QHGA 4UNRA 2W6JD 1XEXA 2ECKA 2JJ2A 4KJZA 3ADCA 1RC8A 4FI3C 1OH6A 1XTSA 2OXRA 2ZUCA 4JBYA 1XD2A 3OIWA 4IOJA 4DSUA 1CBUA 5GJBA 5L8VA 1JJVA 3WMEA 4RZ3A 2J7PA 4DC9A 4PR0A 1CJTC 2QY9A 1JR3A 1WA5A 2JJ2D 5EP4A 1D2NA 2P0EA 4QM7A 4Z8XA 1Z6GA 2WBLC 5KNDA 1KK3A 1AM4D 3EAQA 1NMXA 2IF0A 5KSPA 2QMOA 3GLFE 3A37A 2J7PD 4IEIA 4Q03A 1JR3D 4JJZA 1T0HB 1G4AE 3KFVA 4LHWA 4RD0A 4JSYA 3TUJC 2A78A 1PV4A 1HQCA 2V3CC 1YVDA 821PA 2VBCA 5SZHB 1X1RA 4JVNA 4QHTA 4FW9A 5F98A 5FBQB 4II7A 4E22A 1GG2A 5C18A 3VHLB 3OFNA 3KFXA 2QL6A 1U94A 3EIQA 2F1JA 1OYWA 3B60A 5G41A 1ZNYA 5KU1A 1OXTA 4LCBA 1J70A
chains in the Genus database with same CATH superfamily
4D6PA 1NONA 2W42A 2BW0A 2C54A 1MFPA 5K3BA 3WISA 4B9EA 1K0UA 1YVRA 2FPIA 4NNOA 4YFYA 1WZ2A 1VE5A 4P35A 2VDRB 3WRYA 5JNTA 4A23A 1ZJZA 2WWXA 5KTYA 2J9FB 4TTRA 4X1KB 4TVSA 3IUQA 5KEIA 5C80A 2JCGA 1YZLA 3TLJA 5IT9A 3H1GA 2JBWA 1WCV1 3CW8X 2B7LA 2O05A 3KUXA 3B3JA 3X1WA 4QG3A 1URPA 2AG5A 1Z4PX 2QAGC 1XCLA 2ZVQX 4PG4A 1SVLA 1NE2A 1OLXB 3C85A 1CIJA 4OV6B 4KUHA 4DUGD 1WB9A 2AOUB 3K0AB 5K3CA 4BLWA 2B4KA 3U7GA 3GFVA 5L95A 4HH1A 4N6GA 5C53B 4JI1B 1VCMA 2G1AA 1F2VA 2Q99A 2CCGA 3AR7A 1Z5PA 2I6GA 1L3CA 1OC2A 3A1SA 3DNFA 2FZGA 1GSOA 2ZRCA 1SOAA 2VAMA 3HYNA 5KYGA 3RSLA 1FXWA 4CCWA 4JWTA 2Q5JA 3I6QA 3O5AA 4A0FA 4BUJA 1TADA 4NBLA 1AX9A 1ABFA 4B73A 5BVGA 1UMKA 5FBZA 5I5GA 4M1MA 4S0ZA 1GM5A 3CV3A 5EY5B 3OZSA 4H6VA 3KX2A 3WLKX 4HOYA 2WJGA 5CXXA 2UYYA 4KPUB 1LPSA 3ZD9A 4ARBA 1I5RA 1J8DA 3M2TA 3PXAA 3O03A 3H04A 1R50A 2CVFA 2G5CA 2XBLA 1M33A 2WSSA 3KKZA 3PCXA 3PDUA 2CUNA 1IBKB 4R3WA 3A7EA 2V7EA 5HIIA 1YQGA 3LECA 3KKNA 1EA7A 2BEWA 1AUQA 1E2GA 1UC5B 4JD5A 4M87A 2FK7A 2C03A 3AZOA 2W9XA 3BMCB 3R5JA 4QNRA 4CR7A 4DIKA 2WIJA 4AYWA 3ECSA 3GWGA 2YCLA 4BEVA 2Q6KA 2YJ6A 3EQ9A 4IV0A 1QYVA 5KWVA 3BQNB 2C3UA 2PKEA 1LA2A 4J75A 4NXMB 4TTJA 3FYHA 5EXDA 1G8FA 4MOWA 3TG2A 4DCTA 4IDNA 4WZAE 3PT9A 5SYNA 1EDEA 3BF7A 4PZDA 4QQNA 3E0XA 4BO9A 2X5OA 3ZXYA 3ABZA 4A2PA 3I5MA 3PEFA 4US1R 3R7SA 1OYOA 5AKHA 4FBMA 4O2AA 3ICQB 5BWLA 5KVSA 4YXWA 4FSHA 4ER3A 4G4JA 5JLAA 2VXYA 1GXSA 3HKDB 4DRYA 3P9NA 4BMNA 2AQ8A 4K7JA 1G9XA 4HXFB 1IBMB 1MQ9A 4HFMA 1B6SA 1DVRA 2GB4A 2LCIA 4LYHA 3KHSA 4WHMA 3O7WA 3KLPX 3DWFA 4EATA 1V4NA 2PYIA 2B4RO 3P4XA 1Y3BE 3ESXA 3DAPA 3JR7A 4XYGA 3UUEA 1E62A 1G5RA 5EZ6B 2HX1A 1Z2EA 4FOOA 3RVPA 2D0PB 1D1PA 2YN2A 3OC6A 4BQNA 3WLTA 3ZGXA 1F7VA 3EXHC 1EVQA 3CO5A 4N3BA 2Q0QA 4WECA 3KXLA 1VCIA 1OGYA 2WI8A 3AUUA 2HNBA 4V3BA 2OMKA 4CFZA 1D03A 2X0NA 2IHBA 5FBHA 2SKCA 1CY7A 2WE8A 5B3KA 1HE3A 1MUUA 1O9GA 4C6RA 2WQ6A 1F48A 2IUYA 1J0XO 3HB1A 3IPCA 3P2JA 3Q3VA 3QBVA 3ZWYA 5F7XA 3ISTA 5GZ3A 5FWAA 3DFMA 3EWAA 1YZYA 2EP8A 2O3JA 1SCUA 4FGZA 4FHZA 4OY3A 4UW9A 3WGOA 5A7FA 2BZ0A 3TPZA 3IO5A 4EIWA 1XQWA 2NU6A 3K92A 3NAMA 1JI3A 3ACCA 3MT8A 5INTA 1HNWB 2FFRA 2QSZA 4N01A 4ES6A 3WRWA 4CUJA 2NV0A 3X2FA 1CUUA 5H5JA 5D5HA 4DZTA 4D98A 5ENVA 2RARA 1P2VA 4XKJA 4LJ6A 4WASA 4Q12A 1JFSA 4DEXA 1LDBA 4AY3A 1WNFA 2Y3IA 3BMNA 3IDSA 1ECCA 4P3OA 1DOZA 2JLAA 5IP5A 4AX8A 3O31A 3RFUA 4Z3KA 2D2IA 1HNZB 3D3NA 5EXPA 4X3CA 3A3YA 1QTIA 2HWYA 1XN1A 3LW8A 2ZQ5A 4KMSA 3GRVA 3TIGA 2WTNA 4IFEA 2RONA 2BH9A 2XUFA 3KQKA 3EIOA 1G19A 1ECLA 4MARA 5L45A 1G3QA 2W2MA 4ID3A 5KVVA 1HK7A 4XFDA 1CZNA 1DKNA 5FPHA 1M0WA 4G4IA 4LTDA 4D2IA 5MFZA 4WLOA 1WVGA 5CLFA 4JFRA 2OXTA 1PR5A 2J5KA 3FKQA 4WOBA 5BR1A 2ORYA 3V2IA 3RCBA 2PV0A 2XQGA 1O6BA 2X4IA 2P35A 1QHXA 4PAMA 1OY1A 1W52X 5BVGB 2CL5A 3EW7A 5I9BA 3FLEA 1XKTA 1LSOA 2B1GA 5C8VA 4BE9A 3THXB 2IE0A 4AUKA 4JI3B 4OHBA 1I5OA 3IOYA 4DRXB 1ENYA 3OOYA 2EKLA 4WERA 5DISB 1XKLA 4YRJA 3VGPA 3SY8A 3LY7A 4KO8A 2LIVA 3WYBA 2JRLA 1BWPA 3MQ4A 3ASUA 1B0AA 1FVHA 2BEWB 3ZJ5A 4YASA 4XB2A 5EYPA 4W9MC 3FTCA 1TEXA 2G06A 3SI7A 4JYMA 4U1RA 1RMYA 2GM3A 3MIIA 3L6BA 4L75A 4LRWA 3EVZA 4BWFB 1BU5A 2AMJA 3RKUA 2V3VA 2Y0PA 4KVAA 3N9IA 5DBFA 4M1QA 3F67A 4BCDA 1CZHA 1YHNA 3R7BA 1JZQA 3VH2A 3RTDA 2HPZA 1EP9A 1IFXA 1M54A 2QPTA 2F4NA 3EFOA 2HSGA 1MC5A 3SHQA 2O8DA 4DYVA 3BXOA 3I42A 4LZLA 2YQZA 1GVNB 4MP8A 1U0FA 1RYFA 1KAOA 2O0JA 3CX6A 4PFKA 2OO7A 4TXMA 4DV5B 3RJ9A 4DLPA 1KK2A 2RHCA 4EW6A 2CD9A 3BH6A 1SWVA 4DMGA 4XSGA 1E8NA 1HFWA 3OZRA 2P7IA 3A2LA 4UFPA 4O2AB 1NZFA 2CEKA 5GY7A 3A4MA 2W6ID 4OQ4A 1GXSB 5I3ZA 1XWFA 5CIQA 3PE3A 3ZCRA 1E1KA 1ODFA 2OBMA 3GHHA 5AJXA 1VA4A 1JQLB 3BBPA 1GG5A 4E1BA 1ZHHA 2P8JA 3LKVA 1JHDA 2X9GA 3WRXA 3WY9A 1EUDA 1PS8A 3IUJA 4AMUA 3R5HA 1DT3A 3SS8A 1PV2A 3DQPA 1QZXA 4AI6A 3CLSD 1ISIA 1YZUA 1ORDA 1SBHA 2VSNA 1KGSA 4KFSA 4KN5A 5CT5A 2DWQA 3DUFB 4HGPA 1NBMD 4RANA 4UPEA 3IMKA 3U5TA 3LD9A 4R9RA 2DFPA 2C4KA 1V47A 3Q98A 4JLAA 4HDSA 2B69A 4EW1A 1NU8A 1Y1RA 2EEPA 3OEHD 4FDAA 4GGMX 4KE6A 4LTNA 2B2XA 3JALB 4JLKA 4R8RA 3X0DA 3BJMA 3V7UA 3TOSA 3D8UA 3GPBA 2QL7A 2X5XA 2Q3DA 4ZVQA 1SCUB 4DY6A 3EVAA 3FRIA 3U17A 2ZU6A 5MF6A 1K9SA 3K8OE 4MUAA 3U0BA 4NCAA 3DAYA 4DLAA 4KBGA 4O1HA 2NU6B 5FJIA 5A9SA 5AW2A 5IK2D 5KWEA 4E11A 4LHEA 5IKXA 3H1AA 3LUAA 3UO8B 4RKFA 4Q9JA 5GVRA 4B6JA 2YNMC 3WL5A 2I2DA 5FFNA 4HTAA 2ZSEA 5IBPA 4HYYA 4XPZA 3TOXA 1FLAA 3NNSA 1ABBA 3K35A 4PGMA 5D8DA 3ZW8A 1NL3A 1WO8A 3BMNB 3E53A 1ESZA 1R0LA 1JH8A 1TD1A 2RDMA 3T1HB 3B36A 3Q3GE 4MZDA 1IHDA 3WGNA 2ZUBA 3C3PA 1NLZA 3CZRA 3MJHA 1V8DA 2QTVB 3A26A 2GD0A 4AO7A 1AKUA 1U2RA 4NBUA 1KARA 5DDIP 2ESRA 4EARA 3OZEA 2JLYA 3GCGA 4CIBA 1DBQA 2EVWX 3FNEA 2UUPA 5FBLB 1V3TA 4LZAA 1VKZA 1WU7A 1JHAA 4B6GA 5AJYA 4RTSA 3GMIA 5KREA 1V3QE 1Z0IA 3IOCA 3K0FA 4LC1A 4DCSA 2ZUWA 1V25A 4GKBA 4H9GA 3UM9A 1NBAA 1CSEE 2DBRA 2ZG6A 4JROA 5GM1A 2VEOA 3BORA 4AL4A 1W5SA 2F48A 2V9ZA 5FP0A 4YRRA 4GEGA 4L76A 3O92A 4RD4A 2PZ8A 3D3QA 2IF2A 2PSEA 2W83A 2Y1KA 1QP8A 1H1LB 3BCSA 3DEIA 4GLFA 3ZLTA 4PYMA 3K9CA 1ZCBA 2I22A 3N05A 1MGOA 1D1TA 4OFWA 2JNWA 5I7FA 3LKZA 2HXYA 2X22A 2DQYA 3EN0A 3RRFA 1LRLA 4EGQA 1EA5A 3D0RA 5DV9A 1V7ZA 1E1RA 1P33A 1JPNA 2C1ZA 3EY4A 4DDVA 5KOYA 3N0TA 5EYPB 1G55A 3L8GA 2K4MA 1JJIA 1S2LA 5EKXA 3S2FA 5HNKA 5JJ5A 2PAAA 1XC7A 2WUVA 5I51A 4H17A 1BQ4A 2X0KA 3GEIA 2XNSA 4ON9A 3WLHA 1NVDA 1E20A 3KJQA 4WKNA 3K6JA 4QVGA 2OHIA 1NT4A 3EFOB 3H4IA 4LKRA 4BUZA 4BP8A 2O8DB 2ZUTA 4N8EA 4B4UA 3NASA 4Q3CA 2OHXA 3H2KA 4R1OA 1CLUA 4MP3A 2GAJA 4I6JA 3ZY2A 4H7FA 1VPEA 3ZD6A 2DAPA 2ZQYA 1SBCA 2CNWA 4LJ9A 3HJTA 1I2CA 1RSZA 2X41A 3ROXA 1DNPA 1Z28A 1W88A 2W22A 2RGRA 3PHCA 2B5OA 3EGDA 3A4NA 4FFDA 4LGVA 4PPQA 2P65A 1K6MA 2PZMA 4TS1A 3H8SA 2Y1WA 1A8PA 1D2GA 3HEMA 4MQUA 2J45A 4Q15A 5AJTA 3GCDA 2PQ0A 3BCRA 3IERA 1DC5A 3Q2IA 4LRXA 5KTMA 3S3TA 1U4SA 1B0PA 2HJHA 3W7AA 2XNDA 1KYTA 3ESYA 1RYHA 2HJSA 1OBCA 3GV0A 2E49A 1EUDB 4YMIA 1JIIA 3RS2A 3ANLA 1P4AA 4F38A 2FFHA 3HBMA 4PIVA 4J76A 5FFFA 4OHVA 4ZYYA 1HTTA 1VXOA 5LMUB 4O2BF 1WZNA 3R3XA 4CM8A 1YF3A 1H1TA 2H51A 2NSDA 2B4AA 1F8XA 4KFRA 4A8PA 1EQ2A 1XLVA 4TMXA 1ZONA 3A9VA 4S24A 4NU0A 3A11A 3SICE 2QM7A 3V4VB 1BHJA 1UXOA 3D7MA 1L7XA 2MDTA 2WNSA 2V96A 3E03A 3H84A 3LX8A 4HDSB 3PRHA 3HYTA 4H1HA 1ESCA 1I33A 4U0JA 5FCDA 2ZETA 4EVSA 2EDAA 3ZDQA 1M6EX 3CZPA 1L9XA 5B1YA 1NRIA 3NYIA 4EKDA 1PBTA 2D74A 2Z4TA 1QQAA 1T5OA 1H0KA 2BGRA 1KO1A 4FMCB 1FRVA 4OBWA 4E30A 4ZA2A 5A9SB 1AKTA 1YKFA 3O6VA 1SHTX 5TMEA 1Z4QA 4E03A 1C14A 3H9CA 3OHPA 5GOTA 1O9HA 2Y1XA 1U5AA 5KX5F 5DTEA 1N0HA 3G1WA 2CHUA 2OHJA 3CR7A 4FILA 4HRYA 1SOMA 2FW8A 2VDLB 5LQJA 1LQTA 3EIFA 1QQTA 1P73A 3CC8A 5D7BA 5JAZA 2M6LA 2DSTA 3TVDA 5KYYA 2J1LA 1IPEA 4ZQBA 2X5NA 4HGZA 4PY2A 1CUFA 1CR4A 3H3XA 4KC0A 2XZLA 1V8OA 2FFBA 4L57A 4IFIA 3FE2A 4BP9A 4DPMA 4TLLB 2PX4A 1UM9A 5IDVA 3L0YA 3SXJA 4E88A 4NKRA 1W5EA 4MYTA 2WVGA 3W3AA 2ATXA 3RABA 3QXJA 5B3AA 3KB8A 2R1ZA 4HS9A 3ZLUA 3KTFA 4UHBA 2NVWA 3CEMA 4QBTA 3MTIA 2ZUFA 4HDAA 4K0KB 2ZUEA 4Z1OA 5B1SA 4C0BA 1ZN2A 1DEAA 4TL6A 5AVZA 4Z6KA 4DV3B 2VCEA 4EY5A 3K0FB 4GBGA 1J7JA 4RAQA 1J42A 5JSQA 3W4JA 1ZR4A 3PX3A 2VQ3A 2EL9A 3G2HA 2I5PO 3AOEC 3R23A 3CKMA 4TXNA 3ZBQA 3MJEA 1BDIA 3RKRA 1N2XA 5KSPA 2PEYA 3AF4A 3ZOKA 4B79A 4CGYA 4C2TA 2PL5A 2WUEA 3HR7A 2J4DA 3GEEA 3LJKA 1Y4SA 2NZVG 1WD5A 2BSQA 3HXQA 5CDSA 1GNTA 4RGYA 3RD5A 3K1TA 3EF0A 1KZ4A 1C80A 3ESRA 5DHUA 1ADBA 5JFTA 2HBQA 1YI8A 3PNQA 4CTOA 1ODCA 3CEAA 1G16A 3K6KA 3MUNA 2GCNA 1KDYA 5CB4A 3MHTA 1AQJA 4HF7A 4JZKA 2P3SA 3ZWKA 1FFWA 1TM1E 2ZRFA 3CX7A 1CP3A 2DUUA 1U8UA 1XTRA 3L46A 2X0DA 3GZ4A 2LDBA 1KWGA 1P0FA 3I72A 4IWYA 2O5VA 4X20A 3RVSA 4BFZA 3GGJA 3LY9A 1CQZA 3C3JA 3EPJA 5AHKA 1NY5A 3DJYA 3EXHA 1DBSA 1SUSA 2VPZA 2WWIA 3AHJA 4IEEA 4OFZA 4RZSA 5F77A 3QFTA 1USGA 3H3JA 4PC1A 1SC4A 3R7DA 1JEYA 4MK4A 1JG2A 1Y5MA 1ZM2A 1YZHA 4I3GA 5AM2A 4X6UA 1BDHA 3WWZA 4Q9NA 2VP3A 4XYEA 2YZGA 3BRSA 4JMLA 2HEIA 4XYLA 2Q5CA 3AFNA 2H6EA 3FVQA 1W88B 3HB5X 3PC7A 5LQUA 4CVNA 2F59A 2AZXA 1UK6A 1ZPDA 2GJ4A 3ABQB 2QI9F 4NZOA 5JHHB 3MJCA 4HLQB 1DRUA 1DC7A 1OWPA 1TYBE 3A6GA 4IJKA 3M1LA 5E3JA 1ZC3A 4O4LF 3RG8A 4Z7NB 1XMXA 1JHMA 3K8QA 5KMGB 4NNJA 3MBOA 3RG2A 2HRQA 3TH5A 1YVUA 4OQLA 4AJIA 2PKYX 4QU5A 4XSVA 4K88A 4C3UA 3EBPA 4CG3A 4CM8B 1FUUA 1E5TA 1NQVA 1QONA 3HYCA 1IVSA 1Q57A 3H9BA 2ZBPA 1E61A 4JP5A 5C3MA 4RJLA 2D2VA 1RI5A 4UCFA 4WK0B 3BGVA 5ESDA 3TSAA 5KS2A 2VYFA 5DNDA 2TMDA 2RK6A 2CK3A 2G40A 3PDHA 4MUHA 2Q5HA 3LHFA 3CG4A 3WMWA 2O54A 2JKVA 3RT9A 5A4DA 1RWKA 1VYTA 3TEFA 3RAPR 3B9QA 4BCBA 1R9MA 2FX3A 4A2WA 1K6JA 3HWX1 2ERYA 3REGA 2HWWA 2R11A 3FG9A 5THQA 5ETJA 3A3KA 4I55F 2ZPTX 4FR5A 2I91A 4DDUA 1XKQA 1Z13A 4HWPA 4WCDA 1I2ZA 1Z25A 3LT4A 4YJ3A 2GFHA 1I4OA 3OWOA 4LJYA 4BBAA 1U11A 9LDTA 2Z08A 1LTKA 3GN2A 3ZCXA 4BXOB 3GGCA 2UXDB 2A3NA 2QVZX 2GPSA 4NJEA 5ALDA 4EW3A 3P0RA 1PEAA 3PD7A 2Q28A 1P4HA 4LA4A 4M4SA 4H1TA 5KYYB 2X3UA 1A7JA 4MCIA 1Z0AA 2RHDA 2IOHA 3FOWA 4Y2QA 5D1HA 1KP2A 5HDQA 2I2AA 3FDJA 4KZKA 2QRZA 4OM8A 3S29A 4XW2A 4CF4A 3A2NA 1P6QA 2HRDA 3G1UA 2DWUA 3CSUA 2NO1A 1T3GA 3RHSA 2WJ3A 3JQFC 2PGDA 4LRUA 1IY1A 1Z35A 3BVPA 4FZRA 5F35A 1KYVA 1Z22A 4PPNA 4Q21A 3DVAB 1Z5ZA 4RGBA 1EE2A 3C3EA 3DQZA 2PH5A 2DMRA 3QPCA 3ZV4A 1Q0LA 1TF7A 4IJ5A 4HNUA 3AVQA 4D3FA 4NJMA 3VXKA 5EE3A 4ZC1A 3VC7A 1WW3A 5GINE 4AZWA 3PJEA 1K0FA 2ZOSA 1D04A 4PFSA 4RZ2A 3MBKA 1UWVA 1TFUA 2OZPA 4DDHA 2FQXA 4L7VA 2Z1MA 1J1IA 1WZUA 3K32A 3RC7A 4B3FX 2YFKA 3RUCA 2M98A 1MZVA 4QXPA 3ZCTA 2W90A 3ANMA 1QZ3A 3I2FA 3JQ7A 2FMIA 3CJRA 4IDPA 3TRHA 4DMLA 2GF9A 4D8TA 1ZMRA 3P52A 1JQ3A 2JKYA 3QWFA 1RTTA 3SLGA 1SPXA 3CSSA 3DFUA 5F51A 4EWLA 3L01A 4QLBA 3R6TA 2CNBA 2QW8A 3DCIA 3N8KA 5CB4B 3L93A 5DYTA 2Y0CA 1MV5A 1GAWA 5ICSA 3I4LA 3C6BA 5C0OE 3ZZTA 3KYIB 5H70A 1YJBA 1H94A 5EFOA 1E2FA 4LW8A 4PYNA 1XVLA 1QO0A 3FNHA 3ROTA 3NALA 2XEXA 3H42B 1HL7A 3OECA 5KCZA 1FYWA 1YJXA 4H1VA 2G5PA 4OQMA 1JEYB 1ZKMA 5BR8B 1UADA 2OGSA 2PAFA 1K63A 4J0DA 5F1OA 2H07A 3D5QA 1CDEA 3U19A 1Y4ZA 4WH0A 1Z5NA 2PL9A 3OLYA 4LSGA 1MAVA 2ZSDA 3HZZA 1KQGA 3SD7A 2QSYA 2FRDC 1GPJA 2JHGA 5K0ZA 1TTQB 1CUCA 1EM6A 2Y9MB 3B51X 3PQDA 3EMKA 1ISSA 3FMVA 1DIAA 4YBRA 3IOEA 3NGXA 4CFYA 2VF8A 1DJPA 5F33A 2C57A 2YNMA 3TE6A 2ZAIA 5DX1A 4KXFB 1E6KA 5BOVA 1X8XA 1ORVA 2HC9A 3ZGNA 1VQ1A 2GK3A 4CF5A 1PZMA 1SBYA 3LCJA 2Z83A 1KJIA 4G5OA 4BRZA 1GTVA 2EGUA 1VJ5A 3V8VA 2ZS8A 1L4NA 4Q9IA 4L3OA 4RTQA 1XX6A 2KX7A 3FWPA 1WDKA 2IYLD 5DASA 3M49A 5CDGA 1WR8A 1ZD8A 3P2EA 4R84A 4ZVRA 5SY4A 4DMFA 3OETA 2IU6A 3ZS8A 3HXOA 2Y2VA 1WUYA 2H0QA 5EIXA 1QGUA 3IHTA 5JAOA 3BDVA 2YY6A 4ZV7A 3L5OA 5KTOA 2AB0A 3A58B 2I6XA 1E4EB 1WZIA 2M6SA 2ZP1A 1C9KA 4HLUC 4JLWA 1ES9A 2HGSA 1N3LA 4IIGA 1AMOA 4BJ3A 2HBYA 2EEZA 4RTNA 4FIDA 3KU1A 5JDIC 5IVIA 1PEYA 2AG0A 1AK2A 4PC7A 4ALKA 2CFOA 2V7BA 2IQ5A 2IA5A 3D8BA 4RCYA 4YJGA 3JQ8B 3V4FA 1HO3A 3D4OA 4RFVA 3GEGA 3JATA 4JT4A 1C8KA 4AJ9A 1NTOA 3O2JA 4HDRB 5AXBA 2XA2A 3IE2A 2H1CA 3VISA 2X6TA 1XZMA 4PZAA 1CEXA 5F5XA 2HF7A 4ZO8A 5G4LA 3ZHRA 3F7NA 3FFWA 4MCHA 4YRAA 1NQ5A 5HW0A 3K1YA 1ZQ9A 3CURA 5IJ0A 1M7HA 3I9V6 1HNNA 1UKEA 2BSAA 2O5RA 3NPAA 4GRIA 2AD1A 3IAS6 4K9NA 4LJ7A 4TRNA 4DUZB 1T5HX 2AXEA 3GAZA 4RXUA 4YT2A 4GGOA 1QHHA 5JWRA 1YXMA 2UZIR 3IAM1 2MSWA 3BKXA 3TMAA 1KPGA 5J40A 3RAFC 2FVXA 3IB6A 4NF2A 3BK7A 5M29A 3AR5A 4DJEC 2Z2KA 2PZKA 3LC2O 3NUZA 4IIUA 4NMXB 4PYLA 4CI9A 5ALQA 4GPIB 1ZC4A 2BM1A 1DPGA 4LX0A 4NJMB 3EZXA 1EUCA 1OILA 1OI7A 3AIOA 4X85A 4YV7A 1O5TA 9ATCA 1XZ8A 4YT4A 4LY6A 2H57A 2WSSD 4MJ7A 2H0AA 3WBFA 3S81A 2A7XA 2FPPA 4M49A 1JFTA 3Q3HA 1MU0A 1FUIA 2ETXA 2OHFA 2QMEA 2VCHA 3QFSA 2BEUA 4ZWNA 3STXA 5I9TA 3OQPA 5D5QA 3JQ7B 5AW7A 1NMQA 4FFRA 4DA9A 3JQEA 3KV3O 1O57A 1J8VA 4KSYA 4NQRA 3UXHA 3KSUA 2P6UA 1RJ9A 3HCPA 4F21A 1HE4A 2RSLA 4PSVA 2PQ2A 4V0QA 2J9ZB 3CCFA 3JVUA 3TM5A 2JLBA 3O1HB 4RKEA 3UNXA 3I28A 4PLTA 3RS0A 1R37A 3WQRA 4CMAA 4P3PA 2AFIB 4AF6A 1OCEA 3EF3A 4L85A 1CTQA 3WZMA 2FMKA 3CLRD 3F8SA 3HBNA 3IQWA 3OH8A 4W5NA 2LNDA 3WIDA 4MP6A 2IKQA 4QA9A 4OHPA 4P81A 4BJ6A 1DBWA 3F3SA 3THSA 1P9WA 3RW9A 5HTKA 1E8DA 2QKYA 4PZEA 5AVKA 1XLTC 2XW6A 1HDOA 3EAFA 3KE9A 4N76A 2D13A 2A4MA 3FI0A 4NYIQ 4GPBA 5AKZA 5EP3A 4FVTA 1BN7A 2VYVA 1UJ6A 3HA7A 1GR0A 1OV6A 1GQ2A 3Q0EA 4DR3B 4HQ6A 1M67A 1PR4A 3K72B 4TS4A 2QYHA 3TQHA 1NVVR 3X1XA 2WOJA 4LQ4A 3MJVA 1HLGA 2BGIA 2VP0A 3OOHA 4Q7MB 1HSOA 5I7HA 4Q93A 1ICIA 1WV1A 5HFJA 4WIAA 4JI5B 1C4KA 4KYIB 2P9JA 1NFRA 1R5OA 4G63A 1WY7A 1T8UA 1MT0A 1HM5A 4KN8A 3K70C 3ED5A 5AD1A 3GH3A 4H59A 3P97A 3BXXA 2I6SA 2RAPA 1OX4A 5K0NA 1R0XA 2SICE 3Q4GA 3DBIA 2EP5A 1DO8A 1CJCA 1GOTA 1EDBA 1H0HA 1NXPA 3O2SB 5HCUA 4CW7A 5LL6P 1EWKA 2PX8A 4MA0A 2ZU0C 1O2DA 4O0LA 1VRVA 4IFBA 2OYRA 4EHLA 4F9EA 5CBPA 1I3LA 1OGJA 1PW7A 1S01A 1K8YB 3JR3A 2W71A 3KBBA 3LKDA 4HY3A 2IGBA 2WT4A 1DMSA 5T57A 3SMQA 6GPBA 4BRUA 1JB1A 2WFMA 1RBQA 3OJCA 1E2IA 1VI2A 1L7DA 2PV7A 3H86A 3WWDA 1BOFA 3AOEA 4YJGB 4DYHA 1UEXC 5FJJA 4KZPA 2CZCA 3T9FA 3DKIA 3OQOA 4ZKEA 4GO1A 1GCIA 5JVDA 1NNUA 2PS0A 2ZEJA 1Z07A 1II9A 1G5QA 3LGXA 4TLBA 5CPFA 4JBIA 4ZQHA 4XVCA 1BVYF 1ZZGA 3H2JA 1BGXT 3NUGA 2HQOA 4A0QA 2WUDA 2B3DA 2G4VA 2R8RA 4L02A 4IGKA 1RXEA 1UJ4A 3THXA 5IJ0B 2FLWA 3G8DA 4DM7A 1V1RA 3UJAA 5IPFA 4ZIRA 4K6KA 3EB9A 4LWQA 3RYFA 1ILEA 3AQ4A 3COYA 5DULA 2H3EA 1QHHB 5ALUA 2V0GA 4C07A 4P3NA 3U3OA 4C0JA 2ZZMA 3BT7A 2R4UA 4FFOA 5LJIA 4P5DA 2HEGA 2ZR8A 5MN5A 1FSZA 2O2JA 3OHMA 1NDHA 3FBWA 5B7NA 2QV7A 2A3RA 3D9QX 2F2TA 4B2LA 5GTDA 5JROA 1V3UA 3G0GA 3OUUA 2F90A 3V8QA 4V0SA 1H5NA 4G4GA 5CJ2A 4B09A 4FJ1A 3G7SA 2JI6A 2PD4A 4GC5A 3ZJ4A 3OM0A 3NJRA 3PYMA 1EUYA 4L5YA 4JUDX 2FPPB 3P9KA 3QIVA 3W9YA 1Y1KE 3CKLA 5JE8A 1UPFA 2DUMA 3V4LA 5C37A 1NVUQ 4PXSA 2BEUB 2RD2A 2D5BA 2Y1DA 4R16A 1U90A 4GUAA 2C83A 5BORA 2GEBA 1I7QB 4PG5A 3Q3EA 3CT4A 3LVRE 3REQA 2WMYA 4ND7A 1R0CA 1X3SA 4IDQA 3PXDA 3FNBA 4AP5A 2EG9A 2LCQA 1C4WA 3LBAA 3THOA 1NIJA 2ZJ8A 1DP4A 1FDWA 2OEPA 3R3ZA 4YQEA 4RS3A 4J49A 3D54D 3C3AA 1U8XX 3LC0A 2GESA 2YRXA 1KOLA 5BR7A 2F9FA 3MUFA 2ZRQA 5FUBA 3PA6A 3RC9A 3SYKA 3ETJA 3RIGA 2PLFA 1P1IA 3HI4A 3TL3A 2JAPA 3ONNA 1E0JA 2ZRLA 3TVYA 1FFCA 2PRZA 2ZLBA 3PUVA 1Q14A 1XXLA 2WSYB 1GPDG 4OQXA 4UEJA 4BO7A 3L1KA 4CV3A 4BEWA 1XQ1A 5M3BA 5K3OA 4EHHA 1X7XB 4YRQA 4YO7A 1RP1A 1R9GA 3B8HA 3CYFA 2XBMA 1T0PA 3O82A 1VMEA 1IQUA 3PPWA 1WSBA 2NWQA 1HOTA 3A9UA 1GU1A 5J2UF 1CY6A 3IV6A 3KE8A 2XXJA 5TE9A 4FUQA 4TZKA 4E7OA 4PX3A 3NHFA 2WTUA 3KT3A 2COEA 4ZCPA 4QKQA 3CZ9A 3QOYA 2XDQA 4LECA 2FWNA 4MRRA 4TZTA 4U3JA 4YJ2A 4LYEA 4RM3A 2PCJA 3WGVA 3AWIA 1PFVA 3BWDD 4KX3A 4XIFA 1AZSC 1XZLA 3A6LA 3CLUD 5CGQB 5DM0A 5FBKA 3ZG6A 1OX4B 5IZ4A 4PLZA 1RKQA 3A1FA 5CVCA 4GX5A 4NYMQ 3JQFA 3ZYZA 1RACA 5KOHA 3BEDA 4G1UC 3UANA 4EGJA 5M04A 5J9FA 1AUVA 1HEUA 1AB6A 2BFEA 2EV9A 5CBPB 1XMPA 3OKPA 4KKXB 2R87A 2XI4A 5J3JA 5AR1A 1KPHA 2QU7A 3MVEA 1X8LA 1GCGA 1Z0DA 3BGDA 3ILYA 1WNTA 1THTA 5CYPA 4UFNA 4H4DA 4AJLA 1RZRD 1PL6A 2II6A 1W8DA 1IZ0A 1FDVA 5JVDB 1RP7A 1ZD1A 4TUYA 3QV2A 2Z6VA 1G6OA 3N8IA 4NAVA 1TNDA 1KZ9A 3OTQA 5H9WA 4DDTA 2W8BB 3IGFA 4U2GA 1N6OA 4ASUD 3HH8A 4B44A 4ZIRB 2Z8XA 1C4XA 1SBTA 2QVLA 2WFAA 3LC1O 4OAQA 3RYFB 1PEKE 5EWMA 2DE0X 3QKRA 3OX4A 3MCUA 4H18A 4E2YA 3U09A 1OH7A 2XPCA 3OWXA 4N18A 1VCNA 5EPEA 1MB4A 2HI0A 2KE5A 3R1IA 4MUXA 4Q1VA 4TV9F 4EHIA 5K5EA 3D4PA 5T8KA 2CXNA 1U0JA 2DHCA 4MQEB 3SC6A 3WBBA 1OZGA 1PQYA 2O50A 2X3FA 2CN1A 2W11A 3OTOB 1PVVA 3VNSA 4NU8X 4U0KA 3TO5A 5FBVB 1SVOA 4A6EA 1YBVA 1Q15A 3UPUA 3FJOA 3IVAA 2IYEA 3OE5A 4C20A 2PRIA 3AEYA 2NXEA 5ERGB 3QUQA 5B3LA 1FFXB 2XKAA 1U0RA 3DLTA 4YT8A 1U8YA 1IJEA 1D8AA 1BC5A 1N9ZA 3LWNA 4I19A 4QDUA 4C43A 2PKWA 4CF3A 1EGHA 4YGYA 2CW5A 4BZWA 2B20A 5DOVA 1IVNA 2C58A 3I9MA 2BLNA 3AR9A 4D9BA 5FL3A 1FW8A 1VIMA 4NP6A 3RWBA 1UBLS 4RJJA 3EA0A 1TMYA 3VR5D 3QU2A 1M7BA 3CLRC 3F7MA 3D7NA 1T6NA 4K1LA 4FONA 5BSHA 4WJLA 1TRKA 2HQSA 1UQTA 1QLHA 2QZJA 5K8LA 3MJDA 3L6RA 2FQYA 5AM1A 3WWCA 5B57C 4I1OA 1VJ1A 4ZCLA 5I7RA 3CZCA 4X97A 3CF0A 4OGGA 1QCZA 4Q3LA 4HLUA 5TPZD 3OMLA 4I4IA 3CSDA 4U8HA 1B6TA 3PXCX 4YC7A 3T7EA 3I2YX 3VVBA 4DB4A 4U7PB 3S8MA 2P8SA 2BELA 4IUBS 1Z0SA 3ROEA 2O8EA 5LBTA 4P92A 4DMCA 1JHOA 1T3TA 4UHDA 2WVHA 1L5RA 3FYSA 1DOAA 3OWHA 5DT2A 4FCTA 4JV5B 3KDAA 1RHUA 1PAUA 4IIJF 2ZYIA 1JHVA 1Y7TA 4MWBA 3OKFA 2VH5R 4ILKA 2FZLA 2XDQB 4C9BA 3LBIA 4QC2A 4HVLA 1O6FA 3OF2A 4KYUA 4U3JB 4YJ2B 5L7TA 1IBCA 1E96A 1CEEA 2YHIA 3E5NA 3SHVA 3IOMA 1MEEA 4L8YA 1DBRA 3LX5A 1N7IA 3BJRA 3GD5A 2JZNA 3L1IA 1Q7RA 1S3FA 4XD2A 1F8UA 2BFFA 5JPDA 2EQAA 3OX3A 1A2OA 1L7BA 3OIYA 2VJKA 1UANA 3RHFA 2B2CA 4B0PA 2GZHA 1AC5A 3W90A 3ES9A 2FY8A 3KXKA 5JJKA 1Z62A 2BFEB 3C3DA 1TA4A 3EFHA 4P38A 3N6VA 3MTAA 1CUVA 2H0RA 4YP1A 1G6HA 1PG5A 1UPCA 3V8BA 2JAHA 3NBXX 8ABPA 2BFCA 2IZOA 1LF0A 2B30A 1F9EA 2N3ZA 3EVGA 3EBOA 3KSMA 3ZTTA 3PEWA 2YV5A 4RV4A 1UBMS 4LXIA 2JL1A 2XQKA 3IIKA 4DSOA 1FDUA 4UMEA 4C3ZA 5AVQA 4DWVA 1P2FA 1X7WA 3M83A 1QBGA 4MV3A 2XUAA 2FZ4A 4TUYB 5CA1A 2Q62A 3P9SA 1JLKA 4EG1A 4LF7B 2DY1A 4Y9SA 4A8JA 1R9NA 2OL4A 3I01A 1VBMA 3CMCO 3GJ8A 4ROTA 2BGGA 5JAQA 1JW9B 5BN3B 2UVPA 1T3LA 4R9SA 5BW4A 1GGHA 2NACA 3INYA 2ZT7A 5CNIA 3RFXA 4BFTA 2BH2A 1DKQA 4KN9S 5EWMB 1K4KA 3QKRB 3NHYA 5HRUA 2QMHA 2HA0A 4L6CA 5WRFA 2PSFA 1A82A 1H8EA 3L0SA 5K20A 3VJKA 4BBPA 2FR8C 1QIMA 1EFUA 5FYDA 3RVJA 4YLYA 2D0IA 2JGFA 2WIDA 1AQNA 3EEFA 2ZSHA 1N2CE 1EVKA 2FW9A 2NZJA 4K9DA 1Q1NA 3K5PA 5I01A 4DJFC 1S8NA 4HAVA 1YCHA 4KX5A 5JZMA 4NFHA 5C7IO 2IWRA 4YDSA 4BWYA 4MA5A 3TCXB 5JT1A 5YASA 4RVOA 2ZDGA 1QV7A 2NXJA 5IVDA 3UC5A 2YJNA 4DIOA 1ZJYA 4IXTA 2VEDA 4GC9A 2WK1A 1PT6A 4LBWA 2QTFA 4HMPA 2ECQA 1Y63A 5FADA 4YRZA 4DIFA 1UXKA 2R65A 5AJVB 1TQHA 3UK1A 5JYCA 3HJFA 2YWFA 4DLNA 4P33A 4Y6QA 2DLNA 4OUDA 3TLAA 3FZYA 1QG2A 3ZE8A 1THMA 2BT4A 2QUKA 2DKOA 3ONEA 1I3MA 4ZYXA 4MJXA 4MUGA 2PX6A 5JNUA 2CCJA 5IAEA 3WBKA 5KTRA 2V7TA 2VXBA 2PH3A 1EQUA 1U2TA 1RI1A 1IWOA 3Q3JB 3RFTA 2A5LA 4YV2A 1JXMA 1O5IA 2XBUA 2IPNA 2QPLA 3FH0A 4WY2A 4BO8A 1SPBS 2NZYA 2HWUA 3DOCA 4QGBA 2GFIA 3LU1A 1YULA 1JLHA 3A6PC 3G2KA 1WZCA 4NEHB 1R6UA 5EQTA 4XWKA 5GADl 2HU8A 3OTWA 1O97C 1YFJA 2H3HA 1KNQA 2QP3A 3Q8MA 2FPXA