4CV3A

Crystal structure of e. coli fabi in complex with nadh and pt166
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
239
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv3A00
3AUUA 3L9XA 4IJUA 4EYEA 1SNYA 1TLTA 5JDCA 1LDBA 4ALMA 4C4OA 1GZ4A 1NHWA 2A35A 2C7GA 4ROSA 5B37A 4CQMA 4D0RA 5A4DA 1ZK2A 5C7LO 4PZCA 3RQSA 4YT8A 1MC5A 2PNFA 4OKNA 3NV9A 4HBGA 5CPBA 5IZCA 5EQFA 1VKOA 2EJWA 4I8XA 1WWKA 3PVZA 3NTQA 4HKTA 1ZXBA 3DBRA 4FOOA 5KKAA 2DT5A 3HDHA 1AHHA 3PJEA 4OMUA 1E3WB 2G5CA 2PZKA 1H0KA 4QEDA 1U3TA 1XU9A 1B3BA 1W6UA 1BMDA 2Y99A 4NBUA 1HZZA 2FSVA 1ENZA 2Q3EA 3F4BA 2V6FA 5T64A 1VJ0A 4EI2A 2GERA 4XR4A 2W4QA 1T2AA 4IDAA 2JD0A 1LQTA 3ZHBA 1NR7A 2BMAA 3MJ4A 4Z9XA 3PJDA 2V65A 1LU9A 4YCAA 1WMAA 1UAGA 1TT5B 4NZ9A 1MG0A 3O8QB 1IE3A 3JQ9C 4OOFA 2CVZA 3ZNOA 4DPMA 2GNAA 4NH4A 4O59O 2X5KO 3ITDA 4ONEA 4PIVA 1EFKA 5ILGA 2Y1OA 1B15A 3F47A 4PLYA 4CMBA 2UUPA 2HAEA 3EVTA 4CM8B 2D2IA 4EZBA 2GASA 1CWUA 1B14A 1GV0A 3E1KA 4CM3A 2W98A 3H5NA 4BVAA 1LSJA 3GGGA 2JD1A 2HRZA 1N1EA 4PLZA 3FTPA 4IQ0A 5EERA 4PZEA 1U4OA 3PJFA 1T2EA 1YB5A 4OQZA 1YQGA 3OA0A 2D59A 1ENPA 4JX8A 3V2HA 2YV3A 3TPCA 4YRAA 1U8FO 1HLDA 3WWYA 3KLPX 3PWZA 2VCYA 3HUDA 5I9NA 2BFMA 4TZTA 5C3MA 3ONDA 1NYTA 3LT0A 3LYLA 4Z0PA 1KEPA 4YA6A 4RO0A 5JCXA 5G4LA 1IY8A 1G6KA 4TWRA 3GMDA 3RCBA 4R3NA 3UHAA 1VJTA 1YL7A 2HMWA 1V8BA 2BI8A 4B7XA 2ZTMA 3EZLA 4GWGA 3GGPA 5KJ1A 4KTVE 4NIMA 2J3JA 2DFDA 1UUFA 2GN6A 3QLJA 4J1NA 4L76A 3Q0EA 1TB4A 4DQVA 2P4QA 1YONA 1DFGA 4ND3A 1NHGA 4W7IA 4CM1A 4XX0A 3ANMA 4ZRNA 1MUUA 4Y67A 3OSUA 4RGBA 1I01A 3E9NA 3K92A 4I08A 3RFXA 2NVWA 1U4SA 3UFXA 1U9JA 1KVQA 1JKFA 2Z1NA 3VOSA 2NM0A 3O4RA 5K9ZA 4CJXA 4E2XA 1D3AA 3RUFA 1GYRA 1LX6A 1VE9A 3ZWCA 1Q0LA 1GQ2A 3WLFA 4BMSA 8LDHA 1PS8A 1DIAA 5IZ4A 1I5RA 3PWSA 4DYVA 1H94A 2WD7A 2B36A 4XRRA 1DPGA 4Y6PA 2G82A 5CDTA 4J2OA 1NVTA 4WLUA 3QHAA 4CLRB 5COAA 4CMGA 4WCFB 5F1PA 3W8DA 4F3YA 1PZGA 1XKQA 1LDNA 1GUFA 3KHUA 4D3SA 3BAZA 4CMEC 3ZH2A 1SEVA 3IAHA 2PV7A 3HWRA 2RCYA 4U0KA 3TZCA 1M66A 4NK5A 1WLYA 2NU7A 4YJHA 3ENKA 3KZVA 4P4LA 4IDGA 1H9BA 2A9FA 3ZWYA 3RC7A 4E5NA 5B1YA 5ITVA 4Q3DA 4OSOA 1OFGA 4CMIA 4B3IA 3MEQA 2DLDA 2VNAA 3WG9A 5K6AA 3HHPA 4DMMA 4FFLA 1E3JA 1X1EA 2WE8A 4IJWA 4PZDA 2CDBA 4GAEA 1D1SA 3DQPA 4XGNA 4QQRA 1BRMA 4IQ8A 3RBXA 1YH3A 3NAQA 1BGVA 2I66A 4AJOA 2X9VA 1VKNA 3DBLA 2EP5A 3VZSA 2YZ7A 3FPCA 4OQYA 1G0NA 3PDJA 1KC3A 3CIFA 5TT0A 4PGFA 4E30A 2NSDA 5JDCC 8ADHA 2P9GA 3R6DA 3JQGB 4Q3BA 5KVSA 4YR9A 1PJBA 4PLGA 5IDWA 3RD5A 2IRWA 1DC5A 5AXAA 3F5QA 1OMOA 2DVMA 2P2SA 1AGNA 3MOGA 2B5VA 4LMPA 3GUYA 3RU7A 2TMDA 2VN8A 4YQYA 4JNKA 3DMYA 4FBGA 4DQUA 1Y8RA 4BKOA 3RUDA 2HU2A 5BT9A 5TS3A 3AWDA 3W4IA 5TJ9A 2ZYGA 1DEHA 1V9LA 4PLFA 3DTTA 3LT1A 2RAFA 2BGKA 3EYWA 4GSLA 1A5ZA 1VSUA 4RORA 1ZSYA 4ZN6A 3TZKA 2X0NA 1Q7BA 3SLGA 2Q1TA 2X5JO 3PIIA 2CSUA 4CLOB 3PYLA 3FHLA 5KJCA 3ZWVA 3GQVA 3RU9A 3VKUA 3EVNA 3BZUA 1P77A 2ZTLA 3FF4A 3M1AA 4YT5A 3H65A 4YVFA 1PJSA 1PTJA 3I6IA 4G81A 4I5EA 3H4VA 1I2ZA 3GOHA 3WMXA 3GDGA 4RVUA 4KQWA 4XGKA 5HA5A 1SOWA 3UCXA 4OSPA 1P1HA 3MWDB 2O50A 2OMEA 5HTOA 1JAXA 1I3MA 2FOIA 3AW9A 4BQRA 3OEWA 5MGBA 3W4KA 1QYWA 3BHIA 1VL0A 3DB2A 1CIVA 3UH1A 4M55A 4CR8A 2I76A 1DXYA 3WGQA 3WQSB 4RPJA 1KOLA 2VOEA 3RASA 5A05A 2OFPA 1PJ4A 3OBBA 1LRKA 3BTOA 3W8FA 2JCYA 4IY1A 3T7EA 5BR7A 1B8PA 2Q4BA 5JPIA 4EUEA 3K8ZA 3LF2A 4RJTA 3W6ZA 4J91A 4MP3A 1C0LA 2OORA 3D64A 2CMDA 2YDXA 3K9QO 4PFJA 1P31A 1Y9AA 4MVJD 3QV1A 3OHSX 4J1QA 4JJFA 2GZ3A 4XDYA 3BTVA 4I9UA 4NFHA 5EN4A 1HE2A 3GNQA 1GQQA 1WMBA 3TF5A 3DZHA 1UXGA 1GV1A 4MIYA 4RPKA 3KRTA 2GSDA 1LEHA 1R15A 4UVHA 3RI3A 3DBHB 5EINA 4QXMA 3E9QA 3IMFA 4QTZA 1XDWA 4J1TA 5T5QA 1T26A 3QJ5A 4RQUA 4PLVA 3EW7A 4MOWA 2BI7A 3VPXA 1WAMA 4D0SA 1Q2XA 4H3VA 4XJSA 4A73A 1LQUA 5JXWA 4W6ZA 3H9GA 1J4AA 4Q3AA 4E5KA 2QHXA 2VWPA 2G0TA 1KETA 4H7PA 1HYEA 2FPPA 3QVSA 2YV1A 1ONNA 1Q0HA 1ZEJA 2W2KA 3BIOA 4FC6A 4HX5A 3ANNA 1E6UA 5TJHA 3ETGA 3CZRA 1VM6A 4CV1A 4LCEA 1XG5A 2GRAA 1XU7A 3S2GA 4AJHA 3CEAA 2PZJA 1XGKA 1FMCA 2YW9A 1Y8QA 1CQIA 3S2EA 5BNTA 1R37A 3JQAD 1GY8A 4E5MA 5THKA 4I5DA 3GDFA 4L4XA 1R66A 2BGLA 4N54A 1N2SA 1V35A 4I9HA 2E4AA 2VT2A 3I23A 2EKQA 1HDCA 2D5CA 4PG6A 4UVGA 5F5NA 4ALKA 4WEOA 1JVSA 1K6IA 1QG6A 2R6JA 5JFOA 4ZICA 4NFYA 4B3HA 3NGLA 3DHYA 3WLEA 4CM5A 5TNXA 3P2OA 3LC1O 3L77A 4ZQBA 2VHYA 2B4TO 3QA9A 4ALLA 3WGTA 3WXBA 2BFOA 3KYDA 1PJ2A 1EDOA 5K6AC 3PI7A 3AOGA 3R3JA 2YFQA 1LLUA 3V8BA 2AQIA 4FFPA 1ZVMA 5GZ6A 3FD8A 5EL0A 4JGBA 5DBFA 3E48A 3GHYA 4BB5A 1U3UA 2I65A 3JD3A 3K6JA 1PGPA 4I5GA 4JCOA 1ZUD1 1T2DA 4KMSA 3NT4A 2AG5A 4LVCA 5THQA 1E7RA 4TRJA 5AQ1A 5LC1A 1IB6A 5DOZA 3WICA 1E6WA 6LDHA 3GFGA 3MTJA 5ILOA 1K6XA 3MJTA 3C85A 2X7HA 3VKVA 1SMKA 3KSUA 2VZ0A 2BHLA 2PFGA 5L4NA 4LK3A 2E6UX 1E7QA 3DFZA 3CH6A 5U4QA 3L07A 1HDZA 3LLSA 1GZ6A 4UEJA 3JYLA 5CDSA 4K9DA 2ZB8A 1E5QA 3QP9A 4NU6A 3L6EA 3Q3CA 1CERA 4Q3EA 1HTBA 2QQ5A 3D5QA 5LCXA 5CDGA 2W90A 3VDQA 4DTIA 1YQXA 1XQ6A 4GMFA 3RJ5A 3ZV4A 3NX4A 3X2FA 1E3IA 1RYEA 4ILKA 2VQ3A 1C1DA 3QWAA 1DHTA 4JIGA 4LW8A 3MJCA 4NK4A 3A28A 2PWZA 3BA1A 4Y9DA 3ONFA 4PG8A 4AJLA 3H9EO 5G4KB 3O9ZA 4CMAA 4ESOA 4AJKA 2O3SA 1NQTA 2O4CA 2QX7A 1NP3A 3GC6A 1LLDA 2RIRA 3HJAA 1R6DA 5JYEA 4WLNA 1RWBA 4FCCA 4GQAA 1R0SA 3GHHA 3LU1A 4IJKA 5A9SA 1WDMA 2YHIB 1A71A 1YB4A 3S2FA 3DHEA 1ONPA 5IF3A 4BS9A 1EE2A 2CDCA 3W8EA 3JYPA 4BO0A 3E9MA 4PLWA 1QXSA 1YDEA 4IGEA 4OAQA 1ISGA 1CF2O 2Q99A 4NQZA 4RDIA 4BGEA 3D3WB 1PZEA 5ENDA 3U5TA 3ROKA 4NG5A 4QUKA 4HXYA 4IBOA 2HMSA 3QVWA 1P1IA 1ZJYA 4BQPA 1U7TA 5ER6A 2IYPA 1QMGA 3NDIA 2Y0DA 3GEDA 2VZ8A 4NNJA 3ST7A 1JTVA 1LDMA 1O94A 3L9WA 3BTUA 4O63O 4J9VA 5F3RA 4B4OA 4D79A 1FF9A 1IHYA 4XYLA 1MX3A 2Y1EA 1K89A 1YOVA 3B1FA 4WKGA 3ZNNA 4IMPA 4B4UA 3FSRA 5H81A 2PKQO 2PD6A 3OIFA 2QRLA 2J5KA 1UP7A 2EW2A 3RKRA 3S8MA 4MJLA 4WASA 5HS6A 1Z45A 4R1UA 4HNGA 4TKLA 2VYNA 4BO5A 1IZ0A 1XWFA 1GR0A 5DP2A 3KSDO 4LSWA 4D7AA 1KVUA 1ORRA 2GGSA 2AXQA 1BVUA 1T24A 4YRBA 3GVPA 3JTMA 4CQMB 5ADHA 3HFGA 1PWZA 1YRLA 2GD1O 2OOSA 4PG5A 4A26A 5A03A 2VTEA 4YWJA 5JBIA 4QFDA 5L53A 2X22A 3DBRB 3AM4A 3QWFA 1JU9A 2J6IA 3OMLA 1X13A 5ER9A 2NVBA 1QYCA 5AXDA 5DCUA 5JO9A 1R12A 1IPFA 2H5LA 5F5LA 1BDMA 2Y67A 2VRCA 1VJ1A 4U6QA 2HJSA 2C5EA 2JAPA 4LRSB 2EKPA 4N5LA 3Q11A 1U2DA 4GSKA 4K6FA 3FRJA 3ZV3A 4AL4A 4YAKA 2CZCA 4MVJE 3TSCA 4XJTA 2YJZA 4FGSA 1GPDG 1FDSA 2D4AA 1LNQA 3T4XA 1OAAA 3TOXA 4CV2A 1ZK4A 1DIGA 4OM8A 2BD0A 3QIVA 4FFOA 3TN7A 1WPQA 3CPSA 3N58A 5BSGA 4IDBA 1QSGA 2IXBA 2OBYA 1Q7GA 3D0OA 2GZ2A 5EMHA 1CQJA 2FZWA 3IP1A 3ZHXA 4G2NA 1GFSA 2O7QA 1G0OA 4AJNA 1ZW1A 4NR0A 4DL9A 1VI2A 2NTJA 1EBFA 3WNQA 1WDLA 2PGJA 4ZQFA 4IDFA 4D44A 4IZIA 1LDGA 1ISJA 1KBZA 3AY3A 2OP1A 3VZPA 2D0IA 4D3DA 4L4SA 1NX6A 5JAMA 1A4IA 3JQ8A 4AJJA 4XQEA 3RBZA 3H8VA 2B5WA 4RL6A 4ND2A 5L9AA 1DO8A 2VTDA 2Y1CA 4XR9A 1YB1A 1JN0A 4PG4A 4CV3A 4JLWA 1BSVA 2FRDA 3U4CA 1A9YA 5I7FA 2ZYAA 3TDKA 3ZW8A 3VHRA 2QG4A 4GGOA 4XKJA 4ZD6A 2IZ1A 2Q1SA 4CLHA 3PFWO 1GYQA 1I33A 4L73A 2DTXA 1LBEA 2X0IA 2Y05A 2ZKLA 2QW8A 2JKVA 3WQRA 4IUYA 3D5TA 4ZRMA 4D41A 4JQCA 4CV0A 3UN1A 1N9GA 2JHGA 3JD4A 1I24A 3G1UA 4ND4A 3WYBA 4BGUA 1DJNA 1M75A 5BSFA 4Z3DA 3H9QA 1U5CA 3H2SA 2VOJA 1XCBA 4KQXA 2E37A 1XELA 2NVUA 4QO8A 3MJVA 1LLQA 1N7HA 4JJGA 3HB4X 3VZQA 2Y1FA 2C82A 5IXSA 4P8RA 1V6AA 2O2YA 3GZNA 1L1FA 3ZWWA 1A7AA 3VH1A 1PL6A 2X8LA 4WPGA 5EJ2A 3JD0A 1U7HA 1NPDA 2NWQA 1UZMA 3QVTA 1EUDA 4Z9YA 5I9MA 3DHNA 4MKXA 1SBYA 3I4CA 2NACA 1SB9A 1E0DA 1H6DA 1RM3A 5IN5A 2W2LD 2UUOA 4A10A 4XIJA 4J16A 1EUZA 3HSKA 5H83A 3TJRA 5L4LA 3I4FA 3SEFA 3WGGA 4DBZA 1GPJA 4MVJM 5KCZA 4BNTA 1ZFNA 4D3FA 1XLTA 3ZNQA 2Q46A 4TVOA 1H9AA 1PGOA 3QWBA 3NJ8A 2WD7B 2DQ4A 2YY7A 3FNFA 2PKQP 2IXAA 3KM0A 4HV4A 4R54A 5COQA 2C0CA 1HXHA 1I32A 1B0AA 1B8VA 1VRWA 2ZCVA 4UVDA 3C7DB 2X6TA 4TRNA 4OXKA 4C7JA 3PYXA 2D5AA 2FHSA 3MCVA 1HE3A 5B4TA 3DL2A 4IPTA 1M6HA 1JW9B 4GGPA 4FDAA 1HETA 4YJHB 1UDCA 4O5OA 1EFLA 1HLPA 4QX6A 4F6CA 4D42A 3LSYA 3UXYA 2VHWA 3SX2A 3ULKA 3OEYA 1UXIA 1YQDA 1NTOA 1T4BA 2XOXA 4MKZA 4CMIB 5A1TA 1P1KA 3G79A 2E49A 1BHSA 2VHXA 3GH3A 2PK3A 5JSFA 1HYGA 4RCVA 4TQGA 1H93A 1BXZA 4MO2A 4BKUA 3TQHA 4CM9D 4HUJA 3DBLB 2HCTA 3SVTA 3AU8A 3VH4A 4K28A 4DXHA 1Z73A 3W1VA 4CLEA 5A5FA 2E48A 1HDXA 3OJEA 3PQFA 5A3VA 2CVQA 2YFHA 1NAIA 3AFNA 1W4ZA 3KYCA 3ZV6A 2EXXA 1T4DA 1DRUA 1ZKMA 2O2SA 4ZQGA 1JAYA 5JAZA 1LRLA 1PL8A 4FJ0A 2IZZA 4E33A 3JD2A 3HN2A 4HNHA 2AW5A 3UW3A 1P9LA 1RPNA 4ALJA 1C1XB 1XYGA 3PJGA 3GG9A 3ORFA 4KDEA 4R16A 3HDYA 4N7RA 1LC0A 2BKAA 1QKIA 1PQUA 1Z75A 3BMQA 2NU6A 3GPIA 2Y1DA 4GMGA 3VVBA 3NDRA 1RM4A 3F1LA 3BTSA 3U4DA 3GNTA 4LISA 3DZIA 5IDXA 4BO1A 1N7GA 3AY7A 3IKVA 1YKFA 5HS4A 2EF1A 1PGJA 1IUKA 3H5AA 4I5FA 4TZKA 3NTRA 5MDHA 4PRKA 1BTOA 1DHRA 3A9WA 3B70A 3F46A 4GLLA 4K6CA 2VRBA 3IL2A 2DFVA 3K2EA 1IZ9A 3HN7A 3ZU3A 1MXHA 3FR8A 4JXKA 1M2WA 3DZGA 1AUPA 4BO6A 1WP4A 3D4OA 1U1IA 2FR0A 3R0IA 5JMWA 3ZHZA 2IZ0A 2O23A 1E3WA 2DBQA 1CYDA 4IIVA 4CM6A 1Y9EA 2PZLA 1XHLA 3TZ6A 1VSVA 1YGYA 2V6GA 1BXGA 2Q49A 1I36A 4R41A 1BVRA 4F45A 1E7WA 2CF6A 3DBVO 3VZRA 2IYOA 2OUIA 3FNHA 1NR1A 3Q1LA 1WNTA 1XSEA 3BHMA 5FFFA 4EJMA 2VYVD 4LSMA 2HK8A 3KYBA 3EAGA 2D1YA 3I9OA 1UXJA 2ZIZA 3C1TA 4HADA 4IXTA 4J43A 4CQLA 1KC1A 1MV8A 1O8CA 3PGJA 1UP6A 4JBIA 4GVXA 4DIBA 2WYVA 2ZCUA 3WIEA 4P38A 4CLXA 1R4MB 1HDYA 4HFNA 4CM8A 4J3FA 2A92A 2GCGA 4AVYA 4W82A 1KYQA 3LQFA 4WNCA 5C5IA 1JA9A 1RJWA 1WDKA 4GL4A 3M6IA 5COBA 3RROA 2PD4A 4J2HA 4YPOA 2FWMX 5ES3A 2P9EA 2NUAA 3MWEB 3GFBA 5IZCC 3K30A 3UGKA 3LC2O 3D4PA 4J0FA 1UR5A 4DGSA 2O3RA 4EEXA 1F14A 5KKCA 1ZIDA 4ID9A 2WYWA 2PR2A 1U2GA 1JQBA 4XIYA 2GN8A 3WOHA 1SO8A 1A72A 3GVCA 5DULA 1AHIA 3RUCA 1IPEA 2DPHA 2GN4A 1T1SA 1P0CA 3GLQA 1DBVO 3F6YA 1ULUA 1N92A 3JQBA 4XA8A 4A27A 4WLOA 4M87A 3RVDA 2B35A 3OICA 4IGFA 5CFZA 4Z6KA 3U4HA 4EJ6A 3AI1A 3SC6A 1WXDA 4YAEA 2I67A 4RPHA 3IOYA 5JY6A 3C3XA 4YJGB 5KJ6A 2A4KA 1I30A 1K5HA 1E7MA 1P1RA 3INGA 1NPTO 1DC3A 4FGWA 4DUPA 4WLVA 4N5MA 4BO4A 2YQ4A 4TROA 2Y68A 1BDBA 3ON5A 3TWOA 2HLPA 1R4NB 2QZ9A 1Y1PA 4DBVO 1X7GA 5DZSA 3RKUA 1Z82A 4YT2A 4YDRA 1A4UA 1X1TA 4DQXA 3DDNA 1Y7TA 4FSHA 4FOSA 2J3HA 2IE0A 3I9LA 2VNSA 3PHJA 4IJVA 5CHEA 2W2LA 5A5EA 4YAJA 5JYDA 4HWKA 1RM5A 2ZATA 5I7SA 3GPDG 4ZVVA 4JP3A 3KV3O 3KUXA 3OIDA 3RWBA 1PR3A 2O48X 3IIEA 3ADPA 1H6CA 3DTYA 4J4BA 4DMLA 4W4TA 1LRJA 1ZMOA 3RUEA 1RM0A 3BMNB 1L7DA 1S7CA 1MG5A 3QY9A 1Z6ZA 4CLRA 1YDWA 3GR6A 1X14A 3OA2A 2Y1GA 5HM8A 4GBJA 1GAEO 2O3QA 2DTDA 3BMCA 2EWMA 4UVEA 3PYMA 3WSWA 5TF4A 3WMWA 3IC5A 4ZQEA 4CL3A 5IFLA 1H5QA 3ABIA 4IINA 3ZN2A 1JWAB 3WR5A 3KLMX 3RFVA 3JYOA 4D46A 5U1PA 1B3RA 2PGLA 2HO5A 3CXRA 1LA2A 2I6TA 3CMMA 4JN6B 5TC4A 4EUFA 3ZCXA 3LDHA 2B37A 1R0LA 3QE3A 1DC6A 3OQ1A 4CM9A 3VAZA 2X5OA 3VH3A 1HWYA 1NWCA 4CUZA 4EBFA 2DM6A 4RF4A 4Y8VA 4KUEA 4R1TA 4AJIA 3H2ZA 1A7KA 1UJMA 3GY0A 3GEGA 4XZ3A 4U8GA 4UULA 4CM4B 2Q1WA 1KY4A 1PZFA 3I9NA 3W4JA 4JBGA 3DONA 3GVHA 4GH5A 3NYWA 5KIAA 3SBOA 1DLJA 2GZ1A 5KVQA 4RQTA 4O0LA 1B8UA 3CE6A 2FR8A 2VUTA 4RF5A 3P7MA 2PH5A 5A9SB 5HBRA 2C59A 3D1LA 1LC3A 2YQ5A 3MJEA 3VPHA 1LLCA 1T2FA 3PLNA 2QYSA 2BRUA 4XYMA 5FI5A 4QO7A 2EG9A 3PZBA 4N5NA 5JY1A 2UDPA 1FDTA 4U5QA 5DBGA 1PQWA 2ZTVA 3WQQA 3WS7A 1YBVA 3DOCA 4L8VA 4BNIA 4WNIA 3FCOA 3WJ7A 1Q7CA 1C0IA 1I0ZA 1YBMA 1VLLA 2QRJA 4ALNA 1Y81A 3JYQA 3I3OA 1P1FA 5TLSA 1Z74A 4R9RA 3HG7A 1FJHA 2YUTA 1AN9A 5AXCA 3VVCA 2POQX 1YOVB 2Q2WA 3GRPA 4N18A 5KWEA 1U28A 3H7AA 1TEHA 4KWIA 3P19A 4UREA 1NFQA 3AM5A 1O89A 6ADHA 1E6EA 4BNZA 4FB5A 5JLAA 1C0KA 4NJMA 2GO1A 4FJ1A 3PEFA 5EIOA 3ZU5A 1KS9A 3VPSA 1KEVA 3F9IA 4B7CA 2GN9A 4E3ZA 1HKUA 2D3TA 1D8AA 4CQMD 1H2BA 1I10A 2ZJ1A 4GKVA 4PLPA 4PCVA 3L6OO 3G0OA 1IHXA 2EV9A 1TXGA 4RDHA 5G0SA 4CLDA 5FEUA 1IOLA 1JDJA 3GVXA 3ICCA 5L4SA 5H82A 4CMKA 4RVFA 3R3SA 2CY0A 4IDDA 5F21A 1E77A 1MFZA 1YBAA 1WW8A 1IL0A 4XCVA 3ZWAA 1QLJA 3ENNA 1C14A 3WNVA 3NT5A 1ENYA 3ZI0A 2UV8A 1AXEA 3I5MA 3PDUA 4R4JA 2XXBA 3GNSA 4BGIA 4NPCA 2X9GA 4RV9A 4A03A 3WYEA 2IEBA 3UOGA 1YJ8A 2PTGA 3MOIA 1DLIA 4YJFB 1ADBA 1PWXA 3L0DA 2JFFA 1YJQA 4E32A 1ZK1A 1O0SA 4GX2A 1H6AA 1I2BA 1O5IA 5JO0A 4DIFA 3TZHA 2Z1MA 4G5HA 4NJOA 1DFIA 2QZZA 3PIDA 1BW9B 1X7DA 4FFNA 3I83A 3B1KA 1SB8A 2DPGA 3ASVA 4GKBA 3AOEA 3TL3A 1CETA 2AE2A 1D7OA 4QT0A 4LN1A 2Z5LA 4ZGWA 3ZU4A 3WGOA 1DAOA 4E0BA 1SEPA 2FPGA 5AXBA 2NQTA 1QORA 2I3GA 4ALIA 3AU9A 3WIDA 3PQEA 1DAPA 2O7SA 3JQ8B 4BL5A 3PZRA 3KSZO 4CODB 3JQDA 4F46A 2B83A 4AG3A 1GDHA 5KJEA 1E92A 4YQZA 4WJZA 4NMHA 4XEHA 5A3JA 3RAJA 1UAYA 3JCZA 1SPXA 4WECA 4XD2A 2P9CA 3GAZA 3S1LA 4AICA 1L7EA 4CR6A 4EDFA 5DF1A 3GK3A 2CD9A 4P4NA 5DCWA 3DXFA 3EMKA 3E18A 1DRVA 1J0XO 2CUKA 3DO5A 1ADFA 2Y0EA 4MKRA 1YL6A 1EVZA 3R1IA 4IS2A 4MVJF 4DA9A 4W99A 1N9GB 1P74A 3HDJA 3UAGA 4O1MA 4JROA 2AEJA 4DPKA 3K5PA 3KETA 2O3UA 3DFUA 3OECA 5DOVA 1EUCA 3I1JA 3MTGA 4DREA 2DKNA 4J7CA 2NVUB 2NLOA 1EK6A 4IS3A 5JC1A 2X9NA 4BNYA 1EK5A 2EERA 1KVTA 1PSDA 3OJFA 3ANLA 1PS9A 1LJ8A 4CM7A 4Z0TA 1DIHA 4J4HA 5KTKA 1HEUA 2ET6A 1ZK3A 1PS0A 1QYXA 4GX0A 4EITA 1ONOA 4J1SA 2HMTA 4UEOA 3S55A 4XYGA 2CF5A 1ISIA 4BO7A 3AJRA 3E03A 2EHDA 3DZJA 3CZMA 4MVJA 1P0FA 1GQYA 3B1JA 4GX1A 4BNNA 3UICA 3TFOA 4BKQA 4JJIA 3WX0A 3PGXA 3K96A 5GZ3A 5HRUA 1U3VA 4OXYA 3WBFA 1GZ3A 5CAEA 2OGUA 1X7HA 3ITKA 3GRKA 4CL8A 5JNLA 3IDSA 1LUAA 2Q1UA 3O38A 3WSVA 3IUSA 4EJ0A 3EGOA 3E82A 3DEYX 5CPFA 1HF3A 1P45A 1NNUA 3HADA 4CMCA 4Z9FA 1MFPA 1F0YA 4A5OA 4Q9NA 3VH2A 1F8FA 3IUPA 4B79A 2O3JA 1NAHA 4J9UE 3AI2A 3WFJA 4BO9A 4DC0A 5BSEA 3NT2A 4KWHA 1E7SA 2NV6A 4ZA2A 5F1OA 3W6UA 2WTBA 4AJPA 4NI5A 3PHHA 4GI2A 3JQAA 4IDEA 1GTMA 4FR5A 1DSSG 1C3VA 2JL1A 3QWIA 4R68A 4W9NA 2YHIA 2OXIA 1PGNA 2RHRA 3EUWA 4HP8A 4RVDA 4IQGA 1MGOA 4M86A 2J5RA 1P1JA 3SJUA 4H16A 3NDJA 3UCEA 4DIOA 1ZEMA 5CDYA 3F3SA 3EK2A 3I9MA 1I2CA 4KTTE 2XAAA 1OZAA 1NVMB 1XEAA 2ZK7A 3INRA 3IQDB 3ONEA 3SC4A 3ADOA 3GZ4A 3N74A 5L3ZA 3AUTA 5T6BA 1KY5A 1Z7BA 3D3WA 3Q6IA 4JK3A 2ZB3A 1D4FA 1D1TA 4II2A 2JHFA 4GWKA 4RVGA 4Y6RA 3X2EA 4AFNA 1Z7EA 5CG2A 3ROPA 1BWSA 4FD3A 1S6YA 1E7YA 2QRKA 2VT3A 3DZFA 3JYNA 2WM3A 3OF2A 5EESA 3UCFA 4UUNA 3G17A 5CEJA 2Q45A 5DP1A 1G1AA 4NFSA 3U3XA 5KVCA 3K2BA 3PP8A 1UH5A 1J6UA 2WDZA 1MLDA 1MC4A 3C7CB 3BMQB 4NBWA 2RH4A 4OXNA 2B0JA 3P2YA 4ND1A 3OJLA 2FR1A 3T4EA 3KEQA 3KB6A 4PLHA 3QVXA 4AJ2A 1ZK0A 3HNPA 3JQFA 4BOYA 1YXMA 3U49A 2IEDA 5DT9A 5G0WA 5A04A 4DRYA 2G17A 5ITWA 1E1MA 3OJ0A 3F1KA 2CFCA 3ZGYA 5AVOA 1OI7A 5A06A 5HWSA 4K1LA 1V3UA 4HFMA 2PZMA 3RSHA 1FK8A 4DLAA 4WUVA 4E13A 1X0VA 1RKXA 4TRMA 4R01A 2ZJ0A 1HT0A 1T2CA 1I3LA 3AOEC 3BXXA 4XDZA 5TRTA 1LSSA 5K0ZA 2GLXA 3GDOA 3A14A 3ICPA 4RF3A 1HSOA 2JD2A 1NQ5A 2EKLA 1GU7A 3FBGA 1EDZA 3WDSA 1T25A 4E2YA 3VTFA 5BQFA 5L45A 2GPTA 3JQ7A 1KEUA 4OH1A 1R0KA 2GUGA 3BMOA 5G0TA 1HDRA 4BO8A 2X58A 1BXGB 4RLHA 4MIEA 3OETA 3DWFA 4YAGA 4U7WA 2RHCA 3LZ6A 4BNVA 2GF2A 3GUCA 4E21A 1EVYA 1OC2A 4M8SA 4DC1A 4ND5A 3EHEA 3C24A 2X1HA 3I6QA 2NU8A 4OKIA 4WGGA 3JQEA 4R1SA 2OP0A 4E2WA 3RFTA 3LF1A 4CQLB 5I7EA 2UYYA 1KEWA 5FF9A 4JBHA 3CKYA 2B4RO 4CUJA 3E5MA 4EEZA 2BFPA 4ZHSA 1GEEA 3GVIA 3GMSA 1I3KA 2QYTA 2EIHA 2HQ1A 4YEDA 3D7LA 1EQ2A 3TRIA 1E1LA 1ML3A 1FDWA 4BMNA 4YXFA 1PJCA 3DR3A 3PFFA 1PJTA 3UKOA 2Q4EA 5AYVA 3U4IA 4PLTA 3FNEA 4R5HA 5A02A 1PJLA 5F1KA 4BNMA 4BNUA 1YE3A 4RLSA 4FIZA 2Q50A 4LMRA 1HYHA 2AE1A 2V6BA 2X0JA 5LDGA 3ZWXA 2AHRA 5U9CA 4WLEA 4GVLA 4YACA 1IYZA 3RUAA 3S2IA 1B7GO 1ZNQO 2PY6A 1XQ1A 3HDQA 1Y8RB 3V1YA 4BV9A 3L4BA 1BG6A 1MA0A 1WVGA 4MP8A 1QV6A 4L74A 1A9ZA 2B4QA 2PGDA 4Q3NA 4BNWA 2WMDA 1KVSA 3FN4A 3T7CA 5IAAA 5G0VA 1EE9A 3WGZA 2J3IA 2P91A 1NQOA 1EZ4A 3STHA 2YDYA 1P44A 5CEEA 1ZH8A 5ENVA 2I3AA 3PLRA 4RVSA 1KERA 1NASA 3VDRA 5CEFA 4QECA 5L40A 4YT4A 3H9UA 1JVBA 3OP4A 4DPLA 4FS3A 1ULSA 2ZYDA 4TMFA 4XYBA 4BGVA 1Y6JA 2EP7A 3IS3A 3VPFA 4RVHA 4BO2A 3LK7A 3WFIA 5TGDA 3CUKA 3ETDA 2JCXA 3WBBA 1E3LA 4MP6A 3C7AA 4H15A 3U9LA 5DDIP 4DWVA 2VWGA 3V1TC 1NWHA 5JW6A 3GEMA 5J23A 2WSBA 4KP7A 1DB3A 4FJ2A 1SZJG 1ZXLA 3PTZA 4M89A 1B2LA 2DBRA 3OJOA 3QW2A 1VC2A 2XF8A 3V2UA 5LDHA 4BNKA 4GLOA 3KOUA 2O3TA 4EUHA 3M1LA 4W9NC 3VPGA 2BFAA 4E31A 1PU2A 4GX5A 1M76A 2HDHA 3GT0A 4RF2A 5L7WA 4NBVA 1TT5A 3O8QA 3RUIA 4RZIA 3K31A 3SLKA 1O9BA 4UEKA 4HFRA 4HY3A 3ZW9A 3GG2A 1FDUA 2WEKA 1VPDA 4FW8A 3HZZA 4ZQHA 3BMCB 4BIIA 5KJFA 3JV7A 3NEPX 1CDOA 3GN1A 1N1GA 2SCUA 1B16A 3OFSA 1PJ3A 2EGGA 3PWKA 3RUHA 1DFHA 1NQAO 3B20A 3FNGA 3QVOA 3E8XA 2ILTA 2Q2QA 3VTZA 1YWGO 2A94A 4BUCA 4FC7A 5DN9A 1ZBQA 4OYRA 3KVOA 4LCJA 5A9RA 1X15A 2G1UA 4MPDA 5I8WA 4OIMA 4CMHA 3G3EA 1JLLA 1CEQA 3G49A 1QP8A 3Q9NA 3H6KA 1SAYA 4MINA 3RIHA 3JQFC 3SXPA 1HE5A 5BSHA 7ADHA 4W7HA 3IJRA 4S3MA 2YV2A 4B8WA 4RZHA 5BNIA 5L7TA 1LXCA 2NQ8A 5L7YA 3IKTA 2W2KB 4YBZA 3AY6A 1EVJA 4P22A 3EY4A 3EZYA 1DC4A 5C7OO 2TMGA 2DBVO 1MXFA 1ZSNA 1TA4A 2FN7A 2C54A 3GGOA 5I8ZA 1CJCA 1MP0A 4PLCA 3UVEA 3ZU2A 1SC6A 5JDIA 1Y8QB 3MZ0A 3ZNPA 1HDOA 2HRBA 3JD1A 1DJQA 1EMDA 2BLLA 3A1NA 3KTDA 3AUSA 3ZWPA 1C1XA 1UZNA 4S1VA 2YHUA 4Z0HO 1O6ZA 2HKIA 1HE4A 2C5AA 4E6PA 4FPXA 4R3WA 5JE8A 1BXKA 1O95A 1DIRA 4E5PA 2DUWA 1FDVA 4QSMA 3KO8A 2C2XA 5B4VA 4RPGA 2EGHA 3KYDB 4IIUA 5IDYA 3PHLA 2OZPA 3COSA 1EEHA 3FTNA 9LDBA 2UVDA 2PH3A 4P4GA 4BKRA 1UXHA 2Y0CA 5B12A 4BMVA 1GL3A 3V5NA 1J5PA 4OHUA 1RYDA 3OH8A 4R69A 2F00A 2AQHA 3VC7A 2LDBA 3WGIA 1E1NA 4NJMB 2JAHA 4U0JA 4FFRA 2DBZA 4XGIA 2GYYA 5JS6A 3U0BA 2AQ8A 4WCFA 2AEMA 2VYND 3WJAA 1UZLA 4ITUA 2F1KA 3DOJA 3EDMA 4Q39A 3U09A 4XYEA 1GUZA 3QQPA 2FSSA 5KVVA 3HQ4O 3O26A 4NDNE 4DYDA 4BHTA 3Q2IA 1I3NA 4J7XA 4J6FA 3L4SO 5JMPA 5JCJD 1KIFA 3RC2A 3PXXA 1LSUA 3AI3A 3INTA 4XB1A 1NVGA 4J4TA 4OO3A 3H3FA 5IDQA 4Q3CA 4Y6SA 4B4VA 3GAFA 1E3SA 1TI7A 4WEQA 3FPLA 3M2PA 5T8KA 2QIOA 1LSOA 3L4BC 1WZEA 3DMTA 2D8AA 1DRWA 2P4HX 4TVBA 5TT1A 3WTBA 3PQDA 3ROQA 3NGXA 4PRLA 4E4YA 2VRCD 3GA0A 4UUOA 1EBUA 1C1DB 2VZ9A 4OL9A 1R4MA 5DBIA 1LTHR 3H5RA 2HMUA 7MDHA 4CR7A 3E6AA 2Y93A 3HE3A 4WOKA 4XQCA 1Q1NA 3ZWBA 3RC1A 4BNJA 1GCOA 4B4WA 4BNLA 3F5SA 4WCDA 3CMCO 5FWNA 3GN2A 3BHJA 3JQGA 5ICSA 5IG2A 2WYUA 4MVJG 2NU9A 5KOIA 3ZWNA 2DTEA 4YRDA 3NKLA 5FYDA 5TSDA 4BNHA 2PA3A 4M49A 1KVRA 2Z95A 3ZV5A 4DLBA 4UAGA 4IXWA 2CVOA 1HZJA 1PX0A 3EC7A 2FY8A 1MB4A 2ZTUA 3IJPA 3A4VA 4WE3A 3ROMA 2PD3A 3NRCA 2DU8A 2P5UA 1XR3A 1YL5A 1PZHA 1P3DA 3A06A 4WOJA 5DCYA 1GD1O 1WZIA 1AE1A 3I9KA 2ZB7A 3PPIA 3QSGA 4NU5A 4AJ4A 4KOAA 2OL4A 1PEDA 2HUNA 2VWQA 3I52A 4FN4A 2RBEA 4CLOA 3MJSA 3V2GA 4C7KA 3SJ7A 4G65A 2PKRA 4NHEA 3DAPA 2EEZA 4J49A 1GUYA 4YJGA 5I7VA 4XQ9A 4XB2A 3PRJA 4KDFA 2J8ZA 1UDAA 2R00A 3TL2A 4OOEA 2UAGA 4I9NA 4DVJA 3GF4A 1LI4A 4AJ1A 4TSKA 1F06A 1IULA 1R4NA 3FI9A 1GCUA 2NNLD 2WE7A 5C7IO 3NJ4A 3TFQA 2R2GA 2ZQYA 1ZSVA 2Q2VA 3KBOA 1QV7A 3PHIA 4I1IA 4FQ8A 4URFA 5CP8A 3CSDA 2GR9A 2X4GA 2XPCA 4MIOA 2HK9A 3UF0A 3K73O 3PHGA 4PVCA 1W8DA 4O6VA 4MVJH 1OBFO 2BF7A 2X0RA 4YTEA 1Y5RA 5DNAA 1P33A 4L4RA 3PK0A 4L0QA 1U8XX 2J3KA 4J0EA 4E2ZA 3RJ9A 1E3EA 3BMNA 1XA0A 4MDHA 2VYVA 3NUGA 1C0PA 2C7VA 3OQ6A 4Y98A 4IMRA 5IXYA 3KXDA 1HDGO 1W73A 3WB9A 4XQGA 3LT2A 3QWHA 1B26A 4XRGA 4A0SA 2O4UX 3TZQA 3ETEA 1YVEI 5GZ1A 1ID1A 3JQBC 1Y5MA 5JDIC 1GADO 4OJNA 2I99A 4UVIA 3FBTA 2JFGA 9LDTA 1ISMA 1W0CA 4EW6A 3CTMA 3DBHA 2PLAA 4L9RA 5I9LA 1SCUA 1NPYA 4CUKA 3H9JA 1K0UA 1UDBA 3U62A 3AUAA 1U3WA 1PGQA 1GYPA 4BNFA 3V1UA 3IP3A 3KEOA 4E12A 1AXGA 5AOVA 4WK6A 1K3TA 2DC1A 2B69A 1FXSA 4NBRA 2C29D 5IJZA 1PJQA 4Z3KA 3Q9UA 1ISFA 4DLLA 4NBTA 1DDOA 2P68A 1K6JA 5JAQA 2RH8A 4ZU3A 4CM4A 3L6DA 1R16A 1X0XA 2BGMA 1ISHA 3FR7A 2FZEA 3OIGA 1V0JA 4YJDA 1NM5A 4AJEA 1QLHA 2I5PO 3JQAB 1SOVA 4OGWA 3AFMA 3HB5X 1PL7A 1Q0QA 4J7UA 1LDYA 3Q2KA 5KNLA 1PIWA 3DC2A 4BV8A 4ZJUA 4D43A 1A27A 4YB8A 5G0UA 4WCFC 4K26A 3CINA 4PN3A 2H9IA 4JP2A 4XWYA 3JQ9A 5GY7A 2HSDA 2WD8A 2FMUA 2X23A 1F17A 4YYZA 3DAFA 1QR6A 1UP4A 2AQKA 2LDXA 4UUMA 3C1AA 2I9PA 2DUUA 4FFMA 3WTCA 2C2YA 1OOEA 2P5YA 4KUGA 1YO6A 3WWZA 3QRWA 1M6WA 5IN4A 2CDAA 3ZHYA 2VHZA 5T8KC 4CMJA 3C8MA 1ADCA 4WLFA 1N5DA 3DMTC 3WGYA 2HMVA 3LLVA 1F8GA 3GZNB 2XXJA 5G2OA 2X86A 3LT4A 3WGHA 3ZDFA 5TIIA 2BELA 2C20A 2IODA 2V6MA 3WYCA 4YAIA 1N8KA 4X54A 3DOOA 3H3JA 3NTOA 2IDZA 2JCVA 2AG8A 4J90A 5L51A 4L75A 5EPOA 4BB6A 1H2HA 1PR9A 4PG7A 1OC4A 1F12A 3BYZA 3F4LA 1E1KA 2EW8A 3FWNA 3LC7O 1J49A 3C1OA 2H63A 2BH9A 4INAA 1HRDA 2JFHA 5JCJA 4UUPA 2J5QA 2FP4A 2ZB4A 5L95A 2VUSA 4U6SA 4B3JA 2V7PA 3HFSA 1I8TA 3D3EA 5T67A 3B6ZA 4A2CA 3TOZA 2DAPA 4PVDA 4LGVA 4LRTB 1ZMTA 4R9SA 1M67A 3JQ7B 4R51A 4R1NA 5TQVA 4EGFA 3DZKA 4TRRA 5CDUA 4KUHA 1ZO8A 1NFFA 1ARZA 2NTVA 1V3TA 3BMOB 1K2WA 1NFRA 1DIBA 2GDZA 2OO5A 5EQDA 4LVUA 1ADGA 1NBOA 3JQ6A 1UXKA 2HK7A 4BNGA 5ICMA 3DAGA 4YJFA 3AM3A 5C37A 1GEGA 1XIVA 2CNBA 2WJPA 1JKIA 2EJVA 3OQBA 2E82A 4II3A 4HFJA 2JJYA 5G4KA 3D4NA 1TVEA 2R00C 4BKPA 1JWBB 4R5MA 4RPLA 1PQPA 5TX7A 2WWRA 3FWZA 1BW9A 2H6EA 1ENOA 1LDEA 1V3VA 2C07A 3ZWOA 5JAIA 4TKMA 4MVJP 3AK4A 3P5SA 5B4UA 5T57A 3RBVA 5CG1A 1EQUA 4QFCA 3RC9A 4B8ZA 1YS4A 3DZBA 2HJRA 1EVIA 2AEFA 4D45A 4A7PA 4E5YA 2W8ZA 3I9JA 1H6BA 5GMOA 2OBNA 3LVFO 4IM7A 5BNFA 4CPDA 4MVJI 1NXQA 3KYCB 1ZJZA 3N7UA 4M1QA 2G76A 4BNXA 4CMEA 4KZPA 3ZZNA 5A9TA 4IDCA 2FPIA 4M54A 1QRRA 2AA3A 2NADA 2VHVA 3JSAA 1HSZA 4GPD1 1U5AA 3OM9A 4BO3A 2VUUA 1T1RA 3E5RA 4IZHA 4F6LA 1QYVA 2NTNA 1E5LA 1VL6A 2Y66A 1JKJA 2H1SA 2OHXA 3ASUA 1ZZEA 1TT7A 1CRWG 1QYDA 2ZQZA 3M2TA 3UUWA 3JQCA 3ZWMA 4B7UA 1DOHA 3O03A 5JC8A 3G1TA 1ZCJA 5FI3A 2YYYA 3TNLA 2VWHA 1VL8A 2AMFA 1HL3A
chains in the Genus database with same CATH superfamily
1N25A 1QIKA 4C3UA 2V0CA 3IBCA 4EY4A 1TIBA 4IJUA 1TLTA 1KMHA 3S2SA 4A6XA 3ONNA 4QM7A 3EWIA 2VXBA 2G36A 2O0JA 3HBNA 4D0RA 2MYTA 2AVDA 1PDVA 3O73A 2DPYA 1MC5A 1Q3HA 2VHQA 3NV9A 3NOXA 3DTVA 1M1XB 3H11A 5IZCA 4PSAA 4I8XA 3PXDA 4MR7A 3PVZA 3K15A 3AHGA 5CUQA 3R7BA 2HOQA 2Z3ZA 2FU5C 3VYVA 1J5EB 4UQPA 3WRXA 2OFWA 3BMXA 4GI1A 4OMUA 5AQEA 4ZOAA 4N6NA 4OXQA 3BE6A 1H0KA 1KY3A 2BEVA 3VHXA 2IA5A 4NV1A 1U3TA 1XU9A 2NSJA 4C29A 4DQ0A 4GWLA 1BMDA 1Y98A 2Y99A 1UMBB 1ZISA 2OOKA 1NM5C 1ENZA 3CNOA 2GEUA 3DL0A 3GJYA 5KNBA 2J41A 3AVVA 1VJ0A 5LD2C 3AZOA 3K70C 4IDAA 3SQNA 3ZVNA 2UU9B 1NR7A 1KI8A 2BMAA 2AFHB 3QVGB 4HRYA 3WIVA 3FOEC 3ELUA 3PJDA 5FJJA 2W8BB 4DADA 5D85A 1EWVA 5LB2A 3FVTA 3MHTA 1J8MF 1THTA 3ELWA 3FXAA 3HPQA 3I2IA 4UHFA 3RADC 4QM6A 1G98A 1GDTA 4ISBA 1A77A 2CD7A 2C57A 4TXMA 3CW9A 4BLSA 1HMYA 1T1JA 2EC5A 4BJ3A 1V8PA 4DPMA 2VNHA 4M98A 4K9NA 5BO5A 4M7OA 4ONEA 3W7AA 4B2PA 1C3EA 1B15A 2KS6A 3F47A 4YCCA 2V7QA 4S2EA 3QVUA 2HAEA 3KSMA 5LXTF 1VG9B 1YC5A 1PT6A 1ECFA 3KU4A 1R0RE 2B8EA 5KJ1A 2C4HA 2KW5A 2GASA 4QXPA 4DT1A 1XVIA 5AK4A 1K4YA 4G97A 1U7ZA 4CM3A 3KCNA 3ZXXA 5KX5A 2ZE6A 1LSJA 1LTQA 4MIKA 3ROFA 4ETMA 4BFCA 1FFYA 1O54A 1ND5A 1VJGA 3FTPA 3OD5A 4IQ0A 4PRZA 4PZEA 5AHOA 5EERA 2NUAB 4HQ6A 4GI5A 3TLYA 4D8XA 4OQZA 3HYTA 4CF5A 1GZ5A 3ETCA 1IVNA 2C8JA 4YRAA 2JI8A 1U8FO 5K4AA 3R7LA 1X6VA 3UMFA 4RACA 3WWYA 2B2XA 4MEBA 2VCYA 2BFMA 4NEGA 3RNOA 4W5QA 1ZPDA 1YZKA 1BZYA 5CXXA 5ITSA 3GBVA 4G0MA 4J0CA 3FCEA 5D2CA 3BRCA 3LYLA 4KQKA 5E2AA 4K7JA 4A0GA 1KEPA 1L4LA 1O77A 1OJLA 1USIA 4YA6A 2I4RA 2R85A 1X87A 3HBFA 4UBMA 1BFDA 5CLIA 5K0NA 2WQ7A 2VYCA 3OTWA 1YZLA 1Y8ZA 3DEJA 3RCBA 1JA1A 3EB9A 3Q6NA 4R3NA 5L3SA 1VJTA 3HYNA 3Q4GA 3TAHA 2DQZA 1FP6A 1L4FA 4RVOA 1S2GA 2CXUA 4DIDA 2ZTMA 3CNLA 3EZLA 1Y1RA 1U31A 3LC0A 1JSRA 1CE8B 3P9SA 1ZVQA 2YWGA 1GG5A 4KTVE 4NV0A 3H8SA 1MX9A 5FTJA 2J3JA 1KQNA 4MMZB 4CDGA 3HXTA 1YR7A 2P4QA 1V96A 3OG9A 3PRHA 3T4PA 2VIIA 4AWXA 2CYCA 2XRMA 4CM1A 1QZUA 4L6CA 1B0PA 4LYAA 2C7BA 2QZSA 2IU6A 3CUWA 3EGWA 1C1HA 3OSUA 1TAQA 2EYUA 3NYIA 3TGPA 4I08A 4FFBB 4YRLA 1QHYA 3I8OA 4B80A 3THYB 3S1AB 3BDVA 4JUDX 4AI6A 1FFGA 5EIHA 4ERNA 2OQ2A 3IAS6 4HXEB 5F12A 4BTLA 4IVPA 4E2XA 1D3AA 2HHCA 4F38A 1NRJB 1QV9A 2SHKA 2PH7A 5L6LB 4H18A 3D8SA 3BWMA 2W71A 2NP6A 2VQ6A 2Y1XA 4RE6A 4MUFA 3ZWCA 2JVJA 2YNMC 5TB5A 2DECA 2PXCA 1GL7A 4MR9A 4Q7MB 4MA4A 5SICE 4BMSA 1JIIA 5A7GA 5IZ4A 4WUTA 5C4IA 1P5RA 2GAFA 3PWSA 2WD7A 2JLSA 5ALHA 2B92A 4ZT3A 5LYYA 3T3OA 3AHDA 2CUZA 1IEWA 3AJEA 3PPVA 1CLEA 2YTZA 3QHAA 3R5TA 4WV3A 3PEEA 4X1OA 4CLRB 1W5SA 3NNSA 4F3YA 1ZL2A 1DBRA 3ZDZB 3AQIA 4C43A 3IVGA 1CEYA 2YHBA 2VDOB 2W5UA 3ZH2A 3UANA 2IBMA 4G5XA 3TZCA 2PV7A 4L50A 4YO7A 2PCJA 4PC1A 4P0QB 1X70A 2C3UA 6Q21A 2HD4A 4P4LA 1DU4A 4IDGA 5DI9A 3UTDA 3G9TA 1EWRA 5SZJA 2GF0A 1D09A 1VLHA 3FMVA 1N34B 3O7MA 1G2IA 4B3IA 4CMIA 4EGAA 5AESA 2DLDA 2VNAA 4IF6A 3WG9A 3THWB 3LT5A 1QWSA 1TZKA 2WUVA 3WLAA 3HJGA 4IJWA 2M1XA 4V0MA 5HE9A 4GAEA 3RFFA 3LHDA 3WLPA 1BGVA 3K72B 1G6OA 1VKNA 2VPTA 4RXTA 2EP5A 5FCDA 2C77A 1ZCAA 3B5JA 3FDJA 1TEVA 4B85A 5BY2A 4PYRA 3AP2A 1BGWA 3PDJA 1ZM3A 1JQ5A 1SR8A 4Q19A 4RZQA 2D3WA 2NSDA 1FSFA 1V6CA 2WFAA 5ALMA 8ADHA 4M22A 3MUEA 4CEHB 1YVPA 2H1CA 5KNCD 3R6DA 2REQB 4IFTA 4PYOA 4Q3BA 3WKBA 1OH8A 1S8NA 1XXHA 3LPDA 2QORA 2PNJA 3WK4A 5IDWA 3RD5A 1OILA 4FHFA 4OHYA 2A30A 1RI5A 3ZDEA 4RHCA 1OZGA 4JI2B 4NEQA 2QMZA 4K9QA 3F5QA 5KINB 1ZGAA 1X7XB 2HPZA 3FNIA 1MCZA 7MDHA 1OYYA 3MOGA 4PO9A 2VN8A 4YQYA 3UV6A 1E4EA 3ET5A 3M6LA 4FE7A 4HGRA 4KIFA 4FBGA 3UC9A 2EZ4A 3O8LA 3KKLA 1Z0FA 2HU2A 3DULA 1PR5A 1TYZA 1V48A 2ZYGA 1A97A 1NJGA 1V9LA 4XJVA 3DTTA 2RAFA 1ORHA 2XX3A 3GRAA 4GSLA 4WNAB 4GOXA 4GPTA 1XA3A 7MHTA 2J0VA 1V7ZA 2X0NA 2C88A 2IHJA 3ZOKA 5HKKA 1MJGM 2CSUA 3KL4A 2IGTA 5KJCA 3ZWVA 3VKUA 1JILA 3SIRA 3UOWA 4YAOA 1L0BA 1P77A 2VJPA 3AZPA 5T7BA 4DCMA 2HPHA 5ARCA 3FF4A 4YT5A 3FVRA 1G20A 1E2DA 1MC1A 1W1UA 4MUXA 1VYVA 4G81A 4GGMX 1N0WA 3PCXA 3H4VA 4QJBA 3GOHA 3GDGA 4RVUA 4N6GA 1SOWA 1WF3A 3QKSA 1Y0BA 4K6GA 1BXRA 1E2PA 3U7RA 2O50A 4BMXA 4UCFA 2WTUA 1NVWQ 3RVRA 3T7JA 2JS7A 5HTOA 2FFJA 3FGZA 4L8FA 3RKSA 4Y1FA 4E5UA 4CEJB 4EW3A 1CYEA 2WA2A 3OEWA 5D3KA 2A67A 5MGBA 2QGNA 3AYXB 3W4KA 4DNXA 1EXNA 3FCAA 3EQ2A 4M9CA 3GLIE 3FTEA 1JEOA 3UENA 3OLYA 2A88A 1PFQA 3TBFA 3MB8A 4TV9B 1CIVA 5A4IS 3DTNA 1DXOA 1QBKC 2CXSA 5DGIA 1VLQA 2V5UA 2A78A 1XNGA 3L02A 1V6SA 2YC4C 3WQSB 4JI4B 2VOEA 4MRNA 3KC2A 3GJ8A 2IFTA 4G1BA 1TKRA 2W48A 1U1DA 5JZVA 4HDKA 2RGNA 1VP3A 4ZI5A 4D2IA 2BN4A 4JB2A 1BWRA 3NDBB 3EOBI 1Y3BE 3EW9A 3L7AA 3PGVA 3T0IA 2O8BA 4BMCA 7AT1A 4LBZA 4CT5A 2CW5A 1AS3A 1EI9A 2ES4A 2HPAA 2CL7X 2QRUA 1AMUA 4G0WA 1N1MA 4NAVA 2ARKA 3H84A 1C0LA 1CS4C 1T9ZA 2HRRA 2QAIA 3D64A 2VJYA 3MQFA 4MA5A 3AIIA 3BQMB 3ISJA 3PHBE 4DR7B 3DPIA 1Z5WA 1G55A 1Y9AA 2I87A 5FWDA 3ZJVA 4J1QA 1BMFD 1NVEA 1SBZA 1ZL0A 2BFDA 2FMKA 2HY7A 4WA8A 3TXAA 4YLYA 1HE2A 3ZDQA 5CD1A 3TF5A 2HA4A 2I2DA 4EVRA 4Z3OA 3ROGA 3EC1A 5T41A 1SHJA 1LEHA 2ABWA 2IOHA 4ENVA 4G1MB 1LZLA 2D4HA 3DBHB 1HLGA 4OQPA 5C0OE 1VJRA 2H4XA 3MILA 3TLEA 6NULA 2D7JA 3HVKA 4J1TA 5EIEA 1T26A 3QJ5A 3GGDA 4PLVA 3C3EA 1SN7A 2JFNA 4I55F 3FLMA 3B7WA 4OGLA 4WN9B 1WAMA 1SKAA 3D59A 3QEOA 2G04A 1F5SA 2L17A 4W6ZA 1AURA 4O29A 5C8ZA 3Q85A 4LJRA 4RHTA 1J2JA 2BZ0A 1KETA 2OUKA 1HYEA 2ZI9A 4TQ9A 5BYKA 5JSZA 2QP3A 3D7NA 3IJEB 3PNQA 4HX5A 1JE1A 1G291 3KZMA 3TD9A 5I47A 2QJWA 1L7VC 4KN6A 1Z4PX 3NBZC 3HXLA 4EARA 4AJHA 3KP1A 2FEOA 3WMRA 3KJZA 3S4YA 1N3YA 2PJUA 5HSGA 4E5MA 5KUTA 3M3DA 10MHA 5THKA 4I5DA 1RRKA 4N54A 1TUBA 3P32A 4I9HA 5E0OA 1JDNA 2AI3A 2IUSA 3U80A 4G0PA 3L6BA 4WZBE 1Q0PA 1HDCA 4C6TA 4UVGA 5BYJA 5IMSA 3VR6H 2Q5JA 3V3KA 1JVSA 1K6IA 5JFOA 4ZICA 1SVNA 2GBIA 3OURA 3F97A 4B3HA 3WLEA 2A0UA 3J7AC 5TNXA 4NYJR 2XITA 3RYFA 3Q3VA 1JIVA 4MUNA 1GTG1 4GYJA 3GLGB 2JIPA 5AOBA 4DV4B 5IJ9B 3GAMA 2VHYA 4JYAB 1NMEA 3D7KA 3QA9A 1TTPB 3WE7A 1PFVA 3QK7A 3SDZA 3SX4A 1UKVY 5D3MA 4U7JA 2FK8A 4L51A 1EK0A 4Q3KA 4UNRA 5DBOA 3IXQA 4F9GA 4HPJB 1W85B 4DJ5X 1CZUA 2YFQA 3H1PA 3M34A 2CNWA 4PS1A 3V8BA 5K7SA 3Q8MA 1SBTA 1ZVMA 1W29A 1ZH4A 3KK0A 5EL0A 3T52A 4JLJA 1W30A 1P39A 2I65A 3JD3A 1N3IA 1PGPA 4BASA 4NZMA 4RANA 4YRQA 3OPNA 4DEVA 3RDPA 1T2DA 1Z2CA 3GRFA 3JZIA 1RWXA 4LVCA 5AIBA 3BXPA 4I1VA 4L78A 2XYVA 1Z62A 4L3WA 4CU2A 1FP1D 1Z88A 3RYHB 4E7OA 1AU9A 4F8JA 3GFGA 2QN1A 1IWBB 2H4HA 3JWIA 2E21A 4BX9A 4CKCB 1SQFA 5EP2A 3C85A 2X7HA 4C7OA 3EQ9A 4KFRA 1H8ED 1F8UA 1KZ6A 1N2IA 4QJ3A 1O1YA 5DHTA 4KVZA 4LK3A 2E6UX 3AR3A 4U63A 3BL6A 4RFLA 1H4TA 4GI7A 3RGGA 4LRQA 3RYIB 2UZ0A 4REQA 5U4QA 3L07A 1Z0SA 3W2IA 4B7ZA 4BLWA 3NMUF 3N75A 1LI7A 4INPA 5CDSA 3DEFA 3MGKA 2LKDA 2ZB8A 1MPTA 1AH2A 3AP3A 2VF8A 5DNCA 2XMQA 1HTBA 1E6CA 1S4MA 3RTCA 3D5QA 5LCXA 1POXA 4AY3A 2BI4A 3MQ4A 1XQ6A 4CCWA 2VJOA 2FUNB 1IJEA 1CK4A 2GETA 1N0HA 4G01B 5F1YA 4C0HA 1CKEA 1SQ6A 5D3QA 3NONA 4ILKA 2VQ3A 1A69A 1C1DA 2GPBA 3FFAA 3MGAA 3RO7A 1DHTA 4BE7B 4LW8A 1HI9A 5B58T 1Y6QA 4NK4A 2D06A 1Y4UA 3C15C 2FN3A 4QPDA 3SAJA 1AS2A 4KQEA 3UPUA 2H4YA 3A28A 6YASA 3FKJA 2X0EA 4Y9DA 2XVZA 1KQFA 2FEKA 2WWIA 2XUJA 3MELA 4PG8A 2B1RA 3U3KA 2ZJ6A 1N57A 4L85A 4ZREA 5HGXA 3U6KA 4IHJA 2VQFB 2DHEA 3LQRA 4OHWA 3W6OA 5C5DA 3HXQA 4AJKA 3OM1A 1B1CA 1Y3DE 3GH1A 2O4CA 3IEVA 2VF7A 2QIPA 3RC8A 3OMWA 4RL4A 1XDBA 1RWBA 4GQAA 4TLBA 4WLNA 1E6MA 3VSBA 5A3RA 3SZRA 4FINA 3SZGA 3VU3A 1XMIA 3TYXA 4MLZA 1T8WA 3JWJA 4IWYA 4W5WA 4CIVA 2DRIA 3EDYA 2XLBA 4JQOA 2X1MA 1LI5A 4MS3B 2WY2D 3S2FA 1MJHA 2D1RA 1ONPA 4P4TA 5C1PA 5IF3A 4CTOA 1TMKA 5FUYA 4RD0A 3KE8A 1EE2A 5FWYB 3PG5A 4AY5A 2H48A 4DIEA 5CK5A 2AOWA 3E9MA 3IEKA 4PLWA 2QB5A 5LYJB 1QXSA 1QQAA 1YDEA 2IYZA 4IGEA 2FXVA 2Z98A 3CBQA 5AJTA 5K8UA 4LXYA 1NNLA 2JJ1A 1JRLA 2YYSA 1L2TA 4RDIA 1WUKS 4ZOLF 1H65A 1Y6ZA 3ABOB 1J8YF 2WT8A 4NENA 4QUKA 1JLKA 2HMSA 4N03A 1JL3A 1L3IA 5ER6A 3A4MA 2QT1A 5HQTA 3EF1A 4LYGA 2UVQA 1AKMA 3NDIA 3CZPA 3OU6A 4B4OA 4J9VA 1ZGCA 1XEWY 2HB6A 4DDTA 4F9TA 1YOVA 5EZYA 3CLUC 3CLKA 4PM4A 1NA5A 1XOIA 3PCTA 2J31A 2EDAA 1DE0A 2PKQO 2PD6A 4P83A 1DQNA 3RKRA 1UP7A 1Q15A 1WSDA 2EW2A 5CH8A 2XNHA 2PQ6A 3KCQA 4MJLA 4GR5A 1LKZA 4KW7A 4ZC1A 2DQYA 4DQKA 5GADl 1NY6A 4BO5A 1NMXA 3DNPA 1XWFA 5HK8A 3QFFA 3OFNA 4M0PA 5B3AA 4LSWA 1ZMBA 3D3JA 3W04A 1GPAA 4QDXA 1ORRA 1IWOA 4D6PA 3EXG1 3HFGA 4PBTA 1PWZA 1QZXA 2WPNA 1XPJA 2INGX 4MV0A 2WAYA 4PG5A 4A26A 4Y9RA 1KFKB 5A03A 3DTVB 3H11B 5TQ0B 1UKBA 4YWJA 2OK8A 1YASA 4I4TA 3I32A 5K51A 2I0FA 3N7TA 1JU9A 3CPJB 1X13A 4AW9A 1U0BB 4ESHA 2WV7A 3BX1A 4G5RA 2XYRA 5JO9A 3RHZA 1R12A 2BEVB 3VHXB 1KO7A 1S8FA 1XCJA 2CXPA 5HKBA 4U6QA 2Z3VA 4LHVA 2ZJ7A 4TWZA 7REQA 4IO0A 3DUWA 5C5EA 4TKVA 2GZHA 1W7AA 3SE0A 4MVJE 3E58A 4XJTA 5K6AA 2V4MA 3TOXA 3HJNA 3T4XA 4UNPA 1U99A 2YY5A 3E3AA 3QNMA 4LC0A 4U9HS 5EZ6B 3QIVA 2EVWX 4FFOA 4M1KA 3SFZA 2GSWA 3TN7A 2C1XA 3STYA 1H1DA 5BSGA 4FSDA 4IDBA 1Q7GA 3HH8A 3GFOA 1Z08A 4B3XA 3IP1A 4IIXA 3A3YA 1TFUA 4LY9A 1EJBA 1FBTA 3PX7A 1E66A 1SY7A 2HADA 3RIYA 1KOFA 3MRXA 4OAPA 4BEWA 5C51B 2HL6A 3C6XA 3F6SA 2XQVA 1L5LA 4AJNA 1OX4A 1SUEA 1S01A 4DL9A 1E1CB 4IX9A 4KQGA 5BRJA 5IT9A 1XAGA 4EZEA 3WNQA 3KB2A 1MB2A 3II6X 1U2TA 1L1QA 1XLUA 2ZBVA 1C41A 1NT4A 3OZDA 3PC7A 4Y2PA 2YXEA 3T15A 5E2BA 3NRBA 2G3YA 1ISJA 2RH5A 3ABQB 3DFFA 3JWHA 4DT1B 4EYQA 1MO2A 5DSXA 5TPWA 3CF0A 5HR5A 4L4SA 4AJJA 1KYIA 1QKKA 3HXPA 1WHSB 3R5FA 5KX5B 5E6SA 3FOFC 1BS1A 4EATA 4M0EA 1JH9A 4EHJA 1YZGA 3EDQA 2AXEA 1QFXA 5DX8A 2VTDA 2I29A 2Y1CA 4AX4A 2NZJA 4G9BA 3DL4A 3R76A 4HNVA 2C58A 1XVTA 2N46A 2VP9A 3QLVA 4D9HA 3TQIA 1K7SN 5K0JA 1BSVA 3LY7A 2EFJA 2OD7A 3O4GA 5PNTA 1A9YA 4NY1A 3H1FA 2ZBPA 4O2AA 4RZ3A 5G1PA 4GGOA 5G1OA 3VPBA 4ZD6A 1IONA 3U4GA 4ZYYA 3PFWO 1GYQA 5J4LA 2P9BA 4NZZA 3KQYA 2X0IA 2Y05A 2ZKLA 3HWSA 2QZJA 4F2DA 3LCRA 3S6JA 2C3OA 3KWLA 3WQRA 4IUYA 1V5EA 2I4LA 3FOBA 2BTQB 2GJAA 2XYHA 2H9YA 4NCKA 4D41A 5LQKA 3TAUA 3UN1A 5L3SB 3V3TA 1EDDA 5CNJA 1N9GA 3JD4A 1KTIA 4J94A 4JXXA 4ND4A 4PAGA 4BGUA 5BSFA 1M75A 3EAFA 2C5FA 5E2IA 3H2SA 1QC5A 2VOJA 1GRCA 1T8SA 2Z58A 2XRZA 1CUZA 2B34A 2HNBA 3ECSA 1MVNA 2ZSIA 1AX9A 3N53A 4R31A 4DCUA 3RE1A 3IE1A 1M72A 2UUCB 2JASA 2Q5EA 1ZM4A 3HDVA 1KO5A 2QLJA 4JJGA 1P7WA 3EXAA 3L8EA 1L1FA 2BHRA 3GZNA 5IUJC 2HA2A 5K3EA 4ND6A 1VA4A 3EUEA 4Z1OA 2PMWB 2X8LA 5EJ2A 3BB3A 3JD0A 2UUAB 1NBMD 2GCEA 1YNSA 2JFBA 3HI4A 1UZMA 4XM1A 1Z12A 4ZDJA 1ETHA 3X1MA 2AYYA 4P86A 3MINA 2WF5A 2FN8A 4PFQA 3C70A 4NNPA 5I9MA 2P6PA 5GAJA 1FFHA 3I4CA 2GPYA 1VQ1A 2NACA 3DF9A 2QUZA 5B1EA 4P3YA 4WJKB 1IRXA 3OE7D 2W2LD 1IZ8A 5LNK6 3COZA 4A10A 2X2PA 2A5LA 1PNRA 4RKEA 2GPSA 3VR4D 1FX1A 1OVMA 2I54A 3I4FA 3DT9A 1GPJA 2WP8J 2XDQA 1K8ZB 4BNTA 5K0CA 4D3FA 2VP6A 2ZZKA 3LBNA 4HR7A 2QSUA 3QUBA 1POWA 5UKDA 3TMAA 5JCZA 4WH0A 4ZV7A 3AFOA 5TPZA 3T3DA 2WD7B 2YY7A 4DC9A 4HV4A 1EHYA 4HGPA 4OJMX 4RSRA 5COQA 4M8NE 1U1FA 2C0CA 1JXMA 5KU7A 2JGRA 1OBOA 2ZCVA 2D00A 2FPKA 5BUSA 3KB8A 4R98A 2IT1A 4IFBA 4OXKA 5HE8A 4GP7A 5CGZA 5HFJA 3GP8A 2QT9A 3MCVA 2XUGA 4NNOA 3ORSA 4CDNA 2BCGY 2Q4RA 1SG0A 1VCIA 3ESXA 3OCXA 1TX4B 1U9YA 2QVYX 3QH4A 2XWBF 4HRVA 3U2QA 3CHYA 1UDCA 3H97A 1MJ5A 1WX1A 4A16A 1E1DA 3HCDA 3RG8A 2G80A 4FQ7A 3UXYA 3EFOA 1K1EA 2QMHA 3TM5A 2QM8A 3I92A 3SX2A 3ULKA 1UXIA 1O94C 1NTOA 1T4BA 3KTAB 2OBMA 4GOKA 4CMIB 5A1TA 1FQKA 3D2LA 3WLLA 2OD2A 4G4SO 3FSJX 3PPWA 3CR7A 1QS0A 3RAFC 3CVXA 1H0HA 1ZJJA 2QV7A 4GRDA 3U3MA 4HLQB 4YYEA 4BUZA 2ZSDA 5B7QA 1G3IA 4CM9D 1NSYA 3SVZA 1RJGA 5B6PA 4RZSA 4AECA 3S81A 2HCTA 1D07A 2ISSD 2ZT7A 1UPUA 1KFEB 2GN0A 3W1VA 2I6QA 3SR0A 4MCIA 3SYRA 2CVQA 1DV1A 1N0VC 4O0MA 3WHPA 3K1ZA 3C48A 1JLHA 1E1QD 5KNCH 1W4ZA 2KX7A 1Z7YA 3ORRA 3OTQA 4GW3A 4HQFA 4NPAA 1G3UA 3PSHA 4B9EA 3EDOA 4CZ2A 1T4DA 1P9OA 3GGSA 4R71A 1Z33A 1OTHA 1U1GA 4ZQGA 4F2PA 1JAYA 1P7ZA 1WB5A 3P96A 5TE9A 4G5GA 4L22A 1P2DA 2GWRA 3KBBA 4HNHA 3Q7IA 5FLYA 2H2DA 3O9VA 2HWXA 4HQOA 2YJ4A 5HW0A 4ALJA 2R66A 4WK4B 1I9CA 3IBFA 2Y2VA 4KDEA 4CKBB 1V4VA 2O9JA 1QKIA 1ZJ6A 5FKJA 2IW3A 2R1TB 3LX8A 3OUTA 1KE2A 4ZAVA 2PS3A 2XNKA 3VYRB 1QHHB 3WZMA 3T3GA 3ZDDA 2Y1DA 4GMGA 4QBFA 3NDRA 3RYTC 4YRGA 3AERA 3J80A 3LQKA 2VDKB 2Y4OA 4EYKA 1RM4A 1RPZA 3QTTA 4RPIA 3U4DA 5LWQA 3HJUA 3HABA 3MCTA 1OPRA 3ZJYA 4LISA 3RS0A 5IDXA 1HQCA 1N7GA 4OSEA 3L46A 5F9HA 4MQMA 3Q12A 1PGJA 5B6JA 3ESZA 3B3AA 4OF4A 4Q4DA 4P4UA 3K8OE 3QNWA 1JMKC 2KSQA 4GKAA 2BCJQ 1G20B 3G2OA 4B6QA 3B70A 1SD5A 1U2ZA 5KOYA 3V97A 3I72A 2E89A 4ENQA 3IL2A 1CZRA 1SXJE 4TN5A 1K3UB 3IDZA 3LXMA 4CG3A 3FR8A 1V5WA 2PDAA 4ZALA 3QKSB 4RTOA 1AKRA 1BXRB 1MB0A 2IP1A 3DZGA 1AUPA 1X1AA 3HL4A 3ICWA 4U7GA 4BO6A 3I73A 4DA0A 4QPCA 1KMCA 4CM4A 4TYMA 2E4VA 1A9SA 2IZ0A 2F1HA 1E3WA 4UUAA 5D5HA 3TCXB 1CYDA 4IIVA 1P60A 2PZLA 5BOVA 5JHHB 4MDYA 2ZUCA 1VSVA 4AMVA 3GPCA 1D6MA 2EFYA 1PDWA 4LYYA 1NIJA 4R41A 2HF9A 3OVMA 1OZHA 1NXXA 1GAJA 3TS1A 2CF6A 1DDGA 4O4LB 4KQIA 3A6PC 2B94A 3C3YA 3NWBA 1U94A 4WGFA 3VZRA 4I9FA 4A8JB 1O97D 4HDKB 2XB6A 1Z37A 4UHHA 2AL7A 4CKWB 2RMKA 1DWOA 3DGFC 2O8BB 2FYTA 2G9VA 1NR1A 3NHZA 4F2WA 1G6Q1 4LSMA 2SKCA 3KYBA 3DQQA 4J43A 3CRQA 3G9UA 1UXJA 3C1TA 4FKMA 4HADA 4IXTA 4JJ4A 1K92A 4Y1GA 9ATCA 3NYRA 3PGJA 1RHUA 4ZDKA 4GVXA 3V2IA 2HTEA 3KPWA 2CV2A 3QJYA 4KPUB 4HYQA 5J4YA 2BFDB 1R4MB 3AVXA 1XAJA 2XW6A 4KLNA 2HBQA 5IX8A 4H7HA 4DLPA 1NYLA 2AOUB 1L8LA 2GCGA 3KZNA 4AVYA 4M2LA 2ZDHA 2DE0X 3LQFA 4WNCA 4EPVA 5GV7A 5C5IA 3ZZTA 2YIVX 1VIMA 4MX8A 1Y6GA 5ALNA 3RTEA 3ZBUA 2JH3A 3M6IA 3RROA 3A2LA 1QTNA 4J2HA 1CFZA 2FQQA 5EWJB 1YQQA 2FWMX 5LR6A 3X1XA 4MB6A 1II8A 1LW7A 1P4GA 2PUWA 4C88A 4J03A 2NZVG 2Q6KA 4HATA 4FOPA 1KBQA 4MS1B 4EEXA 3IIMA 2DY1A 2FG6C 4IGKA 1ZIDA 4ID9A 4KREA 2WZBA 5HDQA 3W5AA 2EBWA 4PYJA 1QH9A 2BFBA 3W5UA 5JI3E 3PC8A 3WOHA 3GVCA 3P9PA 1SC9A 1MOZA 3QMPA 3R77A 1V1RA 5AW0A 2W2MA 3QIAA 3RUCA 1HNWB 2XQIA 3A6GA 2GN4A 3V9AA 3HKBA 4EYOA 3DVSX 1T1SA 3L6CA 3GLQA 4XSVA 3RV4A 4CF4A 1IBSA 1QIFA 2NSYA 4IYJA 1E0SA 1ULUA 2XB9A 3JQBA 1IZZA 3DDHA 2QXYA 3M83A 2LV8A 4G1VA 4M87A 4JI5B 1BFUA 2B35A 4L16A 4C0JA 1CDEA 1D6JA 5CFZA 4M1MA 4Q24A 4OB6A 2GT1A 3AI1A 4Z6KA 2B0CA 1FFAA 3CKKA 3TX6A 4AKGA 2I67A 2DFNA 3I1IA 1OU4A 3IOYA 3PUIA 3QXXA 5FD8A 4PHGA 5JY6A 2YICA 4RTNA 1P1RA 4FBLA 5AKKA 3EVDA 3T3IA 1DC3A 1K08A 3FPGA 4FGWA 4IIJF 1LK0A 1DTWB 2IDKA 2PUVA 2ZSBA 3ID6C 4BO4A 3RYFB 3JSXA 3TWOA 5KOHA 3CKMA 1CZKA 3O91A 3RKUA 1KYWA 4YT2A 3R4CA 4YRSA 3SS7X 3W5BA 4DQXA 2PUGA 1HOXA 2KE5A 4FOSA 1LV8A 3L1JA 4NAUA 1QGOA 1DADA 2CVHA 3DOIA 4JJAA 2Z2JA 3GJ6A 4OHZA 4BP9A 3DYBA 4M76B 4C87A 2I8AA 3ZCTA 5BVHA 3PR2B 1K6MA 1RWQA 1IHOA 3OF5A 4E2FA 3BWCA 3MMSA 5DHSA 4J0QA 4YUYA 3O3CA 3IBTA 3OCYA 3NW9A 3KUXA 3C41J 3EIEA 3JVIA 5K0LA 4YRCA 2O48X 1DJPA 3ADPA 1U7OA 1ZLXA 1H6CA 3SBEA 3DTYA 4C7XA 4D4JA 1FFDA 3TO5A 4DMLA 4W4TA 1MB9A 4HDQB 1ZMOA 4QTXA 5ESXA 3RUEA 1RM0A 4EJSB 4ER3A 8OHMA 4PWZA 4B2IA 2CVFA 3MMZA 3L0YA 1YDWA 5ITZA 2Q8PA 2A9JA 3ZY4A 4BFXA 2IZOA 3OA2A 1KO1A 2Y1GA 1GAEO 1ZCBA 2DTDA 2JI4A 3DKRA 4L9AA 4PXYA 4X61A 3FSEA 5JLJA 1DCTA 3WSWA 3WMWA 4JLNA 4REQB 4UNIA 4ZQEA 2BFCA 3JALA 1Q1GA 2ZIVB 4RNCA 5FUVA 3TMKA 1H5QA 1JZQA 3FDZA 4F5EA 2ONYA 3ZN2A 2COEA 5AM3A 1VZ2A 4M9ZA 1ZD1A 4AO6A 4TN1A 3KLMX 4V02A 3S0JA 3BK7A 1DOZA 3JYOA 5FUMA 5U1PA 4MWGA 4DLZA 4FLFA 1AGPA 2HO5A 4KK4A 1Q12A 3D5EA 3CMMA 3NHKA 3K0AA 4FR0A 4NV3A 2ZVPX 5E6UB 2WUGA 3NOVA 5KAPA 3ZCXA 4FONA 3UWSA 3PL1A 3RYCA 5KNDD 2B37A 4DR1B 5JWOA 1SKQA 4ZVKA 3TRDA 2O07A 2CFSA 1FVFA 3TPZA 3UMBA 5FQNA 3D3QA 4CUZA 4EBFA 3O8BA 4Y8VA 3N59A 3GY0A 5B2EA 3GARA 1NN5A 3FE2A 4QYTA 5E1OA 1CEXA 4MWSA 1EK1A 3Q3GE 4RU1A 1P7CA 1QK4A 3DZCA 5B58C 3U1BA 4IHJB 2ZAIA 3DONA 3GVHA 4DCPA 4RMIA 4EAAA 3NYWA 5A2GA 2W6JA 3I3SR 1JR4A 2G0AA 2YOFA 5KIAA 2WF6A 4NMWA 2X4DA 2GZ1A 4AWBA 1GGVA 1E9AA 2I22A 3LCCA 2MWMA 4RLFA 4RWZA 1FJXA 1AXRA 2XMDA 4P3PA 4P6VF 4WERA 5HBRA 1MDFA 2C59A 2IEGA 5ANRB 3N86A 1R6XA 2CLMB 4KO4S 3MJEA 3ZK9A 5A3QA 1HR0B 3L93A 5ARBA 1T2FA 1A9XA 4YQFA 4QU9A 2QYSA 4XIFA 1WPXA 4XYMA 4Q9JA 2EG9A 3NIGB 1J42A 3F5DA 5DYIA 2W93A 1DC7A 2PH1A 1NN3A 2YZMA 3PZBA 4KIUA 3SN6A 5JY1A 4X64B 2UDPA 4DG8A 4U5QA 4Q0MA 3FHCB 1D03A 4KWEA 4TV9F 2EZ8A 4UOEA 3HSSA 4WY8A 3WQQA 1BYIA 3WS7A 2IUFA 1M2GA 3IQWA 4ZAWA 3WADA 3WJ7A 1HGXA 4K3VA 2ZUWA 1C0IA 1I0ZA 1XN4A 1VLLA 2QQ0A 4PF1A 4WY2A 4FMPA 4EJ2A 1Y81A 2C99A 3JYQA 3L7DA 1FVXA 1P1FA 3BJZA 2GD6A 2YMMA 4R9RA 4X3CA 5IAOA 3VNBA 1UF9A 1KTVA 2E4UA 4IRXA 1FJHA 5BRNA 4KYTA 4Y7DA 2WSIA 1OYOA 2YUTA 3CH5A 4LOHA 4FCVA 2POQX 2WFMA 1YOVB 5EZYB 4F84A 4N18A 1LV7A 2H5JA 1TEHA 1I4TD 3ZCQA 2RCNA 2XCIA 5JAUA 3ND7A 3L7IA 1A0OA 6ADHA 5FB3A 4PSCA 3R7WB 4TUYF 4GOLD 3OOWA 5JLAA 2NIPA 3AXTA 4NJMA 1NBIA 1U7WA 4QOFA 4FJ1A 1E9SA 2GILA 2RHMA 1CUGA 3OCCA 3UB2A 2GTHA 5KSPA 4D5EA 4EHIA 2OG2A 3ZU5A 1KS9A 2Z04A 5CNKA 5JMOA 1Z13A 1ZQ9A 2I1VB 1ZJWA 1QZZA 4BVBA 2R97A 1T6XA 3DE6X 4B3CA 2D3TA 4M88A 5JAPA 2VJLA 2XOEA 2DUJA 1D8AA 3L41A 4QWWA 1M2VB 4WFJA 2NPFA 1H2BA 3IHKA 1DUSA 4RZ2A 3KZOA 3E23A 5JVDA 5G0SA 1AG9A 1JT2A 2EL9A 4AZVA 4S05A 1PNVA 2VTKA 3DTVD 2KJQA 2ZWOA 1GA4A 1SUPA 3C4JA 1Z5NA 3FYUA 2WICA 3GVXA 3ICCA 3LS2A 4KAFA 5JE8A 3QUTA 5F21A 3V33A 2Q0XA 3HLTA 3QKWA 4I19A 5B3JC 2ZULA 1QHFA 1T9KA 1KI7A 2J3LA 3L18A 2A0WA 3NT5A 5EE0A 1VGRA 3QOYA 5F5XA 5HILA 5CBPA 3WAGA 1F2TA 3GNSA 4KQCA 1XRJA 4RK7A 7REQB 2P6UA 1S2MA 5ADUS 3OTIA 2JBAA 4PSDA 2WYOA 1WB6A 1SUFA 4RKYA 1J97A 1PX2A 5DGDA 3TH5A 4DSTA 5HIAA 2VT7A 2JFFA 5M3BA 5TMBA 1FPQA 2IQ5A 4QJIA 1WO8A 1ZK1A 4E32A 2XZLA 5K20A 1I2BA 1O5IA 1ODLA 3MD9A 3R7AA 2PM8A 1QGUA 1YRAA 2AZDA 3KUCA 4I1OA 4RC9A 3TZHA 2OC4A 2BGWA 1MT0A 1XZHA 2O8VA 1IOWA 4X62B 2W6ID 1UQUA 3A3PA 2YH2A 3HUTA 4KLAA 221PA 2C5SA 5KVAA 2JIMA 1OX4B 1SB8A 4BXOB 3I2HA 3R3YA 4WAUA 1M1ZA 2AUTA 3AF4A 3AOEA 2V7QD 3AHJA 1TDJA 1KSJA 1D7OA 1YR2A 1T0PA 2AE2A 2DOKA 3A1SA 4PV7A 2B1QA 5C53B 2H1OA 3WGOA 2CSXA 3FIUA 5ES4B 1C7JA 2CJWB 4QSHA 3SIWA 1AN0A 3WK5A 3AU9A 4MUHA 4X93A 2W0MA 5FTNA 5LL6P 1BVYF 2WJWA 2O2JA 1NX9A 4G37A 1RR6A 2DHCA 5HPYB 3VPAA 5E6SB 1JXOA 1J8VA 1OWPA 2B83A 3AZQA 4KWCA 1KPHA 4JP8A 1C9JA 1NP7A 3VR5D 2L69A 2Q0QA 1Z3CA 3H1AA 5EMMA 3X44A 3VQTA 1DZ3A 3IV6A 3SF0A 2V97A 3SD7A 1XALA 2O6LA 4WK2B 3FDFA 4F9FA 2IYQA 3DWGA 4X66B 1CLUA 4EDFA 4O2AB 1TW2A 1O9HA 3BD8A 3GK3A 2VSQA 2J0UB 5DCWA 4KV7A 1JBEA 1NJ2A 2VDQB 3DXFA 1H85A 3T7IA 5TQ2B 5DXFA 1D6SA 3DO5A 3URMA 1ADFA 2PS9A 4KMMA 1EVZA 1VXOA 2RGGA 3DEHA 3QOWA 4KXWA 4DA9A 1YA4A 1NVUQ 3COPA 1JR3E 4OFXA 1N9GB 1Z4MA 1P74A 1F3LA 1DVRA 5HG0A 1J07A 1UMKA 5E1MA 5CCEA 3DFUA 4DMGA 3G5UA 4J7CA 3LY9A 5DLPA 2X9NA 3VNUA 1E9CA 3SS9X 3UXEA 1EK5A 4P3XA 5I7HA 5DLYA 1KO8A 3L4KA 3DLHA 4S24A 2YV5A 2JJ2A 2Z8YM 4CM7A 1RWKA 1XZQA 2VTVA 3AUJB 1P4AA 4CGYA 3CGWA 5H3LA 1D04A 1K97A 5FWXB 1YZFA 2BFFB 1ZRMA 1U0JA 3VYWA 1G18A 2P1ZA 4I9GA 4BLOA 1ISIA 4X84A 1A7UA 1W25A 2WIFA 4KRYA 3OT4A 1KDYA 3JASA 3SOZA 2PL9A 4YCJA 2GNOA 3DZJA 3CZMA 3BBLA 4QUDA 3TI7A 2PGIA 3NOOA 1GQYA 3B1JA 1RNLA 1RJEA 1SQ5A 1UOEA 2ZE5A 3BSYA 3VC1A 3K0HA 1ZM2A 2QX4A 1W94A 2I78A 2XDQB 3H7IA 1L7MA 1OD6A 4PIMA 4IRMA 4RMGA 3TR5A 4C21A 4OXYA 3AJAA 3WBFA 1GZ3A 5C9ZA 3A3OA 2EKZA 5CAEA 1GILA 1XZNA 3M33A 1E63A 2P0EA 2BRUC 1JJIA 4V0OA 2AR0A 4RNDB 1M1UA 2ZGVA 4ZVUA 3WSVA 1OKKA 4QWMA 4Q00A 4EJ0A 3SYNA 3E82A 3DEYX 4XPZA 3U6BA 2FG7C 4TS1A 3HADA 4C0XA 4CMCA 3QLUA 5KYWA 1OH6A 1F0YA 4Q9NA 3WXMA 4ZFNA 3IGFA 5DHPA 3TW0A 1R6AA 2RK6A 3IUJA 2G9ZA 4D9CA 2PWAA 3VNRA 4X65B 1CX9B 3CCBA 4G8JA 1EXDA 3ZQ4A 1ESDA 3AI2A 4BO9A 2IWRA 5BSEA 3SG0A 4NULA 5HOQA 3PSAA 3ICVA 2B82A 4ZA2A 1SHKA 2NV6A 1G4HA 3OO0A 1JI0A 5AMXA 2AGVA 2WTBA 1GCIA 2PSHA 3PHHA 3M3HA 4X6XA 2ZYWX 1GPNA 1U28C 2OM6A 1OWLA 1ZN7A 4GI2A 4IXNA 4IDEA 5L3VA 1QS0B