4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
4HAVA 3K0AA 1U90A 4A0GA 2RGAA 2F3RA 4HATA 5KU1A 2DR3A 2CNWD 4TLEA 4ZO4A 4LJ5A 2GJ9A 4HB2A 3VFDA 3FTQA 5GJCA 4LWZA 5IF9A 5SZJA 1W36C 4KVGA 1K6MA 1VYUA 1XZPA 2MSEB 4RY2A 3RC8A 1KOFA 1VKJA 3AUYA 2IYYA 2ZPTX 1YVDA 1CRQA 1E0JA 4ILEA 3GCGA 1LVGA 4JL5A 2W58A 1UBEA 4EDHA 4I1OA 4ASUD 1XTJA 1P4SA 3GMTA 3VHLB 2A2ZA 2ZEJA 2Q9BA 4PPQA 2RH5A 2XSZD 2XTMA 1KY2A 3AVXA 1RC8A 4YMSA 4IVRA 4JKYA 1YR8A 3CIOA 3FWYA 5FOWA 2DWOA 4IOJA 4DSTA 4EIWA 4W7SA 2F1JA 4IXMA 1W7AA 4PHFA 3ASYA 2VL7A 3GLHE 3VHXA 3L8ZA 1R2QA 3KUDA 4LI0A 4HZUB 4GRAA 4JZKA 1OKKA 1ZD8A 4ZIRA 2ZANA 1M7HA 1U81A 1ZW6A 2ANBA 3MGCA 1E0AA 3EZ7A 4TQUS 1U0LA 2TMKA 4JLPA 5E7JA 4F92B 1QF9A 4QBHA 2N42A 1KNQA 2W2VA 2ORIA 4TT3A 1EFCA 3NIBA 4B33A 3NBYC 1T6NA 1ZYUA 3CBQA 2IF0A 4HLUC 3RDPA 3EW9A 1KK1A 5BWMA 2QP3A 2CNWA 4EJSC 1KHTA 2CLCX 3VR1A 3W8RA 1G3QA 2IX3A 1XU4A 4KCGA 4TMVA 1N6HA 2ODBA 4XSHA 4ZDWA 3AH8A 4BLRA 2CJWA 4QJ5A 3EPJA 1M6NA 1FL9A 2VIIA 4A8JA 3F8TA 3ZJYA 1E4VA 5DISB 4EKDA 1NMYA 3RABA 3MWLA 3L43A 4KAXA 4D0NA 3SEAA 4DLSA 4E03A 5JJLA 2ZE5A 2QE7D 4ASUA 1KSHA 2GWHA 4DHEA 1GILA 4MKGA 4QHYA 2VTKA 1Z6GA 4MRSA 1M7BA 2XSZA 3SHFA 2GETA 3WMFA 3THWA 2Z83A 5L8VA 4MH0R 1W44A 2CL6X 3S1AA 1II8B 3SFZA 5L3RA 5HR5A 4HLCA 4Q4JB 4UKDA 5FR2A 4JLMA 4UXJA 4XD7D 4MKHA 1TF7A 1XF9A 4AK9A 1J7KA 2FMXA 4JYBA 5CDFA 3QENA 3GFPA 1JQLB 3K09C 1V43A 5C4GB 1XJ0A 2ZS8A 3O8BA 5JMTA 3B1XA 3IBGA 4NH0A 1KDRA 1G8HA 1XXHA 2QMHA 3E1SA 5AUPB 1TNDA 5BN3A 1ZNWA 3HR8A 4ARZA 3K70D 1GWNA 3CWZA 3MD0A 4KSCA 2VQSA 4D80A 2QPAA 4RZXA 5KNBA 3BIFA 5A0FA 5G40A 3SR0A 1JQJC 2DFLA 1DE0A 1Q1EA 3CW2A 4KFUA 4RKEA 1CEEA 1CULC 3IIKA 5BN5A 3KQKA 2P0EA 1CR0A 3PQCA 3LX8A 1LTQA 3AB3A 5FBQB 1FP6A 2IYXA 3PVSA 1TF5A 2V3CC 2BKUA 2HCBA 2VPPA 3RC3A 5JI2E 1NJFA 2F43A 2IHBA 1OH6A 3LA6A 4JKIA 3LQRA 1KKMA 1Z83A 2NQ2C 4U5XA 4MGYR 1ZRHA 4DC9A 4EPVA 1E9FA 2QE7A 3VKWA 2JA1A 1GNQA 5TDHA 5IRCD 3GLGE 2VHQA 3DM5A 4C3ZA 5FI1B 2C8VA 2C99A 4DUGD 3ND8A 4URZR 2XB2A 3EZ9A 1WDTA 4RVCA 4TTRA 3FGNA 4LJ7A 4ZCIA 2AK2A 1SXJC 2BMEA 2F7SA 3T5DA 4DT1B 2JLWA 3QKUA 4LJ4A 1D8TA 4A8JC 4XD7A 4FMCB 2OILA 2DCUA 3TQFA 4DCVA 3A1SA 3CRW1 3VKHA 4UQOA 1T8TA 5HCNA 2IXFA 2O8FA 2FFQA 5SZKB 3IHWA 4BLSA 2UVQA 2VF8A 2HDNB 3A1TA 4M4SA 1DTSA 3AVOA 4PC6A 4JBYA 4Q19A 1XTIA 2D2FA 1DVRA 4B34A 2JJ1D 3U2QA 1YQTA 2W83A 4ZV4A 4IEEA 1YZNA 3A4LA 1G5PA 1QVAA 2VO1A 2NIPA 3ZD7A 4B75A 3RHFA 8OHMA 2H7VA 4QNMA 2ZJ5A 2AHOA 2IYUA 1QHYA 2XJ9A 4V0ME 3PJRA 1EFHA 1W1WA 1Z2CA 1DEKA 4B48A 4BASA 2BDTA 1E2NA 1TMKA 2WOOA 3NC0C 4AYTA 3BBPA 3N2IA 5FFMA 5G53C 2GXAA 3GJ4A 2E1RA 2JLUA 1E99A 4F4JA 3CF6R 3TK1A 3EIQA 3IUYA 1GDDA 4NYJQ 3DL0A 4RD0A 2FJUA 1QHGA 1Z6YA 2OXRA 5BYKA 4H1UA 1EXMA 2JAQA 3A37A 4RJLA 3IEVA 1TL7C 1KJYA 1NSTA 5GJBA 1FX0B 5IDVA 3UMSA 1VG8A 4PO9A 2F1IA 4TSFD 4LC1A 4A2PA 4DUGA 4QM7A 3K0FA 3TE6A 3W34A 2WWGA 2GAAA 1W4CA 2FF7A 1RYHA 2JLYA 4YMUA 3KQHA 3VTKA 1ZCAA 5KSPA 4URWR 4UXIA 4C7OA 1VCIA 3A58B 4QC2A 4UNRA 2F55A 4ZDJA 1QG2A 5FR1A 2JLVA 1Z47A 3Q9LA 5JS7A 3K0EA 5JCZA 1LV7A 4D4JA 1E9RA 3EARA 1EX6A 3CX8A 4AKIA 1JAHA 5E4FA 4PHHA 3NBFA 1E9EA 2Z4RA 2JJ1A 4QL3A 1E2QA 5F3WB 3WYAA 4UXHA 4MUAA 2HF9A 5F2EA 2CDNA 4O0MA 4R2IA 4M2LA 4LHZA 4XTRA 3RANA 3W6PA 2GVDC 4LV6A 2J46A 4XH9B 4OKSA 3FPAA 2CVFA 2QAGB 4YXWD 1RW4A 3RRYA 2N46A 1UF9A 2C04A 3AGPA 2A5GA 3N5CA 1HUQA 4ARZB 5GADl 3CNLA 1XD2A 4DIEA 2QEQA 1ONBA 2GJAA 2X2EA 2GRJA 4US0R 3QNUA 2AWNA 5J47A 1X8JA 5JWRA 1UKYA 2XZPA 3NXSA 4AWXA 5JHHB 2OAQ1 4NPHA 1UBFA 4QJ4A 3DM9B 5F9FA 1A5TA 5FTKA 3CRRA 4R71A 1MR3F 4WXPA 3ND9A 1TQDA 4M53A 3MWJA 4L4UA 1OXTA 1KI9A 3C5CA 4GI7A 3W9YA 3QEJA 4JYCA 3OF5A 4EFLA 5J4YA 2FGJA 1W4RA 1XBTA 3R9IA 2OEPA 4RFVA 5HKKD 1QZXA 4RFSA 1MKYA 2REXB 2H8KA 1G6HA 4TSFA 2QL6A 1W47A 1P2SA 1XEXA 2WWXA 5BYJA 1R4AA 2RGEA 2OO7A 2X1VA 3Q5EA 4LBZA 2OBLA 4FCWA 1M8PA 4MYTA 2BBOA 2IEYA 4QGGA 4E22A 1I4DD 4D26A 4I81A 5EP4A 2DFTA 1XNJA 3D6TB 1BIFA 4WAUA 1VCMA 2ZYTX 2CVHA 4C30A 1XMIA 2NO6A 5JBQA 2WPDD 2XXAA 1GRQA 1XEWX 4PPFA 1G4AE 1KI7A 2KJQA 2IBMA 2JCSA 4KFTA 4LCBA 4M9SA 4X8OA 2NPFA 3SN6A 2XZOA 4PO8A 3A4NA 2QT0A 3M4YA 4DCNA 1NVWQ 4DZZA 3PEVA 3TVDA 3RS7A 4ERNA 3IBYA 2KBFA 1XB2A 2FFHA 4A2WA 3EPLA 3B13B 3PEUA 2UKDA 2UZ3A 3ZVMA 5FOTA 3NTUA 5FPKA 4YXWA 4Q1BA 3ZS9A 1N0WA 1SVKA 2RKOA 2MMCA 1N3BA 2ZUDA 4LC0A 1E2PA 1SQ5A 2C9OA 2IEZA 4A4DA 5DGXA 1SVOA 2ECKA 2XOKD 1QHIA 1AIPA 1YJ5A 1ANKA 3LVRE 1TTTA 2XNSA 3U4QB 3AVQA 4CT4B 2JJ8A 5HCIA 1K5DA 1EX7A 4DDTA 4Q4HA 4DIDA 1W46A 1DOAA 4TLDA 2OCBA 4IDHA 4GDFA 1IXRC 2C95A 1VCNA 2CBZA 3ZGXA 3F0TA 2ERXA 1RRFA 1GAJA 2NTYC 2YZ2A 3CLVA 4OHXA 2IW3A 1E94E 4LYJA 3GLFA 2WJIA 2RHDA 2NG1A 5FBRB 2J7PD 3REGA 2BCJQ 4N0EA 5P21A 2ZRIA 2GZHA 3SJZA 1GL6A 4KODA 3TGPA 4V0OA 1MO5A 1BKDR 1O87A 2AKYA 2NGRA 2JJ2D 1IONA 2WJHA 4FWIB 4IRUB 3UPUA 4BFVA 4WVFA 2WPDA 2DPXA 1F2TB 1TF2A 1E1QD 3R8FA 4JSYA 4WOPA 3W3ZB 4IDOA 2O8BB 4RZ2A 4ZKEA 3WHKA 3JVVA 1JNYA 1JBKA 3P20A 1XD8A 2CLDX 1KSFX 1EG7A 2P5SA 1FMJA 3BB4A 1RYFA 2VF7A 4KHZA 1HTWA 2GZDA 4QFMA 2ZROA 2G77B 2IC5A 1HURA 3A8TA 4LHYA 4Q7JB 1MO6A 4D81A 4EFMA 1IN8A 3SJCA 1MRNA 1MO3A 1AK2A 1M74A 2EYQA 2QMUA 2WJJA 4L8GA 3KTAB 2OUKA 2HXYA 4NCIA 2XOKA 3FOZA 4RD1A 3AVUA 3QXCA 3TBKA 1JPJA 2W00A 1P73A 2Z4SA 1Q3TA 5DSZA 3V9PA 1KIMA 4HB3A 3I61A 2ANCA 2P5TB 1KMHB 3KKOA 4RD4A 4IOMA 1MO4A 1G64A 4AKHA 3KKQA 3L82B 3AEZA 2IXGA 4EAQA 3QXXA 1CBUA 1YKSA 1XDBA 1N6NA 2XZLA 1IJFA 4DEXA 3U44A 1E2EA 4LJ8A 4F91B 2GJ8A 3JZAA 3AKDA 1NBME 3GLHB 2B8TA 3GFTA 2J0UA 1FP7A 1VYTA 1XEWY 5E95A 1WBBA 3RS0A 1NIPA 2GXUA 2J7PA 3M6AA 1PZNA 1SXJE 3WNBA 2C2HA 4NZYA 1ZBDA 3N70A 4DBLC 4JSTA 2OBNA 2JJ2A 2A9KA 2GVZC 2RGDA 1G3MA 1Q21A 3DEFA 2J41A 4FXPA 4V0MA 4BFWA 1NI3A 1CLUA 1NSFA 2ORVA 4ITRC 5JRJA 2AD1A 5JJIA 4Q02A 1E1QA 3PUYA 2PCJA 3TUJC 3VMFA 2HV8A 4B32A 1P75A 4XSGA 2ZJ2A 1CXZA 3PIRA 4CEJA 1SKYE 3QUSA 4TL9A 3V00A 3KJHA 1JJVA 2WWHA 1ETUA 4UJ5A 1GITA 1UADA 4G1UC 2ZQ5A 3K9LA 2Q3HA 4LRWA 4F4IA 1UEJA 2OCYC 4NONA 4C0QC 2WAXA 3SOPA 3CUEF 5KUTA 1TUEA 3QE0A 4HEJA 4QM6A 5JJKA 1Z5ZA 3VU9B 5IHPA 1CJMA 4B3BA 1T5IA 2ZJOA 1DAGA 4DSUA 2OFXA 3DPUA 1XXHE 4IDQA 2JLZA 4LV8B 3T1TA 4TLBA 2QY9A 3I8XA 4KLZA 3TAUA 4P4SB 2JLRA 1EFTA 1YZKA 1QHHA 2D74A 4HUQA 4PSVA 1DAMA 3FMOB 4QGHA 2Z6VA 1DAEA 1J70A 1E2LA 1G8GA 2C77A 1XTSA 4NCKA 1HQYE 3B60A 4ESVA 4QBIA 5FL3A 2IYWA 3KFVA 3KXLA 1N0VC 1MT0A 2R6CA 3CKLA 1P2TA 4EFNA 4AC9A 1Z8FA 2BBWA 4LK2A 5AJWA 4LHXA 4CYMA 3LVQE 1VECA 3LWNA 1GIAA 1P2VA 1BYUA 2QI9C 2HT6A 2GILA 1G4UR 2PJZA 3GLIB 4LPSA 1FTNA 1VYVA 1LB1B 2YWEA 3EA0A 2PLRA 3PENA 5DYIA 4NYJR 4PZYA 5GVRA 3U3RA 2W0SA 3VX3A 1L7VC 5FH9A 1ZNXA 1D5CA 1II9A 4Q9JA 3W6NA 1D6JA 4HB4A 2ZJYA 3TSWA 3QG5A 5KO2A 2ZRCA 1CF4A 1FMLA 4Z8YA 5AJXA 5HZHA 1RJ9B 1XMJA 4DVGA 5K8LA 3N2EA 4D4LA 2IYRA 4Q03A 2FV8A 4BE7B 2EFCB 5IK2D 2IUSA 4HAYA 4YONB 4JLJA 3WP1B 2J7KA 2RHMA 2VA8A 5C1BA 1U8ZA 2ZXUA 2I3BA 2GNOA 1X6VA 1KI6B 4NBSA 2ZRKA 4JLBA 3GLGB 3GJ3A 5LDDC 5CB8A 2V6IA 3HR7A 4LJ9A 4C9BA 5JEEA 3EWSA 4IHQA 1AGRA 3CPHA 2REBA 4TZ0A 1OIVA 3K53A 5D3QA 2X77A 4RD6A 5EZ6B 4ESHA 3C14C 4KBFA 5CJPA 1T3LA 1G21E 3ICEA 4M8NE 4ZDIA 1HV8A 2EYUA 4Q4LA 3I62A 5JWHA 3U7EB 2D4HA 2VHJA 4I1VA 3WMEA 2R6GA 1ZC3A 1M7GA 2WIBA 4HLUA 4B2LA 4WA7A 4YLGA 3B5JA 3GJ8A 3LW8A 4RD3A 4EJSA 3KFXA 3TUZC 4TYQA 2O8CA 1SHZA 2ATVA 2EWVA 5L3VA 1D2MA 2K5UA 5AJYA 1OH8A 3FE2A 4M22A 3EIHA 1HE8B 3OFND 2WIAA 4IOLA 3QSYA 3LO5A 1Z06A 4BPBA 4B3GA 1YZGA 1CTQA 4EPTA 5DNYB 5JHGB 4HUTA 1GNRA 4KLNA 4MA4A 4DDUA 1N6LA 3AQ4A 1N6PA 5L3QB 4O2LA 1JJ7A 2LKDA 4TYWA 1FTSA 4O2RA 2CK3D 2ZE7A 4V0NA 1GOTA 4U7DA 3X2SA 4GOKA 4D0LB 1CP2A 5IK2A 2VP0A 3C8UA 1NBMD 1CU1A 1TQ4A 1S4QA 2OXCA 4B73A 4C0AC 2WJVA 3P27A 2QZ4A 5FI0B 4PAMA 3AV0B 1SXJD 3I3SR 4UNNA 4E07A 2QTVB 4HSEA 2ZI7A 1W0KD 4NCJA 1Z29A 1F6BA 1S2MA 3QPUA 3GJ0A 4PQRA 1Z0FA 2GF9A 3FMIA 5CK4A 3CH5A 3KKNA 4BRUA 1NN0A 4R7ZA 5AUOB 5H1YA 3K09A 5KSOA 1DELA 3MSXA 2NZ8A 3CF0A 1Z08A 5CJ2A 4C2TA 1XTQA 3LW7A 1ZINA 1M2OB 4CIDA 1NG9A 2DYKA 4J0QA 5TV2A 6Q21A 3BFVA 3X1DA 4DRZA 3SZRA 2VBCA 3BAFA 1QHHB 1OLOA 5FOVA 1PVOA 2G1KA 4Q48A 4CVNA 3BH0A 4E5UA 3KQNA 2CLSA 3KQLA 1J8MF 3ZVLA 2A7QA 2I1QA 3LXRA 3P26A 3ZZTA 3OFNA 2OFOA 2ODNA 3AGQA 3KJGA 3KJIA 4IVQA 4JLOA 2R44A 5TXGA 3ZZ0A 2R65A 2XAUA 4BLTA 5L3SB 1TEVA 2H18A 1GNPA 4V02A 1JR3E 2Z43A 3B82A 3UMFA 3ICQB 2H1LA 4TMXA 1A2KC 2CK3A 3QPVA 2AL7A 2Q9AA 3OZXA 1DAFA 4B35A 5M04A 1W36B 4AY2A 4MYHA 1MABA 2ZSFA 4LYHA 1NBMA 2G88A 1S3SA 1UKVY 2NO1A 4I4LA 4W5WA 1UPTA 2Y8EA 4DJTA 4B76A 3QF4A 1UBGA 4P4TA 2OBMA 3RS5A 5DHFA 2GEVA 5FTLA 4QKQA 1SXJA 4L15A 3IHLA 4XVQA 5DI3A 4DXAA 1W0KA 221PA 4P31A 3TUIC 5B58C 3M0EA 2HEIA 3BE4A 4JL6A 3HPRA 2EU8A 2PX3A 3UG6A 3TW8B 1S8FA 2GCOA 1DAHA 3WBKA 4D0GA 1ZM7A 1Y63A 5TARA 4C2UA 1U0HC 1OXXK 3D8BA 2LWIA 2IS6A 1XCGB 3LQQA 3AF3A 4ZCLA 1C1YA 3AUXA 1X1SA 3U7GA 2SHKA 3SYKA 1F2UA 1DPFA 1ODFA 4Q7KA 1KAGA 2YINC 5AUQA 4E09A 1BMFD 1QBKC 4G5OA 3MFYA 3I1FA 4NHOA 3WXMA 1C4OA 1CR1A 3QBVA 3QKRB 3IO3A 3NC1C 2HCJB 3GP8A 2BEKA 3TR0A 3KZ1E 4RZ3A 2JEOA 2IXEA 4IFBA 1KZ7B 1NY6A 4Q1FA 1GL9B 4LOAA 3IPXA 1IXZA 4PTLA 2A5DA 1OT3A 2CXXA 1XCPA 1NVVQ 2CMKA 3L0SA 1J8YF 3EWAA 2O8CB 3IQXA 2B8WA 3GLFE 2XGJA 2QNRA 4Q18A 4F38A 4KBGA 3GEEA 3P1JA 1SULA 1E9SA 5UKDA 1Q44A 3O8RA 3TAHA 1MV5A 3T35A 2X2FA 3EPHA 1IY0A 2JLXA 1W5TA 4MGZR 5KSYA 2ZSEA 3ZH9B 4B6EA 3IKJA 1FUKA 2O8DB 5DYGA 2ZVPX 4Y0AA 2IA5A 3R20A 4QGFA 3U60B 2QPOA 1G3IA 4ZI3A 3P32A 3SE0A 3TH5A 3BORA 1X8LA 1AS0A 3QIAA 1AKYA 1U2RA 3K0AB 2OAP1 4FMBB 4DLZA 4B3CA 1R8QA 3O47A 2GJSA 2VRWA 4OK6A 3DVLA 1QVRA 5G3YA 2VH5R 1QG4A 1JI0A 2VSOA 3BFKA 1XWIA 5CIWA 4B6FA 4D82A 3T12A 3P4YA 5CB6A 2ZRPA 1XMVA 1KY3A 3MJRA 5HE8A 4MRVA 3RVBA 2WWWA 4R98A 2WJGA 1BMFA 3NHBA 4KXFB 5C4MA 4FINA 2BM1A 2OG2A 4FCVA 5FPHA 4B43A 4X8LA 3V4RA 3K9GA 1Z0KA 4Z8XA 3KX2A 2Z5FA 1UFQA 1ESNA 2P2LA 3OIUA 1G18A 4MKFA 3PV0A 4QG7A 3K8YA 1Z22A 3FFAA 4XIGS 3DO6A 4DDVA 721PA 1ZJ6A 5DO9A 3UATA 2J5XA 2YV5A 3BK7A 2EQBA 2O8EA 3DZ8A 1IN5A 3OIYA 1E0SA 2F1HA 3B1YA 3AF4A 1R5OA 3QVVA 2C9CA 4JVNA 1T5LA 4PC1A 3TJZA 3EA5A 4FMDF 4WXRA 1ZCBA 4AKEA 3LDAA 3MRSA 5BXQC 3O8CA 4ZIRB 3KB2A 4PSKA 3PEYA 2CE2X 4Q01A 1XPRA 1U8YA 1LNZA 1OFUX 2ZRNA 4DLVA 3JVUA 4EPYA 1KTVA 2CCKA 3TLXA 5KNCA 5LD2B 2F9LA 1SVMA 4GMXA 4XWAA 2R8RA 1Z6AA 2F1RA 3BJIC 3CX7A 1MABB 5JWOA 1YZLA 4QBFA 1ZUIA 3X1YA 1ZM4A 1JPNA 2BM0A 2GCNA 1NNEA 1GUAA 4N3NA 3KL4A 4KVAA 2WV9A 2CJWB 2AK3A 2B7BA 4A8JB 2YWFA 2OSBA 2ZTSA 5KDOA 2W2TA 3R9XA 3GJ7A 3FB4A 3BH7A 4ACAA 2Q21A 3OEHD 3QKSA 1JR3D 3EC1A 3CF2A 2PT5A 2ZAOA 2IHYA 2HLDD 3BB1A 4FD2A 3CRVA 2QAGC 4X8HA 2O5VA 4OBEA 1R5NA 4POAA 4NYIQ 4WIAA 5FL7D 2ZRBA 1KO1A 2ZRMA 3THWB 2O0HA 1KDOA 1P3JA 3S1AB 4AG5A 4RZUA 4G01B 4M0LA 4EPXA 4TMTA 5DI9A 1NN3A 4C0BA 1E96A 4GOJA 3TSOA 4EQ6A 1QHSA 3I4LA 4TQAA 1KO7A 2P3SA 1PUIA 1AN0A 3EXAA 5HTKA 3MJHA 1NVUQ 1OPXA 1HT2E 1YRAA 4US2R 5KHOC 3UWOA 1HE1C 4JIMA 4BLPA 3T1VA 5GJVC 4GZMA 1O3YA 1VHTA 2P6RA 1I4TD 2AXPA 2ZJAA 1PUJA 1AZTA 1ZD9A 1XXHB 3O8DA 3ZS8A 4LJAA 5ANRB 1US8A 1G7RA 3WYGA 4MYUA 4Q66C 2ZJZA 4P33A 3T61A 2IS4A 2V4ZA 1KYIA 1SHKA 2BCGY 4YDHB 1Z0JA 4R2HA 4OHVA 2CL7X 3NBXX 1DS6A 1R0XA 5EQTA 3NEJA 4PAQA 3B1WA 2GHIA 3KUCA 2PBRA 1HY3A 1EFUA 1IOZA 1RVDA 1P60A 3REFA 3RWMB 2F43B 2Q3MA 4JL8A 1E32A 5JFGA 1JXMA 3FHCB 2FOLA 2VP4A 1NMXA 2YOFA 3BH6A 3OEHA 1JR3A 4D4KA 3R7WA 1P62B 2ZSAA 2J0VA 4P4UA 5SZIA 121PA 2P6NA 1P6XA 4TYNA 4X8MA 2HLDA 1KK3A 1FOEB 2YOHA 4II7A 2WTUA 5FL7A 1JALA 3AF1A 3DOFA 1Q3HA 1W5SA 3SJAA 3UKDA 4NCNA 3A1VA 1J90A 2JDID 3TRFA 1Z6XA 2FGKA 1KI4A 1UDXA 1K5GA 4PR0A 2H57A 5H68A 4Q7LA 2WBLC 2EW1A 2VSFA 4BEJA 1KKLA 4QOSA 2FU5C 3LRPA 2EFHB 4Q47A 3ZVNA 3AVTA 1G20E 1RZ3A 3AVVA 3E70C 2HJVA 3ETLA 3THXA 2I1VB 4LPKA 1P61B 4NP6A 4PXAA 2O8FB 1OH7A 4BLQA 5A4JA 4URUR 4OI0A 3L2OB 4G0NA 3BGWA 4WBSA 3K70B 4LHVA 2FZ4A 2GA8A 3AP1A 3P4XA 1WP9A 1OYWA 4L5BA 3WMGA 1P9WA 4DCSA 3HYRA 5JSZA 4MGIR 2PZEA 1N6RA 4DSNA 1SGWA 4JVLA 3Q72A 4H1VA 3SBDA 4KFSA 2ZE8A 4A82A 3EIEA 5KPJA 2NZJA 1GKIA 2WKRA 1FFHA 3ZIAD 5HKKA 3HYTA 3PUWA 1IJEA 3NEYA 4U02A 3IDQA 4CEHA 4JLKA 5TB5A 3RAPR 2BIFA 3AP2A 4DLTA 5KYKA 4LHWA 4BEBA 2IL1A 3UMRA 1KI2A 1JEDA 4HB0A 5FPSA 1XEFA 3FKQA 2G1JA 2OHFA 3LNCA 1XZQA 1RKBA 5E7IA 4K81B 2YWHA 3HU3A 1L8QA 4DLYA 3B7GA 1N5IA 2VP6A 5EXTA 2UZIR 2QMEA 2JDIA 1SVSA 1E2JA 3K0FB 3THYA 1HYQA 4Q4AA 1HA3A 1KI3A 4FMDB 3UG7A 1XJQA 4S2EA 3W6OA 4C0LA 1YR6A 1UDWA 1NG1A 4I99A 1Z0DA 4PQYA 4C7OB 4S35A 1ZNYA 1MH1A 2RMKA 2D7CA 4YC7A 2WMOB 1ZP6A 5EE5B 1IXSB 5BW8A 4JVMA 4KSBA 4Q9HA 4B74A 4D25A 2ZYVX 4PSAA 3UK6A 1GTVA 1G8YA 2VSXA 2CEAA 3FHTA 4BZXA 4ZDKA 4U00A 2IT1A 4Q1EA 3NG1A 5EE3A 5K8IA 1Z63A 4JLAA 1OV4A 2OCPA 1M1YE 2IK8A 1Q22A 1SVLA 1PV4A 1AGPA 3M1IA 4C0KA 2FSHA 2GZAA 2QPTA 1TU3A 4IW3B 4O25A 1CJTC 1G3UA 3H0KA 1E2KA 1TPZA 1VCOA 1KK2A 1AA9A 1NVVR 4IJMA 1BOFA 2QSZA 1XD2B 2PEZA 3AKYA 3ZIAA 1AKEA 2D62A 1OFTA 1G8FA 4CDGA 1OB2A 2FG5A 1L2TA 3MAAC 2PX0A 5CM8B 2J87A 3WRXC 3HP1A 5KDDA 2FPKA 3EX7C 1ZVQA 1UKZA 3U6BA 1VTKA 3B9QA 3PUZA 4L9WA 3L0OA 4Q9KA 2C03A 4TYPA 4F4CA 4MRRA 2R9VA 2ZI4A 2V54A 4RFSB 2C78A 4QHSA 2V6JA 1XEXB 4Z51A 2G83A 3K9NA 4DSOA 1U99A 1RRCA 2QTFA 2ZAMA 3MCAA 2BBTA 2IYLD 4I1SA 3BC1A 2CCGA 4D2IA 3PUVA 5KTYA 4CEIA 1GKUB 2D2EA 2QN6A 4GP6A 2HYDA 1PJRA 5TY0A 3SHWA 2GXQA 3RRMA 3VX4A 1R7RA 5H70A 2ZRGA 1DO2A 2XXAB 5FBVB 2IYTA 2LKCA 3MUFA 5E3HA 3RLFA 3LD9A 2H92A 5KPDA 2OT3B 2ZRLA 4HDCA 4HYYA 4WZBE 2FEMA 4LV5B 2IWHA 1XJCA 2HUPA 1R5BA 4IOKA 3SBEA 1DO0A 1N6OA 1YR7A 2MSDB 5ELXA 3ZQJA 5H8WA 2HT1A 2PL3A 4IDPA 1H8ED 3B8HA 4UJ3A 2AXNA 3FKSD 5EE1A 2AR7A 3RSOA 3TW4A 4Q1AA 2J3EA 3TQCA 1S1CA 2QMOA 3FMPB 1TU4A 3B9PA 4C0HA 4NE2A 2EWWA 4G5SA 2ZR7A 4BZPA 2XITA 2F6RA 1N2CE 1GKYA 4OI2A 2WJYA 4RSGA 1OHHD 3MWKA 4NYMR 2VP2A 1RE0A 2YNMA 3IO5A 4TZ6A 4L9SA 1COWD 3CPJB 1HQCA 3QJYA 2AFIE 3TIFA 3SQXA 4GT1A 1UBCA 4Q4HB 3B1ZA 3T5GA 3BS4A 4LGMA 1KJZA 3IILA 3ONWA 4YDSA 5FUXA 5G3ZA 4KO8A 4BFUA 2AKAB 2ZITA 2ZE6A 1LF0A 3SYNA 2J0SA 1I4LD 1OSNA 3KKPA 3GLFB 4F7WA 1MRSA 2V8OA 3WP0A 1AM4D 4A6PA 3Q5DA 1ZMXA 2ZRHA 4KITB 1VIAA 2QP4A 3WNCA 1DG1G 4HZUA 2NOAA 1NL3A 4OK3A 3G0HA 1P2UA 2ZR0A 4Q7MB 3A6PC 2G9NA 2B7CA 3SS8A 2BWJA 2PZGA 3K0CA 1FQKA 4A15A 4XJXA 4YMWA 4NKRA 1EGAA 5AJZA 3AVWA 3VNUA 2FEOA 2GBLA 3L8YA 2F3TA 1XX6A 2IWRA 1LS6A 2CL0X 4M1OA 2NMVA 4NYIR 4M9QA 2QGNA 2WWYA 2DBYA 2DFKB 3FKSA 3FMFA 1G5RA 1LF5A 4WW0A 5LB4A 3SNHA 1QRAA 1ZD1A 5FUVA 3PEWA 2A30A 4AYXA 1BO6A 1OF1A 3SJBA 3B2EA 2KB0A 4DB4A 4WZ6A 2GDJA 2WWFA 3PITA 1YRBA 2YC4C 2QM8A 3KXKA 2GF0A 2BJWA 3AKCA 2AN9A 2FNAA 3CONA 2PEYA 2V1XA 2BKEA 1OHHA 3K1JA 1E2MA 1E98A 1KNXA 2KSQA 5DLQC 1RRGA 1S9HA 2GJKA 2RCNA 4DLRA 2Q6TA 3QPWA 2JLQA 3DHWC 4BFSA 3U44B 1CJKC 3BOSA 1RRPA 2DB3A 1UAAA 1GSIA 1E2DA 1DADA 2J0UB 4EUNA 2CHQA 3LBHA 4Z54A 1II8A 3TR5A 4LX0A 4QJ3A 5EXPA 4IFEA 3IIJA 3MG9A 4Q4JA 1E2FA 2ERYA 3I92A 4UNSA 3VR2A 2QRZA 3KKMA 4I1UA 2KI5A 1NVXQ 5FOSA 1VPLA 4OQLA 5TVKA 2RAPA 1D9ZA 1U8AA 2B92A 1OXSC 2F9MA 1TX4B 4B71A 1VDZA 5EP3A 5DH9A 1DG3A 4AURA 1KZGB 1ZM3A 4AG6A 2IUTA 2E9SA 2GXSA 4HZIA 4HDQB 4Q5IA 5GJWC 4CT5A 4CEJB 1FPMA 1KJWA 3NKVA 3C5HA 2QG6A 1E1RD 2QT1A 1NN5A 4D6PA 2C9YA 2B6HA 2XTZA 2ODWA 4V0KA 3CNNA 4JJKA 4LY6A 2QU8A 3QI2A 1Q12A 1AS3A 1NLYA 1YU9A 4WZAE 1UJ2A 4NCHA 4TL6A 4LUCA 1U9IA 4JT2A 3K0CC 1LY1A 4LZZA 4FIDA 1ESMA 4Q1CA 3AVYA 1Q1ZA 2A78A 1NIJA 2ZU6A 5CIQA 2G0NA 4LJYA 1DAKA 2DFNA 3CM0A 5JEDA 2E87A 2GBLC 2GTPA 4HUQB 1V5WA 1Z6TA 2GCPA 4L16A 2IS1A 3KDSE 1W49A 3CH4B 3HJNA 2IYVA 4A2QA 1GP2A 4QBGB 4RD2A 3R9WA 2BBSA 3I5YA 1IN4A 2PMKA 4A6XA 4TLCA 4BFXA 4LYFA 1FZQA 4DT1A 1II0A 2QBYA 1EK0A 4B3DA 5LPNA 1GFIA 1L4UA 2W2XA 2OFWA 4QHTA 2REOA 2ZJ8A 4A92A 5J40A 1IM2A 5FOUA 1N5KA 1K8RA 2ZREA 5AK0A 3A1UA 1YHNA 2DWPA 1B23P 3FVQA 1JAIA 1GRRA 2FSGA 2VHTA 4OHWA 4A0RA 2BVNA 2LCFA 521PA 2WICA 1NY5A 3DDCA 3FFBA 1NF3A 2ZS7A 4JLNA 4M1WA 3G82C 4Q21A 2J1LA 1E1RA 5FTNA 3OEED 3TNFA 3NVAA 4MKIA 3WY9A 1GZSA 4URVR 1CKEA 1KI1A 3PUXA 3LLMA 1GRNA 2L0XA 1KSJA 1BYIA 4TMWA 3KQUA 3WHLA 3EZ6A 2A5FA 3L0PA 1E6CA 4A9AA 1G16A 1NKSA 1EFRD 2IYSA 4LJ6A 3MWYW 1OJLA 4MQBA 2HF8A 4PZLA 1OIXA 4IXNA 5AJVB 1A82A 1N5JA 4M1YA 3A1WA 3GJ5A 1G17A 1FX0A 2RGNA 2YYZA 4KU4A 4A0HA 3TVTA 2BJVA 4HI0E 4B44A 5K8UA 2XTNA 4MYCA 4HLDA 4AKGA 1VHLA 5J5CA 3NDBB 1OFHA 1NN1A 5J4LA 1R0YA 2H5EA 5BN4A 1FNMA 1G6OA 1GM5A 2BC9A 3WRYC 4TMZA 4BLOA 4LBYA 1D2NA 2EFEB 4MGKR 4HAUA 4EJSB 1U9IC 2BV3A 2C96A 1Q1QA 3U3JA 1DAIA 1G7SA 4G5RA 4PC2A 2FSIA 2FZLA 2B21A 2QQ0A 5EUMA 2N1BA 1FUUA 1Q20A 3C7KA 3MMPA 1W2GA 2AD5A 1ZIOA 3BWDD 3V4FA 1H8HD 1OFIA 2IF2A 3HU2A 3K9HA 3VR4A 2P67A 4Z1MD 1CJUC 5KNDA 3R8CA 2HYIC 2FSFA 1P7CA 3CR8A 4HAXA 1E2GA 4FCTA 5G41A 1JB1A 3ASZA 3IEUA 1U94A 1RFLA 4NMMA 3F3YA 1UEIA 3OEEA 5EXSA 2OZEA 3CRMA 1NLZA 1F60A 1G41A 2QAGA 3LV8A 4DCTA 4CF7A 5AUNB 4DLUA 3U6KA 3QVUA 5FUYA 4A0FA 3SDZA 1Z07A 3EZFA 3GLIE 1SZPA 3C4JA 4KJZA 1J2JA 1G3RA 3E5HA 1WA5A 2NO9A 4B2IA 3H2YA 4G5QA 1HH4A 2Q9CA 3B6EA 1EFRA 4MUBA 4FN5A 2VHCA 2PMDA 2Z0MA 4C4PA 3QEOA 5FUWA 3VQTA 3CPEA 3BERA 4GP7A 4TQ9A 4JLDA 1RPZA 3IPYA 4PC3A 5HZKA 4EPWA 1D2EA 3QOFA 3GEHA 3W5JA 5JS8A 3I73A 2A5YB 1BS1A 2I4IA 3GQBA 3QBTA 4TYYA 3T15A 5LD2C 1JEEA 1R0ZA 2H17A 3T06B 2RB4A 3E2IA 4JS0A 3PR1A 4O3MA 4KYIB 1S3GA 2R6FA 4OQFA 3RS3A 5F98A 2WSMA 3FYHA 1J99A 1QHXA 3LX5A 1VIYA 1Q1BA 4RCYA 4XWKA 4PPNA 1Z28A 3PFIA 5EJEA 2QSYA 3W90A 3EZ2A 1I2MA 1Z2AA 3X1WA 1H8HA 3MLEA 4NYMQ 4Z1MA 1MOZA 2D7DA 2QBYB 3OHMA 1IQPA 2RGNC 2GK6A 4OQXA 2QP9X 4XVUA 1AJEA 2GEDA 1QDEA 5FBLB 1XTRA 4XOIA 4BECA 5CYPA 3H86A 3BXZA 2JATA 1TQ6A 2ZRJA 4M1KA 1CR2A 2GKSA 5J4KA 2RGXA 4P3YA 2O52A 2NO0A 2VP5A 3DKPA 4OYHA 4AYWA 4URYR 3L0IB 4M1SA 2ATXA 2OV2A 2PJRA 3QF4B 2PZFA 4RKFA 2GAOA 1W4AA 3U4QA 1T3SA 2XB4A 1SXJB 3C41J 3CO5A 5DI3B 3AVPA 1KO5A 3D31A 2BMFA 4H9GA 2EFDB 1T3HA 4GBMA 2GCOB 1KK0A 1A4RA 1CS4C 4BQSA 1Z0IA 2XX3A 2G6BA 4OJKA 2WWIA 2QM7A 1XMSA 3I5XA 1F3OA 1NRJB 2KWIA 2ZUBA 4CGZA 3RYTC 2FWRA 2W6JD 3VR5A 1QHNA 1VMAA 1XRJA 1TAGA 2R62A 1F2UB 1SKYB 4HLQB 4JLVA 3W3AA 2X19A 2JGNA 3CR7A 1A1VA 1F5NA 2ODEA 4DEYA 2NPIA 2ZS9A 1OW3B 2FH5B 1KO4A 3A36A 4P32A 1XD9A 1ZM2A 1YZTA 3NH6A 2J0QA 3FDIA 1F2TA 4M9ZA 3WBJA 3OAAD 1UM8A 3SYLA 2QQEA 2O8BA 4YMTA 2CCJA 4DDWA 5A5GA 2WHXA 1CIPA 1L4YA 2OLJA 2X8AA 4AI6A 2WAYA 4HAZA 4DCUA 3IIMA 5B2ZA 2G3YA 1I2DA 1WMSA 3QXJA 5FPYA 2QORA 2J59A 4R9UC 2ZRFA 2PT7A 3Q3JB 5FPTA 1BH2A 4QXAA 1XPOA 4PZZA 1E4YA 3C16C 3GD7A 3KTAA 1G9XA 4QNRA 3EG5A 3AKEA 3QG1A 4MDFA 5B30A 1NMZA 1E9CA 3CZQA 4DWJA 3HDTA 4IVPA 2QROA 4OI4A 4KFRA 4ZKDA 5HPYB 1S96A 2QENA 2MMGA 4LSGA 2YOGA 5FTMA 2ZIAA 5EZ5A 1N25A 3TMKA 4URXR 1AQUA 5CK5A 1KMHA 2ZI3A 1R0WA 2AFHE 4YQFA 2XJ4A 4NDZA 4AIIA 2JASA 2RGBA 1W2HA 1TADA 1IY2A 1W48A 3GLGA 2Q3FA 1FNNA 5CLQA 2PCLA 3Q7PA 3GLHA 2WM9B 3CNOA 1T91A 2W6JA 2R6AA 4JVSB 5DE3A 3K70C 2R2AA 4TTQA 4Q1DA 2V9PA 821PA 1XFAA 4A36A 3QXSA 1WB9A 1KI8A 3H4MA 4M1TA 1YR9A 4TL7A 5HE9A 2YHSA 2VYFA 1T8UA 2WOJA 2Q0HA 3HU1A 4KYUA 3ECCA 5JRZA 3LLUA 3OAAA 1R6BX 1OXUA 4W5HA 1P5ZB 1H65A 1PLLA 3LBNA 5CITA 3RWOA 3KXIA 2O8EB 2BHRA 3I8SA 1N0UA 4YMVA 2QUZA 2ZM5A 1ZUHA 5BQ5A 4BRWA 2YC2C 2FX3A 2OM2A 1OIWA 3W5IA 1N6IA 3T1QA 5JLJA 4ZCMA 2FN4A 2ASEA 1YE8A 4F93B 1F48A 1JXOA 1KO8A 3GJ6A 4GPTA 2ZYUX 2HJGA 4K46A 1SVWA 4KI0A 3BRWD 1PLJA 1E3MA 3ADBA 1NLFA 1GVNB 2OCAA 3VU9A 1VG9B 2IYZA 2H16A 3RSLA 1E9DA 3VNVA 3QKTA 3IQWA 421PA 3FHOA 3CB4A 3WNDA 3CX6A 4A1FA 1EESA 1UKEA 5LB2A 3EAQA 1N6KA 1R8SA 4C0JA 4P4SA 2BEJA 1ZU5A 2ZI5A 1GG2A 3Q85A 4GSYA 3EPKA 3GFOA 3QQ5A 1B0UA 1HEIA 1N5LA 4Q00A 3RRNA 4Q9LA 1X1RA 2C5LA 5DN6D 1P9NA 2GK7A 3D3QA 2VLIA 2WVJA 4BZQA 3J81k 1DARA 5JI3E 3DMDA 4LBVA 3Q7QA 3QKSB 2ZUCA 4PHGA 1ELOA 1AS2A 1Z0AA 2VEDA 3A4MA 2W6ID 4DKXA 4G3XA 4Q9IA 3OESA 5B64A 4GMDA 4PAOA 1IY1A 3EASA 4PHTA 1G19A 3GLIA 2ZRDA 1KDTA 2NO7A 4BFTA 3QXHA 4M9XA 5AR1A 3G5UA 3U7HB 1CJVC 1VG1A 1X8KA 2O0JA 3LBIA 3PG5A 4CZ2A 3PXGA 4EQ6B 1SKQA 4MITA 4OI1A 1G1MA 3AF0A 3B78A 3QY0A 3T1OA 3DOEA 2JLSA 4XWOA 1KGDA 3IGFA 2BOVA 1RJ9A 4PFSA 2XNDD 3H84A 4JBWA 4C0SA 1P72A 4CRWB 2ZR9A 3OE7D 1CR4A 3LY5A 3U3KA 3EC2A 5TMPA 5FTJA 2XEXA 3RRZA 5C18A 5KDLA 5FOXA 5DIFA 3B1VA 2ZETA 3BFXA 1US8B 1KI6A 1R10A 3OIWA 4K8OA 3HWSA 2FFAA 3BD9A 4GFDA 3H1TA 3K0SA 2DHRA 2J9RA 2WKPA 3DMNA 2YKGA 4KV9A 2V7QD 4TWZA 1OB5A 2YVUA 3SQWA 2R6DA 2VHUA 1U0JA 1U98A 1IN7A 1OXVA 1KDPA 1E2HA 1S0UA 3KJEA 3X1XA 5DN6A 5FBWB 5F9HA 1W0JD 2BMJA 2GEUA 4BFYA 3T34A 3NHAA 3I72A 4HAWA 5JECA 3U3OA 2DWQA 4GZLA 1PLKA 3PCRB 2FFBA 2O0KA 5LBIA 5KOYA 1OH5A 3R7WB 4FI3C 4NU0A 3WYFA 2QAJA 5D3MA 3GEIA 2W6IA 4TMKA 5E7MA 2A5JA 3LH5A 3VR6A 4JT4A 4OK5A 4GOXA 2WSSD 1WBDA 1ZC4A 3LXXA 1YZQA 2PH1A 4OJQA 3AP3A 5CM9C 3ZD6A 1T0JB 2QA5A 4PX9A 2DY1A 2ONKA 2KE5A 1TUIA 1VG0B 4LBWA 1G8PA 2EFGA 3CRQA 3QF7A 4V0LA 2YWGA 5L3QA 3DKVA 4D4MA 4M21A 4FW9A 2CHGA 3THXB 3ZDQA 2IUUA 1WQ1R 2XNDA 2ZVQX 1E79D 3NBZC 4BGDA 1XPUA 1W36D 4N1AA 3OE7A 5JZVA 2FPLA 2ZI9A 5GVSA 1JECA 2PLFA 5SZHB 1G7TA 2WKQA 3AM1A 2MSCB 2ZYWX 4DLWA 2FDCA 1IHUA 1KMQA 3D7MA 2ZJBA 4DLXA 4DB2A 4XVRA 1HT1E 5EE9A 1ZM9A 1WF3A 5EP1A 3ADDA 1WE2A 2V1UA 1G7CA 1ZIPA 2V7QA 4IKEA 4MRPA 4ACBA 4B47A 3VKGA 5EP2A 4XTCS 1IBRA 1XP8A 2ORWA 5JSZB 1C9KA 5CDFE 1KSGA 4AD8A 3U61B 2JIZD 1Q57A 3F5FA 5CYOA 4BUJA 1LFDB 1FW6A 5DHAA 2CHVA 1NKTA 4HDOB 2V55B 4GL2A 1A2BA 1W0JA 3X1ZA 1WXQA 1XCMA 2C98A 1EWQA 2RGGA 1W4BA 4B3XA 5J4VA 4MDEA 4CEHB 2WMNB 4N0DA 1P9RA 3ZQ6A 1A7JA 2WZQA 4P0TA 4JJZA 3DZDA 3C15C 4IEIA 3RNLA 4ZI2A 1OYYA 4JBXA 4IDNA 4PQFA 1TEXA 2G0TA 1NJGA 2WSSA 4ABYA 3B85A 1S9DA 2BMDA 1GL7A 3ZZUA 4TL8A 5EUQB 4MRNA 3TKLA 3AF2A 4NTZA 1IAQA 2ZSBA 3THYB 1E69A 5AWFC 3RS4A 1T9HA 3I32A 4Q4AB 5KSZA 1Q0UA 1T4GA 2OE2A 5EXXA 5JCPA 1Z3IX 4UNPA 5L3SA 2YJTD 4LYAA 1LS1A 4QGAA 2IYQA 1S1MA 4B2PA 3BB3A 4QRHA 3Q8XB 1E79A 4FWTA 4CW7A 1H8EA 4LDJA 3VAAA 3U5ZB 4TN1A 2EVWX 5C46F 2D3WA 4EPRA 1KAOA 3ADCA 3JZMA 1IN6A 1TQ2A 3ADKA 1WRBA 3LFUA 5K8TA 4OL0A 4G5GA 2CE7A 4W5JA 4UNQA 1RIFA 1X3SA 5IT5A 3SI7A 2ZI6A 5EE0A 3UWKA 4OHZA 2P65A 5CLLA 1Y3AA 2JIZA 3U7FB 3GPLA 1COWA 1ZAKA 1E9BA 1ZU4A 2GESA 2QRNA 4PANA 4B3FX 1E2IA 2VP9A 1FQJA 3UANA 3U3MA 2HXSA 2RGCA 4OQNA 4W9MC 3ZLJA 3TSZA 5B57C 4OHYA 1G291 1G5TA 2QTHA 1E0KA 2FA9A 3VR3A 3THOA 1AQYA 4JMPA 2W0MA 1DBSA 1T0HB 3OIVA 3NWJA 1AZSC 1YZUA 3QKRA 1JR6A 2KBEA 3HPQA 3UXMA 1ZNZA 4TLAA 4US1R 1SVIA 2ZRAA 2ZU0C 3ZVRA 4BWYA 2AX4A 2J45A 1CRPA 2OESA 2ONJA 2IS2A 3W8NA 1ZUNB 3SU8A 4ON9A 3KB1A 2P6UA 3GJXC 4V03A 3RS2A 4ZPXA 2D06A 4Y0VA 4NL4H 4RCZA 5D3MB 3SC3A 4M1MA 3UIEA 3CZPA 4OQMA 1E9AA 4CEIB 4PPGA 4PO1A 2A3RA 1NP6A 1OE0A 1LW7A 2ZSDA 2QGZA 1D9XA 1OKKD 1WCV1 4FMCF 5J4HA 1X86B 3NH9A 3LAWA 2O8DA 3SFVA 3ZYCA 1M34E 4GNKA 621PA 4PC7A 5C2JB 3CWQA 2OLKA 4BFZA 4TT3D 1EWRA 2FPMA 4TTPA 1XTKA 2FE4A 2AWOA 3NDPA
chains in the Genus database with same CATH superfamily
3WRYA 2Q5FA 4AFNA 4HAVA 3K0AA 2POCA 4IGKA 5K0ZA 3OI7A 1SIBE 1JQDA 5A02A 3G7SA 2CVZA 2PX8A 3ES9A 2DR3A 2H2WA 4TLEA 4ZO4A 3V3KA 2OP0A 4NS4A 1JHZA 3BKWA 3SNKA 4RVOA 3VFDA 1P39A 3AZQA 3EQ8A 1L5HB 1KQNA 2PRJA 5IF9A 1YBAA 2BFDA 3DVQX 1PL6A 4P6VF 3VJLA 1GGEA 1K6MA 4FNGA 1XZPA 5K3BA 5LXTF 3WDMA 4C76A 3ITEA 4B7CA 2EBWA 3ZV6A 1Z2EA 2CUKA 5DP2A 4G5HA 4CU2A 5ICMA 3PF9A 2ZPTX 1UM9B 1CRQA 3KCQA 1E0JA 4GPZA 3GCGA 3WQHA 3PGXA 4JL5A 3RUFA 1V7ZA 3F3KA 1PSZA 3IXMA 4U7JA 4EDHA 2ATEA 3IP6A 1RHRA 4M6WA 1P4SA 1N0HA 3GMTA 3VHLB 2A2ZA 4UD6A 1I36A 4RK6A 2RH5A 2XMZA 5BSWA 1KY2A 4CN8A 4X9XA 3V8VA 5IJ0A 5JSKA 2H2GA 3FCXA 4MWGA 2YQ5A 1T35A 3CIOA 3FWYA 5FOWA 4IOJA 4EIWA 2H1CA 2DBVO 5B6IA 3D3KA 2F1JA 4JJGA 4W7SA 1ZESA 4MLCA 1W7AA 4ZAYA 2VL7A 5JNVA 1R64A 3I37X 5EJ6A 4HN2A 1HX7A 2MSNA 3NGXA 2ACWA 4QQ8A 1R2QA 3KUDA 2G04A 3EUFA 3ZY6A 2VJPA 4HZUB 3SZUA 1GA4A 3M6UA 4LNHA 1KERA 5CVJA 1Z2NX 1OI2A 2CFTA 3H16A 3RVJA 4KXQA 5CLIA 2Y1GA 1M7HA 3MGCA 4NBRA 2ANBA 1E0AA 3K8QA 1JG6A 2OC4A 1U0LA 5B7NA 3L1IA 5AVTA 2TMKA 4RTNA 1HE4A 2C00A 4JLPA 3WV4A 4F2PA 5DYWA 3WL4A 1WV0A 3A1CA 4MVWA 4HDMB 4LY3A 3V97A 5BV7A 4OA8A 3HB4X 4B33A 2ZPUA 4CLOA 5EKUA 3CBQA 1J5PA 1XHFA 4QNNA 3LYLA 1DQZA 4YRTA 3S40A 3EW9A 2VPZA 3WWDA 3CF4A 4B7AA 2XCTB 1KHTA 1W5BA 1EG2A 3GHYA 3HB7A 2CJFA 4AP9A 1G3QA 1L6IA 3HMKA 2O1XA 3JS5A 4TMVA 5GM2A 4M0PA 1GTSA 4H35A 4UDOA 3BEDA 4U2FA 3G1TA 3FCEA 5AHOA 4YR9A 3ZJYA 1IG0A 3HJAA 3OIGA 3HN2A 4EKDA 5DK4A 3MWLA 4OB7A 4EUFA 5E1MA 4I66A 3SEAA 5JJLA 3IMGA 3SIRA 2C7BA 4C01A 5E6SA 1G20B 4XYLA 5JXWA 1YJ8A 4G0WA 1CVLA 3U80A 1KSHA 4QXMA 3Q2KA 4Z3OA 3OT1A 4XFDA 5IVDA 4A03A 4F12A 2VTKA 4Z7OB 2VR1A 5JIBA 3SHFA 2EL7A 5AT1A 5L8VA 5TEVA 2WW8A 2Z8ZA 2BGJA 2X41A 4R9NA 1FDUA 5DU2A 2TS1A 4Y3UA 3VZSA 4CF3A 2V6BA 1ZOLA 5LQCA 1XTTA 4A36A 2DFPA 3DHNA 3SX4A 3K9FC 5CM2Z 4MVYA 4DC1A 4CXMA 4UKDA 4DRYA 4JLMA 3DUWA 1CY2A 1SD5A 4WY2A 4UAGA 4CLRA 1P6UA 2H9IA 4X20A 1J7KA 4Y1RA 5FWYB 1S01A 3ZWYA 5E9QA 1TIKA 2L69A 2Y2UA 5U1PA 3CNHA 4TXLA 2QMYA 2Q0QA 5CEEA 1UP6A 1OILA 5JMTA 1BDHA 3B1XA 5CNMA 5AUPB 1KDRA 2BGUA 1U4OA 4CEIA 1EXNA 1GWNA 1MPTA 2YBDA 3ABIA 3EIXA 4KSCA 1ORRA 3O3MB 1J1UA 4FHEA 1RBMA 2ZW9A 3KYBA 3ORQA 2BONA 4E4RA 1JQJC 2DFLA 1DE0A 3CW2A 3K71B 2O3JA 1GZVA 3KKLA 2B1JA 4FLMA 3SSMA 3ZXUB 5LQAA 5DM70 1Z2OX 2Y1OA 4WNAB 1CR0A 3LO8A 3TTTA 2IIBA 1F06A 2WP0A 3H42B 4FBGA 1NC3A 1LTQA 2IEDA 4HFMA 4R4JA 1QYXA 1FP6A 3W5UA 3ROZA 3PVSA 4DZTA 3GK3A 1TF5A 2P6MA 4DYDA 3OFVA 5CCEA 1NJFA 3WK7A 3LA6A 4CMGA 3LQRA 5F9MA 1U2GC 4YAOA 5IYZA 1LZLA 1IEWA 3W6ZA 1FQOA 1ZRHA 3B52X 3TD9A 5FPQA 1WCIA 2QE7A 3VKWA 2C1ZA 2O2GA 3ONDA 5TDHA 2J9YB 4E31A 3HXOA 1OASA 1LPBB 2JD2A 1C8LA 4GPIB 4ZVKA 1L1FA 2QTTA 4CKEA 1ZK3A 4MQUA 1VIVA 1XLWA 2PQ6A 1ORWA 3DM5A 3F49S 4C3ZA 4ZV9A 4LNAA 4PZDA 3L8MA 4E4YA 1AKNA 4J1SA 5TR9A 2QRHA 1M1YB 2QN2A 4TTJA 5DGHA 1WDTA 4RVCA 3RAJA 3LP5A 3E9NA 1A8SA 2MHCA 2W6QA 4LJ7A 1VP3A 3AFNA 4ZCIA 3P9QA 1SXJC 3C70A 3MYRA 4NDNE 3ZJUA 4ND4A 2YRXA 1C5KA 3NHJA 4NV0A 1YB5A 2G72A 4P82A 3HXTA 3ZK7A 1YVPA 3IULA 4XD7A 3TQFA 3A1SA 5IUNC 3VKHA 5ALIA 3G8BA 4UQOA 2VAXA 2ZAIA 4GDMA 1H23A 4ENTA 1T8TA 2A1UA 4WH0A 1XP5A 4RF5A 3KO8A 5EPUA 1HTBA 3GVCA 3QJYA 2O8FA 2YN2A 2HDNB 3A1TA 3H9GA 3GW8A 5D8DA 4C1NA 3A7DA 4CJXA 2XCIA 4B34A 1DVRA 3WGKA 2PRIA 1PG5A 1RYEA 4RANA 2B4YA 1PSDA 4D9MA 1H6CA 1O0BA 1RXWA 1YQTA 4HDRA 3K3PA 1ULHA 3SMVA 2EKDA 3A4LA 4ZO8A 3O8QB 4UTVA 2VO1A 2Z5GA 1B2LA 3NOVA 4V0SA 3N2YA 4C5BA 2PKWA 3RHFA 1N2EA 5EC8A 4E12A 4QNMA 3OQ6A 1TE2A 2AHOA 1VJDA 2XJ9A 3IH5A 3S68A 5FWDA 4ZCSA 1WR8A 1DUSA 3S1SA 1Z2CA 2DG2A 1Z5OA 4XE5A 3GRCA 4BASA 2V4MA 1TOAA 4QU0A 4DW8A 3T9AA 1XELA 2YW2A 5G53C 5I3ZA 2GNAA 2VTBA 5LZ9A 1E99A 3PHIA 2EGUA 3CF6R 4JJIA 2PAAA 3IUYA 3I83A 3SKVA 4AL4A 1I6WA 2G09A 2PSJA 3WSVA 3ZPXA 2G4LA 1XROA 2JIBA 3C6XA 3PXDA 4OM7A 3QTBA 3ZH2A 2F3QA 3JASB 4BIMA 2CZQA 3INGA 5DXAA 5GJBA 2QRMA 4A26A 3P2OA 4WSOA 4WCFB 3CJTA 2JK0A 3FNEA 3LPLA 4W9NA 3E2MA 3S2SA 4DUGA 3EAFA 4J4TA 4LTDA 1FFCA 5F35A 5H9VA 5AKLA 3QYFA 2M6SA 3QV1A 4QUJA 1M34A 1RDFA 1F12A 4Y2UA 1OU0A 5BN4B 2FG7C 3CZMA 3TLKA 4OLAA 5KSPA 3HZZA 5IG2A 4QC2A 1DX9A 2F55A 1QU3A 5JASA 5KHAA 1PL7A 2GDZA 3Q9LA 5JAZA 5JS7A 4M87A 4ENSA 2ODQA 4D4JA 3WLFA 1M3SA 1AGXA 1Y80A 3EARA 3H2IA 1PFVA 3C7AA 3CX8A 3V8NA 4CDRA 1QDLB 4FNOA 2IELA 2FZGA 3ROGA 1YAJA 5E4FA 2DLCX 2O7RA 2QQGA 3ID6C 4LTMA 5DM2A 4C03A 3BGIA 3EIWA 1U2DA 1XYGA 1U0RA 3KUXA 5DHQA 1A2OA 3WYAA 1ZGJA 3CXUA 3HH8A 3PT5A 4TZTA 4FCCA 5JD3A 4PIMA 3VBEA 3BCSA 1RAEA 1QNFA 4O0MA 4UDNA 1P9LA 4PO3X 2A9JA 4LHZA 4QPDA 2RI0A 1GRCA 1QQ7A 5AM5A 3D4LA 3OA0A 3W6PA 4BNVA 5L95A 4KKXB 4XH9B 3AEXA 3NS7A 1YE5A 2CVFA 5EG5A 4B4UA 4QSMA 4ARZB 1UF9A 3N5CA 6ADHA 2A5GA 1GUBA 4MGHA 3CNLA 4ZODA 1XD2A 4KQWA 4DIEA 1ONBA 4B3RB 4HDNA 3R5SA 2AWNA 2G25A 4RQBA 3KT6A 1X8JA 3I34X 2XZPA 3U81A 1O5OA 3H5VA 4L75A 2OAQ1 4NPHA 1I32A 5BSGA 1A5TA 4BDSA 5AOAA 1MR3F 4WXPA 5EJ9A 3MWJA 4HWSA 2OV1A 2G4CA 3N0TA 2WHQA 5EPEA 3W9YA 1Y4ZA 5J4YA 2FGJA 3G17A 3HNOA 1HPLA 1T1RA 3FSGA 4RFVA 4WOKA 1OUMA 4RA9A 4HNGA 2H8KA 1FPQA 1G6HA 3I2FA 2XUOA 1NUSA 2QL6A 3OZGA 1P2SA 1XEXA 2WWXA 4TWRA 3RH0A 4U2CA 3SYTA 3HXPA 2P2ZA 1I0IA 1DZIA 3N6VA 3PQ7A 4FFOA 2OBLA 4FCWA 3SS9X 3BF8A 2HIMA 1M8PA 5BRNA 3QJ5A 2C82A 5AI6A 4ZEXA 3TD6A 2W2QA 1D5WA 3OU7A 1DHTA 1BIFA 4G9BA 1QIJA 2JRCA 3BXHA 3OCVA 4C30A 1YJQA 1XMIA 4YT4A 4UAUA 5E6RA 5JBQA 1QZZA 2WPDD 2XXAA 8AT1A 1GG5A 1L4NA 3L41A 1TEHA 4PPFA 2Z98A 5JDIA 4Q3OA 3SN6A 4X8OA 2JCSA 5LQNA 4JJAA 3A4NA 2FFJA 2JH9A 2NT3A 1VDMA 2QT0A 3M4YA 1FRZA 3O2QB 4GIBA 4JUCA 4LE2A 4LNUA 4JU8A 1AXGA 4DCNA 1NXQA 1L1QA 1VSQA 2AA3A 3C6YA 5KNLA 2ZT5A 4DZZA 4JXXA 2X0NA 3PEVA 3RS7A 2KBFA 5FB3A 4A2WA 4EGQA 3EPLA 3PTZA 3OPYA 4GGMX 4ZYVA 4RZHA 1N9GA 1TFRA 2UKDA 3UJNA 1SC1A 3PFCA 2I2AA 5HKAA 4YXWA 2FF5A 1SVKA 4W5TA 1T4MA 1N3BA 2YYYA 4LQDA 4EHJA 1UOQA 2Q9UA 4EG4A 3WQSB 4NJMA 2HU7A 2FVXA 5EFOA 2NU9B 1RACA 3ZWPA 2A9FA 2XRFA 3BRSA 1DEXA 4XJTA 1BXGA 1AIPA 1JPUA 1NBIA 1YJ5A 2FJ0A 2P8SA 3MWGA 4MVJE 2XNSA 4EP1A 3SZMA 4CT4B 4JYAB 4FNMA 4UU1A 5A1JA 5CURA 4R1PA 1QUEA 5DYTA 4QVIA 5HCIA 4QATA 1MW8X 3E4DA 3GRUA 3KVYA 5ER9A 4JODA 1NMSA 3MTJA 3C1OA 4DDTA 5EHXA 4DIDA 5EI5A 4GDFA 1IXRC 3IP8A 3T0IA 5C80A 4MUXA 1ZL0A 4PLTA 4B8YA 5LYJA 3ZGXA 3QWFA 1BGVA 2ERXA 1FCJA 3CLVA 3FOBA 4HXYA 3CLHA 3IXLA 4WINA 4ZV7A 4YV7A 4X66B 1PZFA 4LYJA 4PYJA 4BY9E 1XLVA 2RHDA 2NG1A 3REGA 2IDZA 5KCZA 4NV3A 1I80A 2POQX 4N0EA 2GZ3A 2GZHA 2H48A 2XR1A 2HUNA 4UM9D 5J2UB 3RBAA 3JD0A 4OJNA 3SJZA 3NX4A 4V0OA 1U1GA 1M1NA 3OX1A 3ZW7A 3MHTA 1KDZA 4NLLA 2NGRA 1MJHA 1MV8A 2JJ2D 2P69A 3KHUA 3SVZA 3JD2A 4RKYA 1W88B 3VSBA 3KTFA 3WL7A 3X44A 3C7CB 4XM2A 4DTCA 3W4KA 1TF2A 3Q1KA 4W1QA 3R8FA 4RZ2A 2V6GA 5CH5A 4E14A 4AM8A 5LMNB 3ZHBA 4WZAB 1JNYA 1WUJS 3K6SB 4KP7A 4DIUA 1XD8A 2A86A 2CLDX 1PNOA 1QCDA 2P5SA 2XMBA 1V47A 5ALXA 3NR2A 1D03A 2FUG1 3E23A 1HTWA 5AK6A 3G2MA 4QFMA 4U7PB 1ONOA 2JVJA 3O82A 2IC5A 1Z7WA 2CSUA 3UYKA 3T38A 8ABPA 2D2IA 1MRNA 2EYQA 4L8GA 2QMUA 4CM8B 2EL9A 5HFAA 3JW8A 3KTAB 2JPDA 2QX8A 1DWPA 2D1TA 1REQB 3ONVA 2IEBA 2H0RA 1VZ3A 2HMSA 4PNEA 2NU8B 1FYVA 3FSEA 2XOKA 4MWOA 1P4AA 3GCDA 4Y9SA 4YYZA 4RV4A 3LM8A 3PGA1 4CMEA 4NQZA 5JXJA 3BPSA 1XAIA 2PFGA 2NUAA 5BNIA 3L6DA 4HB3A 5G0SA 2PUFA 1SC4A 4JI4B 5EIBD 1L5WA 1FNBA 1LI4A 3OQIB 1G64A 4K6MA 1LH0A 2GVNA 3L82B 4EATA 3W6UA 3KVOA 4EAQA 1U7ZA 3LBYA 1CBUA 4EUSA 1XDBA 4CCWA 4HGQA 4NR0A 4Y2SA 4F91B 2GJ8A 3DBVO 3JZAA 4YRRA 3GFTA 1GCAA 4E7PA 2GM5A 1WETA 4EMUA 5T6MA 3N0VA 4YT5A 3VYUB 4RV5A 4D9JA 1UP7A 5KWVA 2JB9A 3M89A 3H1EA 1VKZA 3AFGA 1CS0A 2I22A 2OMEA 3L7MA 5JJ5A 2BFBB 3CINA 1ZBDA 3ED1A 4Y1RB 4CLXA 4JSTA 2OBNA 2GVZC 4H0NA 3NXKA 2VYVA 3GPBA 3I2YX 2QRQA 2EP5A 2WR8A 1ABFA 4XA8A 4ECAA 3A9VA 4EFDA 2ORVA 2DQKA 3GFQA 2PTGA 4E6EA 2XXJA 2P9HA 1Q0ZA 4CM1A 1FDSA 1P80A 4N5MA 4BNGA 4QARA 3PWZA 1WJGA 5HIJA 1RAGA 4B32A 5C7YA 3STXA 1FW8A 1ODKA 5JCJD 1BCRA 2AMFA 3O3CA 4OBXA 3WB2A 1PD0A 4DXHA 2QR3A 1DJLA 1LTKA 1JWBB 3AXTA 3PIRA 3UWSA 1PD1A 3RVPA 2ZM6B 3TCKA 4HWPA 3OUZA 3NBQA 4IH9A 4UJ5A 4GQAA 1DHRA 1L7RA 4OHFA 4MS1A 1THMA 4CHGA 3KSDO 4AUKA 4UOZA 4GX5A 3SOPA 1DTWA 3F7NA 3HC7A 1GYPA 1SWWA 3R6GA 3H5AA 2HWXA 4I5GA 1D4ZA 1DC7A 4HEJA 5JJKA 1EI9A 4E08A 1CRZA 1Z5ZA 5JXHA 6REQB 1KS9A 4B3BA 1FUEA 5FA6A 1ZRSA 3FH0A 2B1GA 2I80A 2OFXA 4EGCB 3UJHA 3PX2A 3AIIA 1N4AA 1B00A 3UMBA 1NASA 2QY9A 1GAQA 3LDFA 4W5QA 2CBXA 4YRLA 4CMAA 1A5AB 1YDMA 1QHHA 2JCGA 1IG3A 5K3OA 1DAMA 1VKRA 5JV5A 4YJ3F 2R4TA 1L7PA 1BHQ1 1G8GA 1O9GA 3D02A 1XTSA 1OI4A 1HQYE 3C3AA 4ZMSA 1C1DA 1T5TA 2IYWA 2VSYA 1QGAA 3KFVA 4WQMA 1JVBA 1MT0A 1N0VC 4OO3A 2R6CA 3CKLA 4BO6A 5GONB 1P1BA 3A06A 3WK5A 4AC9A 1P8JA 1EEXB 1Z8FA 2HF2A 3JYHA 4LK2A 3T1HB 1E7WA 5EKXA 5HRUA 1V8FA 3JQCA 4GUDA 4LHXA 4FEAA 2VK1A 1SKBA 1U3WA 4GMKA 3U7QB 3M2TA 2OWEA 4GO1A 1BVHA 1E8DA 2FEXA 3P9XA 4DBLC 2H29A 2I76A 3E9YA 3EQ2A 2QI9C 4EYGA 2HT6A 2GILA 2CC2A 3M82A 4KZKA 4HQFA 1QAMA 3F90A 1VYVA 4PTZA 5GVRA 4WTOA 3U3RA 3U4AA 4GGPA 5JISA 5KJ1A 2RH4A 3SQMA 3STHA 2WA2A 4KFCA 5FH9A 2QN8A 4PYRA 2D5LA 3JQAA 1QJCA 4CMKA 1TW2A 4P3NA 4UM5A 2B94A 4BQEA 1MUUA 3QG5A 4LF7B 2QU7A 2ATCA 2Z2ZA 3K30A 1OXKB 2PANA 1RJ9B 1WQ3A 1WO8A 5AJXA 4V39A 2FW7A 5AKZA 3TQTA 3RUCA 4DVGA 1JQ3A 2YXNA 4Q03A 2XMRA 4PFJA 1DBQA 2HSZA 4G65A 2WU3A 4HAYA 1J56A 2GZRA 2RHMA 3RSFA 3DLCA 3QU9A 4Y8VA 5G0TA 1CYDA 4DPLA 4UUNA 4LOLA 5C1BA 2JLAA 1BXRB 1X6VA 2O2IA 4IAOA 1CIVA 2ZRKA 5BMOA 4MPPA 1PT9A 4YK7A 4EITA 3VYWA 3GB9A 3HJCA 3GLGB 3ZEAA 5LDDC 3H5NA 1I5EA 3MIZA 1TCAA 3EHEA 4ZC1A 1GR1A 3G79A 2Q3LA 3ILVA 5E7QA 4N0QA 4LJ9A 5ARCA 5JEEA 3PPIA 2Y1LA 2DQZA 1JE0A 3O9VA 1OLUA 4HWGA 1WSDA 3FVVA 3KZNA 3SP1A 5D3QA 4G1FA 2B83A 3VDRA 1RWWA 2R47A 1S3IA 2PFSA 5EZ6B 3UV3A 2JVKA 3VO9A 1EFAA 1G21E 4JUIA 1M8KA 1MX5A 1HSOA 3ICEA 4M8NE 4NBLA 3MM4A 3OOHA 5DTJA 2EYUA 1XALA 3I62A 1FVXA 4P3PA 3GARA 3VR0A 4MGEA 5F73A 5T4BA 2R6GA 2AI2A 1U1FA 2FSVA 2VDOB 3HUUA 4KO1S 4BV9A 3DE2X 4GYJA 1JU9A 1J8FA 5GY7A 4H1HA 4HS9A 1CIJA 2XGSA 2GSWA 4MROA 4P3OA 5FYQA 2B99A 4CG2A 4TYQA 3HDHA 3MELA 2BMAA 3V4OA 5C8DA 4EZIA 3QPDA 1YRQA 4DKJA 5L3VA 2LBPA 2P68A 2K5UA 2YDXA 4IMPA 5E1OA 2MYNA 5LSAA 2XUFA 3F2VA 2FB9A 3PD1A 4MVJA 4IOLA 4XYEA 2QTGA 2AC4A 3LO5A 4MI6A 4BPBA 1BVYF 1YZGA 1CTQA 5K0NA 4EF5A 3WB9A 5AO9A 4HUTA 5BVGA 3DBIA 2X0KA 3MUEA 5CDHA 5T7BA 4OTZA 3I04A 4HNHA 1WWKA 3TD2A 3AQ4A 4DDUA 1C8VB 1JJ7A 3EPRA 3OTQA 1FDOA 1D0SA 1H5QA 1K9SA 1IEQA 2I2CA 4MJ7A 4V0NA 5LNK1 1GOTA 2V7GA 1SUDA 4IXWA 4AP5A 1CP2A 1UXIA 1Y9ZA 3ZCSA 5K8VA 3QA9A 3NYWA 5JSHA 3RHTA 1KMIY 5HIKA 2WJVA 1E0DA 3P27A 1JU4A 2YRFA 3WB1A 4G0OA 4BNJA 3ZE7A 3I3SR 3BZUA 2ZI7A 1NPYA 1W0KD 4LXHA 1Z29A 2FP4A 5DNWA 1EJ0A 1S2MA 3QPUA 1A9PA 4HFJA 1Z0FA 1OAOC 2GF9A 2PA0A 3OZTA 1KS2A 3KTDA 5CK4A 4L5CA 1PYDA 4BRUA 1NN0A 5CDGA 4ZVMA 3K09A 4F9EA 4XWTA 5IBQA 3TLGB 3LK6A 5KSOA 1H1LA 1TVCA 1WNFA 3KOOA 4XIIA 1F8YA 3QLTA 5IAJA 4ETWA 3PDIA 2D0IA 4CIDA 1DL5A 1ZINA 3LW7A 4C2TA 1YS1X 1DBWA 3DWIA 1NG9A 5JPIA 4HYQA 2UXBB 1LBSA 5TV2A 2K6GA 4I4TF 2P9CA 3LUDA 2HZ7A 3BFVA 4KR0A 1ZRNA 3WAKA 1QH1A 4DRZA 4Z4QA 1V8OA 1LC3A 2MT9A 1ESZA 4N54A 2BZSA 2OWDA 4JK3A 4C6TA 1YS2X 2HIAA 2DH6A 4Q48A 1V26A 3D3WB 4XX1A 1M2FA 2QJFA 4YP0A 4ZT5A 4EKEA 1EVQA 2NAPA 1VQ1A 5J63A 3MINA 3WGMA 1P3Y1 3DVAA 2B4QA 2Y0BA 1WHSA 4NAHA 1KZ1A 2A7QA 2GYWA 5D6NA 4OLFA 3LXRA 3P26A 1EX1A 3T4PA 1ULSA 2H54A 3P9RA 3OFNA 3R5FA 1PRYA 2OFOA 3AGQA 2G28A 1TZBA 3L7CA 1PTJC 3H75A 4PM4A 3BHMA 5B6PA 4GXNA 4CL3A 1A04A 3MPOA 5TXGA 3ZV5A 3ZZ0A 4Q3BA 4TMFA 2CYCA 3PHLA 1FLNA 1TEVA 2HMWA 3FLEA 4HQLA 3J81A 1TK3A 1SCAA 3M8KA 1X2BA 3UMFA 1KEEB 2YHUA 2GAIA 3GDGA 3OZXA 5M04A 1QC5B 1W36B 2FSVC 2FW9A 3HADA 2WQ6A 2VJNA 1Z38A 1FFSA 3K6RA 3WLIA 4Z7JA 1UKVY 3T7JA 2FUNB 2WG0A 4B09A 1UPTA 4O4IB 5ALUA 4N5LA 1GCOA 4P4TA 4DHWA 3IE0A 2VBFA 5LP6A 1E60A 4QKQA 1ZHHA 3F6BX 2I6TA 1RLOA 1WLSA 3IHLA 3OBIA 4IL5A 3CR3C 1FY2A 221PA 2WYUA 4MULA 2PL1A 5B58C 3LFHA 3M0EA 2JNWA 3CN9A 2HEIA 4F6CA 1QYVA 4PV7A 3HPRA 2EU8A 2XDWA 2GCOA 1DAHA 2CD9A 3DONA 4ND5A 3WBKA 1Y63A 2JZOA 1ENZA 2BUAA 1HFWA 3F4KA 5TARA 3PWTA 4TV8F 4BMZA 4EW6A 5C35A 1OXXK 4RS4A 4X0EA 4L95C 3LIPA 1JEJA 4BU0A 4DZRA 1WHTB 4N6OA 4RETA 1XCGB 2IS6A 3AF3A 3C6MA 4ZCLA 1WEKA 1QG6A 3AUXA 2IBSA 2SHKA 4N76A 2YJ6A 2FX5A 4N5HX 1KAGA 4BMSA 2D0DA 4G5OA 4QDJA 3KKEA 1AZLA 3STVA 3FPSA 4LIPD 4WMLA 1ZOIA 4IG4A 1H2WA 4DBLE 4F86A 1YKFA 1QFYA 3HVIA 3VO8A 2JFZA 2Z5VA 6NULA 1PJQA 3TR0A 4C2BA 4RZ3A 1GR0A 2A8YA 2JEOA 4UBIA 4YGXB 5THKA 5C3MA 5EXDA 1FLAA 1KZ7B 1N5MA 1Q7TA 3PZBA 4GM1A 5CBPB 1YZVA 1O8CA 1YR2A 3I52A 3IKVA 4KXMA 3T99A 2Q5OA 2PQ0A 4PTLA 4IF4A 3UHAA 1TD1A 1ZJJA 4C5CA 2I9KA 3PFFA 3V4VB 2ST1A 2X42A 1ISMA 3JALA 5DGTA 4YXFA 3Q8LA 3GPCA 4RDHA 2CY0A 2IHVA 3IT1A 4PX3A 1BEZA 5F7JA 4F38A 5JC8A 3ONNA 2AMJA 3GEEA 1SXPA 3P1JA 5UKDA 5T8KA 3O8RA 1X9IA 1MV5A 5KVVA 3MOGA 1V1JA 1S7CA 5EMMA 3D8RA 3UPDA 2XB8A 2ZSEA 3MILA 3BMNB 2CFIA 1JIXA 1BHO1 4JYMA 3HRIA 4MS4A 5AICA 5DYGA 2ZVPX 3SM9A 3M6VA 1ZJ5A 3WHPA 3R20A 4FYXA 2HX1A 4QGFA 2C3PA 3U60B 1C3OA 2AFIA 3D5TA 4RPKA 5BV2P 1X8LA 1YS9A 4QIHA 2MDTA 2AJCA 2XHEA 2R7AA 1IATA 3TZQA 3OJ0A 4A5OA 4P7GA 5B3JC 4ZZ0A 2YYSA 1ABEA 1GGHA 3P2MA 3LT4A 1PS8A 2Z8YA 3UGKA 4DLZA 5JBIA 4DR6B 3B53X 1QVRA 1P74A 1JAYA 1QG4A 1ZS9A 4NQRA 1XWIA 3IE2A 4D82A 4ZYZA 3T12A 4R16A 2ZRQA 1T0PA 1X3LA 1HQDA 4D44A 3QHQA 3IC5A 3DWGA 1ZA2A 1I3KA 1B8NA 4CG3A 3L7JA 1GPH1 4PN3A 4RIEA 3VYTB 3SLKA 1Y6FA 1KRXA 2WJGA 1BMFA 5D5QA 4OU5A 2IY7A 5F4BA 1CT9A 4FINA 3GH1A 2PKXA 2JCYA 1HE2A 1PWEA 1JFFA 4UFNA 4ZAGA 3HXMA 2DHQA 5LMZA 1FNDA 5LIPA 3TLBA 1L7AA 1ESNA 2QM0A 3NM5A 3DPSA 1ECPA 2ZAGA 2D1FA 2Q5QA 1USUA 3L6RA 3OFSA 2PH5A 4FFPA 1C7EA 4JCOA 1X14A 4FFDA 4ZT6A 3DO6A 2EZTA 2W6NA 4A0SA 721PA 1U1CA 5DO9A 1ESDA 1S6YA 2X5KO 5KTTA 3KT8A 1PEYA 1O95A 1E1YA 2O8EA 1UPXA 1C41A 3K5WA 3AF4A 1Z4JA 3ORSA 1VKNA 2XIJA 2K4MA 3QVVA 4O8CA 1Y8QA 3VHXB 2A0XA 3UC5A 2JFYA 4PC1A 3TJZA 4FMDF 3CSSA 1GTG1 1ZCBA 4DMRA 3T52A 3LDAA 2CLEB 2XUKA 4O2AF 5DNUA 3S5JA 1ATIA 1OWPA 1QB8A 2RB5A 3GV0A 1QNLA 3R0JA 2CJYA 2ZYHA 3WA6A 3KB2A 3O8CA 1SBTA 3PEYA 1DLIA 4ARBA 5KYNA 1G21A 1XPRA 2WIFA 1KH1A 2JGKA 4N7MA 3SPXA 1T0BA 2ZRNA 3N3BC 4WI1A 4P54A 4RAOA 3ZXSA 3CHYA 4EPYA 4PLVA 3GT4A 1IH8A 1KTVA 2CCKA 5J3JA 5DWVA 3RYHA 2Q1YA 3HVRA 1TM3E 2L18A 1Z6AA 2V9ZA 2F1RA 2G5PA 5C53B 4PLGA 3FGZA 5GV8A 5JWOA 4MWBA 1RP1A 1Y4AE 1JHDA 3D2LA 4MV0A 4IDCA 1ZUIA 3X1YA 4M1ZA 2HPVA 2BM0A 2O07A 4K3VA 2H11A 4WX2B 5K3DA 1ABBA 4RMJA 3FFTA 5T8KC 3KL4A 1U0GA 2WV9A 2ETXA 1PNRA 3NB0A 2AK3A 3FPGA 1L8AA 4KLAA 3WGVA 1KQPA 2W2TA 4OQPA 4TRNA 4J3NA 5JAIA 2ZYRA 4OXRA 1JR3D 3EC1A 1T9GR 2O23A 1B3BA 2VNIA 3GR6A 4KTVE 2PT5A 1TT5B 4UU8A 3TOVA 1P2FA 4AECA 2IHYA 5TQVA 3AT1A 3C3YA 2AOUA 2EEZA 4FD2A 2QAGC 2W8BA 3GRAA 4EA6A 2O5VA 3E84A 2GLXA 2Q4DA 5A2QA 1KO1A 1O96B 1C8KA 3QVJA 5HQTA 3AU9A 3CV3A 4GICA 1P3JA 3PI7A 1KE2A 1K7FB 4HXEB 3CG0A 3TNYA 3G0CA 1XAJA 2V7BA 1PL8A 2CF5A 4LDAA 1E64A 2VTVA 5FAXA 3JZFA 4C4YA 3I4LA 4EQ6A 4ZGBA 3GBSA 4ODIA 2WD8A 1OPXA 3WWOA 4BWVA 5KHOC 1WU7A 3UWOA 5BQ3A 2EBHX 1M0EA 3VC1A 4HO1X 1KAHA 4GZMA 1O3YA 3D6AA 4X7PA 4Z6KA 4F85A 2HNAA 4ZZ1A 1L7QA 2WM3A 1ZGAA 3NNNA 3O8DA 1M6HA 3LWZA 4LJAA 4XRRA 5ANRB 3H8JA 4CM4A 5JAPA 4R6XA 4C5AA 3QX7A 2PN1A 3T61A 2ZJZA 4P33A 2V4ZA 3QBJA 1BEUB 3N2ZB 5ALDA 5A03A 3S27A 1SCBA 3VU8A 3HABA 4M76B 4OAQA 4DABA 4R2HA 2XUAA 3QWHA 2AQIA 3ND5A 3MERA 3FZQA 3QEMA 2CL7X 4MHOA 3H1BA 1OTYA 3NBXX 5A6SA 1B74A 4CTJA 2R6HA 1Q7GA 3NEJA 4M46A 4QRIA 4X63A 5L40A 4QECA 3VO1A 1RCFA 3UJ9A 3VDQA 1RABA 1TPYA 4LMBA 3REFA 3RWMB 3BSSA 2Q3MA 4JL8A 3BMCB 1KOJA 5FWAA 3TZEA 1EUZA 1PJTA 2FOLA 2VP4A 2B36A 1X1QA 2ZDGA 2OHHA 1AF7A 3OEHA 4DXAA 1S3FA 5K5EA 1M6EX 3WC4A 1IPHA 4R1UA 1V71A 4WKCA 5SZIA 1HL7A 2VYCA 3HQ4O 3DMTA 3LXUX 4J1TC 5I7FA 3BXGA 3NGMA 2PUHA 4DJ5X 4F6LA 2WTUA 2GBFA 1JALA 1VP9A 3AF1A 3DOFA 1EDDA 1WW2A 1UWVA 1DSSG 1W5SA 3SJAA 3LHSA 1LFAA 2EQAA 3C7DB 1B7GO 2FGKA 3Q11A 1Y6ZA 3GAZA 3JQFA 1LRKA 3OJLA 1OXBB 2HREA 3P0RA 4Q7LA 4Y2HA 5H68A 2WBLC 2XKBA 1W25A 3PFNA 1XZ8A 4YEDA 2VJMB 5KTRA 3HUTA 1A8HA 4UVIA 3EXIB 3B7WA 10MHA 1C7RA 3IJEB 4OJMX 1G20E 4ALNA 1KYYA 4YUZA 4GXTA 2HJVA 2NVBA 2ZIEA 4DTIA 5JFOA 1P61B 2H3HA 4KW7A 1V3TA 3JARA 4NP6A 1FTQA 3WNZA 3AW8A 1M6YA 2QD4A 3PYMA 4HGRA 3TLCA 5A4JA 4LMPA 3WRXA 3L2OB 1ESCA 3WWPA 3RVDA 5KREA 2IX9A 3UHOA 1N7HA 3BGWA 3OE1A 3OWOA 1R4MB 5EOVA 4CQLB 4UASA 4N8DA 1XLTA 4ZAZA 3RHSA 3TG8A 3P4XA 1GG8A 3AP1A 3DLAA 3BDIA 3QY9A 4IKPA 2B37A 1WP9A 4DLNA 4BKMA 1P0QA 1J09A 4GVXA 4HPXB 5IFKA 2X3FA 4DCSA 1IZ0A 2WFZA 1U1IA 2CD7A 2FPIB 2J5QA 3D8TA 4ND8A 5BN1A 3SF8A 2PZEA 4LDNA 4DSNA 3TOXA 1YC5A 2E7ZA 3Q72A 4JVLA 3SBDA 3LGAA 3EGOA 4A82A 3HO1A 1GZDA 4FVTA 4TQGA 1R88A 1FFHA 4Q3AA 1DXYA 3HYTA 1FFWA 2Z8XA 1I7QB 4KR3A 2V7EA 3DAFA 4KREA 4HQKA 3QK7A 2Q5HA 3PLRA 1JEDA 1MX3A 1GZ6A 2JAUA 3SEQA 2GH1A 3FKQA 1C14A 4E5DA 1JVSA 4PLCA 1K3UB 1KDVA 3TI7A 3DWEX 3HV2A 4K81B 2AR9A 1EBUA 3ORHA 2BR5A 2YWHA 2X6QA 1JEYB 2XNCA 3CC8A 3BJMA 4NEQA 2JDIA 1SVSA 3OZUA 4MQFB 4R0VA 4V2IA 4YAFA 3RV3A 3THYA 1ZI6A 1HYQA 2NLOA 3H9CA 1XJWA 4Q4AA 2W2LD 2XZTA 1BCSB 1Y9AA 4RELA 3ON5A 1YR6A 4BO8A 5AI9A 2PPVA 4LVNA 4BMXA 5HA5A 2PE5A 4C7OB 2UDPA 1R9JA 1ZNYA 2XA2A 3AZOA 2D7CA 1JW9B 3T9EA 1YS7A 1MJ5A 5GOZA 2YXDA 4B74A 3UK6A 1OYOA 1LNQA 1UANA 4YAJA 1FP1D 2PGXA 3HJRA 3QHPA 4L2IA 3THRA 2B2NA 1NJSA 4ZDKA 2Q7XA 1KC1A 3S7TA 3DMTC 2AQ8A 2LIPA 3OJOA 1GN8A 3AWDA 4I4IA 4WUVA 1BU8A 1M1YE 1JKIA 2DOKA 4X1IA 4HNAB 1H6DA 2PUJA 3EGIA 4OXNA 1EB8A 1J1ZA 1DJOA 1QGED 2B2XA 3AJ8A 3F2IA 3JQFC 3M1IA 5LMUB 3V7NA 4MV3A 2IPOA 4MCIA 4JX8A 1NXSA 2JI6A 1AA9A 5DNVA 2G80A 2QM3A 4DBZA 3CTMA 2JKZA 1ORVA 4IJMA 1PSWA 3ZE1B 3L40A 2PEZA 1KFKB 3AKYA 3PICA 2D62A 4L5IA 3ZJ5A 5IX8A 5KOJA 1G8FA 1I0ZA 1OB2A 2XMCA 2YMLA 5JS1A 3PPYA 3TQSA 2J87A 3DP7A 4XB1A 3WRXC 5BQXA 4E15A 2R1VB 4FWBA 1UKZA 1Z33A 2R79A 1VTKA 1XLTC 3IUBA 3PUZA 4KGXA 2NUTA 5BY2A 3GVPA 4LF5B 3G2JA 2UXCB 1SBNE 4F4CA 2XUIA 5B1IA 1WCXA 4F5WA 2E4AA 2V54A 3CTPA 3PE4A 4FLEA 4RFSB 1BX3A 1VBMA 3VMMA 2F8SA 1XGKA 3ZTTA 5F33A 5D7NA 3C85A 2G83A 2NO5A 3CE6A 3IQIX 4FFBB 2Q4TA 4Q3EA 4U9IS 3ZXXA 5JSUA