1EXVA

Human liver glycogen phosphorylase a complexed with glcnac and cp-403,700
Total Genus 320
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
320
sequence length
808
structure length
786
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKAFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
total genus 320
structure length 786
sequence length 808
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA01
4N3BA 3ZCSA 3VUEA 1P29A 2O6LA 4GZ5A 3T3EA 4CTMA 1P4JA 3OKPA 4GYYA 4YI3A 1GPBA 1SXPA 1QKJA 4RIFA 1VGVA 1JIUA 1NVKA 1QM5A 8GPBA 3D1JA 1WUYA 3ZCTA 3CEJA 1SXQA 4MI6A 1UQTA 1UQUA 2F3SA 1FTWA 2H1FA 4MICA 3DDSA 2FFRA 2VSNA 3L7AA 3CUYA 3QHPA 1XOIA 2QLLA 2VG8A 2XCIA 3QKWA 2QRHA 3C48A 2WTXA 3H4TA 2R60A 2FF5A 4GYWA 2QLNA 1IXYA 1FS4A 2IYAA 2QRQA 1E1YA 1GGNA 2C9ZA 3MRVA 5BNWA 2X0FA 4KQMA 2XGSA 1WUTA 1K06A 1L5WA 4L22A 1L6IA 3G2JA 4GPBA 3MT7A 1Y6GA 3HBMA 2ZB2A 3OKAA 1L5QA 1FTQA 3E3LA 3OTHA 2ACVA 2GEJA 3MRTA 4N9WA 5JTUA 1P4GA 2BGTA 3VDNB 1XV5A 3MTDA 4RIGA 1GPAA 3VUFA 2PQ6A 3OY7A 3CUWA 3DD1A 1JG7A 1LWOA 3MS7A 4M83A 2PRJA 1Z8DA 1HLFA 2VCHA 2PRIA 2R66A 2JLBA 4MHSA 4AY5A 4WADA 4M7PA 4LEIA 2QN2A 2QN1A 9GPBA 4X7RA 3E3OA 2AZDA 2QN7A 3HBJA 2F3QA 2SKDA 2BFWA 3WADA 2IEIA 3O3CA 1L7XA 5TMBA 3MQFA 3IAAA 3L7CA 1ABBA 2G9UA 1LWNA 3CV3A 1C50A 1RRVA 1P2BA 1F6DA 2PYDA 1KTIA 3TSAA 2YJNA 2SKCA 1NOKA 3T3IA 1A8IA 2XMPA 3Q3EA 3DZCA 1JIVA 1O6CA 3BCRA 3UYKA 3SYMA 3H4IA 4AMGA 4X7MA 4QLBA 1NZFA 3G2KA 3G2IA 3MRXA 4BFCA 5TMDA 4X7PA 4YUAA 5DLDA 2IV7A 4HLNA 2Q6VA 1YA6A 4WACA 1WW2A 3BD7A 2ACWA 2QN3A 1B4DA 1NZDA 1V4VA 3Q3HA 3NCHA 1GZ5A 2ATIA 4W6QA 4EL5A 2C4MA 2R4TA 2QN8A 3Q3IA 4BQFA 3T5TA 2F3UA 1WV1A 3MTAA 4AN4A 4XIFA 2G9VA 3HBFA 2X0EA 4CDRA 3ZCRA 4CTNA 2KS6A 4PQGA 3UYLA 3CEMA 3NP9A 1RZVA 3T3GA 3RT1A 1JIXA 2XA9A 1FU7A 1XL0A 3OY2A 3FROA 2QNBA 4FKZA 3NP7A 3RSCA 2VSYA 4RIEA 1PSWA 3G2HA 2BISA 1EXVA 3OKCA 3PE4A 3AMVA 4GZ6A 1L5RA 4FZRA 1E4OA 3MBOA 1Z6QA 1JEJA 2R68A 3NPAA 4N3AA 2H1HA 3ZCUA 2GM9A 2AW3A 1GFZA 1H5UA 3DDWA 5JTTA 2P6PA 3HBNA 2HY7A 4WHMA 2QZSA 4EKEA 4EL0A 1IIRA 2JJMA 2F3PA 1M5RA 3MT8A 4BQIA 4EJ2A 2IUYA 3D0RA 3NAZA 1XL1A 2G9QA 1Z6PA 3L79A 3SYRA 2AV6A 4MHOA 3L7DA 2R4UA 1RZUA 4M60A 2XCUA 1UZUA 4AMBA 2GEKA 2OFFA 2QN9A 3S28A 1AHPA 4Z5XA 1L5VA 3BEOA 3S0JA 2BGUA 3COPA 5GPBA 5LQDA 3CEHA 1P2GA 2X0DA 3TOVA 2IYFA 3CX4A 1AXRA 2XGOA 2G9RA 5D00A 2XA1A 2IEGA 1Y8ZA 2ECPA 4REMA 3VDMA 1PN3A 3MTBA 3MS4A 6GPBA 4NESA 1K08A 1JG6A 1L5SA 5TMEA 1FTYA 3RSZA 3IA7A 3RHZA 1F0KA 4CTOA 3NC4A 4RELA 3GUHA 3WAGA 4KQ2A 3TAXA 4X6LA 4RIHA 4GZ3A 3G2LA 3BCUA 4RBNA 2IV3A 1Z62A 4EKYA 4HWGA 1Y6FA 3NB0A 2X6QA 5C1DA 3CUUA 3BDAA 5I45A 1FU8A 2ASVA 4G2TA 4AY6A 3OT5A 2QRGA 2FETA 1C3JA 3OTGA 3S27A 5HXAA 3EBPA 2GPNA 1YGPA 1WW3A 3S29A 3T7DA 4NC9A 1PYGA 2C1ZA 2QRPA 3MSCA 1XC7A 3L01A 2GT1A 1BX3A 2X6RA 2AMVA 4F97A 3CUTA 4LDPA 1C8LA 2GPAA 7GPBA 3S2UA 3T3DA 4NEQA 3BD8A 3C4QA 3WC4A 1EM6A 1GPYA 2QRMA 1P4HA 5DU2A 4RENA 3D0QA 2C1XA 2GPBA 4F9FA 1FU4A 2F9FA 3E3NA 3L7BA 5TVGA 1NOJA 4N39A 2VCEA 4XI9A 3OTIA 1C8KA 1NOIA 2XA2A 3BCSA 2SKEA 3EBOA 5D01A 4MI9A 3C4VA 1WV0A 1J39A 4KQ1A 1NLMA 1P2DA 5DXFA 4MI3A 3MT9A 3ZCQA 5IKPA 3MS2A 3CUVA 4RIIA 3T3HA 3BD6A 1FA9A 4F96A 4N3CA 4MRAA 5IKOA 5ENZA 1GG8A 2QLMA 3GPBA 4BQEA 2JZCA 3PE3A 2XGMA 3ZCPA 1FC0A 3G2NA 2IW1A 3ZCVA 1PNVA 4YI5A 2PYIA 1XKXA 2GJ4A
chains in the Genus database with same CATH superfamily
4I36A 3UB4A 5IMBA 1KYXA 1ZPDA 5CIQA 2IYUA 2GPWA 2QUKA 1V16B 1Y7PA 4BLOA 3C2QA 4FC6A 1LLFA 4GI3A 1DLIA 4D4IA 3NKVA 4UHFA 2GXUA 3RFUA 1K6XA 4YTEA 3ZKWB 1NJ2A 2CLKB 3HXKA 4EECA 1KXJA 4BO2A 4UNRA 2KYRA 2OHFA 5EL0A 4H18A 3R3XA 3BD9A 4JJGA 4XPZA 2ZUCA 3IKLA 3PPWA 5KPJA 1P5JA 4OREX 1PV2A 1R0WA 4L51A 4MWBA 1FJGB 1HM5A 3TFOA 3T1TA 3HADA 2IUUA 4JBGA 3UIEA 3BULA 3R3UA 3I2GA 3WIUA 1SXQA 4PAWA 1XNGA 4RL4A 4RV9A 1NXXA 1UQUA 3ABZA 4P7GA 4TQAA 4YO8A 4HAYA 4UC0A 4V0OA 3X43A 3NXKA 2PKQO 1SIUA 3DL4A 4BO7A 5K8UA 1GQRA 3UO8B 3DDSA 3NTLA 1U1DA 4RF2A 5JAMA 3HCBA 3OE7D 2C5HA 4W1PA 4ZODA 1NX6A 3DKIA 3W5VA 5KOYA 4LFBB 1NW9B 4X1YA 1IQUA 5BSUA 5DCLA 3F47A 1X80B 1O94A 4H17A 3ROEA 2QVCA 2HWXA 1PWEA 1JXAA 2XDQB 4GNKA 4N8EA 4Q3EA 4WKCA 2XZOA 5KSOA 4U7TB 2LE0A 2EJUA 1I7SB 3R9XA 3LUPA 4IOLA 1CR4A 1CUHA 1Q1BA 3G0IA 2DY0A 2H6EA 1Y6JA 3M5DA 2HF7A 3RFTA 1H8HD 4Q12A 1XRPA 2ZWOA 4Z53A 2QTBA 2AOUA 3P9XA 1M1NB 1J22A 1NKSA 2IYAA 2QRQA 1MJ5A 3OQVA 3W8EA 3MRVA 3KQKA 5BNWA 3GK3A 2C57A 1HQDA 2AUTA 3F5SA 4PZPA 4IDEA 4OXKA 3AHJA 1C29B 1FDSA 1U9ZA 2YMLA 4RK0A 2YY5A 4AUKA 3WLOA 3WWYA 1X8KA 3O4JA 5FHQA 1KPGA 4BNLA 3T99A 4XKJA 1KI9A 1N2CB 1RWQA 1Y4AE 2J0UA 4IIBA 4NCIA 3D2AA 3UHAA 1X7YB 2IHBA 4F06A 4ALLA 5L6MB 1DX4A 4G23A 4MCAA 1J8VA 2AKAB 3OOHA 4WXMA 3ZDEA 5HZGA 1WETA 5FBWB 2QD4A 4J1NA 1J07A 5FA8A 4D45A 1UJBA 1WHSB 4QATA 2JFNA 2AOTA 1BU8A 3Q4GA 4X44A 4EJMA 1OC2A 4NBRA 5J2TF 3V1TC 1R5JA 2FUKA 3ZW9A 2PZMA 3RGGA 3TTYA 5LZ2A 3K0CC 1L5MA 1D2EA 2N9UA 1KI1A 3CLKA 4N9QA 1II8B 1KVTA 1UDAA 3FA2A 2MCFA 7YASA 1L7QA 2JGDA 5JYBA 1SY7A 1GUBA 1OB5A 2C00A 3QE2A 1QH8B 3BL5A 1J1ZA 3KQLA 3LK7A 1MX5A 1B23P 3QY9A 1ZWLA 5JWHA 3W5JA 5K3BA 2I2AA 2I3BA 3U4CA 4ARVA 4KJXA 1UIRA 1SVOA 3O26A 2VZ0A 2JA1A 2X1HA 4UEJA 4NBNA 4DCUA 4C43A 4C0WA 3DT6A 2HMSA 4BVAA 4NE7A 4XVHA 4QBHA 1G8AA 4KYVA 1UEJA 2PRYA 1R8SA 1WAMA 1XCBA 1YACA 5I9MA 3WRVA 4A8JC 1QFJA 5E1DA 1G20B 4NENA 3HXTA 3GNSA 1PQWA 2HJSA 2MYUA 3I8XA 5A5EA 3BQNB 2XKAA 2E85A 1XMIA 3MT0A 1N0IA 3P9NA 4LJYA 2J3QA 2XCRB 2N42A 4B5KA 1AKTA 1CR2A 2EC5A 2DFPA 3VR6D 1LPAB 5CX1B 4EUNA 4TPKA 4RKFA 2PFKA 3NAMA 1QS0B 5J2TB 2C5GA 3GUYA 1BD3A 2YW2A 4GT1A 1VE3A 3FAKA 2ISSD 1GG5A 5KJCA 3MA0A 4PSVA 3ULKA 1I7DA 1YIAA 1H2EA 1ZUWA 2IEIA 4N0QA 2WJYA 5K6AC 1RJEA 4Q4HA 4CLOA 1QMPA 3VSBA 3ZHOA 2C61A 1M6HA 3ZIAA 5CA1B 3PR1A 1PFUA 1IOWA 1P45A 1Z0KA 1LSUA 3D02A 1F14A 3OU6A 4HF7A 3ZI0A 1QMGA 4PPQA 5HILA 4ND2A 3RGWS 4FCVA 4KO3S 2QLJA 1AZWA 4BGEA 2Y1GA 2PYDA 1FP2A 3X1JA 1VECA 3PWTA 4YR7A 4Z4HA 2VSQA 3GLGE 2ZIEA 4CKCA 2P3SA 3ETHA 3B2EA 4WFQA 3W2HA 4E6EA 3I3SR 3JWIA 1WZIA 3B1KA 5JJCA 1WXGA 2NYUA 3FMOB 3N6XA 4KN6A 4LV5B 3WWZA 3Q3EA 1QIHA 3VTAA 5JNUA 1OMOA 4FCTA 2HJGA 4NAUA 3ZUGA 3ZD8A 1M72A 3C3MA 4DNFA 1V7ZA 1CP3A 3VNUA 1YRHA 2WG2A 2XODA 2BEKA 3GJRA 3ZXXA 2C5SA 4M1SA 1QB7A 1UK7A 1KO4A 2YBEA 4V03A 3C1TA 4CE6A 4QLBA 1ZGBA 5L45A 2AX3A 3JD4A 2WILA 3KWJA 4MJ3A 1HSOA 3R3VA 1NNSA 1FCJA 2IELA 4E51A 1UBCA 3PXBA 1VSQA 1JI3A 1PKXA 2BJWA 2VHWA 1D03A 4H77A 3V2UA 2NVUA 3JZMA 1FFCA 4NNOA 2I3AA 1QQBA 1CNEA 1DMSA 1WCIB 3BWYA 3DE1X 4L2IA 4X97A 4HUQA 2HLHA 2A2ZA 1DE0A 1QFZA 3I6ZA 3PHIA 4P4SA 4XDYA 4D9NA 4XGNA 1USWA 2XMRA 3Q9LA 1XG5A 2ZBGA 3WY9A 1GSIA 2QUZA 4URVR 5CLQA 4J1SA 5CCDA 2GZ1A 2H51A 2ZSIA 2XB2A 2F6RA 2NP7A 4N40A 3ZU5A 4F60A 4W6QA 3HYRA 4A5SA 4Q4AA 2C4MA 3G1WA 3I39X 4MARA 5T41A 1I2ZA 3RD5A 4I1PA 3PITA 3EEQA 4A9AA 4BECA 3PSAA 4GWGA 4H7EA 5ARDA 3CF4G 4EMUA 1TZMA 4ETMA 4GLFA 4WASA 4ZIRB 5FOXA 3TOXA 2X19A 2YX1A 2D5AA 2NPOA 2XWJI 4PGAA 4RF4A 3AUYA 3U0BA 5GWXA 3RUIA 3M3HA 4K2HA 3UYLA 1U1FA 5KVCA 3Q0IA 2O8DB 1PWHA 4ZALA 2RC5A 2A58A 1MJFA 2YRFA 2C8JA 1U8TA 2V8OA 4DEVA 2DBZA 3HP7A 4IJVA 3RQSA 1DAEA 4PCAA 4BX8A 1CZKA 1DKUA 3VR4H 4OL9A 5ES4B 2J07A 4JBWA 1DKLA 1FJXA 1A04A 2EBHX 1QK3A 4E5SA 1YASA 3G3EA 5EJ8A 1QX3A 4QNNA 3IUEA 4ZXFA 1ORHA 1ONBA 3K96A 2I34A 1I6WA 2HNKA 1KZ1A 1L1RA 2H2HA 1PDVA 1X3SA 4K9MA 3PE4A 3TKYA 4C78A 1L5RA 4KXMA 2C94A 5CNMA 2AMLA 1P0IA 2R79A 1VHWA 3DE3X 3ZU2A 4WN3A 4B0OA 4UFPA 1GM5A 2Z6UA 4LSGA 3B53X 2PVPA 3EH1A 2IS4A 2QBYA 1BMFA 1ETUA 2G1UA 2ZU6A 1OWOA 2ONKA 1F17A 2GLTA 2W2LA 2ZRJA 3AYZB 3DV2A 3TSZA 1HRDA 3IT3A 1KDOA 4RUKA 3K73O 2NG1A 3ACCA 3Q2KA 2QY6A 4IDBA 2EWWA 1Y7HA 2HKIA 1I5RA 1K98A 4JU9A 2BFBA 4K9OA 5EGNA 1M8FA 2NZXA 3RK0A 5EXDA 2DEUA 3NAQA 1FTNA 1PP4A 2JD1A 3BHIA 5D3MB 1G16A 1BEZA 1WF3A 3GLFA 3IP7A 5ICEA 4B7XA 1V5GA 3TZKA 5SZJA 3OOYA 4BAUA 1UKBA 3DLBA 1FX0B 4EJ2A 2IUYA 1CY0A 1GZHB 3AH8A 3WKBA 2IBTA 5H9VA 5BN3B 4MMYB 1B3BA 3VYSB 4C0HA 4POOA 5JWRA 1RXEA 2DU8A 1ZNQO 3DF9A 5M5BA 4GZLA 3WWEA 2ZAMA 1F4LA 4MRRA 3ENNA 1RPNA 2BEJA 4ZOLF 4GOKA 2LGJA 4D6YA 2PUHA 2C2HA 2X3FA 4EHBA 5BSKA 4X1KA 1A9XB 1I4WA 4S2EA 4JC8A 4M1QA 2V6FA 2JAHA 3GFOA 1FZTA 3RAPR 3R7DA 4H1WA 4O1MA 4UU8A 4WLNA 1QZZA 4ZV7A 5KNBA 5BV2P 4AFNA 3D8NA 3PNYA 3TOVA 1CVLA 4RZ3A 4OLBA 2PE5A 4GEGA 2JGEA 2WPDA 5TJ9A 5AIAA 4BVJA 3IESA 4KYUA 4MHTA 1B8NA 1U0NA 3G02A 5D00A 5FOQA 3H1BA 1SUPA 2NOAA 4QRHA 2B6HA 5FUBA 1H6DA 4QECA 4BO1A 3HCAA 2I6QA 1O94D 4BDSA 3LDFA 4XTRA 3RS5A 5BWNA 1N8NA 2O7RA 1DRUA 1V1MB 2B5WA 1ULSA 4N65A 4YRZA 2ZYGA 4K6MA 1WCXA 3SJAA 5JADA 2E5LB 4D9KA 4FDAA 1CS0B 3BMCB 3RHSA 1LBIA 3DMTC 4A6XA 4BNJA 4BMNA 1T36B 1Y48E 2CHEA 1Z18A 4LV6A 4OJYA 5DYWA 1F0KA 3QKUA 3DMFA 5IVPA 1H0HA 1EX9A 1ODSA 3TMYA 3LPLA 1AN9A 5J4KA 5CFLA 1SVLA 7MDHA 4ZT2A 1W36C 4ZI3A 4JL5A 2PX0A 3HHEA 3JAKA 3N6RA 4HRVA 5CP8A 5ER6A 4BTVA 5KIAA 4LC0A 1I3CA 2GD2A 2WIAA 3PSHA 4KXXA 3TVTA 3LNTA 2CNDA 4YYZA 4GKBA 2J9FB 2FFJA 1M0EA 4D4GA 2ZXFA 1DIGA 1CUWA 4F21A 5K8LA 2O8EA 3G7UA 5HR5A 4UM5A 1DKPA 1TMKA 1OZ0A 4X90A 5FUQA 3ZJ4A 2I4MA 3EOBI 3GCWA 3ZWQA 1W4RA 1WSWA 4FBMA 4ISBA 2QTNA 3NHFA 4I1YA 4K9QA 3KQOA 3SHVA 3PCXA 3I5YA 4PHGA 1CUSA 5L3VA 3A3KA 2VP3A 5COBA 2FFBA 4TWRA 5LJIA 1PFGA 5C8ZA 1CQWA 4EA7A 5BNTA 5KOHA 2ZQZA 1W8IA 1KL7A 3WLAA 1N5JA 2AVNA 4ARBA 5EHZA 2X4GA 3EVDA 3TIFA 3HEMA 5KTMA 4E30A 1ORVA 3CZAA 5EE5B 2PZBA 3QI7A 4BFUA 4F9TA 1J0EA 1DIHA 1K89A 2IF2A 3A1SA 4JKYA 5KVAA 5THKA 3IHWA 2NZ2A 3FZGA 4Q3CA 1DFGA 1PRYA 3U13A 2K87A 1YGPA 1NBHA 1VE7A 4G5XA 3KKPA 3ZE9A 4RTNA 1DTWB 1Q0PA 2HLDD 3W8FA 3JD0A 2W6NA 2F1IA 4QUDA 4CCYA 2PJDA 3ELWA 3IQGX 3PF9A 4OXYA 4BRZA 1JS1X 2A86A 1N4DA 2FDRA 5B55A 4Z6KA 3ABIA 4TMXA 3DXXA 4YMWA 3TLZA 1ULAA 3OPVA 1NURA 4FJ0A 5J5AA 1IY1A 3PUKA 2C3UA 4H7PA 1RI4A 2OAEA 2FWPA 2JHFA 3E15A 1J2UA 3DVAA 3R7WB 4EY7A 3QU4A 3IB3A 5TT1A 1RCUA 3UMBA 5JFGA 4BWGA 2I54A 2ADOA 2QRVA 4DJ5X 2AJTA 2MINB 3LTNC 3IVMA 4L07A 3K4QA 4WXRA 3MPUA 3KEMA 1CB7A 1HE5A 5T4BA 4EHAA 4M21A 3T5CA 4YRCA 2X8BA 3N28A 1CDOA 5C0OE 5LKAA 1W48A 2DH5A 2BKUA 4BV3A 3OZIA 4AJ2A 3HDYA 2XX3A 1OTXA 3I1JA 1OYVA 5IYZF 1DAKA 1P4HA 1XZNA 2Z9DA 3UMFA 3VR2D 4OQ4A 4B6JA 4EO7A 3UWKA 4AS2A 1XELA 3VOBA 2VRCD 4JAVC 1XSEA 3B6JA 3HJUA 3L8GA 2XOXA 3O8DA 3JZAA 2XF2A 3QTTA 4X1IB 5F5XA 3TQOA 4C5CA 1NRJB 2QRZA 3LWNA 1CY8A 1JHRA 5E3HA 3REQB 3GAZA 5J4YA 3VA7A 1YVDA 1CZOA 1AQLA 2VCEA 2V97A 3LQYA 3B9QA 4YRFA 2YICA 1KI6A 1TNDA 5FIUA 1Y9AA 1C8KA 2B6NA 1BCSB 3N2KA 4RM3A 4TZ0A 3K6SA 3T3PB 1DTWA 1F20A 2R00A 3RWMB 3UK1A 1ESEA 5AOBA 2HDHA 3FNFA 1IY2A 3KP1A 4OBWA 1CE8B 4Q37A 1G5QA 3UC5A 4B17A 2FGJA 1V45E 2AXEA 5FTNA 2P1ZA 3SX0A 1Y80A 2EG9A 1CUGA 1HKUA 1EU1A 1P1HA 2R2GA 1US8B 3KU4A 1V7QA 4GM4A 4JVOA 3IDAA 2A88A 4WCFA 3AEZA 5HCNA 3FPLA 5ILQA 1E5DA 5KJ6A 1V35A 4ZJZA 5HKKA 2I1QA 2ZT6A 3HVIA 3COYA 3BFJA 4O2BF 1P31A 3U3RA 3U48A 3W3ZB 3SEFA 4A8PA 4PY2A 1MC8A 1J4AA 3S8YA 2ID8A 4WY2A 3HJFA 1VZ2A 4ZC8A 1TB4A 5EUMA 3PR2B 1YVEI 4F0JA 1TGYA 2CL7X 3NIDB 3OZAA 2PANA 2C2YA 4J29A 4MV4A 1QTIA 3ZDZB 1CFZA 4I5EA 1LBQA 4QFMA 1Q7TA 4B83A 2Q1WA 1EM8B 3AV0B 2BPOA 2XBUA 2PQMA 1ZD3A 3FNQA 3LKVA 3NEYA 4HTFA 4J8PA 3DDHA 3IAXA 2CJWB 2CMGA 3PGLA 3PGVA 4RSHA 3C97A 4O25A 2KQUA 5REQB 4N76A 3NHBA 1A8PA 1KAHA 1XD2A 2XUQA 5EWJA 3RPEA 3CPJB 4FGLA 5EIXA 2CNWA 4MUBA 2FR8A 1C2TA 2PYIA 2AOWA 1KOGA 1PW7A 4FMCB 2XXJA 4OGWA 1J9GA 1EK6A 3OPXA 2PH3A 3R7BA 5H4GA 4F3TA 1GNQA 1UDWA 2LPMA 2PKYX 4TV9A 2W2KB 3KC2A 3WISA 1T4CA 1LZKA 4GZ5A 2FR8C 3N1UA 3E03A 2EQBA 2WKQA 4RL6A 1M34B 3T9AA 3WTCA 3QEBZ 2DSNA 1MC1A 4C2AA 3GJXC 3WK7A 3LUKA 1E7SA 4RZHA 1CRZA 3ADBA 1JKJA 1UBMS 1XTSA 4RPGA 3SXUA 4RIFA 4BNTA 1EFHA 1E3IA 1O54A 3FNIA 1HDYA 3GW8A 4GMGA 4Z2YA 3FHLA 3JRNA 1CRLA 2REQA 2VPPA 1XMSA 1FOEB 1IY0A 4LWQA 3WKEA 5FCDA 3IJPA 5K2MA 4EK9A 3RCBA 1YF3A 4FTWA 1UBRS 2X2PA 4CN8A 2PT5A 4JR2A 1GDDA 4MI6A 1VIVA 4G85A 1MH9A 2HEGA 3D3KA 3THOA 3ZHXA 1VFNA 1YR1A 3IGFA 4AUEA 1FBTA 3FMPB 4BFYA 1SXJC 4GMFA 1GPDG 2J3KA 2C7RA 2RSLA 4JEHA 5DTMA 1RXYA 1N2JA 4HWOA 2VJCA 3PGKA 2VSNA 4NRDA 4ZCRA 6CHYA 2JFHA 1ZI6A 2G72A 1RQPA 1GL6A 1MEJA 1YZGA 2AKYA 1DJQA 4QQ8A 2OPHA 2O8FA 1DCFA 3EXIB 3OZSA 1K86A 3FVTA 2O2XA 2J0VA 3OUTA 1ZNXA 4EA8A 1KPIA 3KAKA 3BERA 1RKUA 4UHJA 1TZJA 3RUHA 2WTXA 3V7WA 3ANYB 3TCKA 4TYNA 3SVLA 3AM4A 2YXNA 3LL4A 1SHJA 3SU8A 3UG6A 2FQ1A 2GCEA 1L5NA 3ZTTA 1H2AS 3OUUA 5A4AA 1MF7A 4NCKA 5HK8A 3K9HA 4DV2B 3K0HA 3GVHA 5YASA 1NULA 4HP8A 5AKZA 4S1NA 4RKQA 4J0IA 2AQHA 3TTXA 1GXSB 1JR2A 3ED5A 3P45A 4KR0A 1N1GA 4OOEA 4YMSA 3TXYA 1KVQA 3NRCA 4ND4A 4OGLA 5TIIA 4MO2A 2DPXA 2W00A 2YRWA 1VYVA 4FFWA 4ZT3A 1C1DB 1NM5A 1XNHA 2E6KA 1L5WA 2JFYA 2VK4A 1ZW1A 3AFHA 1AQ6A 4RWEA 3SYKA 5LD2B 1L7VC 3CINA 5FWDA 3H5RA 4J7XA 3KEQA 2NSDA 1OI7A 1MX1A 3WQHA 2AN3A 3UXHA 2FHSA 1SUFA 2OO7A 1NVVR 1X1BA 3WP0A 2J9GA 1MAHA 4YCAA 5GJBA 3ZIAD 1ICIA 1O94C 3L84A 1JIJA 3I01M 1SWVA 1P91A 3RYCB 1QGED 1H3NA 1UOPA 5H7XA 5JALA 1KAEA 2O1EA 1UC8A 2WYHA 3ET5A 1YI1A 4NS4A 5IAEA 4C05A 2WAYA 2QTGA 4C6RA 5C4MA 2IE0A 2H1IA 3FSRA 4ZOAA 1A71A 3IQEA 3BXOA 1HQYE 5F76A 1W0KA 3JYQA 3OLXA 2HA6A 2FZLA 3ML1A 1XROA 4UPDA 2NN3C 1FDOA 3DD1A 3FJ1A 1JG7A 1R6AA 4PGGA 4U2EA 1MU0A 5CG1A 1KOFA 2POQX 2X15A 1R4NB 1NW3A 1TZCA 2JK1A 3QNUA 4G3XA 1Y82A 1V11A 4F8EA 4U8HA 1CXZA 4GBED 1ZBQA 5EKTA 1SHTX 4KBYA 3TRIA 5FDFA 5GONA 5LKRA 2C4KA 1QRTA 4IVQA 1FMJA 1UBKS 1FW8A 1UM9A 1ILWA 3DTYA 3OTOB 1IZ0A 3MWYW 2XYPA 4GX5A 4JBIA 5TQVA 4R2LA 4FNAA 2CK3D 4OQEA 1GLVA 2MSDB 4P3YA 4F2HA 5F9FA 8ATCA 5KSZA 1JB9A 1BE6A 2B78A 2UYQA 3REQA 2Z56A 5K8TA 4ZVVA 1C3LA 1FLDA 3T1YB 3PXUA 3VR4D 4BCDA 1PVDA 1I0ZA 2PM8A 4IH4A 1BU5A 2P4HX 3FFBA 2P91A 3H2YA 1ZQ9A 1VG1A 2BFWA 2ILTA 1VCHA 2AMJA 4CLHA 1B2RA 2YTZA 3B1ZA 1FMTA 4P82A 4HDMB 3KOOA 4QPPA 4RACA 3UG7A 4AP9A 1J8FA 4QQNA 3THXB 5IK2A 2WB4A 1O9HA 1SC4A 5M2QA 2IZ7A 2PZGA 1QLJA 2G9UA 4A0HA 2XVMA 4D74A 4YCBA 4EIWA 2J4CA 4I0WB 3PTAA 4YJFA 3CZCA 1HXHA 4FFNA 3ZVLA 1HOXA 2VAMA 2O8CB 4E2YA 3D59A 4PPGA 2KSQA 5JSUA 1U9YA 1ZVVA 3WJ2A 3GRPA 2I9KA 1A8IA 1WZNA 2CJYA 4X92A 3ICCA 2P9ZA 2VTDA 3P4UA 2PKQP 5AXAA 4GZMA 4EYKA 4CLRA 1BXRA 1ZH8A 4OHVA 1YRBA 1WMBA 2RIRA 2XUAA 3FNGA 2A9PA 3O94A 4PX3A 4LUCA 5EKUA 3T54A 5FOSA 4BYMA 3PENA 1L4NA 4EG7A 2M6LA 1F6BA 3GOHA 3CA8A 4ASUD 2R6ZA 3PQEA 3ZDXB 4DB4A 4MUFA 3RIHA 1EK1A 3GLGA 3WLFA 3I45A 3TK1A 4KPUA 1N2BA 2PJRA 4GIBA 4JNCA 1FDVA 1BE0A 3AIOA 4ZOCA 4GUAA 1AT1A 1N9GB 2RH5A 3LQ4A 1JKXA 1XFAA 1HTWA 4WXEA 3L1HA 5C9ZA 4GOOD 2FKAA 3WIDA 1E18A 3I5UA 5KQSA 1C7ZA 1KAQA 1KR5A 2H7CA 4JLKA 1NV8A 4PR0A 4YO7A 1QIKA 1LI4A 4IZOA 2XCQA 2FTKE 1WW2A 3TMKA 3TZCA 1U9IC 3MJSA 1CVIA 3C43A 1BWSA 4LJAA 1TCAA 3AUUA 3DLCA 3H5IA 4W7HA 3DBLA 4RGYA 5ALLA 5BWBA 2EQAA 1Z4LA 3QU7A 4WA8A 3O4IA 5EXSA 5CDUA 5CDTA 3V7NA 1WE2A 4DEXA 1Q3TA 1JIKA 1XYYA 4QVGA 1WP9A 2GK7A 1P7VA 3ONFA 3KZNA 3QQPA 3CUEF 5EWMA 2Y0EA 4ZPXA 1ISSA 3MWFA 1V7PC 4G0QA 4C7XA 2P30A 5M3BA 3M4YA 3SBDA 1G98A 3KRTA 4YJGA 1D5WA 2WZQA 3K0FA 1Y9ZA 3PQ3A 3UT6A 3P0RA 2O8BA 1QYVA 4J4TA 3JQFC 1LV8A 1JFFB 3QVTA 4INPA 1H9AA 3WGZA 4BVLA 4FZ3A 4YAKA 1SEPA 3TB4A 1BOFA 4JLVA 1JIXA 4BFZA 1ECLA 1OXSC 3SN6A 3QE9Y 1U2PA 1Y8QA 3DNPA 3NEAA 1G8KA 2JJ2A 3CIFA 2G7MC 4KAFA 3BSFA 3DO6A 1DGQA 2B8EA 4QGSA 2HRRA 2AX4A 3MK31 3MCVA 2JLVA 2WMDA 1M5UA 4RO0A 5CGQB 4LDZA 2B4YA 3UHFA 4M9QA 3U9TA 2HD4A 1X7DA 3CZPA 5IJ9B 4IW3B 4U7GA 5JR3A 4DMHA 3B78A 1G42A 2WT9A 3FETA 3K20A 2FSFA 5I8ZA 1YB7A 3LZ6A 4KCGA 4A36A 3HV0A 3P5BA 2PQ2A 2PLFA 3HUEA 1U02A 3N39C 4L9SA 3E8XA 5EFOA 1ZCZA 2XYVA 2ZJZA 1T2FA 3M4XA 4CL2A 1XAGA 4UCXA 1XR3A 2JCGA 3KT3A 4YQFA 3C14C 3VZPA 4MWEA 5DMXA 4AK9A 5I4IA 4FX2A 2ZW9A 4Q5IA 4JI3B 4HOYA 1TRKA 2HWUA 4YAOA 2D0OB 3EC7A 5FF9A 3W2FA 1F2DA 1H5UA 3DDWA 3HUDA 2P6PA 4J4BA 4JJAA 2EJCA 2NU6B 2QT9A 4JX9A 3SQXA 2RHBA 5F77A 4M9ZA 1KFEB 2GUGA 4PZAA 2JATA 3WDMA 4IH9A 1FRVA 3ZDFA 4Y6QA 3PRYA 4DF3A 4EKEA 3RIEA 5A5GA 3IVRA 3M5PA 2FR1A 2RG7A 3OKFA 3P52A 5FBKA 5HF6A 4DMCA 1ORTA 4DRYA 4DDUA 1E1CA 4M37A 2A1IA 2I7CA 2YC4C 1D1TA 1KBOA 2GN6A 4IIUA 1OFIA 1JLRA 4J1TC 1WUHS 2CXXA 2OZKA 2X41A 2R85A 3FJYA 3HQ4O 4KE7A 4PSCA 5B3JA 1KYTA 4EMTA 4HYQA 3IAS6 2FHPA 2ODWA 4MVYA 5ERXA 3WLRA 3HCDA 3N59A 4KWIA 1YRQA 1BDIA 3EYAA 4JEUA 3QVVA 1BTOA 1M2OB 4IIEA 2C20A 4KXQA 2ID9A 2PG3A 5CJ2A 3GN2A 2XVYA 3QFRA 3KJZA 5HVNA 1FNSA 1J21A 2GEKA 2J33A 4IUBS 1YULA 1P73A 2WF9A 1PE0A 3PHHA 3P9SA 4EB3A 4BXOA 4GQAA 4YDQA 1BXGB 1MXHA 3MAGA 3N3AC 4IDFA 3HO1A 1VL5A 1D3AA 2OY0A 3ES9A 3FFWA 2A0XA 3VPCA 1Y89A 1O6ZA 1E1QD 2GN4A 1SU8A 1U7WA 3KVRA 4MQMA 3MILA 2WT4A 3I73A 1AXRA 3M9LA 4IILA 1OW3B 5HG0A 2G9RA 3QU9A 1KNQA 4Z9BA 1FYVA 2C03A 1T1RA 3HMQA 1E9CA 1UR5A 1GTZA 1UPXA 3DL2A 4JSYA 4LNUB 1IB0A 3HH8A 4NYMQ 2A59A 2O5CA 5THXA 4Q47A 2AFHE 5JVDB 5CB6A 5IVKA 4E3WA 4GOND 3R7SA 3SC4A 3FCCA 1NDUA 2ETXA 2AOUB 1PN3A 3H9BA 4RLQA 2QJTA 1LJUA 3ZDCA 3QPCA 4IV8A 4L0MA 2FZEA 1YR2A 1QH1B 3OICA 3UY4A 1ZYUA 1I1QB 4ZDIA 2FDCA 4Q1VA 5CVUA 3IA7A 2CSXA 5E9QA 3DCJA 4CTOA 1I1OA 2HADA 1Z5UA 3A25A 5CYPA 1E2GA 4BVGA 3NC4A 3MIZA 2F1OA 1GSHA 3HPQA 3L0CA 5A04A 1L8QA 1K8XB 3DFIA 4HH0A 5EIOA 5AK0A 4M38A 1CSEE 1NBWB 5FHRA 5TPWA 1XJCA 1UWCA 2WM2A 2I7TA 3ORFA 3V6LA 3ZNOA 1M75A 4HDKB 5DTQA 1DAPA 5LR6A 3CF4A 5EC8A 3LDUA 1SHKA 4P3OA 4BEJA 3LA6A 3BWDD 1KKUA 2IF0A 3GPDG 3GT3A 3LFHA 3PXEA 1FQKA 5L3ZA 2B8JA 1OH6A 3ZWYA 1OV4A 3B9BA 5AI9A 4L0QA 4ZOQI 1NNEA 5K0SA 1RP1A 4X1KB 4ZARA 3PFBA 3K8ZA 2XB6A 3HCWA 4M2LA 3THSA 3WLTA 3LU1A 2VVTA 5LXTF 1YKSA 2IYLD 4G1MB 4WV3A 1GLNA 3LX5A 3SYTA 1CUIA 4ND7A 2G08A 4DCMA 4LDJA 3H5VA 1NJ1A 1OX4A 2EKBA 1UBJS 2P9TA 2YHSA 2YWRA 1W1WA 2VUIB 3IOYA 2FPWA 4RZSA 3ZU3A 3EMDA 4DL9A 1RI3A 4QOGA 2F64A 4E0BA 2NUTB 3PQDA 3ZV6A 4OF4A 2BMWA 3QP9A 2NPFA 1JSLA 3BJIC 2BBWA 4YV0A 2F90A 5AVWA 1QF9A 1F38A 1GP2A 1T3HA 1U3TA 1YZHA 2DBYA 3L1UA 3PFGA 4KSBA 1B73A 5E6RA 2MYNA 2R5WA 1HNZB 2BZ1A 2PKCA 2WQZA 4PBTA 4QGGA 1QX4A 4WRRA 1M2HA 5AHOA 3RIXA 4BNDB 3I01A 1RDFA 1SUDA 4I9HA 3SEQA 2ZQ5A 4M1KA 1P0PA 1YR6A 4BUJA 5KYGA 5I48A 4YS6A 1L4MA 3E22A 5JI2E 1TEVA 2EKQA 1PYGA 1KKMA 2X1VA 4NC9A 4PYNA 4ZA2A 521PA 4I8XA 3NNNA 1KI3A 2PBFA 3DAGA 3GVPA 4NARA 4RY0A 5G3ZA 1RU3A 2PSJA 2AH5A 3S44A 5B7QA 4D4MA 3H19A 5JZOA 1GAXA 4MS1A 3OAAD 4HVTA 2V0NA 1CEEA 2DG2A 3K6KA 4WZ6A 2C5FA 1KEEB 3U4QA 3N76A 2P7HA 4XSVA 5ENDA 4IBOA 4O4HB 1P75A 2XT9A 3DT9A 3QVSA 4CM9D 1DADA 3H5TA 2I62A 4RSRA 3TZ6A 1YK1A 1YQGA 4NG5A 3U4DA 3VDQA 3RS3A 2QZPA 4H6PA 4M1TA 4WXYB 2HTEA 3OA2A 3Q3CA 4RFLA 4ZMRA 1XCOA 1YZQA 2H9YA 2XKJE 4X3CA 4CUKA 4G1FA 3WDSA 2GJ9A 4RVHA 4JJ4A 4YRIA 4MB0A 4XX0B 1NA5A 3TAUA 1TJYA 5DTRA 1FU4A 5HF5A 3E3NA 1KK3A 2CFSA 1KK1A 4TTJA 1L5KA 3UOAB 4HNSA 1ONSA 4U9HS 2VDPB 1DBWA 2JGNA 1EFUA 2DUMA 1WTCA 3QA3E 1DOHA 4MJXA 4J0FA 5DLQC 5ARBA 2O2JA 3LQQA 4FI3F 2OBBA 1P2UA 3OWXA 2PBRA 4RNDB 2GARA 4K6OA 4MP6A 1M2WA 2A67A 4EI7A 3HR7A 4GLBA 3TRFA 1SCKA 4IFBA 1X19A 1MQ9A 2GM5A 2PA0A 1XA3A 4UTNA 1ORIA 5ALVA 4DY4A 3CLUC 3BH6A 4GAEA 4BP9A 1PDOA 3IDOA 4RNCA 4AY4A 3G6KA 1W19A 3VH1A 2RI1A 2G25A 4FYWA 5BSEA 3SEZA 2ZJ2A 1NATA 1PD0A 5ETJA 1UZMA 3GPIA 1UFQA 2C1EA 2EFHB 4RF3A 3EGXA 1C3OB 4ZKDA 4QUEA 3LLSA 4EY5A 1ATIA 4RPCA 2NU8B 2XNDD 3U7GA 4PIPA 1WD5A 2NW6A 5DOVA 4N3CA 4URHA 2R751 4AUNA 2GAJA 4LC1A 2HO5A 2ZRKA 5EHNA 5BVHB 1ZN2A 4BQEA 5ECDA 1UJ2A 3N58A 1LUAA 3BH0A 2ZJYA 3UGQA 4NNJA 3FYUC 3B1FA 2E82A 4LK3A 1KO5A 3COZA 1T2UA 1YBFA 2XYQA 1P6QA 4ZV9A 4ONEA 5L3QB 3DUFB 3U6KA 4MA4A 4BB0A 1OY1A 1SCJA 1QTRA 2QUIA 1SXJE 1NW7A 2C2MA 1PKEA 4XGQA 3PEEA 3VAAA 1BN6A 1KZ9A 1NUAA 3B9PA 1DT5A 4HNTA 4U7PB 4B4UA 3WRWA 2PZFA 3H2SA 4LF9B 4GUDA 3E6AA 3S55A 1GWNA 2XE6A 3VDXA 4PLCA 3SF8A 1ML4A 4YAFA 2ZI3A 2J6HA 2VC2B 1QH1A 4WK0B 1XTUA 4UVIA 4GYYA 3CWZA 1U3VA 3QTLA 3ZJTA 1VE9A 1E9DA 2DTDA 5ERYA 1ZD8A 1ZUHA 2YZMA 3JZDA 2FPMA 3KELA 5T6BA 2BSAA 4YNBA 3B9RA 4YJ2A 4PGFA 3RSLA 4EYGA 5K8IA 4XX1A 3AB3A 1JFSA 2QGFA 2Y66A 1SHZA 3LF2A 1L4EA 3PHGA 5A3VA 3RVJA 3RW9A 1J00A 3FGOA 3JQ6A 3SHWA 3N2IA 3WLJA 1ZJZA 3TLKA 3ZPXA 3D7MA 3LHKA 1AY0A 1VP9A 3OQPA 4MICA 4C3ZA 3L8DA 2GRUA 3WYDA 4C3UA 1LSSA 1KVUA 1WPGA 5IDQA 6ABPA 3T7SA 1LBHA 1IZZA 2P0YA 4EATA 1XEWX 3BXHA 5JANA 4OQXA 1OH8A 4G5FA 1T2NA 3Q8XB 1M8JA 2I6FA 2QAGC 3MCWA 1B8UA 3DXFA 4I4NA 5I8PA 5LFAA 1JYFA 2FPKA 1P9OA 1RP7A 5LZ4A 2VXOA 1FVOA 4QQRA 3AI3A 3KETA 3FPCA 4GYWA 4D96A 3F1KA 1IXYA 5F1YA 2PSDA 3D43A 3U3KA 2P69A 1YZTA 4EYSA 3EXIA 5DNWA 3T5MA 3EQZA 4F3NA 4GOMD 4MS4B 4I9NA 3G8BA 3X1KA 4ZCIA 4S1PA 1MH1A 1U0JA 3WSVA 1U9JA 1X1AA 3G88A 3DQZA 2YZGA 2CLCX 5TY0A 4AY3A 2OYRA 1AQNA 3M8KA 4JFAA 4ER7A 3DXZA 3EIHA 3EX7C 3H6KA 1OFHA 2PZJA 4EG0A 4QHTA 1G8YA 4HN4B 4QELA 2P6NA 4JGIA 3FI9A 1I36A 2AWNA 1XWWA 2XVZA 1Y6GA 3C5EA 1UFOA 2X8JB 5IH7A 2I91A 2HWKA 1MTOA 2UVDA 1CLEA 3SDBA 4CL8A 5HUJA 4GMDA 5KYKA 2W2QA 4OHOA 2H92A 4KFUA 1JQEA 1A96A 3HJAA 1RC0A 3GT4A 3MRSA 4JJZA 1JEQA 2D0IA 3D9QX 2EKDA 4FILA 4HB0A 4DJTA 1XKQA 2ORYA 1E9BA 4JA2A 4B48A 1AUVA 4RVNA 1DBPA 5CURA 2BGTA 1PJLA 1B8VA 5T8KC 1M1YB 3ZQ6A 1G5IA 3IEPA 3T06B 3S2ZA 3UW1A 1XK6A 3O8RA 2P79A 2PQ6A 3JD3A 2OM2A 4G25A 5BYKA 3TG8A 1VMDA 2CVHA 1EH5A 1LWOA 4IDAA 3E4CA 2Q41A 4XCVA 2PRJA 3UF0A 5T8KA 4WZAE 3BE5A 1CETA 1ZP6A 3LRPA 3MFYA 4LF5B 2WG0A 4OSPA 2QRKA 4MHSA 5ARCA 3TSOA 1WMDA 1XA0A 1M0SA 3GWGA 2DJIA 5CVJA 4CR7A 4W5HA 1CJUC 3IMKA 4UNNA 4LEIA 4B82A 3CZ4A 3QBVA 5EIBD 4IWXA 2DFTA 4YCMA 2ZBEA 2YJ5A 1DRVA 4NCXA 1K0UA 2FH5B 1QHEA 5KNBH 4YRMA 4W5OA 4ZHQA 3IODA 2E2WA 2I7VA 3UAXA 5LB2A 4Q00A 4BLTA 3W6NA 2JH3A 3BREA 4EVQA 3ZGLA 1JKFA 5LIRA 1X2BA 2XECA 2NGRA 2BP7B 2WVHA 1TJ3A 3FUVA 3S1LA 2J09A 3GYGA 2DQ4A 3IRVA 3O2JA 4J1TA 4WN9A 4BLVA 1NBMD 1AQIA 1EB9A 3EDCA 3NHRA 4ZQGA 4A0GA 4NYJQ 3MLAA 5HUQA 1LRKA 4WX2B 4OUDB 5TMPA 4QYIB 3IVAA 5JD4A 2JVKA 3AJ9A 5IRCD 1T0IA 1OI3A 3PFHA 2SKCA 1BS9A 1KO7A 2O6HA 1LF5A 2FSGA 3EVTA 3FPBA 5J4LA 4HDMA 1VLJA 2Q9CA 1Z45A 4TN1A 5CEJA 1GAQA 4WJLA 1P81A 4U0JA 4TKLA 5L4SA 3IIKA 1JU4A 2QS9A 1VXRA 2E5WA 1T43A 1IPHA 3MWLA 4MWOA 5EPEA 3ZWNA 1I01A 1NU8A 1LY1A 1YZKA 5F12A 3SFZA 1DDOA 4DR4B 4XVRA 2IZ5A 3JQ7B 2V45A 5IC6A 4OXNA 3SYMA 1WPQA 3N8NA 3O6VA 4OYRA 5B53A 6AT1A 1FFYA 4XB1A 2Q2OA 2Z8YA 2YOGA 2Q1UA 1OX6A 1NSFA 1NI5A 2D1SA 1O96B 1UWVA 2GVZC 3ZJVA 3NHYA 4D25A 1PCXA 1C7FA 3DOEA 3PFCA 4J7UA 1IQRA 4LRWA 4LYFA 1AGRA 2PGJA 4RANA 5DXJA 3UB2A 3GEHA 4XWOA 5A6SA 3WK8A 3IO5A 1XNRB 1RNLA 2AQIA 1JHAA 2N1MA 2O54A 1NBMA 2EFJA 4U4AA 4MW4A 5F64A 2ZRQA 3TTVA 1RT9A 2ZP1A 1U0LA 4BNZA 4G5QA 1M10A 1TC2A 2F8MA 2LCIA 4HG2A 1V4VA 2FP3A 3MHPA 1QPZA 2IHKA 4P9NA 4QTTB 4CHTA 4IXMA 5JC1A 4BO6A 1Z13A 5G2OA 5JO9A 1XEAA 4BUZA 4DIFA 4REQA 1SUSA 1RE1A 5ADHA 5EAIA 3NYRA 3RTDA 3AERB 1GKKA 4KFCA 3Q3IA 2YDXA 5LOVA 1MC4A 4MWSA 3KJGA 4IWYA 2V7WA 3VOSA 1AK1A 4RADA 2V7VA 2W6OA 2CE7A 1JEAA 4HXYA 3RUEA 3ICOA 3VSDA 1RKQA 2KBEA 4P35A 3V8EA 1DEOA 1X7YA 3GDHA 3LVRE 1ABEA 2EV9A 1GLGA 4Y67A 3AR5A 2V4ZA 2VYCA 5H68A 3RC2A 2ID4A 1T8YA 4LV8B 1IEQA 1R9JA 4MDHA 1Y4ZA 2QYSA 3PX2A 5GM2A 3IUYA 5GGYA 4LZLA 1WR8A 2VWGA 3MQ2A 3X1DA 5CPFA 3GQBA 2VQEB 2GCGA 4HS4A 3AVQA 1WS6A 3UKOA 3GFVA 3KCQA 1FU7A 3A2LA 4RTPA 4NOMA 2FPPB 1BH2A 3VU0A 4B3HA 2F2TA 4GHWA 2QP9X 2VP5A 1VJTA 2ON6A 5AVRA 1AUXA 1TADA 3P32A 4CF5A 2HA2A 4B45A 1ADGA 2CUNA 2P9YA 5EQDA 5EMLA 3UGJA 2NYRA 4OB8A 5EXPA 5BMVF 3EXAA 3AWDA 2PAFA 3GFRA 1QVAA 1RPJA 2GN0A 3L0DA 5D3MA 3MB8A 1T5TA 1IN1A 1PGOA 4L3WA 1ZMTA 5FBLB 3JWHA 4KB5A 1Z6QA 3AHDA 2R68A 3E7DA 4KR2A 1V71A 3KV3O 4PYJA 1E3WB 3I04A 4Z2AA 1FNBA 2X8JA 4LF4B 4BZQA 1FNMA 1LPMA 2H0QA 3ESCA 3H5NA 2G83A 1RM3A 4JXXA 2X2FA 4U1RA 4YYEA 3EZNA 3EHDA 5KKCA 3VMMA 1RYHA 1QV9A 1M2VA 4Q1AA 4ZXPA 1Y4UA 3E0QA 1UBUS 2JKVA 5EN4A 1Z35A 1XZEA 2HXSA 2NSJA 2JLRA 4RKYA 4NKRA 2FEXA 5C5IA 4IVPA 1KQGA 3IVCA 4GVPA 5AUOB 2WOJA 2OORC 4QJ5A 1SIBE 2PX4A 4AD8A 5EE9A 3R41A 1C7IA 2Q1YA 2F8LA 3V8BA 4ENVA 3ESDA 4PYLA 3KD3A 1E58A 3L7DA 4XVCA 4DA6A 1Z0ZA 2IYNA 1SRRA 3DOOA 4IV5A 2I55A 5EP4A 4H08A 2UVQA 1AZSC 1TM1E 4G0WA 3L02A 2VH5R 1T6BY 3PJFA 1NFFA 4D44A 3QV1A 4BBJA 1N4AA 3S28A 2BR5A 3LC1O 2CEKA 4IUDS 3BJRA 2P9EA 2C3OA 3OPYI 4HX2A 2WDPA 3NCTA 2ZE6A 3V9AA 4G0UA 2HLDA 1F8GA 2BEVB 3CEHA 1NXPA 2ZB3A 3W7AA 1KEPA 5CCEA 1XZMA 3UJ3X 5LNK1 4N5HX 2XGOA 2ZYUX 3GD7A 5AOVA 3BL6A 4DEYA 4R0MA 4YCNA 2GPTA 1YK0A 2JIQA 3LS2A 3NU1A 3QYFA 4J0KA 4CM1A 1RM0A 3MBIA 3ZK7A 1A97A 1MO5A 1HUQA 2QPTA 3DG9A 3JYLA 5NLLA 1YV9A 1R6UA 1L7PA 2DC1A 2L17A 5KC8A 5BUZA 4YAJA 2JANA 2XRYA 4R8VA 5AHWA 2H4HA 3QNMA 4Q7MB 5ESDA 2WSSA 4BVBA 4FNGA 1Z6ZA 2G4LA 3U49A 2IHZA 3AEYA 3ZHUA 2JJYA 3V4LA 3TINA 4XQGA 3GCZA 5AW8A 2ECKA 1MDBA 1NQ5A 3K4PA 4W1QA 1QHSA 4R01A 1SGWA 4XYBA 3T5PA 1Q0RA 2CDAA 2H18A 2NO5A 4Q9NA 3IEVA 5JCZA 1Z47A 3CE6A 5FJJA 1VCOA 3O4GA 4RELA 1OYWA 3FVRA 2WUFA 4G01B 5JAZA 5E9WA 5I5EA 4GBJA 2BOVA 1RQ7A 3JQ8B 4MW1A 5TS3A 4FWTA 4HWRA 4HNUA 3GIWA 3LWZA 4TQ9A 3FVVA 4OJKA 1AG9A 2ICAA 4MW6A 2EHJA 4MWDA 3KTOA 3DKVA 5HQ3B 2QMQA 4D80A 4EHHA 4PSDA 1RBMA 5ADWA 1QVWA 1SBHA 1TQ2A 2GD6A 4OU5A 4RBNA 3CKLA 3YASA 5ITVA 2Z43A 5JVDF 5A4KA 3TRJA 3BTUA 3ZDBA 1EVEA 1S3IA 1Q7GA 1UOQA 1MJGM 2AFIA 4PGHA 5B58T 4EKYA 4YXWD 5AVXA 5JSZB 5KPDA 2WJAA 5IH3A 5JNRA 4J9VA 4H6WA 1DBVO 1I1NA 3RFCA 4BL5A 4RPLA 4CVNA 4DG9A 4YJDA 2ZRLA 3E7FA 1MORA 5I45A 2BBTA 5ITZA 3P7MA 1NMYA 4LK2A 1ZGHA 2CWWA 3JQEA 4OUDA 1FQWA 5EA2A 1P18A 5DXAA 4M6WB 1GRNA 5GVSA 1U1CA 2FFQA 3U6BA 1XEXA 4P6VF 2VOJA 2ERYA 4RA6B 1SHUX 3KQSA 2YNMA 5HXAA 3C3CA 1IZ8A 5HZHA 4D46A 1OFTA 3UQYS 4EW1A 1SUEA 4NPAA 1F9EA 1A9RA 1NMZA 2A6PA 4HNQA 4OHXA 4TXNA 3ZDRA 2HQBA 3K70D 2ZYSA 3ISVA 4HQOA 4EBFA 5TEWA 1IZ7A 1Q22A 2ZZKA 4BNUA 4ZMSA 2IOYA 1S1CA 3FF1A 3IB6A 3OOSA 4PNHA 1GZ3A 2FF7A 1I2AA 2C2ZA 2PUWA 3D6HA 3D7KA 4REOA 4UD6A 1XC7A 4R1TA 3MJHA 5BVGA 3P9CA 4WGFA 1YL5A 1ZN9A 4RGVA 4W5JA 4JGBA 3S1AB 2A3RA 5DN9A 3WI7A 4EGCB 2FRXA 1Z7EA 1DCMA 1U3GA 3AHHA 2RHWA 2K2QB 4E5KA 5JE8A 4KRXA 3DM5A 4TRJA 3REFA 2AMVA 5IKMA 1MO4A 1T1SA 4D98A 5CVCA 1NQTA 3RG2A 3ZHBA 1YXMA 1MZVA 2AN5A 4RJLA 4BO5A 5DBFA 4D9HA 4EHDA 4ZQIA 1PL6A 4PZDA 2GA9A 2WHEA 3EAFA 2PUBA 1FMFA 1YBVA 2IU6A 1MIHA 2OD2A 1Y8QB 1PEYA 4DIDA 4NEQA 5B3JC 5JPIA 4C7BA 3N87A 2JLQA 2FK8A 3W3AA 4F92B 3SJZA 3AVVA 1WABA 2XHEA 4E12A 4LPKA 1BKDR 3AI2A 2CVZA 4YRGA 3ETCA 3D7RA 3JY6A 4E09A 2Y1WA 1XB2A 1X7HA 3BE4A 3LDHA 4R6WA 4V3CA 5FUWA 1CYDA 5A71A 5H5JA 2VPXA 5C5EA 4MQFB 5JSHA 2CB0A 1VJ5A 4GYKA 1PQUA 2HIGA 1M1XB 3H16A 4RGQA 4RKEA 3C1UA 1E77A 3LUDA 1N3LA 1T5BA 4ALIA 3SZRA 3VJRA 3QXJA 4MDEA 2Y4OA 3SI7A 3BCSA 1CZLA 1X9GA 4YT8A 2GBLC 2PGIA 3EPHA 1UPTA 2GDJA 5JNVA 1H4VB 3RARA 2OB2A 3DBLB 3FLEA 1N3YA 4MS4A 4XD7A 3RADC 2WMYA 3E05A 2IFTA 1QHHB 1LVHA 1UBTS 2FPXA 3FWKA 4NCHA 2P35A 4CQLB 2Q5FA 1LRJA 1P0CA 1P1BA 2GD0A 3FIJA 3MZ0A 4P7BA 4F3CA 3L0ZA 3MVEA 5IDYA 2AZXA 2DBQA 3OLYA 3NI2A 1D4FA 2NVOA 2EX1A 3TRHA 4KSCA 1WZ2A 1BG6A 2XTAA 4TTSA 3JQPA 3MC1A 1KEEA 3Q10A 5FA6A 4ZYLA 5IKPA 3JCZA 4OBXA 3PNQA 5EJAA 3KAPA 3GLQA 3HVKA 4OLJA 4W9NC 1K63A 1OJ7A 2VSXA 3TO5A 4FB4A 1J2YA 1A5SB 3GGOA 3CVJA 4BDTA 1UPUA 5G40A 1ZH4A 1DELA 4ROSA 1EFVB 2AG0A 3NWBA 5FUMA 2D13A 1ZRHA 2QLMA 3AEQA 1H4SA 1HMPA 3KZOA 1F7UA 1RQLA 4EHNA 1YONA 4R1NA 5FNVA 2EFEB 4BHTA 3DBRA 3AFMA 1U2GC 4AB1A 2ZUFA 2VOEA 3D0OA 3EW9A 2XMSA 3E1SA 3I2FA 3QPDA 3WL6A 4EVIA 1W47A 3HL4A 2XUFA 2ZCVA 2J6IA 3P4XA 1V1JA 2C83A 3O75A 4UTVA 1WB9A 4B35A 1TLLA 3NBXX 4FIDA 3T5AA 2CDCA 4JELA 1GGJA 4RTSA 4UJ3A 4B2IA 1IMOA 2PGDA 3JVEA 3WOVA 4JL6A 1FNDA 3DEAA 2DFDA 1H2RS 3FG9A 1PO7A 2NO9A 3EZXA 1JWBB 1NVGA 1OI2A 2OK8A 3RJ9A 4H7JA 2RI6A 4MZDA 1W0KD 1XTRA 2BCEA 1ODKA 2JFZA 4KTVE 4WNAA 1OBCA 4TKZA 1JQJC 3QKIA 1KYIA 4L1KA 5A9SB 3IELA 2X3YA 1RXVA 2ZWIA 4LXGA 3TGWA 2QTMA 4AWXA 3RB8A 3H18A 2HU8A 2XEXA 4KRGA 3K9WA 3QFSA 4JVSB 2IS6A 3NHZA 5JD3A 5FL3A 1Q57A 5C8YB 4ITVA 4J7CA 4MTCA 4LISA 4RMIA 1Y3BE 5CLHA 3WGHA 4OQLA 3T7EA 3V2HA 3VC1A 1UKCA 2F3SA 1DRWA 1W88A 4GF5A 4J0JA 4US2R 5BT8A 3INGA 4ANFA 1REQA 1U8EA 4ECEA 1GU7A 3NUZA 1ZZEA 2JEOA 2RGEA 4MV8A 4WT7A 2QTVB 4MDFA 5A2QA 3WYFA 2WUGA 3OIDA 5F5NA 1WTAA 1ZUD1 1O97D 3CTPA 3FUCA 4D9CA 3L92A 1OXVA 2OUKA 2ZI7A 1XOIA 2OE2A 3DE5X 4M89A 4RQBA 3GJ3A 5JJIA 4KH0A 1N5MA 4P5PA 5MHTA 4K0KB 1RYYA 1IXSB 1QIIA 2VJQA 3HN6A 3VR1A 1T35A 4TM7A 1YI8A 3IMEA 3IYLW 3W9YA 4EJSB 1FYWA 2AI1A 1X6VA 3AKYA 1ZD1A 4ITRC 3BEDA 4U7FA 4DQXA 4DUZB 4QREA 2PCJA 3EHEA 3C3EA 2WYIA 3VBEA 4L7QA 3W5UA 2O8NA 4KQMA 1N2IA 2PAAA 1HC7A 1CS4C 4PO1A 2R6JA 1NUHA 4CFYA 1P1JA 3EVCA 1XZIA 3IDQA 5TQ0B 4BC1A 1PFKA 4I4TA 3TMAA 2PA3A 4D4JA 1K1EA 2WC1A 4JDPA 2XCOA 3CNBA 4PBSA 2OECA 1EJ6A 1Z4JA 3R3WA 1Y81A 2VHXA 3F4LA 3H13A 3HBMA 1DBIA 1IH8A 2E1RA 1UEIA 4YJ2F 1XZKA 5F78A 1KO8A 4DCNA 2EU8A 3QTBA 4O4IA 5LLSA 1GZSA 1W2GA 4BP3A 2NNLD 3C6KA 2X13A 1KU6A 4LS3A 5I3ZA 3OIGA 4OU4A 1OXBB 1L2TA 2SICE 2GJSA 3E7PA 4X1OA 5AVTA 2WABA 3AR3A 3T1NA 4CZ2A 4HATA 3U37A 3U0VA 1C9DB 3WNVA 2I6XA 3ZUPA 7REQB 5CLLA 1ZICA 3V4FA 3W5BA 4XW2A 4BMYA 3CNQS 2WHPA 1V9LA 1RKVA 3R9XB 1VM6A 3VFDA 2VDQB 3OZBA 4MUEA 1FMCA 2O20A 3O84A 3GLFB 1A2QA 2PH7A 3GVIA 3H5LA 3KAQA 4L5IA 1FLNA 4PO8A 2HRBA 4UBOA 5EZYF 1X86B 3WWOA 4F6LA 1Z9BA 1TRHA 1U0OC 3N9IA 4GMHA 2VLBA 4PAOA 2OO3A 4P3KA 4R1SA 3WWDA 4DILA 1SB9A 1N5OX 1K6JA 4B32A 4J91A 2W6MA 3QEMA 4MTLA 2C78A 5I6DA 4QOFA 1CIVA 4JUCA 1Z4IA 3EOAI 4Q9KA 1A7JA 4TRRA 2O7QA 4PO3X 3UJAA 4U2GA 5AICA 5CFMA 5L6LB 2I1WA 1IJBA 1EUYA 2Z98A 4EI8A 1NUTA 2F3QA 1DTEA 1C3EA 1C80A 3PQ5A 4AZWA 5JS6A 2CNNA 1DWUA 5GIOE 4JVLA 2I4RA 1Q3HA 1VPTA 1U90A 2YUIA 5J5VA 2W83A 3E9QA 4TKUB 4YWHA 3VSEA 5BRJA 2A9JA 4FWBA 2CLIB 3ZTYA 1N7GA 4HGPA 4F56A 4Y2TA 2YQ5A 3SZOA 3MMNA 2RK6A 5EHIA 3L6BA 3CV3A 5IXYA 2A7QA 4MUNA 4C4XA 3L4KA 1RRVA 2PEZA 4Z3OA 2WUDA 1P3JA 2Z4RA 5KNDD 1LBSA 1JYSA 3H11B 5LYYA 5C35A 2H2GA 1WOMA 3IAEA 2O0JA 3ANTA 3F8TA 5GV8A 5B1IA 3WP1B 1OB2A 5DI3A 1N9GA 1EVYA 2KMLA 4ZQEA 3E2IA 3P1JA 1T34A 5LU8A 4DHWA 3NH9A 3FLMA 1ZR2A 2PQ0A 4ZRDA 2G4CA 2IITA 1ZKMA 1U65A 4TYQA 1T2CA 3CPSA 2NT4A 4RVOA 2PZAA 3ZBPA 2SCUB 1IBLB 3G8AA 1RXCA 1E0DA 3K53A 2VDKB 3KQPA 3OJFA 4WERA 1GD1O 3SYNA 3NBMA 3QXXA 3WDLA 1G8FA 2WFAA 2WNSA 4I1SA 3U3OA 1N9KA 1Q2UA 1I4DD 4AF6A 2NM0A 1LQUA 1MOPA 3H2JA 4X41A 1GVHA 4H0FA 2Q5JA 5BN5B 5JCPA 2VRBA 4GSKA 5TMDA 2E4UA 1J7JA 1QORA 5E6RB 1QGAA 2NUPA 2BMAA 4IRMA 2VTEA 3HJNA 4B7AA 4DE5A 4A2CA 4HLNA 4V2UA 4OLHA 1BA3A 1X1SA 4WKBA 3BB1A 4WACA 1VLMA 2ECFA 1PX2A 1GADO 2ZUBA 1ELOA 2RH8A 4NBSA 2VZ8A 1TKRA 3KR2A 3UJBA 1KDVA 3OIYA 1E9EA 2W0MA 1D9XA 5KWVA 3UOGA 1Z6XA 4X8OA 1EP3B 2W11A 4L27A 5FPPA 1MJHA 2O50A 2JIOA 5JG7A 4QVKA 1VBKA 1XLUA 4MVJD 2O2DA 4BQOA 1RWMA 1T6ZA 1V5WA 2FLVA 4H7FA 2SNIE 2D74A 1HL7A 1DBRA 2F3UA 3I2YX 3ZG6A 1ZLXA 4EUFA 2VDUE 3DPIA 1KY3A 5IEBA 2ZR0A 1M2FA 5DSTA 2E7ZA 1RC1A 1XMXA 3QU2A 1T25A 3UJCA 2IYQA 2YMQA 2GEUA 4YK7A 3STYA 2WSMA 3ZCRA 2BGRA 1H2YA 2ZCJA 3DOHA 3NAGA 5EZYB 4ZMBA 2QE7A 1NR7A 4BOYA 3GLKA 3G5AA 3PLNA 3VPXA 4DUGA 3LT1A 1N9ZA 1GA1A 2J3LA 1DG1G 4ENTA 4HX9A 2OCIA 1U04A 4JSRA 4LJ6A 4MV0A 1ZNYA 3W4JA 4R5HA 1P3Y1 5IM4A 4EJSA 3AKCA 1P9RA 3NM4A 2HFJA 4PAGA 1WZUA 1SBNE 3ZQJA 4JVNA 4R3UC 2IPMA 4EKNB 3Q7PA 4DV3B 3HKDA 2QRVB 3TOCA 2H3EA 4I6GA 1I9CA 3B51X 3VR0A 3WLKX 4BNWA 4H0CA 5DI9A 4UTRA 3VZBA 1CR6A 5IHPA 5KTPA 1DG9A 4FHZA 1F3OA 1N6IA 3ODPA 4GZ6A 1E4OA 4TTVA 3M9XA 4UU7A 3AJDA 1X2EA 2R96A 3E9RA 1DQZA 1ZMOA 2X1MA 1B93A 3BTVA 3RKSA 2IDKA 3VKUA 4TGLA 2X9QA 3KKMA 4PLTA 3W9SA 4D3YA 2VIIA 3KQQA 1PGQA 2Q9UA 4PPYA 3VJLA 2B1GA 2IBSA 2XMDA 3I05A 2YWHA 3RVNA 4L85A 2HBQA 2DB3A 1SZJG 4MEJA 5FAXA 1Y1RA 2BMJA 4NL4H 5ER9A 1J2RA 3G9ZA 2HYIC 3WYCA 2BGJA 1M1NA 2X76A 5DGHA 5KQGA 5A3JA 1IBMB 2JHPA 2GCPA 1L5FA 5LP6B 3FWNA 4F5ZA 3C6QA 1XL1A 1U5CA 1GGKA 1KFKB 1ZK2A 4DWJA 1TTHA 5LYJB 1ISIA 2FRDA 3ICEA 3FRIA 4KHPB 2FUG6 4PG7A 4MVJH 1TQHA 2J3MA 2CLLB 4MKHA 2VR1A 1NI4A 2XQJA 1TA4A 2IWHA 4P5EA 3WMWA 3AUKA 3CBQA 1P6UA 5L3SB 1QCCA 2C9MA 2P1DA 4NZMA 3MW8A 5F2OA 2BJHA 2C5BA 5A7GA 3CVVA 4NY1A 2XNSA 3CY6A 4JB8A 4X60A 5TGTA 1YHNA 2VJOA 4A0QA 1QYCA 5L3QA 4WVFA 3ZN2A 2QN9A 5AMXA 1KWKA 3A3NA 3OSZA 4OGGA 2HJHA 2XHZA 3FVWA 2GVNA 3PDUA 3LIPA 4RXMA 2P6RA 1CQXA 2A94A 2IK8A 5F51A 3I53A 3PUVA 3OH8A 2ZDHA 1YZYA 4KVZA 5D3KA 4MP8A 4JFRA 3UT5A 4ZYVA 5DN6D 5GZ1A 5JH7B 3UV7A 5FBQB 5EINA 2XA1A 4MUIA 3O8OA 4JXZA 3EEFA 2QVGA 1KAGA 4EFDA 3C16C 4IIJB 7ABPA 4MAFA 4A8JA 2DQSA 1J7KA 3GRZA 5FP0A 1XQWA 1UOEA 3BTOA 3TW8A 4NHOA 4H7IA 4XVUA 3RBXA 2XVXA 3RSZA 2VA9A 1O4WA 3CZ9A 3W8NA 1RHRA 5DE3A 1DQRA 1PS9A 2Q7XA 4MB6A 4TV9B 2H0RA 3SC2B 4WBNB 4QULA 1CJBA 1XVIA 3N5CA 2Y27A 2Y1LA 1EUDA 3AP3A 4AJIA 2WB2A 2Z3VA 1ZOIA 3K1ZA 5FOTA 1S3GA 3ZGZA 1G5PA 5AVUA 4X6LA 1Z7YA 1NF8A 1IXKA 4IIJF 4X8HA 2PV7A 4ZN6A 5JMTA 1Y37A 1W0JA 1U7XA 1CR1A 4PYRA 4MUXA 2HM7A 4Z3DA 4OP2A 2JFXA 1DAFA 1CIJA 1PNOA 4BKRA 1ZM9A 2WJ4A 1Z07A 3KKLA 3M6WA 4WUTA 5EXXA 3WXBA 1O08A 3GLHA 4DSTA 1TX4B 4QPNA 1L5YA 1U2RA 1KXZA 2JGJA 1RWOA 4FFSA 2V7QD 3G0DA 1T5HX 4O1HA 1Z28A 4DQDA 2BSXA 4IQGA 4HT3B 3GXOA 4TRNA 3ANSA 2XCSB 2GJAA 2UZ1A 1U1EA 3HC7A 4I9GA 3SM9A 5DHQA 4E70A 3UZUA 5C1IA 2FPRA 3PX7A 4IIXA 4OK5A 4R6XA 2IODA 2PYZA 1MD9A 4FPXA 4IF4A 3FCAA 4ZU3A 2FMKA 5AUQA 5H82A 1HZZA 1XQ1A 2HC9A 5FPKA 3GT0A 4EHFA 4ZT7A 4BFWA 4CFZA 2J8ZA 5FR2A 1TUIA 4QL3A 1RRFA 3I5MA 3DWFA 4O08A 1ZA1A 3PUWA 4BEVA 4BN4A 4JLNA 3X2FA 5FPYA 1C0IA 2GNPA 2R8OA 3H7IA 2X6TA 4I50F 1K88A 1SQ5A 2XQFA 4OOFA 5JFOA 1OBFO 4L5AA 3FCUB 1JAIA 2VNIA 4R8LA 4BIIA 3A9TA 2AE2A 3A9SA 3HB0A 4N0DA 3RSHA 2PU7A 2X6RA 2XMCA 4MZXA 5KYYB 3FBTA 1EVLA 2CSUA 2ZT7A 1MT0A 1SPBS 2VUUA 1E3QA 2JIZD 4XDHA 3F6PA 5EPUA 1F60A 4CG2A 3H0EA 4CEHB 4GG1A 1NMQA 3GAFA 5EJ5A 1T2AA 4GGOA 3SOPA 4UARA 3L93A 3GRUA 3REGA 1ZG3A 1FNCA 1C30B 4I55B 4MV1A 1TAQA 5DULA 3UK2A 3WC4A 4O4LA 5JBQA 5GADl 2W2TA 2WBLC 3H9JA 2CUTA 1H0SA 2JL1A 5HYVA 2YV2A 3TPZA 4PSKA 2BONA 4UMFA 2GR9A 4RENA 1G18A 5T7BA 3U44B 1TM4E 3I30X 1RAIA 4Q3NA 2XUIA 3WBJA 2GYYA 5ICSA 2IXBA 5JAHA 3L6DA 1ZC4A 3TR5A 2AC7A 3ZJUA 5K01A 1GNTA 1Y3AA 4GXQA 3T61A 5CT6A 2X4DA 3LTEA 3T9FA 2DR2A 1LPSA 3L8ZA 2GEFA 3BTSA 3RYIB 3HWWA 1ZI9A 4HQRA 2WOOA 4V3BA 3TBHA 4MVJI 1G60A 1S2MA 1XVAA 3THWA 2W8BA 4O4LF 2P68A 4J0HA 4ND6A 3INTA 2FR0A 4H6XA 2ADFA 1KP3A 3L0SA 2Y1FA 4OHKA 4W6ZA 4ML3A 4EKIA 4V0SA 3M82A 1UWLA 2ORVA 4JHXA 4R2KA 4HFJA 1O0SA 1OXMA 4JITA 1QIFA 2DQYA 2OFPA 4MI3A 2HAEA 4US0R 2K6GA 1HDIA 4JNKA 3RJ5A 4RSMA 4HGNA 4OHPA 4QXRA 3GRCA 2WYWA 1SCQA 2H2FA 1FYDA 1NVEA 1CZRA 5ALRA 3VV2A 2REBA 3LQ2A 1VOTA 1TECE 2VAWA 4M49A 2IKSA 1EQ2A 4ILEA 3FWYA 4X84A 3IBSA 4C21A 3D8RA 1W94A 2P9BA 2O0HA 3A4NA 3ISTA 1DIOB 4KI7A 4TT8A 1DC7A 1N6OA 1OYYA 4O4IB 2B1RA 1PLJA 4LFCB 2YXLA 3B38A 1ZHFA 4Q3KA 1PQYA 2AUMA 3D4LA 2JZCA 5IHXA 2P8SA 1CRPA 2YV4A 3FHCB 3U4AA 1E3SA 1SA0A 3FSJX 3GJ7A 4DNOA 1LEHA 3ZK9A 3GAAA 4M36A 2OLJA 1R0KA 2GHTA 3OJ0A 4LZPA 2DETA 5B1HA 1RLIA 5LNK6 1CWUA 2EEPA 5JMWA 2H2DA 4II2A 4PHCA 1QF7A 4GECA 3A6ZA 4FDVA 5DCWA 4XTCS 1WRBA 2ZAGA 2CMHA 3QVOA 1HTTA 2PT9A 3C6YA 3IEIA 4KN9S 3V1NA 2QWXA 3DVRX 1PGNA 3V42A 3WA7A 3A6JA 2B98A 3ZE1B 1BD4A 3HXMA 5B1SA 3TW8B 4A7PA 2DPMA 4MX8A 5NULA 1GPBA 3A2NA 3ND6A 3OT1B 3KG2A 4JS0A 2GZRA 3RVMA 1A5BB 3VO9A 5ADVA 3ZE8A 3ZC3A 3G8CA 1LVUA 5ADUS 3KBOA 4DBLE 1QE5A 3FPGA 2POCA 3CEJA 3PI7A 3QLJA 3TQTA 2CXHA 2PJZA 2DT5A 3PKJA 3LC0A 3I04M 1P61B 4WCDA 3C8ZA 4BWYA 4GXRA 2FX5A 2OGZA 1OAKA 3HKEB 5AW5A 2ZSBA 4EI2A 4AZ3B 2TMYA 2WKRA 2IPAB 1KRWA 2RB4A 4WESA 1J56A 3VJKA 1IIBA 3QHPA 4KFTA 2OCBA 3TEFA 1Y5MA 4C76A 3FMVA 3WK4A 2VTBB 4PQEA 1TEHA 2Q8NA 4P58A 1TGVA 1HDXA 4JI1B 4DWWA 2UVPA 3VXKA 2AOXA 1P8AA 2QSZA 3NVAA 4II7A 4GI5A 1TKCA 5ALYA 3F7OA 4GPAA 1DJOA 3GHYA 2Z4SA 3GA7A 5HDQA 4ME6A 3STWA 1WXXA 4JLJA 1AC5A 1DJNA 1CDDA 1MB3A 4LHZA 3MJEA 2YY6A 4FSDA 2XGSA 3WMEA 2L2QA 3CJRA 4DLBA 4G1UC 3DOCA 2DQZA 5IJAA 1KIFA 1W59A 2JIDA 4KKXB 1WNFA 3E2MA 2CGEA 3ETLA 4OQYA 2QT0A 4BGUA 5E0KB 1N6KA 2G5GX 4UZSA 1JALA 1LBEA 2JLSA 5CH8A 4A0RA 1O6FA 1U9IA 2JLAA 2IZ1A 3M81A 3NVDA 2DZDA 3OKAA 1XLWA 3E9NA 4JT4A 4JX8A 5DZSA 3S7ZA 5I01A 2ZRAA 2NO4A 4I6JA 2JHGA 1SC3A 5ALGA 3GJ0A 4A5OA 2X1LA 4GC9A 2QW8A 1VSBA 2XUGA 3BA6A 5HE9A 3RREA 4BFVA 4G9BA 4OP1A 4ZTZB 2R6AA 3ISJA 1RHQA 4KXUA 3HCNA 4LOJA 4PC2A 4PYOA 4UREA 1TUEA 4WK6A 4MI1A 1G1MA 1PR1A 2EFGA 1VYUA 3CR3C 4QTZA 4RIGA 4EPVA 1GPAA 3NDPA 2B8WA 5EE0A 1FX1A 3AESA 4RZXA 1EWYA 2HOQA 3PKZA 3FR7A 4CCSA 1AA6A 4LI0A 2NQ2C 1G9SA 4OHRA 5EZYA 1JR4A 4OHMA 2C59A 3OZEA 3SEAA 5F7XA 2H29A 1JDJA 1TYZA 2CWDA 5K5EA 1XTZA 1ZR4A 5I4CA 4HFRA 3OETA 3EULA 4HFMA 1H1TA 4XOUA 1SD1A 2Y1KA 2OA0A 4EEXA 3C3KA 4MS3B 2AE1A 2TYSB 1FLVA 3R5HA 1EUQA 3QRWA 5D3ZA 2EJTA 2QN1A 2WTNA 3L6EA 1EVZA 1L9KA 2E37A 4NU0A 4C14A 4K6GA 4R1UA 4Z4IA 3BG5A 3LKZA 3K8YA 4EPRA 4M1EA 1YFKA 4K40A 4ZYXA 1Z0IA 2YJGA 5A05A 4DQUA 1S9DA 1AE1A 1RXIA 1MJGA 3T8YA 2DWQA 5JCJD 1Z5GA 1F9AA 3LE8A 1L7XA 3LHFA 4GXTA 3ZV4A 4XIJA 3ZKWA 2ZIUB 5HIKA 5DYIA 5A9TA 2H00A 1LWNA 3Q3JB 4PLWA 2PMKA 4CMEA 2G17A 5E3JA 3ZYZA 4G84A 1OOEA 1FYXA 3ZHZA 4CQJA 2C9YA 1PR2A 3EY9A 1Q17A 3PTLA 1QZ3A 1OASA 2OCLA 3AR9A 1GARA 3GIDA 5A6SB 3WHPA 1B00A 2JFWA 2AC4A 2CXTA 1OIXA 1GNRA 1OA0A 2OWDA 3IPRA 3TFWA 4QPZA 2FP4B 1TMGE 4YT5A 5E7QA 4ZVMA 4Z1MD 1JQDA 4XM0A 1M8KA 3OCYA 5JSZA 1BVRA 4R8KA 3DMHA 4U6SA 5EWJB 4JKIA 3D4OA 1Z22A 3P5SA 1O6CA 1K8QA 2XTZA 4TRMA 4EFKA 3MXTA 1FP1D 3CUKA 1W93A 1YL6A 1B8OA 3ZYCA 1XTJA 2BT4A 1S5PA 4DAOA 2IUFA 1G5RA 4QUBA 3N8GA 3N0WA 4Q82A 3FBWA 3ROMA 2OB1A 2RI0A 3G2KA 3UKDA 2QEQA 1IM2A 5IT9A 4AS1A 2IPXA 1RXUA 4WSOA 2NO1A 5JCJA 2FZWA 1CNMA 1NU6A 3GF4A 2ZIGA 2ZOSA 5K8CA 1XZCA 2EJWA 1XZAA 3AM3A 3ECCA 1OZFA 2IWRA 2JD2A 1XMJA 3BWCA 3EQ6A 4KBGA 2PUVA 4MIKA 1WM1A 4OQPA 3U3ZA 3WGYA 4JV5B 3LQRA 2OXFA 2ACWA 1G41A 3EA0A 5IX8A 4B3BA 2QTWB 4HLUC 2JB9A 3JD2A 1NZDA 1E61A 3Q6IA 4ZVPA 1OX4B 3BAZA 3IQHX 3NCHA 1V39A 2ATVA 1XEFA 1ACLA 2ZPTX 4QGHA 5FADA 2ZBVA 4YLEA 5L40A 1RI1A 3EPKA 2GKSA 1GUFA 4Y6LA 3RSQA 3V7FA 4HVLA 2AEFA 5AH0A 3T41A 2XQIA 4YRJA 3Q85A 1BVYF 4IIFA 4OAOA 3MMZA 3GJQA 2XKKA 1I6KA 1SKAA 1PZMA 2CFTA 2HGSA 3TZEA 4A2QA 1L7EA 4PWYA 5DIZA 1CW2B 3CF2A 3J7TA 3VHLB 4KLNA 4TS3A 3O03A 4OIFA 4LRYA 4NPCA 3LKDA 4OBBA 2FA9A 2H1RA 4KIWA 2QR2A 5P21A 5IWCA 1NR5A 1Q21A 3LV8A 3R2JA 2BLNA 2UZ1B 4AIRA 4FHGA 4ENQA 3VZRA 3RUFA 1VLQA 5BWCA 4RTMA 1Q1NA 4P4GA 1ZD4A 3GJYA 3LKBA 4RVCA 3Q7SA 4WN9B 2BFDB 3NT2A 2AK2A 4ERXA 1G8JA 1HH4A 1NSYA 1SUBA 2PV0A 4E3ZA 3DV0B 4UCFA 3NGXA 1PSWA 4B4VA 5EIEA 4WNCA 3KEGA 2D5IA 5H81A 3MLEA 3G2HA 3N0VA 4DA9A 2AOVA 2PGAA 1K4YA 5BN4B 1IQPA 1I7PA 1KY5A 2HCBA 4HAWA 2QQGA 4PCUA 2D0DA 2ZWMA 5ALEA 3V34A 1J24A 4BMPB 2GZ3A 3KJXA 2PSEA 5KUTA 1WP4A 3DDNA 4KGDA 1DXOA 1TK9A 4L08A 1UPCA 2C5AA 4LBVA 3OQJA 4B8YA 1VMAA 5JCOA 4IOMA 5EI5A 4ER0A 2DPLA 3W8DA 2GILA 3DJYA 4K1XA 5IZCA 3TQSA 1Q44A 1I24A 3H1AA 1OGJA 3B3FA 1ZK4A 3DC2A 4EBBA 3CXRA 2WP8J 4HAUA 3ZWVA 1T8TA 2GJKA 2PS0A 4IJ6A 1CTQA 3TBKA 2QZSA 4Y9TA 3WMRA 2HK8A 1Z8HA 1VL0A 2VWHA 2X5NA 3P0EA 4C88A 4FXOA 3F78A 3QBEA 2AQKA 4EVSA 4E2WA 1W4CA 5B2ZA 2REXB 5THQA 5DBOA 3K5IA 1YJCA 1H9CA 4QHSA 5G41A 4B4KA 1HPLA 5ESWA 2ZPUA 3CLTD 3ZKAA 4BTLA 5WRFA 4M22A 4UEWA 5HFJA 4MHOA 3CG4A 1R4ZA 5D3QA 3R9IA 1UAGA 3OFSA 1N6RA 3IHLA 1ZH6A 3JAWB 5CEFA 5T64A 2C7GA 5KX5A 1O2DA 3DYIA 1RKBA 3HL0A 4RVSA 3S5UA 3TVDA 4AMBA 4LKRA 1DAOA 2P40A 3TBFA 3CKYA 1ECJA 2OZEA 3HTXA 3ZBUA 4IOKA 3BGIA 3OE7A 4MOWA 3C7TA 1PEKE 3F2VA 3BEOA 4E5NA 3L4BA 3PNKA 5EUBA 1RYZA 3C3YA 1THZA 4Q9LA 4BNNA 2IDMA 1BXGA 4KYTA 1N7HA 3PQ4A 3CX4A 4CKWB 3PQ8A 4TVBA 1AZTA 3GJTA 1LQTA 3K09A 5AM1A 3QF4A 4C0AC 4E5PA 1I4OA 2ANCA 5G0UA 5BSMA 5JMOA 3LBFA 3OZDA 4J3JA 4I46A 1EMDA 2IEGA 3ESBA 3RUDA 4C4AA 1B41A 3L43A 5E3IA 2OZLB 3TTUA 1FNNA 1NVDA 4A03A 4EUEA 1RRKA 3MS4A 1ZGCA 3ZS8A 2ESRA 3T7IA 3VKHA 1EK0A 3WLLA 4A2WA 4J75A 3DFMA 3PNMA 5EUQB 3JD1A 4UUPA 4DSAA 1H4TA 1H8EA 1ADJA 3ETEA 3D6NB 1J99A 3P19A 1RPTA 1QVRA 4CV0A 2YVLA 4X1YB 4BNYA 1U81A 4UM9D 1GQOA 1U28C 1TT5A 2ZRFA 1XQ6A 3VU9B 2FN4A 4I1VA 4PTZA 2JGIA 1PWZA 2BFEA 3F5FA 2LDBA 5C7LO 1ZA2A 3O21A 1BHO1 5KDDA 2Q07A 3NX4A 3QLEA 4TL7A 1HV8A 4X6YA 4RQTA 5DDIP 3KUDA 5HQTA 3VO2A 5D1HA 4KK4A 5JNSA 1N1DA 4BLPA 3K70B 1HFJA 1ZS9A 1WPRA 3MN1A 1R3UA 3P0FA 2ONCA 3PYLA 4BYGA 1NPDA 4UUQA 5LJLA 1LC3A 4BUCA 1U6JA 3GFGA 5F5LA 5FI1B 1I7QB 3EG5A 3E7WA 2FJ0A 1PS8A 3WK6A 4K28A 1DC3A 4BLQA 4Z9XA 1YQWA 3VPHA 2O8CA 5JHGB 2FCRA 2HU2A 2V6MA 5T57A 3C39A 2P2SA 4G2TA 5ALPA 3SIXA 3ENKA 4Q4CA 3C8UA 1MP0A 5TLSA 2E3JA 2QAGA 4XWTA 3I92A 3RRJA 3ZLVA 4A1FA 3ZH9B 1N32B 2VF7A 4QXAA 1NPYA 2ZBFA 3PDJA 1GUZA 2G06A 3JQRA 4UBKA 5KOIA 6REQA 5G02A 2INGX 2JCVA 3HN7A 3TM5A 1EG2A 3LUHA 3E7XA 4KN8A 3CG0A 1LB1B 2BZGA 2O0MA 3FE2A 4KXWA 2P0AA 3W0LB 4J0GA 3S29A 4DVGA 3EODA 1ZBDA 1R37A 1YBHA 3FRJA 4J6EA 5KNCA 5TARA 4AI6A 2F48A 2C7PA 3BGOS 3ZZNA 1H1LB 1WWKA 1R0XA 2B7BA 1U8AA 3P2IA 4MULA 4WOCA 3VH4A 4JQCA 4PTYA 1C8VB 3C3WA 2O0LA 4Q3BA 4Y2JA 1SUAA 5DWQA 2Q62A 1UKVY 1BX3A 2O06A 4A23A 1N2OA 4JP2A 3N75A 4BY9E 3CVYA 1PJ4A 3KVYA 1NN5A 1YS9A 3FTQA 2L19A 1TF7A 1PZFA 2A4KA 2J5XA 2L42A 4FX5A 4Y2VA 4X61A 3KYJB 1GFSA 4LJ4A 2BFDA 4GVXA 2NTYC 1JE0A 4HEA1 3LDGA 1X1RA 4Q34A 4BLSA 3C87A 5FTKA 2PX5A 4B46A 1WDWB 5FV4A 3PV0A 1L4LA 1KK2A 2P90A 3PUIA 4PPFA 1FK8A 4IJWA 2VK8A 1QO9A 1XKTA 1XTIA 4B4WA 6YASA 3WLPA 1I4EB 2JAUA 3MSXA 2ZT8A 4FNOA 3ER6A 5F7JA 4BX0A 2W8ZA 4DGQA 5DV9A 2QMEA 2VSFA 3IV9A 3KL4A 4NJOA 2LUOA 3KJIA 3EAQA 4HJXA 4EF6A 4F9FA 1W36B 3JQ7A 3R8CA 4C0JA 2HTFA 3L7BA 1AXEA 4LF6B 1S2LA 4ZHQF 5JBIA 2L82A 1W5SA 2EZTA 2QUJA