5SZHB

Structure of human rab1b in complex with the bmerb domain of mical-cl
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
GHMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords MICAL C-terminal-like protein
total genus 61
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2016-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5szhB00
2PCJA 2WIBA 3GLGE 4LRWA 4X8HA 2VSFA 3D7MA 3SHFA 2ZSFA 3GLHA 3V9PA 1XTIA 3IEUA 5FPSA 1OV4A 4FW9A 1OF1A 4RFVA 1GDDA 4BLRA 3AQ4A 5DHAA 3SC3A 2V3CC 521PA 4Q66C 2BMEA 4NYJQ 4XOIA 1P60A 1ZUNB 1DTSA 1ZM2A 4WZBE 4ZIRA 3TKLA 1ETUA 8OHMA 1W48A 5LB4A 2QENA 1W0KD 5KOYA 1VCMA 5FBWB 1FFHA 2DYKA 5CITA 2F55A 2I4IA 4W9MC 2BHRA 1G3RA 2ZAMA 2W6JA 3HR7A 5JECA 1G17A 4LPSA 5DI9A 4DDUA 3Q9LA 2OEPA 3QF7A 3MWYW 5KTYA 2FEOA 3DPUA 1CLUA 4LBZA 1IAQA 3L2OB 4AYTA 5CK5A 2GF0A 1U90A 4RD3A 4YMWA 2JCSA 3RDPA 1D9ZA 1R7RA 2FF7A 5DE3A 1OLOA 4EFNA 3PENA 2H5EA 2CCGA 1W7AA 4LDJA 4D4KA 4FMCB 4TMXA 1VYTA 1UKVY 3LWNA 4CYMA 2XTZA 1IN5A 2QM7A 3GLIE 2O52A 4GZLA 4JJKA 2KI5A 1U0JA 3U7EB 1A5TA 1JECA 1F2TB 3Q5DA 4UNPA 1ZMXA 2A3RA 2VTKA 4DKXA 3FHTA 2Y8EA 3HU2A 3N2EA 4ZDIA 2DCUA 3UK6A 1CS4C 1Q20A 2H16A 1FP6A 5KSYA 3W3AA 4EPXA 3QSYA 4RD0A 3ZQ6A 1Q21A 2ZS9A 4FWTA 3H84A 5DI3B 2FPKA 4OHWA 1U0LA 3QKSA 3UKDA 2O0HA 1KMQA 4O0MA 4XD7A 3K70D 3RC8A 1BMFA 3H2YA 1U0HC 3AVOA 5LPNA 2W2XA 5DSZA 3EA0A 2OBNA 4LYJA 4QG7A 4RJLA 4X8LA 4QOSA 2O8BB 4N0DA 3VNUA 3SOPA 2B6HA 4KITB 2Z5FA 2WJJA 3K0SA 4NKRA 1HE1C 1FP7A 1H65A 3LVRE 1W47A 4R9UC 3U60B 5TVKA 4PQFA 1XD2B 2Q9BA 2FSIA 4MRVA 2WICA 4G0NA 1JXOA 1ZW6A 3KJGA 4CT5A 3OAAD 3KJEA 1R6BX 2XJ4A 2ZJ2A 4B74A 3CF2A 3UG7A 3SE0A 2ZVPX 1CR2A 1QZXA 3IHWA 1P72A 3NDBB 4PQYA 3TGPA 1AZSC 1KK1A 4PPQA 1MKYA 4W7SA 2CJWA 3U3MA 2ZANA 4C0JA 1CF4A 1EWRA 1SXJE 1Q44A 1XJCA 1U9IA 2C03A 3DZ8A 3E1SA 2O8DB 2WHXA 3KTAB 5DHFA 2QTHA 1QHXA 2VBCA 1ZIPA 2QMUA 3T61A 1M2OB 4G1UC 2XZOA 621PA 4PSAA 5EXTA 3O8CA 2ZTSA 1A4RA 2NO7A 4JSYA 3RVBA 3R9WA 1ELOA 1G4UR 2FFAA 2OSBA 2FSGA 1GSIA 1HTWA 3CONA 2G83A 1A7JA 4GI7A 3QKUA 4AYWA 2KWIA 2W58A 4JT2A 4KXFB 3MAAC 3B78A 2REBA 5E4FA 3LW7A 1OXUA 4LC0A 4ARZB 4DDTA 1XPOA 4LSGA 4C9BA 4Q18A 5KSPA 1M7BA 1P4SA 4HB0A 2ONJA 2ZU0C 3U4QB 1RVDA 3ND8A 2EFGA 2WSSD 2XAUA 3R7WA 2W0MA 3GMTA 4M53A 1CRQA 2R8RA 3X1YA 4U00A 5AJWA 2J1LA 1XEWX 3GJ0A 1E99A 4M8NE 3PEYA 4A6PA 4A8JA 4Z1MD 4DCVA 5TXGA 5KNCA 1W5SA 3W6PA 4HDOB 4CZ2A 2IWRA 3SS8A 2IYXA 1OXTA 3CWQA 3OFNA 4JSTA 3EZ9A 4ZDJA 4RZ2A 1SXJA 5GJBA 1F48A 2GZHA 3RAPR 3ZQJA 1WRBA 1I4DD 1TUIA 4LBYA 1J7KA 4GZMA 5A4JA 4MYTA 3A6PC 5JSZB 3VR6A 5CIWA 3CZPA 1XXHE 2LKDA 4DUGD 1JB1A 3NH9A 1R10A 3T1VA 3KQLA 1HQCA 1OXSC 5GVRA 1KSHA 1CJUC 2IK8A 2JJ8A 2VSXA 4K8OA 4Q01A 2HCBA 1HT1E 2J0UA 3FDIA 3B2EA 2BEKA 1GL7A 1U81A 2JLSA 3C5HA 4IEEA 3CRQA 3CX7A 1R0XA 3C4JA 4UNNA 3JZAA 3GLGB 2YC2C 2H1LA 1P7CA 1HQYE 4HAWA 4I1VA 5DN6D 1CRPA 1CU1A 1P9WA 5EP1A 1EFUA 2NO0A 4IDPA 3ADCA 1TU3A 2J3EA 3LO5A 4FXPA 4L16A 2AN9A 4ASUA 4M1TA 1B23P 3EPHA 4P33A 2R6AA 3LDAA 1BH2A 4QFMA 3TQFA 1A82A 3V4RA 2ZAOA 2ZR7A 4A0GA 4BFXA 3QIAA 3X2SA 3U7HB 4B76A 2EFEB 3ZVMA 3D6TB 3DMDA 3THXB 4Z54A 4MGIR 5L3QB 4HEJA 2ZRCA 3OAAA 1DAFA 2A30A 5EE3A 3ICQB 2JATA 5JWRA 4AK9A 3BS4A 3DZDA 2FA9A 2D7CA 3CNNA 3CF6R 2GCOB 3T1OA 1E9DA 3BRWD 4Q4JB 2IYQA 4F7WA 2F1HA 1TNDA 3HPQA 1E9SA 1P2VA 3B7GA 1BKDR 5LD2B 2OFXA 3EA5A 4CT4B 1X1SA 4U02A 1OXVA 3PEVA 1B0UA 1N0WA 2MMCA 2QPAA 1ZU4A 4UXJA 1KJWA 2ZPTX 5FUWA 1Z0KA 3KB1A 5FBRB 1KK3A 4FN5A 4IXNA 4OL0A 1OJLA 2JLUA 3SYKA 1R8SA 4C7OA 4OQFA 4Q7JB 4R2HA 3EC1A 1PVOA 4TMWA 2LKCA 2AK2A 4K81B 4DSUA 2VF8A 1OIXA 3WNDA 4ESVA 2FH5B 2BM0A 4YDSA 2NO1A 1MR3F 3CPEA 3OEHA 1XEXA 1E98A 2I1QA 1ZU5A 3WYFA 3AVTA 1D2NA 3FMFA 2AK3A 4A0RA 3F0TA 4Q7KA 3CH4B 4HDCA 4DCUA 4CEHA 2IHYA 3GFTA 2WOOA 4ZCIA 2Z43A 3BAFA 3MWJA 2ZRAA 1LNZA 3OFND 3KKOA 4QNMA 4A6XA 3LNCA 4HATA 1II8B 2ORIA 1XWIA 3CPJB 3LBHA 3B8HA 1W4RA 5ELXA 2GF9A 1U99A 2JLWA 3GJ8A 1IJEA 3WXMA 3WBJA 4G5QA 4WXPA 3I62A 2ZRBA 2J7PA 1NN3A 2CHGA 2PJZA 3AF1A 4US2R 1PUJA 3CRMA 2QGNA 3K09A 3UMFA 3I8XA 4JL6A 5FL7D 4V0MA 1WXQA 3MCAA 2ORVA 2JEOA 1ZYUA 4C0KA 2PLFA 5JWOA 5EE9A 3GCGA 2HT1A 5M04A 2IL1A 2R6GA 4C0SA 2WKPA 1KAOA 1IHUA 2ZRFA 1P2SA 1J99A 1GIAA 2G0NA 2YHSA 4Q03A 2XB2A 1XPUA 2PT7A 3K0CC 5FOXA 2OXCA 3B1YA 2CHQA 2EVWX 1NRJB 5JMTA 2HV8A 2PX0A 3ADDA 4XWKA 2HUPA 1P3JA 3BK7A 3CIOA 5B57C 1DG3A 4B43A 4HZUA 4Q4HB 3RRNA 4IOKA 1F3OA 4HUQA 2QSYA 3MGCA 2OZEA 4XVQA 4W5WA 1G5TA 2BVNA 2A7QA 1QHGA 5DH9A 421PA 4B34A 3L0OA 2VP4A 1VG9B 2W2TA 2PBRA 1HA3A 5L3RA 1QRAA 3QVUA 4B71A 4AC9A 4V0OA 2H18A 2OLJA 4FMCF 5HKKD 4A0HA 3FYHA 1TF5A 4CEJB 2ZRMA 1AN0A 3TH5A 1K5GA 2RGAA 1GFIA 2OFOA 1R5NA 4QBFA 2R62A 3CR8A 1AK2A 3AP2A 5CLQA 1P9RA 2BMFA 4GSYA 5FTKA 4LOAA 4BECA 4F4CA 3AKCA 4PR0A 1KI7A 4ILEA 1N5JA 2XTMA 2ZJAA 821PA 1XMSA 3DVLA 4KVAA 4IDNA 1N6IA 5TV2A 1IN8A 4BZXA 1II0A 1RW4A 4IW3B 1N6RA 2FN4A 1QHHA 4EAQA 1VDZA 3LD9A 4HLQB 5IDVA 1Z5ZA 5DO9A 4A15A 5K8TA 3PCRB 1TL7C 2QP9X 3TUZC 1HUQA 4I4LA 4TL7A 4NPHA 1KSJA 3LA6A 4K46A 4RKEA 2VH5R 3K9NA 2IYSA 4I1UA 3VU9A 4PFSA 4BZPA 2IA5A 5IRCD 1SVIA 4TT3A 2A5DA 5J47A 3B1WA 3CKLA 2ONKA 3CW2A 1OKKD 4M1WA 3C15C 1TQ6A 3BXZA 1O3YA 3GEIA 1GNQA 5HZHA 4JZKA 3X1WA 5C4MA 3M6AA 4FWIB 5HE9A 2P6RA 2CLSA 1U2RA 1ZUIA 1JBKA 2DY1A 2XX3A 2F3RA 1UKYA 5H1YA 3BD9A 1SVSA 4MKFA 2WMNB 1XDBA 2C95A 1JI0A 4ZO4A 1TQDA 4DHEA 1K6MA 4F38A 3OIUA 2ZRKA 2ZRPA 2NOAA 3U3JA 4R71A 2MSDB 1I4TD 3EZ2A 3WMEA 5FTLA 3LW8A 2IEZA 2KBFA 2ZI9A 1PJRA 3MD0A 3TVDA 4ABYA 4BWYA 4AY2A 2NO6A 1N5KA 3TW8B 1YE8A 3IPYA 2VPPA 3A1TA 1EK0A 5FBQB 4DBLC 4C2TA 1TEVA 3WRXC 4ON9A 1KJYA 4UNRA 1KO8A 1E0KA 5DYIA 1OIWA 2BBWA 1G7CA 2WJGA 2WSSA 4DRZA 4A4DA 3OE7D 3HU1A 1TPZA 5BN4A 3I4LA 5CLLA 3NG1A 4AG6A 2KSQA 2BC9A 4B47A 2EYQA 3C14C 4TSFA 3KXLA 3R20A 4OI2A 2C5LA 4BASA 3BB1A 3BERA 2GXUA 4NYMR 1GWNA 4DLYA 3EARA 1I2MA 2IYUA 4X8OA 4B3DA 2C04A 4GBMA 3X1XA 2IBMA 1JQJC 1J2JA 2PT5A 2OAQ1 4BEBA 3NWJA 2A78A 2IF2A 4RZXA 1WMSA 3BFKA 1WDTA 1E79A 3WBKA 5CJPA 1VCNA 1TTTA 1JEDA 1W44A 3AH8A 4TLAA 1NNEA 2QA5A 3ONWA 3R9IA 2C78A 3MJHA 2GTPA 2X2FA 2QZ4A 1ZP6A 3B5JA 3DKPA 3R8CA 2Q6TA 1KO1A 2ZRLA 1XP8A 4BFYA 2VA8A 1VYVA 3FWYA 2OCAA 1VKJA 1E2FA 3KX2A 1SVWA 5CJ2A 5JI3E 3BB3A 1VIYA 2ZJOA 1PUIA 4P4SB 3AKYA 3E5HA 3EAQA 4NCKA 4G3XA 4B44A 1L7VC 4NMMA 1DG1G 2IWHA 4CGZA 1TX4B 4YONB 2HXSA 2RHDA 3BH0A 3B6EA 4DCTA 2X8AA 3BE4A 2IS2A 5DN6A 2ODEA 4ZI2A 1G3QA 2FZ4A 4GDFA 1NJGA 3VX4A 1P61B 3FFBA 3K0FB 2XITA 4MGKR 3IO3A 3VFDA 1E2EA 5EXXA 5JS8A 4Q4AB 2AWNA 2YOHA 2R65A 3L82B 2QMOA 4U5XA 3SBDA 4Q1DA 5L3QA 2PCLA 4A82A 1N6NA 4U7DA 3R8FA 1HH4A 3D31A 1E1QD 1OB5A 2WAYA 4A0FA 3FPAA 3B1XA 2GJKA 4NL4H 3F5FA 4PANA 4Q7LA 3I32A 4D0NA 1G5PA 4P4SA 4DXAA 4URWR 1W4AA 3TK1A 2WWWA 1WBDA 2IS6A 2FFHA 4NONA 1VIAA 1D5CA 2A5GA 2EWWA 3CM0A 3AUXA 1QVAA 4JLKA 4NYIQ 3PUWA 4PHTA 1RE0A 4E07A 2FX3A 1VCIA 1YRAA 3IUYA 4HAZA 1A2KC 1PLKA 2ODBA 4LJ5A 1JAHA 2XNDA 1G6OA 4BE7B 2HLDA 4Q5IA 2ZR0A 1JALA 1E2IA 3CUEF 2WTUA 4FCVA 4KFSA 1M6NA 4HB4A 4LJAA 1M7HA 2OE2A 3TSOA 2ZJBA 1RRCA 4M21A 4NP6A 4XTRA 5B2ZA 4LUCA 4PC7A 2IX3A 1NL3A 4CEIA 3SU8A 1DAGA 4CIDA 4CVNA 3EIHA 3ASYA 4DDWA 4JT4A 3L0IB 4OHZA 4YMUA 2VHTA 4Q21A 3DHWC 4LWZA 4GP6A 1HY3A 2CK3A 5FI1B 2JIZA 3FMIA 4PC2A 2QUZA 1AGRA 2GWHA 1G19A 3EASA 4KV9A 3CRW1 3C16C 4URZR 2ZE6A 2Q9AA 1XEFA 2QRNA 3U4QA 2RB4A 2NPIA 1Q1EA 2YWHA 4JYBA 5J4YA 1JEEA 2J87A 4IHQA 2P0EA 1G291 1OFIA 1IN6A 4JLNA 2BKEA 2ZIAA 2F9LA 3SYLA 5HPYB 4QJ5A 2N1BA 1H8ED 1RJ9B 2GILA 4RSGA 2F1IA 5FPKA 1XF9A 1VCOA 2HYIC 5G3ZA 2MMGA 1S1CA 2O0JA 4UJ3A 2FGKA 1ZRHA 5F98A 4AD8A 2HJGA 3OHMA 2NIPA 3Q72A 1SVKA 1Q0UA 1S3GA 2X2EA 5EXSA 1RKBA 2ZYTX 1HYQA 3FHCB 3SYNA 5FBLB 1FNMA 1G8FA 1YJ5A 3ZJYA 3DL0A 2E87A 3I72A 4MDFA 2ZS8A 1AJEA 2YKGA 4PO1A 5DIFA 2JJ1A 1DO0A 3H1TA 1OFHA 4DLUA 3O8RA 1T9HA 5EUQB 3ZH9B 1FUKA 3GLFB 2IYYA 1IM2A 1GILA 2Q21A 1F60A 1GZSA 2RKOA 2WIAA 2JDID 3NDPA 1G18A 4DT1B 2QAGC 1LFDB 2DHRA 4IVQA 4JBXA 4W5JA 1P73A 2ATXA 2P6NA 2RMKA 4V0NA 1EFCA 1X86B 4PZLA 4DLZA 4YMSA 3QNUA 3TE6A 4OI4A 4HB3A 4M9QA 2R6FA 3U44A 4I99A 3KQHA 3T15A 2J0VA 2AFHE 4G5GA 5HKKA 1E2DA 3FMPB 1Z63A 4B6EA 1G3MA 1GTVA 5G41A 4Q1AA 4QL3A 4OKSA 3VKGA 2FEMA 2O8FA 4OK3A 2PL3A 4C0AC 2BCJQ 1MO4A 2O0KA 1KMHB 5JBQA 1G7SA 2VL7A 1UADA 1A1VA 4KFUA 4B3XA 1P2UA 2Z4SA 5EQTA 2EYUA 2MSEB 4DDVA 2O8CB 3EWAA 3BOSA 3PFIA 1Q1BA 1Q1QA 1RC8A 1TU4A 1DE0A 2VYFA 2GHIA 2GVZC 3C8UA 2IUUA 3GLIB 1Z0IA 2YNMA 5SZJA 2WWIA 2IS1A 2P3SA 1SZPA 3M0EA 2ANBA 4LHVA 1F6BA 4URXR 3LBIA 4D2IA 1ODFA 3CRVA 3I1FA 3A1VA 4TWZA 1E9BA 3REFA 4L9SA 1S9HA 2F9MA 3GD7A 1P6XA 3DOFA 4NCJA 4QBHA 3W5JA 1UFQA 2GK6A 3QKTA 1QHYA 1E3MA 3RC3A 2IYRA 3W90A 5CB8A 1KMHA 1G5RA 4N1AA 1FL9A 3A4LA 2GXQA 3HYRA 1CP2A 5KU1A 4UNSA 4TYYA 2GEVA 4TZ0A 2FDCA 4F91B 1L2TA 1Y63A 3GFPA 1R8QA 3Q3JB 2CMKA 3HP1A 4E22A 2IHBA 1YZKA 5DI3A 1H8HA 4LV5B 5FOVA 721PA 1XTRA 4E09A 2AWOA 3AGQA 2V8OA 3VR4A 3K70B 4GT1A 5P21A 1X8KA 4M2LA 3RRZA 4ARZA 1E96A 2ORWA 2B8TA 2J59A 4R98A 2ZJZA 1KKLA 4MUBA 3WYAA 5F3WB 4KSBA 1COWA 2ZUBA 4URVR 4IDQA 1KZ7B 4UXHA 4B2PA 1H8EA 3QBVA 2F3TA 2NTYC 4B48A 1NG9A 3X1ZA 1KY3A 2G1JA 3MRSA 4EQ6B 3QBTA 4F92B 1XZPA 2OT3B 1RRGA 1WBBA 1E9RA 3ZVNA 1GP2A 3AF0A 3B1VA 4ZV4A 1F2UB 2ZU6A 1IXRC 1MRSA 4KAXA 4XVUA 5JCPA 1GVNB 1ZC3A 3QKSB 3GFOA 4ZKDA 3FE2A 4WAUA 4L5BA 4DC9A 2IF0A 3MWKA 1OH8A 4MDEA 2REOA 3ADKA 5C18A 3P1JA 3THYA 2JJ1D 1KNQA 1US8A 3FTQA 3NTUA 4JJZA 4WZAE 3ZS9A 4LV8B 1XFAA 3KTAA 1OXXK 5FOTA 4LHYA 1NP6A 1R2QA 4MYHA 3W8RA 3EW9A 2Q3HA 2C9YA 5E7IA 3AP3A 2GRJA 4FINA 4F93B 4HAYA 4JLMA 1UBGA 4KCGA 1VPLA 2YZ2A 2ZUCA 2EW1A 1E2HA 1NMZA 3QPUA 2GJSA 3PUZA 3RS4A 2PLRA 1IY0A 1ZCAA 2X77A 1TF7A 4N0EA 2GEDA 3AVUA 1ZAKA 4KHZA 4V0ME 1HE8B 4PHHA 4B33A 3QI2A 3ADBA 1NVXQ 1CJVC 1XX6A 3CNLA 3VHLB 3GJXC 4TTQA 2G0TA 1BOFA 3A4NA 1KO7A 4HAUA 4PX9A 5AJVB 3L43A 2CL7X 2FSFA 2QTVB 1X1RA 1EFHA 3BGWA 3NVAA 4GNKA 4DSTA 1KGDA 1E1RA 1EX7A 3K0FA 2XGJA 3NKVA 4C4PA 1W0JA 1YKSA 4RY2A 2XB4A 1CJMA 1UDWA 5B58C 3ZZTA 5JWHA 1NLZA 3LXRA 3P20A 3QXJA 4JLDA 1GKIA 1XCPA 4JIMA 1W5TA 4TLBA 2IUTA 2J0QA 1LY1A 1J8YF 5C2JB 3RS7A 4B2LA 4TL8A 4AKHA 2FSHA 3SQWA 4IVRA 1NBMA 2XSZA 2XNSA 4TYPA 4Q1EA 4B73A 1GG2A 3IGFA 2YC4C 4HSEA 3K70C 2VP9A 2BOVA 3K53A 4I1SA 1D2EA 1T8TA 1GKUB 1XNJA 1QF9A 3L0PA 5IK2D 3CWZA 2XZLA 3PG5A 4TMVA 2HF8A 2A9KA 2IW3A 2PEYA 4PZZA 2AHOA 4H9GA 4XJXA 3ICEA 1YR7A 4IOJA 2WWGA 2XZPA 3DKVA 3PJRA 2CL6X 5FH9A 4RKFA 1KZGB 3Q7PA 1D8TA 1R5OA 2V7QA 3OE7A 3NIBA 2BV3A 4RCYA 2QE7A 3EPLA 4JBWA 3PITA 3NH6A 4JVLA 1ESNA 2Q9CA 5F9HA 1CJKC 2JLZA 5J4HA 2GAOA 4QGGA 2QSZA 3OEED 1NLFA 1ZM3A 3VX3A 2RAPA 1SVOA 1U8AA 2QAGB 2OHFA 4D25A 4EPYA 2GESA 4O25A 3IPXA 3EXAA 221PA 4N3NA 1JR6A 4WZ6A 2AXPA 2W2VA 4PO9A 1G21E 4QHYA 3QXCA 2V54A 3NC1C 4LHWA 1J8MF 1JPNA 4MKIA 2XJ9A 5FOUA 4EIWA 2WWYA 2CHVA 4AKIA 2W00A 2F7SA 5SZIA 1Z28A 2OUKA 3RS5A 2C96A 2J41A 1MO3A 3GP8A 3HJNA 2G88A 4FCWA 5KHOC 2FWRA 1AS3A 4M9SA 4DB4A 3GJ4A 2C8VA 2XTNA 2FV8A 1OHHA 3JVVA 1AS0A 3LAWA 3ZYCA 1OYWA 3TVTA 3VU9B 2WJIA 1CBUA 1T0HB 2FMXA 2R6DA 5L3VA 3AEZA 3VMFA 2WMOB 4M1YA 3FB4A 3O8BA 2C9OA 2ZI6A 4LHZA 4HLUC 5KDLA 2NPFA 4B3CA 2RH5A 4LK2A 3RS3A 3KL4A 4QM7A 4EPTA 4HUTA 4JVMA 4HAXA 3EZFA 1M34E 1IBRA 1E2LA 4Q7MB 6Q21A 4A2PA 1CR4A 3GPLA 4IDOA 3OIYA 2HT6A 5CYPA 3TLXA 4GMXA 1TQ2A 3TRFA 2F43B 2V55B 1N6KA 4LHXA 1L4UA 4P3YA 4X8MA 5CDFA 3TIFA 3AF3A 3K0CA 2EQBA 4XH9B 3WHLA 2WM9B 4BLQA 5D3QA 2AXNA 2QG6A 1KSGA 5EP4A 3S1AB 2IXEA 1X6VA 1AQUA 1C9KA 1FMLA 1NVVQ 3TAUA 4Z51A 4MGYR 4MRSA 1SHZA 1N6OA 3B85A 3REGA 1UKEA 1YZQA 4Q47A 1UKZA 2OXRA 2GCPA 4LV6A 1E0SA 4JBYA 1E9CA 2AFIE 4PXAA 3KKPA 1UDXA 2CXXA 2VIIA 3NBXX 3NEJA 1S1MA 5AUNB 5DNYB 4O3MA 4AKEA 3SZRA 4S35A 3PIRA 2QQEA 3NXSA 4M9XA 1VMAA 3EWSA 4XSHA 2GZAA 4XSGA 1SKYB 1E4VA 1ZM7A 4URUR 3TR0A 3SJCA 3JVUA 5L3SA 2ATVA 3AM1A 4JLJA 5D3MA 4RD1A 4PQRA 2AL7A 4PTLA 2VHQA 4US1R 2GJAA 3K9LA 3VQTA 2VP2A 1YHNA 4GPTA 5LBIA 2ZYUX 2DFNA 3UG6A 3G0HA 2QT0A 4TYQA 3HYTA 4QXAA 3THOA 1N0VC 3SJBA 3QEJA 1Z2AA 1E9AA 4FI3C 1XMIA 2ZE7A 2QY9A 3Q5EA 5KDOA 1NBME 2YV5A 4TQ9A 1NVUQ 4Q4JA 2OG2A 4Y0AA 1R0WA 2ZYVX 1G3IA 3N2IA 4M1MA 4TQUS 2ZI4A 1XEXB 2O8EB 2Z6VA 1T4GA 1Z22A 2B8WA 2FZLA 4IJMA 1UF9A 5FL3A 4TMTA 3R9XA 4QHSA 1KNXA 2PH1A 4Z8YA 3SFVA 1T0JB 5B30A 4Q4AA 1G1MA 3A1UA 3PEWA 2P5TB 2RGCA 2HEIA 1ZINA 4RZUA 4D81A 5TMPA 5KNBA 4LJ4A 2ZVQX 4OHYA 1FQJA 3W8NA 2DBYA 2I3BA 4Q02A 4H1VA 2GXAA 3UXMA 2ECKA 4MKHA 5TY0A 1CEEA 2ZEJA 1LS1A 3CRRA 3E70C 2D7DA 4II7A 4BLPA 3PVSA 4KI0A 3IIMA 3F3YA 5EXPA 3AVWA 3SR0A 5EP3A 4BFUA 2V4ZA 3U2QA 2F6RA 1S96A 1ZNZA 1COWD 5KNDA 2NG1A 4MKGA 5DLQC 5H70A 5BXQC 4CW7A 3EPKA 2FFBA 2R2AA 3HR8A 1E69A 1SULA 3KDSE 4TLDA 1OW3B 5JRZA 1Z6AA 3KB2A 3RYTC 1WCV1 2GETA 4TTPA 4Q9JA 2ZXUA 4LX0A 1XZQA 3BB4A 5J5CA 4PSKA 3AB3A 1IJFA 4V0LA 1E4YA 4RCZA 1YQTA 3DOEA 4GL2A 1Z2CA 1KO4A 1MO5A 4NU0A 3LRPA 2AR7A 2BM1A 4YLGA 3U7GA 3RSLA 2GVDC 2W6JD 2IXFA 1D2MA 4ZDWA 5SZHB 3GLHB 4EPWA 4A8JB 4YMVA 3AVPA 4DLRA 4DLTA 1BYIA 4ZI3A 3U6BA 1HEIA 1RFLA 2CNWD 1QHIA 4GOKA 1FZQA 1UEIA 4TYNA 3EIQA 3K0AA 1W46A 3U5ZB 3QXHA 4IXMA 1V43A 4MRRA 2VQSA 4JLPA 1OYYA 4OJKA 3M4YA 3Q85A 3TAHA 1AIPA 1BIFA 4G5OA 4TN1A 5K8UA 5TB5A 3SDZA 1GRQA 1KDRA 3LX5A 4EQ6A 1MT0A 1BYUA 2H92A 1KHTA 3EIEA 4PHFA 1N0UA 1PV4A 4P4TA 4BQSA 1YR9A 5JS7A 1U9IC 4BFWA 2OV2A 4POAA 1G9XA 2W0SA 5J4VA 2GBLA 5CDFE 3RRYA 4DJTA 4M1SA 4QJ4A 1GUAA 1OPXA 2FNAA 2ZSAA 1VHLA 2AD5A 2IEYA 1UPTA 1W0JD 4QNRA 5GVSA 1GNPA 1VHTA 2D74A 4PZYA 3FOZA 4OQLA 1XTKA 4LJ9A 5JI2E 1EESA 2RHMA 3AF4A 4MYCA 3OEHD 4EUNA 3A37A 2IT1A 3O8DA 2X19A 3FMOB 3SNHA 1LS6A 1DAMA 1AKEA 3AGPA 1XEWY 4KYUA 4JLBA 4NHOA 3W9YA 3X1DA 2ZRNA 2FGJA 5BN3A 1AA9A 1XTQA 1G7TA 3K9GA 1IQPA 1E32A 3OIVA 3TUIC 1LW7A 5BN5A 3H0KA 1W4CA 2ZI7A 3WMFA 1XU4A 4DVGA 4D82A 2ODWA 1EFRD 1NBMD 3OF5A 3PUVA 1FW6A 1IXSB 1J90A 4P4UA 1WP9A 3P4XA 3ZVRA 4LY6A 3IEVA 2RGDA 1G4AE 2XOKD 2JLYA 3U61B 2AKAB 2NGRA 2AKYA 2CCKA 3MMPA 1TQ4A 5AK0A 1CULC 1E6CA 2GBLC 2MSCB 2ZS7A 2NZ8A 4IOLA 4NYMQ 1H8HD 4JKIA 3RNLA 1LF5A 4DWJA 2VP6A 5HR5A 4Q9IA 4AURA 5K8IA 4A9AA 4CEIB 1N2CE 1Q3HA 1R0ZA 4Q4HA 1KKMA 4QHTA 4TMKA 2R44A 2ZJ8A 1UJ2A 4XWAA 2WV9A 4OK6A 4L4UA 2FPLA 4LJYA 4M9ZA 3UANA 2O8FB 1Z08A 5CYOA 3SBEA 3OEEA 5JEEA 1Z07A 4ACBA 1KI3A 3I8SA 5FL7A 2YWGA 2F1JA 2SHKA 1U8ZA 3BWDD 1E2QA 4US0R 5FPHA 1YZGA 2OO7A 3P26A 2NQ2C 4S2EA 1TMKA 5JZVA 1RIFA 1DAIA 4M1KA 4LZZA 2TMKA 5EUMA 2KBEA 1CJTC 2QNRA 2BCGY 3TW4A 1PLJA 1HV8A 2ZSEA 5JLJA 3KFVA 1G8HA 3THXA 3ASZA 1M74A 1S2MA 3ETLA 1Z6TA 3P4YA 1N6HA 1CR0A 5KUTA 1SXJD 1TADA 2WWXA 1Z0FA 2H8KA 3V4FA 5EP2A 1SHKA 2HJVA 3QXSA 4UJ5A 2YINC 1DAEA 3T1QA 1FX0B 2D62A 3VR5A 3QPWA 4NE2A 5FOSA 1CR1A 3KQNA 1KI2A 3QENA 2ZRIA 1Z47A 5SZKB 3DM9B 4EJSA 1R4AA 4BFTA 4TYWA 1NMYA 5HE8A 3WNBA 4DUGA 4NCIA 5EE1A 1DARA 3QPVA 2H57A 2CNWA 4OHVA 4MYUA 3SEAA 4GOXA 2ZE5A 5AWFC 1Y3AA 3IO5A 4Q9KA 1JR3E 3C41J 3EZ7A 2A2ZA 3AUYA 3EG5A 3WNCA 3ZDQA 1I4LD 2GAAA 1N25A 2RCNA 2QQ0A 4YMTA 2EFCB 1MO6A 1IN4A 1JJ7A 2BBTA 2QM8A 1KIMA 2J45A 1P2TA 2QP3A 4NDZA 4B3FX 1E1RD 1KI1A 4EPVA 3ZD7A 1XJ0A 5TDHA 5IT5A 4DLVA 4WA7A 2HF9A 3I3SR 4ASUD 3PQCA 2QGZA 2ZRDA 3UMRA 5A0FA 3ZZUA 1W1WA 4M22A 1Q12A 2VF7A 3QE0A 4TLCA 1W2GA 2OBLA 5J4KA 3EX7C 3QG5A 1KSFX 4JYCA 4D6PA 2V6IA 3O47A 2FPMA 2EU8A 2B7CA 4RD4A 2YWEA 4W5HA 2QU8A 1XJQA 1YZNA 1Q22A 3PEUA 3SFZA 2W83A 5A5GA 1JAIA 4QBGB 2ZRGA 1E2PA 1E94E 2CL0X 2VHCA 5EE5B 4Q9HA 3TSWA 4XWOA 3GLGA 3EPJA 3GQBA 3NBZC 3RS2A 4LJ8A 1UBEA 1US8B 3GLHE 4EFMA 1NIJA 4A1FA 1NVWQ 1X8LA 2XEXA 2OESA 4R2IA 1HURA 4C0BA 3MWLA 4OJQA 4QRHA 1QG2A 3SN6A 2Q0HA 2D2FA 1IOZA 2V6JA 2FFQA 4URYR 3I5XA 3W3ZB 5F9FA 1AZTA 1RJ9A 1T5LA 5CM9C 1PZNA 3IDQA 2VP0A 2A5FA 1Q57A 2JA1A 2E1RA 1I2DA 1KTVA 4P31A 5B64A 1C1YA 2CCJA 4IOMA 3RABA 1YR6A 2C99A 4LYFA 2D06A 4UQOA 4YDHB 2GCOA 5EZ5A 1ZC4A 3U44B 1GL6A 2DWQA 5G3YA 3IBGA 1L4YA 1TUEA 3QF4A 1GM5A 2VEDA 4MH0R 1SXJC 5CK4A 3VTKA 1T8UA 1MV5A 3VAAA 3WMGA 4PHGA 3IQXA 4M4SA 2EFHB 5E3HA 1ZIOA 5BYJA 2WKQA 3VKWA 2CDNA 4RFSA 1AS2A 5CB6A 1U8YA 2ZM5A 3FKQA 3K9HA 1WE2A 5LD2C 2I1VB 2WJYA 1KI6A 2WVJA 3C5CA 3CO5A 3LX8A 4F4IA 1MOZA 3A1WA 4B75A 1XPRA 1UAAA 5DYGA 2VHJA 3K1JA 2O8BA 2QAJA 4JL5A 4DLSA 3T35A 2YJTD 1LTQA 1NIPA 4CEJA 4EJSB 2R9VA 4DCSA 2Z4RA 1DAHA 1N6PA 2G3YA 4MITA 3CBQA 1ESMA 4J0QA 4JKYA 2NMVA 2DR3A 4XIGS 5JCZA 5HCIA 5G53C 1U98A 1O87A 3T1TA 1A2BA 1SVMA 2DWOA 4DCNA 2EWVA 4DSOA 2J0UB 1EGAA 1OB2A 1XXHB 4YXWA 4F4JA 3KZ1E 4R7ZA 1NF3A 1KDOA 2QRZA 3QJYA 5BYKA 4H1UA 1S0UA 2P67A 3THYB 1NMXA 2F1RA 1G3UA 2ZI3A 3KUDA 1CTQA 1NKSA 4AIIA 3NEYA 5H8WA 1CKEA 3DO6A 2QPOA 3AVYA 2AD1A 4OQMA 5BWMA 2QPTA 4FIDA 3IBYA 3KKNA 4B3BA 3NBYC 3AVVA 5DGXA 5KPJA 2OCYC 2GJ8A 1Z29A 2ZE8A 3ECCA 3F8TA 4IRUB 3AKEA 1OH6A 1QBKC 1XRJA 1RZ3A 4Q9LA 3QXXA 1N5IA 1N6LA 2OCBA 2ZRHA 1LF0A 2DFTA 1OH7A 1WF3A 3BORA 4NTZA 2RGBA 3D3QA 3QKRB 1XXHA 4LYAA 2LWIA 1E2JA 3QEOA 1G20E 3LBNA 2WJVA 2QN6A 3U3RA 3BFVA 2W6ID 3KKQA 2ZREA 3HU3A 2PEZA 1KI8A 2ANCA 2RGXA 3P27A 2BMJA 2OCPA 3L0SA 4HUQB 1W36B 4OQNA 2RGEA 5ANRB 4C0LA 3ZD6A 2HYDA 4HI0E 1C4OA 4CF7A 3E2IA 2CE7A 3CZQA 4ZIRB 1JJVA 5KDDA 2OAP1 3B9PA 3CX6A 4Q00A 3LV8A 4HZIA 3UATA 4C0QC 3IHLA 4JLAA 5HCNA 1N3BA 4C30A 1XB2A 1UM8A 2D2EA 2IUSA 3NBFA 1SGWA 2GJ9A 5JSZA 3QY0A 1T91A 2V7QD 3RSOA 4EPRA 3SJZA 1JPJA 2FG5A 2ZR9A 3FKSA 2J7KA 5L8VA 1Z6XA 2DB3A 3K0EA 2GA8A 4A8JC 4D0LB 3C7KA 4OHXA 4ESHA 1AGPA 2QP4A 1BS1A 2GZDA 3H86A 4NYIR 2QORA 2EFDB 4RFSB 5E95A 1VTKA 2ZITA 4IFBA 4LCBA 2WBLC 3G82C 4G5SA 3GEEA 1YZLA 1G8YA 3A58B 4G5RA 4V0KA 4RVCA 1KK2A 1HT2E 1IN7A 4QBIA 2H17A 3WP0A 2IXGA 1ZD8A 1YVDA 2YOFA 3KUCA 4ZCLA 1T6NA 3A4MA 2B21A 1X3SA 3LXXA 2RGNC 4ZCMA 1L8QA 2BEJA 4PPGA 2NO9A 3QG1A 4M0LA 1UEJA 4LC1A 4UXIA 121PA 3VR2A 5HZKA 2YVUA 3ZS8A 1EFRA 3TNFA 3TR5A 1UBFA 3IILA 3OIWA 4TTRA 3TQCA 2QEQA 2JLVA 2JASA 3HPRA 1VG1A 1E0AA 2DWPA 4TL6A 1NG1A 3B60A 5FUXA 1Z06A 1FX0A 4NBSA 5EZ6B 2C77A 2ZSBA 5KSOA 4TL9A 1E2NA 3CX8A 4D4MA 5JJLA 2QL6A 5KPDA 1M1YE 1VG8A 3QF4B 4GP7A 5AJXA 1JQLB 3WYGA 1XCMA 1GAJA 1V5WA 2HCJB 3TBKA 2QI9C 3B9QA 5L3SB 1GL9B 1P75A 3THWA 1NY5A 3T34A 1QHNA 3T5GA 3WP1B 2BIFA 3I92A 4YXWD 4LJ7A 4TZ6A 4KBFA 5E7JA 2P65A 4B32A 1XTSA 4OK5A 1E9EA 4IDHA 1S8FA 1KI6B 1Z0AA 2OFWA 2J46A 4TMZA 1Z3IX 3NC0C 4C7OB 1OH5A 3P32A 2V1UA 4BPBA 4PPFA 2V1XA 4GFDA 4A92A 3AF2A 4TSFD 3W5IA 3KJIA 2UZ3A 1U94A 2JDIA 1GRRA 1JR3D 1ZJ6A 2PMKA 2ZQ5A 3Q8XB 4BRWA 4KFTA 1W0KA 4DEXA 1QG4A 3G5UA 4FMDB 1Z6YA 1DEKA 3L8ZA 5FOWA 1RYFA 1E79D 5HTKA 1W2HA 3L8YA 4QC2A 4AG5A 2O5VA 4D4LA 3ND9A 5FPTA 1KJZA 2FOLA 2B92A 4HLCA 4B2IA 4DIDA 5JFGA 1KK0A 1LB1B 3IQWA 5CM8B 1XBTA 4IKEA 2G1KA 3LQQA 4A2WA 1KAGA 2IYLD 1E2MA 1G8GA 3MUFA 5TARA 4HAVA 1FNNA 3A1SA 4A36A 2ZJYA 1VG0B 2ODNA 4LI0A 1DPFA 3GJ5A 2WJHA 2IC5A 3KXIA 1OKKA 4KBGA 4MUAA 4JS0A 4O2LA 1Z0JA 1XCGB 2WWHA 4DT1A 3VR3A 3CF0A 2QAGA 3LLUA 3CLVA 1F5NA 1QVRA 4KODA 2OILA 1RYHA 1E1QA 2FE4A 1II9A 3H4MA 4HLDA 1ZNWA 4LGMA 2JLRA 4WW0A 1Z83A 4E03A 1NSTA 3N5CA 4MRPA 2UVQA 5FTJA 1NSFA 1NN5A 2DFKB 1EX6A 2IS4A 2IYWA 1ONBA 4LBVA 3CR7A 4V03A 3KXKA 1IXZA 1Q1ZA 5GJVC 2LCFA 3JZMA 3K09C 3NHAA 4OBEA 3SQXA 1P62B 2OBMA 2QTFA 4DEYA 4Q1CA 3BIFA 5AUOB 2UKDA 4G01B 1EG7A 3LFUA 3PXGA 2XXAA 1IY1A 5FTMA 2BWJA 2L0XA 2WPDA 1DVRA 4PC1A 1Q3TA 2QBYA 3S1AA 1X8JA 2JGNA 1II8A 3K0AB 1G64A 5GADl 3AP1A 2C9CA 3SHWA 5AUQA 3IKJA 3OZXA 5AJZA 3GJ3A 4LJ6A 1F2TA 1YR8A 1AKYA 3BC1A 5G40A 2B7BA 3LH5A 4XTCS 1NLYA 3LLMA 1G8PA 2RGNA 2QMHA 2K5UA 4E5UA 2A5JA 3T06B 2P6UA 3RRMA 2J9RA 3GLFA 5GJCA 3QVVA 4CRWB 2KE5A 1PLLA 3WRYC 1DS6A 1ZNYA 3RHFA 4D26A 1T5IA 5J40A 2QBYB 4BUJA 1P5ZB 2CK3D 3K8YA 3QQ5A 4LPKA 4V02A 1JNYA 4WOPA 4Y0VA 3ZVLA 1GKYA 4MQBA 4BRUA 2QT1A 4NCNA 2DPXA 4Z1MA 2IYTA 3DDCA 3PR1A 4PAOA 4ACAA 1QHHB 2HDNB 2VLIA 2ZSDA 1ZVQA 1WA5A 4OI1A 2DFLA 5D3MB 5AR1A 1K8RA 1FUUA 3EZ6A 2P5SA 3MSXA 5BQ5A 3B13B 3LQRA 4KO8A 1E2GA 2GCNA 3RS0A 3CPHA 1NN0A 1OE0A 2WZQA 3UMSA 4AKGA 4D0GA 1KDTA 3UWOA 1M7GA 1BMFD 1OSNA 3QKRA 4EJSC 4AI6A 3U3OA 2J5XA 3NHBA 4A2QA 1KDPA 1EWQA 1YU9A 3FVQA 2CJWB 1OHHD 4MGZR 1DAKA 1QHSA 1AQYA 1S4QA 3B82A 1E9FA 4MA4A 4DIEA 5JJIA 1YRBA 2BDTA 1YZUA 2G6BA 1RRPA 1G6HA 3RWMB 4BGDA 3TUJC 1ZBDA 3T5DA 3KFXA 5FI0B 4L8GA 1NI3A 3LVQE 4WXRA 4NYJR 1G7RA 5EJEA 3Q7QA 4WBSA 3I61A 3FHOA 3LY5A 2PMDA 3PUYA 4QGAA 2YYZA 4DLWA 1TAGA 3BJIC 3I73A 4MRNA 4ZPXA 3TMKA 2KJQA 3EC2A 4RZ3A 2PZGA 5IF9A 3ZGXA 5KYKA 1KI4A 1SKQA 2HXYA 3BBPA 3RWOA 3UWKA 4BLOA 4C3ZA 4ZDKA 5KSZA 5GJWC 3BH7A 4BLTA 4GOJA 2X1VA 4IVPA 2XSZD 4EDHA 2P2LA 2D4HA 4B6FA 1OIVA 3SJAA 1YZTA 2E9SA 2CEAA 5E7MA 2CBZA 2JLQA 2WSMA 4JVSB 4YC7A 2Q3FA 1N5LA 2G9NA 3AKDA 1LVGA 4AWXA 1XD9A 4TLEA 2PJRA 5H68A 2ASEA 2WAXA 1ANKA 1ZD1A 4JVNA 3TJZA 3W6OA 4ITRC 4KLNA 2N46A 1DBSA 3QOFA 4BFZA 1S3SA 1FOEB 2QE7D 4UKDA 1LV7A 4FMBB 1ZD9A 4P32A 4KVGA 1JXMA 4B35A 2PX3A 2J0SA 1SKYE 2OM2A 2W6IA 4JLVA 5FBVB 1E2KA 4HZUB 4Q4LA 4HLUA 2REXB 2GK7A 3OESA 3A36A 2JJ2A 2BKUA 5J4LA 1W36C 1GITA 4CDGA 1E0JA 1FPMA 1VECA 4I1OA 1DO2A 4TT3D 1MABB 1FMJA 4IFEA 4Q1FA 4QGHA 4CEHB 4ZKEA 2BBOA 4D80A 3FKSD 4PAMA 5EE0A 3ZIAA 1ZM9A 5FUYA 3N70A 2JLXA 2ZRJA 2C2HA 1KY2A 2ERYA 4HB2A 5FTNA 4L15A 3CNOA 5FFMA 1EXMA 3AVXA 4HDQB 4BEJA 4DZZA 2ZUDA 2CE2X 3IIJA 3TSZA 3RLFA 5JEDA 4LBWA 4PC3A 4DB2A 1DADA 4PO8A 1KO5A 1OFUX 1NJFA 4JL8A 3ZIAD 4Z8XA 4QM6A 3W6NA 1NKTA 2VP5A 4WVFA 1MABA 4AYXA 3KQUA 5FUVA 2IYVA 3J81k 2WWFA 3MG9A 3U3KA 1GNRA 5CIQA 4BFVA 1GRNA 2BMDA 2GNOA 2YOGA 3UIEA 3ZZ0A 3GEHA 4FCTA 5BW8A 1XD8A 1OFTA 3PUXA 4P0TA 5K8LA 4NCHA 2G77B 3VR1A 1WQ1R 2VRWA 2GDJA 2IYZA 3B1ZA 4DSNA 4XVRA 4BFSA 5FPYA 2O8EA 2BJWA 2N42A 4OI0A 4EFLA 4QGFA 3THWB 1T3LA 2PZEA 2YWFA 3GLFE 3BFXA 4C0HA 1FTSA 4KYIB 1W49A 4KLZA 1SQ5A 4L9WA 4Q48A 1ZUHA 4RD2A 5KO2A 4IEIA 4M1OA 2Q3MA 2GEUA 3MJRA 2AX4A 2C98A 2BBSA 2V9PA 5F2EA 1T3SA 2GXSA 4WIAA 1VYUA 3GLIA 4FMDF 3V00A 2BJVA 2NZJA 4D4JA 1OT3A 3HWSA 4B3GA 4BLSA 2FU5C 3D8BA 5LDDC 2VHUA 1AM4D 4LYHA 1EFTA 4TQAA 1SVLA 1NVVR 1ZNXA 5C46F 3CH5A 2GKSA 2ZYWX 3I5YA 2KB0A 5FR2A 4PSVA 4QKQA 3U6KA 4GMDA 4JLOA 3T12A 2FJUA 4JMPA 3GJ6A 3A8TA 4NZYA 5AUPB 2CLCX 1M8PA 3SI7A 5IHPA 1G16A 3BH6A 5LB2A 1FQKA 5JJKA 3KJHA 1D6JA 1G41A 2HLDD 2O8CA 2UZIR 1ZM4A 2CVHA 1MH1A 2ZROA 1XMJA 3DM5A 1T3HA 1JR3A 5DISB 1GOTA 4OQXA 5AJYA 3R7WB 1KYIA 1P9NA 1KI9A 3WY9A 2H7VA 1Z8FA 2VO1A 2R6CA 2D3WA 1NY6A 4NH0A 4KFRA 2F43A 2RGGA 2ZI5A 1S9DA 1IONA 1Z0DA 4HYYA 3CB4A 3UPUA 2XNDD 2Z83A 1K5DA 5C4GB 1DOAA 4DLXA 3VKHA 3QUSA 2ERXA 4RD6A 1D9XA 2OLKA 3DEFA 4XD7D 3PV0A 1ZCBA 2VSOA 3DMNA 1Z6GA 2WOJA 4EKDA 4PC6A 1RRFA 1R5BA 2JJ2D 1SXJB 4BZQA 1TF2A 4KJZA 1FTNA 4GRAA 4QJ3A 4KSCA 3KQKA 2CVFA 5JRJA 3AV0B 3ZLJA 1WB9A 4KU4A 2Z0MA 3MFYA 4I81A 4YQFA 4OYHA 2PZFA 4FD2A 5C1BA 1XD2A 3FGNA 5FR1A 1RPZA 4UNQA 2JAQA 1CIPA 1NN1A 2XOKA 1F2UA 4PAQA 1UBCA 2QMEA 3MLEA 1J70A 4ERNA 4C2UA 2JIZD 2QROA 1CXZA 2WKRA 2XXAB 1KOFA 3IIKA 1W36D 1TEXA 1W4BA 2ZJ5A 5IK2A 3M1IA 2CLDX 3FFAA 1DELA 4O2RA 3VNVA 1XMVA 1BO6A 3WHKA 4Q19A 2WPDD 5UKDA 2J7PD 2ZETA 1QDEA 2O8DA 1MRNA 3AVQA 3GJ7A 5JHGB 3W34A 2A5YB 3U7FB 3RANA 5JHHB 4Q1BA 3HDTA 1R0YA 3VHXA 3KKMA 1IY2A 1XTJA 4PPNA
chains in the Genus database with same CATH superfamily
2WIBA 2HJHA 3ZLTA 3D7MA 4LKRA 3R41A 1XTIA 1E7MA 3CNQS 4TRNA 3WNZA 4CM4B 4D0RA 3AB8A 1OV4A 4LOHA 3FNRA 2WP8J 3TD2A 4JYPA 1B4DA 2P4SA 5DHAA 4ZMRA 4PG6A 5I3ZA 521PA 5IMBA 3WLRA 5H4GA 5K6TA 4LGYA 4BMOB 5JNWA 3MQ4A 1DTSA 1A7KA 1ZM2A 2REQA 3G9UA 1PWEA 3T1NA 4EYKA 4ZIRA 1Y8ZA 1N33B 2G5PA 3K1TA 2XIJA 5HX7A 5I7VA 3N2GB 5FBWB 3JALB 5KOYA 2DYKA 4JBGA 5ED4A 3QKIA 1HEUA 4YT5A 3HCEA 5BNFA 2I4IA 3WB2A 4BNTA 4MS1B 1KY4A 3H9JA 2ZXFA 3HR7A 3OUTA 1I3KA 4UBLA 4EA7A 1G17A 1GCOA 4CUJA 2OD9A 5JDCA 4LPSA 4G8JA 5DI9A 4XI9A 1ESCA 3AI2A 3L0CA 4DDUA 4NR0A 2VJPA 3NBAA 3DPUA 3EVDA 1CLUA 1Y9EA 1PFGA 1BH6A 1SOAA 3FCAA 3L2OB 2QRMA 4LBZA 5CK5A 5FWDA 3RC1A 4F5DA 4FM9A 1FDTA 3WWEA 3G59A 1R7RA 3SBXA 2FF7A 3H7IA 2G80A 3LC0A 3W4KA 4ZU6X 5BSMA 5T4EA 3AYZB 2H5EA 1UMDB 4XZ3A 3GAAA 4FMCB 3UA3A 3Q2KA 1VJTA 3DYBA 1OZFA 2PYDA 3DD1A 4FBMA 3OQNA 5CA1B 1R74A 2RHOA 2CJFA 1IN5A 2H5IA 2O52A 3U49A 2WZCA 3S2FA 3BWEA 1OXMA 2A3RA 3NNNA 1OU4A 4R84A 3GUYA 4RK1A 2XYHA 1L8OA 2Y8EA 3T3HA 3STUA 1M2NA 1OT5A 4GXQA 2XCTB 2H16A 5KSYA 3DMHA 5JY6A 4EPXA 1RWMA 1ODTC 3O95A 4JA0A 4MV4A 4OM8A 4YMIA 4BO9A 3K96A 1C0LA 1G2QA 3L93A 4XIFA 3CUWA 3H3XA 3FZQA 3GLGA 4FKZA 3QKSA 3EPJA 1KMNA 2QMQA 1SOVA 1A9RA 1HG0A 2O0HA 4O0MA 2ZVDA 1HTBA 2OZLA 1BMQA 3AVOA 4YTEA 1RNLA 5EIXA 3JYQA 1EP9A 2DMRA 3FWZA 1PCXA 5DN9A 1WSBA 2QR5A 1KPGA 1UFVA 1Y3DE 3SOPA 3BXXA 1YB5A 3GFQA 2B6HA 1L4NA 3GAFA 5CVVA 3NBMA 2EG9A 2RJOA 2WJJA 3N8HA 4KH0A 5CLHA 2BW0A 4NKRA 3STYA 4B6PA 5SYMA 4WBNB 3IEVA 4RF2A 3T9CA 3BJRA 5TVKA 2FWAA 4PQFA 2Q9BA 3THRA 3W9BA 1E3TA 2QLLA 2CVPA 1M5TA 4MRVA 1JXOA 4X7RA 1FTYA 5CXXA 2IHNA 3RC9A 4JQZA 2PMEA 3WFIA 4CT5A 2XJ4A 1JYEA 4ZQIA 1Y4DE 1ZWKA 2IODA 2J5KA 2NAPA 1G63A 3QUAA 1CR2A 1G60A 4GXTA 4AZVA 5LLTA 4UUMA 2WIFA 2J3DA 3QVTA 3NDBB 2B0CA 2E85A 5F1OA 1AK9A 2JHAA 3C3XA 3SX0A 2FG6C 1D7AA 4PPQA 3EXIA 1L7OA 1MKYA 3F9RA 4W7SA 2ZANA 4C0JA 1X7DA 1SXJE 1YT5A 1Q44A 4FDLA 1U9IA 3E1SA 3INNA 3LHIA 4MLDA 4YROA 5EZYB 4BO1A 3KJQA 1M1NA 3KTAB 1G59A 3EE6A 3AYXB 1QHXA 3TS1A 4B79A 1ZIPA 3N8GA 1M2OB 4P2BA 4PSAA 5EXTA 1JIVA 3COWA 3O8CA 3N59A 3R9WA 5ENDA 1QV9A 4ML3A 1B43A 1ELOA 1G4UR 1VL8A 2FMHA 2OSBA 2ZWIA 3DAHA 3OCWA 1GSIA 4I6GA 1JLKA 2IDMA 3PX2A 4ZYTA 1OYVA 5K4AA 2BEVA 3QKUA 1S6YA 3LMKA 1PNOA 1QLJA 1NAHA 2Q3CA 1W5FA 4OHUA 5ES3A 3RF7A 3AY6A 2OGUA 1WCWA 3LW7A 1KEWA 1EBBA 3G5LA 5E4FA 4ARZB 4BVFA 3ZUPA 4CIYA 1XPOA 2X0IA 3D0OA 1AE1A 4C78A 1T26A 2NSDA 5KINB 1YIAA 2JI8A 4FFMA 2ONJA 3CVVA 3EEBA 5JZ9A 2OM6A 2XKBA 2W0MA 3SKVA 4ZJYA 1A8PA 1Y9ZA 4TXMA 5EWJA 3K0BA 4BXOB 3X1YA 3DC7A 13PKA 1XVTA 1QX4A 5A4MS 3B7WA 4FFRA 4BBPA 1E99A 1DIOB 1P4GA 5KNCA 1BXZA 3OJ0A 4HG2A 1FDSA 1BHO1 2P68A 3D6JA 4FGUA 5IEBA 2IWRA 2IYXA 3UV7A 3ZU3A 4UDOA 2J6HA 2WFZA 4IF4A 3COZA 3UJHA 1F48A 2GZHA 5GJBA 3VKVA 2PUJA 2B94A 2G17A 1WRBA 3EXEA 5FTWA 1TUIA 1XRSB 4LBYA 1J7KA 3MW8A 4GZMA 2PKRA 4TM8A 5U1PA 1YBAA 5A4JA 2P4QA 3VR6A 5JSZB 4GWKA 3CZPA 3JQGA 1XXHE 4NAHA 4GUAA 3ZY2A 4L0MA 4JUDX 5TQVA 1Z8NA 1LDEA 2B1QA 2ZTMA 4JB8A 3T1VA 1W30A 1NW4A 1KSHA 2DC1A 2IK8A 2JJ8A 4Q0MA 3L4KA 5K1ZA 2IVZA 4OGWA 2ZZNA 3UAZA 3X2EA 1J21A 3IDOA 1FXWA 4LRSB 4Y9RA 2JLSA 2RONA 2P0YA 4IGKA 3CRQA 1UWVA 3FZYA 2GZ2A 3C4JA 5BSUA 4Q34A 2RC6A 3LF2A 4OG2A 5CPBA 3VV3A 2PPLA 1F8GA 1RPAA 2UVPA 1K9VF 3HL0A 4RE6A 1CRPA 1GN9A 5B3KA 3ADCA 1D1TA 1UDRA 3IR6A 5C5EA 4L16A 3S40A 1E20A 1DL5A 4B6JA 1B23P 2PVCA 3GDFA 1QG6A 1Y6JA 1TA9A 1I1OA 1ZH0A 2R6AA 1NUQA 1A82A 3V4RA 2QTBA 2ZAOA 2FW0A 1QFXA 2EARA 2ZR7A 3HJHA 1WU8A 3N6RA 5I5GA 4DTCA 4FJ0A 2W2MA 4J90A 2R6ZA 1E3JA 2RIRA 1TM3E 3D6TB 4JODA 4OU4A 3THXB 3CWCA 2ZRCA 2GLXA 4EJ2A 1ZD3A 2O6LA 2RIPA 4DMMA 1NXVA 2JATA 3NQ41 1GNVA 1E92A 2HB6A 3OZAA 4C5CA 3BS4A 1PJLA 2F17A 1FBNA 3GPIA 2KW5A 3OKFA 2HA0A 5J3JA 3HBLA 2X42A 3JQFA 3RB8A 4QASA 1I0LA 1PI3A 5CEJA 3CF6R 2XXBA 2OCDA 3H2BA 1OROA 1RQ7A 3BRWD 3S4YA 3K9WA 4C22A 3B6IA 1RAAA 4HWOA 3BD7A 3A2LA 1UBSB 3RVPA 2OGTA 3EMKA 3T7EA 4BS9A 3KOYA 1E9SA 2EATA 3E53A 1IHPA 4OMDA 1RPTA 2NU6B 2QT9A 3EA5A 1IZ0A 4G0ZA 4RTPA 3QPDA 4CT4B 1NA5A 5B1DA 2EQAA 3PEVA 3A6ZA 1CY4A 1N0WA 2GHRA 1PR5A 2ZPTX 5FUWA 1OFVA 1SBIA 2O23A 1SA0B 4KAJA 4C4ZA 4DWWA 3MTIA 2GPBA 1KK3A 5FLXA 3D54D 4OL0A 4IXNA 5HJ7A 2X0EA 2A0XA 4CMAA 2PQ0A 4A10A 4C7OA 2YZNA 4OH1A 5GGYA 1YZ3A 3EC1A 1PEKE 4R2JA 2PD6A 3BD8A 4DSUA 3AEYA 1PP4A 2FZKA 4RJIA 5F35A 4RMJA 4PGAA 1LSUA 2JJMA 1NJ8A 4IDGA 4QOEA 1EK1A 1P4AA 4X6LA 2C9ZA 4YDSA 3PCTA 5AW7A 1MR3F 5CD1A 1JTVA 4IIFA 3NHPA 3B5IA 4RYDA 4C4AA 1E98A 2I1QA 3PF8A 1N8NA 2FP4B 1OPRA 2PK3A 2I54A 1UC5B 3IAEA 4IG9A 2C5FA 2AEEA 3UAOA 2ZRQA 3M5PA 1UJ6A 3BQMB 3V8QA 4O4JB 5KNCH 4HDCA 1RABA 2G0AA 1T4CA 3S2IA 4O8ZA 2Z43A 3MWJA 4UTVA 4F60A 3Q5GA 4XQEA 4RL6A 3F47A 1VPWA 2PRYA 3OFND 2GDZA 4OYLA 2WTBA 3DCJA 2AQHA 1QYVA 3C6KA 3HSSA 4HATA 5DBGA 1WUTA 3N8NA 3WIOA 4NNJA 4BEWA 3DNPA 4E5SA 2UYHA 4LF6B 3TAXA 1ZGGA 1B6SA 1KYXA 3NANA 1OBOA 1GCIA 1VSBA 1Z0ZA 4C6TA 2PJZA 2VS1A 2HZ7A 2R84A 5FIUA 4UTOA 1PUJA 4OXYA 4BRZA 2A9OA 3OLVA 3WICA 4F3RA 2CFIA 3ROKA 4ZVLA 1P7PA 3ADPA 1W0CA 1B41A 2JEOA 1PWHA 3HTXA 1CFJA 2LD4A 2PLFA 4PLTA 3U56A 5EE9A 2HT1A 3LM8A 2IL1A 2R6GA 2LR0A 1KAOA 4O5AA 3O21A 3T9FA 1T1IA 5KJ1A 3BREA 5EMMA 1GIAA 2YHSA 4RMIA 1JDPA 3RWBA 2O48X 3KU1A 2ZT6A 4E5MA 2FMTA 2VXYA 1WXGA 4MLCA 4P58A 1VHQA 1XU9A 2WYIA 1GVHA 1PSDA 1QNFA 1J39A 4ARVA 1NOJA 5JMTA 2VPIA 2PX0A 3IBSA 1I5EA 3K92A 3M4NA 2HUPA 3PX3A 4XWKA 5I7HA 3OZGA 3ADDA 4B43A 3G89A 4UCXA 5EGNA 4XKJA 4IOKA 4RSRA 4I1PA 2GI4A 1MU0A 3QLUA 4X1KA 4YI3A 3TTVA 5EJ5A 1FVHA 2OZEA 4I9GA 4W5WA 1G5TA 3Q9SA 4WUTA 3S2EA 4TPKA 1ENOA 3KAQA 3UOAB 4B4DA 2CMDA 2W2TA 3FH0A 3ULKA 4JLSA 4MMXB 4E13A 2PBRA 3S55A 5L3RA 2VT3A 4G5XA 1QRAA 3LL4A 3QVUA 1NYRA 3PVCA 2SICE 5KJFA 3AETB 2JBHA 1H1DA 3L7YA 3MGAA 1CD5A 5HKKD 4FMCF 4HWRA 2ORYA 3SF8A 4I9NA 1C30A 2PL9A 4C5AA 4JC8A 5IVKA 2B5OA 3Q7SA 3V2IA 4ITVA 5AFSA 4CEJB 1TCVA 2Y9PB 2QE6A 2VPZA 1KR5A 2RGAA 3AG5A 1TGYA 1GFIA 3E2PA 1IB6A 1U7TA 2DTEA 2OFOA 3CR8A 3O0DA 1X1BA 2GPNA 2LIPA 1XQWA 4G4SO 2WILA 1WU7A 1JU9A 2DQ4A 3ESDA 4JGGA 2R60A 3DHNA 3HVJA 4F4CA 3L77A 3OQHA 3QE4A 4EUKA 1JDNA 3JYOA 4BNYA 4CQLB 2HDOA 4Z9XA 1N5JA 3LLSA 2XTMA 3SE7A 3A6KA 1XMSA 3DVLA 4ZEOA 4DUYB 1C0IA 1K4YA 5DYYA 3SEZA 2X40A 1IN8A 1P9LA 2VQDA 4J94A 4ND8B 5GP1A 1ISGA 1Y7PA 2E55A 4EAQA 1VDZA 3PB3A 3D02A 1TAUA 3LD9A 2JLAA 1CUIA 1RAHA 1Z5ZA 3W6UA 4ER3A 3FSGA 2WFAA 3PCRB 4I46A 2OQIA 1Q7GA 3BSYA 1NRIA 3LA6A 4JP2A 4KWEA 2Y66A 1QF6A 4RKEA 3K9NA 4W6QA 2WW8A 2IV3A 1G55A 4RZHA 2WG0A 3BDIA 2EKPA 2JBAA 4J1TA 2R7LA 3CKLA 5CLIA 1KBQA 4IUDS 1N34B 3DLTA 5DKFA 3T7RA 1FRVA 1OKKD 5LP6A 3TLKA 1QO9A 5ARBA 4UHBA 1GGJA 1GNQA 3OOHA 4Z7NB 3UCFA 4ZTZB 3DZBA 2A4KA 5EZYA 2PNFA 3FDZB 1ZUIA 2DY1A 3LA8A 5DXFA 4TXNA 1E5DA 2PUWA 5AVTA 3RBXA 1N9ZA 4XJTA 1UKYA 1SC3A 4NSNA 4WKNA 1SVSA 4MKFA 1DFIA 2NAFA 1GY8A 5ESRA 1A27A 1XDBA 1JFFA 4LJLA 1JI0A 1TQDA 5DHTA 4DHEA 2HSEA 1UQUA 3QYAA 4FGJA 2ZRKA 1VE7A 2ZRPA 2XHEA 1DV2A 3ESAA 3ET4A 4ARAA 5C8YB 2FZEA 1B0PA 3AFGA 4R1LA 5IKXA 1V1RA 2FQWA 3U3JA 4R71A 4LNUA 3Q15C 3ZU6A 1QB7A 4J76A 3IEPA 2I3AA 1MF7A 2OAGA 2ZI9A 3ENWA 3IKLA 3EYAA 3KT3A 2J33A 3MD0A 2PZBA 1L5QA 3FCOA 3O75A 2ZUTA 1KYTA 4ABYA 3S29A 4PLZA 1N5KA 3ORYA 4GGMX 3TW8B 3OZVA 2NQ8A 1O97C 3QFHA 4IDFA 4P92A 2YQ5A 5EPEA 5FBQB 3W7BA 2EGUA 4EBFA 2H48A 4C2TA 1BFDA 1UK9A 4YO7A 3E9CA 3ETJA 2WJGA 3LDGA 2H2IA 3V55A 3HWRA 1D2RA 3GEGA 2EW8A 4E21A 2PX4A 5DHRA 1GQYA 3LBFA 4YV2A 4UUPA 2M6LA 2C5LA 2C9DA 3BERA 2H59A 2QJRA 5LJIA 3VSEA 1Y6FA 1PJTA 2IQ5A 1V1RB 2RB5A 2OORC 4KOAA 4PQGA 4XD2A 4DLYA 3V4LA 1XDWA 1KPHA 3GIWA 3V7YA 3FPBA 3COVA 2IF2A 1GTSA 3STXA 4F06A 1YBVA 3UMMA 4G0OA 1E79A 2IH4A 3WLJA 1GSAA 4CQMD 1JEDA 3O8QB 4TLAA 2YMPA 2BKAA 4Y9SA 3D8SA 4DQUA 5HGXA 3W05A 3ONWA 2C78A 2CHFA 2EC5A 1XTVA 2QYTA 1ZIYA 4EG1A 2Q4TA 3KQPA 3SPXA 3DDOA 4EY6A 1IHOA 1KO1A 3BE6A 3N7UA 5E9AA 1HMYA 4Y30A 2HNKA 3HY6A 2PS0A 2PTGA 1XL1A 5KNCD 4BWGA 2VA8A 2ZIXA 4C1BA 3HN2A 3UWSA 4LNHA 2OCAA 3KX2A 1EQ2A 1CY1A 1A9YA 1SVWA 1UK6A 2QIOA 3BB3A 4G97A 2B5WA 5K0JA 4QVIA 2VT7A 1WHSA 3FDJA 4L3OA 3VNQA 3AKYA 4S1OA 4K0KB 1L7VC 4D41A 4NMMA 4FB5A 5HS6A 1TX4B 2QTRA 3P5SA 4G1FA 1IG3A 4KR2A 2OORA 1G3QA 3QQPA 5KCMA 4GDFA 1SB8A 1NJGA 1TA0A 3V8PA 1KYZA 1T2VA 3ESYA 3DD5A 3JZIA 4CM8A 3HQ4O 1E2EA 5GOZA 1U8CB 1NFFA 3P8ZA 4NX2A 4Q4AB 1AGYA 2HJRA 5TPZA 1FDRA 4ZO6A 4WCDA 3S8EA 5L3QA 5ALSA 2PCLA 3LG2A 4A82A 2OXTA 1N92A 4WINA 4U7DA 4II2A 4KAFA 4GBGA 1HH4A 1BC5A 1DDGA 5HW0A 4B81A 4A0FA 3FPAA 4TTSA 3BWYA 4NNOA 5F21A 3UY4A 4FYIA 1LK5A 4FYMA 1GPBA 4ABTA 3M3PA 4WN9A 3WR5A 4YMLA 2Y77A 1E6KA 2WWWA 3ASVA 1YB6A 2VNSA 2FFHA 2YWRA 1J00A 4NONA 3EXG1 4GX5A 1F20A 4MCHA 2IHVA 1WW2A 5DCWA 4DYHA 1IL0A 1NDHA 3CM0A 4B7ZA 3SVLA 2YTZA 2YASA 1S8OA 3M4XA 1FUEA 4PHTA 4RU1A 3F6EX 1VCIA 1XYGA 1ZRSA 1GQFA 4LJ5A 1JAHA 2XNDA 5T3YA 5E1OA 1UT6A 3DTNA 2I6FA 5JFTA 2ZR0A 3KOMA 5REQA 3ZGNA 1AGXA 1IOLA 4KZKA 2FP3A 4K6FA 2AN5A 4KFSA 3DA8A 4LJAA 1M7HA 2OE2A 5BW6B 1YS9A 2ZJBA 4TYMA 3ZDRA 1LBHA 3LWZA 2FPXA 4EFKA 4EO7A 2Q5FA 1GT6A 2GRUA 4NFYA 4CV0A 3R3XA 4WVLA 1QU2A 4PLYA 3OA2A 2IX3A 4CEIA 3ZDEA 2ONCA 3SU8A 4RIGA 3V8NA 3TQHA 4YCCA 3OX1A 5KX5B 4OHZA 2ONZA 2QXYA 4YMUA 6REQB 1D0IA 4HH3C 4LWZA 4ZREA 5GONF 4GP6A 2EW2A 1KHHA 3LPCA 3ZBQA 3D8UA 1ICEA 2OGSA 3FSRA 5LZ9A 2ZDHA 1WCIB 2QUZA 1W75A 1AGRA 4JFRA 1YXMA 2JZNA 2RAUA 3CRW1 4KZPA 4WNYA 5TMEA 1Z6ZA 3DOJA 1LPMA 3U4QA 3NWBA 1Q1EA 2HDWA 5J4YA 4WK4B 2RBEA 1FJ2A 2J87A 3FPKA 4PNHA 2X8JB 1NM5C 2P0EA 4U7PB 2W2NA 3IHKA 3R7AA 1ULAA 2IYEA 5ICSA 1E0DA 3HZHA 1ESEA 2BKEA 2AUMA 4CL3A 3KQQA 2ENWA 2PMBA 4ZT3A 4XYLA 3FWPA 2JZOA 5JYBA 2GILA 4MGEA 4RSGA 1OY1A 1ZH8A 2CB0A 5G3ZA 2MMGA 4AMVA 7ADHA 1U3GA 4JJAA 4MQ4A 3TZQA 3U4AA 5JAMA 3I4FA 3WQSB 1UQTA 3WRVA 1DBWA 3BXHA 4P84A 3OHMA 4AD8A 2FLKA 3RS5A 5F5XA 5FLYA 1S3GA 2IHJA 3ZXIA 2NYAA 4YCDA 1PTJA 2ZYTX 2IDJA 1HYQA 2O8VA 2DQYA 4B5LA 3KUXA 5FBLB 1G8FA 2B4AA 1JIJA 3I72A 2IIBA 1SU8A 2OCGA 2ROQA 2ODTX 4IXDA 2Q62A 4HVTA 4RK5A 2O3QA 4CMJA 4WNAA 1T9BA 4FVTA 2OOKA 3G68A 4WLUA 3QVGA 2X8JA 4ZAGA 1FNCA 4X6YA 1ZQ1A 3OLCX 1WMBA 3WC4A 1DO0A 2QAIA 4LAFA 4PZDA 4C1NA 1OFHA 2D8MA 3TIGA 2FXIA 4NZPA 4XEUA 1T9HA 4ZCPA 3VOSA 1JA0A 3RW9A 3GLFB 2IYYA 1NGSA 1GILA 3TKYA 3TRHA 4M9RA 1LBTA 5DVZA 4MB0A 1UM9B 1EI9A 4YB8A 2RKOA 3NDPA 4A26A 5AM1A 5MFZA 3VPBA 4HC4A 1ID1A 1F4VA 3FPHA 4WT7A 2DHRA 4XE5A 3WRYA 4W5JA 3ZHSA 4UEWA 3GYBA 3PE4A 3SYRA 1X1TA 4U6QA 4YMSA 3WG9A 5HK8A 3JZDA 4ZK2A 2DLDA 4OI4A 5LOVA 2OFPA 2R6FA 4M55A 1KGSA 2NU7A 3D4NA 4I99A 1VMIA 2JZCA 5IXJA 5H0IA 5SYNA 4L5YA 5CPFA 2DY0A 3LTNC 1V39A 2BUBA 3RIMA 3GJQA 2XQFA 3UBTA 3R4VA 2HOQA 2H1WA 4WX2B 5I7AA 5D2CA 3A1CA 1WUHS 1RZVA 1LNSA 3ESRA 3TO5A 4OK3A 4KTVE 5ALLA 4C0AC 3SZOA 1NR1A 1NUUA 3K4PA 3K0KA 5IXSA 5JBQA 2VL7A 5TS2A 1U9ZA 2RHTA 1FVOA 2XOXA 4N5IX 3REOA 1BD3A 4P4GA 4QLBA 1Q1BA 2YIMA 3EVBA 3KAPA 1RC8A 4F3KA 3C8UA 4OMUA 2GVZC 4PZPA 3GLIB 1T5OA 1Z0IA 5FRDA 1JBEA 1FNBA 4HCJA 1O58A 2BELA 2IS1A 4UD6A 4URXR 1ND6A 3LBIA 1TYEB 1YZHA 4UDXX 1BMTA 4Q7EA 2JFUA 2AV6A 4P7JA 2D0DA 5ALVA 3HEAA 3SBOA 1QK3A 3TLGA 1Z5WA 2X9LA 3QKTA 3LDUA 1ENZA 1FYWA 3NCHA 4FSDA 4LGVA 4OATA 3PVZA 4P4LA 2IYRA 1LW6E 3PJEA 4GHWA 1USWA 4TKLA 3RC3A 1ZLYA 3VU0A 4MV5A 3W90A 4D56A 4LYGA 5JYEA 1DEXA 2A88A 4IIEA 2YFYA 3SOZA 4GM4A 2GXQA 2UUOA 2YV4A 2PQ6A 5KU1A 4Q24A 1T13A 1T2AA 3UB4A 3FIJA 3U39A 4LZAA 3GR6A 5FP0A 3QJGA 4DV4B 2GEVA 4BO4A 5JCOC 4L6AA 5AVJA 2HK8A 3HFGA 2IPAB 1YUNA 2I7VA 3GFPA 1J5PA 4FEAA 2VOEA 1BSVA 1R8QA 4H6WA 5SYAA 2FZCA 1N2EA 2GZMA 3HDJA 1NW6A 5AOAA 3C39A 3WAJA 1OFGA 2N47A 1H8HA 3MUEA 4J0CA 5FOVA 3VR6H 2H4JA 4AUKA 1PZFA 2DTXA 5AW8A 1XTRA 4UDYX 1CQJB 1O6CA 1OWLA 1YTUA 3KM0A 2JIBA 3AGQA 1RAGA 1O54A 4RA6A 3E18A 1EP1B 4QUIA 4RMGA 4GT1A 3A1EA 5P21A 4LDRA 5KTSA 2X13A 1FSZA 1DRWA 1T6YA 2B8TA 2ZJZA 3JX9A 4IRMA 3WYAA 5I8PA 4H7EA 3WYDA 5LDHA 4ND8A 5MHTA 4IDQA 5HILA 2GD1O 5HIIA 3QBVA 1QUFA 4B48A 4Y2QA 3R7LA 1KY3A 3EH1A 4BPRA 1Z35A 1DPGA 3BMQA 4MMYB 2OT3B 1RRGA 5G4KA 4XUDA 4GKAA 2B5VA 1E9RA 4PLPA 2VRCA 5AVSA 3VYRB 3RIEA 1JFTA 3BGOS 3RSGA 1GPH1 1R3DA 3W5SA 4EHAA 2IJGX 5DTIA 1MRSA 1DJNA 1FEZA 4KAXA 5JCPA 1ZC3A 3DE1X 4WPGA 1IEVA 3Q88A 1YIDA 1R0LA 3AHIA 3GFOA 4ZKDA 3INRA 4DJFC 4QTTB 3K6JA 4DNOA 4D8VA 3QXGA 3TEFA 2AC4A 16PKA 1OH8A 1I1HA 3ILXA 3P1JA 3BBLA 1US8A 4DMCA 3NTUA 3IA7A 3ZS9A 1OXXK 1EQAA 3GXBA 3T4XA 5AQ1A 2NO4A 3FYUA 2I2WA 3DHYA 3QVJA 1H4VB 1PG0A 5B37A 3W8RA 2WUEA 5D8DA 5E7IA 4EQZA 1SCQA 2BJHA 4FINA 1R64A 3R1IA 1DAOA 4XUGB 4JLMA 4IXWA 4Z86A 4ZRDA 1HKUA 2YZ2A 2J3LA 2ZUCA 1L7RA 4GC5A 2H0QA 4EGSA 1AUOA 1G0OA 2ZLBA 3OVMA 1PT5A 2AN1A 3QPUA 2PV0A 3W2GA 1KWGA 4M8LA 1MAVA 1DMSA 2XUKA 1IY0A 1DFGA 2X77A 1TF7A 4N0EA 2GEDA 5FWXA 4CLEA 4ZANA 4KHZA 4Q93A 1E1KA 2H3EA 1U28A 2HA6A 2QS9A 3JQRA 3DHEA 3QI2A 2YW9A 3ZI0A 1G21B 1W5EA 1CJVC 2EGGA 3KELA 3L46A 4BJ1A 4ZCTA 2AR0A 5LM3A 2RGYA 4TTQA 1XRRA 1BOFA 4PX9A 1KO7A 4R1QA 3VR5D 4YCSA 5EZYF 3G88A 3NRBA 3LPDA 2XW6A 3UMCA 4EJMA 4PYOA 1KR2A 2CL7X 2ODAA 2QM0A 2QTVB 1PJQA 4FEGA 4GNKA 5ICFA 2V7WA 5LP6C 1EX7A 1PGPA 5BSKA 6YASA 4X1YA 5SICE 2BI4A 5MF6A 1YKSA 3EG9A 3I9OA 1EUYA 1AXRA 3JQ7A 1CJMA 1UDWA 4NCAA 4Y18A 5JWHA 3CN7A 1E3QA 2XMBA 4OHCA 3E4DA 5JANA 3N3BC 1W5TA 4JEUA 2IUTA 2RG1A 1L3IA 1LY1A 2YV1A 4E15A 2VWPA 5C2JB 1KEPA 3Q8WA 4B2LA 1AQLA 1SHTX 2FSHA 5H4HA 3SQWA 1M1YA 4MS3B 1VLJA 4LZWA 2XSZA 1R50A 2NZ2A 4P3PA 3RG2A 3ZU4A 4ZHSA 3OKCA 3SHVA 3E3MA 1NKVA 1E8NA 3C5WP 2Q46A 4HSEA 2XPCA 4TKMA 3EQZA 1H9AA 1D2EA 3BJZA 5CVEA 1I30A 1JGTA 1NVKA 1GKUB 1I3MA 1QF9A 1GFZA 4K1XA 2GF2A 1M6HA 1ZK2A 2G4VA 3GCXA 1UMKA 1YRLA 2C5AA 3IP8A 3KV1A 4CR8A 3HMKA 3AQIA 4AT1A 2YX1A 3B20A 4B7CA 5HMLA 1M5UA 4ZAVA 1PS9A 1UBNA 4DFDA 4UEOA 1Q19A 2XVYA 4KQWA 4XWGA 2NNWB 4KNWA 2C88A 2HA4A 3OJEA 3CSDA 4TKUB 3V5NA 3OEYA 2R48A 3FJYA 3QFRA 4PVDA 4WACA 4MW1A 4CKWB 3HU5A 1F7VA 1WEKA 2VRBA 3UC9A 5HM6A 4KXLA 3ETGA 4HL6A 2V7QA 2FDRA 2JJYA 3NIBA 2BV3A 4MPRA 3ZD9A 2J5QA 2CGEA 5C80A 2YVLA 3EPLA 1XNRB 2XUOA 2DRIA 3PITA 4O2BF 2IV2X 2Q9CA 3M4ZA 5J4HA 3PRJA 4QGGA 2ZAGA 1ZGJA 1NLFA 3UAWA 3SIXA 1V8ZA 3GWZA 4QYWA 5C8YA 4E94A 5K2OA 1PF7E 2GESA 4O25A 2CLKB 2YY5A 5DWQA 5TT0A 1POXA 4BOYA 1I10A 3TZCA 2AXPA 3OTGA 4PIMA 3CNEA 4PO9A 1QKIA 3OLQA 2PTHA 2R7KA 3DLAA 3KB6A 3ZZNA 2CVOA 4Z53A 2V54A 1ODCA 2O6HA 4UAUA 2WWYA 3IIEA 3HZZA 3JU3A 1RCTE 3KVVA 4KPFC 4AKIA 4OHBA 3BMCA 4BVGA 1DC3A 2MR5A 1E7SA 3L79A 4O4IB 1CCWA 2QWXA 2WUFA 3E7WA 1V96A 2YYYA 3GP8A 3HJNA 3NHUA 3V1YA 4FCWA 5KHOC 3R0XA 5KU7A 5H80A 4WLOA 4R6WA 3VZBA 3GJ4A 3CY6A 3P9NA 3WK7A 4C7MA 4DB4A 4JB3A 2ZAIA 5I9LA 1O95D 1BFUA 2ECFA 2R1TB 1IVNA 5I7OA 4CTNA 1CBUA 3D3JA 2FMXA 1I4WA 2O0LA 3UTDA 4E2ZA 3AEZA 1MO2A 5L3VA 1Y81A 3G79A 3LQ4A 4R1UA 3VGPA 2ZI6A 4PG8A 3EPHA 5KDLA 2WD7A 2NPFA 1PR2A 5JG7A 5AHOA 5ALDA 3RS3A 4LOKA 4QM7A 4EPTA 2VBFA 1K97A 1G38A 5JY1A 1MV8A 2QLMA 1V1MA 2NZYA 1N1DA 5DCUA 4BDTA 3LCRA 2X0NA 4Q7MB 1O6GA 2XBLA 4U0JA 4U5QA 6Q21A 1T10A 3GPLA 2L42A 5JPCA 2MYUA 1JKJA 1ISIA 4W82A 3TRFA 3UXHA 4DA6A 3JWHA 5ALMA 4LHXA 4P3YA 4X8MA 2W71A 2OUIA 5E9JA 3AF3A 3EGWA 5CDFA 1YMQA 3HI4A 2AVDA 1TA4A 4XH9B 4CBVA 2EHJA 3LHKA 3MTEA 3OPYI 2LPMA 1EFDN 1Q1AA 1KSGA 2NXWA 3R7BA 3LUKA 3V48A 4N82A 1DI0A 1U28C 4CMKA 3IOYA 1I7DA 1RVV1 3LIIA 1CUEA 4ZZ0A 4LZNA 1PR9A 1V5EA 2PSJA 1NRXA 2FW6A 1POWA 5IC6A 4PBSA 3WKEA 1KFKB 4C43A 3B51X 2IY9A 1J2TA 2DPGA 4S3MA 3RT1A 3ZWPA 4Z51A 3B85A 3LQYA 2WUVA 2Q2QA 2OP1A 4XWTA 1U0OC 1ZFNA 1G0NA 2FSPA 1B6TA 4G86A 2C58A 5F7ZA 3REGA 1NONA 2OXRA 1Y6GA 2ZBRA 2ICAA 3FNFA 4PE5B 1E0SA 1SCJA 4QU9A 5LDGA 4E3ZA 1IBKB 3TLZA 4F6CA 1ZSYA 2AFIE 4EL0A 5KYTA 1D5WA 1SEPA 2C5HA 2NV0A 3IAM1 3KQYA 5AUNB 5JTUA 2HWXA 2WVHA 3NEJA 3PYLA 3WL7A 4XSVA 5ITSA 1RI4A 2J4CA 3SKYA 2YZ7A 4AKEA 3RASA 4MIEA 4WCVA 3NASA 3RPEA 1ZX1A 2BEWB 3CC8A 4F71A 1E60A 2VNJA 3NXSA 5LYJF 3I0MA 4XSHA 5FHRA 1LC3A 3T7TA 2VH2A 2QDXA 4BNHA 3QX7A 3TRDA 1ATZA 1ZM7A 3HV0A 3TGWA 3MJDA 4CXMA 3C6BA 3GRRA 3AIOA 3O1JC 4V2UA 3ICVA 1FK8A 5KMGB 2IGTA 4TGLA 2DXIA 1RWOA 5D3MA 4RD1A 1E58A 4V24A 5CXUA 4PTLA 3FCEA 2GJAA 3E61A 1NZJA 3EIUA 1WAMA 3R74A 4KLRA 4QPZA 5LBIA 1R0BA 1OOEA 1ORTA 3WJ7A 1EVYA 2CBXA 4C7XA 3G0HA 5BWOA 1JQBA 1Q2UA 1VL5A 1QOPB 1PSWA 2HKIA 2VYVD 1VB3A 2CZCA 3I1IA 2E48A 1CY2A 2JAUA 3KCNA 1PDVA 4FI3C 1NM5A 1XMIA 3AEKB 3KOUA 4WFIA 1NBME 4J7UA 2P5UA 3B6ZA 4A73A 4F3TA 1NVUQ 1FS5A 1IEXA 2YR0A 4G0XA 5EERA 1MJGA 1C9JA 3NAGA 4F5YA 2JFBA 2X9VA 1G3IA 3N2IA 4D98A 3PGMA 4YK7A 3QU5A 4L50A 2COEA 4IJMA 3RTCA 5FL3A 1C8VB 1KJ8A 1UF9A 3CNBA 4TMTA 2J0EA 4Y3UA 5CEEA 4QHSA 3DMTA 3SFVA 5KWEA 1SH7A 3HNPA 3KYBA 4GMGA 4Q4AA 3IPLA 3D4PA 4MW4A 3ZZ1A 1G1MA 1UDAA 3A6FA 3FJOA 3JQ8A 3IAFA 3H5RA 5L51A 2P5TB 2IPOA 3DDNA 3DXYA 4FP9A 1M66A 4QPNA 3EF3A 4DADA 2ZIWB 2XODA 3C87A 3FUCA 5DNDA 5KNBA 4TOIA 3TLJA 1PFKA 1MIOB 5DZSA 4QPJC 3WQHA 2DBYA 1V8BA 1YJ8A 3R3WA 2PJUA 4Q02A 4AX8A 2EDCA 4A2CA 3DEAA 4RHCA 2Z08A 3WV4A 2ECKA 2G9RA 5TY0A 2ZEJA 1CZUA 2VDJA 3CRRA 3NVMB 5P8WA 1GZHB 1E3DA 3PVSA 5F9MA 5HYVA 5IT9A 2FUG1 3VAYA 2R8EA 3H5WA 1SK9A 1NU8A 1DZ3A 3ZLVA 4QBTA 3T5MA 3HWX1 5DT2A 1JE1A 3FUVA 9LDTA 1S96A 5KVVA 4ZT6A 4DC0A 3L18A 4ZI7F 5KTKA 4MKGA 5DLQC 5BXQC 4CW7A 2R2AA 4A0SA 3E8SA 3KT6A 1E69A 1J9ZA 1O9BA 2YRWA 1WMAA 2HU7A 2CV2A 3E3NA 4DG9A 1PEDA 1V8PA 3DGEC 4FYJA 4LF7B 4BKRA 5BV1A 2RHCA 2WDPA 1H0RA 2GETA 4EFDA 4I4TF 2X8BA 1XCOA 3GMIA 3BB4A 5KSWB 2BFCA 1QH1A 3BMOA 4MJXA 2KS6A 4MOWA 4GL2A 1RWVA 3MSCA 5JSYA 3CLRD 4NU0A 2IEGA 2AR7A 4YASA 2PNJA 4DQLA 1ZG3A 3QHPA 3ZH2A 1E8MA 1AUVA 1U0GA 1JU4A 2IXFA 2W6JD 4CHGA 4EPWA 2ZUEA 2O2DA 2WMYA 1OTHA 4H6VA 2C1EA 5B3JA 4KKVA 3NYRA 5HRAA 2R96A 3OI7A 3P19A 4ZI3A 4NG4A 1A97A 1RFLA 1OI3A 3EVFA 1JHZA 2PBZA 4GOKA 4NMHA 3VC3A 4LEIA 1UEIA 3RYCA 5FNVA 5I7RA 2I8CA 3U5ZB 1EU1A 3NM4A 2VQSA 1OYYA 3WA7A 3GNQA 1P1RA 2FY8A 3I30X 3E05A 2VJQA 3FSEA 1J1ZA 4RVSA 3K15A 4IX9A 4NXMB 4ZVMA 3B6MA 1D1PA 1WUYA 3BSWA 4EQ6A 3VR4H 2O5CA 2H92A 1YRYE 1F51E 3WIVA 1CUBA 4P4TA 4BQSA 5AICA 1G98A 2OV2A 1UOQA 4POAA 1T1RA 4DW8A 2W0SA 2P5YA 3WWCA 3JQ7B 4DJTA 3ANLA 2FNAA 2IZ1A 2Q2VA 4M88A 5ETJA 3T7JA 3DZKA 1FFXA 1VHLA 4BNWA 2O54A 2IEYA 2XMCA 1LFAA 3MERA 3F7OA 5GVSA 3T3O