1EXVA

Human liver glycogen phosphorylase a complexed with glcnac and cp-403,700
Total Genus 320
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
320
sequence length
808
structure length
786
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKAFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 320
structure length 786
sequence length 808
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA01
3D0RA 1C50A 4LEIA 1JIXA 1SXQA 4FZRA 5DXFA 3IAAA 3OKAA 4M60A 5LQDA 1QM5A 1FU7A 4YUAA 9GPBA 1NOJA 1P29A 3GPBA 4RIEA 3S28A 3C4QA 2C9ZA 3SYMA 3ZCPA 2ASVA 3HBFA 3CX4A 2F3PA 2QRMA 2XGMA 2XCUA 2QN9A 5JTTA 4N3BA 2QRQA 2R66A 2QN1A 1XV5A 4HWGA 1L7XA 1JIVA 1IXYA 3WADA 2JZCA 1Z6PA 2QN2A 1E1YA 1WV0A 1VGVA 2SKDA 1P4GA 1P2DA 2F9FA 2QN3A 1M5RA 4NEQA 2X0DA 4CTNA 4BQEA 4RIFA 3MSCA 3L7CA 1J39A 4NC9A 1L5QA 1P2BA 2JLBA 4CDRA 2QRGA 3L7BA 2X0EA 3RT1A 2GPNA 4AN4A 2JJMA 1L5WA 4REMA 3HBNA 5HXAA 2GJ4A 2IEGA 4WACA 3UYLA 4EL5A 3RSCA 3BCSA 1WV1A 1WUTA 2IUYA 1UQTA 3HBMA 2F3QA 3G2IA 4MHSA 2BGTA 4N3AA 4GYWA 4CTOA 1V4VA 1Y8ZA 1NZFA 3VDMA 5D00A 5BNWA 2BGUA 3CUWA 1C8LA 1EM6A 3FROA 2AV6A 1FTYA 4N3CA 4AY6A 3NAZA 2AMVA 2C1ZA 2IV7A 3PE3A 2X0FA 4BQFA 4MRAA 2XA9A 2PRJA 1L5VA 2BISA 2XCIA 3OTIA 3TSAA 2IEIA 4GYYA 1FTQA 3MT7A 2G9RA 1Z62A 3ZCSA 2QN8A 3CUYA 3MRVA 4FKZA 2IV3A 3C4VA 3ZCTA 1PN3A 5IKPA 2P6PA 4GPBA 4EKYA 2IW1A 1ABBA 1RZUA 3T3GA 2HY7A 2QZSA 4F9FA 2GEKA 2AZDA 3L7AA 3CEHA 3MS4A 2QLNA 3BD7A 3NPAA 4WADA 5GPBA 1B4DA 5I45A 1WW3A 4WHMA 3T3IA 4YI5A 4M7PA 3EBPA 3QKWA 3S0JA 3H4TA 3MBOA 3GUHA 3IA7A 3OTHA 1PYGA 1YA6A 1GG8A 1FA9A 1K06A 1C8KA 4CTMA 2ATIA 2QRHA 3MS2A 3OT5A 1JEJA 4EKEA 2QRPA 1JIUA 2QNBA 3OY2A 2R4TA 2VG8A 3L01A 3PE4A 3CUVA 1E4OA 1JG7A 3MT9A 2XGOA 1P4JA 3E3OA 3BD6A 2G9VA 3BEOA 3OKCA 5C1DA 2XA2A 1YGPA 4X7RA 3T5TA 3L7DA 2GPBA 1EXVA 4AY5A 2H1HA 1IIRA 4M83A 1Z6QA 4RIIA 2VCEA 4G2TA 2OFFA 1NVKA 1XKXA 2WTXA 1PNVA 2BFWA 1FS4A 1F0KA 2KS6A 3VUFA 1K08A 4RELA 3T3DA 3BCUA 3Q3IA 3DZCA 3ZCUA 2FFRA 3TOVA 2F3SA 2XGSA 2FF5A 4X7PA 1L5SA 2GT1A 1F6DA 3O3CA 4W6QA 3VDNB 4F96A 1RZVA 1O6CA 5DLDA 3T7DA 2IYFA 4RENA 3MTDA 1L5RA 4GZ5A 2QLMA 4N39A 4QLBA 3MRTA 7GPBA 2VSNA 1BX3A 1WW2A 1AXRA 3Q3EA 1GPYA 1LWOA 1Z8DA 3MT8A 4KQ1A 2PYDA 2PQ6A 2F3UA 3EBOA 3H4IA 3NCHA 2C4MA 2C1XA 1C3JA 4AMGA 2QLLA 4MI9A 4HLNA 3G2HA 5TVGA 1SXPA 5ENZA 4GZ3A 3ZCQA 2R68A 1XL0A 4AMBA 4EJ2A 4LDPA 2H1FA 2SKEA 3AMVA 2YJNA 2AW3A 3G2LA 2GM9A 2Q6VA 4NESA 3MRXA 1LWNA 3TAXA 1GZ5A 3OY7A 1P2GA 1FTWA 2IYAA 3CUTA 3RSZA 2GEJA 2FETA 4MICA 2ECPA 2G9UA 4KQ2A 4RBNA 3G2JA 1NOKA 2ACWA 2VSYA 2R60A 1UZUA 1QKJA 8GPBA 3DDWA 3COPA 1Y6FA 3NC4A 2SKCA 3DD1A 3DDSA 3ZCVA 4RIGA 3D1JA 3BDAA 4RIHA 3S2UA 3HBJA 1NOIA 3T3HA 3CV3A 1NZDA 6GPBA 3G2NA 3L79A 5JTUA 4MI3A 3E3NA 1FC0A 3NP9A 2VCHA 3C48A 4YI3A 3VUEA 4BFCA 1L6IA 2G9QA 1NLMA 4X6LA 5DU2A 3BCRA 3SYRA 5IKOA 3RHZA 4MI6A 3NP7A 2R4UA 2O6LA 3CUUA 4KQMA 3MQFA 4N9WA 1FU8A 4F97A 1P4HA 3OTGA 3BD8A 2X6QA 4GZ6A 1KTIA 3NB0A 3G2KA 1PSWA 4EL0A 1JG6A 1HLFA 5TMEA 1XL1A 5D01A 3T3EA 1UQUA 3WAGA 1WUYA 4X7MA 3MTAA 3S29A 1GPAA 3QHPA 2PYIA 1GGNA 2ACVA 3OKPA 2X6RA 5TMBA 3S27A 3ZCRA 1A8IA 1XOIA 4L22A 1AHPA 1GFZA 3CEMA 1Y6GA 4Z5XA 3UYKA 2GPAA 2XMPA 3D0QA 3E3LA 4XIFA 3MTBA 4XI9A 4MHOA 3Q3HA 2ZB2A 1RRVA 3CEJA 3MS7A 3WC4A 1FU4A 1GPBA 2PRIA 2QN7A 4BQIA 4PQGA 1XC7A 1H5UA 2XA1A 5TMDA
chains in the Genus database with same CATH superfamily
3U5TA 3KX2A 5FCDA 3O90A 5FBHA 3PF9A 2C5HA 3L0DA 4TTRA 2KMLA 2QJWA 2YHAA 4KXLA 1MO6A 1EWQA 1H9BA 4EI8A 1NQUA 4UUNA 5LXTB 1EDBA 5DXFA 1PQ4A 2H65A 4M8LA 3ZKWA 1LK5A 4RK6A 2ACKA 3H87A 2ZSIA 1R9JA 5DO9A 2N75A 2QPLA 3S28A 2HMAA 5AKLA 3E61A 3TIXB 5TX7A 1S3FA 3DFIA 1UFQA 3ZIDA 2C9ZA 5CM2Z 4WNAB 2HF2A 1W96A 4RD3A 3U4CA 5C5CA 4GM1A 1R8XA 4DFDA 4FDVA 1DRVA 1H4VB 3R5FA 4FDUA 4IIJB 2ZCUA 3OAAD 4NHOA 5CUQA 1P19A 3L1HA 2AUNA 3O74A 5I9NA 3DR5A 5KNBA 4KW7A 2P75A 2JAQA 2GTHA 1Y4UA 2X7HA 4KKXB 2FSSA 4B46A 3HJCA 4RY0A 1QWSA 2CZQA 2X8JA 1EHCA 1I7PA 1X1BA 3LQ1A 3OT1B 5SZJA 2FEXA 4N5LA 1YIDA 3E5MA 4UASA 1K3FA 2P3QA 2OCXA 1RI2A 3CM0A 4M6WA 2CDBA 3B82A 1HWYA 1AO0A 2ZAYA 4PSUA 3RUIA 4MP6A 2CEKA 3CURA 1CQXA 1C1DB 4O8ZA 4DDKA 1PW7A 1W5SA 2A84A 2PLWA 4PO9A 1E2UA 2J3EA 4RMNA 4BQEA 3HDVA 3HYNA 4ZO7A 4J2OA 5DBHX 1OU0A 2NVWA 1OLOA 2RJ3A 1YIOA 2ZWAA 4BKMA 4DBLC 1K7CA 1TO2E 2ZTHA 3FLMA 1EIZA 1YQTA 2R25B 3HY6A 1JSZA 1QVRA 4QYWA 5H4GA 2FW8A 3PXEA 5A05A 2ZQYA 2X7JA 2NTVA 1SH7A 2BELA 3L7BA 5ALXA 3RT1A 1WZEA 1MO4A 1XD2A 5DBEX 4PNEA 4BX2A 3P9IA 3A70A 2R47A 2PGXA 2RE8A 3VTKA 1SUSA 2GD6A 4U7GA 2QJOA 3PCTA 1H6CA 5FOTA 2FUKA 1V3TA 2OKCA 1SBYA 3KQKA 2WHPA 4KO8A 1GZ6A 2A5GA 4GT1A 1OYWA 2AK3A 1KK1A 1ZONA 2TS1A 2GETA 3E6AA 3LBNA 4J7UA 5G0TA 2HEGA 2XWSA 3Q98A 3M3HA 4LXXA 2RHGB 3EMKA 1LPAB 1G2IA 2YTZA 4J49A 4KWEA 3H2JA 5CB6A 3UAYA 1UBFA 2QVXX 4IDGA 1ZVQA 4OP2A 5H3HA 1SBIA 1WJGA 3W79A 1N5KA 4JSTA 1AQUA 2I4MA 1GG2A 4JMPA 3V1TC 4URHA 3BWCA 4U7TB 2P2DA 1LSUA 4HDRB 5HJ5A 2Q4DA 1E62A 2UZAA 3OLQA 4R2JA 2ZIUB 5EHQA 3VDMA 1GUBA 1ZJJA 3LA6A 4Q3BA 3ZBPA 5CFNA 4RL6A 4D44A 2VBCA 2PS1A 4IIUA 1J2UA 4D80A 3HI4A 4KPYA 2PL1A 5DK4A 3CH5A 4BKPA 2CVHA 4CLOB 2NZVG 2A14A 1GYPA 4FPXA 4HKTA 4OHWA 5ECWA 3C3CA 1H6BA 4LG1A 3ZJYA 5LZ4A 1E5TA 2XUQA 4HGOA 1M6WA 2N3ZA 3K9NA 2XA9A 5AM0A 1WMDA 1D4FA 1K6XA 1QIMA 1T3ZA 1NURA 2BHTA 2CL0X 1U99A 2D2FA 2GMWA 2QD4A 1G1MA 4QTZA 2WKQA 4F93B 2QR5A 4XWGA 5A3QA 1BKDR 1NF9A 2ODBA 3QPUA 3THYB 2NUPB 3K1AA 1R74A 3KUKA 4IHAA 4PYMA 2R48A 1S2GA 1TUBB 3ZNOA 4BP3A 3C4VA 4GPIB 5SYMA 1KO7A 2XTNA 3QA3E 4JP2A 2KHZA 2J4CA 2P2SA 4EG6A 3PEWA 1RRFA 2AQKA 3E9CA 2AE1A 3IILA 3LS2A 4LY3A 4O4LF 3A9UA 4PIPA 4S24A 5I4BA 1OBFO 3HSYA 4N01A 3CO0S 4FFNA 3AR3A 5KWVA 3CF0A 1IY2A 1Y89A 3AFMA 1I32A 1UC9A 5EZ6B 4BFLA 2EV9A 3TW0A 2W2VA 1N5DA 3TCNA 2VPXA 4LE2A 1H69A 2HXSA 3CZRA 3HVUA 1B4DA 2CJPA 2HV8A 1PQYA 3AO0B 3NDJA 4IFBA 2ZEJA 3M9XA 4UPDA 1K7XB 4D25A 4U9IS 1LGYA 2OC9A 2GRUA 3Q2IA 3BIJA 4M0PA 5EOVA 5LMUB 3NGXA 4UBKA 3M3PA 1FS6A 4FX2A 4MS4B 1HG1A 3RT7A 1YJCA 4OX9Y 5I48A 5C5EA 4MEBA 1VHQA 3A10A 5ARBA 4I81A 1T1EA 1A9QA 3CINA 4CV2A 4DMHA 3MBOA 1TTPB 2ZI4A 3KZXA 3EGWA 4PGMA 5FL7A 1T9CA 3IA7A 5BYJA 4X8LA 2XCTB 1RI3A 3T7KA 1PGNA 1RWVA 2Y1XA 3L4EA 2H63A 2ZB8A 5HIJA 3AVWA 5JY6A 2G72A 1UEIA 3ZWOA 4CTMA 2WF5A 1JX6A 3U48A 4TYNA 2R2GA 2PIDA 4AKIA 5DNDA 3U19A 2CXRA 4FOPA 4ITRC 3EK2A 4R3UC 1BO6A 3T4UA 3S2EA 1BHJA 1PHRA 1N4DA 4TMXA 1YR6A 3ENZA 3OQ1A 2IXAA 5CDGA 4IICA 3HB0A 2D0DA 5DGIA 3OZ7A 3OY2A 4CQMD 4XYLA 1HNXB 2ZWPA 4YBRA 1BGVA 4CGZA 3ZZ1A 3DVQX 3UPTA 4GE3A 4INAA 3E81A 2HXGA 2JHCA 4PYOA 4NE9A 1JHOA 5C8YF 1KZ4A 2ISQA 4INOA 3EF1A 1Z75A 3U7RA 3ZE0B 1T9KA 3F47A 1LBIA 5KCMA 3UCXA 3D6TB 1KVQA 3PG5A 2XEXA 4UARA 2L69A 2Z3VA 3BICA 3OKCA 1II9A 1XQYA 4D3FA 2XT0A 4P3KA 1MBZA 4L8FA 3AR8A 5J9FA 1EVIA 2Z58A 2WMDA 1ND6A 3EAFA 5J43A 4ABTA 3OCYA 1RP7A 3O9VA 1YS9A 2VTVA 5INTA 1Y33E 4KEAA 1J42A 4TMZA 4RIIA 2AEMA 3UMJA 4N40A 3G17A 1YJBA 3T38A 3R9XB 3O8QB 2FZ5A 1JL3A 5ITZA 3G7UA 2HMWA 3OTOB 1ECPA 3FPGA 1E0AA 3U9TA 2OAEA 1Q15A 1HTWA 2J67A 1PNVA 1ZVJA 4AJ1A 4BAUA 3F6RA 3E8XA 3H0CA 3SJAA 1AHNA 2OYSA 4G65A 1H8ED 3UUEA 4F2GA 2KS6A 4TKUB 3BMOB 2WJZB 5D8DA 2CFTA 3JQQA 3ZDBA 5BW8A 9LDBA 3DBLA 4GLFA 2N46A 5CIWA 1Z5NA 1MXFA 3PI7A 4W1SA 5JZ9A 3NWEA 2IH4A 1JG4A 1FNCA 1IBCA 1Y9DA 3ENVA 3OEHA 3TTXA 4X97A 3TW4A 1ML3A 4GAEA 4HVLA 1C9NA 2UZ4A 3DC7A 4R3WA 2VHYA 1C4KA 3EGVA 4ND4A 4YMVA 2EP5A 3PDIA 3ZQ6A 2GZRA 1UMCB 1BFDA 3I62A 1DAEA 4IVQA 1FCJA 1Z4IA 1VMDA 4XVHA 3DE2X 3QLUA 1Y8QA 1B1CA 4FOTA 4RK0A 3MCUA 4FOLA 1PF7E 3QKIA 2GLTA 1T9BA 2OHXA 1NNUA 3LGXA 4R1SA 3WA6A 4B7ZA 2WFLA 3TLMA 2E3JA 1E0KA 1P1RA 2FVXA 1KI6B 1UPUA 1YXMA 3KEGA 4IIHA 2QG4A 1JQEA 4FYKA 3TE7A 2WWRA 1B8UA 2IXBA 1KI7A 4HQRA 4LKRA 4MQ6A 3WDMA 1G60A 1YK0A 2CVZA 2XWJI 3CRZA 5EFOA 4AK9A 1BX3A 5JAUA 3QIAA 4GPTA 3H5RA 3I0ZA 3I6YA 4IIVA 5EGNA 4AQ7A 1LWOA 1V95A 5JAHA 1KO5A 4PR0A 4R6XA 3PVCA 1Z2CA 3EXHC 4ZVPA 4KDCA 1JW9B 2HQBA 4JEIA 3C24A 3EBOA 3BJIC 3M82A 4TOIA 3NS7A 2O1EA 4A8TA 2YX1A 3CIFA 1L9KA 3FI0A 4P4UA 2QLLA 3HR4A 1L5OA 4GBED 4IKOA 4Z0HO 4EJ6A 4NOKA 5B58C 3U4MA 1MJGM 3WV4A 4EYSA 5JBQA 3CZAA 3LYHA 1GZSA 5G41A 1Z6AA 3TE6A 4QTYA 5GZ6A 2BFCB 2K7FA 2A5LA 1BW9A 5TT0A 5A6SB 3ZCQA 3C8ZA 5JCZA 2G88A 2JI6A 4EGJA 3GUYA 1JEYB 3ELWA 2JANA 1H2AS 1AG9A 1K66A 4G8CA 3N0WA 4JX9A 3V4LA 5K05A 1JDJA 1MFZA 5AW0A 3IXMA 4LSZA 1CIJA 3DULA 3HHEA 3I9JA 3MJ4A 5FULA 3HC7A 4B0PA 3VKGA 1CUEA 1RPTA 2R8BA 2XUGA 1VCMA 2CLDX 3I1IA 1GQQA 4KGVA 4EMUA 4YRLA 3UJCA 4DRXB 3B6ZA 5KQLA 4OSPA 1GP2A 4GXQA 1YI1A 1KMCA 2PUFA 5K3DA 3N0XA 3UHFA 3PKIA 4OFZA 2DX7A 5H68A 3U40A 4H31A 1W49A 3SK0A 4Y2SA 3QEBZ 1T0HB 2XYHA 3O7WA 3RU3A 1U9IA 4U0KA 1A5SB 3QSGA 4G41A 2W22A 4PAQA 2Q07A 2IYAA 5K2OA 4HDSB 4DCSA 1D2CA 1ULSA 4H7PA 4DPLA 1BU5A 5HFJA 2NPFA 2GI4A 1Z08A 3Q6IA 3OPXA 1OLXB 1ZCJA 4JA2A 2EDAA 4YJ2F 2GPJA 4YRMA 4HG2A 3PNQA 3CRNA 2NU7B 4JODA 4MP8A 3SXJA 5IKXA 3EBLA 4DZZA 1NBME 4UMVA 4Q7LA 4L5IA 1KL7A 4MSUA 5C8DA 2DVMA 3HMKA 2RGAA 3TKAA 2DY0A 2RHTA 5F23A 1ARZA 2F8TA 2NP7A 1WXEA 3P9CA 5CH8A 3WWCA 5FP0A 4DTCA 2OB1A 1FIUA 1P7VA 1NVWQ 5A4KA 3U7EB 3GEPA 5B1EA 2DH5A 2QGZA 3D6JA 3G3EA 4RMGA 1AKWA 4HFNA 1G98A 2XRFA 3WFJA 3E8MA 1CEQA 2V0CA 1YRQA 2GAIA 3GYBA 5EA2A 4AW9A 3IQZA 3ZBQA 2PUAA 4V3BA 1IHPA 4Q1EA 5HP4A 1FLAA 2O8CA 2PEYA 1AO3A 2XVYA 1C29B 4BLVA 4ZQEA 2QIOA 1Y3AA 2X3YA 3EG9B 5FUBA 3V34A 5EJAA 1IWOA 5EEGA 721PA 1UPTA 1D2AA 2H9IA 3LA8A 1R6UA 4RIGA 4UQOA 1U2EA 1ODKA 1T35A 1UM9A 1WW8A 1MQ9A 1Z37A 2RCNA 3GQVA 4G4SO 2QV7A 3QFTA 4P83A 5GVRA 5TPZA 1QQTA 2EP8A 2RMKA 4KYIB 4EUKA 2VTBA 1PJSA 5GIPE 1CTQA 3CNEA 1WZNA 3GF4A 3M6AA 4JR2A 4CI9A 1DIHA 1QB7A 3G8CA 1G8JA 3L79A 4M2LA 4KGZA 1IN8A 4KXVA 3AL3A 5DB4A 1EFVB 4W5TA 1A95A 1N9GB 1GNTA 3NM4A 1OBHA 1RM5A 1U7ZA 3MEQA 4C0BA 4EY8A 2B8NA 1CJCA 1MOSA 2DPMA 4CT0A 3ZJUA 4HAWA 5FTLA 2I2AA 2O0KA 3BZBA 3W04A 4KFTA 4DCVA 3CNBA 1JI0A 2WM3A 3ILSA 2ZRCA 4YRDA 2O6LA 4IGIA 1E8DA 1BHQ1 2VH5R 3EIOA 1WNTA 2X58A 4BCCA 4N9WA 1FU8A 5FBWB 4YUZA 1N4AA 3UXMA 1Y80A 5CLIA 1H66A 2IEZA 2IZ1A 1O6BA 1DP4A 2J5RA 2O06A 1M1UA 4UATA 2N1BA 3RR2A 1KFCB 1P60A 4BCDA 4DB4A 1NATA 2XB6A 2HWYA 3FWHA 1WXWA 3GH1A 3L1JA 5D2CA 3WNVA 1NMYA 2Z8XA 1U7WA 3N3AC 1M6VA 3AUKA 5B6PA 4UUPA 5D01A 1JKXA 1I1QB 3KLMX 1WBDA 1TGYA 1T2DA 4R2HA 3TTSA 3UAOA 2HHHB 3GEBA 3ZXYA 3WLIA 2A0XA 2J6IA 2PLAA 4G9EA 3IVGA 4LMAA 5CFPA 4AQDA 5JECA 1QQ7A 1XPOA 2Q3JA 3HK2A 1H9CA 1TU3A 2YXEA 2QTVA 4RTQA 2ISSD 1WXFA 2QIPA 2QX6A 5JNTA 2MYUA 3OKPA 2X6RA 4M0FA 3A6JA 5AI8A 2P9CA 3LWDA 4QXOA 4K9KA 1E1CA 4IGKA 3NNDA 1H2ZA 3RKRA 2V9CA 2QT0A 2XYQA 1A9TA 5G4LA 2PJDA 2ZS9A 4PRYA 1EK5A 4C5AA 3C1AA 2QI9C 3EJ6A 4ECAA 5IAOA 2OWDA 5P8WA 3T1TA 3ZN2A 2ATXA 5BPHA 4DVGA 2HMSA 2I7VA 3DA8A 3HWRA 3W1VA 5B2FA 1ZGAA 2WJVA 3OE5A 1HTTA 5CDTA 3E4DA 3OX3A 3FPEA 5EQFA 3Q0TA 1XPRA 3GLIA 2BEWB 3JASA 2FWRA 5LBTA 4BV2A 5MFPA 3GGPA 2ATVA 4JB8A 3K0CA 1HR0B 3KEOA 1DQPA 1XFAA 2NM0A 3FJ1A 1UKAA 3AG6A 3LP6A 5EIBD 3QEKA 5BWOA 4RKWA 2QN7A 4GQBA 1UJCA 3ZWDA 4OB8A 5E9AA 4S1NA 5JBIA 3OM0A 4F4FA 3NHSA 4GI1A 5JROA 1KKLA 3UNXA 4AY3A 1FUEA 3I9V6 3VDXA 1Z0JA 2H18A 2RI1A 5EJ9A 4KRYA 3ZC3A 3RYFB 2B3DA 4QICA 3AV0B 4XEUA 3ZDFA 3FKSD 3Q4GA 3GCXA 4EHJA 3QE4A 1I2ZA 2P3SA 1G291 5C8XA 2QRKA 2ZDQA 5DFAA 1C9YA 4RIEA 3OPNA 4FR2A 4YRZA 3HP7A 1GKLA 4JIMA 4K0RA 3ZU5A 1MABA 4EAAA 3GEIA 5HK8A 4BMOB 2HU7A 2CMDA 5T6MA 3PGA1 4GEKA 4KNVA 4R8SA 2TECE 2OUKA 3CX4A 3P0HA 1NW5A 1F12A 2JW5A 2DE0X 1K6IA 1MV8A 1PEYA 2XGMA 3HUTA 2HPAA 2OV8A 4WWHA 2VH1A 2NUBA 1N3YA 5IT5A 2WV7A 2I55A 2JFFA 4OBBA 1FW6A 2Y92A 2R6HA 2YJ4A 4CDGA 2AMFA 3FUVA 1CP2A 2C96A 4CQJA 4UAGA 4E88A 5C8VA 4BNNA 4PNZA 1CY6A 3SICE 3V8QA 3B3QA 1OZFA 3G2PA 3REFA 4QQ8A 4X71A 4NONA 5DASA 3VR4A 4URYR 1W30A 1KI1A 1L9XA 2R5WA 1KPIA 1TL7C 1WXQA 3ADKA 2ID4A 3PUHA 4FUQA 3G88A 3KJFA 5BT8A 2CV2A 1NVFA 3P9SA 2FPUA 3TOCA 2YCBA 2WSIA 3OOWA 1A8HA 1WTCA 3A4IA 4MKGA 5LP6B 4X8MA 5HGXA 5EG5A 2AVNA 4HVAA 3P2IA 1GLGA 5AW2A 1H4QA 1JBQA 4LZZA 3TLZA 4PSKA 4MUKA 4RUKA 4K9QA 4OL9A 4DUZB 3RNLA 2O0MA 2JLBA 2GD0A 1JLSA 3B8EA 3AF6A 2IL1A 2PSSA 3BBPA 2VYQA 1BQ4A 4OXNA 3SS8A 2HQOA 4J16C 3BK1A 1CZKA 3DV0B 3JAKA 4ZZ0A 4QASA 3ETJA 3D7KA 4REMA 3UK0A 3HBNA 1P72A 1KEEA 1P7ZA 1X38A 2GJ4A 3QOWA 3UYLA 1PFGA 2ODPA 4J0JA 3P0IA 2OCPA 1NMSA 1CZOA 3R40A 4MMYB 3ZWPA 1U1FA 3VAZA 2HCFA 3U4DA 4C7OB 1K98A 1XAIA 2PRZA 4WA8A 1ZI6A 2F3QA 2Y0BA 1GPNA 2BFBB 3CXRA 3JSXA 1CUUA 2OC4A 3SE0A 3DFUA 1L4BA 3PJGA 2JL1A 1JDNA 1XTBA 4QIHA 4NEGA 1PWEA 1PJ2A 1RAAA 4N6NA 1TVEA 3FVWA 1LB1B 4MAAA 1NDHA 5JCJD 3ORFA 3IQFA 4MV0A 5CFRA 2B83A 2A9KA 2CY0A 2Y1LA 4JVOA 4HR7A 2I76A 4J7XA 3UKOA 4TTTS 2OQIA 4OPMA 4JC4A 1ZKMA 1C8LA 3H86A 2JJYA 3UXYA 5KWEA 3OUUA 1YDGA 4LOAA 5FFMA 4CQLA 1GA1A 2W4QA 4ER7A 2AIRA 4AY6A 3KWMA 3LQRA 2JKZA 3FSGA 3TEJA 1L6RA 5LNK6 1AA6A 4BO4A 3P4UA 4RJKA 3JY6A 2YY6A 4G8JA 1IEVA 2P6MA 1TQ4A 2O2JA 1W59A 1ZM4A 4OJNA 1GEGA 4MEAA 4X65B 5IAAA 2ZAOA 1NI4B 1MT0A 1QK5A 1M2OA 2Z8YA 1QV9A 2LZ0A 4U6SA 4Y6GB 5FTJA 2XCLA 1A88A 3EXAA 4EPRA 2O8FA 4XWYA 1WB4A 1PRYA 1R9MA 5ALLA 5JS7A 1OT3A 1AZTA 5KNBD 4RQTA 4YRQA 4M87A 1KJ8A 1CBUA 5FI0B 1W36B 4RHXA 1MIHA 2EW8A 4FGSA 4JKIA 4AWAA 3ZZMA 2VP9A 5CT9A 5CXUA 3PU6A 4QAJA 1WSWA 3R8XA 3NIDB 5I7HA 3TYXA 2JVKA 1ZIXA 3OPYI 3HKDB 5I3CA 4DMGA 1JPNA 2KM1A 3PBKA 5L6MB 4H15A 5TSDA 2F64A 1TC2A 3PWSA 4A9AA 1ABBA 1R8QA 4HFRA 3PUWA 4IOLA 1IBKB 4O4JA 4R1PA 4LDZA 3GLTA 3NTQA 5LYYA 5J2TF 2JBAB 1M1YA 1SXJE 4TXMA 4U7PB 2J3MA 2W6MA 2QLNA 3B8HA 3Q3GE 2NUTA 2PVPA 2BRUA 2IXFA 1JG2A 4FLMA 4UTXA 3TSYA 4O2BF 2OXIA 1QDEA 3C6KA 2PX2A 2QG6A 1KYYA 1VZ2A 3OOEA 1C4WA 4IW3B 3EFOB 4L02A 4LAFA 1H2YA 1J7JA 2D5AA 3EGDA 4A92A 3T3IA 4YI5A 1L4NA 3TTVA 3OLZA 4HY3A 4JJ7A 1KEPA 4EWLA 2BEVB 2V7WA 4KSYA 4BNVA 2PMFA 1AOXA 4Q47A 4Q4HB 1TF7A 1JIQA 1L4HA 4CG3A 1FP7A 3MWYW 3WMXA 4B4DA 4B33A 2O3TA 3KWFA 3A4NA 3K9QO 4KV7A 3K9LA 1NW9B 3PKZA 4RZHA 3S68A 2D4AA 3FIUA 1CUFA 4JUBA 3RYTC 3C8DA 3LRXA 4OJYA 5DHSA 1GYQA 2FQXA 4WZBE 4CG1A 3AUUA 4UPVA 1O0CA 1A50B 1J07A 3RVMA 4EGFA 2GQ0A 1K06A 3ECAA 5F5LA 3VZBA 1RLTA 3WX0A 5IABA 2GO7A 2G8LA 3PL5A 2ZM6B 4IMPA 3DZKA 3WSTA 4M1YA 3FE2A 4US0R 3N07A 1S8NA 2FE4A 2FEWB 3TDNA 4B80A 1IVSA 3SHQA 1L7OA 3GWZA 3FCYA 4COKA 5ISMA 1YRAA 3QXXA 1Q0LA 5T67A 5K6RA 4FW8A 3AGQA 3HXOA 3SYLA 3ZXSA 2RGUA 5AKGA 3BULA 5JSZA 4ALIA 2A5DA 3VR3D 1GTVA 3AFOA 1CD5A 3K20A 4DL9A 3CVVA 4HYTA 5FLXA 5HTKA 2XTZA 4NNOA 1XTRA 2W00A 2IWRA 5GJCA 2AS0A 3ZBUA 3W2EA 2GKOA 2PX3A 1PT7A 3D4NA 4XYGA 4G26A 1UMKA 3GIWA 3OCVA 1IVNA 3UH1A 1O0BA 4C6SA 1KARA 1P7CA 3F5SA 3GUUA 3IQGX 1SKAA 1YZ3A 1VIYA 1R18A 1IUNA 2AF3C 3DYBA 2F1RA 3TQSA 1DQNA 4QU9A 3WYDA 4NJEB 3VHRA 5LQUA 5C1PA 1T10A 1KC1A 4AL4A 5G4KB 5TT1A 5H1YA 3LHKA 3WJ2A 2VK8A 3FPLA 4YUYA 1P8JA 3TLAA 3FMFA 2PRSA 2BN4A 2JFYA 4DZTA 4TS4A 3EHEA 2O57A 2R8RA 1UKVY 2ZYHA 3H8JA 4GMFA 4W5HA 1R0CA 2PGJA 1UAAA 4RH0A 4NWIA 2VEOA 5KO2A 5TQ0A 3JX9A 2CYBA 3K0FB 4DMKA 3VA7A 2HJVA 3QVJA 4P4GA 3VZCA 4AN1A 4ZHQA 4LV6A 4H6VA 2WWFA 4AG6A 1D3AA 4E14A 1U6KA 4MLZA 2IT1A 5EMJA 1GUYA 4L27A 3QY0A 4KIWA 2FFRA 4Y1EA 1EGHA 1QDUA 3P5BA 1ZNYA 4QXAA 4KE6A 4TPKA 3QG1A 4OQPA 3IVXA 1EM8B 3LK7A 4BLPA 1JVSA 1RWOA 2ZUDA 3A1UA 3EVTA 4H1HA 3QYAA 4HH4A 2KSQA 1OILA 2GAAA 4FLFA 5KYKA 3A37A 1J0CA 1QNFA 1QRDA 2F9MA 4MIYA 1RHUA 5TARA 5KOHA 1KETA 2DHQA 3PR3A 3R7WB 1IATA 2EHJA 4AP9A 2XKJE 1QHHB 1G5FA 4N39A 1QIHA 4QUBA 2DXIA 2ZSUA 1VCNA 2EU8A 3DG9A 3EE6A 3DHEA 2J9ZB 2R86A 3N76A 2VJCA 3H2BA 1M2VB 3JZAA 4HGRA 2GS9A 5FWYB 4C14A 4EI7A 4DDTA 4X93A 3VR5H 3DBHB 1WULS 2D3TA 3TUZC 1UC5B 1GRVA 3LBHA 1B3BA 3BMQA 3EVDA 5U4QA 1KERA 5FNVB 5LXTF 4PCVA 4D0LB 3HCAA 1E2NA 3LT4A 3LLCA 3U1TA 4M1KA 3TOXA 3IQHX 2NACA 5IT4A 2OXFA 4IH4A 4D0RA 4BY9E 3IHLA 2ZRBA 2Y1GA 5TGZA 5JSFA 2JLYA 2GNAA 3W0LB 1SU4A 3E7FA 4FB4A 4IIJF 5F9MA 4KBFA 5TY0A 4M36A 1RJ9B 2J3IA 3F6PA 1K0FA 4P8RA 4ZT7A 2R68A 4N0MA 5FA5A 5JCJA 2QRVB 3VU9A 1RQ2A 3DVAA 4Z1MA 1E2JA 4TYMA 3EWIA 2J9FA 2SKEA 1RZRD 1CC1S 2LRHA 1U3FA 2OHOA 2UVDA 3K3PA 4XA8A 5KSWB 5I3ZA 3GBSA 2OV4A 4ZQGA 2ZAMA 1JQKA 1BROA 4YA6A 1N34B 2QLFA 1ONPA 4YJHA 4LBWA 3H84A 3UJNA 1KP9A 3RC9A 5IZCC 4L8LA 4M38A 3A2LA 4TWJA 4IL5A 5ALIA 4Q1VA 3TEFA 3AVOA 3KHSA 2PFSA 2AFHB 2HK7A 3GZNA 3R6GA 3U7JA 1QZZA 3L7NA 3VO1A 2BHNA 4BNDB 4YJFA 4ALNA 1DG1G 4FNOA 4R0MA 2E4VA 3DYVA 1HDGO 1ZUNA 3PK0A 4LC9A 2DT8A 4QO7A 1N1GA 2QQFA 2AOTB 3ME5A 4MGEA 3TUJC 3RSZA 4ZTBA 4CI0B 2A1UA 4G24A 5H80A 4D8VA 3GZ4A 3AEZA 3KVRA 3LRPA 3EZNA 3MXTA 4MS1B 2Z2ZA 4TRNA 3VO9A 1ZLXA 3OEHD 2JAUA 1RYYA 2DT5A 4OGGA 1N2SA 2R96A 13PKA 1P17A 2WJ3A 3H13A 4TN1A 3K9BA 3VU0A 5JAPA 3EPRA 4CEJB 1KOGA 2BTOA 4OJMX 1QR6A 1DOZA 1KFJB 3EC2A 1OIVA 3UPUA 5BMVB 2JLRA 1SCUB 4U7DA 1SHJA 3KOMA 3FYCA 3RYIA 3ULKA 4U0JA 3ISVA 5CFQA 5K6AA 2BEUB 2G25A 4IIEA 5ESXA 1E0DA 3CN7A 4EB3A 2QK4A 2D59A 1U9ZA 1XTIA 3I2HA 3NDBB 1YJ5A 1XXHB 2CXQA 2PZ8A 3R3SA 4KIGA 1J8MF 2QM3A 4R1UA 4DE5A 5LPNA 2AI3A 3OZRA 3AJ9A 4H08A 2QNRA 4IDNA 1WDWB 1X7HA 2N42A 3P0EA 4TZKA 3W34A 4DRZA 3ODPA 3TZHA 3W5DA 5F1OA 2GOYA 2DTEA 3O1LA 1FRFS 5DGCA 1T0UA 3K8QA 4OQDA 3HGTA 3I9OA 4N4AA 2FJPA 4PC7A 3UH0A 4CKBB 2D0IA 5FWXB 1Y1PA 1Y5LA 1RAGA 2GN1A 1E2IA 1AVTA 1SIUA 5D86A 3PTLA 5F5NA 1U7OA 4IJVA 4YV1A 5C7YA 5D3MA 3TOZA 4WT7A 4OFXA 3KT3A 7MDHA 1QPBA 5B2ZA 1CB7A 4C88A 3LC7O 1US8B 3A31A 3HBAA 1GGHA 1MJHA 3ZE6A 2NV0A 3TXYA 4U02A 4XVUA 4UDOA 2A5FA 2ONYA 4P31A 1ZR2A 1Q50A 2C8LA 4CMEA 1C7QA 2CE7A 4I4TA 4CE6A 3CUUA 4MS3A 4AU1A 1T2AA 3GAFA 3Q8WA 1DCFA 4FTWA 1APBA 4CM4A 3PNSA 1II0A 1LC3A 1PJLA 1GCUA 2NO1A 2NYVA 2A0WA 1X87A 3DJFA 3DOUA 3FCXA 4LDJA 4N9QA 4YQZA 2XBUA 3RK4A 3SF8A 3O91A 4KXMA 2IEAA 1XBTA 1PWHA 2OD9A 4HNGA 1BGXT 1DJLA 4A23A 1LRLA 1VPDA 5JXHA 1OF1A 4KHPB 2DFTA 4GI2A 4GOKA 4N7RA 1NSYA 1H0HA 1PBTA 2F67A 2QDXA 4HWKA 4IUCS 3I1YA 3AJRA 3A6PC 1WUYA 1XN1A 4KWTA 1QIGA 5HQTA 5HOQA 3RS8A 3LT0A 3P71T 3ICWA 4NF2A 1BWRA 3JVEA 1XCMA 4YJ3B 5EIXA 2WVGA 2LBPA 4AZ0A 2C61A 2Q8QA 1E2HA 3OUZA 1VB5A 1XTVA 4IJ5A 4XPIB 1XU9A 2Q4RA 3F3MA 1XJQA 2HSWA 5AVOA 4RVGA 1UPXA 3RCBA 3JQBA 1H1DA 3HPRA 1D2HA 6PFKA 3PXAA 3LT2A 1MRSA 1L0BA 1GGVA 1V39A 2XMPA 3H04A 3I8OA 4LRTB 3DAFA 1S8AA 4XASA 5CRIA 5HQJA 1GCIA 2ACEA 3D54D 4FT4A 4UTOA 5IUJC 3EDRA 3QE9Y 3HKBA 2JRLA 4RKYA 5EXSA 2IRWA 3GAZA 4XARA 1WXXA 3A9VA 3I64A 2B7CA 1CXZA 2PGNA 3MLEA 1XF1A 3Q3HA 3QF7A 4IMRA 4LCBA 4WH0A 1KQNA 4ETIA 3VGPA 4C20A 1KRXA 2WNHA 3CCCA 4WZ6A 4QUDA 1HYGA 4ZYXA 3L4JA 2UVPB 5CBKA 521PA 3DM9B 5KEIA 4JI7B 4JNCA 3WR5A 1DX9A 5TPZD 3WK6A 5JNLA 1NBMA 5BOVA 3KE8A 5E6SB 4UFPA 1TD9A 2ZXFA 1JKIA 1E94E 2PXAA 3F6CA 5E4JA 3TDKA 3K94A 4J0GA 3AY0A 3EDYA 3C1TA 1PL0A 4ZAZA 2ZJOA 5K3FB 3F9CA 5BSUA 3AYXB 4QVIA 3IAS1 4YB8A 1PJCA 3D0RA 4FMPA 4DIKA 2B8WA 3NASA 1GG9A 1NU6A 3A1FA 2WP8J 3QIVA 1E7RA 2HHCA 4G97A 4K6HA 4MYTA 4OEHA 3QWHA 1QRSA 2VDJA 3GJTA 1CUWA 1JZTA 5DRTA 3R9KA 1EINA 1FDOA 1L2TA 1SCKA 3FNHA 1JF8A 1T5TA 2DECA 2II6A 2IW3A 3GPBA 2BHSA 3O73A 4HEA6 1SBQA 3SJ7A 4A3SA 3V9AA 2A92A 2PMCA 4L6IA 4D9HA 1BMDA 2C3YA 3HLYA 5AXDA 3O93A 2Q6LA 1LLCA 1E3QA 2D8AA 3WBJA 3UBTA 1ZK2A 4EARA 4O4IA 1L3CA 2IHUA 1DB3A 1POWA 3D8SA 3DCIA 3LQFA 4HGQA 4ZVOA 3GWGA 5JPCA 3GZTB 5HZGA 1ZWLA 2AHOA 5FI5A 3K09C 1EDDA 1KDRA 2A8YA 2QU8A 3WRVA 4QT0A 3NKLA 3CNLA 3RD5A 1ZJYA 1SBNE 2VUIB 4BEWA 1NSTA 3AEQA 2FR0A 2RIPA 1BVYF 5EHNA 3N6VA 1JIVA 4B45A 1X1AA 2VQ6A 1FSPA 3F8SA 4DHWA 3AR4A 3EA5A 1D4AA 1G6Q1 1Z6PA 1NXWA 2NSYA 1O9HA 1XRSB 5FL3A 3PCXA 1QF9A 2YOGA 4DMUB 5KCZA 2XNKA 4IDHA 2Y93A 4H77A 2LUOA 1H0KA 3W2IA 2EFGA 2F9FA 1FDSA 3GCZA 3D9QX 4S1OA 1JFTA 5SYNA 2X1LA 3UV3A 2R1ZA 4TZ6A 2O2YA 3R7FA 1BXZA 3KYCB 1BTOA 1M8JA 1C8VB 2O1WA 5BP7A 4CEIB 3BORA 4D56A 3HDQA 1KDYA 2H9YA 5TGTA 3U80A 4FFSA 1Z88A 4B6RA 1T9ZA 3ZHZA 5M34A 1J99A 2PH1A 4ISCA 1IXRC 3KVYA 1TF2A 2B82A 3BKXA 1HXHA 5CLJA 4BLOA 4B6GA 2WB2A 4FFMA 2VHXA 2HSGA 5BT9A 4O8CA 1EJ2A 1DO0A 1SC3A 1C3XA 1M2JA 1QE3A 2FLVA 3ZK7A 4CTJA 2QVCA 1WAMA 3GJ6A 2O8BB 1MW8X 4FDAA 3ZLVA 3W05A 4KN8A 1ISGA 2CDRA 3RAGA 1KMIY 4B2IA 2H59A 2WHEA 1EFKA 1Z83A 4C29A 4M21A 1JT9A 3H1FA 2OBMA 4GMDA 2OCDA 3O8OB 4P86A 4R31A 4Y9SA 2J3KA 4M0DA 5H59A 1B15A 1E1NA 3RS2A 3E22A 3FXAA 2JLZA 1ATIA 4OYRA 1UBTS 1ID1A 3SS9X 2IX3A 3GVHA 3LG2A 2WP0A 2D00A 5L4SA 2GN2A 3AQIA 2P9TA 1E9DA 5T41A 1USWA 4C89A 1V43A 3GD7A 2YWBA 4YMTA 1I3NA 4YV2A 5FHQA 2AL7A 4HDQB 1CULC 2ZE5A 1JYFA 3AR9A 3NAZA 3RK1A 4CU2A 1EAMA 3BE4A 4E11A 5CDFA 1KI2A 1QHGA 3AG5A 5CB4F 2UVQA 4F4CA 2IV7A 3QJ5A 1ZMRA 1R0BA 1EVYA 3HN6A 2X0FA 5JQGB 1VRCA 4QBFA 4HLDA 4JL6A 2VHVA 1SG0A 3COVA 2N0SA 4Q3EA 4G5HA 1M8KA 2MHCA 5J63A 2IYWA 2CHGA 1SULA 3M49A 3NAQA 4C22A 1WDMA 1KRWA 4BNKA 2W2QA 1VL2A 5F12A 1EX1A 1UADA 3P2EA 1TYAE 1Y3DE 2CYAA 3D7LA 2EEZA 4ILEA 3FRHA 3I05A 4F7WA 4O0LA 3CLKA 5FO0A 4A2WA 3U6KA 2QXYA 3R6DA 2OG2A 2C97A 5IKPA 4QPDA 3THXB 2XB9A 1VIDA 3L7LA 4POAA 1S3IA 2ZSAA 2VDWA 3MBIA 3NETA 2HY7A 4PLGA 1RZ3A 1Z4MA 5LWQA 3MWJA 2GZAA 4QOEA 1QHSA 3FZNA 3A8TA 2O59A 5I7RA 3PXGA 3GD5A 3QEMA 3WYAA 1DAIA 4FVTA 4CWAA 1VE1A 4JBXA 1XJ0A 1JP7A 4O29A 1W52X 3QGMA 3UATA 1KPGA 4ARUA 1Q7EA 2B1GA 3AB8A 3I2YX 4JQOA 8AT1A 3IXLA 5CCBA 3S2FA 2IOHA 4WHMA 2EJBA 4PINA 1COZA 3BL5A 1Z6XA 3MLBA 3AEKB 4R1MA 4AG5A 1KI4A 1RSZA 3D3WB 3UJBA 1EFDN 1U8ZA 4RGVA 1A9PA 3IALA 4WVFA 1O7JA 5M5BA 1QFYA 2O52A 1A5ZA 3V33A 2GPYA 1CZNA 3F3SA 4P33A 1IVYA 1MGPA 4HBGA 4JEMA 3WGKA 3CVUA 5H02A 2O7SA 3AHCA 3DLIA 2OL4A 3QX9A 2W2KB 2YIMA 3OFJA 2W90A 3KYIB 4FFOA 1ODJA 4R0VA 4YROA 3QV2A 5E1OA 3SHOA 2E6KA 1DCTA 3U49A 2XDYA 1SC6A 2FP4A 4X24A 3UTCA 2CMGA 4PGHA 3IP8A 4H18A 1GVNB 3C5WP 4ZT3A 1Y7HA 1QYWA 1SO8A 3KZCA 1NXQA 3I9NA 5EIBC 4FBLA 3VR1A 1JIUA 1XZDA 2H4HA 4IM7A 4X63A 3ZK8A 4CMGA 1W34A 1ZOPA 3ZU6A 3K1ZA 5JRDS 2VN8A 3FCCA 3OOYA 4JWTA 2NT4A 2QVBA 1LSJA 1HGXA 4ZAFA 3GPDG 3MOIA 5CT6A 2V65A 1S9HA 3BRSA 1L7BA 3UWKA 5AM1A 2D7CA 3GOHA 2ZP1A 4X90A 1DAFA 5JLAA 4M1SA 1GPMA 2X8JB 3R4VA 4WERA 4JLSA 2UV8A 3S1LA 3TTUA 4D9KA 5IJWA 5FORA 2C7RA 2QDKA 4FNMA 3R7BA 1WVIA 3HDHA 2NXJA 5E9QA 1EBBA 1WKCA 1IOLA 2P4HX 4M6WB 5NLLA 3L7DA 1RAIA 4AY5A 2VKTA 4IDDA 1XZLA 3TD2A 1EG2A 3OIDA 5DM4A 1JTVA 1ZI9A 3MT0A 3VJKA 3UFXB 4CF5A 4K5QA 4PHHA 4TTIA 1RMYA 3ROZA 4EOGA 3GEHA 3PEEA 3BG5A 3FPFA 4WZAE 4GBJA 1E2BA 3AKZA 3N8HA 3T61A 3KS9A 2J33A 2HIHA 4QPJC 3GGGA 2O4CA 2W6JD 4BEVA 4M9XA 4N0PA 4RTJA 2BKAA 1XD2B 5EY5B 1B73A 1Q0PA 1UXGA 2PS3A 3ZI7A 3SR3A 4CMHA 2YYYA 1I8TA 3ICEA 4NXNB 1VECA 3UWMA 4AJIA 1N25A 4ENPA 2ANCA 2WHPB 3P0FA 4RDCA 4RHCA 3TX6A 3WKAA 4CIDA 1FEZA 4FDMA 2OGUA 4UNSA 2E1RA 3JYPA 4JLVA 4NBKA 2IUUA 3G8AA 2VTDA 1L5SA 1PR5A 1HQDA 3S81A 3REQA 1RQLA 3H3JA 5ALNA 4JC0A 1FTNA 4NJOA 4FINA 3O3CA 4MMZB 5JSKA 2YFQA 3PPXA 3ZDZB 1YB5A 4BVLA 4F8EA 4ZCLA 4F96A 2R00C 1QNLA 4JYCA 3X1XA 2DQKA 3S4YA 1CEYA 1MJFA 3FY4A 3K05A 4Q3DA 1L7RA 2PWZA 4JYPA 3HY4A 1HOXA 2R6GA 3L4SO 5KNBH 1W9HA 5I8ZA 5IJXA 4V3CA 2BH2A 1EP9A 2J5QA 3VNQA 2XQIA 4GW3A 1Q1NA 1WLSA 2HSJA 1H8HA 2ZXEA 5IVPA 2A6PA 2PQ6A 4EJSA 4GBGA 2H31A 1EFCA 3QMWA 1CJUC 1XD9A 2O50A 4IH9A 1NQWA 1Y6JA 2BE9A 2ZKLA 1QQ6A 3UTDA 3JQFA 1YB2A 1Y98A 3DHWC 3IP6A 3TIVA 4GOMD 1GNRA 3QVKA 3NBYC 1H85A 4LY0A 4OQXA 1KIMA 2QD1A 1M1XB 1YL5A 3COYA 3F71A 3OF5A 3KTFA 2E37A 3VU3A 4QREA 3TLCA 5TQ2A 3PC3A 4L8WB 1PYOA 1VSTA 2GHTA 4HRYA 4ARBA 1LNZA 3FTPA 5AQ1A 3SZGA 5LDHA 1XL0A 3SJBA 2VEDA 4I1UA 4YDQA 1NQXA 1WQ1R 4ZICA 3GVPA 4DTIA 4R9UC 2PM8A 4CEIA 2FDXA 3ZDCA 1VI2A 2X0KA 5D1HA 4JJ6A 2JK0A 4XIIA 4M9ZA 1FMFA 1R0LA 2QL5A 4MV9A 4QRHA 5A6VA 1I3MA 1OYVA 5TPWA 3HCOA 5IFKA 4EYQA 2ZSDA 2I8CA 3AY6A 1YVDA 4PY2A 3LOUA 4GI3A 3UMBA 2MIIA 5A7GA 3SC3A 5JAZA 3L9WA 1E2EA 2IZ0A 1MG0A 2IJGX 3HFSA 4MVXA 1VSUA 1GTZA 2A3RA 2X4GA 3DQPA 4KQCA 1AUVA 3U4QB 4UAVA 1M8FA 1HETA 2FQYA 4EEKA 3PIIA 2H48A 1I4OA 1PX0A 1A7JA 3A0UA 3PGJA 4IHJA 4TVOA 5LZ2A 5DCYA 1UBJS 1B74A 1PZFA 4N0DA 2ON6A 4FE4A 2BI7A 4LF4B 4BDSA 4YV0A 2FETA 2J48A 3G2MA 2I3ZA 1ZGBA 1E79A 3U09A 2GSDA 2JIZD 2NGRA 4KQ2A 1AQ6A 1Z6TA 2QP3A 4L0DA 3KBOA 1BX1A 1HDIA 2OHHA 3V8PA 1V25A 1JU4A 2DY1A 4L9WA 2ZE8A 1RYMA 2FPIA 4OXKA 1AV7A 1TK3A 3ZY3A 2AOUA 3FHLA 3WSWA 3ASYA 3ANSA 1RBQA 1XR3A 3NBAA 1GZVA 3HJAA 1JYSA 4Z3KA 3YASA 3FW1A 4TGLA 2QW0X 4WOKA 1IHDA 1JN0A 1QKJA 1AH2A 3K0BA 1YBHA 3UOGA 3KQMA 3PFGA 4FYXA 3FTQA 1XB2A 1E89A 4GECA 2XYVA 5ALMA 5HDQA 3SX4A 3P2OA 4GR4A 4OHOA 4N0EA 3LY7A 2NV2B 5DWQA 2BFNA 1J8QA 2HWKA 1HURA 4L2IB 1C7FA 1J25A 2GCOA 3VTAA 1HT2E 4RTMA 2G08A 4BNUA 5E7MA 3N7AA 2K87A 5BWMA 5TF0A 4MR8A 1EXDA 2DUJA 3S2UA 1R00A 3OETA 3PX3A 4OMCA 5ES4B 4FWTA 3T3HA 2QE7A 3DZFA 2GVDC 1R5JA 3UV7A 1QLWA 3BYZA 1AZWA 1B93A 3KPVA 4GWKA 2XDWA 4ZAXA 4DCNA 1JB9A 2MSCB 3BFJA 3P94A 1GT91 3A7EA 2R1TB 2CB0A 1FC0A 1K8XB 3LL7A 5C51B 3W3ZB 5DTEA 5IAGA 1AMNA 4O4HA 2J30A 2XGJA 4W7IA 1CE8B 2G9ZA 3NHPA 3VUEA 1X7ZB 2G9QA 2HIMA 2R2AA 2VL7A 3M1YA 1E2MA 1BE1A 3RLIA 4G86A 3UUWA 4PN3A 5ITZB 4RK7A 2P3LA 3D6AA 1L1FA 5H82A 3PQ7A 2C78A 4LBYA 3B6EA 1BKSB 5LCXA 2R4UA 2O5VA 3I72A 2Y4NA 4Q9IA 4U7FA 1C9MA 1OA0A 3UICA 5DN6D 2L2QA 3GLFE 1HNZB 4K9MA 3KZNA 4M76B 4N1AA 2AMYA 3DBLB 1HDOA 5KOYA 1NBEA 1FFXA 2A1TS 4C43A 4GZ6A 4YCAA 1M72A 3HVRA 1SIBE 2WHXA 1G8YA 2FCAA 3RQIA 2PGDA 1WPGA 3O83A 4TQGA 4K05A 1Z34A 4NBWA 1KSFX 4AKTA 2XCSB 1B23P 2BKVA 2ZBPA 3SSMA 2XV1A 3ID6C 1G16A 3PDIB 1XTTA 1SWVA 1VMIA 2AWNA 3GA5A 1A2QA 4MUMA 5EEHA 5JZOA 1XQ1A 2OE2A 3LDAA 1X1CA 2FNAA 4H6XA 1U2QA 1XCLA 4X20A 4QDOA 1Z5OA 2HLDD 4JB3A 4MRVA 3GH3A 1Y8QB 4KAXA 4FR0A 4RK4A 3DDCA 2Z83A 1HEUA 4QJIA 2PWPA 1JDPA 1V1MA 3EC7A 5DGXA 2WFLB 4Q05A 3Q0EA 3QWIA 1TRHA 4XW2A 1B76A 1S7CA 1C0PA 3VHLB 2IYLD 1K92A 1CB0A 4L07A 3PDHA 4PRZA 1AN0A 2ONCA 3CNNA 3TNLA 2PWAA 4CU5A 1Y5RA 1LA2A 3BXPA 2NW6A 3CVXA 5LQAA 4I6GA 3PWZA 4COOA 1ZX1A 1WU7A 1NFQA 4MB6A 3RUDA 5J4LA 1ONSA 4N3GA 4PV7A 2FRXA 1TZMA 1WBJB 4ZGGA 4LHEA 5ESRA 3DUFA 1VSQA 2HFJA 4ENQA 5L3QB 5IASA 4DLUA 4ACBA 1Y5NA 5HBGA 2C5AA 3GRZA 4WEOA 5EWLA 4OHXA 3FOEC 4PG6A 3H9QA 3CLRD 3ROTA 3H4MA 3WP0A 1EG7A 4G1CA 3QE2A 2QWXA 4MYUA 3KQPA 4ZC8A 1EUQA 1JAZA 3KD3A 1F5NA 1TZKA 2HPZA 2J31A 3HU3A 3SQDA 1GNSA 3B7PA 1R12A 3K6KA 4PYIA 1KYQA 1N1EA 5T8KA 1NW3A 2J09A 1RXCA 3KV3O 4Y8VA 1E1QA 4PZ9A 3PGXA 4KR7A 1A4RA 4BUCA 2ECKA 1DTSA 1Y7TA 2B4AA 3I01A 3G0GA 1QYRA 4MXDA 4JI3B 4EJ0A 2JCGA 2VZ9A 2Z5GA 3ZYCA 3V7FA 1FPQA 5HG0A 4EPWA 2JBHA 221PA 2QROA 2FX3A 4WNCA 3LFUA 3TPZA 3CRQA 3JAWB 2BDEA 1F3LA 1NJFA 3LX6A 2QSUA 1QM5A 1FK8A 3BA6A 3HDTA 3DW1X 3REGA 4YUAA 1NYRA 2YNMA 3WWEA 3DLBA 1JE1A 3W7VA 4ZTZB 4DSUA 5LJLA 2ASVA 2BCEA 2OSVA 3O8BA 5KYGA 2JJ2D 5KYWA 1D5CA 1P9RA 1U90A 3FKQA 1OW3B 4MTCA 3SHWA 4C0HA 5KQRA 2BLNA 4C5BA 2ZRQA 3HZZA 3ROQA 4FNGA 3H9JA 1NDUA 2W5UA 3PQDA 2VIIA 1E96A 4LJ5A 2NU6A 2FR8A 2NYAA 3O3OB 2QN1A 1RC8A 1ULHA 1XV5A 2WWTA 1XE3A 3SJZA 4INJA 1L7XA 3NXKA 2J0UA 3C3KA 2ZYSA 2I5PO 4ZYUA 3OQNA 1H1TA 1NW4A 1P9WA 3ROGA 2ZJ7A 4UOEA 5LLTA 3KQSA 2WR8A 4G01B 3OF3A 2FUNB 2YUTA 3U7QB 4DYVA 5F98A 3GDWA 1QP7A 1MH1A 1X94A 4K9OA 2IUFA 2B37A 4XIJA 1VSBA 1G20B 1PR2A 4KVAA 1LDBA 3VMMA 4ZOBA 1LH0A 1UDCA 3L1VA 4TUYA 2C57A 3CCBA 4IVNA 3VU1A 1WE2A 4ATNA 3PL1A 1PEAA 1FFCA 2O8CB 4IS3A 4NAVA 2X5NA 2FAXA 3DT6A 2C94A 4NAHA 4IJKA 1EXNA 4G89A 3KKKA 3DOJA 1MB2A 4CDRA 4ZANA 2AZ4A 3ILVA 5CVEA 1OB2A 3MCZA 3U62A 2VQFB 4GOLD 3FGNA 3LV8A 4BU0A 2F4VB 4Z7OB 2VTBB 4OXQA 3IJEB 4ZCRA 1R9NA 1Y1KE 4HNUA 2FA9A 1S9DA 1F06A 1F4VA 4W5OA 1RNLA 4TMYA 4PC6A 3C7TA 1QAOA 3FX2A 2W37A 1L8LA 3G7SA 5TDHA 3HL4A 1O08A 1G66A 1YQXA 1DIAA 1P5JA 2ETVA 1TADA 2UZIR 3F1KA 1P1JA 4YDSA 4BX8A 2ODAA 2H11A 4XCVA 4DLVA 5IWCA 4DIFA 1NVDA 2BTEA 2Q50A 2JD1A 2QX8A 3AC0A 5DV9A 3U44A 3IUSA 3TPFA 4EEZA 1MORA 2HRBA 3LX4A 4XIYA 3T7RA 2C95A 2WTAA 1ZAYA 3DV2A 4F7DA 4ZCMA 5B3KA 1CF9A 4OOFA 5EQDA 4ZYTA 4E5PA 3P8ZA 1I4LD 3FWZA 2C07A 1XZJA 3K0KA 4DCMA 1N6IA 3LM8A 1M0EA 2HW8A 4B4VA 2LV8A 4PS0A 2QLJA 2R79A 3CLTD 1EA5A 1O94A 2PLFA 2C8KA 1Y7IA 3BTSA 3E58A 3IIKA 4RHFA 4BWFB 5HKOA 4DRYA 1RD4A 2X0IA 4A82A 4NYIR 1FFEA 1PK9A 2QVYX 1M1ZA 2HOQA 2I4TA 3AJAA 4UNRA 1JJAA 3ZXUB 3EGCA 3C7KA 2I6FA 2JEOA 2Q3CA 3R41A 3MWFA 1F1BA 1JKJA 3HNRA 2IEIA 4HRAA 4JR0A 3X2EA 3RSOA 3IYLW 5AI9A 3TRFA 3L4BC 4A26A 5FLEX 2ODWA 3ZKAA 2G5CA 3QNMA 1XLTC 3CT4A 4N5NA 1GUDA 3CUYA 5ALRA 5JCXA 2NZ2A 4O3MA 2JLQA 3PUYA 3L7JA 4MWEA 4HV4A 4PWZA 3ZDQA 1FZTA 1E1CB 3G49A 4B47A 2PBFA 4LDAA 1G3QA 4A6PA 4A1OA 4QZVA 4C7MA 3UOAB 2ZRPA 3LYLA 4A10A 1I1OA 1TUEA 4LS3A 4CUZA 4QGSA 1O8CA 3AX6A 5FBQB 4C0SA 2RSLA 1N6HA 1YMVA 1KOLA 4E22A 1NP3A 5M04A 2DLCX 2I67A 1A3CA 1VYVA 1LBTA 1F38A 2HGZA 1GRQA 3K6SA 4HAIA 5IMSA 5BMVF 2M32A 3KR1A 3W1WA 1ILWA 5C0OE 1KEZA 4HN4B 4P3PA 2YYSA 2QMZA 4P3OA 3ESBA 2AOXA 2VPQA 3FOBA 4XWKA 3JASB 3TJZA 1AZLA 4RACA 4BQRA 4OI0A 4S0XA 3GHYA 4JXKA 3LW7A 4B4UA 1TU4A 1U0BB 3L46A 2YYZA 5CLGA 5EP3A 1G7RA 2HF7A 1CUZA 3DP9A 4XB6B 3ZHTA 4Q7QA 3BGVA 1IDN1 4LZAA 4NENA 2CVPA 3LIIA 5L9AA 1TD1A 1K4YA 2VNJA 3KQYA 3T12A 4IEFB 3U1VA 1KU6A 3H75A 1R50A 1TUIA 4JLUA 3ZD8A 2I4OA 2LR0A 3I5XA 5IBPA 1UQRA 1N33B 1PYGA 2I6GA 1F17A 4YXWA 3U0BA 1LDGA 1G6KA 5IC6A 4F4HA 2JH3A 4L57A 3R3YA 4OI2A 4YRPA 4CKBA 5H9WA 2HAEA 5HNKA 2XOEA 3NHYA 1G8SA 2P90A 5AI5A 1GGEA 3AZOA 1EUYA 2BPOA 1DE0A 2Z43A 3GRVA 5B37A 4TKVB 4F1JA 1H0RA 4ZV7A 3M5CA 2Q4EA 3IB3A 4C0KA 3ENNA 2JA1A 2P11A 1MABB 4FI3C 4L50A 4LE1A 5F7JA 2JZOA 2FPWA 3HJHA 4PCLA 3A1WA 4G9GA 3MM4A 5BSMA 4D8YA 2HU5A 1NY5A 1QGAA 4HQLA 2NNLD 3F3KA 1N7GA 4H3HB 1U0NA 3HCFA 3NRBA 2I2BA 3LAWA 1QU2A 1YVEI 1E4OA 1RP1A 2IDJA 3C97A 1P3JA 4AP5A 3WJ1A 4AZSA 4DARA 1VP9A 1X2BA 2XXBA 4OQYA 3KHKA 1CUCA 4V0KA 1LPNA 1E61A 1MNQA 1EVEA 2J6CA 4Z7NB 2AOWA 2C4UA 3D4LA 3JRXA 2WABA 3MXOA 3BHNA 2B6HA 5MGBA 4EB6A 5JYDA 1OOEA 1AB6A 2EYQA 3I9MA 1QS0A 4N8DA 4NJMA 1GL6A 4X7RA 5LJIA 3WO1A 1E2QA 1XKLA 4I50A 3JWHA 2QTLA 1U6JA 5EKUA 1XZEA 4M83A 4F2HA 1I7QB 3KETA 1SC1A 1HY3A 1GDTA 1IRXA 3PWKA 1ICEA 4RO0A 3F9IA 4ZOEA 3SOZA 2OV2A 2JGKA 4TMTA 1K0UA 1JDBB 4YJ3F 1EFLA 1QCCA 4BVHA 1A5BB 4EY6A 3PEUA 4Q1FA 2BFWA 1IY0A 1R4MB 3LDHA 3OPYA 1FS4A 3MTGA 4RXUA 1W85A 3DC2A 3OECA 3WGGA 4C5CA 5IU6A 5LQJA 4FMDF 1T6YA 3SLGA 4TT3D 4C01A 4D4IA 1QRAA 2RJOA 3JARB 2MSEB 3CLHA 3HB7A 3ICVA 3F8WA 4K6MA 4NIMA 4X7BA 3TVDA 1D6SA 2F9LA 1LI7A 1AM4D 4RK5A 4G0MA 1OAKA 3CZ5A 4RLFA 2H2DA 3IURA 4Z0TA 5KTRA 2XY4A 3OA0A 4FS8A 4UHKA 1CZLA 2A78A 2X4IA 2XECA 3VU8A 3BC1A 4S1WA 1IG3A 3IOYA 2V03A 3KDAA 3HBLA 2J59A 4H7JA 5CH5A 5E0KB 4QM7A 3AESA 4NBUA 3IKMB 4YAIA 5C35A 2FDCA 2SBTA 3AM5A 3SE7A 3ORRA 1W0KD 5T4HA 1M54A 4XFDA 3U56A 3GDHA 4Y1RA 2YMLA 4U9HS 1HA3A 3MZ0A 4F45A 1DPFA 4YP5A 1UXKA 4BVBA 3CY6A 1A77A 4DADA 4XYMA 1GPUA 2CC2A 1LVUA 1V8BA 3ZWNA 1EGAA 3ZW9A 2FHPA 2Y2VA 1NBHA 1DXYA 2YWCA 4MA5A 2FWBA 1VLLA 4U2FA 5DISB 2H85A 1U1IA 3V2GA 1IZ8A 1L4KA 2X2FA 3HZOA 3U4IA 2WWIA 1JWLA 1Z8DA 2IYXA 3BFXA 1VGQA 4HDNA 5LUBA 3FYUA 4CFYA 3OZTA 4NHEA 1KWKA 1ZRMA 5ESDA 4N54A 3H4IA 3H97A 1PUXA 2CLOB 2F1OA 3WSVA 2JI8A 4LJ8A 1K2WA 3KCNA 3FVVA 3NNSA 1GGFA 3LHFA 5SYAA 3VR4H 4RZSA 4RETA 2FK8A 4N0QA 4PRKA 3FA2A 1I6MA 3CMCO 5L45A 3BWMA 3ZQKA 5A71A 1T25A 1C81A 1GYRA 3JVUA 2PU7A 2YVAA 4YECA 5ENZA 3HB5X 4JOQA 5JJIA 1AKNA 4EX6A 1QLJA 4K3VA 2VUUA 4JT4A 1Y3FE 5HIKA 3C5CA 1T9DA 4ZPJA 2IXDA 2POCA 3I8SA 1YDEA 3DZGA 4IZ6A 3A7DA 1D4ZA 2YIJA 2AW3A 1OKKA 4G0NA 2O2SA 3UG7A 2NAPA 4ARAA 2IITA 1IN6A 2G5PA 2VF8A 3ZZNA 3ESYA 4L73A 4O4JB 3HWWA 2ECQA 3I3SR 3ISJA 3NHZA 1M1YB 2OBFA 2B35A 1CS0A 5DLEA 5EHXA 2IU3A 2NUTB 2WIDA 1EK6A 1OHHA 3ZD9A 3MMSA 1P2GA 2VJAA 4AS3A 3U3KA 3QU5A 3T3MB 1J5EB 4QLAA 3OQIA 4EHLA 4ZI7F 3L8ZA 1PL6A 3JD4A 4IMIB 4P0TA 4AAYA 2HJWA 3EMBA 5AKKA 5IC5A 1NE7A 3FUCA 3WGLA 1PUJA 3MN1A 3E7PA 1A2KC 1EWKA 1P31A 3MJCA 3IP3A 1R1DA 3NONA 4PBRA 3OMLA 5CFMA 1A9ZA 1I7DA 1SVIA 2ZBFA 3OFND 1UBHS 4OQMA 1NPTO 2Y0EA 3A11A 1YE5A 3ZS8A 3GRCA 3WLQA 3JV7A 1OASA 1GPWB 2VSOA 4UTZA 1XLVA 4PO1A 2YVKA 3H2SA 4XE5A 4G85A 3MINA 4ZAYA 5LYJA 5YASA 4BLSA 4E5SA 2SICE 1SCAA 3DGEC 3FTDA 3O2SB 4H7DA 4M8KA 3GUVA 2R60A 4LHWA 4YRGA 4RULA 4U6QA 4CYMA 4U1RA 5DT9A 3ZGOA 3DE1X 1WETA 2B4RO 1JLLB 3ZIAA 1WCWA 3FFAA 2R6JA 3I83A 4QWMA 1SG9A 4EZIA 4OJQA 1FBTA 5DSTA 3RS0A 3GMTA 3NJ4A 3IPXA 5EERA 4TYYA 2P6OA 3Q9NA 4WZAA 4LDRA 2FWAA 5E4TA 5AYVA 3DZBA 2ZW9A 2OZVA 4RW0A 1R5NA 2W6CX 2GERA 2HK6A 3WLRA 5CD9A 5HX7A 2D1TA 5ALZA 2LWIA 3NHKA 3ELBA 2OA0A 1ISFA 4EY7A 3RFUA 2X1MA 3HYLA 4HNRA 1SCIA 5AQEA 4EPXA 2PMKA 1HYHA 4PZPA 1JUDA 1I0IA 1SXJD 1PT6A 1YL7A 4AJLA 1P7YA 3C2QA 3BWDD 2WHQA 2M6RA 4J75A 3UQYS 1WO8A 3B52X 4ZZ1A 4DMFA 1RCUA 3LTEA 4ED9A 4EGCB 1J1IA 4LY9A 4KL8S 5JQGF 5JT1A 5JTUA 3QBVA 4HEJA 2DMRA 3KTDA 4J3JA 1YH3A 3GHHA 1KSHA 3PHLA 3BWXA 3RBAA 3ZLJA 3HUUA 1GM5A 4NTZA 5I7EA 1ADGA 2H54A 1UOQA 1QTRA 2HDOA 3I0NA 5EE9A 3RIMA 2C5LA 1GPH1 4RU1A 4BFCA 4IJWA 3ANLA 4R16A 2BD0A 1G2QA 4REQB 5ILOA 5E9JA 1O95A 4DXAA 4Q7JB 3WLEA 4WCFA 3ZY4A 1I0ZA 4MQ4A 3RHZA 2VJNA 2JFZA 2R1VA 3SSAA 3QUBA 3K70B 3K0EA 3VVMA 4KQKA 1CUYA 5T6BA 3UHOA 1XZ8A 3T15A 5L3SB 3BA1A 3AUSA 5TQ0B 2WIFA 1Q7CA 3G13A 3KK0A 2WFAA 1MC5A 1C9DB 3F96A 1SCJA 2IXEA 3S6JA 5JZSA 1OGJA 3H99A 3NBKA 1NFFA 4ZHQB 1CEXA 1OAOC 3MGGA 1KP3A 1IAVA 3PDUA 3AUXA 4RL4A 4CKWA 3SMQA 4EDFA 2VHUA 1FFDA 4IMJB 1K75A 1AXEA 3O94A 3CQ9A 2PUWA 2PL5A 2X9GA 4XM2A 3PR2B 1IEXA 3LP5A 3Q9SA 3OEEA 1FVHA 2YS6A 2UYGA 1SUAA 2CF5A 4XLLA 1KSGA 1X8LA 4D96A 5DNWA 3EG5A 2Q2OA 3H1TA 1WZCA 3MUOA 4Q9DA 2B5WA 1JFLA 1NJ2A 4BO7A 5KOHB 3QHPA 3IUJA 1MAVA 2G09A 2PYIA 5BSEA 1XMPA 1ZVMA 1JDTA 3Q1KA 2GJ8A 4G07A 4IGAA 4BIIA 2FV8A 4CJXA 2Q2NA 3OJXA 4YLGA 1L5NA 1N7HA 2A33A 1XNGA 5KUTA 3ESCA 3OZCA 3WLKX 2GGSA 1JEAA 2HMVA 2CB9A 3KQVA 1TA0A 2ATCA 1PCXA 1FY2A 2GZDA 2J4DA 2W2NA 3E9RA 1NWHA 1ABFA 1GFIA 2GPAA 3EH1A 3PYMA 4TV9B 1VQ1A 3HV2A 3NIBA 3TMAA 4A4DA 2O8DA 5ALFA 2ZQZA 2EZ9A 3STWA 3OX1A 4DMMA 2CSUA 2WSSA 4W8OA 1XVTA 3GRUA 1TDJA 2P8SA 3DOCA 4WXPA 1GRNA 2ZYTX 4C6TA 4CVNA 2PQ2A 4KO1S 4NFYA 3V4ZA 5ICMA 4YQEA 1ZA2A 2VZEA 1QWOA 1U11A 4QU5A 2IE0A 3ESRA 1V7PC 4MRNA 1ZPDA 3EAGA 1HBJA 2AEFA 3JR7A 3QFSA 3QMMA 1O5IA 1PV2A 2CHQA 4KQ6A 1H5NA 4W9RA 5BR8B 2V74B 2X0RA 3JWGA 3M89A 4AY2A 1LZLA 2QYSA 1JPUA 1YD7A 3LU1A 4HO1X 3C16C 1QQBA 3HLTA 4ZK6A 4OHCA 3N86A 3PICA 3VU9B 4MO2A 3FSJX 4QPZA 3ZLUA 5A3JA 4MWSA 4DEYA 2VJDA 5I9BA 3N70A 1ODFA 4KPFC 4F0JA 3AUFA 3VKUA 3Q7EA 1WD5A 2R7LA 3RVPA 4YJHB 4GP6A 5G0UA 4ZYLA 1JIXA 2UDPA 4RZ2A 3ZD6A 5B1IA 3UAXA 1WG8A 1GZ4A 1YCDA 2J0EA 3DKPA 4JP5A 3TLXA 2DCMA 2RAVA 3WO0A 2PUCA 1VCHA 4JENA 3PFKA 3MBKA 4JVLA 2NVOA 3R0JA 3NAMA 3N28A 2FW0A 4WXEA 4PPQA 1H23A 4A0FA 1H22A 4BZXA 1KSJA 1YWGO 4D7AA 4YCCA 4MV5A 2PE5A 1JIIA 1SZCA 3SYMA 1DMSA 3OOHA 1KVUA 1OZ0A 3E9DA 4GI7A 4EBFA 4WXHA 3DONA 1J33A 1CDEA 3NANA 3H83A 5C7IO 3RVQA 2QRMA 2A1UB 3AIOA 3E03A 2YBEA 2BBOA 2PT6A 3A1NA 1MO2A 2P9ZA 5C4MA 5K6TA 3WHLA 3WLNA 3RGWS 3HR7A 3VKVA 4CKEA 1V3QE 1QIFA 3LUDA 3S70A 3FNBA 3GLGB 1JH8A 4YUWA 4XB2A 3ETHA 1Q0RA 4OGWA 3WYNA 4P7FA 4O1HA 2DR0A 4XSHA 3NU1A 1ZMXA 1KVTA 2VYVA 3NH6A 3UT6A 4D9MA 5ICSA 1BU8A 2ZBDA 1XJCA 2XAAA 3UW3A 2EGGA 1RLUA 4Y2QA 3RRBA 5BOSA 4XFJA 2QTHA 3EYAA 4D0GA 3QXCA 1OXSC 1P5FA 5IMBA 2IU6A 3RV4A 3OLCX 3RYIB 2ATEA 3FIJA 4OHYA 2F8MA 5DHUA 2IDZA 2C2KA 2ZI6A 3R20A 4HDAA 1E2LA 5H3LA 5K20A 1T6XA 2CHEA 2QUJA 3ONFA 3L0OA 3ZTYA 2G71A 4EQZA 3SJUA 1K5HA 2PUGA 4EA8A 4LA4A 2REQA 3BE5A 3DO5A 3LC2O 4GGPA 1P2BA 4HXYA 4IZOA 5HZMA 1XDSA 5G0VA 2H4YA 1VBFA 4J3NA 1OXKB 2H1OA 3HI6A 2QRGA 3EIWA 2W2MA 2FFBA 2FY8A 3RWOA 2FPOA 2G1AA 1HH4A 1INLA 3QQ5A 4FHEA 3T7TA 3VO8A 4J1QA 3X43A 1CDDA 3R0IA 3ZJ5A 4JSYA 3P1JA 4AN4A 1PJ4A 1KQ3A 2IY7A 2OCBA 5GQSA 1NBIA 3C7CB 3A2NA 1XRJA 4UM7A 3EEOA 4WACA 1FMJA 1MHPA 5ITVA 4GL4A 4RKQA 1QLHA 2C5SA 4CZ2A 1Z7YA 2P78A 3DZDA 2RK6A 1MRNA 1OR8A 3CLSD 4R68A 2O0HA 1YOBA 3L6UA 5BQOA 4KOEC 3V2HA 2X8BA 5DPMA 1PZXA 5C34B 4C4SA 5KINB 5IYZA 1UQTA 1MXHA 2WKPA 3Q1LA 2QT9A 1YNSA 3D59A 3IP7A 4TLCA 3EZFA 5EWMA 3VPXA 3T1NA 3M34A 4G25A 1R6AA 5ALPA 1KDZA 1NMEA 4B3FX 3DZIA 1TIBA 3DB2A 2B4QA 4LPSA 2EF0A 1C0IA 5M2QA 1N6NA 1O1YA 2GK4A 4AJJA 1W5EA 4E51A 1H2HA 3O4JA 2XVMA 4MS3B 3LC0A 1HSOA 3QW4B 2BGUA 4JL8A 5F2EA 5KMGA 1N5LA 3EXEA 1S2MA 5FEMA 4N12A 4CM4B 1TQDA 2QU7A 3ETGA 3DFZA 3N5CA 4QATA 1VSVA 1ZR4A 3SF8B 2OWEA 3NWOA 2P0YA 1WP9A 3FAZA 4JUFA 3VYUB 3QBJA 3R0XA 1FQOA 1Q44A 3CZPA 3NT4A 4J0CA 2F90A 4JLKA 3WG9A 1N6RA 1ZRNA 2NYUA 2PDAA 3FM9A 4E33A 5ICEA 5JNSA 4MRAA 1XKTA 2X2EA 4H7FA 5A1TA 3OH8A 3TSAA 1XHLA 1Z8NA 4IYJA 5ALKA 2J6BA 5BN5A 1UBMS 4ROSA 2VDLB 1NXSA 1UODA 2AFIA 1U0EA 1U9YA 2HSZA 3LBAA 2ZYDA 3ZGXA 4XSGA 2JCXA 3FG9A 1A04A 3VNRA 1NG9A 4LHSA 2AR0A 3T7CA 1OC4A 4ERXA 4BB9A 4LJSA 2ZIVB 3P2YA 1PJZA 1Q0UA 4V0OA 4CMIB 4DCTA 4V1CI 2BV3A 4M1TA 1K3TA 4WSOA 2VAVA 3MCTA 4BP8A 1A5AB 3A25A 4Q03A 3ZHRA 1W4ZA 3HJBA 4R6WA 4ANFA 5IVKA 4F6LA 2OR3A 4EKYA 5AJVB 1U5AA 1Q1AA 3DDZX 1Q3TA 3HS3A 4XLZA 1DXOA 1BAPA 2UUOA 1W73A 1XGKA 4FHZA 4O59O 4AF6A 4YAJA 5KWSA 1KPHA 3R3ZA 4WQMA 3QHQA 4AWXA 2X4LA 2ZREA 5EZ5A 1K3UB 4K0KB 5IN5A 4JITA 5K0JA 2XEDA 1R0XA 1WDTA 2D62A 3TFQA 1E98A 2DLNA 4AFNA 1YE3A 4LF8B 3LFTA 1GL3A 1COWD 2GILA 2R4QA 1SEPA 3BFVA 3I92A 3O8LA 4HAYA 5DM0A 2VF2A 4O0MA 5ESWA 2E4XA 2ZRKA 2E87A 3G6WA 2D7JA 3HZHA 4MVJG 2C2GA 1M6HA 3VISA 2OBLA 4J0EA 2CLMB 5A5EA 4BQPA 4XUGB 3IR7A 5CG2A 3OZUA 5FWDA 1OAAA 2Y05A 3AKCA 4HSGA 1EEXB 4RKRA 3GP8A 3IKVA 4NK4A 1JMKC 5I9LA 1BE0A 2C3MA 3CVYA 1SVWA 3E27A 4F04A 1I6KA 1W0CA 1ZCZA 4G37A 3B60A 1BHO1 1H9AA 1Y1RA 2YFYA 5JR3A 3SC2B 1YA6A 1O6FA 3I8XA 1GG8A 1FA9A 1NQVA 2CLEB 5AHOA 5BN3B 4GMKA 3AY3A 3QITA 3MD9A 1WR8A 3AF0A 1SHKA 2J5KA 3CLRC 4GEGA 3UHAA 5I51A 3KL4A 4RYDA 4M9CA 3V3KA 3PDCA 4TXLA 3SEFA 1A1VA 3FUTA 2JLAA 2H17A 2GZ3A 3WHPA 1PQPA 2GRAA 2QRPA 3OMWA 1IG0A 4KAJA 3H11A 5U4XA 4WFJA 1PIWA 3X0DA 2X6TA 4DT1A 2XD4A 2X40A 4O4IB 5KYUA 1E0SA 1QGED 1WSDA 1NW6A 4KK3A 3UA3A 5TE9A 4BN0A 1R8SA 3QE0A 3TLBA 3V6LA 3RJ5A 4IAOA 2WYUA 1O94D 2F62A 2I87A 5JH7F 3IEVA 2Y0DA 3HKEA 1MGOA 1VLMA 2FE1A 4PQFA 2Q4BA 5EKDA 1SKYB 4JNKA 3AEQB 2D5BA 1XEAA 3KKNA 1W581 2A7XA 4DA8A 2IELA 2K7ZA 5FTMA 5LA6A 3D4BA 3ZHVA 4DF3A 1TM1E 4CXMA 3C5VA 3BD6A 4IF6A 4DPKA 5BRAA 3DMPA 1ESZA 1VBNA 2CN1A 1LJ8A 2VP4A 2JI4A 4A2QA 3LPAA 4FD2A 2VPPA 1WPXA 1MJ5A 3JVVA 4I5EA 3GRPA 4QT4A 4CMEC 2YDXA 3EVEA 2A0UA 1KDPA 3FNIA 1UKCA 4AURA 3NQ41 4BMSA 1ESCA 1U0TA 1KZYC 4P0QB 1DU4A 1CQJA 3DR3A 3WYGA 4AJ2A 4ZWNA 4CV3A 3QU4A 1TCVA 1LK7A 2P91A 2NO6A 2CLLB 3DEFA 2Q41A 1GDDA 1D1QA 1R8JA 2VF4X 4H1UA 3TL6A 4BX9A 4DLAA 2Q5JA 5IJAA 3DE4X 2BBSA 5EE3A 4Z53A 2G76A 2X8AA 5EWJA 1DKOA 4OQFA 2NZXA 1GWNA 2YW9A 3QLEA 4GBMA 4QJ5A 4LIPD 3VNUA 3BIOA 3CW9A 4TTJA 4WFKA 1JILA 5EUBA 4M4SA 4HXFB 4JCOA 3HB4X 5FADA 5IJ9A 3RRYA 4D74A 1IAQA 4W9MC 4I9GA 1QHEA 3LGSA 1N7IA 5CEJA 1EQAA 2DP4E 2GHQA 2OV6A 4A1FA 3ZWBA 4ZQCB 4PYRA 5ILGA 4CV1A 2C1EA 3C6BA 4JGIA 2FEPA 1UBOS 2VPIA 1E3WA 4X7PA 2D1SA 1Y0BA 5CIYA 1N57A 3W8FA 4UM5A 4XVRA 3Q8KA 4ZT2A 4Y2RA 1Z4OA 1OY1A 3F7TA 2CDAA 3KXKA 1A9XA 3P4XA 2CXSA 2HQSA 4OM8A 3AIKA 5CBPB 1IHXA 2Y1EA 3JQBC 4JVMA 1R2QA 2IYFA 3CKYA 3E22B 5D87A 8ABPA 1YTLA 2FLKA 3ROMA 3HJTA 2I2DA 4FJ0A 1JHRA 1ZCBA 4YXWD 4EVSA 2Q7OE 4D26A 2YW2A 2XXJA 2A30A 4NYJR 5FPSA 1OYYA 3IUNA 3MRTA 5K7SA 1X0XA 2YQ5A 4PQYA 5KC9A 3CVJA 4YDHB 4BKOA 2AJTA 1P2VA 2RBEA 4A91A 1EDOA 2CFCA 2IZ7A 3IAHA 4WNYA 3DOHA 4Y9UA 3TW8A 4Y67A 4BQSA 4DLRA 2C2MA 3F4LA 1QMGA 4RA9A 3SIRA 1AKEA 2H29A 3RTCA 4MR9B 2H5EA 4M8SA 1WKBA 4G5OA 4PG7A 2B2XA 2OGTA 2YY5A 2ZETA 3WS7A 1X0VA 1FXSA 2E1PA 4BGVA 4Y7DA 1C3JA 1C7ZA 2PL9A 3GMSA 4D3YA 3WGIA 2E48A 4YJDA 2HMYB 3OHMA 4EZEA 1D0IA 1Y42X 4B35A 1TEXA 4GLLA 2VJYA 4IFEA 5SZHB 3P0JA 1TIPA 2OTCA 3NCTA 3T7EA 2XKKA 4MYDA 1CR4A 1YZFA 4EKDA 4AS1A 1PT5A 4CDMA 1VDZA 1WXHA 2J7PA 1IN1A 3B6IA 3MB8A 3CLTC 4QDXA 1YB1A 4ND7A 4JB2A 3BK7A 2Q21A 3AMVA 4AYXA 2XNSA 4M53A 4Y2XA 3SLRA 4DHEA 3U1BA 2VDWB 1R37A 2NXCA 2Q9CA 3PQFA 3ZOKA 3ANTA 4G5RA 3EQ6A 5FJIA 1AA9A 2GM9A 3FUWA 4KFUA 1YKSA 2X1HA 3EXHA 5LQSA 4LJRA 1PQWA 1NAIA 3U3ZA 4FHFA 4R1TA 2XOKD 3G85A 3QEMB 4MLCA 4PFJA 2C00A 1Z28A 1ZINA 3PJFA 3NG1A 3QBEA 4JFRA 1UPFA 1JHVA 2FK7A 3B70A 5HUJA 1XROA 5LZ8A 3CVWA 3OEYA 3MYRA 3VPGA 2Y68A 4DEVA 1FYEA 2ZJBA 6REQA 4BVGA 3BH7A 3VBEA 3GLKA 5AM4A 4EB8A 2UYCA 2PO5A 3LDGA 5C4GB 2YZGA 1I0LA 2Z5VA 1QTNA 5CYGA 3IAS6 2QSZA 1G2OA 1HL7A 3VR2A 2XB4A 5JSUA 3FR7A 4JYZA 1FTGA 4JGBA 3REOA 2IDKA 4NMMA 2H1RA 2VLIA 1CG6A 3W2FA 4HEQA 1F2VA 2MSLA 1LVHA 1P81A 4L4ZA 5AR1A 1D6JA 2AG8A 1EFUA 3ITDA 5CA0F 4W1QA 4UU0A 4E2ZA 4S04A 4V03A 3ZJTA 2FP4B 2BGGA 2IGBA 3EZ6A 4BMCA 4EHNA 4HAZA 1SD2A 2JJ1A 5JCOC 3CX7A 1QANA 1WQ3A 3HA7A 4URVR 1E2PA 2BE7A 3R6LA 1NZJA 3SGLA 4U5QA 4IDEA 3H5OA 2W48A 2O8EA 1N2IA 3SU8A 1I4EB 1NN0A 1HSZA 2OM6A 1T5SA 4ZO6A 4URUR 4J43A 5AIAA 4D9CA 1TM2A 4YDRA 5FYQA 1K86A 4AYWA 2IV2X 1HE1C 5G3ZA 2CD9A 2NSHA 2QHXA 2QZJA 3BMCB 1H4TA 3AFHA 3PUKA 4RWEA 5KPDA 3ZCVA 2C5EA 1WMSA 4KE8A 3AUTA 5F35A 5JRZA 5B7GA 1HLDA 1N6LA 1YL6A 1P4RA 2ENUA 2MTBA 2ZTMA 3MRSA 2CNWA 2QM7A 1U98A 4FZ3A 3T35A 4EFLA 1B0AA 3S2YA 1SPBS 2G06A 3P9NA 4DA0A 4LV8B 4Y2PA 3VOTA 1NVEA 3ZEIA 4C21A 5LKAA 4HAVA 1RJFA 3KYDA 2I3AA 1OTHA 1TAQA 5A0TA 3MCWA 2NG1A 2VATA 1YR2A 3FETA 1DLIA 2ZUWA 1M66A 2DPLA 4UEQA 4QNRA 3UN1A 2OXEA 3M2TA 2C0PA 1OE0A 2O23A 3DF9A 3DLPX 3T5CA 5AM2A 1EIWA 2J9RA 5AW5A 1F6BA 4FFVA 1S2DA 3NP7A 5HIMA 4EF4A 4F1KA 1OKKD 2INGX 1FVXA 1L3BA 1JDVA 5D5QA 1IY1A 5CVJA 3PJRA 3PFWO 3TGWA 4Q3NA 1UUFA 4RQUA 1OPRA 2BGWA 4XOUA 4DQUA 3ERCA 1X39A 3JU3A 2XYPA 3CB4A 5KQSA 1EUDA 3TQRA