4CV3A

Crystal structure of e. coli fabi in complex with nadh and pt166
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
239
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
total genus 85
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv3A00
1WPQA 3DMTC 1NASA 2O3JA 1XDWA 4M89A 4D3FA 2W90A 4M1QA 1UXGA 4FC6A 3JQGA 1PJCA 5IDWA 3DR3A 4CMIA 1IULA 4LRTB 1A7KA 4GKBA 1PS0A 4OHUA 2HMUA 4FSHA 3JQAD 4PVCA 3JQAB 4XR4A 2ZYDA 4F46A 1LLUA 3GDOA 4FJ2A 4NFSA 4R1TA 4H3VA 4KZPA 4XQ9A 2Q2VA 2B5VA 3V2GA 3MJ4A 3ORFA 1QYCA 1M6HA 2PKQO 2VNAA 4EUFA 3WWZA 1LRLA 1KVSA 3QWAA 4GAEA 4MPDA 1LLCA 3JD3A 3HDHA 3WLEA 4PG4A 4IMRA 3EVNA 4D0SA 2CY0A 3ZNOA 3GH3A 4K9DA 1SEPA 1VM6A 1Y9AA 1YS4A 4RVGA 4OYRA 2AG5A 2Y1CA 4J1QA 4RDHA 1IY8A 4BO6A 3S2IA 1PJ4A 2HQ1A 1H5QA 1QLJA 1NVMB 3L6EA 4ND5A 2YW9A 2O7QA 1VC2A 5IAAA 1O95A 4CM8B 4CR8A 1H6BA 5G0SA 1QORA 1P31A 3FWNA 4QEDA 1XWFA 5C7OO 1HKUA 1LI4A 1SB8A 2CNBA 4PLHA 4ZQHA 2FZWA 3JTMA 2AHRA 4WLOA 4RVUA 4LCEA 4ZICA 1PQWA 2Q3EA 5JMWA 4FW8A 1BRMA 3RROA 4F6LA 4I1IA 3H5RA 1SBYA 1T2CA 4AJPA 1Y9EA 4CLRB 1GZ4A 3PYMA 5LCXA 4IDAA 1RWBA 4FCCA 3H5NA 1RYEA 3WTCA 1R0SA 3DB2A 3UN1A 1EBUA 1U1IA 5I9MA 1NBOA 3IQDB 2OL4A 1Z7EA 5B12A 2AXQA 1EQ2A 1E1MA 1D8AA 1ZMOA 4PLTA 1E6WA 2G17A 3EAGA 2B5WA 3AY6A 4BNYA 4DYVA 1RPNA 3TZQA 3H5AA 4B7UA 1I8TA 5F3RA 3GA0A 1FXSA 5K6AC 1ULSA 3VDRA 2POQX 3D7LA 2FWMX 4XWYA 3AUTA 4J1SA 2GF2A 3VH2A 2E48A 3AFMA 4XRRA 3GR6A 1NWCA 3PFWO 2W2KA 4FOOA 1A5ZA 3WWYA 2WE8A 3AY3A 4RPKA 3AOEC 1FF9A 1MXHA 4R54A 1W73A 2NU7A 3GZNB 4JLWA 1MV8A 4NPCA 1HETA 3DHYA 4NJOA 3DBLB 4UUMA 2GR9A 3MJTA 4FDAA 5T8KA 2W98A 5I9LA 3AY7A 4ND1A 3JQFC 3DC2A 2PLAA 1CERA 4I8XA 3H9JA 3PTZA 2O23A 3AUSA 4DPKA 4HY3A 1PZFA 1PJQA 4L0QA 2YDXA 3WG9A 3DBHB 3Q11A 3HNPA 5DBIA 5AXDA 5DOVA 3VAZA 1Z75A 2PK3A 3PGJA 3V8BA 5A9SA 1WDLA 2Y66A 4J0FA 4J0EA 1WDMA 4WCDA 4LCJA 5BSEA 1R4NB 3ZV3A 3O26A 2OORA 3PGXA 3ITKA 4HXYA 1E1NA 3S8MA 5CPBA 3QQPA 4CV2A 1DFIA 4PLYA 4UVEA 3WGZA 1I2ZA 1WP4A 5EL0A 1WMAA 4CLOA 3QWIA 1A72A 4DLAA 3GGPA 1N7GA 4HWKA 4OOEA 3MJEA 3K9QO 2CDBA 4DRYA 1KS9A 1BW9B 3OEWA 5FI5A 1YE3A 4L75A 4DA9A 3PRJA 4HBGA 4FR5A 2NTJA 5A3JA 4JJGA 3SC6A 1T4BA 4LVCA 3BMCA 2JHFA 1LDGA 4N7RA 3LQFA 1T1RA 3KSZO 3KSDO 5IDQA 1U2DA 4DPMA 1IHXA 2ZCVA 2ZIZA 1HDZA 2FP4A 1VL8A 3F6YA 1NP3A 2BELA 3HADA 4TRJA 2FHSA 3GHYA 1PWZA 4XYLA 5T67A 1B2LA 2ZJ1A 2C2YA 3IIEA 3OHSX 2G82A 2C5EA 3ONFA 3ZWMA 1OMOA 1ML3A 1MP0A 1U3TA 1ADBA 1JN0A 1DIRA 3BIOA 3L07A 2X23A 3PXXA 3UGKA 4GWKA 1IB6A 5DBGA 1WAMA 3F1KA 1HYEA 2D8AA 4OGWA 4YAIA 3QJ5A 1IHYA 1I2CA 4PZEA 2G76A 1BGVA 1S7CA 4BO0A 3ENKA 1CETA 3KEQA 5A06A 1NYTA 1LLQA 3LU1A 3WBFA 4XCVA 1J4AA 4XGKA 1K6XA 3L4SO 2JFGA 5EERA 4ND2A 1NR1A 5MDHA 4XR9A 3F9IA 1YL6A 1QRRA 3Q1LA 5DT9A 4RF2A 3PDUA 3ZWCA 4MIYA 1Q0HA 3O03A 3UAGA 3CMCO 1IE3A 4TROA 4ZA2A 2I66A 3JQAA 1T2DA 4YJDA 2UV8A 2O3SA 2JHGA 4WEQA 3RUCA 1YB1A 4UVDA 2H5LA 4Z9XA 3MEQA 5HWSA 3JQGB 5JC1A 2FSVA 4H15A 1AHHA 4CUKA 1DIBA 2DT5A 3U4HA 5EN4A 4J7CA 2EGGA 3ZCXA 4BL5A 2JD2A 2PWZA 4B4VA 4DWVA 3HDQA 3GGGA 4B4UA 4CL3A 3BYZA 5CDGA 4D79A 1B7GO 4WCFB 2RHCA 1ADFA 4J90A 2UVDA 1E6EA 1DC6A 4IIVA 2ZYGA 4OSOA 3VKUA 2YJZA 1X1EA 3DAPA 3KYBA 3GQVA 3L4BC 2DTDA 1E7SA 3RVDA 1L7DA 2O4CA 3DEYX 2NVWA 2H1SA 1L7EA 1NQTA 1KEWA 2O3UA 2ZYAA 1N1GA 2X1HA 3PZBA 1GFSA 5ES3A 1ZNQO 4KUGA 3H9GA 3KBOA 3L9XA 3R1IA 4IGEA 2E6UX 2C0CA 4D46A 1XA0A 2OUIA 3AM4A 5BNIA 4WUVA 5L7TA 3IOYA 4I9NA 4YCAA 5HBRA 3QE3A 2ZTUA 3KLPX 4MP8A 3SXPA 3TL3A 4F6CA 3TRIA 3Q2IA 4GKVA 4R01A 1UR5A 3P19A 1RYDA 1DEHA 3FPLA 5IF3A 1YB5A 3OA0A 3ABIA 4I9HA 5CFZA 3INRA 1ORRA 3KYDA 5CP8A 3EVTA 1W4ZA 2DPGA 4HKTA 1GD1O 5JAQA 4AJIA 3KVOA 1PQUA 3DZHA 1BDBA 4J1NA 4DLLA 3EC7A 1HE4A 2E4AA 2I76A 4R1NA 3EY4A 4BNXA 5K9ZA 5AXCA 4BNTA 2FZEA 1V6AA 4GBJA 4B7XA 3ROKA 1ZCJA 2OFPA 5IN5A 5JBIA 1HDRA 3JD2A 4XDYA 3G49A 3Q9UA 4ZRNA 3JQCA 3CEAA 1FK8A 1HF3A 3WGOA 5AXAA 1F8FA 1C0KA 4NMHA 3AJRA 4TRNA 3O8QA 1J5PA 5ILGA 4CM1A 4LW8A 4HFMA 4YWJA 1H0KA 3V1YA 2RH4A 3IJPA 3OA2A 3F3SA 3WGHA 1DBVO 1YJQA 3DBHA 4CJXA 1FJHA 1KC3A 4HFRA 3H8VA 3NEPX 2AQIA 4LSMA 1M75A 4D3DA 1PS9A 2DUWA 1TI7A 2EKLA 3DMYA 1P1FA 2WYUA 3H9EO 4FGWA 2WWRA 1V3TA 2ZQYA 1LC3A 3PVZA 1A71A 4WPGA 2NU6A 4DBZA 3UOGA 1PJTA 4WLNA 1H2HA 5FF9A 1AUPA 4AL4A 1EDZA 3HHPA 2QG4A 1E77A 2FRDA 1BXKA 1Y5MA 3E82A 2DTEA 1PJSA 1HDOA 1GUZA 2QX7A 2Z1MA 3PLNA 5MGBA 1D7OA 2PZMA 4RJTA 4E2XA 1O5IA 3FNEA 4KWHA 3DFUA 2NLOA 4BO1A 5IFLA 4NBRA 2XAAA 1TXGA 4IJWA 1F17A 2PD6A 1EE2A 5F5NA 1K89A 2GERA 3HFGA 3C7AA 2GN9A 3VPSA 2VYNA 2ZB4A 3VZRA 4BNKA 3WIEA 4IBOA 2AG8A 4BMNA 4CM7A 1NPYA 1UZLA 1ZK3A 3H9QA 4BV9A 2XPCA 3RUFA 2VYND 3H2ZA 4GMGA 4CQMA 3RQSA 3JQ8A 4RZHA 3RC2A 4CR7A 4CV1A 4MKRA 1ISHA 4HX5A 4JIGA 2X0IA 4XKJA 3GG2A 4AJ2A 1NQ5A 2NSDA 4BGVA 1YQGA 2PNFA 3JQBA 4L4RA 3WNQA 2OO5A 1AHIA 1ZO8A 3I1JA 3H6KA 1MXFA 4AJJA 4ZJUA 1DRVA 1JTVA 2Y1GA 4BV8A 4PIVA 4R9RA 1O89A 4FB5A 3DL2A 4L9RA 1A27A 3QVWA 2IDZA 1BHSA 3WSWA 4ZHSA 1HYHA 4J2OA 4YR9A 4PLCA 3VH4A 2E37A 2FR0A 4A7PA 2WYWA 1BW9A 3CZMA 4CR6A 1WZEA 3H9UA 1B14A 3RD5A 1C1DB 1LA2A 1A4IA 3V5NA 2R6JA 1H94A 4XYMA 5T5QA 3QLJA 4FFLA 4DREA 3VVCA 2HO5A 3WXBA 3Q6IA 3P2OA 4QFDA 5AYVA 1XIVA 4HNHA 1DAOA 1JA9A 1WXDA 4RDIA 1HLPA 1I01A 3FI9A 1XGKA 1LXCA 4NQZA 4FGSA 4I5FA 3KHUA 3I6IA 3SC4A 1SZJG 1YBAA 2HMSA 3B1JA 3JSAA 4QTZA 4MKZA 5THKA 3JQ7A 3KETA 3LT0A 3MJVA 4DL9A 1BMDA 5CPFA 3ZDFA 2FPGA 3GUCA 5JNLA 5A3VA 2YHUA 3D3EA 5COQA 3TOZA 5JFOA 5EQFA 3JYNA 1CWUA 4FJ0A 3QP9A 1E3SA 3VZQA 2DUUA 1DFHA 4YBZA 2D5CA 4CMEA 1YL7A 4MVJA 3S55A 1SCUA 3EDMA 5A1TA 4NHEA 3WLFA 2EP5A 3KV3O 1GY8A 3WMWA 1FMCA 1ZFNA 4J43A 3RU7A 2JJYA 4HV4A 3TDKA 2WM3A 4G5HA 4GVLA 1KEUA 9LDTA 2CF6A 4R5MA 2W8ZA 2NU8A 5IG2A 2X9GA 3PHGA 3W4IA 2CZCA 2WYVA 2Q4EA 2OP0A 2I65A 3JYQA 4TSKA 3JQ7B 5TF4A 1YVEI 1LSUA 4U6QA 2EHDA 5EINA 1T26A 3D4NA 1QYVA 3KUXA 5FYDA 3VKVA 4E5MA 1MFZA 4JK3A 4W82A 4OXKA 4DQVA 1FDTA 5AQ1A 4LN1A 5JCJA 4JBIA 1TEHA 2LDXA 3TN7A 4MVJI 3U5TA 5G0UA 3X2EA 1GCOA 4XJTA 3V1TC 3RUDA 1ZEJA 2NVUA 4YRDA 4BKUA 3I5MA 4IJVA 2CVQA 4ZN6A 3DZJA 4D41A 1X13A 3VVBA 3E8XA 3AUAA 4OKNA 4FQ8A 2JFHA 2YYYA 4CLRA 5L3ZA 1JAXA 3FN4A 1DC3A 1U2GA 1UP7A 3F4BA 4RF4A 4CLOB 4CMCA 1OZAA 1XKQA 1HE3A 1HSZA 1LRJA 1S6YA 1H2BA 2X5KO 1K0UA 5ILOA 1R16A 3W6ZA 2E49A 4IDBA 3DQPA 1GCUA 2Y67A 2DBQA 4ONEA 1IPEA 1JAYA 3ZWWA 4NZ9A 9LDBA 2GO1A 3N58A 4IINA 4HADA 1OFGA 1MC4A 3GNQA 1K2WA 4DMLA 4OXYA 4A26A 2VHYA 4LVUA 4G81A 3K2BA 3KXDA 4WLUA 3ADPA 4PG8A 4NU6A 2GZ2A 3K6JA 3Q9NA 3MTJA 3OIDA 4FN4A 1RM5A 3H3FA 5K6AA 2QW8A 4ROSA 3S2GA 3V2HA 3G1TA 2NVUB 1F14A 3L4BA 4E31A 4QT0A 1SOWA 3DHNA 5G4LA 5JAZA 3RBXA 1E3LA 4Y6RA 3JD1A 1I0ZA 3F46A 4WLVA 3E9QA 4C4OA 4Z3KA 1Z6ZA 1Y8RA 4YACA 5ITVA 3ON5A 4ITUA 3WGGA 4GMFA 3TFQA 3B70A 3JQ9C 4E5YA 5EQDA 4YVFA 3ROPA 1ZZEA 4K1LA 3UW3A 4ALMA 3BTUA 4HFNA 4PG5A 1IL0A 2HMWA 4QXMA 4LSWA 4IMPA 3GVHA 4KQWA 1I36A 4R1UA 2GN6A 1C14A 1XU9A 1KY4A 5ER9A 1YOVA 3ETDA 1ZH8A 2GSDA 2EKQA 3L0DA 3QY9A 5DF1A 1JVSA 1X0VA 3FTPA 3QRWA 5L40A 3BTSA 1TT5A 3BHJA 1ISIA 3E6AA 4CMEC 3PFFA 4S1VA 4WKGA 1BWSA 2HK8A 3MZ0A 4YEDA 3UCFA 1M6WA 1MX3A 3GOHA 1E3WA 1GDHA 1O6ZA 2YV2A 4LK3A 4YXFA 2F1KA 2P9CA 4J7UA 2Q1UA 1Y6JA 2Q2QA 3K30A 4YJFB 3WFIA 1NXQA 1U8XX 3I3OA 1I3KA 2X5JO 1YBVA 4MVJD 4BNUA 3OQ1A 2Q1SA 4BNWA 4R9SA 1Q0QA 2X0JA 4YJGB 3ICCA 7MDHA 1P44A 3DBRB 4U0KA 3U9LA 1FDVA 1Q1NA 2B37A 2Z95A 2EV9A 1SMKA 1M67A 3GGOA 1UDAA 2YY7A 3KEOA 3ZWBA 3AFNA 4BOYA 5IDYA 5AXBA 1I24A 4IY1A 5DP2A 2AQ8A 1GV0A 1U9JA 2BMAA 1DXYA 3AU9A 3PWKA 4YA6A 1C1DA 1EMDA 3C7DB 5GZ6A 4E4YA 5CG2A 3K96A 3U62A 5FEUA 1NM5A 4GL4A 4E5PA 3IMFA 2X0RA 2VOEA 3INGA 3QWFA 2IEBA 2Q50A 1HEUA 4ALIA 5J23A 3NTOA 2DBVO 3M6IA 5T64A 3D5QA 4W4TA 4RPHA 4IQ8A 1P9LA 2XOXA 1ZXBA 2WE7A 3PHIA 3TL2A 2CFCA 5DDIP 2BFAA 1C0IA 4YT8A 4G2NA 2HAEA 2CD9A 2BGKA 4MVJP 1PJBA 2DFDA 4MVJF 1EDOA 5IN4A 2WD7B 4P4GA 1ONOA 2PD4A 5TJ9A 4K6CA 4KUHA 2NQTA 1ARZA 2YQ5A 3JQBC 4TQGA 3ZU2A 1GZ6A 1ZK1A 4E6PA 4W7IA 2XXJA 2X0NA 3QWBA 4BNGA 1LQTA 1HDXA 3ONEA 4W6ZA 3G79A 3K5PA 4J2HA 4XYEA 3DAGA 3AM5A 3OF2A 3JQDA 1P1IA 3HN7A 3ZWVA 4F45A 1MLDA 3WBBA 4LMRA 4J9UE 2WD7A 1KEPA 1N92A 5G0WA 2AEJA 3BXXA 3KTDA 4TMFA 4CMHA 3HWRA 5F1OA 4E2ZA 4UEOA 1EQUA 3ASVA 4K6FA 3KYCA 4MVJM 3MOIA 3HJAA 4GLOA 1LEHA 3C1AA 3KOUA 1JQBA 1DIGA 1T2FA 4E21A 4YYZA 4DXHA 1UXHA 1Q0LA 4CUJA 4QECA 5EMHA 3BHIA 4BQPA 5BQFA 3LLVA 2D2IA 5JDIC 3ZWPA 3WB9A 2Y93A 4XB2A 2X8LA 1R4MA 3NTRA 3W1VA 3EZYA 4BNFA 4IIUA 4JCOA 3I83A 3RBZA 2Y1DA 1PIWA 1ZSVA 4TKMA 1BVUA 1PGOA 1WWKA 4OL9A 1N7HA 3BMQB 4GX2A 1LX6A 4D42A 4IZHA 1J0XO 2Y0CA 1N9GA 3W6UA 4TKLA 1P45A 1U5CA 1H6DA 1A9YA 3GPDG 4YDRA 3R3SA 4JBGA 5THQA 3DXFA 4KQXA 4NK5A 1GUFA 3M1LA 3E48A 3CH6A 3H3JA 4II2A 2VHWA 5DNAA 4RVFA 2DLDA 3PQEA 3WJAA 4INAA 2PA3A 4HNGA 5F1KA 2QIOA 4C7JA 3C24A 5TSDA 2B36A 3DZFA 2P5UA 1I33A 1U3VA 1VLLA 2GRAA 2EKPA 2Q4BA 4FS3A 1EUDA 4Z6KA 2Y1EA 1ZXLA 3LT4A 4MP3A 4WGGA 5G0VA 1HDGO 1MA0A 3U4IA 3UF0A 5L95A 2I3AA 2VQ3A 2BFMA 3RUIA 3ST7A 3C3XA 3F47A 3S1LA 3WR5A 4GX5A 4Y98A 1EE9A 2PH3A 3GVIA 1GPJA 4DQUA 3FR7A 4I5DA 1JKFA 4CPDA 5ITWA 4OQYA 2QYTA 1B3RA 2VWQA 2BFPA 3IAHA 2PTGA 1B8PA 1KVQA 3Q0EA 4GI2A 4NBWA 4R41A 4CQMB 3ANMA 3D1LA 2VRCA 1YONA 4PFJA 4E12A 2BFOA 3PYLA 4H7PA 3EYWA 4NFYA 4DGSA 3VDQA 1HXHA 4PLZA 3T7EA 5I7FA 1LDEA 3K73O 1NPTO 1U3WA 2DFVA 3B1FA 2GLXA 3AOEA 3I9JA 5BSFA 2X9VA 4IJKA 2VT3A 3EUWA 5CAEA 1JWBB 1Y7TA 3ZU5A 1K6JA 1UP6A 4EUEA 4J16A 2V6FA 2I99A 3H4VA 5TT0A 4CODB 1UXJA 2CDCA 3KM0A 3R3JA 4R69A 3UKOA 4RL6A 4AJHA 1E3WB 3O4RA 1SNYA 1NQAO 2P91A 4EEZA 5HRUA 4IJUA 1X1TA 2VWGA 1EVYA 1DLIA 2Q2WA 5JO0A 3E5MA 4MIOA 4IDEA 3NGLA 4XYBA 1KC1A 2B83A 4JGBA 4OKIA 4W7HA 1I3LA 4IM7A 1ADGA 3GVXA 5A9RA 1O0SA 3OETA 5CDTA 3QSGA 4CQMD 1X7GA 2Q1TA 2AA3A 3ENNA 1BDMA 3BMOA 4NFHA 2FR1A 3G0OA 4R51A 4PLWA 4ILKA 3GK3A 4ALJA 5BNTA 1GPDG 4BO2A 4GSLA 4QUKA 1H6CA 2P68A 3GHHA 2OBNA 5A5EA 2W2KB 1E7YA 3NYWA 4LRSB 2OXIA 4OQZA 1Z82A 1E3JA 3CTMA 3UCEA 4PVDA 1LJ8A 1YQDA 3K2EA 1JKJA 4KOAA 1T25A 2P4QA 3IKTA 2EEZA 1EK5A 1QYXA 1RM0A 4O0LA 1HLDA 3V1UA 4BB6A 4NBTA 4GH5A 1KBZA 3PLRA 4WNCA 3WYCA 4YJFA 1SOVA 1LC0A 2B4QA 2EIHA 2Y0DA 3QA9A 4J49A 3HB4X 4M8SA 3VHRA 3ZGYA 3ZWXA 1PZGA 3DAFA 3ANNA 4BKRA 1NHWA 1NQOA 3CUKA 4YJHB 3WNVA 3DZBA 5JYDA 2JAPA 3PQDA 1KVRA 4Q39A 1AN9A 4WNIA 4UVHA 4M54A 5FFFA 3U09A 4FC7A 3TFOA 1UDCA 2I9PA 5IDXA 4YAEA 2DM6A 4BGIA 1V0JA 1HT0A 2DBZA 2AE2A 4NK4A 4DIFA 2C5AA 2LDBA 2EXXA 4W9NA 3SLGA 3GEMA 4B4WA 1P77A 4CMGA 2IEDA 2UUOA 1KIFA 3GZNA 3RKRA 2BRUA 4IDFA 3LC7O 4RO0A 3KZVA 4L8VA 5U1PA 1Z45A 5A9SB 5T57A 3PHLA 5C3MA 1LDNA 3RJ5A 2OBYA 3VPGA 3ZHYA 1XR3A 5JAMA 1BXZA 3LDHA 1OI7A 4KTVE 5KJCA 3NGXA 4BKOA 3UCXA 5F5LA 1UUFA 5DCWA 4ND4A 4RLSA 4CMAA 1FDWA 2HMVA 3FR8A 2I5PO 1KY5A 3DOCA 5B37A 4AG3A 4B8WA 3ZW8A 4A2CA 1NHGA 1ZUD1 2HMTA 4CV3A 1Y81A 4Y8VA 5JLAA 3LSYA 4GSKA 5HS6A 3ZNQA 1XU7A 1YDEA 4DTIA 4FPXA 5L4SA 2DAPA 5A02A 4MINA 1VJ1A 2Q1WA 5KTKA 3D5TA 2JCXA 4EUHA 1EBFA 1GADO 5C7LO 4CM5A 1DO8A 4BMVA 1I3MA 2VYVA 1P1HA 1YGYA 4EJMA 3I9MA 1C3VA 3ZWOA 4B3HA 4QFCA 4NG5A 2O4UX 1Q7GA 2WDZA 5G4KB 5KKAA 4YAGA 1ENOA 3RBVA 1PJLA 2UYYA 1PSDA 3JD4A 4ALLA 3IP3A 4OXNA 4EJ0A 1SAYA 4XRGA 1E5LA 1I3NA 2O50A 4FOSA 2CUKA 3ZU3A 2YZ7A 4MJLA 2G0TA 5KVVA 4DVJA 3LK7A 1TA4A 4NIMA 3SJ7A 1QYWA 2Y1FA 5A05A 3ZWNA 2ILTA 2JD0A 3IUSA 4Y67A 4M55A 3UXYA 5AOVA 3E5RA 3TSCA 5CEFA 3AK4A 4XDZA 4ND3A 4OMUA 2C2XA 4M86A 2IE0A 1E3EA 2CVZA 5GMOA 3EHEA 4DBVO 3ANLA 4QX6A 3N7UA 3NUGA 1EUCA 4BO7A 1BVRA 2XF8A 2EF1A 1VRWA 4AJLA 1HWYA 3UUWA 3CIFA 1MG0A 2GN8A 1PL6A 1WVGA 2X9NA 3ROQA 4XX0A 1DC5A 3C1TA 1PL7A 1M76A 4PRKA 1DHRA 2C20A 5G4KA 1M2WA 3U3XA 1DDOA 2C82A 2OMEA 3DWFA 1R6DA 4P8RA 4C7KA 5GZ3A 4R3NA 4GVXA 1LDMA 1VKOA 1Y1PA 1NTOA 3B6ZA 4NNJA 2VRCD 4WEOA 1XYGA 3ULKA 4DUPA 1PL8A 3OSUA 2EW2A 4GX0A 1AGNA 1B8VA 2J3KA 3ZNPA 3IDSA 4Z9YA 4BB5A 5ER6A 2HRZA 3DBLA 4Q3NA 3WDSA 5TRTA 5KWEA 3H7AA 5AVOA 3DBVO 1GQQA 3ZHXA 5I8ZA 4AJOA 1H93A 3A14A 1O9BA 4Q3BA 2ZB3A 3NAQA 1PJ3A 2SCUA 2ZKLA 3GT0A 3HB5X 3MWEB 1C0PA 3MJSA 1EFLA 1NPDA 3ITDA 2HDHA 3HN2A 2HK7A 4UUPA 1VKNA 3ASUA 3AW9A 4YPOA 5TC4A 1ADCA 2D5AA 3VTFA 2GDZA 1F06A 4ALKA 2OZPA 1GUYA 4Q3CA 1E5QA 1I32A 1PS8A 3NDRA 3OJ0A 3ZV4A 2A35A 5H83A 1ZK4A 2VWPA 2VUSA 4MOWA 1X15A 4BS9A 3TZ6A 1ISGA 3HZZA 3JQ6A 3F1LA 3JQ9A 1Q2XA 5CG1A 4E2YA 4OOFA 3L77A 1MG5A 2CMDA 4PZCA 5JYEA 1C1XA 3BMOB 4PN3A 2CF5A 5TIIA 3H65A 3TZCA 3LVFO 1TT5B 2OGUA 4NBVA 4IPTA 5JO9A 1B15A 2BI8A 4RPGA 5EJ2A 4ZQBA 3CINA 3ICPA 2WTBA 5L9AA 2V6GA 1R15A 2HLPA 2FSSA 1P1RA 2PGDA 4QQRA 1XLTA 1R66A 2W2LD 1NNUA 3DOOA 1LRKA 5CEEA 2ET6A 1OOEA 4JJIA 2IZ0A 4OM8A 5DN9A 3FNHA 4DYDA 1NWHA 4NH4A 2FR8A 2FY8A 2PV7A 3OM9A 2YV3A 4EDFA 4QO8A 1WW8A 4Y9DA 2NV6A 1B16A 3VTZA 5TGDA 3GRKA 2ZB8A 2I6TA 4WOKA 5KOIA 4RPLA 1U8FO 4QSMA 2ZQZA 1D1SA 5GY7A 1G0NA 2CDAA 3INTA 1GEEA 4O63O 4JBHA 3PJFA 4N54A 2X7HA 1ZKMA 1R4MB 1GU7A 2EP7A 4RVDA 4XD2A 1DLJA 1L1FA 1QV6A 3FNGA 1PEDA 3O8QB 2DC1A 1PGJA 1KEVA 3KYCB 4J3FA 5G2OA 4I5GA 5JMPA 3TZHA 5L53A 2DU8A 3DFZA 4XZ3A 4ALNA 4J4TA 3OJFA 1ZMTA 1P0FA 3LC2O 3SEFA 3X2FA 4A0SA 2VUTA 2NACA 4XQGA 4CQLB 2DQ4A 4BIIA 3OJEA 4BGEA 4XA8A 1GEGA 3GMDA 4XGIA 3ONDA 1P74A 3K31A 3GPIA 5JS6A 5ICMA 5KJFA 1P1KA 3FCOA 3GNTA 3LLSA 5A5FA 4Q3EA 4A73A 3OBBA 1NAHA 1ZK0A 3I9LA 3LC1O 1LNQA 3PI7A 4OSPA 4IGFA 3D3WB 2A94A 1Z7BA 1YWGO 1T4DA 2D0IA 5B4VA 4Z9FA 2X6TA 4M87A 4EJ6A 2BD0A 3RC7A 3D4OA 3OICA 4YT4A 1NAIA 5TS3A 3ZNNA 4TRMA 3JQFA 2VHXA 2AMFA 4MDHA 1LLDA 2Z1NA 3OH8A 3LF2A 4B4OA 2HRBA 2O7SA 3WX0A 4N5NA 2X86A 3VPHA 3NDIA 4CM9D 4JX8A 4DLBA 2Q46A 4RF3A 3FD8A 4YB8A 5JY1A 1V8BA 3GY0A 3BTVA 3LYLA 4IDDA 3RFTA 1IOLA 2WEKA 4Z0PA 2YHIB 3NT4A 3VOSA 3O9ZA 2NQ8A 4Z0TA 1DJNA 3EMKA 3PPIA 5CDYA 2X4GA 1N8KA 3DHEA 4Z3DA 3TJRA 3VH3A 3ZW9A 4TRRA 3GRPA 4IS3A 1XQ1A 4L4XA 4YAKA 4FFNA 3I4FA 3CSDA 3U49A 3VC7A 1XELA 1PX0A 1U4OA 1UH5A 2JFFA 4OJNA 1PGPA 2D3TA 3BA1A 3HDJA 5H82A 5BNFA 4URFA 1DFGA 4E0BA 3OIGA 4DIBA 1RJWA 3A9WA 4RPJA 1ISMA 1E0DA 3RASA 2GGSA 3TNLA 3TZKA 1QR6A 1JW9B 4CLXA 2BGLA 3P7MA 4CMIB 3HG7A 3NX4A 2QRLA 1ZEMA 4IXTA 1Y8QB 4MKXA 1EUZA 4FIZA 2Y05A 2H9IA 4L74A 2D1YA 3WTBA 1PU2A 2OP1A 4MVJG 1G0OA 3FPCA 1IPFA 3OEYA 4P4LA 3WJ7A 2WSBA 1JVBA 1KYQA 4CMJA 1QG6A 1U4SA 4AFNA 1VL0A 2PGLA 3KYDB 2BLLA 3U4CA 3I9NA 3CMMA 4U0JA 1DRWA 3PHJA 1BG6A 5B4TA 4DIOA 4R4JA 3AU8A 1DB3A 4IDCA 4ZQGA 1ULUA 3T4EA 3ETGA 3KRTA 3BMQA 4Q3AA 2C07A 4CM3A 4Y6PA 2Y0EA 3QVSA 2C59A 3IUPA 3FF4A 1E7QA 3NV9A 5JY6A 4UEKA 1GZ3A 2AE1A 4CL8A 1OC4A 1YXMA 2O2SA 3JQEA 2FMUA 2VNSA 3HE3A 4GX1A 1EVIA 1LQUA 2IYPA 1SC6A 2Q45A 1E7WA 3EK2A 3PIIA 5L45A 3R6DA 3CE6A 1O8CA 3I9OA 3WIDA 3WICA 4YTEA 5ADHA 3D0OA 3WQQA 1U3UA 5F1PA 3P5SA 2XXBA 3GAZA 3NT5A 3IKVA 3ZZNA 4FFOA 1PTJA 5COAA 3W4JA 3WGQA 1B8UA 1EZ4A 1N1EA 3G17A 4H16A 1X14A 3AOGA 3JYOA 3O38A 3ZV6A 3OJOA 4XIJA 3GC6A 4PG6A 5GZ1A 4JN6B 2C7VA 4OH1A 4B8ZA 3D4PA 1N5DA 4U8GA 5TX7A 1LTHR 1CQJA 2EERA 1WZIA 3VH1A 4J4HA 1DOHA 2ZK7A 4CLHA 4KMSA 1KERA 5KVCA 2B4TO 2QHXA 4YRBA 1YJ8A 3PYXA 1AXGA 4PLGA 4EW6A 1UJMA 4KDEA 1Y8QA 2PKRA 2DPHA 2X5OA 1IYZA 4YJGA 3PP8A 3RUEA 1B3BA 3EGOA 1PGNA 1Q7BA 1VJ0A 1X7HA 1ZW1A 4UAGA 2GD1O 3UICA 1T2AA 5TLSA 4PZDA 3GFGA 4R3WA 2EJVA 2Z5LA 3M2PA 1YO6A 3FHLA 1TB4A 4CM9A 1J49A 4I08A 3PEFA 1C1XB 2V6BA 1GTMA 4E13A 3KLMX 3KSUA 2NWQA 5I8WA 1YH3A 1UP4A 3P2YA 1BXGB 2O3QA 1DC4A 3SVTA 8LDHA 2P4HX 3RC1A 1SB9A 2AQHA 3BAZA 5FWNA 2AEFA 4CV0A 3ZWYA 2GASA 5L4NA 1YB4A 3QV1A 3FTNA 4BNIA 2R00C 3H2SA 4S3MA 3CZRA 3FBTA 4ESOA 5JE8A 1D3AA 5JSFA 5A4DA 2FPIA 4II3A 3M2TA 4O5OA 2J3IA 2QYSA 1UZNA 3ZU4A 4KWIA 3ZHZA 3QHAA 1R0LA 5I9NA 2HUNA 1EFKA 1PR9A 3PJEA 1F8GA 1Q7CA 4IUYA 4IZIA 2PZLA 3JCZA 2BHLA 2A4KA 3GF4A 3JQ8B 5TT1A 2C7GA 3G3EA 4W9NC 2Q99A 4HFJA 4U5QA 2NNLD 1CQIA 3RCBA 4YJHA 3QW2A 4OIMA 4ZD6A 1CF2O 4J91A 4A5OA 1ENPA 3PWSA 3MWDB 3WOHA 4FFRA 5KVSA 4PLPA 4PLVA 2X58A 3BTOA 3NT2A 2RCYA 1N9GB 2PH5A 2VWHA 3I6QA 4YAJA 4BO8A 4XQEA 5ENVA 2YHIA 1PZHA 4BVAA 3EZLA 5JDIA 2I3GA 3Q3CA 5COBA 1AE1A 1CIVA 3RUHA 3UVEA 2O2YA 1KVTA 2GZ1A 3GAFA 4CLDA 5B1YA 3GEGA 3RUAA 1QKIA 2UAGA 5IZCC 1WMBA 5HM8A 1XSEA 2C54A 2GN4A 4JNKA 4DQXA 3RFVA 2JL1A 1XG5A 2UUPA 2O3RA 5JC8A 3S2FA 1MUUA 3D3WA 4AJEA 1PJ2A 3GEDA 4PRLA 4ZQEA 5B4UA 5K0ZA 4A03A 3PZRA 7ADHA 4W99A 3C8MA 3GDFA 4CM4B 5JXWA 2QQ5A 2G1UA 2JD1A 2QRJA 3PWZA 1T24A 4J7XA 4NBUA 4UULA 2IXAA 3PJDA 2ZCUA 1OC2A 2FPPA 1BSVA 4G65A 1HZJA 3N74A 2RIRA 1ZJYA 4UUOA 3GVPA 2VTDA 5H81A 1GV1A 5L7WA 2IODA 1GYRA 2EG9A 4WK6A 1ZSNA 4DC1A 5KKCA 5BR7A 3CXRA 4I5EA 5JW6A 5L4LA 2Y99A 2PGJA 2R00A 3VZPA 1VSVA 1P1JA 1PR3A 2B4RO 1AXEA 4RGBA 2C29D 1E1KA 3ZHBA 1HE2A 4YQYA 1W6UA 3RU9A 2DTXA 2YFHA 2DVMA 2NADA 3PQFA 2AQKA 4HP8A 3QWHA 4BKQA 4CM4A 1ENYA 4EZBA 3DOJA 4KUEA 3BMNB 4XJSA 3A28A 1VE9A 1I2BA 2O48X 4TZKA 2EWMA 5DCUA 4FBGA 4LGVA 4BO4A 2Y68A 4WLEA 3HUDA 4BGUA 1NFFA 2GNAA 3GN2A 4CMKA 5C5IA 4FJ1A 2PFGA 1R12A 3Q2KA 3NKLA 4D44A 2EW8A 1UXIA 3ZI0A 4IDGA 2JCYA 1E92A 3C1OA 3A1NA 4BO5A 1V9LA 1A9ZA 4A10A 5DULA 3RWBA 2VCYA 4WE3A 4XEHA 1ONNA 3V2UA 1BTOA 5JAIA 5HS4A 3QVXA 1H9BA 3W8EA 2D4AA 4NDNE 4XQCA 1TT7A 3I52A 4N5MA 1DAPA 4O1MA 3OIFA 3DZIA 1I30A 4JXKA 1E7RA 2OOSA 4WLFA 4IQ0A 1IZ0A 4BNMA 5KVQA 3C85A 1LSJA 2TMDA 3WS7A 4AJ1A 3E9MA 3OECA 3W8DA 4R1SA 1E6UA 2VTEA 2TMGA 3OP4A 2BH9A 4MP6A 4JQCA 2GPTA 4E2WA 1HRDA 1GR0A 3U4DA 2E82A 2VHVA 3STHA 3BMNA 1A7AA 4L4SA 4BNVA 1IUKA 1UDBA 1NVGA 2P9EA 4LISA 4WCFC 4F3YA 2J8ZA 4BNHA 5LC1A 1CRWG 4UUNA 4AJKA 4L73A 3MCVA 4OO3A 1Z74A 2VHZA 4WECA 2NTNA 3WYBA 4NI5A 5JDCA 1H6AA 5TNXA 1YBMA 4XIYA 2QZ9A 6LDHA 5T8KC 1VL6A 1NFRA 3SBOA 1YOVB 2ZTVA 4QO7A 1GL3A 1F0YA 1DHTA 3DONA 1R4NA 1EVZA 4PG7A 3TWOA 3HFSA 5IXSA 2Y1OA 4ZVVA 4WJZA 2IXBA 1VI2A 3DTTA 4RQTA 5EESA 1P33A 3AI1A 1DRUA 3JYPA 5CDUA 2VOJA 2CVOA 3UHAA 2FN7A 4EEXA 4OAQA 4U7WA 5HTOA 1PWXA 1QYDA 2J3JA 5KJEA 1Y8RB 2RH8A 1CYDA 4J1TA 3S2EA 4HUJA 3JYLA 2VZ0A 5I7EA 5IZ4A 3QVOA 2O3TA 4E32A 5L7YA 4PGFA 2RAFA 3FRJA 4BO3A 3T7CA 1CDOA 1NVTA 3PDJA 2B69A 4D0RA 1XQ6A 2A92A 3I23A 4MVJH 3RIHA 1T2EA 1JKIA 1CEQA 1KOLA 2I67A 1QMGA 4BO9A 2CSUA 3B20A 3HQ4O 3ZH2A 2QRKA 5KCZA 5T6BA 1DPGA 1MC5A 2G5CA 3C7CB 1N2SA 2JKVA 3WGIA 1U28A 4GQAA 1LSSA 4TZTA 1R37A 1SO8A 3WGYA 1ZBQA 2HU2A 2J5RA 4B79A 2BI7A 4ZQFA 3ZV5A 2AW5A 2HSDA 1ZIDA 3EW7A 3BHMA 3GN1A 1U7TA 1FDSA 4RQUA 5KJ1A 2W2LA 2VN8A 3QIVA 3NDJA 4MVJE 1GYPA 2UDPA 5G0TA 3VPXA 4K26A 4B7CA 5EPOA 1ZVMA 2YFQA 1YRLA 3WFJA 2NM0A 4ID9A 5U4QA 3IJRA 4O59O 4BUCA 4DC0A 2J3HA 3E9NA 2OHXA 3WQSB 5ICSA 5KIAA 4EI2A 5DZSA 2FOIA 3ADOA 5IJZA 3WSVA 1VJTA 3FBGA 4FFPA 4JROA 5EIOA 3A06A 4CM6A 3I4CA 3AUUA 1EVJA 4Q3DA 3RI3A 1WNTA 1ID1A 1MB4A 4J4BA 3AI3A 1VPDA 5HA5A 4RF5A 3FSRA 1LSOA 1JWAB 4N5LA 1FDUA 4RCVA 4XYGA 1QLHA 2GYYA 4E33A 3PK0A 1G6KA 1LDYA 4PLFA 4ZRMA 2IZZA 2JAHA 4WCFA 2J5QA 1V35A 4CUZA 3PJGA 2EJWA 2PR2A 1ENZA 3G1UA 4XB1A 1YDWA 4CLEA 2B0JA 4NR0A 2EGHA 1QP8A 3ROMA 1UXKA 3VZSA 1DIHA 1C0LA 3L6DA 4CQLA 1HDCA 1PGQA 3OMLA 2DBRA 1JDJA 1X7DA 3D64A 4AVYA 4EYEA 2NVBA 3I9KA 2VZ8A 4GGOA 4D43A 4P4NA 8ADHA 2V7PA 4WOJA 2ZATA 3K8ZA 1V3UA 3RAJA 4BNLA 5KNLA 1YQXA 1V3VA 3MJCA 2GZ3A 3RKUA 2P9GA 2NUAA 3RC9A 3NJ8A 2VYVD 1KVUA 4UEJA 3FNFA 3WMXA 2P5YA 3PIDA 4Q9NA 4AJNA 3JV7A 4TVBA 4ZGWA 5BSGA 4RLHA 1XHLA 4XGNA 3WGTA 1HL3A 1HDYA 4N18A 4RV9A 4RZIA 2YDYA 2AEMA 4GLLA 5JPIA 2GUGA 1PZEA 1E1LA 1HYGA 1RM4A 5A03A 3DZKA 5LDGA 1PQPA 1OAAA 1U5AA 4R5HA 5TQVA 5F21A 2VRBA 1K6IA 2HJSA 4X54A 2WD8A 2ZTMA 2NTVA 3F5SA 6ADHA 2YQ4A 1F12A 1HZZA 4KDFA 1HSOA 1ZK2A 3T4XA 5DBFA 2BKAA 5BT9A 5C7IO 2R2GA 5CHEA 5IZCA 4DMMA 4EBFA 1J6UA 1LDBA 2PD3A 3BZUA 4E5NA 4CM8A 1NFQA 1TVEA 3GLQA 1VSUA 3TOXA 1EK6A 1XEAA 3FWZA 3ZN2A 4B3IA 2BGMA 4P38A 3COSA 1T1SA 1QXSA 3F5QA 3LZ6A 3OQ6A 4IXWA 5L51A 2H6EA 4UVIA 1X0XA 4YT5A 3WQRA 4EITA 1LU9A 3GNSA 1ISJA 4AICA 4J9VA 2WMDA 4J6FA 4A27A 1YKFA 2PY6A 1EEHA 3RFXA 5DCYA 3LF1A 3DO5A 1XCBA 1G1AA 1Y5RA 4GWGA 4UREA 1P3DA 1JLLA 3BMCB 3GUYA 4YQZA 5IXYA 1DSSG 1MGOA 1K3TA 5JCXA 2VUUA 4JP3A 5U9CA 2ZJ0A 2NU9A 4WASA 2HCTA 1I10A 2ZB7A 3M1AA 2P2SA 1O94A 2J6IA 3KO8A 2W4QA 3RJ9A 2J5KA 2PZKA 2F00A 3SX2A 3E1KA 3JD0A 5KJ6A 4R16A 1OBFO 1SPXA 1UAGA 1GAEO 2Q49A 4D3SA 3TPCA 5DP1A 4AJ4A 5A9TA 2VZ9A 1DIAA 4JP2A 4L76A 3PHHA 4BNZA 4D45A 4YRAA 4BNNA 1CJCA 3L6OO 3A4VA 4NJMB 3HSKA 3UFXA 4B3JA 5TJHA 3B1KA 3VPFA 1B0AA 3GFBA 3CKYA 1E7MA 1DJQA 5FI3A 4RVHA 3DMTA 3UH1A 2V65A 4FFMA 3DDNA 1W8DA 3NJ4A 3W4KA 1ZJZA 4NU5A 4FD3A 3SJUA 4PCVA 4CMBA 1YL5A 2HJRA 2PZJA 1D1TA 3RSHA 1UAYA 3OQBA 4M49A 4RORA 2IYOA 2A9FA 4KP7A 1NR7A 1D4FA 2QZZA 3IS3A 4NJMA 5I7SA 1I5RA 5C37A 3IL2A 1ONPA 1SEVA 1QSGA 4R68A 4D7AA 1LBEA 1Z73A 3NTQA 4BKPA 4E5KA 4EGFA 2RBEA 3ZWAA 5BSHA 5JCJD 4DPLA 1IZ9A 2X22A 3MTGA 3WYEA 4MIEA 3AI2A 1A4UA 5JDCC 1ZSYA 3IP1A 4YT2A 5LDHA 1P0CA 4IQGA 3U0BA 2PKQP 3SLKA 1KETA 4P22A 5CEJA 1WLYA 4O6VA 5CDSA 3AM3A 1BXGA 2D59A 4BHTA 2ZTLA 3LT2A 2RHRA 2GCGA 3AWDA 4JJFA 1GYQA 3K92A 3R0IA 4GGPA 2HKIA 2JCVA 3E18A 3DTYA 3OFSA 3L9WA 5DOZA 2YV1A 1NX6A 1ISFA 3MOGA 1UZMA 4UVGA 4ZU3A 2B35A 2VT2A 3GMSA 4TWRA 3DBRA 1B26A 4I9UA 3DZGA 3HDYA 3E03A 3NRCA 3TQHA 4MO2A 1H9AA 4E3ZA 4E30A 4Z0HO 4U6SA 1LUAA 1U7HA 4GPD1 4RVSA 2H63A 3F4LA 4BNJA 3GDGA 1QV7A 2WJPA 3ETEA 2BF7A 1RM3A 1MFPA 4IS2A 4Y6SA 2HK9A 1HTBA 4K28A 1E3IA 3GVCA 3CPSA 3GG9A 4KTTE 4BMSA 1GQ2A 1JU9A 2YUTA 2IRWA 3LT1A 1HE5A 2IZ1A 4TVOA 3IC5A 4BQRA 1M66A 1W0CA 3GZ4A 3OJLA 3W8FA 2DKNA 1GQYA 1TLTA 1K5HA 5A04A 3KB6A 3QVTA 5ENDA 5I7VA 1WDKA 1RKXA 2V6MA 1R0KA 3TF5A 4LMPA
chains in the Genus database with same CATH superfamily
3HBFA 3KOMA 2O3JA 1Y82A 4M89A 3PA8A 4DV0B 3PSHA 4I6GA 1T5SA 1XTSA 2W90A 3RK4A 1Q12A 1LVUA 1Z5WA 2GBIA 2Y1KA 1PJCA 2VSQA 1XZEA 5MN6A 1PLJA 1U6KA 1IULA 2VP2A 4QASA 4ZT3A 1ORWA 1JEYA 3HJFA 3L06A 1E2PA 1XTQA 3ZE6A 2OCBA 1K8XB 4FHCA 2H1LA 4E51A 1R8SA 2F1HA 4YMWA 4XR4A 4L5AA 1ZN7A 4BQFA 1U94A 1NUPA 2GNOA 3K5HA 4FJ2A 2WF6A 4U8HA 4H3VA 4XQ9A 1RP1A 4FBLA 1VCHA 1ZN9A 4KR9A 3E8SA 4MQEB 5TQ2A 1MN6A 3O93A 2HXGA 1SVSA 1GGVA 2FZVA 3V2GA 4HPWA 3AEYA 3N76A 1WF3A 4Q0MA 1VG9B 1UM9B 1M6HA 3I2FA 1E1QD 2PKQO 3EE6A 1CQWA 3BGDA 2HCJB 2FFRA 3PUZA 4C3OB 2REXB 2R8OA 4GAEA 1C2YA 2JHPA 1H69A 5AKLA 1MNAA 1GPNA 4HGNA 4PG4A 1AK9A 4IMRA 2BE9A 4QVGA 4BRWA 2OORC 2RB4A 3O31A 2DWCA 3GV0A 4I3HA 4E46A 3A2KA 1VB3A 1PK7A 1Y9AA 1KA9H 1FYEA 4OYRA 2A5YB 4G5XA 1KYZA 3IVAA 3S2IA 1BA2A 4JLDA 1W9HA 3ASYA 3E7DA 3N5CA 4M8IA 1DMSA 1VPWA 1GITA 1OXVA 1O54A 1QLJA 4OXRA 4BX8A 2W2TA 4Q7LA 2O7QA 1VC2A 3OPYI 1OLOA 3RS8A 4PNHA 4CM8B 1SUIA 4HEA6 1U0SY 2BEWB 2GNPA 2IOHA 2QTZA 1FFHA 4S1OA 4QEDA 5EWJB 5FWAA 5KTMA 4R6WA 1SBNE 1SB8A 3OE5A 1KK2A 3CISA 1BMTA 1B0PA 1MORA 1PQWA 2IHUA 2Q3EA 2W0MA 2YXEA 3FDJA 3RROA 3PFBA 3ZKWA 4OHVA 2Z98A 4RJKA 5K0JA 4CG1A 4W5RA 1IY9A 2WUGA 5DHFA 4DM7A 1Y7HA 2JPDA 4QDXA 3Q10A 4FCCA 2QQFA 1E4EA 2IYEA 5B3JC 1U1IA 1NRIA 3L3BA 1L5LA 3IAUA 3QZUA 2FZGA 2OL4A 2A30A 3C4QA 4X3CA 1LJLA 1TMKA 3B89A 4AWAA 2R84A 5KYGA 3O8CA 3B3JA 4PLTA 1P7YA 5K2OA 3MK31 3LXUX 1RPNA 3AF0A 1N2JA 3ZK7A 4AP5A 2IZ6A 4C06A 5CLGA 3OPNA 2QQGA 4B7UA 4DEXA 4DG5A 3IKJA 3IHLA 2O8NA 2PSEA 1P2BA 3DEIA 5K6AC 1A76A 2POQX 2HBZA 3N0RA 2F67A 1M0SA 1MJHA 3UMSA 2H3HA 2VJCA 3DMNA 3RV3A 3FVVA 2GF2A 2AJDA 4X6XA 4GR4A 5FD8A 4QOGA 2E48A 2QD5A 4AX4A 2BL4A 5JWHA 3AFMA 1ZM7A 4R1PA 4XRRA 3I5UA 2QM0A 3MFYA 4MQUA 3QXCA 4TTVA 5ALEA 5EG5A 4CU2A 1KKLA 2C4VA 3AY3A 4RPKA 4U7TB 4QTYA 5G3ZA 4R54A 2GBFA 3RAEC 5M3BA 2NU7A 5IYZA 1AZSC 1AURA 5C52B 2IIBA 3GZNB 4JLWA 1MV8A 2JEOA 4WZ6A 3TCNA 3DUWA 1FP4A 1HTTA 2B1JA 3DBLB 4NJOA 3TE7A 2GR9A 1S2GA 3AF1A 1JA1A 5HIMA 1Y7LA 2W98A 5T8KA 5I9LA 1ZAYA 2V1UA 3D6MA 4DR4B 3AY7A 3FMFA 2AN5A 4FD2A 4WL0A 1MD9A 3EBOA 3IUEA 3DC2A 3S1AA 2PLAA 1CERA 4I8XA 3VC3A 3U61B 1X8JA 4RUKA 1BD4A 3PTZA 3MQ2A 4O2AA 4DPKA 4DDWA 2R97A 5EQTA 3AR8A 2AFHE 3H05A 2YDXA 4IO0A 4OBWA 3EF1A 1L9KA 1YUNA 3HNPA 3PIRA 3D81A 2OBLA 2O6LA 4L5CA 3CX4A 2PS3A 5EJAA 1E2HA 2PK3A 3UKJA 1IAVA 5ALMA 5K99A 3QEMA 3GLGB 2Y66A 1XZNA 1FXUA 1WDMA 3VR5D 2FU5C 5BSEA 3BSFA 5JJ5A 4BDSA 1F9AA 1LX7A 1YZGA 2E4VA 2PANA 3A3YA 3O26A 3ZV3A 4B2PA 4Z54A 4Y9TA 4HXYA 2NU7B 1RP7A 1E1NA 3WKDA 3B5IA 1YJXA 5KU7A 3H2YA 2IHNA 3GJYA 3FSEA 2VYFA 1DFIA 2XOKA 3LLCA 4UVEA 5KAPA 3TAXA 3WGZA 1OXSC 2J7KA 1I2ZA 4I36A 3ZDRA 3S8YA 1QZUA 2QS9A 3N2YA 2D00A 2CK3D 4CEJB 3DYBA 4NONA 4TMVA 2QGFA 5FCDA 2H1OA 1A72A 3EEIA 5CRIA 4PYLA 3RJMA 1E0KA 1KAGA 2YL2A 3W5JA 1AKTA 1P5HA 2CDBA 1Z4NA 1XQXA 1HT1E 5TQ0A 1SHKA 3E4DA 4JKIA 3FJ1A 1WZCA 2P0EA 1GZVA 1DWUA 4L75A 4GLBA 2R1VB 5EXPA 4AF6A 5BN3B 2O8FA 3IELA 2P9TA 1I1NA 2CE2X 2E3JA 4Z1OA 1M6VA 3WRVA 2G7ZA 2PZFA 3D1VA 4G1CA 1ECFA 1LDGA 3M9XA 1UBLS 3KSZO 1OX4A 3TNJA 1MO2A 1K7CA 1Z0JA 3G8BA 1KGSA 1VZ3A 2ZI6A 2WK1A 2DSTA 4AKHA 2FP4A 2OD7A 4EF5A 1CHNA 4KC0A 3UHPA 4OYYA 3D6TB 3JPYA 4NAUA 4LAFA 3RSOA 4H7HA 5HCNA 3OFKA 3GHYA 4ISCA 1IUOA 4Y18A 4A91A 4C3VA 1W0JD 1J0AA 4OK5A 4PNPA 3T7KA 4I1PA 2AUMA 2GJKA 3V1KA 4QOFA 2ZIWB 4II7A 1V2HE 2MU1A 3LK6A 3VI3B 1KDVA 1XCJA 2P0AA 2R96A 4GXNA 5ICCA 1L4LA 1DIRA 1RE0A 2A84A 3H19A 1R0ZA 1PFGA 2ZZMA 3R5FA 3CVJA 3TKYA 3Q6NA 4JL5A 4LOLA 1X7XB 3HVHA 2PLNA 4XW2A 4DWJA 3BS4A 2J48A 4DC9A 1I2CA 1ECLA 3R6GA 1GTG1 4PZEA 1PNQA 4BRUA 2I4MA 1RFGE 1PYDA 2X8JA 3ENKA 5A06A 2QRUA 1S2OA 1NYTA 2EJBA 3CXUA 3V1MA 1QOZA 2PMEA 3RTBA 3T1QA 1LK0A 2JFGA 4KQ1A 4ND2A 3NIWA 2PPLA 1X38A 2R11A 4PZPA 3A9RA 4XR9A 3E7PA 1KYIA 3OIUA 4JP8A 1YL6A 221PA 1X42A 5DSXA 4B2YA 3F90A 1Y9DA 4JC0A 3PX7A 1WKBA 4BECA 3C98A 5TQ2B 3SKYA 3VA7A 2EW1A 2M6KA 1NR5A 2HGZA 1DWPA 3I64A 4WESA 1SUPA 3UAGA 3PTLA 3KXIA 2FZLA 4L7VA 3KKPA 2PUFA 3W5IA 4DLKA 5FWYA 3NHUA 1FZTA 2RG1A 4OI2A 3EIFA 5KTOA 2OB1A 4UVDA 4BATA 4Z9XA 5AUNB 3TLCA 3G2LA 5HWSA 4DBLC 2P5TB 3QE2A 4KMOA 5FB3A 1KAQA 4UATA 2XOEA 4FOPA 4DCMA 3G02A 1JMVA 4H15A 3DKVA 2ZBDA 4LHXA 1QJCA 3AR3A 4AX8A 2H1FA 4CUKA 1K86A 2DT5A 2M2IA 2AC4A 5EN4A 4D80A 5BN5A 1NXTA 2B5OA 4KYTA 4ENUA 1KAHA 3LBIA 4B4VA 4B3MB 4DWVA 3M4JA 1XRMA 2P4EA 1ZOIA 3F96A 5EEHA 3AZOA 3BYZA 2YX1A 2ANCA 5CGQB 4EMSA 5M2QA 4WCFB 3TE6A 4J90A 4IZOA 2UVDA 5IW8A 2ZYGA 4OHYA 3KZMA 4IIJF 2OCIA 1DT3A 2NV2B 1W5EA 3F5MA 1DGQA 1ZGCA 2WFZA 2QRQA 3DD5A 1L7DA 2O4CA 1US8B 3HPQA 2HHJA 4ZXPA 1E0SA 1C9MA 1A82A 1R6XA 4C6TB 5MF6A 3EWNA 2ATEA 3ECSA 2PRJA 3LP8A 3NHYA 4Q82A 1GFSA 5DMHA 1XJWA 1V1JA 1ZNQO 2HLHA 2JCBA 3H9GA 3LY5A 3KBOA 3OF5A 5AK6A 3OY7A 3L9XA 4IGEA 3VVMA 3PDHA 3TOCA 1TU3A 2C0CA 1GNTA 2OUIA 5CLQA 2J5BA 5BNIA 3OIWA 3J7TA 2Q7DA 4YCAA 1BO6A 4LHWA 1WZUA 3KSRA 2ZTUA 3SEQA 4HXGA 3SXPA 5IF9A 1IJBA 5FTMA 1I1OA 1FUKA 3TRIA 3Q2IA 1MABB 3K20A 3FMVA 3OCVA 3FLMA 3WY9A 2VP9A 1RYDA 1OGIA 1UKYA 4IICA 2QN8A 1Y6QA 1LS1A 1WCIA 2DP4E 2CHEA 2GX6A 2G67A 2JH8A 3FPLA 3R20A 2IIVA 3EWAA 3H2IA 4LYFA 3MCAA 4Q1EA 1P0QA 2M9MA 2QWXA 4PSAA 1GDTA 1TUEA 2Z4TA 4N39A 1ODLA 4ENWA 5FEMA 1K8QA 1OKKA 2DPGA 1P80A 4YREA 4AJIA 3SS9X 5I9SA 2SHKA 4Q4CA 1I4LD 1EWKA 4J1NA 1XXHB 1M8JA 4DLLA 3HXOA 4WKBA 2MMCA 1VG0B 5A5VA 4OHBA 3EY4A 1ZR4A 4KXXA 4A0RA 4PQYA 3ESRA 4QGFA 3LCJA 2IJGX 2OV4A 1H23A 2IDJA 2GN1A 2FG5A 3L7OA 5IX8A 1J70A 2LVBA 5D5HA 4PPYA 3IP8A 1XKLA 1Z4MA 3CEAA 4FZRA 4J0IA 2I4IA 4P3YA 4ZRNA 5REQB 3GPLA 2QDXA 5AXAA 1F7VA 1C0KA 2OZVA 3AJRA 1D07A 4U3JB 2WJ4A 2VQEB 4EJ2A 4ZKEA 1CSEE 3ILVA 4CM1A 2C97A 3MVEA 1EESA 1H0KA 4GXRA 4RDCA 3P20A 4N3GA 3IJPA 3V1YA 2PLRA 2ZJ7A 4MI6A 2IWRA 1PHPA 4UHHA 3WGHA 1ZJJA 2PL1A 1IK6A 1RQGA 4V0KA 1YZ3A 4FBMA 1ZC4A 5JU6A 3TW0A 3G2MA 4OTZA 4I14A 2OAQ1 3AJDA 5C35A 1CY7A 3G2HA 4TLAA 2A9QA 3W9YA 1HQYE 1TI7A 1XRLA 2JZCA 5HDBB 3H9EO 3PNOA 1SCDA 2H4YA 2YZMA 1V3TA 3KR1A 1H2YA 4QUHA 3N3AC 4DCJA 1YD7A 1A71A 1TMYA 3QITA 3UWMA 4YPFA 2ZBUA 4FHEA 1PJTA 4WLNA 2JGMA 4JOSA 1AUPA 2OCYC 3WGNA 3HCRA 3HHPA 1KO8A 3UJ7A 3RVOA 1BXKA 2UZAA 4L78A 3UK2A 1BDHA 1QH1B 4BE7B 3KFXA 16PKA 1PR0A 2FCAA 3IGFA 3VHXB 3N75A 1NA5A 3AUFA 4OQ4A 1EGHA 3PLNA 5I3ZA 4F8JA 4RJTA 3C5CA 2HB6A 3HO8A 3KKZA 4HGZA 3WLLA 4A8HA 3OT1A 3G2QA 2VSOA 2NLOA 3DFUA 4RESA 4YRMA 2VPYA 5J1SB 4YGYA 2IC5A 2XAAA 1TXGA 1ZD5A 5AOAA 3WLRA 3EZ6A 3EXIB 3ZIAD 2PD6A 1UMDB 2OAEA 1EE2A 3M3DA 3G2JA 1IY1A 4KO1S 5F5NA 1Z39A 1K9SA 3F49S 1JSZA 2VYNA 4BVKA 4BNKA 4JBNA 1OLUB 1TCCA 3FUUA 4IBOA 3V6MA 3CLRC 4ZCRA 7YASA 3M3HA 5ALFA 1E2BA 3HXLA 3H9QA 1KYTA 4BV9A 4EX7A 4LE2A 3RW9A 3LTNC 3H2ZA 1V5WA 2AJBA 4KOEC 1QB7A 3CB4A 4CR7A 1ZVKA 3JS5A 4CV1A 2OCKA 4UZFA 4X1OA 1E96A 3BL8A 4JIGA 2X0IA 4R84A 2JI7A 5KNCH 1XZDA 3Q8MA 1YZFA 5SYAA 2DH5A 3BGIA 3KJFA 1TQHA 3AEXA 1NQ5A 2NSDA 1P2GA 1ORHA 4R9VA 4BGVA 3CJQA 2YY6A 4IIEA 5AKZA 1XCOA 3BJRA 1S9HA 5JHHB 2G4VA 1AHIA 3BWCA 3AETB 4WOCA 4MZXA 5JVDA 3C8UA 1XB2A 4BV8A 2Y1GA 1SKYB 4FB5A 1BE6A 1GLVA 3DL2A 1A27A 3O1LA 3QVWA 1BHSA 4G67A 4NS4A 1KR5A 4X91A 1HYHA 4LBYA 4DLVA 4ZHSA 2IYLD 4ZYZA 4QARA 2OESA 5H7XA 4QJBA 2E37A 1SK9A 2EJUA 1OFHA 4YMSA 4A7PA 2WYWA 2FP4B 4NWIA 3CZMA 3LGAA 3H9UA 4TLBA 3KT0A 2OILA 4MGKR 1GGKA 3TNDA 1Y3HA 1ZUIA 1NUQA 1HDIA 1K08A 1W88A 3C4JA 3L7JA 5HUQA 1QGDA 4XYMA 4PFQA 4CT0A 1QOPB 4YUVA 4DREA 3CKKA 3UV7A 3CJTA 3Q6IA 3L7MA 5AYVA 3JZIA 4JR2A 4KLRA 5E2AA 2ZUCA 1GNQA 4QDTA 3U3RA 5TVGA 5HOEA 4CXMA 4HNHA 3UYLA 4DS3A 5EMLA 4KJXA 4ZCSA 1H2FA 3G0BA 5AUOB 1LXCA 1YIDA 4K2AA 1HX7A 2H11A 3KQYA 4UMFA 3I6IA 2QAGA 3TL6A 3W5BA 1TQ4A 4M1ZA 3SC4A 3LHDA 1G60A 5CCEA 3DOHA 5DB4A 2HMSA 2FKNA 1SCKA 1G9SA 2XEXA 4HSEA 4QTZA 2C57A 3X44A 5KO2A 1KOFA 2BJHA 4BU0A 5AVUA 3DMGA 4BAGA 1NBAA 1S8FA 3LT0A 3M9WA 1XA4A 2F2TA 2CBXA 4GLFA 3B9PA 3ZDFA 2DR3A 4QDJA 4OF4A 3WMEA 4OHPA 3UKDA 3F3KA 3ZE7A 2QV7A 1M3SA 5LIPA 2WW8A 3D3EA 3TTTA 2HJVA 5EQFA 1V8FA 3KKQA 4FFBA 4MWSA 1CWUA 3GMTA 3QP9A 5DASA 3HXQA 2DLCX 4JBXA 2DUUA 1W34A 1TJ4A 1JQAA 2Z5FA 1DFHA 4PAWA 3HEMA 4KR6A 2D5CA 2HWWA 2AT1A 4G25A 4MUXA 3WLFA 1H85A 1NI5A 2R44A 4WZBA 1T9BA 3KV3O 1GY8A 1SD2A 2QD1A 3SC3A 4IW3B 1FMCA 1PNTA 3U7IA 1U2TA 4K03A 4XB6B 4CW7A 3TDKA 2R7MA 4G5HA 4XX0B 1CUEA 1RJEA 1JA0A 2HLNA 3CC8A 5D6OA 2CF6A 4R5MA 2W8ZA 2NU8A 4ED9A 1KEEA 5IG2A 5DTIA 4M8NE 5IT9A 1AHPA 2CZCA 1N2GA 3HRHA 2OP0A 4BFYA 1GCIA 2HO4A 5EIXA 2A7QA 3FTFA 4L02A 4GI7A 2YOGA 1ZM3A 7GPBA 3EARA 1DUVG 1O8BA 3OFVA 3D4NA 3OZDA 4PX3A 6REQB 2FPPB 1YJ5A 1RRFA 1YTLA 1XTUA 1VE5A 1WBDA 3GLFB 2R8ZA 3D0RA 4JT8A 5ALKA 5JMTA 2NO7A 4OMFG 3UK1A 1FDTA 3DVSX 1MVOA 3ZYZA 4CG0A 3K15A 4JBIA 4MR9B 5JCJA 4L1KA 4M0MA 2LDXA 3TN7A 3U5TA 3IB6A 3SQXA 3AFIA 1G3MA 2G71A 4B3RB 4KE7A 5G0UA 1GCOA 4K6OA 3V1TC 4QPJC 3LUAA 3MAGA 4BKUA 4YRDA 1ZGBA 4ENVA 1KGDA 2CVQA 4NXMB 3DZJA 2FDXA 4MWZA 2X77A 4C78A 1AV6A 5D7NA 3WMGA 1N6OA 4FFSA 4OKNA 1YR3A 3AKYA 3D2AA 2TMYA 4W5WA 1ORDA 4CLRA 3GLHB 2OV2A 1W5AA 1JAXA 5ALLA 1DKMA 2I2BA 3MBOA 5FI1B 2MDTA 4PU0A 2PT7A 1HE3A 4GOOD 1H2BA 2X5KO 5KMGA 3EFHA 4H7FA 1XMOB 1UKBA 4B4DA 4O4JA 3QEOA 3W6ZA 2FH5B 2OXTA 1XALA 13PKA 1LH0A 1MT0A 2ORYA 4F3RA 3O8OA 1JXMA 1PRYA 4ONEA 1JAYA 2HBYA 4IEEA 3ZWWA 2BTQB 3SP1A 2G9ZA 2FQWA 2G4CA 4NZ9A 2V4ZA 2C03A 4AURA 1KWGA 3GNQA 3CF0A 4PWYA 1K2WA 4OXYA 2ONJA 2ZBPA 4QBIA 3OWOA 3KXDA 4QICA 5E6UB 2PGAA 3ADPA 4LQDA 5K51A 3RARA 4CZ2A 3ND6A 4BFCA 1J25A 4FN4A 1OXMA 5K6AA 3KT6A 1AU9A 2H5EA 3S2GA 4ZCLA 4TMZA 3V2HA 4EPTA 1YSCA 1E5VA 2QXUA 2NVUB 5INTA 3R23A 3L4BA 5A4JA 5IVKA 2XNKA 1A5AB 1IDOA 4QG7A 4MVXA 3MHPA 4OJTA 3D5EA 3RBXA 3GFPA 4I4TA 1WA5A 5BQOA 4AJ9A 3F46A 4EQ6A 1ZBDA 2DQSA 3N5KA 1FYFA 3RBAA 1N2EA 2Z2IA 3ABOB 3E9ZA 3A2MA 2F9FA 2NT4A 3OOJA 4KBGA 1NF8A 2QL9A 4G0PA 4P5DA 4M2LA 3TVDA 2QMUA 2I33A 3TFQA 3LHIA 4O4HA 4EG7A 4EELA 3M1IA 4ZYUA 5EZYA 2VDNB 4KXMA 4L27A 4YVFA 4BQSA 4F72A 10MHA 3HCDA 2WY2D 3UW3A 1THMA 5B7QA 1J23A 1EJ2A 1UIMA 1XNJA 4URHA 4DSTA 2G40A 1C7RA 1QC5A 3LKZA 2PUTA 4PXAA 1YE8A 4KQWA 5EIAA 4BXOA 3HVRA 3R4CA 1IY0A 1W0KA 4MVYA 3P0HA 4KVFA 4LKOA 3QPUA 1SVOA 1T6NA 1M1YA 1P72A 3MTQA 3L0DA 4ZU6X 2WZCA 3D7NA 1S2DA 4GRIA 1TT5A 1YRWA 2HBRA 1N0VC 4LDNA 5DJ5A 3RAGA 4Q1VA 2JKZA 4ZI2A 2JGJA 5A7FA 2B7LA 2ERYA 3V9AA 3PE6A 4WKGA 2VF2A 5FV7A 1QZTA 2RHBA 2ZAYA 3IMEA 3MZ0A 4R83A 2AX3A 4F04A 1II8A 1MX3A 1PR1A 3OCJA 4KQIA 4KPFC 1E3WA 5C2JB 1CUUA 3BK1A 4LK3A 3JYHA 3BG5A 4LVNA 5A3SA 1RRMA 2EQ5A 2P9CA 5F3DA 5JT1A 5KC8A 1PEKE 3IFSA 4WRRA 3DTNA 3S7TA 1DBWA 4HB2A 5E6RA 1QRAA 3WFIA 3UB2A 3JQRA 3G68A 2RKBA 2KS6A 4X44A 4ARBA 3D31A 5CCDA 4AZ0A 1ZY2A 1N8SA 3CEJA 3QJYA 3RIEA 1LD3A 4PO8A 2BUBA 2Q1SA 3OQ1A 3HKCB 4JFRA 1I3OA 2ZGVA 2PX5A 4BVLA 4Q7KA 1T0UA 2CYAA 3E2IA 1DAEA 4TKVA 1FDVA 4ME6A 4QQKA 1USUA 1QFZA 1W4RA 2ZS7A 1DWOA 5LZ5A 4DZRA 5HTKA 1D8TA 1OE0A 1SMKA 4PZLA 4TYQA 1UDAA 2PO5A 2RJNA 5DBHX 4DDVA 5IDYA 4B80A 4LF4B 3DNFA 4IY1A 3EQ7A 2AQ8A 2BMAA 3PWKA 4K46A 4YA6A 1IN4A 1QFMA 2RSLA 4MCIA 3R75A 4MV4A 2ZJ2A 2R62A 1C3OA 4B83A 1E2UA 2HA3A 3U62A 4GL4A 4IH4A 2X0RA 3JATB 3WP0A 4TKVB 5I7OA 3M7IA 3QWFA 2IEBA 2Q50A 4TUYF 3UJNA 5T4FA 1OLXA 4RTJA 4JI2B 4CHGA 2NUPA 2B82A 1GTJ1 3NTOA 3D5QA 5ICGA 3ND9A 2O0JA 5ERXA 5K3OA 1ZXBA 3BN3A 3TL2A 3CZ9A 1UBCA 2BFAA 5K8LA 2ZSHA 3VNSA 2PE5A 2CNWD 2Y4NA 3MWLA 4YT8A 2HAEA 4LXQA 1V95A 1T2VA 2ZRGA 3PD0A 4RY0A 5H02A 3KQQA 2DFDA 3U1BA 4I1YA 4M9XA 5EJEA 2BGGA 3U4MA 2YWXA 4EKEA 3TMAA 1PR4A 1G6Q1 2W2QA 2F9LA 2PD4A 1EWRA 2PYZA 4P4GA 5TJ9A 2HMYB 3JQBC 2A0XA 4EO4A 4XD7A 3ZU2A 3U4QA 2DEUA 1XNQB 4DV6B 2Y6VA 3DXYA 1K8ZB 2WM8A 3QWBA 4BNGA 1TIKA 3PXCX 5ADWA 4JNCA 1R0WA 2Q9AA 1FP6A 3M6VA 3VPBA 1XMJA 5F33A 3SY8A 2NNWB 2V5UA 3G79A 5ED4A 1MABA 1ILWA 1R0RE 5BUQA 1J2YA 2DLNA 2H1HA 5EWLA 3UANA 3I0MA 2I7TA 3HN7A 4PHFA 4DJJA 4F45A 2PUHA 3EZFA 5ECDA 3OD1A 1R0XA 2AKAB 3BQNB 3KJGA 1PK8A 3IH5A 3DEJA 1KEPA 4EPWA 1NMXA 3G9TA 1UT8A 3FOCA 1I4TD 1EP3B 5JJBA 1UF9A 2RHDA 4E2ZA 4UEOA 4QBGB 3TR6A 2MMGA 1ECBA 3CUTA 5K6TA 3U1VA 1DZIA 1XJ0A 3DKKA 3TQQA 1FNMA 5AK3A 4Z9BA 1D9XA 2I2FA 2IXGA 5GM2A 4E21A 2BFDA 1G64A 2O2IA 4U63A 1OUMA 3MTBA 4Z49A 1UEIA 1TC1A 2HPZA 3D3NA 4QECA 5EMHA 4BQPA 4IXDA 2D2IA 4CKBA 5JDIC 1X7ZB 3WB9A 4DG9A 3GLGE 2X8LA 4QPNA 3EZYA 3FCCA 4EYGA 4PX5A 3RBZA 1X1QA 3HKDA 3VR3A 3GJ6A 4CI0B 1U9YA 2WJVA 2ZUEA 4DJFC 2EGUA 3U9TA 1VCOA 3QUSA 3A1VA 2YMQA 1SIWA 2JFOA 4IZHA 1J0XO 5EIFA 4DMUB 4TKLA 2FCRA 1P45A 1SN7A 1H6DA 4DLNA 4YMHA 1A9YA 4DSOA 1S8OA 3GPDG 1EG7A 1F8YA 2X7XA 3A9UA 2P2YA 3KT3A 4KQXA 5DNYB 5T3YA 3C3PA 3M1LA 2FPKA 1KDZA 2P40A 5AICA 4II2A 4RJJA 3UUGA 4ACAA 4RVFA 3ZHCA 2AYZA 3D6JA 3WJAA 4INAA 4LF7B 3U17A 3ZOKA 3KAKA 3TD2A 4IVRA 1TCAA 5AW9A 2XMPA 1XD9A 1UBSB 2P41A 3QLEA 1VLLA 3B1YA 2C2BA 3R3XA 4FS3A 1I5OA 1EUDA 1UFOA 4JLKA 4UE2A 1YZVA 1OXXK 2Y1EA 2D5LA 2XW6A 4WGGA 2HPVA 1YI8A 3CZQA 1V8DA 3HA2A 2CDNA 4TX1A 5G0VA 4Y30A 5JHGB 2VQ3A 2OV1A 3UK0A 2V7EA 3ST7A 3C3XA 3BDVA 1ZOOA 2I6UA 2EQBA 3F47A 3S1LA 3VKHA 2WG0A 4Q19A 2ZANA 3M4ZA 3TQTA 2J30A 4Y98A 1A2KC 4TYMA 3N53A 2HF9A 1FMTA 1GOTA 3FR7A 1YK0A 3B36A 3HJBA 2WJIA 4X71A 5CLIA 5ALNA 5HJ2A 3KR9A 1E62A 1NRXA 1V8PA 1B3RA 5IJ0B 1RAEA 1RC1A 3HCWA 3LFHA 3ND5A 2PTGA 4MX8A 1KVQA 4R41A 1GG2A 4N5DA 4NCXA 2JRCA 4G1FA 2C9BA 2A3NA 4OV6B 4E12A 1X7ZA 3BSYA 1DX6A 2BFOA 4CT4B 3D6NB 3PHCA 3H6GA 3HKDB 4UJ3A 4DGSA 1V8OA 3VDQA 2BGRA 2KLHA 1AS2A 1XWWA 3WB2A 1RJFA 1VMKA 1XZHA 3K73O 4HAUA 3I9JA 1AB5A 1M9NA 2BN4A 2X9VA 3I01A 2GAFA 4B4KA 4D5EA 3DTVD 4GDMA 4HLNA 4OXKA 5CJ2A 4MUIA 2JLVA 4UC0A 2X4DA 3W7AA 4F2GA 4Q18A 5ICEA 3H4VA 3NRJA 4C4TA 1B6RA 4EHBA 2P2GA 3KM0A 4R69A 1G4UR 4RL6A 3KAJA 4AJHA 4E5SA 1FLDA 2HWYA 2R6FA 2OXRA 2P91A 4EEZA 4IJUA 2VWGA 3EG5A 4JUBA 5EKXA 2CV0A 3FFWA 4D97A 1DLIA 2Q2WA 3CR7A 3TSYA 4CKCA 2VDVE 3E5MA 4MIOA 4CKXA 4XYBA 2PVCA 4JGBA 1UC9A 3AEQB 1XQYA 4TM8A 3QKRA 3CGWA 3LPMA 4IM7A 5DM4A 3WDLA 4IL5A 3MMNA 1CVIA 1TK9A 4R8RA 4WNAB 1QRSA 3BMOA 2PV0A 1T0JB 2FR1A 2Q9UA 3F67A 3TDNA 3DPUA 3W2HA 1RPAA 1XP8A 1VGRA 3DDSA 2Q8PA 4LJ5A 2XDYA 3AKZA 2AOWA 1TYZA 1W85B 2AOTB 5K3AA 4L95C 4QOIA 2PZBA 3OAAD 4G4IA 4PGMA 4A6DA 2WT4A 3TAHA 1I94B 1A96A 2HSGA 3I5YA 1Q20A 2RAUA 3UCEA 1JIUA 4V0QA 4PVDA 2WKRA 2N0SA 5BMVA 3V4FA 1EEXB 4D3XA 3F4KA 3X1KA 4KOAA 3QFFA 1E4VA 2FW1A 4G0MA 4B6GA 3RS3A 3IKTA 2EEZA 1O95C 1EK5A 2VJPA 4G23A 4QNNA 1HLDA 1TM7E 4BB6A 4ETWA 1Z63A 1B76A 1JSCA 1VBMA 3R7NA 1Y37A 4GR5A 4RY9A 1CLUA 4B6JA 1P39A 4QGHA 4A2QA 4Q9JA 2HRCA 3T8YA 3V55A 5EJ8A 4J49A 2B4QA 3ZGYA 1K2VN 1PZGA 3KUDA 3OE4A 1NHWA 1ZISA 1IZ7A 4YJHB 3WNVA 3DZBA 1GT6A 1WXHA 4DQKA 5JYDA 3U09A 2WHXA 1AKVA 4D0GA 4POAA 3COVA 3EULA 4YUWA 5IAOA 2FP3A 5CNJA 4B8YA 2VFAA 2I9PA 4L08A 4ZOCA 3ETLA 2QMHA 5HP4A 3H8WA 1QDLB 3LH5A 3ZDYB 2GK7A 5H59A 1HT0A 1T3GA 4NK4A 3T15A 3A1SA 5ENZA 2V4UA 2C5AA 1N0UA 3BJMA 4OAPA 4Z2AA 1MOQA 3SLGA 1NC1A 4B4WA 3QELA 2AFHB 2P6RA 1FYDA 4JH0A 2VCHA 1RBQA 4XGQA 3V9PA 3HZHA 2ROQA 4HYYA 4U7GA 4GT1A 1UBRS 2BRUA 3RKRA 3RLFA 2IXTA 5UKDA 1IAQA 3LC7O 2RKWA 4RO0A 1YCHA 4HZGA 3SDBA 2K2WA 1Z45A 2HADA 5J5AA 1UIRA 1L5KA 1LDNA 4PM4A 2O2JA 2LBPA 3KFLA 1I9GA 2ZT5A 4F6RB 1IHPA 1PG2A 2WD9A 2XR1A 3HXTA 2AV6A 3G8DA 2VATA 1WXFA 4N0PA 4Q7EA 5HYVA 4Z1MA 5E2IA 5F5LA 3HFRA 4ARUA 1P4RA 3DTVB 4P92A 2BDUA 2TRSB 4RLSA 1YVUA 3NYIA 1IQPA 1FDWA 3BDIA 1IUNA 1MRNA 4AXXA 2C2WA 2PRKA 3FAKA 3UBTA 4V1CB 4JI8B 1KY5A 1JYSA 3IALA 4U7HA 4RS4A 3SZRA 1O94C 1JQ3A 1XAIA 1A8SA 2HMTA 2HRRA 2P2ZA 1WY5A 2WSSA 2ZI9A 1XU7A 3LSYA 2JHCA 1C7QA 2I03A 2RGCA 2DAPA 2Q8QA 3H1FA 4DT1A 1GNRA 3TTXA 5LU8A 1SCQA 4UMDA 2O8DA 2JCXA 4N40A 4KB5A 1GADO 5C7LO 4MWTA 1NZFA 1ZRMA 5C34B 2J0QA 1BYUA 3W9BA 1BXRB 2JAUA 2R4TA 4Q9DA 1C3VA 2Z4SA 3GW8A 1MB3A 1H4VB 3QBDA 3VZDA 3ZWOA 5CIQA 2O7VA 1E2IA 3HI4A 3OX1A 4OLJA 2ACKA 1VYHA 1Q7GA 4QM7A 2WU4A 3DFKA 4L5YA 5EKSA 4UOQA 1KBOA 4EQ6B 3MELA 1PSDA 3WHIA 1IZ8A 1XWIA 4EYOA 3DT9A 5DW3A 3DZDA 3HU3A 3M5PA 5CK5A 3T06B 1I3NA 4XRGA 4QYXA 2YZ7A 4C89A 4CN8A 1K3FA 4DV4B 1L5RA 1UDXA 4KL8S 2RK3A 4GPZA 1TA4A 5AK0A 3SJ7A 3VSAA 4V1CA 2Y1FA 5A05A 1G5FA 2HBQA 2ILTA 4JJZA 1UKVY 3WP1B 1M1UA 3DL4A 5AOVA 3P2EA 2I6QA 2OSBA 2V96A 4R2XA 2YC2C 4XSVA 3AK4A 5C4GB 2AOUA 2H00A 4OMUA 2C2XA 2E5WA 1DUIA 2OT3B 1E3EA 2QZJA 5FI0B 3RTEA 2EDCA 4ADSG 5REQA 2AWOA 4DBVO 3LQRA 1W5FA 2R6CA 2XF8A 1P5ZB 3GRVA 3T3IA 5BYJA 5DX0A 4MUNA 2R6GA 4YJ2A 3CIFA 3T1HB 1C29B 1PL6A 1R3DA 1Y5LA 2WVAA 2YWGA 5FR1A 2GM4A 2EFEB 4QXRA 1DBRA 1L5ZA 1SXJC 4G24A 4NZZA 5EKDA 6NULA 2G77B 3TRHA 2BZSA 4HS9A 4C7KA 3DJFA 5KMGB 3DNPA 1Z12A 3KD2A 4K40A 1DBQA 4LYAA 5EZQA 3ZTTA 4UDYX 5I4CA 3UMMA 3L8HA 4DNFA 5JXJA 5E1DA 3O2NA 4X63A 3VI4B 2I2DA 1IEWA 4QPPA 5D5QA 3O3NB 3R9XB 1XYGA 1J20A 4EATA 3ULKA 4F4DA 1PL8A 1RRKA 1B8VA 3DF9A 2LP4Y 3BEDA 4LHEA 4Z9YA 5HKLA 1DCFA 4GLOA 3WL4A 4R8MA 4DCUA 1CZUA 1GLGA 1XCGB 3CA8A 5H68A 2OHJA 4MLDA 3E58A 4QGAA 4RSHA 2HRZA 1CZHA 4I50A 5AM3A 2D1TA 1XZJA 4MRAA 5E0OA 5TARA 1GQQA 4K9LA 5I8ZA 1HFKA 3WWDA 4AJOA 3ZCTA 5AI8A 8OHMA 4O4HF 1U9CA 2OG1A 2ZZNA 1P0IA 2VPXA 1Z29A 3KXPA 3MINB 4D02A 3F6SA 3A11A 2JBAB 4YV1A 1EFLA 3TZLA 5CVTA 2FMIA 2HDHA 3HN2A 3SMQA 3I6MA 1EUDB 4RZSA 2ZRLA 3QNUA 3MMZA 4HYTA 4URYR 5AUQA 5TC4A 4QU8A 2D5AA 3VTFA 1F06A 1GUYA 5JROA 4Q3CA 1E61A 3FG9A 5JISA 1XZIA 3OJ0A 1J2EA 1SCJA 2DZDA 2HYDA 1Q7TA 3ETNA 5CDFE 4R8LA 4A8JA 4BRZA 2VUSA 2EL9A 2WNHA 1DRKA 1OH6A 1KH1A 1E3TA 3LECA 4PZ0A 5C0OE 4ZEVA 2BE7A 2VJOA 3H4MA 3JQ6A 3BVPA 1MO4A 1SR8A 4M0LA 1CJKC 4QPZA 3UJ9A 5EJ6A 4G0WA 1JHXA 3ZJ5A 5AKYA 5BO5A 1UEXC 2CMDA 2COKA 2GHIA 4JI6B 3Q40A 1N1MA 1UK8A 5JAOA 5DNVA 3NTLA 1C2TA 3CUYA 3SZOA 1A8IA 2KQUA 2EX0A 3CQ9A 3LVFO 4XDHA 4MPJA 3VTKA 5CYPA 1G8GA 4IPTA 1EJ0A 1B15A 1V5EA 3CEHA 3PFKA 1UOOA 3QK7A 1CZLA 3PXAA 4LOHA 1UBEA 4RPGA 4ZQBA 5EJ2A 2YRWA 4IQ4A 1R15A 2HLPA 3L7BA 5H8WA 3TXAA 5B2ZA 1WUIS 1R66A 1BVYF 3GEIA 1VLZA 1F6BA 2DFLA 2ISCA 1BA3A 1OOEA 4JJIA 2V55B 3BD6A 2IZ0A 3IULA 1FQOA 4WXYB 4MUYA 4MTLA 1LGYA 4OKSA 1SUEA 3MPOA 1EAMA 3SVZA 4YMUA 3FZGA 1NWHA 4A16A 4NH4A 3T54A 3K8QA 2FR8A 1UQUA 2FY8A 3HYTA 1OWLA 2PV7A 2YV3A 4EDFA 1E3MA 3FRHA 4Y2PA 4X1IB 5K3CA 3R7BA 5K0CA 4R40A 4WCVA 3W06A 3SFTA 2NV6A 2QRGA 4BTEA 5AW4A 2VDUE 4N9WA 1KQOA 1C5KA 1WEKA 2P6UA 2YNMA 2ZB8A 3P2IA 3QU5A 4DRZA 2I6TA 4WOKA 2YRXA 5EYPA 3ELDA 4RPLA 2BZ0A 4QSMA 2VP0A 4RTKA 4BASA 5CW1A 1G0NA 1JFFA 2CDAA 2G5GX 3SLRA 4TV8F 2IS2A 2P4SA 4JBHA 4GQBA 1DAFA 3FCEA 3PJFA 1NY6A 3KV1A 1POWA 2FVXA 4F8EA 4EUSA 4ZC8A 4E08A 3KJQA 2FRVA 2JFQA 4K3UA 4RVDA 1RWPA 1DLJA 4D4LA 1SUCA 3ITEA 1SIUA 2QL7A 3DWEX 5AW1A 1RXEA 3EXHC 1PGJA 2IYYA 4GM1A 1GRQA 3NYQA 3BH7A 4W5HA 5JMPA 3AEZA 2UYQA 3F3MA 4OGLA 3R8CA 1XAHA 2JI8A 4J4TA 1UANA 5K03A 1ZMTA 3A6EA 3IV6A 3SEFA 4G6ZA 1Y6GA 2GAJA 4NCHA 1G8YA 1XHEA 3KOYA 3LX5A 4XQGA 2X13A 1QKKA 4DT1B 4LV8B 4M1MA 2JFYA 1GEGA 4XA8A 3TTYA 4AN1A 3GMDA 3KG2A 1JG1A 1P74A 1YR6A 3E1GA 4QIHA 3B52X 4JWTA 5ICMA 5KJFA 1D1QA 3FCOA 3LLSA 4A73A 5IHXA 3OBBA 1NAHA 3LHSA 3LC1O 4JB2A 5MN5A 3HACA 3TG8A 4IGFA 1LV7A 5ADVA 1N0IA 2A94A 1DXHA 3ZQ6A 1Z7BA 1YWGO 5BWNA 1T4DA 1JU3A 1XZGA 1AKNA 3FMOB 3IHTA 5B4VA 4Z9FA 1UQTA 2BAGA 1CD5A 3HB7A 4LYYA 5AHKA 1YR8A 2YCLA 5D5PA 5JRZA 3QEBZ 2OCAA 3IQWA 1ZXXA 3UOWA 4NABA 1L3CA 4ZMSA 1E6MA 2XUDA 1U9IC 5K0SA 2LWIA 1EFAA 1Y80A 1NMQA 4MDHA 2GLTA 1VRVA 3LQ4A 1C7JA 2CGEA 4ZV7A 1MMFB 3WDMA 3KDSE 4B4OA 5KYXB 3ZD7A 4RPCA 2DE0X 4RK0A 3WK9A 3NDIA 4PAMA 3HV2A 3DLPX 4DLBA 4RF3A 3FD8A 4QTUB 4NULA 1V8BA 2MSDB 1RJ9B 3LYLA 4UHEA 2V98A 1YBFA 3FPAA 4JCCA 5A7GA 1A04A 2HSJA 3CW9A 2Z57A 3DSRA 2O57A 2WEKA 1AMOA 4OFBA 4JBWA 2NQ8A 4EI9A 5K4HA 2V97A 4DG8A 2JJ2D 5CDYA 1VHWA