4CV3A

Crystal structure of e. coli fabi in complex with nadh and pt166
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
239
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 85
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv3A00
4FW8A 4W9NC 3O4RA 4HNHA 4J1NA 2G76A 1FXSA 3DAFA 1I5RA 1BSVA 4DUPA 3C7CB 5HM8A 3HDJA 1NXQA 4RPKA 1ZNQO 4XR4A 5F1OA 3KYDA 3ENNA 4R16A 3K2EA 4AJOA 5HTOA 4YJFA 5T5QA 1U9JA 5GZ3A 1ZXBA 4PG6A 4L75A 1QYVA 3SLKA 4LRSB 3RKUA 3ZWYA 4ZGWA 5MGBA 4IGEA 2O7QA 2GUGA 3ADOA 3K96A 4Y6SA 4E6PA 3KSUA 3MWDB 5ER9A 4HWKA 4D42A 3C7DB 4J0EA 1U2DA 3NDIA 2ZTMA 5KCZA 1N92A 4R9SA 2Q4BA 4GX0A 4DL9A 3HE3A 4ND1A 2A4KA 4AJPA 4UEKA 5JAMA 1EUZA 3JQFC 4E2WA 3ZW9A 1U3VA 3ONFA 4F6LA 5B4UA 4XIJA 2UAGA 1MC4A 3AOGA 3LF1A 2NM0A 1UXJA 2NSDA 1PGNA 4BNIA 4CMGA 2B5VA 4XQ9A 5AXCA 4E5NA 3U62A 1YB1A 1UZNA 4BIIA 4PLHA 2B37A 1PQWA 4Y9DA 1NWHA 2GSDA 2VN8A 5K6AA 2Q2QA 1PJ3A 1I24A 1JQBA 3QWAA 3CE6A 5JPIA 4DPLA 1ZK3A 4Z3KA 2JD2A 2RCYA 4WCFC 1EDOA 4W7HA 3ZU5A 1C1XA 3ZNPA 1KOLA 4OIMA 5EINA 3EYWA 2FR1A 3GMSA 1GCUA 1DC4A 1JW9B 2FWMX 4WKGA 3JYLA 4DRYA 2VT2A 3GUCA 3CZMA 4ND5A 1VL8A 2B4TO 4K26A 1ISIA 1VI2A 2J6IA 3H6KA 4ALKA 4YTEA 3T7EA 4JBGA 1P0FA 5T57A 3V1TC 3PGXA 2EW8A 2X0NA 1P74A 3OJFA 3INGA 1GL3A 2YHUA 4AG3A 4M86A 6ADHA 4DIFA 5BSGA 2VOEA 3MJVA 3KOUA 4J2OA 4TVOA 1NVMB 1VL6A 1GR0A 3JQBA 4Z6KA 1GZ3A 2PV7A 4JJIA 4A0SA 4IJVA 4I5GA 4KUHA 3GDGA 3WTBA 2Q1SA 2AEMA 4GWGA 5KKAA 3B1KA 1DAPA 5DULA 4N5LA 2WYVA 3O9ZA 3RC2A 2VT3A 5B4VA 1B14A 1SOWA 4BQPA 5I9MA 4YJDA 4CM9A 2FSVA 1XKQA 1NX6A 2I3AA 3FNFA 5EL0A 3HADA 3B1JA 3SLGA 2IRWA 2R2GA 1H0KA 1MXHA 4YCAA 3BMOA 3E82A 3VZSA 5CDUA 1DBVO 1XWFA 3DAPA 4E5MA 4ZN6A 1QYDA 3PIDA 2NTJA 3WIEA 1OBFO 1VM6A 1Z6ZA 1T2DA 2VHYA 5C7LO 1O8CA 2PK3A 4UEJA 1P1FA 2IXAA 1I3NA 3AOEA 2BFOA 2D5CA 1P9LA 1QP8A 4O6VA 2CZCA 4BB6A 1R0LA 5F21A 4YAIA 3CMMA 2JD1A 3WNVA 4YAKA 2E82A 4PFJA 1A9YA 4IDCA 1C0IA 1BXZA 4NK4A 3GG9A 5K9ZA 4GVLA 3AY3A 1DJNA 3HNPA 3TQHA 1F12A 1ZSNA 3BIOA 1A5ZA 3AI3A 3L07A 4RQUA 1FDWA 3BMQB 3GRPA 5KJ1A 1LXCA 3EGOA 1PWXA 3FHLA 3UF0A 4A26A 2VWPA 2HK9A 2VWQA 4IPTA 4BKOA 3WICA 2O4CA 4UVIA 1PL8A 1A27A 3GDOA 1HZZA 2D59A 1WMAA 2Y1OA 3OJOA 4R1NA 4U0JA 2NADA 3HSKA 2DT5A 3LC1O 4NJMB 1KVSA 4GVXA 4BKRA 3KVOA 1H9BA 1YB5A 1E1LA 3ZV6A 3NDRA 4B3JA 2Q46A 3TFOA 1CERA 5EJ2A 5I9NA 4PZEA 4Z9FA 4I9NA 1GQ2A 3IP1A 2YUTA 1P1KA 2IYPA 4EW6A 5LCXA 2C82A 3DEYX 3L6DA 4HY3A 3NX4A 3FN4A 1DAOA 2TMGA 3GVPA 3HDYA 4NBRA 4XQGA 1TEHA 1WLYA 2A94A 3I23A 5I8WA 1E6EA 2X0IA 1UJMA 2OFPA 1GD1O 3ETDA 1C1DB 1ZW1A 2HMUA 1E7YA 4L74A 1YKFA 2GYYA 2QIOA 3LC2O 3H7AA 1DLJA 4TROA 1TB4A 4BV8A 2V7PA 4B4OA 2VHVA 5CG2A 1YQDA 3HWRA 1JN0A 4XWYA 1QLHA 2GN9A 1LSJA 5JCXA 3PVZA 1XEAA 1KY5A 1LDNA 4B8ZA 4PZCA 1SZJG 4CMAA 5KIAA 4BNFA 3GHHA 1GUZA 3DBHA 2OMEA 3ICPA 3EMKA 4EUFA 4MVJP 4FCCA 4KWHA 3C7AA 4RPJA 1CIVA 4A2CA 3HHPA 3ZGYA 4MVJH 4GX5A 4KOAA 3ZN2A 3NDJA 2I65A 2ZJ1A 4ZA2A 1QYCA 3JSAA 4XGKA 5DF1A 4MPDA 3JCZA 1EE9A 2A35A 2Z1MA 1EDZA 2J3JA 2FMUA 3I5MA 4BMVA 4ZU3A 1V6AA 3DONA 4KZPA 4BL5A 1X15A 2WYWA 3OSUA 3DDNA 3WSVA 1RM4A 4CLOB 3EZYA 2XF8A 3OETA 3FR8A 1KVQA 2UVDA 3IUPA 1BDBA 1EBFA 4C7JA 1XA0A 1QYWA 2NWQA 3L9XA 3PLRA 5KJFA 2X23A 4NBVA 2NACA 5IZCC 4R54A 2AMFA 1Z74A 5EN4A 1XIVA 2V65A 2W2KA 4BV9A 2O48X 2P9GA 5COQA 4R3WA 1H9AA 1E3JA 3DC2A 2C2YA 1VJ1A 2PGLA 1TT5A 2HKIA 2X5KO 2IYOA 2CNBA 3BMNA 3MJSA 4B3HA 2GPTA 3E9NA 1MFZA 1U28A 1DIRA 3KV3O 2JJYA 4BO6A 1KEWA 2HJRA 1R0SA 4RF4A 4ZICA 1Y9AA 1T4BA 3M1LA 1XLTA 3R1IA 4H15A 4XR9A 1MLDA 5C3MA 4L76A 4M1QA 1PJ2A 1X1EA 4OXNA 3IMFA 4NQZA 1B26A 4JGBA 3EVTA 4MP8A 1MB4A 4R9RA 1M6WA 2X22A 4XYBA 1UAGA 4J43A 4NFYA 4LMPA 1T2AA 4WECA 4AVYA 2EEZA 3WJAA 3PJFA 1W6UA 3W8DA 1IZ9A 1AE1A 3IIEA 2VNAA 3LDHA 2NU7A 1NWCA 1P44A 3EC7A 3IL2A 3WQRA 4CM5A 5KOIA 2CDAA 3W1VA 4NHEA 4A27A 4HX5A 4E21A 4BNJA 4RVHA 1LLQA 1I2CA 2HRBA 3VH3A 1GEEA 5IDYA 2DU8A 3ABIA 1H6DA 2OP0A 1BW9B 1PJSA 1T2FA 1T25A 2VYVA 3WGOA 4F46A 3V5NA 3IKTA 1Z7BA 7MDHA 1R37A 1PS9A 2DPHA 1YB4A 4XIYA 2VWGA 2BMAA 1XYGA 3BAZA 5C5IA 4XQCA 2JCYA 2PA3A 3PHGA 2DC1A 3GGGA 1QV6A 2VZ8A 4DGSA 4A5OA 5JFOA 4YQYA 4D43A 5JY1A 1YDWA 2V6FA 3Q1LA 1KS9A 3L4SO 4E5YA 3PYLA 3I4FA 2F00A 3JQ9C 1PS8A 1S7CA 4J1QA 4BNMA 3DTYA 4HFNA 5JO9A 5H82A 5BSEA 5GMOA 4FD3A 2HUNA 1U3WA 3PZRA 5I8ZA 3L77A 1PJTA 2DBRA 3DOOA 3GNQA 3GVCA 2ZQZA 4NR0A 3UOGA 1C3VA 1X0VA 5FI3A 4E5PA 4AJLA 2EWMA 1WZEA 3E8XA 3U4IA 5HS4A 3M2PA 2X86A 3H5NA 3JYOA 4KUGA 3UXYA 1TVEA 1HYEA 1ZEMA 4CQMA 4L4RA 3WTCA 3JYQA 2CF6A 4MKZA 3QY9A 2IZ0A 4CL8A 1HKUA 1I36A 2X7HA 4XZ3A 4MVJI 3Q6IA 4IS3A 4N18A 2X9VA 4HUJA 4M54A 2OORA 3QE3A 3JQGA 3UCEA 3KZVA 2TMDA 3CPSA 3LU1A 3UICA 3VVCA 2XOXA 4RVFA 2JFFA 2HDHA 1E3SA 4YRDA 3ZU4A 4IDAA 3D5QA 1H2BA 1ZZEA 3GVXA 2Y1FA 2BELA 1MC5A 4RORA 3DBHB 1Q0LA 5KVVA 4AL4A 2Y68A 1ENOA 5FYDA 1H6AA 1GUFA 3CKYA 4KQXA 3VOSA 1DIAA 4RVSA 4PRLA 3AUUA 4M49A 5EQFA 3H8VA 3WB9A 4E12A 1YDEA 3IP3A 3OIGA 1YWGO 4TZTA 3JD3A 3G17A 4RZHA 3NT2A 1ML3A 3DHNA 3ZWXA 2DBVO 3DZHA 3I9KA 2YV1A 1R4MA 4JJFA 1DRWA 1N7GA 1JA9A 4I5DA 5L40A 1AXEA 3IKVA 1Y5RA 2C7VA 1XU9A 1YL6A 3UHAA 4KWIA 4AJHA 5B12A 5ENVA 4TRNA 4YQZA 1UZMA 1LDYA 3AM4A 5K6AC 4M87A 2OL4A 3D64A 2GLXA 2IODA 3MJTA 4OH1A 4QFDA 3C8MA 2JKVA 2GZ2A 4J7CA 5CP8A 1UXKA 1HDZA 3HFSA 4GI2A 1E6UA 1ULSA 1SEPA 3GPIA 4C4OA 2JCXA 2GGSA 3ASVA 3TZHA 2AEFA 1CYDA 3RJ5A 1P33A 1WDLA 2X4GA 2YHIB 2PH5A 4BO4A 1XHLA 1JAYA 3ZI0A 1DO8A 2FZEA 3PQEA 1HDRA 1S6YA 1NFFA 1NVGA 4J4TA 4U8GA 1DEHA 3LVFO 4LVCA 3T4XA 2V6GA 3OJ0A 4II2A 2QX7A 2FR8A 4FQ8A 4GLLA 4K28A 2VZ9A 4NPCA 2EXXA 3F47A 4J1SA 4A03A 4QEDA 1UR5A 4S3MA 4F45A 1OC2A 2YV2A 1F8FA 1P1IA 2NVWA 4CJXA 1QLJA 1GFSA 2AEJA 2C59A 2W4QA 3OJEA 1I10A 4PLVA 2ZB7A 3TDKA 4BNHA 4IDEA 2PD4A 3LQFA 1LSOA 4AJ4A 2Q99A 3E9QA 5DDIP 4IXWA 1NR7A 1LLUA 3UGKA 1A9ZA 4ZHSA 4J0FA 1E7MA 1HWYA 2IXBA 1PL6A 3AM3A 3DOJA 2Y1CA 4LW8A 5F1PA 1GYRA 3KTDA 1YBMA 1H94A 1J49A 3M1AA 3HFGA 3VPFA 3GFGA 3G1TA 3CSDA 1LI4A 2VTEA 3RUAA 2ZK7A 2X1HA 3X2FA 1AUPA 2UYYA 1F14A 3TFQA 2HO5A 1CEQA 1CWUA 4RO0A 1O0SA 3HB5X 2P2SA 3QVWA 1XQ1A 1GU7A 2YHIA 4PG4A 4ID9A 3VDQA 1DFHA 3AI2A 3DO5A 1Y8QB 3I3OA 4OYRA 1ISHA 4IUYA 1PL7A 5AXAA 1YS4A 5A03A 2EJWA 3CEAA 1DHTA 3F9IA 4B7XA 1Y6JA 4OJNA 3VHRA 4WOJA 4YYZA 5DT9A 4URFA 1ZK2A 5U9CA 4CQLA 5JMPA 3M6IA 3RQSA 1H93A 3RROA 3V8BA 4R41A 1AN9A 4DA9A 4R5MA 5FWNA 4RDHA 4O1MA 1I30A 3GG2A 5C7IO 1Q0QA 5GZ6A 3H2ZA 2P5YA 3PJGA 3WLEA 1VL0A 4BUCA 1N7HA 1WP4A 3A4VA 1Q1NA 1K6JA 5CDSA 4DC0A 1KYQA 2Y1GA 4J4BA 2Y99A 4DWVA 2JHFA 1E77A 1I2BA 3WGQA 1XU7A 2HK8A 2I76A 3A06A 3K30A 4G2NA 2H63A 1ADGA 3VTFA 2F1KA 3EK2A 3L9WA 5BT9A 3FTPA 3EHEA 4YJGB 3LF2A 3OEWA 4YAEA 3RCBA 4HADA 1WNTA 7ADHA 1ZEJA 3ROPA 3E9MA 3F5QA 4X54A 3A1NA 5TC4A 3GQVA 3OHSX 1IHYA 3ITKA 2J5KA 2JL1A 4FS3A 2RH4A 2OBYA 5EPOA 1HLDA 1VLLA 3BYZA 1U3UA 1E3LA 1LDGA 4JBHA 5G0TA 1PQPA 3Q9UA 4PLZA 1JWAB 4UUPA 3MEQA 4CV0A 4CLOA 4BNKA 2HMVA 1VJ0A 2FPPA 2HMTA 1Y81A 3FNEA 3W8EA 2NUAA 4ONEA 1VSVA 4U7WA 3K5PA 4Q3CA 2X5JO 1KBZA 3GNSA 4J2HA 1B7GO 1WPQA 3QWFA 4CM7A 4ZQBA 4TMFA 4CM4B 3VKUA 4I08A 5JAIA 3GOHA 4Z9YA 2C5EA 4LSMA 2PY6A 3PQDA 4D45A 1PX0A 4HFMA 2JAHA 1D8AA 3WQQA 5CPBA 1P77A 4CR7A 2CFCA 3IQDB 4CLEA 4MVJM 3HZZA 4WPGA 4CMCA 1SAYA 4XGNA 3NGLA 2GDZA 1B8PA 4D0RA 3PPIA 4ZJUA 4TRRA 4MP3A 2I6TA 4UUMA 1SOVA 4CLXA 4Z3DA 3ORFA 4CM9D 4R1TA 1Q7GA 3KRTA 4P8RA 5IN4A 4RCVA 1EVJA 2I9PA 2QYTA 3OJLA 3QIVA 4GKBA 4ITUA 4EZBA 3TL2A 3TSCA 1EK5A 4BNYA 1JTVA 3VAZA 3N58A 3CH6A 3DAGA 4QFCA 3RWBA 4QX6A 2ZTLA 3DBVO 3VC7A 4BGUA 5FEUA 4TQGA 3WMXA 2QRLA 3SVTA 1A4UA 1MG0A 1VSUA 4IZIA 3ETGA 3ZWVA 5JXWA 4E5KA 3NUGA 1ENYA 3WGTA 1M75A 4DLBA 3HG7A 1WAMA 1CQJA 1G0OA 2J8ZA 3JQCA 1FJHA 4WOKA 3HQ4O 1UDCA 2JHGA 3OICA 3P7MA 3NAQA 2B69A 4HKTA 4M8SA 5KNLA 1NASA 4BKPA 4FPXA 3SJUA 3DBLA 2JD0A 1D4FA 3LLSA 2ZQYA 3DXFA 5G0UA 3S2EA 2GN4A 3ANMA 5U1PA 2P4HX 3JQAD 4CM1A 3SEFA 4D3DA 3TOXA 1F06A 4PLGA 3QWIA 3LC7O 2AQ8A 3RKRA 2VNSA 4IBOA 1EE2A 1UUFA 1NP3A 1XQ6A 5JCJA 1Z73A 3MOIA 5IXSA 1R4NB 1QSGA 3S8MA 3ZU3A 2P68A 5B37A 5GZ1A 4FFLA 4Y6PA 4N54A 1ONOA 3RI3A 1F8GA 1U1IA 5IAAA 5TSDA 4CM8A 2E48A 1ZJYA 3BXXA 4R5HA 4BMSA 5A9SA 1QXSA 5LDGA 2RAFA 2IEDA 4EDFA 4CMIB 2H9IA 3U0BA 3GRKA 1HLPA 1I3MA 1OOEA 4DLLA 3H3JA 3UUWA 1E1MA 1VKOA 3VPXA 2GZ1A 4I5FA 4DYDA 4EITA 5L45A 4QECA 3PHJA 2IE0A 1IE3A 2NTVA 2O3SA 1BG6A 4J7XA 4I9UA 3RUIA 3B70A 4YT8A 3ZWMA 3H5RA 3D7LA 3RU9A 5DBGA 5JE8A 5DZSA 3WLFA 1E1NA 1IZ0A 2BGKA 4IJKA 4AJNA 1ADBA 1GTMA 5CFZA 5T67A 3I6IA 5TT0A 4ND4A 1RM0A 4TKMA 3FWNA 4IDBA 2JFHA 4UREA 2VCYA 4GPD1 3RVDA 1B16A 1HE3A 2XXJA 1NM5A 2BF7A 4TVBA 1N1GA 1OZAA 4OSOA 3ZHYA 3KM0A 3ZW8A 2OUIA 3G1UA 1AXGA 5JMWA 1EEHA 5G4LA 1FDSA 3IDSA 4P4NA 3C1AA 1W8DA 3F1KA 5TX7A 1I3KA 2B4QA 3CMCO 4QUKA 2NQ8A 1FK8A 2CVQA 3HB4X 3LZ6A 4K6FA 1CDOA 1WVGA 2POQX 3KYCA 1EZ4A 4NDNE 4Y98A 3TN7A 3HDQA 3H9QA 5HRUA 3PHLA 3QV1A 2AQKA 3ANNA 3FBGA 3DQPA 3BMOB 4H7PA 3OM9A 4U6SA 5TJ9A 5CEFA 4HFJA 4YRAA 3UKOA 3E5RA 5L7YA 5L53A 4J9VA 4CLRA 2PNFA 1P3DA 3Q0EA 5TRTA 3DL2A 3ENKA 3H9UA 4WCDA 2NV6A 2ZYAA 1ORRA 4BGEA 4DVJA 3ONEA 2G82A 4KMSA 5KTKA 4WEOA 1LJ8A 3P19A 1T26A 4L0QA 3C3XA 3AOEC 1PQUA 4W82A 4B4UA 3TJRA 1DHRA 3VKVA 4RZIA 2W2KB 1GV0A 5KJCA 3S1LA 4B4WA 1GV1A 1LNQA 4NG5A 1UDBA 3RBXA 3PWSA 1HDGO 2EKQA 3Q2KA 4PG8A 2W90A 4Y6RA 2WD7B 3GAFA 1UP6A 3W4IA 4CUJA 5DBIA 5BSHA 1EUDA 1X0XA 4BVAA 4LCEA 3BMQA 1UZLA 3IUSA 2E49A 4N5MA 4OQZA 2P9CA 4J90A 2DPGA 2ZTVA 3B6ZA 3PQFA 3IJRA 3GFBA 1NQAO 3U4CA 4EJ6A 1JAXA 2AHRA 3GA0A 4IIUA 4H3VA 4UULA 4WNIA 4M55A 1HTBA 1UDAA 3GN1A 2EGHA 4WLNA 2PZJA 3KLMX 2WTBA 4Z0HO 1NPTO 4CL3A 2EG9A 3EVNA 3EY4A 3ZNNA 5A3JA 3N7UA 3NRCA 1UXIA 1Y8RA 3T4EA 2CD9A 1PZEA 2QG4A 4BGVA 1IB6A 1GZ4A 4FN4A 3GMDA 2WDZA 1R4MB 3DZBA 5ILOA 2QRJA 1N9GB 3WFJA 4NBTA 4BNGA 2VYVD 2HJSA 5EMHA 2AA3A 1HSZA 3JQ7A 5KKCA 4I8XA 3RU7A 1TT5B 2C0CA 3LLVA 4MKXA 1VKNA 4MO2A 1M76A 5TLSA 3QSGA 1KEUA 3RUDA 1Y1PA 2EHDA 3WFIA 3FNHA 4JQCA 3OECA 3ZHBA 4CLDA 3WGHA 1DC3A 1K0UA 5LC1A 1VJTA 4BQRA 4O59O 1LU9A 4RQTA 3MTJA 1BGVA 3ZV4A 4R3NA 2PGJA 1P1RA 2B83A 1IOLA 1HDOA 5L4SA 1PS0A 2OZPA 2CVOA 3JV7A 5IN5A 1FDTA 2H6EA 1YOVB 4XEHA 2NU8A 4GH5A 1J6UA 5T6BA 1E3WA 5A4DA 1NHWA 2HMWA 4BNWA 5ENDA 1A7KA 4CPDA 4C7KA 1LSSA 2CVZA 2FHSA 3QRWA 4JCOA 4B79A 2A92A 3JQDA 2VZ0A 3PZBA 5COAA 1U2GA 1JU9A 4D44A 3NEPX 4FJ1A 2J3KA 4YB8A 4BNUA 1ENPA 4CMKA 3PYXA 4FB5A 3JQ6A 3GEMA 3RUHA 4CQMD 2H5LA 3DFUA 3VZQA 2DTDA 1E92A 2YDXA 4UVDA 5BNTA 3OQ1A 3ASUA 1LC3A 1JKJA 3A9WA 3R0IA 2BI7A 2FY8A 3D4NA 3W4KA 2I3GA 1OAAA 2V6BA 3Q3CA 4A73A 1L7DA 2EGGA 2BLLA 2PLAA 3D0OA 4OSPA 3ZWOA 1MA0A 5TGDA 1V9LA 3WWYA 3SC6A 1UXHA 3PP8A 3BMNB 3WQSB 3S55A 4GX2A 3ZNQA 4DYVA 3DTTA 5KJ6A 4JX8A 1YJ8A 4FC6A 5F3RA 3KUXA 1CETA 3VPGA 1EMDA 5TIIA 2DKNA 1DB3A 2YYYA 1QYXA 4GX1A 4IMPA 5F5LA 1E3WB 3IJPA 3SXPA 2WD7A 2UDPA 3F4LA 2ZYGA 3UVEA 3V2UA 1O95A 1O9BA 1P31A 5G4KA 4N7RA 3OQ6A 3I4CA 1E6WA 1JLLA 3L0DA 4DPMA 5JYDA 1MUUA 3GF4A 3JQ8A 4F3YA 2NTNA 2ZB4A 2Q50A 4BO3A 4IS2A 5EESA 1O5IA 1QV7A 1U7TA 9LDTA 2GASA 4NH4A 5BNFA 3L6OO 2RBEA 4EBFA 3NV9A 2BD0A 5ES3A 4CMEA 4R1SA 3GEDA 4TRMA 3AM5A 1YL7A 2VUUA 3W4JA 1Y9EA 2EIHA 4YEDA 3U9LA 2PD6A 3C1OA 1X14A 1B15A 3BTVA 1ZJZA 4CR8A 5C7OO 3ROQA 2O2YA 2G5CA 4BMNA 4JNKA 4IQGA 2GZ3A 2PKQO 2AW5A 1DJQA 3FPLA 2B0JA 4IIVA 3H9JA 3TPCA 3VH4A 3OIDA 4I1IA 3TNLA 3BZUA 4E0BA 4MP6A 4W99A 2BKAA 1HSOA 2CDBA 1K2WA 1YO6A 2EF1A 2C7GA 3ST7A 1AHHA 3K6JA 1KY4A 3OMLA 1H6BA 5AVOA 1E5LA 3GGPA 4YWJA 2I67A 2O3UA 5CPFA 3RC9A 1J5PA 3BA1A 4NFSA 1DXYA 1H2HA 2W2LD 1FDUA 3ONDA 5TNXA 3KEOA 1PJCA 3H3FA 1XELA 4NZ9A 5DP2A 2NU9A 3S2IA 1ZMOA 1GY8A 2P91A 2CSUA 3U09A 2NU6A 2QRKA 2Q4EA 3MJCA 4CODB 5HA5A 3GT0A 1ZSVA 1R0KA 4ALMA 3NYWA 1Z7EA 3AFNA 1NTOA 4FR5A 3WR5A 1PJBA 3DHYA 4FOOA 1I32A 1V3TA 1YBVA 3QP9A 4DIOA 4YBZA 3ZNOA 1OFGA 2WJPA 3INTA 4G65A 4A10A 1NAHA 4RPHA 4BOYA 3FI9A 3UAGA 4R01A 2EERA 1NQTA 2J3HA 1EUCA 2BH9A 1T1RA 4R69A 3V1YA 1LX6A 4N5NA 1HF3A 4U6QA 5F1KA 4EI2A 3PTZA 4PLCA 2O3JA 3ZWWA 2X0JA 4OXYA 3UFXA 4ALIA 1O89A 1O94A 3GLQA 1JVBA 2HK7A 4Z9XA 1RM3A 4EGFA 5KVSA 4ZQFA 4AICA 3DWFA 3HUDA 4XRGA 1ZSYA 1CJCA 3ANLA 5JDIC 3KO8A 4OOEA 1DDOA 3OFSA 2DBQA 4B4VA 1NNUA 4CMJA 1DRUA 2EP5A 3Q2IA 5F5NA 2OGUA 1P1HA 1SEVA 4Q3AA 4YXFA 3A28A 2Y67A 3FTNA 2VWHA 5L95A 4PZDA 4QTZA 3EAGA 4TSKA 4HV4A 3DR3A 1NFRA 4ND3A 1NPDA 1V8BA 5DCUA 1JKFA 1XDWA 1M6HA 1KVTA 1SC6A 2G0TA 4J49A 4OM8A 1KC3A 3WYBA 4NU5A 3JD2A 1DFIA 4D0SA 4YT4A 2Q45A 2HQ1A 4WEQA 1C1XB 3EZLA 2FR0A 2W98A 4K9DA 3HDHA 5A9SB 1X7GA 3F46A 3KBOA 4GLOA 3R6DA 1E7SA 1BXGA 3G3EA 3GK3A 2D8AA 3PK0A 1FF9A 3KYDB 5CDTA 1NQ5A 2AQIA 2DM6A 5BSFA 5ICMA 1QRRA 1LRKA 5EERA 4B7CA 3K8ZA 1J0XO 1ONNA 4IM7A 2W8ZA 1YRLA 1IPFA 3NJ4A 1CQIA 1DIHA 1H5QA 1TA4A 4XDZA 1PJQA 2H1SA 2YDYA 4R68A 4MJLA 2Y1EA 1IULA 1UP4A 1D7OA 4B3IA 3U3XA 4RGBA 4TZKA 5ER6A 3K92A 3LT0A 4QT0A 3TL3A 1PTJA 3MJ4A 4AJEA 5A02A 4E4YA 4M89A 5JDCC 4I5EA 1LEHA 1BVUA 1SNYA 3E18A 3H4VA 4Q3DA 2FP4A 4P4LA 4CM8B 3CUKA 5I7VA 4QXMA 1BWSA 1VC2A 2Y66A 3MTGA 4CMIA 4I9HA 2R00A 3FR7A 3W6ZA 4DMLA 1D1SA 5ILGA 1AGNA 3E48A 1U3TA 3GN2A 3AUTA 4O63O 4Q9NA 4D46A 3RC1A 1TT7A 1ONPA 2ZIZA 4WLUA 1VE9A 3S2FA 3PDUA 2QZZA 2ZB8A 2E37A 3HN2A 4LVUA 3WYEA 4EEXA 1MFPA 1Z45A 1W4ZA 4IINA 5JAQA 3DFZA 3NTQA 4P38A 4BB5A 3WGIA 1HE4A 1W0CA 2QQ5A 5CEEA 3U49A 3QHAA 2GR9A 4ESOA 4HXYA 3GZNB 2I99A 1DOHA 4PG7A 2AE2A 1GPJA 4GWKA 2O3TA 4FGSA 4XJSA 1PR9A 2HLPA 2CDCA 1Y7TA 1GADO 1RJWA 4LK3A 1AHIA 1HETA 1BHSA 3C1TA 5G2OA 3BMCA 1NBOA 5THKA 4RL6A 2YQ5A 4R1UA 1Q7CA 1K6IA 5JAZA 5ITVA 3DZGA 1WXDA 2OBNA 1ZBQA 5I7SA 5TF4A 1PU2A 3H9GA 5AXDA 1VPDA 3D4PA 4LISA 3FBTA 1BRMA 4BKUA 2PWZA 4PLWA 4S1VA 1QMGA 3WIDA 4B8WA 3PIIA 3H65A 1EQUA 5KJEA 3VZRA 1FDVA 4E32A 4EJ0A 5JDIA 3HN7A 4D79A 1E7RA 4FGWA 4KQWA 2DFVA 1H6CA 4MVJD 1B8VA 1OI7A 1LQUA 1RYDA 1WWKA 3BHMA 5ADHA 1KERA 3K9QO 2OXIA 3C24A 1SO8A 5IFLA 3DBLB 5TS3A 2D2IA 1K89A 4GGOA 1BXKA 4F6CA 4FC7A 1Q0HA 1UAYA 5ITWA 4BO5A 3ZU2A 2B4RO 2OP1A 1YH3A 2DLDA 3QVXA 1DPGA 1CRWG 4J6FA 4OHUA 2O3RA 3VPHA 4XQEA 1ISJA 5AOVA 1K3TA 3DMYA 2PZLA 3SBOA 4BNLA 1M2WA 3DOCA 3NT5A 4UVHA 4WASA 4FJ2A 4BO9A 3L4BC 3UCFA 1MV8A 4A7PA 3KHUA 4D3FA 4DQUA 4AJKA 4NMHA 4YAJA 3OQBA 4INAA 1U8FO 4CM6A 5I9LA 3VDRA 2DAPA 4GMFA 3NT4A 1SB8A 3WGZA 1BMDA 3ON5A 2FN7A 1EVYA 1I01A 5IG2A 1X7DA 2FPIA 1SMKA 4MOWA 2PGDA 1V35A 4BO8A 1YJQA 4PLYA 4XB1A 3R3JA 4XCVA 1HYHA 4DMMA 2EKLA 3GH3A 3UH1A 3HJAA 5CDGA 5DP1A 5JNLA 1X7HA 3OIFA 5A05A 5BR7A 3I9NA 5MDHA 4NJOA 4OQYA 3EDMA 1U5AA 5GY7A 2VHXA 2ZYDA 3WX0A 1LUAA 1X1TA 3LT1A 2SCUA 4WLVA 2GCGA 3MCVA 1LRLA 2C29D 2NLOA 4Z0TA 1G1AA 4LRTB 3RBZA 3D3WB 3DZJA 1C0PA 2AG5A 1C0LA 1M67A 3TZQA 1TLTA 1KETA 4CV2A 2BRUA 1EFKA 1GCOA 5TT1A 4EUEA 1LC0A 1ZCJA 3KXDA 1UP7A 3FCOA 5IXYA 4W6ZA 3I9JA 5C37A 1PZHA 2OHXA 2EP7A 1I0ZA 2HRZA 3OA2A 3ZWBA 4CQLB 1LTHR 5L4NA 4TRJA 1LRJA 4JIGA 4LCJA 2D1YA 2Z1NA 2HCTA 2X9GA 4DC1A 2CF5A 2D3TA 1NR1A 4EUHA 2GO1A 1PGPA 3R3SA 3ETEA 2JAPA 3KYBA 1ZK4A 4CV1A 5FF9A 4ZQHA 1KVUA 2RIRA 4OKIA 4OKNA 3SJ7A 3VTZA 4DIBA 2BFMA 3FSRA 1MG5A 5H81A 4XA8A 3KB6A 2ZATA 3OBBA 1PGOA 4RPGA 5H83A 2WE7A 4ND2A 3TZCA 2X58A 4GSKA 4W4TA 1YONA 3U4DA 4U0KA 4XB2A 2VOJA 1JVSA 5KVCA 1E3EA 1MP0A 3AU9A 1T4DA 2Y0DA 3AUAA 1V3UA 3WBBA 4RF2A 1NHGA 1P45A 5TJHA 5JBIA 4BNZA 1D3AA 3GVIA 1Q7BA 5JS6A 2Q49A 2PKQP 4ROSA 2QYSA 3D3EA 1SBYA 3MJEA 3PLNA 1PJ4A 2FZWA 5A06A 3WYCA 1PGJA 4FIZA 3PHIA 1A7AA 3DBRB 4PLFA 4AJ1A 1Y5MA 2WSBA 1GAEO 6LDHA 4OOFA 1LDMA 2WYUA 4LMRA 2IZZA 4IGFA 1DRVA 5JW6A 4MINA 1YBAA 4XYEA 2X0RA 2QZ9A 4MVJG 2Q1TA 2PZMA 2VRCD 3ZV5A 5L3ZA 3K2BA 1R16A 4W7IA 4ZVVA 3M2TA 1HE2A 3F5SA 4W9NA 5G0VA 4WNCA 5DNAA 2Q1WA 4FFOA 2NVBA 4MIOA 1KEVA 4PN3A 1T2CA 3O8QB 3D1LA 1ID1A 3IC5A 2B35A 4E2YA 5L51A 5T8KC 1G6KA 2AQHA 2DUUA 3JQAB 4YPOA 1J4AA 4OXKA 3GAZA 3VH1A 2WE8A 3JYPA 1BDMA 1KC1A 1V3VA 3IS3A 4MKRA 4WLOA 2D0IA 5U4QA 3UW3A 4PG5A 2XXBA 3PI7A 2Y1DA 4BKQA 1ZFNA 3T7CA 4U5QA 2WWRA 3O38A 2ZB3A 3NTOA 1DC6A 3OF2A 5G0WA 3OP4A 2BHLA 2UV8A 5COBA 5IJZA 1SB9A 5TQVA 1EQ2A 4FDAA 3GC6A 1PR3A 1N2SA 3FPCA 1QG6A 3PWZA 2X9NA 4UUNA 5L9AA 2JFGA 1JDJA 3LYLA 5EIOA 4CLHA 4KDFA 4XKJA 2D4AA 1MXFA 4ZRNA 4YA6A 4AFNA 4BNTA 3WBFA 1ISFA 3N74A 2BFAA 2CUKA 2VUTA 4NJMA 3QVSA 3GVHA 3PEFA 4RF3A 5DBFA 5CEJA 2G17A 2HAEA 5ICSA 3H2SA 1EFLA 1EVZA 1HXHA 1ZXLA 5JYEA 3JQ7B 4XRRA 1YGYA 5JO0A 3I52A 1C14A 3QWBA 4PCVA 2ZCUA 3RUEA 4Y8VA 1D1TA 1PWZA 4BGIA 2GD1O 2X6TA 2I66A 3U4HA 1RPNA 2CY0A 4J3FA 3WGGA 3ZDFA 3E1KA 4IQ8A 3WWZA 1Y8RB 3FWZA 3FD8A 1BVRA 2YW9A 4JP2A 1KVRA 1N9GA 3F3SA 3KSZO 4P4GA 4GSLA 5DOZA 1U5CA 4CUKA 1N8KA 4CUZA 2IDZA 4MIEA 5CHEA 3DBRA 3MWEB 4P22A 4QO7A 1NVTA 3GGOA 4CM4A 4CQMB 1YOVA 5T64A 1ARZA 1LQTA 4GGPA 3L6EA 4ZQEA 1MX3A 1KIFA 1GYQA 1IYZA 1LLCA 2DTEA 3GZ4A 3V2HA 4ZQGA 1ISGA 4PVCA 1MGOA 2PZKA 1YE3A 3G79A 4XGIA 5JC1A 4MVJE 5L7WA 4QSMA 1ZUD1 3G0OA 3BTOA 2YFHA 1RM5A 1F17A 2HSDA 4E2ZA 2O4UX 1KEPA 3E6AA 4Y67A 4D41A 3ITDA 2DFDA 1DC5A 2GNAA 2YQ4A 3PGJA 4PVDA 3O26A 3P2YA 5CDYA 3PJEA 4XYMA 4BO1A 1OC4A 5IDXA 3AJRA 1RKXA 3INRA 5G4KB 2WEKA 3WG9A 3RJ9A 1YQXA 4TWRA 4JROA 3D4OA 1N1EA 1P1JA 1G0NA 2BI8A 4Q3EA 5L7TA 4L8VA 2PD3A 1GEGA 2UUOA 4RVGA 1B2LA 4RJTA 5B4TA 2NNLD 2VHWA 3NJ8A 2DTXA 4CMEC 1R12A 2O2SA 4NBUA 3AWDA 3SC4A 3VVBA 3ZWAA 4J9UE 1HDXA 1T2EA 9LDBA 1SCUA 1T1SA 4EYEA 3OA0A 1XSEA 1R6DA 1ZVMA 5IZCA 5BNIA 2ILTA 3PJDA 4TKLA 3ZHXA 4J4HA 2UUPA 5FI5A 3WOHA 4FJ0A 1HDYA 1CF2O 3JQGB 2R00C 1A4IA 1V0JA 3W8FA 1P0CA 4H16A 4OO3A 3DZFA 2YJZA 3WS7A 4AJIA 4NFHA 4RVDA 3AY7A 3SX2A 2HU2A 4MVJF 4YDRA 4CMBA 5AYVA 2DQ4A 1XR3A 3AFMA 3RFXA 3EW7A 4AJ2A 3BTSA 2RHRA 3JQ9A 1B3BA 4LSWA 3LT4A 1GDHA 3PFFA 3VH2A 2ZTUA 2C20A 3G49A 2FSSA 1OMOA 4FOSA 1E1KA 1E3IA 1WDMA 4GL4A 2P5UA 2ZJ0A 4MDHA 1U8XX 1Q2XA 2B5WA 5A9RA 1IUKA 1B0AA 4UVGA 4FFRA 3DMTC 3WNQA 3RUCA 3TZ6A 4IDFA 3ULKA 1B3RA 4MVJA 3JQFA 5KVQA 4BO7A 4JLWA 4GQAA 3RSHA 2YFQA 1RWBA 2J5QA 4ALNA 4DXHA 5A04A 3ZH2A 5BQFA 1GPDG 1ZKMA 5JY6A 1K5HA 2BGMA 4WGGA 1QR6A 3FRJA 3RUFA 4QQRA 2AE1A 3B1FA 2ET6A 2O3QA 3BTUA 1ADCA 2Z5LA 4RLHA 2Y0EA 1XCBA 3JYNA 5L4LA 3QA9A 1IHXA 4Q3NA 2O7SA 5AQ1A 4E13A 1BTOA 1ZIDA 4ZRMA 3I9MA 3S2GA 3Q11A 3BMCB 4K6CA 2EKPA 4OL9A 3D3WA 4WK6A 1TI7A 4WLEA 4IDGA 1ZMTA 5JDCA 3QW2A 1E0DA 3AK4A 3ZHZA 4UUOA 3WXBA 1R15A 2WD8A 1SPXA 3H5AA 1IY8A 1IL0A 4GBJA 5IDWA 4GMGA 5A3VA 4YVFA 4HNGA 4CMHA 3JD0A 5I7FA 4ALLA 1LLDA 1GYPA 4RV9A 3IOYA 4DQXA 3P5SA 2P4QA 3RFVA 1TXGA 2BFPA 2Y93A 4UAGA 1QKIA 3UN1A 3D5TA 1E5QA 2JCVA 4KTTE 5DCYA 3ZCXA 3KEQA 1ZK1A 4IQ0A 2VQ3A 3PFWO 4G5HA 2NQTA 4RVUA 3OH8A 4NI5A 4YAGA 3E03A 4RDIA 1LDEA 3ZWCA 4CLRB 1JKIA 1EVIA 3JD1A 4OGWA 4XX0A 4E2XA 1L7EA 2LDXA 4IXTA 4WCFA 3ICCA 3I9LA 2VTDA 4HBGA 2O23A 8ADHA 2PR2A 1HRDA 3RIHA 3WDSA 4UVEA 3ZV3A 4BO0A 3GR6A 1B8UA 3QVOA 4FBGA 1PZFA 4BO2A 4GKVA 1HT0A 5IDQA 3QLJA 1DSSG 5A5EA 2C07A 3BHJA 3F4BA 4AJJA 3QQPA 3AY6A 5HS6A 3TOZA 3KYCB 4IDDA 5KWEA 4KP7A 2C2XA 5I7EA 1I33A 4LGVA 4DBZA 2QHXA 3ADPA 3C85A 3K73O 3GDFA 3STHA 1EBUA 3W6UA 1K6XA 4O5OA 2Q3EA 4IZHA 3VZPA 4WE3A 1YVEI 3JQBC 2J3IA 3ZWNA 2YZ7A 1PGQA 4CV3A 3GUYA 3COSA 3OEYA 2C54A 1NFQA 1ZH8A 1WDKA 3WMWA 2EW2A 4DPKA 5CAEA 3LT2A 3TF5A 5CG1A 4HFRA 5DCWA 3UCXA 1PJLA 2LDBA 1BW9A 1ZK0A 4ALJA 3F6YA 4IY1A 3CXRA 4YT5A 5JSFA 5J23A 4E3ZA 1C1DA 4B7UA 1ADFA 3V2GA 3WSWA 2J5RA 2C5AA 1Z75A 2B36A 2GRAA 2Q2VA 4YJHA 3VPSA 5A5FA 1A72A 1VRWA 2V6MA 4FFNA 4XYGA 4R4JA 3I1JA 5T8KA 4CM3A 2AG8A 3DB2A 4BNNA 2VYND 3ZZNA 3H9EO 4J7UA 1YQGA 1XGKA 4FFPA 4ZD6A 4PLPA 2XAAA 4JN6B 1HYGA 1O6ZA 3O8QA 1M66A 2QW8A 1DIBA 4YACA 1E7QA 4DBVO 5DN9A 3MOGA 1UXGA 3JD4A 2Y05A 4YT2A 4DTIA 3FF4A 4L9RA 1GZ6A 1NAIA 2D5AA 1ISMA 1I2ZA 1HL3A 3I83A 4EJMA 5JLAA 2YY7A 4FSHA 3PRJA 2DVMA 2RHCA 1L1FA 3AW9A 4KUEA 5HWSA 1BXGB 4CR6A 4WJZA 3Q9NA 4IMRA 2YV3A 3NKLA 3ZWPA 1F0YA 4L73A 4E31A 4NK5A 2R6JA 5IZ4A 3DZIA 2P9EA 4DQVA 3QWHA 4YJHB 3CTMA 4XD2A 3WGYA 4XDYA 4OMUA 3DHEA 5B1YA 3RD5A 2VYNA 4NIMA 4LN1A 1ZO8A 4J91A 2IEBA 2EV9A 1WZIA 2Z95A 4Q3BA 2PKRA 2ZKLA 4Q39A 4J1TA 1LSUA 3P2OA 1EK6A 5THQA 3K31A 4JP3A 2IZ1A 2WM3A 4PIVA 1GQYA 1R4NA 4YJFB 2ZCVA 4PGFA 3TWOA 8LDHA 3GPDG 2XPCA 5G0SA 4BNVA 3KSDO 4JBIA 1UH5A 3JTMA 5AXBA 4R51A 2NVUB 1GUYA 2G1UA 3LSYA 4D3SA 4NU6A 1Z82A 3AU8A 1WMBA 4L4XA 3B20A 4Z0PA 1NPYA 3RC7A 1HEUA 4PRKA 3JQAA 4WUVA 1C0KA 3TZKA 1U4SA 2E4AA 2PFGA 4HP8A 2E6UX 2GN8A 2WMDA 1FMCA 5JCJD 1E7WA 4XYLA 4FFMA 3MZ0A 4OAQA 2AXQA 3AI1A 4KDEA 3PWKA 4D7AA 2GERA 1GQQA 3I6QA 3BHIA 4XJTA 3GNTA 2HMSA 2PTGA 1T24A 4WCFB 3GZNA 2OO5A 3CZRA 3FNGA 1Y8QA 3GHYA 3TRIA 1LDBA 2FOIA 4NNJA 5DOVA 1HZJA 3KLPX 2W2LA 4QO8A 1YL5A 3GY0A 1DIGA 3A14A 1WW8A 4YR9A 1N5DA 4J16A 4JXKA 4WLFA 2EJVA 2Y0CA 4II3A 4BNXA 4L4SA 4G81A 5A9TA 4EEZA 5JC8A 1A71A 3JQEA 4KTVE 3RBVA 1NQOA 2OOSA 1U4OA 5A1TA 2GF2A 4BHTA 3AUSA 1U7HA 1XG5A 3GEGA 3ROKA 4GAEA 3JQ8B 1PSDA 2Q2WA 3QJ5A 3ROMA 1YXMA 3WJ7A 1LA2A 4JK3A 1HDCA 3CIFA 5FFFA 4IJWA 3EUWA 5EQDA 3RASA 2PH3A 3CINA 3PXXA 2GN6A 2VUSA 2FRDA 1ULUA 2BGLA 3I9OA 4DREA 4YJGA 3F1LA 4RF5A 2X8LA 4E30A 2DUWA 5HBRA 1NYTA 2DBZA 1PIWA 3IAHA 1W73A 4NBWA 1DFGA 1ENZA 2CMDA 1R66A 3DZKA 4O0LA 3RAJA 3RFTA 2VRBA 4RLSA 3PYMA 1PZGA 4DLAA 3NTRA 3V1UA 1X13A 1HE5A 3DMTA 4ILKA 4PLTA 2O50A 3NGXA 1JWBB 3PDJA 2X5OA 3QVTA 4E33A 4BS9A 4UEOA 2VHZA 4RPLA 2A9FA 4JJGA 1IPEA 1QORA 3X2EA 2I5PO 3KETA 3E5MA 4IJUA 5LDHA 2VRCA 5K0ZA 1I8TA 5IF3A 1PEDA 1RYEA 2FPGA 1LBEA 2NVUA 1I3LA 3PHHA 4K1LA 3U5TA 4MIYA 3LK7A 4YRBA 2Q1UA 3L4BA 1DLIA 2RH8A 3O03A
chains in the Genus database with same CATH superfamily
3QYPA 3U3RA 2BE7A 2G88A 1RZ3A 2YTZA 3O4RA 4HR7A 1ZHOA 1Z2EA 3DAFA 4YUVA 2QUJA 4EP1A 1FP2A 4DUPA 3IT3A 2V4MA 3EZGA 2W71A 1GQRA 4XVUA 4OHFA 1KE2A 1E2HA 4P7GA 4ND6A 4AJOA 3B9QA 3S27A 3Q12A 3NC1C 4RW0A 1W34A 2M6RA 1YRBA 2BZ1A 2CFOA 2RDMA 3BICA 4NZYA 1XTTA 3NIBA 5G3YA 3ZWYA 1S02A 4CCYB 1SFRA 3CS3A 2GZRA 3EVCA 3PFCA 4ZGWA 5MGBA 1UDXA 2OFOA 4DWJA 1XTUA 5BYKA 2H85A 3VR6A 4IMJB 4F5EA 3R5XA 1JQEA 4HWKA 2WHQA 2DLCX 3VSAA 1RI5A 2HEGA 3ZOZA 1V39A 1O4WA 5FT9A 4R2XA 4WOPA 3R5JA 3EGIA 2CV1A 1WQ1R 1AKEA 4FE3A 2EJTA 5KCZA 2WIJA 2AI1A 4BUJA 2J41A 5ALVA 2UZ4A 5BNZA 3RYFA 3UFBA 1HG0A 2A4KA 2RB5A 2XYHA 3J7TA 4YUYA 3MRVA 1WTCA 1WG8A 4WESA 4CU5A 5BWLA 3JQFC 3NBUA 4RHFA 1H4QA 3ZW9A 1U3VA 2QM3A 3ONFA 5B4UA 2HIMA 2XUOA 5DGIA 5F2KA 2YIVX 5C8ZA 5B1EA 1NJ5A 4NEHB 3RYCB 1PNTA 2NM0A 1UXJA 2NSDA 2PKCA 3P9IA 2QRUA 2PKWA 4YJ2B 2G07A 3AYXB 2CFRA 4RZQA 3WK7A 5BSKA 1RYHA 1X7WB 2P7HA 2HOQA 1N7JA 4EO7A 4X85A 1W4RA 2C2GA 3I92A 2XXAB 1F8UA 2B37A 1PQWA 2R1VB 3M6VA 4R1PA 1OX4A 1NWHA 2OENG 2JH9A 2VN8A 3RWOA 1PJ3A 2O2GA 1MRSA 5JPIA 4DPLA 1KZ1A 4Z3KA 4HGPA 1NNEA 3BXEA 4W7HA 4QGAA 3DDWA 1C1XA 3KR1A 3B1XA 2EFCB 4G26A 3GMSA 3L0OA 1VPTA 4IIJB 4ZVRA 1EKXA 4PR0A 5E1BA 3WGMA 5KYNA 1ODKA 5DW0A 2EWWA 2TSYB 2WYIA 3JYLA 3L1JA 2FN8A 4DRYA 3ZLJA 2ZCJA 4MZDA 5ALTA 1M2OA 1XKLA 1Z6PA 3THOA 2B4TO 2BGJA 2C9OA 1EX1A 4E11A 4J76A 1UC8A 2QP3A 5CLFA 4X65B 1JG2A 2D62A 4IGKA 5FPTA 4JBGA 1PW7A 3V1TC 3PGXA 4UMVA 2NTEA 3V00A 5AI0A 3SP1A 2XUQA 3GJ7A 4OQXA 5H7XA 2X0NA 1P4SA 1P74A 1P1CA 4UE2A 3T06B 2YHUA 3TLXA 4Y9RA 4Q7MB 4DXDA 821PA 3LC0A 4M86A 1CVRA 2OBLA 4QU0A 2NIPA 4DIFA 4BQEA 1QVZA 1KK2A 3I05A 1GR0A 1F38A 5EUBA 4DIEA 3AERB 3MTIA 4RHCA 4G0YA 4DA0A 3GDGA 2J1LA 3COZA 3Q41A 5KKAA 1NVFA 3SSMA 3B1KA 3VDNB 2GAIA 4MLCA 3JRXA 5E1OA 5LNK1 3SSNA 3ESBA 1FFEA 4N40A 1B14A 2J45A 1SOWA 1ETHA 1E5XA 4FZVA 4GGMX 2C83A 3NWPA 1KU0A 1MX9A 1BCSA 3N6VA 2GBPA 2YXEA 5LP6C 3T3GA 4ISBA 4K9NA 4CM9A 4ZFNA 2J3QA 3FNFA 2I3AA 2MHCA 1ZH0A 3B1JA 1MCZA 4RZ3A 2R2GA 1CUFA 2P40A 1QFXA 4EYSA 1IDOA 3L1HA 5IYZA 4YCAA 1EHYA 3E82A 3V4SA 3VZSA 5CDUA 5K0NA 2GETA 3LYAA 2COEA 1VMKA 3A1FA 4E5MA 2AD5A 1SZCA 1XTPA 1VM6A 2D00A 1NV9A 4F93B 4MQBA 1T2DA 2F4NA 2H8GA 3R3ZA 1O8CA 2AZDA 3HXLA 3ZJUA 1QZXA 1SOMA 2P75A 4BJ5A 5F2NA 5IFLA 2BFOA 4Q4AB 4EAAA 4LF7B 1CC1S 1RMYA 1R0LA 2QM8A 4FDVA 3CMMA 5F21A 3ZKWA 4E94A 2AJTA 2EU8A 2IJGX 1RJ9B 2V7TA 3X1YA 2WY2D 4UPEA 1U1DA 3J81k 2O1XA 2QRVB 2V0CA 2WOOA 3H17A 1VI6A 3PV0A 4WX2B 5C4GB 3S5JA 1ECPA 3GLHA 5LD2B 5EMMA 5C2JB 4NK4A 5DVZA 2DQKA 2O7RA 3W78A 4BXOB 1KYYA 2JK0A 4H0NA 4JZKA 1ZSNA 3BIOA 5DYGA 4B85A 1FP6A 4WV3A 1QAOA 3DVSX 3GRPA 4JC5A 4GMDA 3CZQA 3C3EA 3FHLA 4JUIA 1W76A 5E7QA 4YAUA 5TMBA 2HK9A 2R8EA 3CB4A 5ECDA 4LF8B 1NUUA 2VYCA 1PL8A 1P6XA 2VK2A 4MQUA 5IFKA 2Y4OA 4EOGA 4D3XA 1XI2A 2EFEB 4Q4HA 4WZAB 1KJWA 4Q93A 5ALOA 4QYIA 5HMMA 2MCFA 3HSKA 5F3WB 3LC1O 2QY9A 4ODIA 4RKRA 1UEJA 1VSTA 3RVOA 1N2CE 5BV7A 2M6KA 4QJ5A 1XVTA 1KRWA 1E1LA 1QDLB 1A04A 2MINB 2Y4NA 3NDRA 5DWVA 2QXTA 3JYHA 3LAWA 4MS4B 1GSHA 3ZGVA 4F4FA 4B3JA 1EJ0A 2Q46A 3EXHC 4GRAA 1CERA 4LDQA 4M76B 3MRTA 4X24A 5CTAA 5AVXA 5GVSA 1KAEA 4G0UA 3KKEA 2Z30A 3FAZA 2HA2A 4BY9E 4C4RA 4I9NA 4PU0A 3OQOA 1P1KA 2IYPA 3S2SA 1AV6A 4EW6A 5LCXA 2C82A 3DEYX 2RHOA 4U63A 4HUQB 3FN4A 3GVPA 3TTWA 3IAXA 3QFTA 4DT1A 1DEOA 2M6LA 3WLTA 2V7EA 1E6EA 2X0IA 4MLPA 1WXHA 1P7WA 1BXRA 5E4TA 1GD1O 4HGRA 1QBGA 3ZXSA 4NJEB 4F06A 1OFUX 1YKFA 2GZAA 3WHIA 2W6JA 3LC2O 3S3TA 3IVAA 1G8AA 1TB4A 3ZJ5A 3CCCA 2WB4A 3Q5DA 1XPUA 1AKQA 4P58A 2CZQA 1QLHA 2GN9A 4CI0B 1QHYA 3PVZA 4QHTA 2I2AA 1TW3A 5KCMA 3G0CA 3NQ41 1XTBA 1Q0UA 4RJJA 1DEAA 1Z47A 3JQRA 1XN4A 4RGVA 3GA5A 1JHRA 3SKYA 2VJBA 5I7HA 1NQXA 4BAZA 4XIIA 2C84A 3Q1KA 2YWCA 1A5SB 2ZE7A 3DBHA 4E07A 4U7HA 2I7CA 3N5KA 3P9CA 2FVXA 5IKXA 1CIVA 4P7FA 2O6HA 2EKBA 3FVWA 5LB4A 1QYRA 3KPWA 5TGTA 4MVJH 5ICCA 1QFJA 3AF0A 4YQFA 5I7OA 4P53A 4M8KA 5G1PA 3F78A 4GZLA 1QYCA 1XCJA 4S1WA 2PL1A 1QRAA 5ECGC 1JQDA 1A77A 1KI7A 3BORA 4G4SO 1JHDA 2A35A 4KQ2A 1D4OA 5EE3A 5D7NA 1EDZA 2QTVB 2J3JA 2FMUA 3IPLA 4JY7A 3P0EA 4CTMA 3KQHA 4QOEA 4UBLA 4ZU3A 4PFKA 4ZZ0A 2P0EA 4LWQA 1KMHB 2D4HA 3E15A 3MBKA 5E3IA 3D3NA 4CETA 3KKQA 2IHBA 1QHHB 1ZESA 2X13A 3A9RA 3WSVA 4CLOB 3EZYA 2QT9A 3GLHB 1YDGA 3ESZA 2UVDA 3PUWA 5H3LA 2NWQA 5AW3A 3PLRA 1ZP6A 2Y9PB 3X1XA 4HQNA 1SD5A 3PFGA 1NQUA 5AJUA 2BI4A 4TTIA 4WKCA 5HOEA 3R41A 2PMBA 4TPKA 2P9GA 4M6WA 4YGXB 3K4HA 2AC7A 2ASVA 1VJ1A 2B8NA 2PGLA 4IFTA 4RNCA 3EGXA 2IYOA 1XJQA 2Q4OA 2CNBA 4PRYA 3MJSA 1A7UA 2GPTA 4WK0B 4WZAA 2IDJA 4MKHA 1M1YE 4YMWA 1U28A 3QQ5A 3QIAA 2JJYA 4PYJA 2XGMA 1KEWA 3IHWA 1Y33E 3B9RA 5E1MA 4RF4A 4ZCTA 1Y9AA 1T4MA 3K05A 2R4QA 3NDPA 4ML3A 1RR6A 4AB1A 4DQ0A 2RJNA 2WWFA 1W46A 4QEZA 4P98A 5BN5A 3I2FA 4AQ7A 3K53A 3TLKA 4OBBA 1F2VA 3O8OB 5H5JA 3A10A 3EVTA 4PANA 4QEKA 4MP8A 1IY0A 3HKEA 4HQLA 5KTOA 3MJDA 5GOTA 4NFYA 1K5DA 4JLBA 4B3XA 4AVYA 1T2AA 1B0ZA 3VKGA 2EEZA 3C45A 3HVJA 2IU4A 3SU8A 3CISA 1MQSA 4NQRA 4TSRA 3CX4A 5ALSA 3LDHA 2WJAA 3IL2A 4H17A 3WV5A 1Z13A 3K70D 3WQRA 4CM5A 5KOIA 3W1VA 1EK1A 2XZPA 3GP5A 2VYFA 4N0DA 4F5WA 4BNJA 1U8UA 3D81A 2CJPA 1LLQA 2H2HA 1RXYA 2HRBA 3VH3A 3L8HA 4CF5A 2DU8A 5FUMA 1DO2A 1YQ9A 3U39A 3TR0A 3ZX4A 3DKVA 3HA5A 1PJSA 4KQIA 1T25A 3WGOA 2ZXUA 4M9SA 4TWZA 3V5NA 3IKTA 2PV0A 3A4TA 3P9NA 4BX0A 4UBKA 4D74A 3UK2A 4OI4A 4REQA 3KCNA 4FNGA 2ID9A 3RTCA 4RULA 4Q7EA 4C29A 3C3WA 3LX6A 3L7NA 4D4LA 4FR0A 2VAPA 4XQCA 2JCYA 2VH5R 3PHGA 3Q7IA 4HUTA 2O8BB 1FL9A 2EIXA 2GF0A 4EMTA 4KRGA 5B53A 1J56A 4A5OA 3CUTA 4YQYA 5K6TA 1NOJA 2V6FA 3DD5A 5H16A 4GHWA 4D99A 6NULA 3ZVKA 1PW5A 3L4SO 1RP1A 3PG5A 4OP1A 4U4AA 3UHJA 3WB2A 2XOEA 1WM1A 3JQ9C 3KKPA 5AKEA 4YWHA 3W5JA 2ACEA 4BNMA 3DTYA 3CCBA 2K2WA 3EEQA 3I5YA 4HFNA 1QE3A 2BHRA 5CFMA 1ZR2A 4IO0A 2E6KA 4RA6B 5BSEA 2XAUA 3DFIA 2JCSA 3ENZA 2MU1A 1U3WA 3PZRA 4N6NA 4NF2A 1B23P 4M22A 2C9DA 3PXEA 3L77A 4UHFA 3V4ZA 1YJBA 3LG2A 3VFDA 2ZQZA 5HIIA 3W3AH 3DLHA 4NOKA 4CG3A 3SM3A 2WVGA 3V1MA 2VAMA 1B6SA 2B78A 3V8RA 5FI3A 4E5PA 4AJLA 2CK3D 3EODA 3GCZA 3ROTA 5C31A 5HS4A 5JATA 3I28A 1A88A 1E32A 4O08A 1RRVA 2ODPA 1RPTA 4CQMA 5BXQC 4L4RA 1WV1A 2OHHA 1Z62A 3B78A 3QY9A 2IZ0A 4KN9S 5FOXA 3D7SA 3LX4A 3LXUX 1UBRS 1XDBA 3JWPA 4XZ3A 4MVJI 1ZLXA 5B7QA 3DNPA 2X9VA 4R8VA 5CYPA 1IBKB 5MGNA 2CKMA 1N0IA 3C16C 2WSIA 4RJLA 3EXAA 1Y4AE 4TTJA 2QSZA 2VPYA 3G89A 4DNOA 4Z2YA 3Q15C 4OIFA 2HDHA 1E3SA 1GTZA 4G5GA 4CKCA 3DVRX 4C04A 2LCIA 1CPYA 3IXMA 1V9CA 4QUJA 2XWJI 5EHIA 3PL5A 3E81A 3PFKA 3T15A 1GJRA 4JUBA 1Q0LA 1ECFA 2FPGB 1BA2A 3D6MA 4GOXA 4Q3OA 1V6SA 1UBFA 5FYDA 3U3KA 2VSNA 3CKYA 4KQXA 1CYEA 3EZXA 1E2BA 5GM1A 3ZK7A 2AK3A 2WU3A 5DGHA 2WDPA 5AW7A 4RVSA 4WSOA 1KYIA 1ZGBA 2A5GA 2CZGA 4M49A 3T5CA 2N1BA 4L8YA 4O4HF 1KYXA 4RABA 4NOLA 2HQRA 1GU0A 3KJFA 2ODTX 4AIRA 3FVRA 1FYWA 1ML4A 5HYVA 3BCSA 2P11A 1RWPA 3CJQA 1LWOA 3H6GA 4EGAA 3QOYA 1ML3A 5AD1A 3DHNA 1EDBA 3DZHA 3I9KA 5D2CA 5EVJA 2JA2A 1WE2A 2G9VA 1F0NA 4JJFA 1DRWA 1VGVA 4Y2JA 2VP0A 1P3Y1 5DGDA 1JA9A 1TA0A 4OB6A 3AR6A 5L40A 5DLDA 3VR4D 2ERXA 3A9SA 1Y5RA 2C7VA 1YVUA 1QIEA 1YL6A 2VZEA 4MUJA 5G41A 2Q6TA 5EZYA 4AJHA 1TDJA 1CD5A 4UMDA 2BFDB 5CB8A 1XOIA 2GUWA 3AM4A 3WLSA 1MW9X 2OL4A 3D64A 3KKKA 5TQJA 3MJTA 4X93A 3C8MA 5AKHA 5HFJA 2VBIA 3ZUPA 3FNRA 1E6UA 1ULSA 4B44A 3THWB 2VTVA 2INGX 2IZ7A 3I2GA 2PWBA 4C4OA 1SIWA 2GGSA 3AZOA 3EIWA 3X1KA 1ZAYA 4I2VA 3A1WA 1CYDA 4Q5IA 2TS1A 3RJ5A 4DMHA 3C6ZA 4D8XA 4JVLA 1ZDMA 4L8GA 1XHLA 2A0FA 2R48A 1JAYA 5GONB 3PQEA 4JOSA 3NTLA 5DO9A 1NVGA 3ND5A 3IA2A 3K6SB 1UBEA 1B73A 3LVFO 3OQIB 3N9IA 5DU2A 4S04A 2BKXA 2AKEA 4II2A 2QX7A 4FQ8A 4C2BA 1CEEA 3FDXA 3F47A 5LP6F 1Q7TA 1AVTA 1JAHA 3H5TA 3IEUA 1ZJ4A 3MMPA 2PS1A 3QGMA 3PS9A 5T6MA 4QUGA 4F45A 2O2JA 2NP6A 3ZZ0A 3T1VA 2RFLA 1F8FA 1E2QA 3ZPXA 1YF3A 3QOXA 1EFPA 1H2FA 1QLJA 5AKLA 2QGNA 3ITEA 4XJXA 1AUQA 2AGVA 2Q1YA 2RAUA 4U6NA 1U04A 2O8VA 2E4YA 2IPNA 4XGQA 1JEAA 3GJ5A 1GA1A 5JQWA 2OCIA 3MLEA 4R8SA 1OVGA 5LQCA 3RK0A 3O4GA 1DOAA 4AJ4A 3UJ8A 2Q99A 2WU1A 2FJUA 3GXOA 4EM6A 5E9WA 3A0UA 3LBIA 3TX2A 1Z06A 3N87A 1NR7A 1LLUA 1W85B 3UGKA 1A9ZA 3MGCA 3WLOA 3ZY4A 4ZHSA 1AJEA 3PPYA 4ZYTA 2LRHA 1E7MA 2YMQA 3QLEA 2IXBA 1PDOA 1PL6A 2H5IA 4YRJA 4TTTS 4CDRA 1IEVA 4BVHA 1Z37A 1GYRA 1YBMA 1ZJ5A 1J49A 3M1AA 3HFGA 2JLQA 3KUDA 3KU1A 4AQYB 3VPFA 1LBIA 1OBHA 4QG7A 4EX7A 3G2QA 4B6EA 4FFBA 3DWEX 1HNXB 4QBIA 1LNSA 4JC4A 1Y1TA 1LI4A 1PWHA 4MEAA 3WYNA 2ZK7A 3ZLVA 2OFFA 1U9IC 2QJTA 2AN3A 4JS0A 3VU1A 4EYKA 2W4MA 4G8JA 1YZQA 2XKBA 4G56A 4PC2A 1GU7A 2GAOA 4ID9A 4QM6A 3M5CA 3OTHA 2JGFA 2ADOA 4XVRA 4TT3D 2BW0A 1ISHA 3BF7A 4IUYA 5CITA 4HDQB 5LZ5A 3RJMA 4LDNA 3AW8A 3IEPA 5ALXA 2EJWA 5A03A 3W1EA 5KWIA 1G2PA 1DG1G 3F9IA 4B7XA 4EHIA 3P4XA 4BFCA 3VHRA 1A5TA 4WOJA 5FO1A 5BN1A 1GL6A 4BP9A 3QG1A 3URMA 2VTBA 2P6OA 2QE6A 4F3TA 4OEHA 2F3RA 3M6IA 2FGJA 2GO7A 1I0LA 3V8BA 4ZT7A 4GDFA 1Z6AA 2I4RA 3CF4G 5IVKA 1O7JA 3TLBA 3ET5A 4TYQA 1I30A 3ACCA 3RO7A 3QBVA 1II8A 2PNJA 1CHNA 4LE0A 1M1YA 1PT5A 3DCNA 1WP4A 5J4VA 1H2ZA 2XV1A 3A4VA 1CFZA 3RODA 4Z49A 1Q1NA 1S2LA 1STOA 3G8DA 4AYXA 4BLTA 1NBIA 3M1IA 1KI1A 1NVDA 2Y99A 3OE1A 4J4BA 1B4DA 3R7AA 1ABFA 3AH8A 3R2JA 4OV6B 4UFNA 1X8XA 4EGQA 3DTVD 4ZCPA 3PIRA 4QOGA 3VAYA 2HK8A 2I76A 5KNCA 4G2NA 2PRYA 1I6LA 2HIGA 4OQLA 3BF8A 3FDZB 2J3LA 2OGZA 3IBTA 1RWVA 1Z07A 3QVJA 5BT9A 3SIRA 3Q6MA 4BMCA 3RSCA 4LUCA 4YJGB 4UAVA 1NW7A 3K6SA 3RCBA 5FPPA 3GEIA 1AURA 2CBZA 2J33A 3QXCA 3A9VA 3Q10A 1L4UA 1VXRA 1CJBA 1EFVA 4HEJA 4GC9A 1D8TA 1ULZA 4OFWA 4UARA 2N1MA 4IGAA 4YNBA 4P0PB 1QG4A 5F33A 3A1NA 1C7JA 1SU6A 5ENZA 2WV7A 2EKDA 2GVZC 3HACA 4TQAA 1IHYA 2J5KA 1XNHA 2JL1A 1GLVA 5AW5A 6AT1A 4J0HA 3KSBC 1DARA 3H0CA 4PAWA 2FP4B 3BYZA 4TUYF 2JZNA 1D2AA 2V4UA 4QYIB 4UBJA 5C9ZA 2RE8A 4U2GA 2M6SA 1AD2A 1T1JA 2NU9B 2GJ9A 4M98A 1JP7A 1ZI9A 3ORRA 3ZQJA 4WY8A 2QJWA 3F90A 2PFKA 4Q1EA 3ZY3A 3QPBA 4CV0A 1R9MA 1CZHA 4HNUA 1IRIA 5D86A 1FTNA 2HMTA 3OCZA 2A5JA 3S1AB 1VSVA 4Z2AA 5CT5A 3F6CA 2R84A 3K5PA 1EZZA 3KJXA 2C3UA 1GWNA 1PR6A 1TUIA 2P1DA 2I80A 2OV6A 2REXB 1W0JD 1LPMA 3OI7A 4KWEA 1Y1LA 2IPXA 2XNHA 1L4NA 1WPQA 4H77A 4MR8B 3RT1A 1T4GA 3WBKA 1AK1A 3VKUA 2WPDD 5JTUA 1KK3A 1RKUA 3FRHA 5BV0A 4DKJA 2XE8A 3GZTB 5KREA 1BQ3A 1WOYA 2WABA 3T5PA 1M2VB 2X4DA 3K9LA 4ARVA 1KF0A 1XZJA 1UAAA 4BU0A 4X41A 1UFKA 5CPBA 1ODTC 4BTEA 3PNLA 4CR7A 2WVAA 3IQDB 1FSZA 4INOA 1N3BA 1R8XA 3NHMA 1MAUA 1B8PA 1DAGA 2XXAA 4D0RA 4I7EA 3T5AA 3NWBA 5ILQA 2I6TA 1Z0AA 1ISRA 4MNTA 1Y3IA 3ZTTA 3TTUA 4JDUA 4BZXA 1DT5A 3ZK8A 2WP8J 4MWBA 4Z3DA 2Q07A 2Q7DA 5ISMA 5CB4F 2YRXA 3BH6A 5JSHA 2BRUC 1XZAA 4RCVA 2ALJA 4LEIA 5JWHA 4ITUA 4GKBA 4EZBA 2CLKB 1Y8ZA 3W9BA 4R31A 5FRDA 1JTVA 4TV9F 4LQDA 3TVDA 4MR9A 3IOBA 3CH6A 3DAGA 4QFCA 2AFHB 2DE0X 1WX1A 2RC6A 2RCNA 1NTRA 2K7ZA 3VXKA 1FMLA 4TQGA 3VO2A 1RQNA 2QRHA 3AF6A 4N8EA 1MAAA 2QRLA 1OYYA 3CURA 2ZJ5A 4H1VA 4M0CA 1GGFA 1PNOA 1UJCA 1VSUA 2CMHA 2PT5A 1D0IA 2Z6VA 3DL4A 3ETGA 3GW8A 1FFGA 2D2FA 4J0GA 1WSDA 5EWLA 4NOMA 4ZVSA 3VSDA 3WGTA 3G6WA 4BQQA 1F7UA 2Z8YM 4K8OA 2Y0BA 2Q1XA 2VF4X 1WMEA 1NN5A 2ZW9A 2X40A 5JROA 3P7MA 3R4CA 3B12A 2FUEA 2PQ2A 5A0VA 2YHBA 1EG2A 3FOWA 4QNNA 3A4YA 3I8OA 3TBHA 4BN4A 4WXEA 2ENWA 4G4IA 5AHRA 3C5CA 4FMCF 3VOAA 2B2XA 2F17A 4KFSA 2IPMA 4HB0A 2GN4A 4QJ4A 2P4HX 4CM1A 3JAKA 3SEFA 3T41A 1XU4A 3A7DA 1DKQA 3I5AA 1EAMA 4Y2HA 3SD7A 3KV1A 1VPVA 2AW3A 5JTTA 1NF8A 2CUZA 1EE2A 2IY8A 2NZVG 4B6GA 5JCJA 5KYGA 1Z73A 1ZGCA 3MOIA 3EQ9A 5LP1A 3ZU3A 5KWSA 121PA 4MUBA 2QPOA 3FYTA 2PSDA 3RFFA 1IBLB 5ALKA 5IC6A 2C3MA 3SZ3A 2H2DA 4Y6PA 3T5BA 2XHZA 2Y6UA 2ZYVX 1JGTA 2MMCA 1P19A 1ONOA 4GEGA 3B85A 4AZSA 4LZAA 5D1HA 4TUYA 1UBTS 4C6HA 2PWPA 4JR2A 4RADA 2AFHA 2WAYA 1SVNA 1W1WA 3ADBA 3KAPA 4QPCA 3U0BA 1POWA 4G84A 4UU8A 1ZN9A 3ZE7A 1HLPA 1JIUA 1E2JA 4PWYA 5IUNC 3G13A 3H3JA 2P2GA 4S24A 3RRBA 3TR6A 3VPXA 3GRYA 4C4SA 4W8OA 4DABA 2Z3ZA 3K1JA 4QECA 3MAJA 4IXNA 3C8HA 1HG1A 4J7XA 4V1CI 4M1EA 2FP3A 1QF7A 3B70A 3IAUA 4MQFB 5K3AA 4ZTZB 3EGCA 4LV6A 3D7LA 4XB6B 2GNPA 1V7CA 4JKOA 3AF5A 5DBGA 1RQ7A 5CW1A 4B3DA 3HKDA 5DZSA 1II0A 1EFUA 4K46A 3RV4A 5LJIA 2NYAA 1JLSA 3NHUA 4O4JB 4P82A 3M4ZA 4ND4A 3P32A 5KHLB 3PPXA 3FWNA 4NU8X 1JLMA 3OQNA 1LNZA 3RVDA 3DE4X 4JJ8A 2G71A 3HO1A 1IMOA 2QJFA 1ZCAA 2HBZA 2V7XA 2AUNA 1GPBA 4TL8A 5EZ5A 1Y4SA 4TVBA 5CT6A 4OK5A 3WAKA 1RHQA 2EL9A 5EIBD 4Y2GA 5HXAA 4KYUA 2ATVA 5FKJA 2YC4C 5K20A 5JJCA 2ZYRA 3DO6A 1FRQA 4JBNA 1Z34A 4RTLA 3S81A 1EFHA 1TYEB 1BJRE 3Q9SA 2R7AA 1G41A 4GG1A 3OC6A 2CHGA 2PX3A 4EDHA 1ZOSA 5LSAA 3HB4X 3E5NA 1TFUA 4K6FA 1CDOA 2ZUWA 4WAUA 5E0OA 1LK7A 5GJCA 1EZ4A 3WGUA 4DHWA 5JUWA 3K1TA 1O97D 1CVIA 2PA0A 2VT7A 3H9QA 2R47A 5DTQA 3PHLA 3GUZA 4MYDA 5IAJA 1Z6GA 5FOSA 2AQKA 2XBMA 2QUKA 2FPPB 3EEFA 4E4TA 4Q7QA 3DQPA 5CA1B 4EBBA 3BMOB 5FDFA 1TJ4A 1IHDA 2B61A 3FSJX 5TJ9A 4YRAA 2W4IA 4ICIA 1FNDA 4MR9B 3AHIA 4EJSA 5FOWA 4MQ4A 4XW2A 4U9IS 2F2TA 3CZ5A 4A6DA 4JBYA 2PWAA 3IURA 1KO4A 1ATIA 2GK3A 3EWSA 3LVBA 4OGFA 4RH0A 4X7MA 2C42A 2XJ9A 3W5IA 4BGEA 1N5LA 4RLQA 2G82A 2BGGA 3FM9A 3OCUA 3NCTA 3N86A 4WEOA 2QNBA 5T41A 4ENSA 2Q6IA 3P19A 1E98A 2Q3BA 3C3XA 3AOEC 4RZSA 4YP9A 4H6WA 4DLTA 3LV8A 2HT1A 2DYKA 5IJ0A 4U9HS 4B4UA 5KX5F 1EJ2A 5DI9A 4RZIA 4G3XA 1PHRA 1V4BA 2FPMA 2W2KB 2O5EA 5L3SB 4X44A 3RBXA 2DEUA 1KMQA 3WGKA 1GR1A 3PEWA 1BQ4A 1B93A 3ENVA 3EXG2 4Y6RA 2ZE8A 1UP6A 5CLGA 3T1NA 4CUJA 5BSHA 2GB4A 3LBYA 1FS6A 1QQ5A 2BISA 2IW3A 2CFSA 2E49A 4JLMA 1THTA 2NZXA 2UYQA 3GFBA 4F38A 5GINE 4NDAA 4XWGA 2HU5A 3N8HA 1X1AA 2Y27A 3ISTA 3SYKA 5IWAB 2WBLC 4UULA 4WNIA 1Q14A 2XWQA 3FH0A 4YRLA 4CBVA 1VFPA 1U6IA 1UDAA 4EHHA 3MTAA 2XADA 3ELYA 3O75A 4LOLA 4MRPA 1WXWA 3AI7A 2DP4E 3I0ZA 4Z0HO 3D3JA 3VVMA 4P83A 4CKWB 4CTJA 3ZNNA 1GO2A 5A3JA 3NRCA 1HI9A 3PR3A 3AR5A 1Y63A 3T4EA 5K05A 1I5OA 4BGVA 4DV0B 1IB6A 4TUYB 3RF6A 4FN4A 3GMDA 4XM1A 2DHCA 4KR2A 1UJ4A 2QRJA 3H8SA 1K97A 4LTNA 3WHKA 4JD5A 2OZVA 2VSXA 3K0FB 4M7WA 3V6MA 3KUCA 4BNGA 4O2LA 2HNKA 5EMHA 4P3XA 3F6BX 3JQ7A 1EK0A 4DV3B 4OHVA 2ONJA 4DV7B 2WFAA 2Y1LA 5AW4A 2PFSA 2PZFA 1WB4A 1IBCA 4K9SA 2R8XA 2V03A 5TLSA 1IH8A 3MGKA 3MT7A 1KEUA 4AY5A 1JDBC 4KAXA 4RIFA 1TK9A 2D74A 2RGNA 3OECA 3OWHA 3ZHBA 4JQSA 4RELA 2ECFA 3RTEA 1XWIA 3TW4A 4K2HA 3KD2A 2QTNA 1LPSA 1K88A 4MA0A 4RY9A 5DHPA 2DT8A 4QVGA 3WWEA 4RIEA 4NYJR 4R3NA 1XAGA 3WQHA 4EO4A 5LYJA 1YC5A 2GCEA 2PGJA 1A9QA 1N2EA 1XEXB 2B83A 2OAQ1 3EWAA 4RH3A 3TIGA 1AZTA 4F04A 1FDTA 2H6EA 1M3SA 1V1RA 3FTDA 3MWLA 2UZ3A 3EQ2A 2H17A 2PGOA 4UQPA 2V7QD 3A4MA 5ENDA 4C7KA 1LSSA 2FHSA 4B79A 4HEA6 1XP8A 2O8EA 5KNDD 2O2DA 1JFFB 1W2GA 2VZ0A 3I2YX 4IHKA 5COAA 4A1OA 1RCFA 1K7SN 4K3UA 4D44A 1XRSB 4ILEA 1NU6A 5LKAA 2P4UA 4BNUA 1WPGA 3TO5A 4WNYA 2VZLA 3HSSA 3R5TA 4HNAA 3GRCA 1YIOA 2VXBA 4Q34A 1ENPA 4Q47A 3H16A 5J2TB 4FB5A 1P2GA 3T0IA 3RUHA 2C2ZA 2GF9A 2XHEA 4D82A 2JH3A 3DE0X 2DTDA 3TZBA 3U3OA 1TZBA 2YDXA 4LYYA 4OD0A 5CAEB 4CVNA 3O8LA 1L5QA 2EVWX 3IHLA 4MDFA 1DT3A 1PWYE 1CQZA 3G9QA 2C1XA 2QD1A 2IELA 2YC2C 2OCAA 2FY8A 1L0BA 4WA7A 3D4NA 4YPFA 1B0UA 3RS9A 2V6BA 3W77A 4BAUA 4A73A 3ZCQA 1E3TA 1L7DA 2G63A 2XOKD 3FLEA 1Z28A 2BLLA 4XM0A 4ZANA 4ESVA 1TD9A 4IDPA 3JATA 5AKJA 1FJ2A 1NDHA 4GPBA 3ZWOA 2I7TA 3H99A 1MA0A 5CH8A 5BXYA 2JZCA 2IBMA 5IWCA 3ND9A 1XDSA 3PDCA 5H59A 3GLIA 4YO7A 3P9KA 4KVZA 1FMJA 1JJIA 4G5QA 1IBRA 2VUHB 3SC6A 4MPPA 3C1UA 4YONB 1DG9A 2I8LA 2A3NA 2IL1A 3UY4A 3ZNQA 2MSCB 3DH0A 4GP7A 1CRPA 3Q72A 1YJ8A 4MMYB 3KUXA 1FQOA 1AS3A 1JLRA 2OA0A 5F2EA 3KNZA 4GX1A 1QRDA 2WWXA 2XUIA 4LBWA 3ZBQA 2C99A 3I6MA 4LRXA 2UDPA 2GPBA 3I73A 4JSTA 4S1NA 1VG0B 2BR5A 4HRAA 1S2IA 4KV7A 1TF2A 5G4KA 3UGTA 4N7RA 4DZTA 1N9ZA 5HCNA 3HKBA 4ENUA 1J25A 3A9CA 1D2CA 4ZMRA 1MUUA 1KAOA 3JQ8A 2IS4A 2ECOA 2ZB4A 1U8AA 1YS1X 2E1PA 4IS2A 5EESA 5TARA 3QKWA 3L84A 1U7TA 1S3FA 2B4AA 3O73A 3VYSB 5BVHB 5HR5A 1U3GA 1XXHA 4NH4A 4EBFA 3KQOA 1VJDA 3L06A 1S8FA 4MUYA 1MJFA 3GEDA 1US8B 2B0CA 4OHRA 1NKVA 1PSWA 1YL7A 4NZMA 2XTMA 2QUAA 2X0KA 3G2OA 2XA9A 3HN6A 3IH5A 1N1DA 2VKTA 1A2KC 3BCHA 1X7YA 3OEEA 3L6CA 4IP0A 3GJSA 5DTRA 4JP1A 2E4ZA 3BTVA 1ZJZA 4JAVC 1SCAA 4AF7A 2CDNA 1Q3TA 4IQGA 1TE2A 3CNBA 3E1SA 4S2UA 2GZ3A 4ZT6A 4HPXB 1DZIA 5FPQA 1DJQA 2DJIA 2ZDQA 1RVDA 3EVZA 4F86A 4ANFA 4A6XA 1E2GA 1SVUA 3TPCA 3OIDA 2D5IA 2P27A 3DR5A 2Z43A 3OT5A 4NNPA 3ZCVA 4C9BA 4YAKA 5I7RA 4W99A 2HU8A 2XUJA 3M5DA 1HSOA 1X70A 1J97A 3FOBA 1IZ7A 4O4IA 1MRNA 2C7GA 1F51E 1U1EA 4HEHA 4FWIB 3DEAA 4FMBB 1E5LA 1GVHA 1NT2A 2EYQA 3GGPA 2EDAA 5E8JA 3A04A 1J0CA 3W2TA 3OD5A 1PJZA 1Y1KE 3PDHA 4P5PA 3PQ7A 5TNXA 3KEOA 1HYBA 3H3FA 1XELA 2WZBA 1MPXA 5DP2A 2NU9A 3HR4A 1ZMOA 2QUIA 2BZ0A 2ZXEA 3SFVA 1JNYA 2Q4EA 4Z53A 4CODB 5AOAA 1CJKC 4BJ1A 1GPKA 3JVDA 5HA5A 4AKEA 4Q24A 1ZSVA 3TSOA 3HJRA 2XB6A 3AFNA 3PICA 3WR5A 2A58A 2XMZA 3OU7A 5DTMA 1V43A 1N3IA 3DHYA 3W3AA 1KSGA 5JCOC 2XCRB 3CBGA 1EK2A 4YBZA 3KP1A 5BSMA 4ZKEA 3ZNOA 1CDZA 2WJPA 3INTA 5DM4A 2J08A 4HC4A 4ME6A 1NAHA 3E27A 2E4WA 1PDWA 3NH6A 4BOYA 1NVEA 4E6EA 5FPSA 2Q5JA 2EERA 2QDXA 1NQTA 2J3HA 3EA4A 2CHQA 3ZE1B 3NP7A 1MDBA 1J9EA 4IIXA 4U6QA 5JXJA 4EI2A 3DF7A 3GGJA 4RSRA 2QUBA 4RTMA 1WJGA 4PO1A 3HP7A 2WSMA 3U80A 1FDRA 4O4JA 5DRTA 3A9TA 4LOHA 4CT5A 4WH0A 3MUFA 1O94A 3GROA 4M6WB 4Z9XA 5ARDA 3SVZA 4AS1A 1O57A 1JF8A 3DWFA 1RZRA 3AHFA 2PPLA 1TM1E 3D8BA 4IFBA 3ANLA 5MFPA 2CHEA 2WIBA 4MROA 1DDOA 4JP5A 4J07A 5T3UA 3S2ZA 3TCXB 1JFTA 2IXTA 3ANXA 4B4VA 1CXZA 2A7QA 3VO9A 4DNXA 1DRUA 1TLFA 3Q2IA 4QU8A 5F5NA 4Z5XA 3BGSA 4BQPA 2WZCA 3KLBA 4Q3AA 1VE1A 4BFTA 2Y67A 4IVNA 1Z39A 1J2TA 5L95A 5AI8A 2PGNA 4PZDA 2Z5VA 3M4JA 1UPXA 2IZ5A 1P5JA 4JJAA 4TSKA 6ABPA 4WFIA 2CJWB 4B31A 4HQ0A 1D9XA 2YZ2A 1JKFA 1XDWA 5T4FA 2G0TA 3OT4A 5JFTA 2XIJA 3PA8A 3MT0A 5AVJA 5CGZA 1KYVA 3PDIA 1DFIA 2XKAA 3MWJA 1RMTA 3MUOA 4QREA 5B3AA 4BCDA 5I6DA 2Q45A 1Z4PX 1MOZA 2HQ1A 1N77A 4WEQA 1H3FA 2P5SA 2D54A 3N5CA 3VX4A 1ECCA 1C4OA 2EX1A 5KSOA 3K4QA 2D0OB 3KBOA 3HO8A 3GAMA 4QOJA 1FIUA 1RAFA 2G5TA 4H6VA 3THXA 3G3EA 2OZEA 4G0XA 3EJ6A 4OBWA 5D6OA 4TN1A 1DADA 2R1UA 3OLCX 2FF5A 1W36B 1SCUB 2HTFA 2FCRA 3ZBPA 1JNXX 2AQIA 3WISA 5CDTA 1LH0A 2GJ4A 5JNWA 5EERA 2NT4A 3K8ZA 1N5OX 1OKKD 2PSHA 3JAKB 2Q5QA 1A95A 2AMVA 1JYFA 2W8ZA 3K9BA 4DV5B 3I12A 1XCGB 4LHXA 4HB4A 3TQFA 1DIHA 4XGRA 2PRJA 1NUQA 1M73E 2MR5A 2IUFA 2N9UA 4G0QA 5B58T 4R68A 2GYVA 2BR4A 2E89A 2IYNA 2PX8A 2Y1EA 4QXQA 4JFAA 1UJ5A 1D7OA 3HDTA 4QNMA 4LJ9A 4W8GA 1VBMA 2GZMA 4HHEA 5ER6A 3LT0A 1WA5A 1Z5PA 4HLCA 4YP0A 3V42A 1TEVA 1Q17A 4M89A 4CKYA 1BVUA 1VLQA 4FK8A 1SNYA 4B47A 1G21A 3H4VA 1QIFA 2IXEA 3FKJA 4U7GA 3RSQA 4MYHA 4KX5A 5I7VA 4CDGA 3VO1A 3HO6A 1U11A 2HA0A 3MTGA 2JLYA 1AC5A 3BUSA 5JQGA 4CMIA 2HJ9A 2NG1A 3FR7A 3IQXA 4DMLA 1MTOA 2W2MA 2FPKA 4KE7A 2GTPA 5FNZA 1FFSA 1H2EA 3MMNA 4KAFA 1NRWA 1AQUA 3IT1A 4M0KA 2ZIZA 5BOSA 2XH8A 2ZRLA 3S2FA 1PK7A 2QVGA 3EPRA 3PDUA 2HXGA 3L7IA 3DQQA 2H4HA 2ZJ2A 3QKSB 4M1KA 2O20A 1GTVA 3OPMA 2Z9BA 2YXLA 2QX6A 4PZUA 2C4UA 5JAQA 1IWPB 1RRKA 3NTQA 1GVNB 4C87A 3WI7A 3CVOA 1WMFA 2QYHA 3NLLA 3W3ZB 5CEEA 1ILWA 1GRCA 1QIJA 3U49A 2FQYA 1UINA 2GR9A 3IUQA 3I4LA 5C5EA 3QUBA 2ENUA 4FFBB 1DOHA 4D02A 3LCCA 2O3TA 2YV4A 3BOSA 4FGSA 4FLFA 4H7JA 2B2CA 5LMUB 3UAVA 3ZHRA 2Z2ZA 2BEVA 4PXSA 3VMFA 5DK4A 2PUVA 3U6KA 2FQXA 5C0OE 4XIGS 3GJ0A 2CLSA 2GH1A 3C1TA 4X95A 3STXA 2PIAA 1HYQA 3I2JA 1WU8A 3LO5A 4FGKA 4EF6A 4R1UA 1GG9A 1VHLA 3RIGA 4JYBA 3ECCA 4H1TA 4IJ5A 5JAZA 1KXJA 2ADMA 4C03A 1G21B 1WXDA 1T9BA 4EB3A 3VJRA 5I7SA 4QU9A 2Z4TA 3D59A 3MELA 3VU8A 2O7VA 2AJDA 3ZJVA 4BO8A 3D4PA 3EFBA 4JL8A 4E03A 1VBFA 3AF3A 4I1SA 1WF6A 4LFAB 1JPJA 2A86A 4I14A 4KXLA 1EQUA 2Z1DA 2QW1A 3PUJA 1NQVA 4ND7A 5IM5A 1FDVA