4CV3A

Crystal structure of e. coli fabi in complex with nadh and pt166
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
239
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 85
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv3A00
1FF9A 4IM7A 1E3IA 4DPMA 4DLAA 2P2SA 1A72A 1M67A 3B1JA 3GEGA 3GMSA 2NV6A 2HMTA 3QVTA 4QFDA 1YBMA 1FMCA 4GKVA 2HK8A 5DCUA 1EE9A 1E6WA 2UUOA 3OP4A 3OH8A 5EPOA 4CLOA 4UEOA 5CPFA 4CLRB 3AY6A 5HS4A 4AJEA 5GMOA 1XHLA 1FXSA 3PYMA 1SOWA 1AXEA 1FDTA 5CPBA 3EGOA 3FPLA 5FFFA 1J6UA 3IIEA 1Q7GA 1IZ9A 2NWQA 1EVZA 3QIVA 1O5IA 2BMAA 4URFA 2CFCA 1GYRA 1ISGA 2D8AA 2VWPA 3K6JA 4YJFA 4XWYA 1G1AA 4MO2A 1JA9A 4IY1A 5L40A 3FNEA 4W4TA 5I9LA 2NUAA 1U8XX 3RC7A 1PSDA 2VNAA 2NVWA 3FTNA 4IDBA 4FJ0A 4H3VA 3G3EA 1WLYA 3ZNQA 4FOSA 2NVBA 3TZKA 3IP1A 3N58A 1MP0A 5EQDA 3HFSA 3DDNA 3S55A 5KVQA 4OIMA 4FB5A 4YVFA 5JO9A 3QA9A 2VTDA 4XJSA 2GN4A 4CM9D 2CSUA 4WLEA 4P4NA 3PHHA 5U4QA 4U6SA 3JD1A 3Q9NA 5K6AC 5FF9A 1Y8QB 4BO4A 2HMUA 1XEAA 5DBGA 1XCBA 3JQAD 3GN1A 1I2ZA 3H5RA 3OJFA 3KHUA 1IB6A 3JQCA 1LDNA 4LISA 4TRRA 4AJ2A 1D1TA 4OOEA 4TRMA 1A4UA 3UCXA 3OFSA 2WYWA 4EBFA 1PR9A 4BO3A 1XYGA 3PPIA 2WYUA 1NFFA 1LDEA 1E92A 2YQ5A 2YV1A 3WBFA 2VRCD 4NIMA 3QV1A 1F14A 4Y9DA 3H9QA 4AFNA 4UEKA 4E32A 1C1XB 2AEFA 4INAA 2O3TA 3DHYA 4LSWA 1T2AA 2P9CA 8ADHA 1T1RA 3ZCXA 3DBVO 3AWDA 4DYDA 5MDHA 1GCUA 3DBLB 3H6KA 3NT4A 5F1PA 1DDOA 1PQWA 1EBFA 1GZ6A 3RBVA 3T7CA 1OOEA 1I0ZA 1X7DA 1PGPA 3HDJA 3H9EO 3E6AA 2QX7A 2VZ9A 4QTZA 3ONDA 4CV2A 5TGDA 1DRUA 5JY6A 3BXXA 4R1TA 1MB4A 4CM4A 4DIFA 2CDCA 3PWKA 4AICA 2UUPA 5A9RA 3JD2A 5C3MA 2QZZA 1Z7BA 2GRAA 5ITVA 3GDGA 1PS0A 1L1FA 2B35A 1ZK4A 4B3JA 3L07A 2B69A 1GZ3A 2YW9A 4D3FA 3OECA 2NQ8A 4I9UA 4DTIA 1UXGA 1HYEA 2TMDA 4BNNA 2G82A 3WTBA 4J0FA 3GG9A 5TC4A 3ETGA 3FI9A 5G0UA 3GEMA 3PP8A 3O26A 1QLJA 4OQYA 4R4JA 2HU2A 4LGVA 1NVTA 3MJ4A 1EDOA 4RGBA 3VOSA 1XQ6A 2V65A 3LSYA 2BF7A 3NV9A 3GDOA 2PY6A 4NI5A 4BUCA 4Y67A 2PH3A 2ZB4A 1YB5A 2PGLA 3TJRA 4Z3DA 3BMOB 1P3DA 1Y6JA 4NZ9A 2AE2A 4YT4A 1M66A 1GYQA 4IDEA 4L4XA 2UDPA 5AXCA 5J23A 4UVHA 4BQRA 3HDQA 1I36A 2C07A 5A3VA 5TT0A 3ZNPA 3VPHA 1DO8A 3ZNOA 4HFMA 3DFUA 4W7IA 1VKOA 1F06A 1LTHR 4GL4A 2H63A 2OGUA 4N54A 1R4MB 4Y6PA 3TPCA 4E5KA 2FN7A 4EGFA 4D7AA 3LC1O 4E13A 1YOVB 4ND3A 1LLCA 1A9YA 5TX7A 3K2EA 3GVXA 5KNLA 4S3MA 2EKQA 3DZFA 4H16A 4MVJF 4A26A 4RQUA 3UVEA 5I7EA 3Q2KA 3RD5A 4KQWA 4B79A 1GQQA 1ONOA 3WGGA 1EUCA 5L45A 3I5MA 4Y8VA 1I8TA 4ALKA 5BR7A 3EMKA 1GV1A 2PZJA 1I32A 3OSUA 3M6IA 2A92A 4OJNA 4TROA 1PGQA 4FFRA 2FHSA 4J7CA 5CP8A 1DFGA 3VZSA 2PD6A 2AEMA 1S7CA 1WWKA 4J4TA 4CMIA 4KMSA 1N7HA 4AJJA 1QRRA 3LK7A 2X8LA 3KO8A 3UKOA 1V0JA 4O5OA 2HRZA 2NSDA 3JYNA 3P2YA 4UAGA 4FFLA 1KEWA 4CM9A 4BKUA 2NTJA 3FR7A 4BNWA 1XU7A 3WGQA 3ZI0A 2HO5A 3NGLA 3C3XA 4CQMD 3ZGYA 1WP4A 4BIIA 1LC0A 1V9LA 3D3EA 4DREA 4KTTE 1UUFA 3JYQA 4MOWA 1R0SA 3JQAA 4OAQA 2W98A 4L4SA 2H9IA 3IJPA 1WMBA 3RC1A 4OYRA 4R41A 1J4AA 4RPHA 4CMCA 3KYBA 1WVGA 4DIOA 4KWIA 1E3LA 1E3SA 2B4RO 4TVOA 4K6CA 2R2GA 3JYPA 1DHTA 4QSMA 2G17A 1U7HA 4CR7A 4DLLA 2R6JA 1D4FA 4JQCA 2RHCA 3Q9UA 2NNLD 2JHFA 3LDHA 3ORFA 2R00C 4WOJA 4ZRNA 2VRCA 4OXNA 4CV1A 1YDEA 4YAKA 4E2YA 2OBNA 1DIGA 4BGVA 1DEHA 4OKIA 1VSUA 4WLNA 4JCOA 5CDYA 8LDHA 3DC2A 3E9QA 3LLSA 4U8GA 2DUUA 1I33A 1MG5A 3VPSA 4YT2A 3CH6A 1XR3A 4B3HA 4BO9A 1B26A 1A9ZA 3IP3A 5CDTA 5G4KA 1TXGA 4D79A 2B37A 4NNJA 4XIYA 1ZCJA 5KIAA 2EV9A 3PTZA 1PGOA 3BTVA 1ZW1A 5DCYA 5JLAA 4DC1A 3TNLA 4BNFA 4BGIA 3KTDA 3ROMA 2X6TA 1X1EA 1B14A 2JAPA 1UP4A 3NEPX 3KXDA 5DNAA 2F1KA 3OHSX 1PJLA 2AA3A 4WNCA 3ZW9A 1CWUA 2ZQZA 4CM8B 1HDCA 4E5MA 2EKLA 3H2ZA 2X0NA 3AFMA 2CDBA 1MUUA 3OEYA 3S1LA 2CDAA 3GLQA 2NU6A 3ANNA 1DJQA 3D5TA 3C1TA 4IZIA 1PJ2A 1TT5A 2BRUA 2Q1WA 4J1TA 2VHYA 4NDNE 3I4FA 3JQ9C 1W4ZA 3FNGA 3MJCA 4CQLA 1F0YA 3NJ8A 5ER9A 3FR8A 1H93A 3W8DA 2I76A 1LBEA 2Q2WA 1PWXA 2ILTA 4PG4A 2V6BA 5K6AA 2GF2A 3SBOA 3RC9A 1Z74A 1IE3A 1U7TA 2XOXA 3KLPX 2OL4A 3JQBC 5IJZA 3RSHA 4L73A 3IS3A 4DGSA 4CMBA 1UDCA 3MTJA 3RUFA 3U5TA 2Y1CA 1SCUA 3TOXA 5A9TA 1X0XA 3O38A 5DBFA 2V6GA 3KYCA 1U3TA 3GDFA 3WTCA 5BSHA 4J6FA 1U3UA 1D1SA 2Y1GA 4IDDA 1R66A 4R5HA 3E03A 5AVOA 2C7GA 4CUZA 2NU7A 4YEDA 1UAGA 4GMGA 3MWDB 3WFJA 4OGWA 2XF8A 4OSOA 1RM4A 4BQPA 2HMSA 5T57A 5GZ6A 1LXCA 4F6CA 2WEKA 4PLGA 1O95A 1ZK3A 2CZCA 2J8ZA 4Z9XA 3ST7A 3OA0A 3MOIA 4UULA 2B83A 3GRPA 4ZQHA 3H9UA 4XQEA 4HNHA 3PWZA 4HV4A 2BFPA 4FPXA 3I3OA 5TRTA 5B37A 1J0XO 5T5QA 2G1UA 3BTOA 5CFZA 1ZSYA 4CQMA 3DQPA 3RUHA 2PD4A 4P22A 4TKLA 1KEVA 2C7VA 3UCEA 4IQ8A 1LDBA 1OC2A 3LC7O 5JMWA 1P44A 3O8QA 5IXSA 1E5LA 1QLHA 3H4VA 5B4VA 4ID9A 4ITUA 2YDXA 3F1KA 3GRKA 5A3JA 1U9JA 2ZB8A 4PLCA 1TEHA 3RUDA 3WQQA 2DTDA 4CM7A 4PLWA 2GDZA 4J7UA 4Q9NA 3RC2A 3ZWBA 2X0JA 1T2DA 3QVSA 1C1DB 4BO2A 2PKQP 3F5QA 4E3ZA 3TN7A 4YTEA 2Z1MA 4ND4A 3PDJA 4I9NA 1PJBA 4YBZA 3UFXA 5JYEA 4RLHA 3GR6A 1E5QA 2GZ3A 3GVPA 2WE7A 3X2FA 1YXMA 1Z45A 3EVNA 3WS7A 3GQVA 3IKVA 3CXRA 5T67A 3ONFA 3EYWA 1NAHA 4IDGA 4BO5A 2NTVA 3H5NA 4IJKA 4WNIA 3AFNA 4N18A 4Q3CA 2VUUA 4GLLA 2BFMA 4BO8A 3KV3O 1C0KA 1DRWA 2JD1A 4NBUA 4LMPA 4U5QA 1V35A 2WWRA 2VZ0A 3ENNA 3WLEA 3L6EA 2ZYDA 1N8KA 2GUGA 4JBHA 2YY7A 4W99A 3DZBA 4AJKA 1EDZA 1ADCA 1GEEA 5CEEA 4YJGA 4DXHA 3BTUA 3VH2A 3WSVA 3DMTC 2SCUA 5H81A 3PJGA 4XR4A 4CV0A 3EVTA 2OO5A 4MVJI 2WD8A 4MKRA 4AJNA 3UH1A 1P74A 4Z0HO 3JQFC 3QP9A 1ENOA 1YS4A 1ZXLA 1WAMA 2Y0EA 4NQZA 2I99A 4XIJA 1RPNA 3M1AA 4LSMA 3E9NA 1DAOA 3U4CA 2FPIA 1YO6A 2YQ4A 3QWAA 4GGOA 4R1NA 3K31A 2UYYA 1NFQA 4PLTA 1IOLA 5H82A 3DBRA 3EUWA 3RBXA 4YRDA 4MIYA 4K6FA 3BMNB 3QVWA 5JDIC 4ZQBA 2HCTA 3ICPA 4MVJG 2P4HX 1Y5RA 3GAZA 1HL3A 4YYZA 1V3TA 1HDOA 2PGDA 3K73O 5CHEA 4ROSA 3ASVA 1TA4A 3GNQA 3PFFA 4ALLA 3NUGA 1NYTA 2XXBA 2NQTA 4MKXA 4IS3A 1F8FA 2GCGA 1BG6A 4E6PA 4JNKA 4ZGWA 3OIDA 1U5AA 3HHPA 5IG2A 2A35A 4BNHA 3HN7A 1EBUA 1DAPA 4TSKA 4RVDA 2IZ0A 3D5QA 4J91A 3ZHBA 4CUKA 2D5AA 4IGEA 3BMCA 3GAFA 3GHHA 1KVSA 1EK5A 1N92A 4E5YA 1HSOA 3AY7A 2P5YA 5KWEA 3LF2A 2OHXA 1DIBA 2VUTA 1MLDA 2IEDA 2CF6A 1R12A 4JLWA 1NVGA 2ZYGA 3HDYA 1DRVA 5GY7A 2AXQA 3D1LA 4YJHB 3G0OA 1E1KA 3M2TA 3C85A 3G1UA 4DQXA 2OMEA 1Y8RB 2IYOA 4NJOA 3GUCA 5DN9A 3ZU2A 4CR6A 3LLVA 3INRA 2Y68A 3NYWA 4BMNA 9LDBA 2PD3A 2PK3A 4Q3EA 4A27A 3L4BA 2HK9A 1GY8A 3FRJA 4N5NA 2FR1A 3WOHA 1CRWG 2FR8A 1ZH8A 1PQPA 5JO0A 4CMAA 2VWHA 3ROKA 4MP6A 3PLNA 4UUMA 3DMYA 4B4VA 1TVEA 1KEUA 3GPIA 4J90A 4QX6A 1YE3A 4GWKA 3C8MA 4RPLA 5JAIA 4TRJA 3JYOA 1YJQA 1YKFA 1XU9A 3NRCA 3OJEA 2VYVD 5EJ2A 3UICA 2ET6A 1I2CA 4F3YA 5L51A 2WD7B 5A5FA 1BW9A 1ZIDA 3DAPA 1GTMA 5THQA 3JQ9A 1DC4A 2GN6A 2DU8A 4GSKA 2VT2A 1I24A 2X0RA 4IQ0A 4KWHA 4ONEA 5DZSA 3KSZO 1RKXA 1H9AA 3WYEA 1ZK1A 1VPDA 1B8PA 3KZVA 5F1OA 1P1HA 3IJRA 4R16A 2QZ9A 4D0RA 3BMOA 4YACA 4F45A 4L4RA 3B70A 3V5NA 3KBOA 2X23A 5I7VA 3JQBA 1A27A 4X54A 4JXKA 1PJQA 5L7WA 1SC6A 4J4HA 3VH4A 4ZQEA 1LUAA 2O3UA 4EUFA 1VRWA 4ZQFA 1ZUD1 2BGMA 2I9PA 3MJTA 5I7FA 4I5FA 1PZEA 1ZO8A 1WZIA 1NQAO 3AW9A 3WMWA 1R4MA 4DYVA 3HE3A 3A06A 1QV7A 3ITKA 2PZMA 4GVXA 2ZYAA 1WW8A 2HRBA 2EKPA 4XGNA 4C7JA 4OSPA 3UCFA 4JK3A 1ZVMA 5TLSA 4ZQGA 1YH3A 4BO7A 1ZMTA 1H2HA 4PLZA 1UJMA 1L7EA 3BAZA 3CE6A 5CEFA 2NM0A 4I5DA 3R1IA 3T4EA 4XQGA 3N7UA 2P5UA 3PGJA 3RFTA 4A7PA 1ZJZA 1KC1A 5IZCC 4RF5A 5A1TA 3S2IA 5LC1A 1E7YA 1BSVA 5T8KC 3SJ7A 2QIOA 4YQZA 5B1YA 1VJ0A 3JQ8B 4YRBA 3QE3A 1YJ8A 2PV7A 1LNQA 3DAFA 4B7XA 1HDXA 1B2LA 3ONEA 3PFWO 2B0JA 4NFYA 3FBTA 5FI5A 1W73A 4D41A 1E1MA 1OFGA 4L0QA 4NJMB 3L9WA 4G65A 1ZKMA 4NH4A 1DLJA 2JCXA 2X9NA 4ND5A 4EZBA 1I3LA 4RV9A 3WQSB 3F47A 4J49A 1LLQA 2IODA 3LYLA 1HDYA 2D5CA 3QWIA 4PZEA 1BMDA 1H2BA 1XELA 3JD4A 1YB4A 1EK6A 3GGPA 3WWYA 4A10A 1HDZA 3AI1A 4NK5A 2YUTA 1E7QA 1FDWA 3VPGA 4HY3A 3ZWPA 4M55A 5DBIA 1JWBB 4UVEA 4KP7A 4BNUA 5JAMA 4M87A 3Q3CA 4CMKA 1KY5A 4YT5A 1SB9A 4NMHA 4YAEA 4FFNA 3PDUA 3CUKA 4JJFA 5JC1A 1X15A 1CQIA 1HEUA 4YR9A 4K9DA 3ENKA 1NWHA 1GUZA 3JQDA 2BGKA 1ADGA 4GPD1 4H15A 4LMRA 2PFGA 3D4PA 3S2EA 4TRNA 5CDUA 3QVOA 4PLYA 3V1YA 3GMDA 3AU9A 3UXYA 1LRLA 6LDHA 1HLDA 5CDGA 2IEBA 2LDBA 3L6OO 3T7EA 1B8VA 4BKQA 1M76A 1I30A 2CUKA 2ZTLA 5LDGA 1C0PA 3Q0EA 4JIGA 4LCJA 3SVTA 1DIAA 1L7DA 1LC3A 1PJSA 4WCFB 4ZD6A 4HNGA 3OMLA 2IYPA 4BGEA 2NTNA 3I1JA 4CM8A 3WJAA 1HT0A 3JQFA 4GBJA 4PFJA 4YAJA 3I9LA 4XDYA 3VVBA 4NFHA 3D3WB 3QQPA 4XZ3A 2J6IA 2RIRA 1IZ0A 2VYVA 3UOGA 4XRGA 5DDIP 2W2KA 1VLLA 5ILOA 3WYCA 4E2ZA 1WDLA 5JDIA 1H6CA 3R3JA 1BRMA 4J16A 4WGGA 4WLOA 4O1MA 1YBAA 3VPFA 1ONNA 1NPDA 2G0TA 2P9GA 2FRDA 4W7HA 2VWGA 3FNHA 3C7DB 3OM9A 4YJDA 1EQ2A 3GOHA 1DIHA 1EMDA 1NAIA 3VKVA 3WFIA 2DBZA 2Q3EA 4J9UE 1UP7A 3EC7A 3DO5A 1DHRA 2WDZA 5KJ6A 3GPDG 3BHMA 1N1EA 1MA0A 3V2UA 1MGOA 3IAHA 4ZJUA 1PJTA 3HUDA 1W8DA 2DFDA 2DQ4A 4BNGA 3GA0A 4UREA 4XYEA 2NVUB 2YDYA 2X5JO 3NX4A 1R37A 2HMVA 2C0CA 4XDZA 2Z95A 2AQ8A 3EW7A 1P77A 1KBZA 2BHLA 5BNFA 5IXYA 1PJ3A 3AM4A 4DA9A 2X9GA 5H83A 2WE8A 5C5IA 2VHVA 3UGKA 1NVMB 3K9QO 3K30A 1U28A 3MEQA 2FSVA 2NLOA 3IL2A 3AM5A 4E30A 4BNMA 4IINA 4W9NA 3PYXA 5JCJD 1PS9A 4P4GA 1LEHA 4CM1A 3ZDFA 2PGJA 1VE9A 3PJFA 2E4AA 4RZIA 3RROA 4GAEA 4EYEA 1P9LA 5A06A 1OZAA 1DOHA 3DOOA 2DM6A 4RL6A 1X13A 5EMHA 3ZV4A 3WYBA 1AHHA 2PKQO 4PVCA 1OC4A 3ADOA 1KYQA 4ZHSA 1YRLA 1E3JA 3P7MA 5GZ3A 4HADA 1B16A 4QXMA 2GPTA 4IBOA 3AI2A 1JWAB 3WGZA 2DFVA 3GUYA 3RVDA 1HKUA 1P33A 4YA6A 3X2EA 4DMLA 5U1PA 5JNLA 1NFRA 1KEPA 1M2WA 3DEYX 3GVHA 2VOEA 4C7KA 4BKOA 4NBRA 4DIBA 4DL9A 1CEQA 1SO8A 3U62A 1YL7A 3R3SA 4B4WA 3LT4A 1MXFA 1I5RA 2Y66A 4HP8A 1T1SA 4K28A 4ND1A 5G0WA 1ENZA 1EVIA 4B7UA 1B3RA 1HYGA 4MP8A 3JYLA 3TDKA 1C1DA 5KJCA 3DZKA 7MDHA 3BMQA 1BWSA 3I6QA 3I4CA 4J1QA 5IZ4A 2FR0A 5DT9A 1OI7A 3KYDB 3O9ZA 3MCVA 5JYDA 4FBGA 3C7AA 5EINA 5KCZA 1NP3A 2BELA 3A9WA 4M1QA 5TF4A 3V2GA 1KVUA 1PL6A 4XB1A 4XQ9A 2IZZA 2RBEA 4CLXA 5KTKA 4PG6A 3CZMA 4MIEA 4OO3A 2FPGA 3B6ZA 2Q99A 1Y5MA 3E5RA 1LDGA 3H8VA 4AJ1A 1KC3A 4J3FA 1ISHA 1AN9A 2NU8A 1XKQA 1R0LA 3KVOA 3OQ1A 5I8WA 1HSZA 3D64A 5EERA 3AJRA 5K9ZA 1H0KA 3WWZA 4IJVA 3C1OA 1LJ8A 3NDJA 4PIVA 3GZ4A 1C0IA 4RVGA 4WCFC 2QG4A 3ITDA 2BFOA 3CSDA 3NTQA 3TWOA 4EJ6A 1X7GA 1OBFO 5EQFA 1B3BA 1Z73A 2IXBA 2X58A 2Y67A 1PZGA 3DZJA 3HSKA 4PCVA 1Q0QA 5EL0A 4BNXA 1PR3A 3OJLA 4R3WA 3VZPA 2RHRA 4WEOA 2FOIA 4IGFA 3UHAA 4WCDA 5JPIA 1J5PA 1DFIA 3ZWNA 5T8KA 5I9NA 4GGPA 2HUNA 2JHGA 1X1TA 5GZ1A 2V7PA 2GSDA 1V8BA 1P1IA 1AXGA 4A5OA 3AM3A 1CYDA 4J1NA 3I83A 2X86A 4G2NA 4Y6RA 2O3SA 3RAJA 3SXPA 4CMJA 3GG2A 4P4LA 1LRKA 5B4TA 1I2BA 4D42A 1NASA 4RPKA 2J3KA 1WNTA 2CVOA 4K1LA 1LDMA 1C0LA 2GO1A 4JX8A 4UVGA 5EN4A 1DSSG 2DPHA 4MKZA 4O0LA 4Y98A 1IL0A 1PWZA 2EGHA 2Q1SA 5FI3A 3H65A 1Q0LA 1C14A 4GWGA 3ZN2A 1Q7BA 3PZRA 1JKJA 1UH5A 3FSRA 1ISMA 4NPCA 1EEHA 4QO7A 3WIDA 3GVCA 4II3A 4KDFA 4HUJA 2OP0A 1BXGA 1A7AA 1NBOA 3BTSA 4HX5A 3VHRA 1HDRA 1R4NB 3WR5A 2X0IA 1HXHA 3HWRA 3ZZNA 2O2SA 3UN1A 1QXSA 1NQ5A 3HADA 5EIOA 3E48A 5CG2A 4YQYA 3KLMX 1SPXA 3L9XA 5JFOA 3A4VA 5L9AA 3H9JA 4XGIA 3W4JA 5ICSA 2EG9A 2AQIA 4FOOA 4RVUA 3A1NA 3OETA 4Q3BA 3JQGB 5L7YA 1BHSA 2ZTUA 4CM4B 4JROA 5JCJA 1IPEA 1LLDA 3R0IA 2PKRA 1ZMOA 2VHZA 5DOVA 4CPDA 4YJHA 2QRLA 2DKNA 3DZHA 3IC5A 3JQ6A 5TJHA 1Y8RA 4AL4A 1ONPA 4KQXA 3VTZA 1VL6A 2GGSA 5A9SA 5F21A 1D3AA 2O7SA 1EFLA 3ZHZA 3G79A 4ALMA 4JJIA 3SLKA 2RH4A 3JQEA 3BIOA 3CZRA 1JLLA 1U5CA 3ZHXA 2HLPA 4NR0A 4F46A 2VNSA 4U7WA 1JKIA 2OZPA 3DZIA 5A4DA 5JS6A 2YV3A 4KUEA 3LVFO 4YXFA 3ZV6A 5EESA 5BQFA 1MX3A 3GGGA 2EXXA 6ADHA 1FDSA 1K2WA 1E6EA 3A28A 3HB4X 3DHEA 2AQKA 1ENPA 3OBBA 4E5NA 1GR0A 4IUYA 2HJSA 4N7RA 3B20A 1GFSA 2VQ3A 1ULUA 5COQA 1UXJA 2D59A 2DAPA 2CVQA 5IDXA 4BKPA 4D44A 1LSUA 1O0SA 3GZNB 4L8VA 3JD3A 1R16A 4PG7A 3V1UA 4OXYA 2JJYA 4RQTA 4XGKA 4RDHA 5G0TA 1S6YA 2BD0A 3W1VA 2EHDA 3EAGA 4UUPA 3E82A 3ZW8A 3KSDO 5TS3A 4FC6A 4WECA 3I23A 3IUSA 3F1LA 1Z6ZA 2HDHA 1H6AA 2O48X 2I66A 1T2FA 4ZU3A 4FSHA 4EEZA 1ZFNA 3K5PA 3VH3A 4XA8A 4OQZA 1U3WA 3P2OA 4DVJA 3IMFA 3NT5A 1P1JA 2O2YA 1SEVA 2JAHA 3AY3A 1PS8A 3ANMA 5TQVA 3VDRA 4CMIB 4CMEC 1QKIA 4GI2A 4IMPA 1LDYA 9LDTA 3P19A 4E33A 5A02A 5JW6A 1QYCA 1VKNA 4MVJH 3TL3A 1ZSVA 1O89A 2VZ8A 3KEQA 3S2GA 1KETA 1LU9A 3QRWA 4CLRA 4RVSA 4LN1A 2W8ZA 3VC7A 5T6BA 1BGVA 3E18A 4BNTA 4XYMA 1PL7A 3JQ8A 5ADHA 4A03A 4BB5A 4KOAA 3I9NA 1R6DA 1JTVA 1GPDG 1ZSNA 5C7OO 4BMVA 4B7CA 2XPCA 2CY0A 5JCXA 4RPGA 4FGWA 2Q1UA 4ZVVA 3U3XA 3DTTA 2I65A 1NHGA 3C1AA 2ZK7A 5BNIA 5KOIA 4RPJA 1YBVA 4NJMA 4RLSA 5IF3A 3PQEA 3AUUA 3COSA 4FC7A 1PGNA 1SAYA 4XYBA 1WDKA 1F12A 3N74A 3C24A 2GR9A 4DBZA 3E1KA 3O4RA 2BLLA 3TZ6A 3V1TC 4ND2A 4DC0A 4PG8A 1EZ4A 3HN2A 4PLFA 2BKAA 4AJPA 4PGFA 4DQUA 4EUEA 1X14A 3DBHB 4JP2A 2ZCUA 3F3SA 1U1IA 3GK3A 4QECA 2YJZA 2C2XA 3H9GA 1UZLA 4RJTA 1ARZA 3SEFA 3PHJA 4U6QA 2I67A 4WPGA 3OJ0A 1HZJA 5ER6A 1HF3A 1B7GO 1WMAA 1Y8QA 2GASA 1RWBA 4E5PA 2UV8A 4MP3A 2YHUA 1HLPA 3I9KA 2YZ7A 4MINA 4UVIA 3AUAA 4D3DA 4XYLA 4OKNA 3CMCO 4XJTA 2PTGA 3Q1LA 4IXWA 4B3IA 1Q0HA 2OXIA 1H6DA 4MVJP 1E1LA 3PVZA 1LA2A 1PL8A 1VSVA 4BNZA 1WDMA 2R00A 1YQGA 3D0OA 5K0ZA 2UVDA 1C1XA 1KVTA 2EEZA 3QWFA 3PJDA 1H9BA 5JSFA 4XX0A 5JBIA 3FWZA 1RM3A 2VWQA 2XAAA 3DBLA 1P45A 5JC8A 3PXXA 2C2YA 1O6ZA 1TT5B 2VHXA 1EQUA 2FY8A 1ML3A 2JD0A 1I10A 4A73A 4U0KA 3BHJA 1O9BA 2Z1NA 2O4UX 5F1KA 3KOUA 1PJ4A 2D1YA 2O7QA 3D3WA 4CQLB 3GF4A 3NDRA 2FSSA 1UXKA 4Z0TA 4E2XA 2EGGA 5HWSA 4IIVA 3SLGA 3CEAA 3H3JA 4GX0A 3EHEA 1ZJYA 2X5OA 3WX0A 1I3KA 2I3AA 4JBGA 5JDCC 2BFAA 3VKUA 1C3VA 1GCOA 1P0FA 4MVJE 4IDFA 4P8RA 5KJEA 3RWBA 2AEJA 4PG5A 1AHIA 3KRTA 4CLHA 4FR5A 4FIZA 1Q1NA 2CVZA 5MGBA 3BZUA 5DP1A 3KYCB 5G2OA 4QT0A 1KERA 3INTA 3FBGA 4WOKA 2C29D 2O3QA 4IZHA 1OMOA 2NVUA 4DQVA 1UP6A 5FWNA 4YDRA 3WNQA 1KY4A 4A2CA 4R69A 1DJNA 3UW3A 5HRUA 2QRKA 4EJ0A 1GYPA 4HWKA 4M89A 4M54A 2QHXA 1PIWA 1SMKA 2DT5A 4OHUA 4BNLA 2P4QA 2GNAA 5KJFA 3D4OA 4FQ8A 2QQ5A 2EIHA 4FGSA 2UAGA 3TZHA 3WGTA 1P1FA 1D8AA 1E6UA 1B15A 4KTVE 3ZHYA 3EK2A 4CL8A 4FD3A 2A4KA 1YL5A 2WM3A 3AUTA 1TI7A 4NU6A 5AOVA 3OA2A 3H2SA 2HSDA 1N5DA 3DR3A 3U9LA 3LT0A 2X9VA 4XCVA 1MFZA 1TT7A 1EUZA 5COAA 2Q45A 2FMUA 2OUIA 4IS2A 2X1HA 3V2HA 2BH9A 2YHIB 5A05A 3CMMA 1D7OA 2H6EA 4J2OA 1YOVA 1IHXA 5AXDA 3GNSA 3NTOA 1HE2A 2HKIA 3TOZA 3QJ5A 4BL5A 4XR9A 1DC3A 5L4LA 4M49A 4MVJM 4II2A 4R9RA 2G76A 3ZU5A 4BMSA 3WGIA 4ZICA 2I5PO 4RF2A 5F5NA 1E3WB 3PGXA 5IAAA 1DBVO 1YDWA 4PZDA 4EW6A 4Z6KA 2NU9A 4EITA 3GHYA 1HRDA 2E6UX 4J4BA 1LSJA 4ILKA 3WLFA 1TLTA 3AOGA 3ADPA 4QO8A 3TFQA 2EP5A 1KVRA 4WE3A 2AW5A 1GU7A 5A04A 2Q4EA 2DBQA 1YGYA 1HTBA 2O50A 3TL2A 3FD8A 2V6MA 3MWEB 3OJOA 4E12A 1BDMA 3RQSA 3LC2O 3TSCA 1ISFA 3F4BA 3WNVA 5KVSA 1GDHA 2AE1A 1ENYA 3UF0A 3KYDA 3ZU3A 3HB5X 4WK6A 3W8FA 5L3ZA 1N1GA 2AG5A 4ALNA 5IN4A 4R54A 2JL1A 3WGHA 4NHEA 3PWSA 1T4DA 3HG7A 4KZPA 4AG3A 1FDVA 3H5AA 1K6JA 4MVJD 4YCAA 3GNTA 1VJ1A 1LSOA 4YJGB 1YVEI 2ZB3A 2Q2QA 4CLDA 1J49A 5KVCA 4P38A 3C7CB 2I3GA 2ZATA 1Z75A 3PQDA 5ENVA 4AVYA 4CM6A 4GH5A 5KKCA 3RCBA 3ZV3A 3GY0A 2VOJA 2GN9A 5L4SA 2QYSA 2WSBA 4I5EA 1GL3A 2FP4A 4UVDA 4CMEA 1HE3A 1E3EA 2QW8A 3DBRB 4DPKA 4WJZA 5IN5A 1K0UA 1JW9B 1MG0A 2RAFA 2CMDA 2IXAA 4BNIA 3MTGA 3SC6A 3QLJA 4BO0A 3BHIA 1KOLA 1XGKA 1RYDA 3F5SA 4IPTA 1GADO 4LK3A 4XRRA 3QVXA 3HNPA 3ROQA 5CDSA 1SBYA 3TFOA 3WG9A 1IY8A 3LU1A 2RCYA 1IUKA 4GLOA 1W6UA 4FDAA 4PLHA 1VM6A 5C7IO 3MJSA 5CG1A 1JAYA 4YB8A 3ULKA 2JCVA 3U09A 3QWHA 3ZNNA 1T26A 3DMTA 5JE8A 2Y05A 1HZZA 5ILGA 2VUSA 2X5KO 1ZXBA 5BNTA 1GV0A 1UDBA 5AYVA 2DC1A 3HQ4O 4CUJA 2ZJ0A 1YWGO 3HDHA 3PJEA 3GVIA 3Q6IA 2VTEA 4KDEA 5F5LA 2ZCVA 4CR8A 3IDSA 2Y1DA 4LVUA 3I52A 2DTEA 3HFGA 3BMCB 1Y9AA 2IZ1A 4GX1A 3ZU4A 4GVLA 4CM3A 4R1SA 5DP2A 3AOEC 1PTJA 4WEQA 4B4UA 1T2EA 3RBZA 3JQ7B 4PN3A 3PLRA 3D7LA 4GMFA 1NXQA 3RIHA 4IMRA 1Q2XA 3V8BA 1XQ1A 1R4NA 2YYYA 3E5MA 3G1TA 3LF1A 2J3HA 2B4QA 4DUPA 1EE2A 1MC4A 3ON5A 1HYHA 5HTOA 3ETEA 1ZK0A 5BSEA 4JBIA 1RYEA 2ZJ1A 2HAEA 3WGOA 4FFOA 3FHLA 1PU2A 3QWBA 4BNKA 4JP3A 4G81A 1N7GA 4RVFA 3JQGA 4FW8A 3EY4A 1GEGA 3WDSA 3FN4A 5I8ZA 3QSGA 4XB2A 4E21A 2ZB7A 4D46A 5IDYA 4Q3DA 1NX6A 3DWFA 4IQGA 5ES3A 2PA3A 1ORRA 3ZWCA 2PNFA 1DIRA 1GPJA 2J3IA 2OFPA 3K96A 1FK8A 5L4NA 3WJ7A 1T4BA 1PZFA 3DAGA 5LDHA 1H94A 5B4UA 2VYND 1U4OA 3HJAA 3L6DA 4EUHA 5F3RA 4FN4A 2Y0DA 4I5GA 1BW9B 4N5LA 2C20A 1CF2O 2FWMX 3F6YA 1ZEMA 3STHA 2EWMA 1UZNA 4DWVA 1P1KA 2Q4BA 5CAEA 2Y1OA 3NKLA 3RASA 2C82A 3CIFA 2E37A 1Y81A 5BSFA 4Q39A 1FDUA 4BNYA 1F17A 3AUSA 4QQRA 1DFHA 3PHLA 4IDAA 2W4QA 3R6DA 4ZRMA 5JDCA 3WMXA 1LX6A 1NM5A 1N9GB 3RUAA 4AJIA 3RU7A 2OORA 5G4LA 2GLXA 4HFJA 2OOSA 4FJ1A 1PGJA 3SX2A 4HFRA 4PRLA 2W90A 4YWJA 2OP1A 1A71A 1E7MA 1U3VA 4CMHA 2PZKA 2H5LA 1B0AA 1YL6A 1P31A 1E77A 2F00A 3GZNA 4PLVA 4PLPA 3ABIA 4R68A 3FTPA 2EP7A 4NBVA 1HWYA 2J3JA 4FFMA 7ADHA 5AXAA 1DC6A 4MVJA 1WZEA 4Z9YA 1E7SA 3RKUA 1UXIA 4LW8A 4D45A 4Y6SA 5TJ9A 3PIIA 2Q49A 4NBTA 4YAGA 1QSGA 3WBBA 4XKJA 4BVAA 2X22A 4EJMA 5FEUA 1T24A 3G17A 1LI4A 4GKBA 2ZTMA 4CLOB 2Q50A 4HKTA 1DC5A 4CODB 4J43A 5DOZA 2B36A 1Z82A 1AUPA 1MC5A 3K8ZA 2GYYA 4Q3AA 4YPOA 1A4IA 3PZBA 3K2BA 3PEFA 2AQHA 5TIIA 4O63O 1ZEJA 1IPFA 2DBVO 4RDIA 2A9FA 3H7AA 5L95A 1G0NA 3DL2A 3Q11A 4YJFB 3WSWA 4CV3A 4L74A 3PYLA 2B5VA 5L7TA 4QFCA 3LZ6A 3RUIA 1A5ZA 4BKRA 3SC4A 4ZN6A 1H6BA 1XIVA 4QUKA 3IUPA 2GZ2A 2POQX 3TZQA 1K3TA 4KUGA 3ZWVA 4WKGA 1RJWA 1UZMA 2Z5LA 3B1FA 4AJOA 4TKMA 2WJPA 3JD0A 3TF5A 1P1RA 5IZCA 4WASA 4B4OA 3AU8A 3ROPA 1HE4A 2O3JA 4OM8A 3RJ9A 2HJRA 4L9RA 2Y0CA 1VL8A 1EVYA 3HZZA 2LDXA 2DTXA 2HMWA 4FFPA 1PJCA 2YV2A 3WGYA 3TRIA 3BMNA 2JCYA 3DXFA 1GD1O 3PI7A 4R9SA 3ICCA 5HS6A 3GH3A 3DBHA 3OQ6A 2WMDA 2J5KA 5BSGA 3RFXA 2ZIZA 1NHWA 4BHTA 1Y1PA 2P68A 3KEOA 2JFGA 4D43A 2EJWA 2JFHA 1PEDA 2PLAA 1ADBA 2D2IA 2EW8A 5G0VA 5I7SA 4J7XA 3U4DA 3W6UA 3U49A 4PVDA 5IDQA 5T64A 4TVBA 4ZA2A 3ZWMA 2IDZA 3L4BC 1NPYA 3VH1A 4BO1A 2W2LD 3ETDA 4E0BA 3LQFA 2FPPA 2CD9A 1X0VA 2X4GA 4DLBA 1YONA 1GAEO 2AMFA 2XXJA 3DTYA 3OIFA 1O8CA 2G5CA 1KIFA 3RU9A 5A03A 1BDBA 5KKAA 3PK0A 1JDJA 1U4SA 5B12A 4I8XA 1A7KA 3U4IA 2JD2A 1GUFA 2B5WA 2CF5A 3LT2A 1M6HA 3W4IA 3OEWA 1B8UA 4NU5A 4ESOA 3GC6A 2VYNA 3A14A 1MXHA 2PR2A 4LRTB 1I01A 3LT1A 4AJLA 5U9CA 1GQYA 4BV9A 1KS9A 1JVSA 2VRBA 2W2KB 1U8FO 4HFNA 4R01A 4BOYA 3FNFA 2H1SA 5JY1A 3DZGA 2P91A 4JJGA 3NAQA 5HM8A 2O4CA 3WICA 3KB6A 3B1KA 1KVQA 5L53A 4J0EA 3PQFA 1BXKA 3T4XA 2WTBA 3GEDA 4DRYA 4TMFA 4J9VA 2JFFA 2VCYA 1V3UA 1NWCA 1ADFA 2EF1A 1XG5A 1NNUA 2C5AA 2VT3A 5G0SA 2E48A 3PRJA 1CDOA 4MJLA 2C5EA 3ZWYA 3ZV5A 4IJUA 3KETA 2GD1O 4BS9A 4D0SA 3BA1A 1UDAA 4H7PA 3JSAA 3JTMA 4EEXA 3QHAA 5FYDA 5AQ1A 4IJWA 2D4AA 5DULA 2Q46A 4I08A 4L75A 1E1NA 3ZWXA 3AOEA 1I3NA 3RI3A 1LRJA 3VZRA 1M75A 2WD7A 3VAZA 1ZNQO 1ISJA 2ZTVA 4UUNA 2OBYA 1HE5A 4RVHA 4J1SA 5C37A 5IDWA 2DPGA 4TZKA 3L77A 4CL3A 3DHNA 5TT1A 1BVUA 1BXZA 1ID1A 3WB9A 1E7RA 3GFGA 2D0IA 2BI7A 1BVRA 3OIGA 3W8EA 4CLEA 5ENDA 2PZLA 4Z3KA 3RJ5A 4E31A 1JU9A 1QYVA 4LVCA 4K26A 4NFSA 4D3SA 1EFKA 4N5MA 3M2PA 3ANLA 4EDFA 4QEDA 3S8MA 2BGLA 3QY9A 5COBA 4FJ2A 4GQAA 4OMUA 1ZBQA 1G0OA 1T25A 4LCEA 4Z0PA 1OAAA 1VI2A 2HK7A 2YHIA 3RKRA 4I1IA 3F4LA 1FJHA 3OF2A 1WPQA 4RF4A 4ALJA 1LQTA 1EVJA 3EDMA 5HA5A 1M6WA 2V6FA 2B4TO 1O94A 1NR7A 4YAIA 4OL9A 1UR5A 4A0SA 1E7WA 4E4YA 3ZWWA 4TQGA 1IULA 1E3WA 1I3MA 1XDWA 1X7HA 3CPSA 4XQCA 3FCOA 3NT2A 3S2FA 1NR1A 2VHWA 5AXBA 3VZQA 4BNJA 5A5EA 3BMQB 3FWNA 1IHYA 1GZ4A 1SOVA 2P9EA 3K92A 3MJVA 4DMMA 3QW2A 5JMPA 1AGNA 5DF1A 1DPGA 2J5QA 2HQ1A 3JV7A 1E0DA 3U4HA 1QG6A 5CEJA 4BB6A 3JQAB 1U2GA 5LCXA 1RM0A 3W6ZA 5TSDA 4BO6A 4RO0A 4AJ4A 1NQTA 2CNBA 3ZWAA 4MIOA 1U2DA 3NJ4A 3VPXA 4R1UA 5TNXA 3RUEA 1DB3A 3OQBA 2AHRA 1CETA 4CMGA 3VDQA 1V6AA 3KUXA 4B8WA 3UUWA 1QORA 1F8GA 2W2LA 4S1VA 2Q1TA 2Y1EA 4J2HA 1VJTA 3KM0A 5BT9A 2TMGA 1QYDA 2DVMA 4ALIA 3UAGA 1PX0A 5DCWA 4XEHA 1JVBA 3DONA 1V3VA 4YRAA 2Y99A 4U0JA 1MV8A 3PHIA 5G4KB 2QRJA 3VVCA 3W4KA 4RCVA 3ASUA 4GSLA 1XWFA 4FCCA 2C54A 5JAZA 3TZCA 4NK4A 1QYXA 3L0DA 3CINA 4G5HA 3SJUA 2E82A 1K89A 1XSEA 2FZEA 3IOYA 1SZJG 1HDGO 1SNYA 3G49A 4TWRA 2FZWA 2DLDA 4NG5A 3CTMA 4W82A 1IYZA 4MDHA 3RFVA 1K6IA 3Q2IA 4UEJA 2E49A 3DB2A 4LRSB 4WLUA 1JN0A 4EI2A 3GT0A 1H5QA 2O23A 4CJXA 1RM5A 5JAQA 1LLUA 1QMGA 1K5HA 1JQBA 4PZCA 4WCFA 3WQRA 4BV8A 3E8XA 3PHGA 3ZWOA 3D4NA 2BI8A 1ZK2A 4M86A 4PRKA 1BXGB 4BNVA 4O59O 1ZZEA 4JGBA 3IQDB 4HBGA 4WLFA 3DOJA 1G6KA 2EW2A 4FS3A 1YB1A 2A94A 4HXYA 1GQ2A 3BYZA 1SEPA 1K6XA 3JQ7A 1LQUA 4XYGA 3VTFA 4AJHA 1YQDA 4O6VA 2Q2VA 1QYWA 3I9JA 4XD2A 2Y93A 1NTOA 3EZLA 4W9NC 4E2WA 3JCZA 1CIVA 1GUYA 1N2SA 3NGXA 4MPDA 5I9MA 2GERA 2NACA 1PQUA 3RUCA 4TZTA 4F6LA 1T2CA 1Y7TA 3O03A 3MJEA 5ICMA 4WLVA 2D3TA 3ZH2A 4GX5A 5C7LO 1WXDA 1Y9EA 2PH5A 2EJVA 3I9OA 1UAYA 4DBVO 3U0BA 4R51A 3FPCA 1TB4A 4NBWA 5A9SB 5IFLA 3GN2A 2GZ1A 1MFPA 4WUVA 2IRWA 1QV6A 1NPTO 1VL0A 2VN8A 1PZHA 3FF4A 4RF3A 5KJ1A 3NDIA 3P5SA 2DBRA 1NQOA 1DLIA 5HBRA 5KVVA 3DOCA 3E9MA 3WIEA 2I6TA 4M8SA 2QYTA 2GN8A 2J5RA 4W6ZA 4IIUA 4CM5A 2AG8A 2C59A 3AK4A 5JXWA 1LSSA 2Y1FA 3H3FA 1BTOA 2DUWA 3TQHA 3PIDA 4R3NA 2NADA 1QP8A 2ZQYA 4R5MA 3GGOA 1DXYA 4KUHA 4Q3NA 2X7HA 1SB8A 3EZYA 4L76A 1XLTA 2ZKLA 1Z7EA 1EUDA 3AI3A 3KSUA 4CQMB 3I6IA 4DPLA 1ISIA 3IKTA 2JKVA 3CKYA 4OOFA 4IDCA 2YFHA 3MOGA 1CERA 1Q7CA 2PWZA 3O8QB 5THKA 3WXBA 4YT8A 1R0KA 4OXKA 4RORA 2IE0A 1UXHA 1AE1A 1R15A 2YFQA 3DFZA 4RZHA 4B8ZA 1N9GA 4I9HA 3L4SO 3GFBA 4GX2A 4OH1A 1QR6A 1CJCA 4BGUA 4Z9FA 1HETA 4C4OA 1CQJA 1JAXA 1W0CA 1XA0A 4JN6B 3INGA 3F46A 1JKFA 4IXTA 4UUOA 3MZ0A 2RH8A 2O3RA 3M1LA 3NTRA 2EERA 1YQXA 3I9MA 3F9IA 1P0CA 1VC2A 5ITWA 2WYVA 1ULSA 3OICA
chains in the Genus database with same CATH superfamily
2CMFA 2PWYA 1E3IA 3ZKWB 3RVOA 4L4UA 2WWYA 1TUBB 4ZYUA 4IVPA 4PXAA 2Z9CA 2B9EA 1M67A 3H8JA 2JFZA 4BLSA 2NV6A 4CNBA 3QYJA 3H75A 1TU3A 1N2ZA 2HMTA 2WFZA 5FP0A 1YBMA 1TD9A 5HDBB 1QIJA 4KVFA 2HIHA 3OP4A 3H2YA 2CNOA 1KRHA 1IUOA 5CPFA 5EJ6A 1U5BA 4CDMA 4CLRB 2JIZD 5JXJA 2BGIA 2VP2A 2L19A 5EKSA 4EO7A 1KZ7B 2RKBA 4PC7A 4RD2A 1XHLA 3OZFA 1FXSA 3KZ1E 3PYMA 2G71A 4G0ZA 3C48A 1NLZA 1AF4A 1IQPA 2IC5A 1UMBA 4IDOA 1L5NA 3UIEA 3KB8A 5FFFA 4UE2A 4HDCA 2SCUB 1EVZA 1TJ5A 3QIVA 3WBJA 4BRZA 2MYNA 5ALPA 1E4EB 2CFCA 1FP6A 4C6SA 1JZQA 4YJFA 4ZK2A 2PQMA 1N3YA 2FN8A 2AV6A 4MWDA 5IVIA 3ZTYA 4HDMA 2HLHA 2CCKA 3LZCA 2A3NA 3ILYA 4Q4JA 1KS2A 4TLEA 3ZLVA 3JAMA 3B6EA 1U8XX 4IDBA 4Q1EA 3J81k 5FB3A 1D9ZA 1O0CA 1HTWA 4M0FA 1AM4D 2B7LA 3NNDA 3TZKA 2FN3A 4ENWA 3AVWA 5AWFC 1RWOA 5KHOC 3DDNA 2YBDA 1HLFA 3DC7A 4OIMA 1D04A 2VTDA 2QNIA 2GN4A 3R40A 2C4MA 2I4RA 3MS7A 4KB5A 4DUYB 4NCAA 2EHJA 3EGXA 4GZMA 4RU1A 2I78A 3CN7A 5IWCA 2PQ2A 4EH1A 5K6AC 5FF9A 3IQZA 4H6VA 4QL3A 1NIJA 1X9HA 2HMUA 5F64A 2ATEA 3O4VA 1Z0UA 2QAIA 3RIMA 3U44A 2CV0A 1XCBA 1RRMA 1OBOA 3K1YA 4RSMA 1JFFB 1I2ZA 3AEUA 3H5RA 4L8YA 4CG1A 3JQCA 3AB3A 5BVGB 1D1TA 1RLJA 2G7MC 1RE0A 1UJ2A 1EFVB 3BBPA 2IP4A 2QTFA 3C5CA 4PQGA 1JHAA 1T4CB 1NN0A 1CY1A 3VYVA 3EXFB 4D3YA 3I30X 2R6AA 1XYGA 5ELLA 5REQA 2HU5A 1LV7A 1NFFA 1SD1A 2YQ5A 5FA8A 2NSLA 4TV8F 3WBFA 2VRCD 3WWPA 1F14A 2BOVA 3LNTA 1T6YA 3FAKA 3DT6A 3Q87B 2DQYA 2QZSA 4INAA 2QN2A 3QLUC 4LSWA 2DHDA 3UXEA 4KPUB 1FLVA 2P9CA 4NPHA 1T1RA 2XMZA 1CJVC 2RHMA 3DBVO 3VC2A 5JBQA 4M9ZA 1OXBB 2QMYA 1AZLA 4EHNA 1M2VA 3GUZA 2XUIA 5F1PA 1H2ZA 4LJRA 1N8NA 4KFUA 5BR4A 4WXPA 2NSJA 1U02A 1P0MA 4XM1A 1ADJA 3D7RA 2V3VA 3T7CA 1EM8A 1V8PA 1Q1AA 1W6RA 2H1VA 3LAWA 3H9EO 4DT1A 1S1MA 5B2FA 4B2YA 5DN6A 2E0IA 4LF4B 3JVEA 2BEUA 2YXPX 5EWJB 3VDXA 3EFOB 3IO5A 2ZWIA 2XOKD 4MB2A 2YWGA 5TGDA 3QEMA 4CM4A 4GYJA 1S7GA 1P4AA 3KFXA 4DEXA 3ZWDA 4DIFA 3PWKA 4D80A 2IEIA 2ONCA 2XZDA 1T0PA 4B09A 1XNQB 1ZVQA 3C7TA 5BRNA 2ZE6A 1Z7BA 2AXPA 3CO5A 1HYBA 1J06A 3D8SA 3KDSE 2B35A 1ZK4A 3B9BA 3I58A 5KNDD 1RWVA 2II6A 1REQA 2PZAA 3A2LA 3L1JA 2DECA 1YS6A 2PHZA 3PPWA 5T4HA 5A4MS 2NQ8A 4I9UA 3NIWA 1DCKA 2XUGA 3P5BA 3R3VA 4XVCA 2W2QA 2G82A 4KLNA 4EB8A 1LNSA 5LU8A 4NABA 3PENA 5D2CA 1VLVA 1N78A 3SMQA 5GVRA 1I14A 5JOQA 5B7NA 4R4JA 4OQYA 1NYLA 5C34B 1QNFA 4P98A 4PPFA 4V38A 3FTDA 4CKCA 1QIMA 2A14A 1XWWA 1G60A 1FQJA 2PEZA 1ZRMA 2F9LA 1RWWA 3R5KA 3NPAA 2VQEB 4KQHA 3JASB 2C98A 1YR9A 3PC4A 4TS9A 5F2NA 1V3QE 4KCGA 4Y67A 2HSJA 4LDNA 4BLRA 3S2SA 5HIKA 4Z3DA 3H4MA 1P3DA 2WF7A 4NZ9A 2AE2A 1E1CB 2I4NA 1GYQA 1QHXA 4IDEA 3UJPA 2R6ZA 1W4AA 1YV9A 4M83A 4BN0A 4BQRA 3EF0A 3HDQA 4TMYA 4EX7A 2C07A 5TT0A 1BMTA 3GA5A 3ZNOA 1YQ9A 3VI3B 4HFMA 3DFUA 3SJBA 4H77A 2GDJA 1XAJA 3JYHA 1CJTC 1N1DA 4RPIA 4W7IA 3WGVA 5HKBA 4KIUA 5KPDA 1VKOA 2R6GA 2YYAA 4ZQIA 1JXMA 1LTHR 4JMLA 4N54A 2OGUA 1J00A 1IHPA 4E5KA 3W2IA 2VPTA 1OWPA 4E13A 3HDTA 1F8XA 1H1TA 3W3ZB 1LLCA 2WJVA 1EB9A 3I2IA 1A9YA 4K5QA 4GNRA 3OT1B 4KK4A 2F7SA 1YKGA 3T3HA 3GVXA 4C0XA 2IGBA 2MDTA 3LPMA 3MAGA 5EHZA 3GYBA 1HQKA 2EKQA 4MVJF 2RHOA 1E5VA 1YZNA 2CLDX 1VYUA 4KQWA 5DCLA 2XNCA 1ONOA 3I0ZA 3SQNA 1MQSA 1I8TA 2WPDD 4GYKA 5JCOA 3AHHA 3EMKA 5BUSA 1QU3A 4MNTA 1GV1A 2FXVA 1I32A 3G9UA 3OZVA 1ZESA 1F4LA 1QHFA 4P81A 3ZQKA 4XX1A 5AI0A 4NXNB 1Q1QA 3R7AA 3GJ4A 4J7CA 5FOVA 4D99A 1YZUA 5CP8A 3HVUA 4XH9B 4FKZA 4OIFA 3L6BA 2E9SA 4KMSA 2AN3A 2ZJ4A 1N7HA 1TUEA 3AHGA 1A2KC 3UKOA 1M1YE 2W8BB 1TZCA 2NSDA 2IUUA 2F8TA 3FG9A 2R6CA 1KEWA 5K0FA 2NTJA 3TPFA 3W2HA 3ZI0A 3HBJA 1SXHA 3PSAA 3U16A 2R66A 3OTOB 3C3XA 4CQMD 4C7BA 2WSIA 3HS3A 4Q1CA 3RS4A 5LDDC 2JH8A 2EJBA 4BIIA 2ONZA 4ARZB 1UUFA 3LI2A 2G9UA 3CEHA 4WHMA 2Y0PA 3QM1A 1S3GA 3QVJA 2YVQA 3GIWA 2C2OA 3ZE0B 2Q0XA 4URHA 1SUSA 3HXTA 4LZNA 4OYRA 2XB6A 3IVCA 5D1HA 1J4AA 4CMCA 3KYBA 1WVGA 1I7NA 1UT8A 3UNXA 2VBIA 4KWIA 2B4RO 2YJ4A 2R2GA 3C98A 1VHTA 1D4FA 2R6JA 3BIFA 4ZRNA 2NNLD 3N3BC 1AKQA 1IPHA 3GMIA 4OXNA 3FOAA 2IU3A 5D3MB 1YDEA 4YAKA 1QUFA 2ZSEA 2OBNA 2AJBA 4GRDA 2B1RA 3TBFA 1DEHA 2D2FA 4Y0NA 3L7OA 5CT6A 2YV4A 3WLNA 3NHLA 2XE6A 2HQSA 5CH5A 3E9QA 4ENVA 2GAAA 1L5MA 2IOFA 1BHQ1 3ER6A 3PCRB 2QN7A 3OEHA 2HQOA 1CRZA 5DKFA 3MPOA 5IUKC 1T9HA 4WXHA 2AN9A 1D2MA 2WFLB 2DUUA 1J0DA 2E6KA 1MG5A 3GT7A 3IFSA 4JQSA 4K9MA 3RGWS 4C1BA 4B3HA 4RY0A 1N6IA 4KSBA 3ZI4A 3IP3A 3DUWA 3DP7A 4C7VA 5CYPA 4B82A 4BX9A 3IDQA 2B8WA 4P08A 3E7XA 5LQDA 4P4UA 4P4SA 1LK5A 1JEOA 1XTIA 3JATA 4I0WB 5GONB 2P8SA 2GX6A 4YJ3B 4F2PA 2EV9A 3PTZA 2I8AA 1MT3A 4HDKA 1PGOA 1IN7A 3P2KA 3AXSA 1ZW1A 3BTVA 5JLAA 3OKCA 3CJTA 2A3RA 4EQ6A 4N03A 4JEIA 4QFMA 2X6TA 1X1EA 3TM4A 3B9QA 2H4ZA 3KXDA 5AK3A 3W0LB 3I5AA 4JP8A 3X1XA 5JCPA 3O21A 2BKXA 3N28A 3MTDA 4FI3C 1KWGA 5JROA 2JG3A 2ZREA 2ZBQA 2Z3VA 3KJZA 2AYYA 2AA3A 3A3YA 1W4LA 2FB9A 2J46A 1MW9X 2PX4A 2ID9A 1UBJS 4G1MB 1HDCA 4M0UA 1Y3CE 1YUMA 4MV0A 1QGOA 4DZTA 2YX1A 3H2ZA 3AFMA 2CDBA 2Q5IA 4QPNA 5DGXA 3S1LA 3NS7A 4YGXB 1B8OA 1PKXA 2CDAA 1II8A 1RCFA 2NU6A 2OECA 3NBYC 4IZIA 2XMQA 5FADA 3U80A 3ZHSA 1EVQA 2Q5EA 2EFYA 5EMLA 1TT5A 3L06A 3L7MA 1M34E 3TUJC 4FONA 2XB2A 2VHYA 1XJWA 1NIPA 2VJMA 3MJCA 3SBDA 2G4LA 4CQLA 4Y6GB 3HA7A 2JIBA 3FR8A 1LS6A 3SQDA 5EWLA 2REBA 1H93A 3DE5X 1NZDA 2C1EA 1GPKA 1G3MA 4PTLA 3M3DA 4PG4A 3ACDA 3AF1A 2P1ZA 1Z0AA 2GF2A 3LECA 1SKQA 1GP2A 1EXWA 3SBOA 4AYWA 2Q6LA 2IH2A 3RC9A 1A95A 4A0FA 3MINA 4INPA 1GTRA 2H1IA 2PRJA 2ASVA 1NY5A 3JQBC 3G0DA 4UD6A 1QQ5A 3RSHA 5FBVB 1V6SA 2JGKA 3IS3A 4I1VA 4DGSA 2IDJA 2HFKA 3HXPA 3RUFA 4KR2A 5LOVB 1SBNE 1SCUA 2QU8A 3GFTA 5JSUA 2NZUG 2N1BA 3KYCA 1U3TA 1BGXT 3P0HA 1Y37A 1T3SA 4R7GA 4R6WA 1E9VA 4ZZIA 3O7MA 4WXYB 4F2HA 1W87A 4M7WA 3ADBA 2FE4A 1R66A 1KOFA 1PT9A 1PDOA 2BHSA 3LGSA 4IDDA 4RTMA 3FXAA 1E2KA 3RK1A 3AETA 3QH4A 2AFRA 1MKYA 1QCCA 4DCPA 2GZSA 2VPQA 4AUKA 2PUCA 2ORVA 4YEDA 3COPA 4B8YA 2QN9A 3MWDB 5IS2A 3BEOA 2XF8A 4PANA 3OIWA 4Q3KA 1J42A 4KBGA 3WL7A 4EPYA 4WFIA 4BQPA 1T6NA 2DJ5A 5SY6A 2HMSA 1DX6A 4IEEA 2JFWA 2WEKA 3ZBPA 5KSWB 1O95A 2NT4A 3CSSA 4L5IA 3ZU6A 2CZCA 2J48A 2IPLA 3ZUPA 3OA0A 3CGGA 3EMDA 1R8QA 4HNAA 5T4EA 5CFRA 3GRPA 3CNOA 4ZQHA 4Z4GA 3EGEA 3V1KA 3QJGA 1M10A 3O8RA 3FYUB 2PWPA 4P31A 4ZDKA 1AHPA 2FMKA 2B8EA 3BZWA 4R8VA 1L3CA 4EENA 3I3OA 5A1JA 2R85A 2FMFA 4ALJA 4UPEA 3M81A 4K9RA 4IV5A 5EZSA 1JB9A 4ZT6A 1J0XO 2WWFA 3CZ9A 4OPMA 5T5QA 3ME5A 4DA0A 3IE1A 2O1WA 3V6LA 2H65A 3QF4A 1G5FA 4ZEWA 5FO0A 5DE3A 4TKLA 3BE4A 3EWIA 1KEVA 2A9VA 4IQ8A 4AP6A 3KU4A 1OC2A 2PH1A 1IBKB 3DFFA 2AFHE 2BVNA 3A0UA 4HWGA 1C9EA 1KL7A 4BLOA 2RGRA 1E2QA 1QLHA 2XIJA 5CB4F 2WWVD 2HBQA 3RF6A 1E2MA 1XAIA 4MJ7A 3BH6A 2AZDA 3ILHA 3GDHA 4DB4A 3SZOA 2FLKA 4XIGS 3GRKA 3WADA 4PLCA 1ZRNA 4P2GA 5DGDA 1KAMA 2KS6A 3H1TA 3MCUA 4LBYA 1RJ9A 2GDZA 4PLWA 2GCOB 3I72A 4O25A 3RC2A 3BGOS 3WDKA 2ZJZA 3HMQA 4QBFA 1T2DA 3IX7A 3QVSA 1L1QA 3PWTA 2UZ3A 4V2IA 3LQ4A 3RYFA 1X1QA 4RH0A 5IBCA 2Y6UA 1AUXA 4YTEA 5EHXA 2PO7A 2A67A 4I9NA 2B7BA 4KQGA 5BSRA 5JYEA 5IC6A 1RQ2A 2PX8A 2GZ3A 1XYYA 5EE1A 3WB2A 4L5YA 2VJQA 3L3BA 4XI9A 1E2BA 1DJOA 1UBUS 4UAVA 2C96A 4GR5A 4AWXA 5CD1A 3C70A 4KR3A 4Q4HB 3Q88A 3BFXA 4WN3A 3WMRA 3AZPA 1NTRA 4LTNA 4DA7A 3ONFA 4Y2JA 3EYWA 4EF6A 1H22A 2RC5A 4CIWA 2V6JA 5KOJB 1RC1A 2VO1A 2GK6A 2SKEA 3GJ5A 1C9NA 2AZTA 4BO5A 4C3ZA 2GPYA 4UNPA 4HN4B 2FPGB 5HQJA 3H5NA 2ZTSA 1AQUA 2QRPA 3FCYA 3AFNA 5EJIA 3SMVA 3T35A 3T9BA 5KMGB 2GYUA 1A8IA 5CCEA 2CVPA 4GLLA 2BFMA 4GZ3A 1GRVA 2JD1A 4LMPA 2WWRA 2Y1XA 1ESDA 4JBHA 2GUGA 1D2EA 4OJKA 3L2OB 3DZBA 4AJKA 1EDZA 1Q50A 2EYUA 2OCGA 4AKTA 5K6RA 3F8TA 4OATA 4TYMA 4YJGA 4QGSA 4BLTA 1LBQA 3GZJA 4OGFA 5F98A 4P3XA 4BTVA 4EA8A 1K63A 5H81A 5C4IA 4A16A 1GZHB 3HJTA 1RR6A 2WD8A 2RBGA 4IKEA 1SXIA 3BVPA 4IEIA 1BYIA 4MKRA 1P74A 1QQ7A 4Z0HO 4IIHA 1UMDA 4R2HA 5A0FA 2ZU0C 3OAAA 1ENOA 2CXNA 1ZXLA 3KPWA 1QOQB 2XRMA 2I99A 1LV8A 2OV3A 2WF8A 3TCNA 1S01A 1RPNA 2YRWA 3K7EA 5DVZA 3E9NA 4FMDF 3WRYC 3ZVMA 1DAOA 1EAMA 3L7CA 2ODNA 1U3CA 3U4CA 4MUMA 3RS3A 3K31A 1NFQA 3MA0A 3SVLA 5H82A 3FFBA 4ZTUB 1D6MA 2GEKA 2RGAA 4MIYA 4A6XA 3BMNB 1QGYA 1VZ2A 2XNJA 4X1YB 4JENA 4Q05A 1NZFA 3ITEA 4CIYA 3X43A 3W79A 1Y5RA 3B7WA 5HFAA 3M34A 5BN3B 1N25A 3UWKA 2NXEA 2PUGA 2XUZA 2PGDA 2VF2A 5LBTA 4NZNA 1TZMA 2CXHA 3RRZA 5CHEA 3PTAA 5BQ5A 4CGZA 3V7NA 3FRIA 1DG3A 2D6FA 1ZHHA 1P2SA 2FH5B 5EJMA 4ROSA 4ZVTA 5IYZA 1TA4A 1J07A 4I4NA 1TEZA 1NYTA 2QNBA 1KO4A 2XXBA 2B1IA 4PAQA 1YULA 2HPVA 2ZJAA 4FM9A 1RZ3A 1SVLA 1SR8A 2GCGA 3W1EA 3V4SA 1SBCA 2JFOA 2BHTA 5FTMA 5BVHA 3IV7A 4PZZA 9ATCA 3AKZA 2XCIA 2W5UA 5FYQA 1P39A 2PZGA 3HBFA 2A35A 4I50A 4TT8A 1NYQA 2BM8A 1Z12A 1EBUA 4TSKA 1JJFA 1M83A 4RVDA 2IZ0A 3RYHB 3FZYA 3FUVA 2XCQA 1YDFA 4CUKA 3OIUA 4IGEA 2WJAA 3N2KB 3LOUA 1SVIA 3M3PA 2OXCA 3JRXA 2GZDA 2V58A 4KH0A 1N92A 2M1XA 4HLCA 3NHUA 1CEYA 2ZR9A 3AY7A 4HZGA 1QVVA 2J0QA 4YCBA 4ITRC 4FZRA 1N2CE 4B3SB 2OLKA 2H9YA 2HA7A 3LF2A 3NOVA 2IEZA 3WBKA 4QIHA 1Z2NX 2FPOA 2IEDA 2CF6A 1ZJ6A 1R12A 4YPFA 1Z5UA 2QN1A 3KQYA 4JLWA 3WGMA 3U17A 2YFYA 4C0KA 1AV6A 3W05A 1XTKA 5FPYA 2VDOB 1NJ8A 2AXQA 3OE1A 3ORYA 3M2TA 4Z4HA 3G1UA 4H7DA 3WK9A 2YWCA 1CCWA 4N6NA 3ZU2A 5A03A 3NHSA 5T4FA 4MJXA 3NYWA 3B6MA 2VTBA 2G7ZA 4JFAA 4MVWA 4PBRA 2PK3A 4AXBA 5HRCA 2JGJA 3VKHA 4ZFNA 3ZOKA 3ZU5A 4NESA 4CBVA 3OPQA 2H31A 4PBTA 3MTQA 1JHDA 1I9CA 3TLBA 2AWNA 3VYWA 4EKNB 3L0PA 4HGRA 4ND8B 4NOMA 4RZ2A 1SVWA 4YCSA 2A1TR 3T94A 5JO0A 1ESZA 2EL7A 2P3QA 2VWHA 5EXEA 3ROKA 3VPBA 3W04A 5IT9A 2A5LA 4F2GA 2O8DA 4UUMA 3F9CA 4F3RA 4PNEA 3H0KA 1UBGA 1KEUA 4JBLA 3IMEA 4J90A 1YE3A 3C8MA 2W6JA 3T1OA 4EY3A 2PBLA 4TRJA 4B6EA 1FXWA 3JYOA 3NRCA 4UTPA 4DLXA 1CTQA 1UBEA 4LZZA 3UICA 1LPBB 4GKJB 4DWJA 4E09A 4O8ZA 4C0JA 1BW9A 5THQA 2A0FA 1GTMA 3DAPA 1QS0A 3JQ9A 3M6UA 4KZKA 1QBGA 1ZN2A 3MTIA 4L4ZA 1DC4A 3AR6A 4GSKA 5HJEA 2HHHB 2VT2A 3WMGA 3L5OA 5ALVA 4BASA 1I24A 2ZIVB 4KWHA 4PICA 4WESB 1ZNWA 5AM5A 5DZSA 2JGDB 1FP1D 4ETIA 2FCRA 5K8CA 4XUGB 1VPDA 4FGKA 3TPZA 4EW2A 3JR3A 5AM4A 2V4MA 5CA1A 3IJRA 2B8TA 3BCRA 4U39A 4A4DA 5LXTB 4A3SA 4YACA 4L4RA 4D9KA 1YMUA 5A5GA 3N2LA 4W5OA 1YHYA 5DB4A 2REXB 3F0TA 2IIPA 5G3YA 5I7VA 4RA6A 1A27A 1KI1A 4JXKA 4X54A 1W88A 1SC6A 4J4HA 4ZQEA 1PHPA 4PAGA 1HT1E 2HR1A 2AFVA 2QUHA 1HBJA 1N34B 4MQFB 2BGMA 4L2IB 2RHLA 1PZEA 1ZO8A 2JF0A 3AW9A 1KF0A 3H6GA 2HZBA 2WG1A 4BLQA 1K8ZB 1MRNA 3O3NB 1XNRB 3E7DA 1QV7A 1U4NA 4ZOLB 4CYMA 1HQYE 1P9WA 2QF7A 3B53X 3AP2A 1YVUA 2HRBA 2G1AA 4OSPA 1Q6YA 3LBNA 4OK6A 1ZVMA 1SCKA 3MFQA 1XTUA 1ZMTA 3H16A 4FOTA 4DSTA 4O3FA 5BURA 1K1EA 2H4WA 4L5CA 9MHTA 1A77A 5CEFA 1J99A 3DPSA 2AOXA 4D5GA 2BFEA 1NUHA 2X4DA 4N7MA 1W29A 3PGJA 4XQGA 3RFTA 2VNHA 3DV0A 1KO7A 4A7PA 2I6FA 3KKKA 1KC1A 1YRHA 4AO7A 4A0QA 1E59A 4I2NA 1JHVA 2AMJA 4INOA 4KX5A 3W9UA 1BSVA 5KQMA 3HKDA 3KKNA 5J2UA 1AK2A 3NUQA 2WYHA 1IN1A 1KQOA 1SHJA 3QE3A 3P52A 2BM0A 3DAFA 1FRVA 3OTGA 3VPCA 4BMZA 4BP1A 4BU0A 2I0FA 4EYQA 3K09C 2YCBA 1HDXA 3UT0A 3H13A 3PFWO 4TL8A 4UQLA 2OLEA 2R60A 3GB9A 5HF5A 4ENSA 1Z28A 2CBZA 2GJSA 5FNVB 3OZTA 4D41A 2CLEB 5EZ5A 3FPSA 3M0EA 1KR5A 4G65A 4NJMB 4ZCLA 4DQDA 4NH4A 3IAFA 5HKKD 2X9NA 4OQPA 3RV4A 2NZ2A 5BV2P 4RIEA 4AS1A 1HDYA 3PA8A 5DFAA 2JBAB 3JD4A 3R9IA 2VS1A 3TK1A 1RMYA 2ZVDA 3GGPA 2QV7A 4G5FA 2DETA 3ZD6A 2CBXA 2HHJA 3CGWA 3AI1A 1G5TA 3FMPB 5C1DA 1KI7A 1OGYA 2FUCA 3BJRA 3GX1A 3N86A 4PCLA 1EUQA 1R5NA 3G2MA 4MUYA 5A7HA 2CJPA 4H7JA 1KI3A 2REOA 4F06A 1D5WA 1P2GA 1IJFA 4LZAA 3P9XA 4M55A 4KP7A 2D5IA 3GYGA 2PUHA 3Q3CA 5J9FA 1KY5A 4YT5A 4JELA 5ALHA 4DUGD 1P19A 2FVXA 5JS1A 4NMHA 3O2SB 4FFNA 4O4IA 3CUKA 2NNWB 3OQIB 1CQIA 3EVCA 3L8ZA 3KPVA 3MT9A 1ZR4A 1KYZA 1RXVA 2ODBA 2H85A 3DAOA 3JQDA 2BGKA 2PFGA 3D4PA 1PLKA 1PJAA 1ZH2A 4HQKA 1CRQA 3Q8MA 3MUFA 1GAXA 1HNWB 3UXMA 1YI8A 5ICGA 1LRLA 4QRDA 4Q6WA 2YICA 1XCOA 2QD2A 4EY6A 1X80A 2LDBA 1CY2A 3L6OO 5HYVA 1N2GA 1R0WA 2ODQA 4ZYTA 2IS1A 1L7XA 1YVPA 2ZSJA 3BQ9A 4EY7A 1MVNA 2B20A 3HY4A 1MGPA 2BMJA 4MGZR 5CU7A 2ZDQA 4OV6B 2X3FA 1A8PA 2A6PA 2FQYA 2IHUA 3GWGA 5LZ8A 3DVQX 4LQLA 4HT3B 5KSOA 5AO9A 3HGTA 1GQSA 1FVOA 2DWUA 2WJ3A 1SIUA 2OGZA 3E35A 3HEMA 5JVDB 1PJSA 4ZAXA 3V1LA 1A97A 2QTVB 4CT5A 4HNGA 3OMLA 4TTQA 4D9GA 3ZZMA 3PX3A 4DMFA 3KJXA 1ECFA 1MIOA 4CM8A 3JQFA 4NEGA 1VYHA 4PFJA 4FMCB 4XDYA 3GCDA 4LX8A 4OA5A 1XJQA 1NYRA 4YDQA 3K0KA 1R8SA 2J6IA 3I01M 3N59A 1P4JA 3AR4A 4CIXA 3UOGA 1QE3A 3ZYZA 2W2KA 3FUUA 2I71A 3AR7A 2CVFA 1BRMA 4J16A 4WLOA 1XROA 3CNBA 4HGNA 1I0IA 1OJLA 3DBIA 1KH1A 3D6UA 3FNHA 4XD7D 1YQUA 2R79A 3GOHA 2BBOA 4G5YA 3NWPA 1FNDA 4ZYYA 1QFJA 4J9UE 3KZXA 5H1YA 2DCMA 1X74A 5KJ6A 1AB5A 1JG6A 9LDTA 1N1EA 1MNAA 3AHFA 2I8LA 3PXGA 5P8WA 3LUCA 1PJTA 3WLJA 1C50A 2DQ4A 3CONA 4BNGA 4KQJA 2O8BA 2VAMA 1X7ZA 2NVUB 2YDYA 3GT4A 4H4EA 1YUNA 1U7UA 4LI3X 2FW9A 1FP7A 2OHIA 4QASA 4XDZA 3IEMA 1AA9A 1M7GA 4FUQA 1DG9A 4FLFA 4M1ZA 3OFNA 1GA6A 1JG7A 1W5BA 1X38A 2BHLA 2AK2A 2P7IA 1GARA 3EW7A 5BNFA 1TVMA 2HSGA 1QHYA 2X9GA 5DNCA 4MYDA 5AJXA 3JSXA 3UGKA 1YZVA 3LD9A 1PVDA 1G3UA 2QZPA 3G5MA 1A9PA 2FZVA 3PE3A 1X8KA 4CTKA 2FSVA 1U0GA 1VCIA 2NLOA 1G66A 1EBBA 2O0JA 3CXUA 3LYUA 3QXJA 1SZCA 4P7FA 1RE1A 2C03A 1N6LA 2C9ZA 4IFEA 1G2PA 4OFBA 2BFWA 2H57A 3PYXA 1FMFA 1QIIA 2PUBA 2N47A 3BX1A 3GLFE 4EYKA 2FLVA 2QLTA 2XDYA 1Q6ZA 4P4GA 2B98A 4PHTA 3ZDFA 4F5ZA 2PGJA 1WD5A 2PS1A 3EQ2A 5DMXA 3BXFA 4EQZA 3WDLA 1EUDB 3A25A 1P9LA 4ZRDA 1FYVA 5A06A 4R1QA 4HZUA 4DTCA 1DOHA 3DOOA 4MVXA 4NS1A 4ZODA 1X13A 1R5BA 2ZJ7A 1RP1A 2BP7A 2DE0X 2BEWA 1UBSB 3ESDA 3M6LA 1QUEA 2PKQO 2ZVQX 3D2AA 3WYBA 1VBKA 1YRLA 3GRZA 3KE8A 3P7MA 4D9MA 2O52A 5SYMA 3VOTA 2ODTX 2IOQA 1E2HA 1W30A 2BI4A 3RU3A 3F6BX 2ZS9A 4G41A 1BO6A 1SQ5A 3RHZA 4AP5A 1M2HA 1YFJA 3TAUA 2CXRA 5M29A 2P6PA 1GFZA 1TZ2A 3GUYA 3OCWA 5FO1A 1HKUA 1LTKA 1S4MA 1YU9A 4YA6A 3RVDA 4W1SA 3RW9A 3X2EA 2VOEA 4BKOA 4HEJA 3D8RA 3AW8A 2DWOA 3L7BA 3S8EA 1F1JA 1W4CA 4ICIA 4QDTA 2GN2A 1CEQA 3LLMA 3O91A 1SO8A 3QEOA 1I5EA 221PA 1XTJA 2G9RA 2QY6A 1YL7A 3JAKB 4NAUA 4ZO8A 1IIBA 1MXFA 3QE0A 1K5GA 4RD3A 4ZVRA 1VLQA 3RRFA 4IRXA 4K28A 4MUJA 5FL3A 5A0VA 4TLAA 1JR3E 3AF2A 3FDZA 5EUCA 4MP8A 1LZKA 3TDKA 2YXLA 2XF2A 3BRQA 3DZKA 4DV4B 5DYNA 1MAAA 3BMQA 4E51A 1W5SA 3HM2A 3GLIB 1J8VA 2A5YB 2XKBA 1EFRD 1RBZA 4ZXPA 3DA8A 4OHKA 5EINA 4KITB 5KCZA 3LHIA 5ED4A 1UM9A 3QU5A 4IIGA 2ZUDA 5KB3A 1TVKB 2BELA 2WAMA 3FLBA 1JG2A 4MUHA 3PF9A 4HB4A 1VMEA 1H2FA 5TF4A 1EWKA 1KVUA 1J2UA 1PL6A 3A10A 4XQ9A 4R31A 2VEOA 1VIYA 1YRWA 2QM3A 3L0IB 4CLXA 5KTKA 4PG6A 4CT0A 1OBVA 2Q99A 621PA 4DKJA 1A7JA 1HQDA 3EZ6A 3PUJA 1VMAA 4G5QA 4U7JA 1O08A 3RF7A 4JU8A 5C31A 4KV9A 4UZSA 4BVBA 1JLMA 1R0LA 3OEEA 4MHOA 4DNOA 1UC8A 4XLLA 1V4NA 3DVLA 1H0KA 2D1QA 1UL1X 3CV3A 2W2VA 2QR5A 1LJ8A 3HABA 2PN1A 1SQFA 4ARBA 3K5WA 3ZHRA 5GIOE 4RVGA 2OGWA 3MJRA 3VHLB 3SX4A 1PEYA 3ITDA 1U8TA 3TJMA 4ZHQA 4TZ6A 2BFOA 1N5LA 1XC7A 1YZQA 3CNHA 3FVRA 1V16B 2FX2A 3NHJA 3NTQA 3AUJB 4FZJA 4HDQB 1GPMA 2IXBA 3HSKA 3DZJA 3WE7A 1BX1A 2P65A 1Q0QA 5EL0A 3VZDA 4BNXA 3UHPA 1KRWA 4R3WA 1DQNA 1G5HA 3LE8A 1G8KA 3SE0A 4Z7JA 1QIDA 4HH1A 1ZWKA 3RS8A 1DFIA 3CVOA 5TQ2B 3T5BA 3HVKA 5I9NA 4J2TA 2RDMA 5K03A 4GPIB 4DMGA 4H1WA 1C8KA 1QCZA 1AXGA 3MJFA 4UTXA 3LCCA 3AM3A 2KM1A 1A2OA 2VDJA 4H1HA 1CYDA 1VDMA 2B3TA 3PGVA 4YRIA 2E1PA 1AKUA 3QENA 4PU0A 5EUBA 1HNNA 1N6KA 3ABOB 1LRKA 4P4LA 5AI4A 1VIDA 3Q1KA 4D42A 3QBTA 1ZGZA 2J3KA 3LO8A 1HRKA 1PQYA 3ICWA 4K1LA 2A57A 2GO1A 4K46A 3HJRA 4RIHA 1KP9A 4LDPA 4UVGA 1EKXA 5FBHA 4DMHA 4V02A 1T36A 3I6YA 5FOWA 3TG8A 1G2OA 1FUEA 3OWHA 1PX2A 4R2JA 4EHIA 4G0NA 3HKCB 3CR8A 3WL4A 2CLCX 4KXNA 2UUBB 2HRQA 1C14A 2OAQ1 4GWGA 3ZN2A 3PQ8A 1NV9A 2ONYA 2QORA 1C7EA 2MSWA 4BYMA 3AKEA 3SEAA 1ISMA 3G2KA 4NPCA 2IKQA 4QO7A 7REQA 2IZ7A 4KDFA 2OCLA 3QW4B 3JQQA 3BTSA 2H4XA 1WULS 4L51A 4QU8A 3GD5A 2WJJA 1R4NB 2DZDA 1T9DA 1DWPA 2X0IA 5I4BA 4JEUA 1T4GA 2GJKA 4YBRA 1K06A 3HWRA 2DSNA 4DEVA 2P9FA 1OZHA 2CEAA 4RMIA 2X5XA 2JI7A 2C00A 4OB7A 5E6RA 3E7WA 4D9BA 2BFFA 3ZPXA 2E85A 3BB3A 3A4VA 3QEJA 2HC9A 5ICSA 5DX8A 2M6LA 1NRIA 3B2QA 4G5GA 4P93A 3JQGB 1JIJA 3PVSA 3TVTA 5JCJA 2X1VA 3QX7A 3R0IA 2YRXA 2LCIA 4MKIA 3SXJA 1TM4E 4TTJA 1G291 1ZUHA 2DKNA 2EC5A 1ZN8A 3O2NA 2OD7A 3A9UA 4TLLB 4QUIA 3KLOA 3H5WA 1Y8RA 4H7KA 3NUZA 4G1CA 4A8TA 1LCIA 3GJXC 3O84A 4KE8A 4NCKA 1VL6A 4IOMA 1XTRA 3I0MA 4UM7A 5GP1A 2DSTA 1R10A 2I6GA 2Q5CA 3HI6A 3OUUA 1JFLA 3CF4G 2IDMA 2SHKA 1WKVA 3EE6A 1UANA 3QPVA 3ZLBA 4C05A 4D26A 1KMIY 1EFLA 2ZI5A 4EYOA 2ZJ6A 5GPBA 3L0CA 4CIAA 2VF5X 4UM5A 5K8TA 1ML4A 2ROQA 4OGGA 5FR1A 1UBOS 4IRMA 4DY6A 1WBJB 5AM1A 4EFDA 2Q0SA 1EDEA 4MV9A 1WQ3A 3CZRA 1NATA 5KAPA 3WLKX 5AMXA 3MILA 4DHWA 2NO6A 1KDYA 1NBMA 1HA3A 2OBLA 2EBHX 3L0BA 3OIVA 3PC3A 4RUKA 5TEVA 1MCZA 4JB8A 4MHTA 2VNSA 3NNSA 4U7WA 5G1OA 3B6JA 1SM4A 3H5VA 3DCYA 1USIA 4Y1GA 1RAHA 3D6JA 5JS6A 1FFBA 2E2WA 3I9V6 1BFUA 3R4VA 4XWGA 5FBWB 4OI1A 4OXXA 4YUZA 4YXFA 1SG6A 4FYYA 1KFCB 2G04A 1Y4AE 3ZV6A 1WSWA 5EESA 2H8GA 2O9JA 2X2FA 1IBLB 2RGNC 1K2WA 1E6EA 2YXDA 5K0LA 3DHEA 2AQKA 2JIRA 1DTSA 4O2BA 5FIUA 1BJRE 1DQSA 1JIKA 3NHYA 5EVJA 1PV2A 1SXJD 3OU6A 2PCLA 1GFSA 4FTWA 1L5HB 4MCAA 1AY0A 1ZC4A 4DILA 1ZLYA 2DAPA 2GWRA 3IKLA 1R0CA 2CZGA 3GZNB 1N0IA 3SLRA 2OC9A 5KINB 3JD3A 1IY2A 1BHO1 4QPCA 3B5IA 3PXEA 4GI5A 3U3ZA 3V1UA 1P9NA 2D1RA 2RAPA 3DKPA 1NJ5A 4RQTA 4Q4AA 3KXPA 3HA3A 4YQFA 2BD0A 1AK9A 2H2WA 4RWEA 5DK6A 2G9QA 3RV3A 2DQZA 2EHDA 4JX9A 2GI4A 4NZPA 4RFSA 4UUPA 3TRKA 2PUDA 2CNKA 4HHEA 3KC2A 1EZZA 3OM1A 3VR3D 3IPYA 3QPWA 3W6NA 4EFLA 5KWVA 3LUHA 4FC6A 1KPGA 4KGDA 5EKXA 5TS3A 4COOA 3PEWA 3IUSA 4CFSA 7AT1A 1T2FA 4H27A 3RE1A 5HUHA 1GG9A 1ZFNA 3VO2A 3BGDA 1FX0B 1U3WA 4KQIA 1Z6GA 3UPDA 4D96A 4EPXA 5DYGA 4DVJA 3E1GA 4L6CA 3RRJA 4F5WA 3NT5A 4I4TB 4MR8A 2QBYB 3ZKWA 3EIWA 4U2FA 3RADC 2IV7A 2VXOA 5E8JA 3WJ2A 5D3QA 4JD5A 1LDYA 1NI5A 4QGAA 5C32A 1Y7IA 2PYDA 3IAXA 3L8HA 4KRFA 1D6JA 3QYFA 5LMZA 3HP1A 3R2JA 3S28A 5HPYB 4JHLA 4N41A 1GAJA 3KS9A 4DA4A 5JQGB 1ZSVA 4G4IA 3LTNC 1SCQA 3V8NA 4CLRA 3ZXUB 5KTYA 4G24A 3AF6A 3JQ8A 2HV8A 1EB8A 3WWZA 5F7JA 1B8NA 4HUTA 1JU3A 4KQ6A 1OA0A 2WC1A 4G9BA 4GI3A 4N0DA 5K45A 4BMVA 2W6ZA 1PF7E 1NT2A 4V39A 1GUDA 2HT1A 4W1QA 2Q62A 1M7HA 4JLVA 1FX1A 4N9WA 1QGUA 1VG0B 4MR9B 2R1VB 1ZD3A 3DTTA 2ZK7A 1HZZC 2PSHA 5BNWA 3ESAA 1YBVA 4ZMBA 6CHYA 3ZY4A 5IF3A 2V98A 1TIPA 1PGNA 1SAYA 2APJA 1N0WA 2BMDA 4CEJB 4GR9A 4DBZA 2EZ9A 3E1KA 5HMMA 2LRHA 2C1XA 2EAUA 2QB5A 2BLLA 3E3AA 4ZKEA 3VR6D 1V26A 3QKTA 4PG8A 1C3JA 3PPXA 3E61A 1VJDA 1FTNA 2FZ5A 1J0AA 2X41A 4EUEA 4NCNA 1GHTA 3K16A 1J7JA 1QK3A 3D3NA 4ER3A 4G85A 1I3CA 3OPNA 4MQ4A 4RJTA 4J0QA 3EA4A 3OJ0A 4HDSB 5ER6A 1IRXA 1HF3A 2ZUUA 5CDFA 3WGNA 2IS2A 2X8JB 1E99A 2GASA 5SY4A 1FC0A 2UV8A 4MP3A 1HLPA 4DCMA 4ZMSA 4M9CA 2YZ7A 2GTIA 5IYZF 1JU4A 2BC9A 4UVIA 4D3DA 2ZSKA 3TNYA 3CMCO 4XJTA 3INYA 2PTGA 3FGOA 2HWYA 3L93A 2WP8J 1Q0HA 4Z53A 5BSMA 2OXIA 3ZY5A 4MVJP 1W96A 2AT1A 2PS3A 3WB1A 1VSVA 1DCTA 3M6VA 2AI2A 1M8JA 1YQGA 3BWXA 4I50F 1TRHA 1V7CA 2P8JA 1VFPA 3GJ7A 4S1OA 5F2OA 3U3OA 1BEZA 2B0CA 3ROZA 5HK9A 5JWHA 4JJEA 3MAJA 2HOQA 3QTLA 1ULAA 2BBTA 3QWFA 4JYCA 2NXJA 4KPUA 1H9BA 2Q6TA 3ESZA 3OCJA 5JBIA 2XZPA 1MF7A 4OHCA 1E0SA 4RKEA 2BJWA 1RM3A 2XAAA 4UXHA 2AUTA 5E4TA 1YA6A 3TINA 4JOSA 5L7YA 4EG1A 1W36D 5ULLA 3E9YA 5F1YA 1DIOB 1ML3A 3BMXA 1CUSA 4YDSA 1RMTA 3KKPA 4UCXA 2PRYA 4U0KA 3LX8A 1IIRA 5SYAA 2Z1NA 4MS3B 4FFSA 1K27A 4Y6LA 1KP2A 3TTYA 2D1YA 1G98A 3B5EA 2J9ZB 3BZBA 3ZHVA 4WBNF 2H0RA 5CBKA 5EWJA 1E9BA 4B46A 3EFOA 3RRMA 3PRYA 5AJTA 3U3RA 2X5OA 2J87A 1I3KA 2WTMA 4JBGA 4GP7A 5EIHA 3URMA 1C3VA 4LC9A 3WX0A 4B3MB 2XW6A 1WXFA 1E8DA 4GXQA 1P0FA 5AP9A 4IDFA 4JUFA 3BD6A 4UBNA 4BC1A 3SYRA 2CXSA 2OORC 3QTTA 1S96A 3RWBA 3KRTA 3VJLA