4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
1RRGA 3BH7A 4G3XA 2CLSA 4FMCB 1U0LA 2J3EA 5E95A 1KI4A 4JBXA 3L0PA 2GXSA 2ZSEA 4AWXA 2ZSFA 3THXA 3CONA 3T1TA 2QORA 3TSZA 2DFLA 4CEJA 1P72A 1JI0A 2WJIA 2FDCA 1E2QA 4PHGA 4DLVA 4LI0A 5JRZA 1XPUA 1S9HA 2XAUA 4JMPA 4BRWA 4EUNA 4CT4B 2CCGA 4QBIA 1MO5A 1XD8A 2B7CA 5BN3A 5DLQC 1COWA 2TMKA 3K9HA 4QM7A 1K8RA 4C0JA 2YHSA 2CHQA 4H9GA 4TMKA 3MUFA 4OK6A 3EIHA 2O0HA 3TK1A 3KXIA 2D62A 2REBA 2YWHA 2IL1A 2OUKA 2BMJA 3C8UA 1ZM2A 3AP1A 4DB2A 5CB6A 3CF2A 3QPVA 4MA4A 2OXCA 2ZUDA 3H86A 1EFUA 3SJCA 1KDRA 3BFVA 1XJCA 4ZIRB 3EARA 3AP2A 1F6BA 5CDFE 3ZLJA 1Q12A 3B13B 4B44A 2OAQ1 2FN4A 2ZJ2A 4C0LA 3SU8A 1E6CA 1N6RA 1DELA 5KNDA 2WWXA 3QF7A 4BRUA 2NOAA 3N5CA 3SEAA 3UIEA 3DL0A 1DARA 1T8TA 4O2LA 1G3QA 1T6NA 2GXAA 2DFTA 2F9LA 5JMTA 4UJ3A 1E69A 5KDLA 3QSYA 3AVTA 1E2MA 2FFAA 1AK2A 3ZZTA 4CVNA 5FTMA 2GZAA 4C0AC 4TSFA 3MAAC 4BEBA 1O3YA 5UKDA 2A5DA 5AWFC 1V43A 4Q7LA 3A1TA 3TSWA 1M1YE 4LYAA 3NKVA 2FPLA 1UAAA 2XOKD 4TZ6A 4GOKA 4WW0A 5C4GB 2QBYB 3AH8A 3MGCA 4G5SA 2HDNB 1VCNA 2I3BA 2G83A 2A5GA 3WP0A 5DYIA 1OSNA 4I99A 3VR1A 2F55A 3CRQA 4LJ7A 4RFSB 2RGNA 3X1WA 5KOYA 2VP9A 1KJYA 2JLRA 5H68A 1E4VA 2IX3A 2B6HA 2QGZA 3HP1A 1TQ6A 2NTYC 3D8BA 3K0CC 4ESHA 3IGFA 3CRRA 2QEQA 1LW7A 3BE4A 4PFSA 2XB2A 3LBIA 1G5TA 3CRW1 5KHOC 1CKEA 2FFQA 2B92A 5SZKB 5JWRA 2JJ8A 3I3SR 2C98A 3NC1C 2QMEA 1DVRA 3LQQA 3W90A 1L8QA 1VCOA 4DC9A 4LOAA 4DCUA 3GFPA 5KUTA 2ZXUA 3QKRA 4IOJA 2AFIE 5GJCA 621PA 1XFAA 2FEOA 4I1SA 4V0MA 1AZSC 3LXRA 1UBCA 4JLPA 4LBWA 2O5VA 4DJTA 4Q1BA 4QJ4A 4CDGA 1HUQA 2ATXA 2FJUA 2IF0A 3MG9A 1KZGB 1WBDA 3Q72A 1BMFA 2PL3A 3QY0A 4PSAA 3QUSA 3B60A 2CE2X 4IEEA 2BMFA 2OE2A 1VTKA 2ZJOA 4LJ4A 1CRQA 5FI0B 1QRAA 2N1BA 2XSZD 2HT1A 4KV9A 4CGZA 4P4SA 4C0KA 1XD2A 2ZS9A 4YONB 4BPBA 2V1UA 2P6RA 2XNSA 3CW2A 1ZUNB 1CR1A 4HB0A 4GSYA 1G8YA 4F4CA 1Z0KA 1HV8A 4AYTA 2WICA 4UNPA 3B5JA 3EZ2A 4DLSA 2FH5B 2FZLA 1GZSA 3IKJA 3T06B 4ESVA 2H8KA 5FPSA 1ODFA 5DHAA 2EFHB 3MMPA 3LDAA 4PPGA 3TVDA 4N3NA 2EQBA 4MRPA 4B3GA 2B8WA 3GJXC 2NO9A 4V0LA 5ANRB 4L5BA 2QE7D 4MRVA 3EZ6A 1LV7A 2LKCA 1G6HA 1Q21A 3P20A 1E79A 3WYFA 3CPHA 3C15C 1U81A 4WOPA 1E0AA 3SFVA 4A92A 2CCKA 3DM9B 3P32A 2WOOA 1IXSB 1OYYA 5DI3A 3B1VA 3SBEA 3LLMA 1P2SA 3DMNA 3GJ4A 1NMYA 1RYFA 3E5HA 3VR4A 3RS3A 2JJ2D 1W5SA 3M0EA 4ZCLA 3EIQA 3UANA 1ZCBA 4KBFA 2AHOA 2V4ZA 3TKLA 5HZKA 4QHYA 5EUMA 1E32A 1N6NA 1U98A 4HAYA 4EJSC 721PA 1LNZA 2ZRHA 2AK3A 2D7DA 2P5SA 3ND9A 1M6NA 3E70C 1RKBA 3TQCA 5K8IA 3OIVA 2GDJA 4FWTA 3LXXA 3RYTC 1IY1A 1GKUB 2R6AA 2O0KA 3AKCA 1NJFA 3VNVA 4B73A 1AGRA 2CJWA 4DCVA 1NN0A 1Z28A 1G8PA 2HUPA 3B9QA 3EC2A 2FX3A 4PC7A 3T1QA 1HTWA 4DBLC 4EJSB 5KPJA 3FB4A 3M4YA 1IXZA 1YHNA 4AG5A 4LYJA 4TTRA 1NLFA 4LUCA 2QPOA 1A82A 1VHTA 1MV5A 2ZYTX 4RKFA 1JR6A 3WNDA 4URUR 5DI3B 4BLPA 1F2TB 1VCIA 2ZYVX 3JVVA 1OH6A 3CWQA 3A1WA 3LA6A 5JJIA 2ONJA 1NY5A 3FKSD 1NNEA 4B6FA 1HQYE 2X1VA 2YWGA 4OHXA 2RKOA 1XBTA 2A5YB 4FCVA 1RRFA 1OIWA 2ZYWX 4KBGA 1H8HA 2EFEB 5G40A 2IWRA 2Q3FA 1E9BA 3G82C 5C4MA 4FWIB 3LQRA 1WA5A 4I1UA 4JYCA 4PHHA 4DDUA 2PT7A 4LBYA 4G5GA 1XMVA 4PQYA 1HT1E 4B47A 2VA8A 4V0ME 4UNSA 5AUNB 3RANA 1KO8A 3VMFA 2PH1A 2OBMA 2XNDD 1YR7A 5C2JB 2JDIA 1JXMA 2AKYA 4MYCA 2OSBA 2ZRJA 2Q3HA 1FMJA 2PZEA 1HE1C 4US1R 4FCWA 1XB2A 4YXWA 4LV8B 2L0XA 4JT4A 3QKSB 4UQOA 2MSDB 3PIRA 2OFWA 2IWHA 2V6IA 3S1AA 3MD0A 1OF1A 2ZJZA 1Z22A 3LH5A 3TH5A 2EFDB 3C41J 4PQFA 3FOZA 4WZAE 2C9OA 4XTRA 1WRBA 2ZITA 1CULC 3GEHA 1K6MA 1M7BA 2NQ2C 2Z4SA 3PUXA 4JLNA 5FPYA 4PR0A 1XCGB 4GZLA 4LHZA 2C9CA 2VHCA 2HLDA 3A8TA 2UVQA 5D3QA 3VTKA 3WNCA 4BE7B 4EFLA 2GZHA 4NKRA 3UMFA 3KJHA 2FGJA 1MT0A 2Z83A 4JS0A 5KNBA 1Q0UA 3F3YA 4UXJA 2W6JD 1R5OA 3ZZUA 2J0SA 1CXZA 1P7CA 2NG1A 1N5IA 3OFND 1QBKC 5CYPA 4YQFA 3ADDA 2C95A 1Z8FA 4HZUA 3W9YA 1KIMA 1YZLA 3AVXA 2P2LA 3GFOA 3UMSA 1AQUA 2ATVA 2GJ8A 3KKOA 2IYZA 1QHYA 2G1JA 5FL3A 2O0JA 2FSIA 4HI0E 1KJWA 3PEWA 1Z47A 2VSXA 1XNJA 1P3JA 1OHHD 2ZE8A 4LSGA 4B2IA 4NU0A 2EVWX 4CEHA 2R9VA 4AG6A 1GP2A 3A4MA 1DE0A 2HJGA 4DLWA 4E07A 2WJHA 2C03A 4E5UA 1U9IC 2WWFA 1E0SA 4PTLA 1J2JA 3W8NA 4KITB 1XD9A 5DNYB 1Z6AA 2D2FA 4B34A 4P33A 2ZE6A 3U3RA 1WP9A 4KO8A 4BFVA 4KFUA 3LWNA 3MSXA 5EXTA 2G0TA 5B2ZA 3ZDQA 1VG1A 2X8AA 4DHEA 4UXIA 3U5ZB 3LNCA 1R2QA 2E9SA 3GLFA 1G8HA 1I2DA 2V7QA 2ZJYA 4CT5A 4MKFA 4JLJA 2NZ8A 2JIZD 3H0KA 3GFTA 3VQTA 2ZRGA 1II0A 1ZUHA 2PEYA 4ZKDA 5AJYA 5FOXA 2ZAMA 3AF0A 3BB4A 1F3OA 4A0GA 1M34E 2QAJA 2EW1A 2ZETA 2IYWA 2OG2A 4BFSA 3BRWD 1NLYA 3WMGA 3I61A 5EE0A 3Q7QA 2YINC 3EAQA 4QM6A 4OI2A 4DLTA 1X1RA 2ZIAA 1JNYA 3UPUA 2Z6VA 5IF9A 4LPKA 1ZMXA 1G7RA 1TQ2A 2C78A 3PCRB 4HZIA 3TW4A 3U6KA 3U4QA 1QVAA 1N0UA 2DBYA 4Q4HA 4JLMA 2OV2A 4DDVA 3X1XA 4HAWA 4ZPXA 1QVRA 2J45A 2AL7A 2H5EA 5KO2A 4ASUD 2PBRA 3U6BA 4R2IA 1QHHA 1EFRD 1OKKD 2AK2A 4A1FA 1IOZA 4G5QA 2NZJA 3GLIA 3A4NA 1L4YA 3Q5DA 4X8HA 5AUQA 2YKGA 4HAVA 4R2HA 1IBRA 2QRZA 4IDQA 1UF9A 1Z0AA 4PO9A 3AB3A 1MKYA 3C16C 4N0DA 2FMXA 4YMSA 3IHLA 3NDPA 1HYQA 4NCHA 1YJ5A 1PLLA 4NCJA 1E2EA 5FUYA 2XXAB 1R8SA 4EPWA 4S35A 1JALA 3PUYA 5FTJA 3QXXA 1DG1G 4B71A 1OE0A 4V0KA 1N6LA 5JECA 2D3WA 3FGNA 5L3QB 2OBLA 2VSOA 4F7WA 6Q21A 2PX0A 1HY3A 1OB5A 4IVRA 3NDBB 1AZTA 2DY1A 3FWYA 1IONA 2JJ1D 2XGJA 3U3MA 4QNRA 5AK0A 4C0HA 1IN7A 1LB1B 2GK7A 4TT3D 4W5WA 4BLSA 3B7GA 4V03A 1XU4A 1GDDA 4DVGA 2RGXA 2MSCB 1SKQA 2VPPA 3ICEA 4Q4HB 3AUYA 4TTPA 1ELOA 1JJVA 2ZJ8A 3CNOA 2J7PD 4TYWA 2J87A 2WZQA 1LY1A 4D2IA 1VYVA 4CW7A 3U44B 3T34A 3THOA 1U0JA 4XWAA 3K70C 4KLZA 1TADA 4C9BA 4EIWA 2FZ4A 2PX3A 3CX6A 1QHHB 1E1RA 1G4AE 1Q44A 2DB3A 4YMVA 3B9PA 2IS1A 1GITA 3SC3A 4NE2A 1OT3A 1ZNYA 5H1YA 1JQJC 4Z1MA 2IUSA 2WIAA 5A4JA 4GPTA 1YR9A 5FTNA 3B82A 2WKQA 1YRBA 2YWEA 2IXGA 4KVGA 5AJXA 4D4KA 1TEXA 3K70B 2HF8A 3H4MA 2V9PA 4M1KA 3TIFA 4NH0A 3N70A 2DFNA 3VNUA 1NP6A 4JLOA 4UXHA 1UKYA 2OCBA 3IIMA 4HLCA 4QGAA 4WA7A 4L9SA 1G18A 1FNNA 1R10A 2JLYA 1KI6A 2E1RA 5EJEA 3OEEA 2ASEA 2DPXA 2QG6A 1MABA 5JJKA 4HLUA 5AJWA 5FBQB 3X2SA 2KE5A 3B85A 4KFSA 2IS2A 1KNQA 4TWZA 4D80A 2GCOA 2J5XA 2HJVA 3VU9A 2OXRA 5G53C 1CR0A 2ZS7A 5IT5A 3K0AA 5GJWC 2CNWD 3A58B 1MRSA 1NN5A 3EZFA 3B1WA 1B0UA 3B1YA 3LO5A 1FQJA 2QTHA 2K5UA 1IN5A 1IAQA 1QHSA 1DAHA 3LBHA 3PV0A 1U0HC 2IYQA 2ZRPA 3ZVRA 4LHVA 1QHGA 4A2WA 1UEIA 2JLQA 2GJKA 4Q4LA 5EZ6B 3T35A 1E2PA 1SULA 4TL7A 4MRNA 4KHZA 3IQXA 3AKDA 1EESA 2BBTA 1IN8A 1EFHA 2WMOB 4CEIA 2BKUA 4KU4A 1XXHB 1ZIOA 2HCBA 2NIPA 3THYA 1DEKA 5B58C 3D3QA 3IO5A 1D9XA 3I8XA 1E2JA 3LW7A 1AM4D 2ODWA 3ZVLA 2B7BA 2GVDC 2ZYUX 1UPTA 4PAOA 2PLFA 5JSZA 2LKDA 4FCTA 4DDTA 5DISB 1MO6A 3GLHA 3NHBA 1R6BX 2FE4A 4DIEA 2OFOA 4RD6A 2WWYA 3GLIE 4LWZA 4BLQA 4B75A 4NHOA 2BIFA 2VHTA 2XTMA 1VYUA 5CB8A 2ZJBA 4KXFB 2GEUA 5KSYA 5AUPB 2CLCX 2FPMA 1IXRC 4GBMA 3RS4A 1S4QA 2CDNA 2JGNA 4NBSA 1US8B 1FUKA 1P2UA 2IYXA 3SDZA 4DZZA 3DKVA 1I2MA 1KI3A 2CVFA 1NBMA 4LBVA 1K5DA 2QT0A 3FYHA 5GADl 1OH5A 2EYUA 4OI4A 3TRFA 1U90A 5EUQB 4C7OB 4OHWA 1RJ9A 3NBYC 4M4SA 4HB2A 3VR6A 3P26A 1RIFA 3FDIA 4LBZA 4NCIA 2A5JA 4XIGS 2ZRMA 4A8JA 5JEDA 4W7SA 2ZPTX 4BGDA 3FE2A 5E7JA 2XTNA 1Y3AA 3HJNA 2QAGC 3PQCA 5FUWA 4IHQA 3DPUA 3KZ1E 4XVQA 4Y0VA 2H17A 2WBLC 3RS7A 3DZ8A 2IT1A 1S8FA 4GRAA 1II8A 3MCAA 3U7GA 3PUWA 1KMHA 2CE7A 2VTKA 4B2PA 2NGRA 3B8HA 4XD7A 1G64A 2YOFA 4F91B 4JKIA 4PAQA 3AVQA 2YZ2A 1BO6A 2HCJB 2MMCA 2ZUBA 4GI7A 2QU8A 1CJTC 1D2MA 4QGFA 2V54A 4GOXA 2XX3A 5BYKA 2PZFA 5BXQC 1G8FA 2D7CA 2I1VB 4WXPA 2QAGB 2QENA 3I8SA 1P9NA 3I92A 4Q4AB 1OXVA 4MRRA 2QSYA 2IXFA 2XJ4A 3BFKA 4Z51A 1L2TA 4RZUA 3BC1A 5KYKA 1XXHE 2O8EB 4MYHA 1OW3B 4Q47A 2WIBA 2UZ3A 4NP6A 4YLGA 4H1UA 4JJKA 3I32A 4K46A 3WHLA 4KODA 4D0GA 3DZDA 1E79D 2A5FA 4LV6A 5HZHA 1G3MA 4UNNA 4XWOA 5JHGB 5KSZA 1KDOA 1DADA 2R2AA 1AKYA 4RKEA 3I5XA 2BCGY 2Z5FA 3LD9A 1W0JD 3SHWA 3A37A 1FP7A 4QGHA 1ZINA 4GDFA 1X8JA 2BJVA 3TE6A 2R44A 1NMXA 1AQYA 2N46A 4TQAA 1T0JB 4II7A 4D81A 1E98A 4U00A 3ICQB 2O8CA 1II8B 1GWNA 3REGA 4G01B 1N6OA 2IA5A 1RRPA 2HF9A 1GOTA 4OQXA 2RAPA 1M2OB 3O8DA 4OI1A 5FPHA 2F3TA 1RRCA 1MH1A 2ORVA 4DSNA 2E87A 4IEIA 5CYOA 1VPLA 2QNRA 3FPAA 1OFUX 1OXXK 4LJ6A 1QHNA 1HA3A 4AYWA 3PITA 5FFMA 4V02A 2BDTA 1ZM3A 5TY0A 4AURA 5ELXA 4EPYA 1ZUIA 1TMKA 4U5XA 1FX0B 5BYJA 1ZM4A 1IY0A 2ECKA 2V6JA 4JLVA 2QSZA 2YNMA 2R6FA 1U8AA 4HAXA 2REXB 3QXSA 3CB4A 4A0HA 3K9NA 3QVVA 4L9WA 1CJVC 3WNBA 1OJLA 1XTIA 3THXB 3GLHE 3RNLA 2RCNA 3KXKA 4B3XA 4CEJB 2QTVB 3CR8A 2F9MA 4PZYA 3O47A 1N5KA 4URWR 1G9XA 1UDWA 3DOEA 4LK2A 2W2VA 4BQSA 3W3AA 3EPLA 5KNCA 4RJLA 821PA 1E1QA 3TNFA 3TUIC 2QZ4A 3IIKA 4MUBA 4D0NA 2C99A 3OHMA 1H8HD 1W2GA 4L15A 3A36A 3NH9A 2HT6A 4LJYA 1G7TA 4B48A 4QFMA 4TL9A 1P2VA 3ZS9A 1NBME 3NBFA 1TAGA 2GKSA 1G7SA 1CIPA 2DWQA 3KJGA 3SYKA 1XTSA 3PXGA 2F1JA 3I4LA 3LV8A 4YDSA 3J81k 2B21A 4AK9A 4TYYA 2CHVA 1VG9B 4JJZA 1KOFA 2IYTA 2VF8A 2JDID 2WJVA 1ZCAA 4D82A 1ZJ6A 2GVZC 4A15A 1ONBA 3BH6A 3Q5EA 4Q9HA 1JR3A 4B76A 2ZRAA 1Z2CA 4Q02A 1YZNA 3MJHA 3IIJA 1W4AA 5FBRB 2QQ0A 3SE0A 1X8KA 5DGXA 2Z4RA 3GJ8A 4ZCMA 3U3JA 5G3YA 1W0KD 1XZPA 1A7JA 2WWWA 2RGEA 3SQWA 1P73A 2BMEA 2GTPA 1Q3TA 2W2XA 4UNQA 4XTCS 1CP2A 2RGNC 1KHTA 2OT3B 3OEHA 2RGBA 4DCNA 4EPTA 4W9MC 4PPFA 4RD4A 3IHWA 5HKKA 3HPRA 2HV8A 1FTSA 3KB1A 4UJ5A 2XZOA 2YYZA 4PSKA 1N3BA 3BORA 2IYUA 5KDDA 3PUVA 1M7HA 1T3LA 4ZDWA 4E09A 2FNAA 3BIFA 1M74A 2QL6A 2FWRA 4TTQA 4Q5IA 1A5TA 1GL7A 4BFWA 1R0ZA 1W4BA 1P5ZB 3KFVA 5G41A 3KTAA 3U2QA 3PR1A 2P67A 3D7MA 2YJTD 1W36C 1XDBA 3LY5A 4JZKA 2JAQA 3QENA 3QEOA 1GRNA 2P6UA 1PZNA 2WPDA 4AKEA 3BD9A 1UFQA 3FFAA 1UJ2A 2BJWA 1W46A 3JZMA 4JT2A 3RSOA 1LFDB 1LTQA 2ZI7A 5J4LA 2G1KA 1HQCA 5TXGA 2R8RA 4M9XA 2ZEJA 5J4YA 1NKSA 4JKYA 5D3MA 1BOFA 1DAMA 2GXQA 3KKQA 4URZR 3MJRA 3RC3A 4PAMA 3AF2A 1S3GA 3NH6A 3CH4B 2IS4A 1WQ1R 3FTQA 3QKRB 2QMHA 2OCPA 1Z0JA 1ZVQA 2ZANA 1W36B 1JECA 3F5FA 2GETA 2A3RA 4A0FA 3SOPA 1Z6TA 2XB4A 3KQHA 4QNMA 1XZQA 4FMDF 1I4TD 1D6JA 3VKGA 5M04A 3A1VA 3OE7A 3KX2A 3CX7A 3ND8A 4PHFA 3MFYA 2V7QD 4URYR 4V0NA 5EXSA 4IDOA 1R5BA 5HE9A 3FHTA 4PC6A 2XTZA 3CWZA 3PEYA 4P4SB 3OF5A 1XD2B 4MQBA 4QJ5A 1FL9A 1UKZA 1WDTA 1T8UA 3FMOB 3QG5A 1N6IA 1VCMA 4YC7A 4M1TA 4D0LB 1FOEB 2FF7A 4OK3A 5BQ5A 4AYXA 1SHZA 3I72A 2OCAA 2W0SA 4JIMA 4Q1AA 1M8PA 3KKPA 3OZXA 2A2ZA 4IFEA 5FI1B 1OFTA 1SHKA 3U7EB 1HT2E 4ZDIA 4AI6A 3REFA 4NDZA 2GWHA 2OAP1 3EXAA 4TZ0A 1Z3IX 3ZD6A 1OFIA 3T61A 1KK3A 1TU3A 3L8YA 4DLUA 5DN6D 3P4YA 1TL7C 4KSBA 1P60A 1E3MA 1Z2AA 4WZ6A 1PV4A 5LB4A 4B43A 2Q3MA 3C7KA 3ZH9B 3N2EA 4JL6A 4NPHA 3KQNA 3TUJC 4XOIA 3PVSA 4HB3A 5TV2A 5F98A 2FSHA 1ZM7A 5EP4A 1SXJA 4IDNA 2OBNA 4MGKR 4S2EA 1JR3E 1N2CE 1UEJA 3K0SA 5KDOA 3QPUA 3C5CA 4HEJA 5P21A 1ZU4A 3EX7C 3K70D 4PQRA 4P32A 3PUZA 2BEKA 4U02A 4IOLA 4EKDA 4DUGD 4XSHA 1QZXA 5CJ2A 1YZKA 2GBLA 1ETUA 1W4RA 1JQLB 3T5DA 3ASZA 5J47A 1NSTA 4DLZA 2IXEA 5TB5A 4TMZA 3L0IB 2CJWB 2PEZA 1UBEA 4NTZA 1W2HA 1IM2A 4EQ6A 1NLZA 1NY6A 4LHXA 3P27A 1SXJC 2XOKA 3RWOA 4MGIR 5EXXA 4LYHA 5EP3A 2VHQA 4EFNA 4QC2A 2VRWA 1KJZA 1C9KA 4TMVA 4P31A 1G5RA 1VDZA 4PANA 4JVMA 4HYYA 3F0TA 4GP6A 1EG7A 4EAQA 3A1UA 3GEIA 4DCTA 1X86B 2GBLC 2VYFA 1WF3A 3HR8A 3LRPA 3QVUA 1TQDA 2AWNA 2ZS8A 2GRJA 1FMLA 2EWVA 4DIDA 2IUTA 4HUQA 1SXJB 4IDHA 2ANBA 3UATA 5FOTA 2JEOA 2NO1A 5AR1A 1RZ3A 3CLVA 3O8BA 5FL7D 1GSIA 3W5IA 2V3CC 2NPIA 1KI7A 3LX5A 1F60A 1H8ED 4PX9A 3GJ7A 3HWSA 4BFYA 2EWWA 3LBNA 3A6PC 3EC1A 4UNRA 1CLUA 1DPFA 2FGKA 1FP6A 2OM2A 3VR3A 1K5GA 1VG0B 5A0FA 5CJPA 1KSFX 1Q22A 1SVLA 2RMKA 4OL0A 3A4LA 5JBQA 3AKYA 3RRMA 4OBEA 5DSZA 4EQ6B 4WAUA 4KI0A 4IDPA 4Q01A 4PZLA 3WBKA 4MUAA 5LD2C 2I1QA 1CRPA 3NWJA 1X6VA 1Q1QA 1NN3A 5TARA 3V00A 3GJ3A 3Q9LA 2AD1A 1KKLA 2XSZA 3S1AB 3U61B 4QRHA 2KB0A 1E0JA 4YMUA 4Z8XA 1XJQA 2EFGA 4M22A 4BWYA 1TU4A 1C1YA 3UG7A 2QPAA 1XPOA 1G20E 1G5PA 4KFRA 4R71A 1NVVR 5IHPA 1XF9A 1R7RA 1ZW6A 2UKDA 2HYIC 1SGWA 5LD2B 3B1XA 3OIYA 4WIAA 1TQ4A 2SHKA 3EA5A 5FR2A 2WKPA 3C4JA 1KSHA 3NG1A 4QXAA 3N2IA 3CRMA 2H7VA 3L0OA 2KJQA 2QE7A 1CJUC 1DBSA 1T3SA 1YQTA 4D4LA 4P4UA 4HZUB 2JCSA 4X8LA 3ADBA 2IS6A 5GJBA 4JYBA 2CCJA 5K8UA 2IHBA 5JS8A 4MYTA 2F1HA 3B1ZA 4JVSB 5FOVA 3MRSA 1P62B 5EP1A 5FH9A 1Z29A 3TGPA 1E94E 1XTRA 4IFBA 2PCLA 3QJYA 4AY2A 3BB3A 4EPVA 4A36A 4QBHA 3EWSA 4NONA 3W6OA 1ESMA 4C0SA 2BHRA 2F7SA 5FBVB 2JJ2A 2IHYA 2W6ID 4CEHB 3M1IA 4KVAA 1SKYB 5CIWA 5BW8A 1SXJE 1GUAA 2HYDA 1AIPA 2WWGA 3IO3A 3KFXA 1WXQA 1NI3A 3K9GA 3IQWA 2P5TB 4B3BA 4DSOA 2ZR0A 3AF1A 4G5OA 1NL3A 4LYFA 1LS6A 5DYGA 5EP2A 5B57C 2F1RA 4D4MA 4G0NA 1NBMD 4MYUA 2H1LA 1L4UA 1OLOA 5J4HA 1QF9A 3V4FA 2IW3A 5JRJA 4V0OA 2KI5A 4PSVA 2O8FA 1E0KA 1EX7A 4KCGA 3EPHA 3GLFB 2D74A 4Q4JA 3I1FA 4Q7JB 4M1MA 4E22A 2YVUA 5CIQA 5CK4A 2RGDA 3RVBA 1UDXA 2VHUA 2C9YA 1GRQA 3THWA 3QBTA 2GXUA 1L7VC 2C77A 1HEIA 3ZIAA 3CX8A 2W58A 5CITA 3MWYW 4BASA 1A1VA 3FVQA 4NL4H 2GJSA 4NZYA 3UMRA 2Q0HA 3CKLA 2RGAA 4ARZA 3GD7A 5HTKA 2VL7A 2WJYA 3I5YA 2VSFA 2VQSA 4Q48A 4QBGB 4XH9B 1CJMA 2GF0A 4OQFA 2RGGA 1GAJA 1FW6A 4A9AA 4XVRA 3SFZA 1GNRA 2BBSA 2BEJA 4KJZA 1P9RA 3RDPA 4OYHA 3U4QB 1W44A 3WRXC 2LCFA 1DS6A 3EPKA 3CUEF 3PJRA 1QG4A 2IYVA 4B3FX 4POAA 4PO8A 3HU1A 4Q1EA 1II9A 1ZC3A 4MH0R 3AV0B 3G0HA 3QQ5A 4PPQA 3OAAA 5K8LA 2BCJQ 1AJEA 3MLEA 2JLVA 2AXNA 3GLIB 3O8RA 3GJ5A 1Z07A 5EXPA 2XNDA 3TR5A 2P6NA 4IKEA 1G17A 4US0R 2H16A 3QXHA 5J4KA 1OYWA 1DTSA 1SVWA 2C8VA 4RZXA 2Q9CA 3UWOA 2FG5A 1GKYA 1SKYE 2GILA 3K9LA 2QUZA 1XEXA 4YMWA 4TLCA 3VX4A 1KTVA 1E2HA 2ZRCA 4HB4A 1COWD 1OV4A 3FMPB 2ZSBA 3F8TA 4TLAA 3QEJA 3QKUA 3RWMB 4KLNA 3EPJA 1RC8A 1T4GA 1YU9A 2ZTSA 5DE3A 1NVVQ 4FMBB 4QG7A 2JA1A 1J70A 1NSFA 4FMCF 2B8TA 4GMDA 4RVCA 3Q85A 1IJEA 4BEJA 4FXPA 3ADCA 1Z6GA 3GLFE 2CL0X 1N0WA 4YDHB 3WBJA 4M9QA 1FPMA 1TX4B 4L16A 3CZQA 1S3SA 3C5HA 3AVVA 3OFNA 4D25A 2REOA 3E2IA 5J40A 3DEFA 2GEVA 3IUYA 1GRRA 1GFIA 4M8NE 3VX3A 2O8DA 1DAFA 2Q6TA 3HU3A 4ZDKA 4XVUA 3AQ4A 1PUIA 4P3YA 1KI2A 3SJAA 4FD2A 2F43A 3WMEA 421PA 1UBGA 2QM7A 4IW3B 4JSTA 2AD5A 2VO1A 3AGQA 2ZR7A 4HLUC 4B2LA 3QXCA 4TSFD 4Q9IA 3HR7A 3EA0A 2Q9AA 4TL6A 4US2R 1FFHA 2NO7A 4TQ9A 1QHXA 4LC0A 4KSCA 2WWHA 5DO9A 4MKIA 4PC2A 2ONKA 5JI2E 3BH0A 3CBQA 4QHTA 4X8OA 4AC9A 3AF4A 1P4SA 1KI6B 4W5HA 2EU8A 3KJEA 2BMDA 1MABB 1JEEA 5BN5A 2JLXA 2ORIA 2C2HA 3GLGA 1TUEA 2C04A 1XTJA 3QNUA 2CHGA 2QPTA 3GEEA 1DAIA 2GCOB 5B30A 2JIZA 3JVUA 1WMSA 3VU9B 2QM8A 1PLJA 3K0AB 1YZUA 5CDFA 2O8DB 2CK3A 5SZIA 3BERA 3V4RA 2BVNA 4IOKA 1DAKA 2F43B 3ZD7A 5EZ5A 1P61B 4PC3A 1AKEA 3ZGXA 4TYQA 4RD1A 4DT1A 4CYMA 2ZVQX 4GFDA 1N25A 4F92B 4AD8A 1E2KA 1YKSA 1W36D 2VP2A 5FTKA 4BZQA 4QOSA 3TUZC 1BIFA 1MO4A 4LJ5A 4TMWA 1NIJA 5FUVA 3VFDA 1ZYUA 5DH9A 3IBGA 4CEIB 4Q66C 2QI9C 3K0FA 5HR5A 3THYB 1F2UA 1TPZA 4Q7MB 5E4FA 3X1DA 1BMFD 2W2TA 1QG2A 4HUTA 4DEXA 2VP5A 3QF4A 3FMFA 2XZPA 4ASUA 5JSZB 1OXTA 1Z0FA 3GLHB 2EYQA 2GCNA 2JLSA 5IRCD 1EFRA 1OKKA 2DYKA 2OFXA 2H57A 4LCBA 4Z8YA 5JLJA 3GLGB 3DVLA 3NXSA 1A2KC 2H92A 2ODBA 3RAPR 5LDDC 1ZD1A 3CNNA 1XMSA 4FIDA 1DO0A 4KAXA 4I81A 4QKQA 3LVQE 2WPDD 3SNHA 4A8JC 4DEYA 2QA5A 1XEFA 1D2NA 1XJ0A 4NMMA 4ZI3A 2QP4A 1FZQA 4ZDJA 3SBDA 1YE8A 1CS4C 2QP9X 5AJVB 3CPEA 3RS0A 3SZRA 3GCGA 1GG2A 4JLDA 1ESNA 4M1YA 4JVLA 1RJ9B 1BH2A 3ADKA 4XSGA 2J41A 3AVYA 3HU2A 4LGMA 2JJ1A 3R9IA 3VAAA 4TT3A 1N5JA 1KSGA 4N1AA 2JLUA 4A8JB 3P1JA 3BWDD 4WXRA 1N6KA 3DO6A 3K0FB 3GQBA 1GIAA 1KDPA 1XCMA 4KYUA 3SN6A 2PJRA 3CZPA 1ZBDA 2P3SA 3QPWA 1XPRA 8OHMA 1SZPA 4BLTA 1V5WA 5JWHA 1XTQA 4ZIRA 1G4UR 1KMHB 2ZRKA 2V1XA 4LY6A 2BC9A 5C46F 2G3YA 2C5LA 1E2NA 1JPJA 1J8YF 1Z5ZA 4Q9KA 1G3RA 1R0YA 1Q57A 3RSLA 1CEEA 5IK2A 3KJIA 2J9RA 1Z08A 2HXYA 3BK7A 3QI2A 4FI3C 3LX8A 1EK0A 1ZRHA 4G5RA 5FBWB 3H1TA 3WMFA 3QE0A 4CZ2A 1G16A 3TAHA 3HYRA 3KB2A 1KI1A 3UXMA 1S9DA 4AKHA 3AVUA 3FHCB 2ZM5A 2QBYA 2LWIA 3K0EA 2R65A 1E9CA 5FTLA 4MDFA 2WSSA 2OILA 1KGDA 4RFSA 3R9XA 1ZP6A 3GLGE 2BKEA 3K53A 4RCYA 4LDJA 1KAOA 1KI8A 1IN6A 2ZU0C 4LRWA 4C30A 2J0UA 4Q18A 5KSOA 4JSYA 4OQLA 2AXPA 2VEDA 1CBUA 1SVOA 1E4YA 1AS0A 4RD3A 3T1VA 3GMTA 4BLOA 4DB4A 2O8CB 1SXJD 1ZNXA 4JLKA 2CNWA 2AR7A 1TUIA 2ANCA 4ZV4A 3QG1A 4RZ3A 1A4RA 1OXUA 1T9HA 3TAUA 4DLXA 1E2GA 1TNDA 3WYAA 4NYJR 2FOLA 5JEEA 1DAGA 1EGAA 3DOFA 1VECA 4Q00A 2GJAA 121PA 2H18A 2WV9A 3K0CA 1X8LA 4RSGA 1UKVY 2CL6X 3Q7PA 4NYIR 4R98A 3TJZA 4JLBA 5F3WB 4EDHA 1E9DA 1N6PA 1DAEA 4PO1A 4YXWD 2GAOA 2RHDA 3LVRE 1AA9A 4A4DA 1CR4A 1CR2A 1GNQA 4RD2A 4MRSA 1MOZA 1J7KA 4CIDA 2JASA 1IY2A 2FA9A 2QRNA 4HATA 3VHXA 2F1IA 4X8MA 2HXSA 1Q1EA 3IEVA 4L4UA 1KDTA 2J0UB 1ZM9A 2YC2C 4CF7A 4TMXA 3LW8A 3H2YA 1W7AA 2KBEA 3G5UA 4AKGA 3OIWA 1QDEA 1LVGA 2QN6A 1VHLA 1AS3A 4O0MA 2HLDD 3IPYA 5JWOA 2W0MA 4OHYA 4HLQB 1LF5A 1E9SA 2VP6A 5EE5B 3ZZ0A 1KI9A 1NKTA 2ZI6A 3DMDA 4HDQB 4M9SA 2V8OA 4L8GA 1OXSC 1NG9A 3CPJB 3NEYA 2ORWA 4R9UC 3CH5A 2FFBA 3MWJA 2F3RA 1HH4A 4HDCA 3WP1B 2ODEA 5J4VA 1RW4A 4B3CA 3ASYA 3GPLA 5HCIA 2KSQA 3AVWA 1G291 1Z63A 2ZI3A 3TLXA 1IN4A 1CF4A 1G21E 4TL8A 3W6NA 3X1ZA 3CNLA 1A2BA 3CR7A 3ZQJA 1DG3A 2A7QA 4OK5A 3ZYCA 1ZNZA 3BJIC 4FN5A 1BYUA 5TDHA 1OIXA 1YZTA 4LX0A 4LV5B 4A0RA 1I4LD 1MO3A 1U8YA 1W49A 3MWKA 1E2FA 3L82B 3P4XA 1TEVA 5E7IA 1Q20A 1JEDA 4JL5A 5TVKA 4OKSA 2GHIA 4TLBA 3AUXA 1DO2A 1EWRA 1OH8A 1FQKA 1W47A 1VIAA 3EW9A 2XEXA 3SS8A 3L43A 1WE2A 1G7CA 1KNXA 4MGYR 3HYTA 2CVHA 3EZ7A 4ACAA 4XWKA 2ODNA 4EJSA 2AFHE 2QY9A 3KTAB 2X2EA 4WVFA 3AP3A 2OLJA 3VR2A 1W0JA 3PEUA 4LJAA 3NHAA 1F2TA 4URXR 4C0BA 4IVPA 1RFLA 3KQUA 4GNKA 3I73A 4N0EA 3RRYA 4FINA 3KUDA 3EZ9A 1S1CA 1ZC4A 5H8WA 1ZD8A 4U7DA 1PVOA 2NO0A 2PZGA 4PC1A 4A2QA 3C14C 3CF6R 3HPQA 5D3MB 2J7KA 4DSTA 4F38A 3R8CA 1Z0IA 2QMUA 4NYJQ 4I1OA 4TLEA 3IILA 1JB1A 3W8RA 1XEWX 1N0VC 2I4IA 3FKQA 4EFMA 1KZ7B 4DKXA 3CIOA 3MWLA 4PXAA 1UBFA 3RC8A 2FU5C 2VIIA 2BBWA 221PA 3W3ZB 4F4IA 3BOSA 1R4AA 3RABA 3KQKA 1S2MA 5CLLA 4BZPA 2J1LA 1C4OA 4NYMR 4NYIQ 1OB2A 4IRUB 4DRZA 1YZQA 3NBZC 4M0LA 1E96A 5GVSA 2CXXA 1VG8A 1IJFA 2IF2A 2ZSAA 2A78A 4LPSA 2DR3A 3QXJA 1U2RA 3ZIAD 4BFTA 2GJ9A 3KKNA 3QKSA 2YV5A 5EE3A 2Z0MA 4HAZA 4JBWA 1G41A 3D6TB 5LB2A 4FW9A 5FUXA 2WM9B 1XEWY 1UADA 1EFTA 4AKIA 2BV3A 2QQEA 5E3HA 5FOUA 2BM0A 1D9ZA 2VBCA 1WBBA 2IEYA 2X77A 5L3SA 2OZEA 4OJKA 4BFXA 2CEAA 1GM5A 1E99A 1XMJA 4GP7A 1SVMA 3ZJYA 4Q03A 3PENA 1ZIPA 1JXOA 1U8ZA 1Q1BA 2OLKA 4Q21A 2MMGA 4QGGA 2J0QA 3IBYA 4C4PA 4QL3A 2ZVPX 1KK2A 4WZBE 3RLFA 3CF0A 1D8TA 5BN4A 2FSFA 5FOWA 1E9AA 3OAAD 3AM1A 1TF7A 5FOSA 4D26A 2WMNB 2OESA 3L2OB 4K81B 5DIFA 3T15A 1E1RD 3ZVNA 2XZLA 2ZRLA 1HE8B 2PMKA 2CBZA 3Q8XB 4TYNA 1IHUA 1W5TA 4LJ9A 4IXMA 2FFHA 4Z1MD 3IPXA 4M21A 5C1BA 5JS7A 2ZR9A 5JCPA 4B74A 4ON9A 1XWIA 2UZIR 2ZI5A 5H70A 2G9NA 4LC1A 3UG6A 1OIVA 1W0KA 1XMIA 4JL8A 1QHIA 3WHKA 5DHFA 3D31A 1DOAA 3HDTA 1YZGA 4GOJA 3KKMA 5L3SB 4C2TA 1NF3A 1Z0DA 4E03A 4A6PA 3OEED 2QP3A 5HE8A 3R9WA 1PJRA 1E2IA 4LHWA 3V9PA 4UKDA 3WRYC 4MKGA 3B6EA 4DSUA 1EXMA 1U94A 2D2EA 2RGCA 2VF7A 1U9IA 5HPYB 5CM9C 4HSEA 4LHYA 1MR3F 1ZU5A 2YOGA 3ECCA 4Q1DA 2ZI9A 3T1OA 4B3DA 3U3OA 2XJ9A 1WB9A 3DDCA 4QBFA 5GVRA 5EQTA 4TLDA 2GEDA 4K8OA 4IOMA 3WYGA 4PHTA 3KQLA 2CMKA 4RCZA 4BZXA 5KPDA 1Z06A 1ZD9A 5CM8B 1W1WA 2RHMA 3B78A 4LJ8A 4ABYA 2ZUCA 4MDEA 3E1SA 4FMDB 1YRAA 4YMTA 2GA8A 4HUQB 2WAXA 3U3KA 1D2EA 3NEJA 4BLRA 1NVUQ 5FPTA 1YR8A 3R7WA 1B23P 4QHSA 3TMKA 1HURA 2AN9A 4Z54A 2DHRA 1KO4A 2ZRDA 3NC0C 3FMIA 3H84A 2A30A 1LS1A 2Y8EA 2A9KA 4AIIA 2Z43A 2AX4A 1KAGA 1GTVA 5C18A 3BAFA 2J46A 5J5CA 3X1YA 2ZRNA 4HLDA 1T5IA 3DHWC 3NVAA 5JJLA 1VIYA 1ANKA 1X1SA 4G1UC 4NYMQ 3RHFA 4MITA 4Q19A 2IYSA 4Q7KA 4JLAA 4A82A 1PUJA 3LLUA 2WVJA 2ZRFA 1AS2A 1SQ5A 3SQXA 4RD0A 1XP8A 4A2PA 2PJZA 4BFZA 4GMXA 3JZAA 3I62A 1NG1A 2CK3D 2XXAA 2BM1A 3SR0A 1I4DD 3RRNA 4EPXA 4M1OA 1S96A 2ZRBA 5L3QA 2IYYA 3AF3A 2WOJA 3TQFA 3R7WB 3TSOA 2ZAOA 2OCYC 1TF5A 3W6PA 1NIPA 1M7GA 2C96A 4QJ3A 5A5GA 1Q1ZA 2CL7X 2D06A 2WKRA 1XX6A 3RS5A 2MSEB 2VHJA 1NN1A 3AEZA 3PEVA 4ILEA 3VR5A 1G8GA 2DFKB 2IBMA 1NRJB 1J99A 2DWPA 2FSGA 1J8MF 2JATA 2ZSDA 5F2EA 3TW8B 3TVTA 5FPKA 4I4LA 3BS4A 4ZO4A 5DN6A 4B35A 5LPNA 3U44A 5EE1A 3T5GA 1OH7A 1T3HA 1VKJA 1YVDA 4TN1A 4M53A 2R6DA 5SZHB 3VKHA 1BS1A 3RRZA 5JHHB 5E7MA 4W5JA 1JBKA 2QT1A 4XD7D 2PCJA 3K8YA 1GILA 2GESA 1T5LA 3FKSA 4DCSA 3M6AA 5AJZA 4ITRC 1G1MA 2HEIA 1IQPA 2Q21A 3QIAA 2NPFA 1Z83A 3SJBA 4URVR 3UKDA 1NJGA 1H65A 3KUCA 2RH5A 3L8ZA 1OFHA 2GCPA 2GNOA 3CO5A 4M1SA 3K09A 1S0UA 2ZI4A 5IDVA 3LAWA 2IC5A 4DUGA 2ZU6A 4HAUA 2WJJA 2O8FB 1R5NA 3ZVMA 2G6BA 2RB4A 4Q9JA 3U7FB 4Q4JB 2CLDX 2WTUA 1E2DA 1N6HA 4NCNA 1WCV1 3SI7A 4TMTA 4O25A 3IDQA 3PFIA 4ZI2A 5LBIA 3THWB 5AUOB 2IYRA 2QROA 1BYIA 1KSJA 1P6XA 5KU1A 4RY2A 3KL4A 3NTUA 4B33A 1RVDA 1YR6A 2IUUA 1R0XA 2WSMA 4RFVA 3BXZA 4IVQA 4XJXA 5DI9A 5FR1A 4ACBA 4PPNA 4ARZB 3DM5A 2VLIA 521PA 3K09C 1CJKC 4JBYA 4C3ZA 1AGPA 3KXLA 5F9FA 3EWAA 2D4HA 3BBPA 2W00A 1GL9B 3T12A 3VHLB 3NIBA 2DWOA 5IK2D 1RPZA 2ZREA 4TYPA 1LF0A 4A6XA 5F9HA 2WWIA 1W48A 4GZMA 3DKPA 4M2LA 2WAYA 2AKAB 2ERXA 2FV8A 5JI3E 5FL7A 4JVNA 2W6JA 1H8EA 4F4JA 1GL6A 1SVIA 1VYTA 1J90A 1XXHA 2OHFA 2PMDA 4R7ZA 3NBXX 4KFTA 2YOHA 4BUJA 2ZJAA 1U99A 3CM0A 4BECA 5BWMA 1E9FA 1FNMA 2WSSD 5HCNA 3U7HB 3OIUA 3ONWA 3RS2A 5JZVA 1T0HB 1KY2A 4P0TA 4DWJA 1KO1A 2JLZA 1CTQA 2PT5A 4LZZA 1G6OA 1OHHA 2EFCB 2GZDA 3B2EA 1AN0A 1JAHA 1JAIA 3SYLA 1XEXB 4B6EA 1Z6YA 4ZCIA 3PG5A 1E1QD 2OEPA 4D6PA 2GF9A 1P9WA 1XTKA 2DCUA 2O52A 2OO7A 2J0VA 4F93B 1US8A 5JCZA 1R0WA 4M1WA 4B32A 2R6GA 4D4JA 1E2LA 2G0NA 2ZJ5A 3CRVA 5L3VA 4OQMA 4H1VA 4EPRA 1TTTA 4WBSA 4CRWB 4I1VA 2P65A 4DDWA 4C7OA 3TR0A 2V55B 3L0SA 3LFUA 4M9ZA 4BFUA 1KYIA 2O8BA 5FBLB 1JJ7A 3EG5A 2F6RA 3QBVA 3GP8A 4OHZA 1GVNB 2IEZA 1KKMA 2VH5R 2YC4C 1UM8A 3R20A 3ZS8A 1EX6A 1P75A 1VMAA 1NVXQ 2KWIA 2WHXA 2FPKA 3AKEA 3BFXA 2YWFA 1S1MA 4P4TA 4PZZA 1EFCA 3VKWA 5TMPA 4J0QA 1JR3D 1XRJA 2ZE7A 1D5CA 1KY3A 3GJ6A 1RYHA 3ZQ6A 2R62A 2X19A 2AWOA 3KDSE 3AGPA 3A1SA 4RZ2A 3K1JA 1FUUA 2JLWA 4IXNA 1GKIA 3AVPA 1ZNWA 1KO7A 1NMZA 2Q9BA 2GK6A 2W6IA 3QKTA 2BOVA 2IYLD 3OEHD 2QTFA 3WXMA 2FEMA 5KSPA 5HKKD 2XITA 4OI0A 2QGNA 4Q1CA 2QAGA 1Y63A 4Q4AA 3FHOA 2ERYA 1Q3HA 2PLRA 3W34A 3R8FA 3QOFA 3EIEA 3AVOA 5CK5A 1JPNA 1UKEA 4GL2A 2O8EA 1PLKA 4Q1FA 4Y0AA 2IK8A 1G3UA 4DLRA 3W5JA 1TF2A 1N5LA 3IEUA 3SJZA 2ZE5A 1E9EA 3GJ0A 1CU1A 5B64A 2BBOA 2QMOA 3EASA 3U60B 1EWQA 2O8BB 4C0QC 5KTYA 5L3RA 5G3ZA 1FTNA 1RE0A 2NO6A 1KK0A 3SYNA 1OPXA 4GT1A 3UWKA 4Q9LA 4OJQA 5GJVC 1KK1A 2ZROA 3BB1A 4O3MA 4NCKA 1GNPA 2W83A 1W4CA 5SZJA 2VP4A 1ZAKA 1XCPA 2VP0A 4O2RA 3FFBA 4ZKEA 1T91A 1F5NA 2R6CA 5CLQA 1G3IA 4DT1B 1F48A 2ZQ5A 4OHVA 4IJMA 2BWJA 4KYIB 2N42A 1R8QA 2GAAA 2KBFA 3UK6A 2ZRIA 2WJGA 1BKDR 4DLYA 3SHFA 5JFGA 1NVWQ 1MRNA 1KO5A 4MKHA 4TQUS 3WY9A 3Q3JB 5EE9A 1KMQA 1SVSA 4HDOB 4ERNA 4C2UA 4MGZR 5K8TA 1O87A 1P2TA 5L8VA 1F2UB 1G19A 2J7PA 3OE7D 3TBKA 4DXAA 3O8CA 2J59A 3BGWA 4OQNA 3QF4B 1Z6XA 2P0EA 2X2FA 1SVKA 1FX0A 2NMVA 1E9RA 2G77B 3OESA 3ETLA 2G88A 1X3SA
chains in the Genus database with same CATH superfamily
4FMCB 8MHTA 1AB5A 2J3EA 4QO8A 2A0UA 2ZSEA 4KQWA 2D3TA 3DWIA 4AWXA 4U9HS 1CUCA 3KLPX 3DE6X 3C4QA 4N40A 5JYBA 4LHEA 4YT4A 4LXXA 2HBZA 5ALFA 1JI0A 1AQJA 3E2PA 3DXFA 4QYWA 2YDXA 4CLRB 3IJPA 4PHGA 5HA5A 4DLVA 4LI0A 3H9GA 1JE1A 5C8VA 5JRZA 1S9HA 5IZCC 1DHRA 4MVJA 4ND7A 1ORRA 4E1VA 1VE3A 3C6QA 4DZTA 2ISSD 5T8KA 5BN3A 1ZEMA 2A0XA 1XU7A 1OZHA 2G04A 4K6KA 5ERGB 5JAPA 4CIWA 3WR5A 4ETWA 5A04A 1K8RA 1C7IA 4TKVA 1PWEA 3I45A 3CLUC 4NE9A 1SFRA 1L4NA 3I9LA 1NDQA 4J90A 4L73A 3B2QA 4TMKA 2YJ4A 1KDVA 3HVJA 3RTDA 3SC2A 5B7PA 2O0HA 2J9XB 2QMZA 4UULA 4H4CA 3OJLA 3KZCA 1X80B 1GQYA 3HABA 4F06A 1QR6A 2IVZA 2W43A 3JAWA 3MGBA 5THKA 3HHEA 3RQIA 4MA4A 3C3AA 3T6KA 4M99A 4MQLA 4RSMA 4HNVA 2ZUDA 4XLLA 4MV8A 2GEKA 5KJEA 3EVGA 4RKRA 1G21B 1MB4A 4GH5A 1KORA 4YDRA 3EARA 3FNEA 5HHTA 3AP2A 5CDFE 4MOWA 3HWX1 4BGEA 3SSMA 3KVYA 4DMRA 1IEQA 2XCTB 1Q12A 3L8EA 4C0LA 2OAQ1 2ZJ2A 2PMEA 4O59O 1DELA 2OZLB 4OFXA 4O2BF 5KNDA 3QF7A 1YXMA 1NP3A 4OJMX 3N5CA 3SEAA 4CCAA 3L84A 3UIEA 1DARA 2AQIA 4CE6A 1QE0A 3IAS6 4KEAA 1YC2A 2Y66A 5DM4A 2XGOA 5AT1A 1LC0A 3BUSA 4YPFA 3FUCA 2HKIA 3H1PA 3TD9A 4QVKA 5JMTA 5KDLA 1E69A 4YNBA 5JNWA 1E2MA 3JR3A 2FFAA 4DSZA 4CVNA 4FKMA 4FNMA 1FP4B 4C0AC 4YRZA 5EWJB 5A02A 4LN1A 5AVVA 3TQHA 1SCDA 1Z75A 4FNGA 2ZXFA 1V43A 2CMHA 4Q7LA 4U6NA 4TRJA 1IMJA 1XZKA 1M1YE 2Q4RA 3AR5A 3NKVA 4DV6B 2I9KA 2V4UA 4P08A 3C6XA 4MHTA 2B25A 1WB5A 4UUBA 1GTZA 2ZR8A 2I3BA 3TGLA 1E3WA 3N0TA 1KTIA 1A95A 4YJFA 3PDIA 2I4MA 4EY4A 1EXVA 1XRQA 1E3QA 5K09A 2BE9A 3MUNA 5KOYA 3HB7A 2KS6A 5H68A 3SZMA 2CNKA 2QGZA 2G5GX 1L6RA 4LVCA 4D57A 2XE6A 2VYVA 4ID3A 1YO6A 2BZSA 2CWDA 1U63A 5LXTF 2YZGA 1JMYA 3QVMA 3LQKA 4LMRA 3EQ7A 4PCAA 4O0LA 2L82A 5DLYA 2FFQA 4BAUA 4G5HA 5JIBA 2C0CA 9ABPA 1XRMA 1ZFNA 1BWPA 3ZHTA 3LYUA 2A9PA 2I4OA 2HRRA 2VQ3A 4ZA2A 4E5MA 1TQHA 4EY6A 3T3NA 3HKCB 4GM4A 4LOAA 5K4HA 5KUTA 2E4AA 4P0QB 1UP7A 3D7NA 3DVAA 1LLFA 3MLBA 1JG3A 2I22A 4IOJA 5GJCA 1KH1A 1UFOA 4ZGBA 621PA 1L5LA 1KVRA 2XUPA 3LXRA 2JAHA 7GPBA 4YQZA 4QJ4A 3PA8A 5JDCA 1TAHA 1P45A 1G2QA 1HDRA 1YJAA 1U8TA 1AQLA 1HUQA 2ATXA 2B98A 3QOXA 3T8YA 3HEMA 1TZBA 1HLGA 1XCLA 3NDRA 5GZ3A 4DFDA 3ETGA 3COSA 2BMFA 1FF9A 4INZA 1QRAA 3I9KA 3OJCA 4PSUA 4S1NA 4BNDB 1RRMA 4P4SA 1XD2A 1JAZA 2ZS9A 3CZRA 3ENZA 4YONB 1RADA 5EERA 4MW4A 1M2KA 5F2OA 5KS2A 4L4RA 2V1UA 5CLGA 2BI8A 2EXXA 2P6RA 1CR1A 4RGQA 3JQ8B 3DZJA 2ST1A 1Z36A 4GSYA 4F4CA 2JI6A 3FXAA 2O8VA 3C1TA 1WDKA 1XRLA 4MUXA 2FEKA 4DQVA 4EW3A 3EZ2A 5HDBB 3R7AA 3ZJ5A 5EJ8A 3UHJA 2Q99A 1HKUA 4IQGA 5JDCC 1DFIA 5IS2A 2BKXA 5CNJA 4ALNA 3U4CA 5IT0A 4KPFC 3MMPA 1IUKA 5CLFA 3TVDA 1CJBA 3M5WA 4J43A 3INRA 1SXQA 1V8ZA 2X9LA 5EHIA 4YYEA 4P98A 1JKIA 1O5IA 2MSNA 3GHHA 5JC1A 4V0LA 2WAAA 3EZ6A 1ADFA 2M2IA 1E79A 2DHQA 3CPHA 3WYFA 4EJFA 1U81A 4Y2HA 4C3OB 3FTNA 1E0AA 5I7AA 1VJ5A 4A92A 4ALLA 1RHRA 2CXSA 2QMQA 2YMMA 3GCDA 4D8TA 1DTEA 5FCDA 4QOIA 1P2SA 4RZIA 3GJ4A 1NMYA 4Q93A 4INOA 1NRXA 1MJNA 3JQ9C 1PTKA 3M0EA 4M9UA 5KYWA 1EUZA 1QSGA 3PF8A 4ZCLA 4ZT5A 4URZR 1XZIA 2I7XA 2PQ0A 4G0OA 2DPMA 4KBFA 2L18A 2PUHA 1Q7GA 3AU8A 1TA4A 3DKIA 4LSMA 2VSQA 2FW6A 4FEAA 2GFHA 4NEHB 2AK3A 4E88A 4YDQA 1XNQB 1SUDA 2I6XA 1P9OA 5GV8A 3CLKA 5JCOA 3WWZA 4MR7B 5K8IA 4PXSA 3OWHA 3LXXA 3HH8A 1GKUB 3IP1A 1W2WB 2WZCA 2O0KA 1NJFA 3W5AA 1CRLA 4V0QA 2R4QA 3VNVA 1BOOA 2LD4A 4YFYA 3ZHSA 3OFKA 3JASA 4HGZA 3EA4A 5H9VA 5LYJF 1Z28A 3IPCA 3GEDA 1QTIA 2PUCA 3P5BA 4J0CA 4Z9BA 1L1RA 3T1QA 4OL9A 1BWQA 2VG8A 5AO9A 4EJSB 5KPJA 2WAOA 5A7HA 3M4YA 3A4TA 2QRLA 1N8TA 1ULTA 2R68A 1L5QA 4GVPA 4IWYA 1QO9A 1ULSA 1A7KA 3H11A 4QVGA 1ABEA 2CNDA 3L6OO 1NLMA 1A82A 1VHTA 3PGMA 5F12A 3ZLVA 1MV5A 1EFAA 5K51A 1JR6A 4W5TA 3WNDA 5IN4A 4CL8A 3K4QA 2HSEA 4URUR 2PLWA 5DI3B 1KJ9A 3BGVA 4Z3OA 2G1PA 1XK7A 4FUTA 1OH6A 3WK6A 4L5IA 4JU9A 3FKSD 4J0IA 1HQYE 2X1VA 4ZRDA 1E1CA 5B58T 4UUAA 2RKOA 4EQZA 1XBTA 1Y8QA 1ECJA 1YH3A 3JWEA 4FCVA 5E6SB 1Y3CE 3DLIA 3WXBA 4BX9A 7MHTA 2IWRA 1SUWA 1WV1A 3NJ4A 4YR7A 3O3MB 2NP6A 1P74A 2Y99A 1Y98A 2YIVX 1M6VB 3LQRA 1ZL2A 3PNPA 4O02B 5E1BA 4D4GA 4PHHA 4EA6A 2LV8A 3HL0A 4LBYA 5DWDA 1HRKA 3ZKWB 4BB9A 2G6TA 5C1OA 3OT4A 4CMJA 2ZDHA 1JI3A 3BDVA 4PQYA 4HWRA 1UP4A 3EW7A 1M5UA 4A26A 1BH6A 1V8FA 4RY9A 5LN1A 4RQTA 1MGPA 3FCOA 5CEFA 3ANTA 4NLLA 4UNSA 3CLTC 1QH8A 1GCUA 1VL6A 2QYHA 2D59A 2VS1A 1ZSVA 3D8SA 4QPPA 2UUCB 2CMFA 5C2JB 1XCBA 3KJQA 2AKYA 3L8DA 4UARA 5ESWA 1FS5A 3TSAA 1IOWA 2OSBA 1C1DB 4M9CA 4JQYA 2ZW9A 3I37X 4INAA 4JJ4A 1XI2A 2BGIA 4X84A 1FMJA 3AUKA 3FJ1A 4FCWA 1XB2A 1BCSA 2BFFB 2HIGA 4J0EA 3ETDA 2Y1DA 3LK7A 3M8KA 4UQOA 4BNZA 4CU5A 4EHBA 3UA4A 2V6IA 1ID8A 4ENQA 4B4OA 5FV7A 5ENZA 4GKKB 1Z22A 3TH5A 1QU2A 1HBJA 3C41J 3SR3A 3AJ9A 1MQ8B 2J48A 4JA2A 4LGCA 2G17A 2DQYA 2ZSHA 4ZAYA 2UZAA 1GCIA 1IQRA 1K6MA 4R1SA 2OB1A 4IKOA 4RTPA 1LNQA 1EUYA 4JLNA 4KHPB 4OGLA 1VIDA 2OGZA 2VBIA 3X0DA 1DLJA 3RVKA 1E3JA 3ETNA 1O2DA 3IA7A 2VHCA 3C24A 4W1PA 3A8TA 1G38A 1SG6A 1V1MA 5I4IA 3KK0A 1PVDA 4DYDA 4NKRA 3UMFA 3KJHA 2FGJA 2Z83A 4JS0A 4BO5A 5H16A 5LZ9A 2PKQP 4B6JA 1CXZA 1QDLB 1UAGA 1QGUA 3B6ZA 3QMVA 4JVOA 1AY0A 3ADDA 2C95A 4LZPA 1SQ6A 3IP6A 4QULA 2P2LA 3FTDA 1T1RA 1EDZA 1BJTA 2ATVA 4YECA 2NYVA 2UZ1B 1AO3A 1QHYA 3N6XA 5TPWA 2Y68A 3E7XA 4HOYA 5JFOA 3M3HA 1QGYA 3JZFA 5CNMA 1BXRB 4QTUB 2VSXA 1JIUA 5HUJA 4HC4A 2ZE8A 4LSGA 2WILA 4EMUA 6LDHA 5E6RB 2EVWX 1SKUA 1J2TA 2IPXA 3ANMA 3EZXA 2OGUA 5HQ3A 1HNZB 4AG6A 1GP2A 3S5UA 4QECA 1Y6QA 4KDEA 1KPIA 2AA3A 2YWDA 3GZ4A 5FWXA 1I32A 1AGYA 1U9IC 4PTLA 5E9AA 2ZUUA 3MZ0A 1KVTA 1R0CA 1V2GA 1XD9A 2HJ9A 3PLAE 4PZCA 2CGEA 1B73A 3KC2A 4ED9A 4KQHA 3O7MA 2ZE6A 4P33A 1JDZA 3SY8A 3U3RA 1WP9A 1FVOA 4ABTA 3A9RA 4KFUA 3KUKA 1IH8A 2GT1A 1UP6A 3E5NA 4QDTA 4U1RA 1GPDG 4O4JB 3RIXA 1KU6A 3ZDQA 4BX2A 4JIGA 3WJ2A 3QLEA 4UXIA 4DJDC 5A9SB 3LNCA 4DGSA 2B99A 3GGJA 3GLFA 3HI6A 4WKNA 2V7QA 2VRCA 4ML3A 2GM4A 2X8WA 1JTFA 3T54A 4BVBA 3K3PA 4GVXA 3D4PA 1BE6A 2BFMA 3VVCA 2CV0A 2VQFB 1II0A 2PEYA 3B12A 1RM4A 5FOXA 1F0YA 1KP9A 1UZLA 2DPLA 2FEAA 2Y1CA 2ZAMA 2OZKA 3PC4A 3I58A 4RDHA 3ANYB 4X94A 2C2OA 3AQIA 4GMHA 4ZREA 2OG2A 3OZGA 5ADWA 1NLYA 3VMMA 2QRUA 3WMGA 3F97A 4RPKA 4ZCPA 5CB4B 5MHTA 1M8FA 3KSBC 4ZV9A 1P3Y1 1W8IA 5C7OO 4DLTA 4DDHA 2ZIAA 4HVTA 1ADGA 3EMVA 3SXUA 3V9AA 2RHCA 2SKEA 3E3NA 5IBQA 1RJWA 2P9GA 2Z6VA 4F4HA 5IF9A 2YXDA 2C78A 1G7RA 1XTZA 3DTTA 3PCRB 2D1YA 1L7PA 4HZIA 2AEJA 2R6ZA 2WE7A 4MV1A 1N0UA 2W8BA 4CG1A 4F3YA 1Z35A 4HBGA 2P90A 3N7UA 4DDVA 3O4RA 3OUZA 5JXIA 1GFWA 3S5JA 3X1XA 3EZLA 4HAWA 4M7PA 4TWBA 1QVRA 1P19A 2J45A 2AL7A 2XMGA 3WICA 1I1OA 2GEFA 3HUTA 1NAIA 2PBRA 4IDFA 3N87A 1XRNA 4FIZA 4BFCA 3DMRA 4I55F 3U7RA 1PDOA 3V7WA 4CR6A 1NRIA 4G5QA 1P5HA 3MJFA 3H5LA 1TYDE 2VUTA 5EWMA 2QRJA 3WO0A 3CBGA 1QANA 2AVNA 2CNLA 3FHLA 3PCTA 1VE6A 3GRKA 3QLVC 1X0XA 2NT4A 2QRZA 2QSUA 4MINA 5EVJA 1DXOA 3G1UA 5EPEA 3OOWA 1MKYA 5BMVF 3KUXA 5BWBA 2PKRA 3HZRA 3Q3HA 5HOQA 1TA0A 4J2HA 1YJ5A 4NCHA 1C3EA 2VNJA 1K89A 5CUQA 4YALA 2XXAB 1F8GA 5IZ4A 5LQSA 4EPWA 4S35A 3O83A 4TTTS 3QXXA 1DG1G 3TZ6A 3GCXA 1AXEA 1TVEA 2HXGA 2OC4A 3ZW7A 1KAHA 1DC5A 3P0IA 3OVMA 4F7WA 1QBGA 2RG7A 1A5AB 4IVRA 1D1SA 3NDBB 3QX3A 3IESA 1YRLA 3ELWA 1NSYA 3U3MA 4C0HA 1E1YA 3UUGA 1SKMA 4OQDA 1RTTA 1LEHA 3QLTA 4W5WA 3PF9A 3TLZA 4DVGA 5A2QA 5K01A 2PBZA 3GLKA 2MR6A 2VPPA 3KOMA 4GYYA 3ICEA 3ENQA 2GZ3A 1KZ4A 1QYCA 1C1XB 1ELOA 1OC4A 1QO0A 2PUWA 2ZBVA 2ZJ8A 3HJCA 3KVVA 4PLGA 1PD0A 3ZE7A 2J87A 3TKAA 4AJ4A 4CTKA 4R0MA 1A9XB 3RD5A 1HWYA 4CW7A 3UA3A 1Q14A 1FSSA 1TFRA 3K70C 2K2WA 4KG7A 5F78A 4FGUA 1TKRA 4C9BA 2FZ4A 3IURA 3CX6A 4MVJM 4EIWA 5J1SB 3W77A 2CFOA 1Q44A 4J3FA 4Q39A 3LUKA 2OWDA 1YTLA 5ALTA 1JHZA 4WX2B 4TXNA 1PCXA 1AU9A 1YCGA 3EEFA 5KHAA 2OCXA 3GFSA 1XQ1A 3HFJA 4K9LA 5E2AA 4ZAWA 4P80A 4X1YB 1ZNYA 2VK1A 1B15A 4JK3A 4W8HA 4ZOLB 2CHEA 1LZLA 3K7EA 3O21A 4Z1MA 5A4AA 4WASA 5JARA 3OI7A 1LU9A 5A4JA 1CUXA 1WMFA 2G76A 2WKQA 2GYUA 2WUGA 4D4KA 2O7RA 4L3WA 2P2ZA 5CFLA 4HH4A 2CYAA 3KT8A 1G60A 4FJ2A 3HCBA 1NE2A 1KVSA 2BGUA 4YN3A 1NP6A 3H16A 4UXHA 2PKYX 1T5HX 3IIMA 2ECFA 4HLCA 5CXUA 5I4KA 1RLMA 2PL1A 4YRAA 4RF5A 2E1RA 1J8FA 1BX1A 2D8MA 3OEEA 4X00A 5J2UA 2KLBA 5JWRA 3P2YA 1MABA 2NTVA 3W2HA 4DA6A 4OX9B 2YVQA 1DBPA 1U7PA 1VYHA 1FRZA 4TWZA 3E9QA 5EQFA 1ENOA 1PGOA 3ZK7A 2WWRA 2HJVA 5D8DA 1J5EB 1RVV1 2P8JA 2PGNA 1UPCA 1T8PA 1U2DA 3L7OA 5G53C 5IT5A 3AEQA 5GJWC 1AE1A 3MUOA 4B3HA 3B1WA 1V3VA 2JCXA 3NBMA 3O91A 1VI2A 3WAJA 2VH1A 1ZA1A 3FFWA 2BPOA 2K5UA 5F5XA 3ZXUB 2DT5A 1OTXA 4XGKA 3ONDA 4BATA 5JANA 1IVNA 3ABIA 3KPUA 2FWJA 2ONYA 3ZVRA 5MGNA 3CVYA 1NPDA 1QHGA 4MQFA 1P0CA 3AI3A 5EZ6B 1JEJA 1ML4A 1Y3HA 3KYDB 5JY6A 2WVAA 2PKEA 2GSDA 4FGWA 4KHZA 4DA7A 3UUEA 2I2CA 4C87A 1D7AA 2BBTA 1JG4A 4HFRA 3HRKA 1PR5A 4G89A 4L72A 4E1BA 1XXHB 3SKYA 1N7IA 5B58C 2M98A 2CLKB 1IOVA 3IO5A 3JQGA 2FDRA 1W34A 3B3JA 5AVRA 4RTOA 1E2JA 2C4NA 2XUAA 3TF5A 5U4QA 2QRVB 2Q28A 2C7GA 1N5MA 2OSVA 3ERCA 3TSCA 2LKDA 1PYGA 2HU5A 3JPYA 3IR7A 3GLHA 5DISB 3WLAA 1FVHA 4IF4A 4HY3A 3QE9Y 2JZCA 4RD6A 2WWYA 1POWA 3F7OA 4LCEA 1TCAA 2O3RA 1P8AA 3KKKA 2IPLA 4L50A 2BSAA 3HHPA 3IUEA 1KDZA 1I36A 1RXCA 2QD4A 3X2FA 2ZYIA 1SVNA 3A9UA 3UAZA 4EUEA 5L4LA 1SBZA 2C5HA 3DUFB 3COJA 4ND1A 3UC5A 2QX4A 1IXRC 1HDOA 1BS9A 2DFPA 2HMVA 4IV0A 1LQTA 4GBMA 3WL7A 4CN8A 4CV0A 3ER9A 2Q5FA 1Y4UA 4NBSA 1FUKA 4BNKA 4OAOA 1XZLA 3EXFA 5JYDA 1PT6A 2HHAA 2D5BA 3CINA 3DMHA 1IZ7A 1DT5A 2CVFA 2FQQA 3CWCA 3PUJA 1FFDA 1RP1A 2QT0A 3FYHA 4LBVA 5EUCA 5GADl 4MVXA 1NMQA 2C42A 4OB7A 3OSZA 3TRFA 5JT1A 2HSJA 2G71A 1OILA 2FSVA 4BCBA 3CU5A 4BNFA 2ZPAA 1QJCA 3RB8A 1EAMA 2PXCA 1E63A 3FCCA 4RH3A 1EGMB 4F86A 3HBJA 3P26A 3WDMA 1E6UA 4OATA 4XIGS 1R6AA 3WLTA 1M33A 2DMRA 4O4LA 3RW9A 5CEJA 2XE8A 2OZVA 3E4DA 3JX9A 3QA9A 4XR4A 4WT7A 5KYXA 3AEYA 5CX1A 4A36A 1U3TA 2K6GA 3HJNA 3C1OA 1XLUA 1Z25A 3PQCA 3K35A 4IHQA 3KZ1E 3OCWA 2EJCA 2VUUA 4Y0VA 1A5SB 4F56A 2WBLC 4DMFA 3DZ8A 1PYDA 4K9DA 4BBJA 1II8A 1QOQB 2LCQA 1WXEA 2VTKA 4N4AA 4XYBA 4NBKA 2CWWA 5AKIA 3SSNA 2YOFA 4MSUA 5B1IA 3SP1A 4BNTA 2VZEA 4JKIA 3A28A 1OTHA 3KO8A 4UPEA 2MMCA 2HCJB 3QU9A 5ELLA 4GI7A 2QU8A 4YAIA 2RGWA 1M6WA 4MZXA 5BXQC 4WMLA 1G8FA 2RHLA 2H0QA 2D7CA 2Z08A 3ENNA 5DX0A 1NYTA 3CV3A 2MU1A 3E22B 2FP3A 1NW6A 3HN2A 4MRRA 2QSYA 4MRMB 5U1PA 4LQCA 5B5SA 3TECE 2NU7A 4A3SA 1V7ZA 4RHXA 3ES9A 1GARA 3ON5A 3BWXA 1FLNA 2Z95A 4EMBA 4CTOA 1XXHE 5KYKA 3GAMA 3EGXB 1R8YA 2Z04A 4MYHA 2WIBA 2X13A 4Q47A 3QWBA 5DB4A 4JI3B 3UWMA 3OIGA 2HUNA 3RODA 3SZLA 3QYAA 4FBMA 2BI7A 4KR9A 4CF5A 3IVAA 4CWAA 2H1FA 4CG0A 4OU4A 1ORWA 1ID1A 3ROZA 5BXYA 4LJKA 4UNNA 3HM9A 5KSZA 4GWLA 4RKEA 2R2AA 1AKYA 4OREX 2BCGY 3LD9A 4B82A 3R0QA 1T15A 1ONPA 4R5HA 2C5BA 2J6HA 4GDFA 1ZINA 3O92A 2P0YA 3QYPA 1J8VA 2C2MA 3Q8WA 3TE6A 2ACEA 1NMXA 1W87A 3I83A 4FDMA 4N5LA 2VRBA 4KDCA 4XQCA 4D81A 3QHAA 3ICQB 1Z68A 4R2LA 5DULA 4D42A 1GWNA 4G01B 3QSGA 1EDOA 1GOTA 4WOCA 1UJMA 3TW0A 1UUFA 2IFTA 3D1VA 4DG5A 3O8DA 2VWHA 4R8SA 4HYTA 3NOQA 2E4ZA 3OLCX 3OUUA 4OB6A 3I1YA 2F3TA 3U56A 2Y3IA 4C4XA 2GVNA 1IG0A 1YL7A 5CYOA 1Y4AE 5IDYA 1VB5A 4HH3C 1NF8A 2BGLA 2OGTA 3C1AA 3W8DA 4AYWA 1HA3A 2VAWA 3RFTA 1JDVA 3KSZO 3O84A 4L51A 3H18A 4V02A 2EBFX 2AOUA 5TY0A 5C52B 3Q4GA 5ELXA 3G0GA 4NPAA 4IIJB 3BL6A 1EDDA 3EVBA 2GZ2A 3G2OA 5FLXA 1WKVA 3EK2A 4I1IA 4JLVA 4YWHA 4HAXA 4BB6A 2REXB 4AWBA 2GM9A 1I0LA 3CUTA 5CCEA 1CYDA 1OWPA 3KALA 3QVVA 1F06A 3TNDA 4RE5A 1DCMA 4CDMA 3KAQA 3THXB 4MCAA 3R5TA 3UEOA 4YK7A 3T41A 2FYTA 4ALIA 5BV8A 1ZOPA 2MINB 4M89A 2V5VA 2QS9A 3D59A 2FZEA 3RPEA 4URWR 1EA7A 1G9XA 2XTJA 3DOEA 4BQSA 4YLEA 5F64A 5KNCA 3RAFC 1T9AA 4R54A 4RJLA 2W2MA 3GOQA 1AC5A 1E1QA 2ZGVA 4DADA 3TUIC 3S8EA 2AQKA 1ZI9A 2OQ2A 4DREA 2C99A 3OHMA 1W2GA 1H23A 1YQEA 3A36A 4UOZA 3W2FA 2HQBA 2GD6A 1G7TA 4QREA 3SF8A 4RVNA 4EO4A 3FPEA 1C2YA 2FQYA 2GNPA 1VQ1A 3B70A 4TL9A 4Z3DA 5IYZF 1G7SA 2NYRA 2DWQA 3U4GA 5J4YA 3U3DA 1M83A 4QEZA 4UMVA 3VSDA 5ABPA 1XTSA 4P35A 5K1ZA 3FJYA 4RLSA 4YIKA 3GVCA 2F1JA 4YDSA 1LW6E 1WHTA 2B21A 1BGXT 3FFTA 1MFZA 2OO5A 1EEHA 4QUBA 4V2IA 4B7AA 4CQLB 1IN1A 2FOIA 1KOFA 2IYTA 4GG1A 5FBHA 4FZRA 2ZAGA 2VF8A 3O4IA 2PSSA 2VTEA 2WJVA 4P93A 4N3GA 5KVAA 4A15A 4YR9A 2MYPA 3Q5EA 1XK6A 5JD5A 4F46A 1JR3A 4R2JA 1CJSA 1E8MA 2H5LA 2PO7A 2ZRAA 3E23A 3LPNA 3NRCA 3NXKA 4WK0B 4C6RA 4ESOA 3SE0A 3W9BA 3GJ8A 5IT4A 4NZ9A 3OZ7A 2IBSA 4JOBA 3KXPA 1M75A 2WWWA 3DBRB 4E51A 1N7HA 2AN4A 2BMVA 3VO8A 4UHHA 5IJ0A 1J5PA 2WAMA 2YIMA 2PRIA 4C88A 1LSOA 2RGNC 2BFEA 2ZIGA 3TGWA 3FUVA 4OLHA 4S1OA 1DX6A 2YXNA 1SC9A 2QZ9A 5HCUA 4UJ5A 4KXWA 2P9BA 2X9VA 2H2AA 3MCUA 1WZ2A 2WF7A 5IC5A 1QUEA 3I53A 1BRTA 2ZJ4A 4Z99A 5B37A 2FNAA 2W22A 4HDMB 2QL6A 1T2UA 2QJOA 2WA2A 3I9V6 1H2FA 3OOJA 4AMYA 2HQ1A 3H8VA 4CLOA 2NW6A 4PQEA 2XMBA 3L0BA 1T2EA 4GEGA 4OLFA 1UOQA 3U2QA 3E7FA 1ST2A 1WMBA 3QX9A 5KQGA 1JA9A 1TK9A 4E6EA 3D7MA 5A7GA 4JC0A 3ZQ4A 4K26A 4ZYZA 3LY5A 2JNWA 4YUXA 5ARBA 5JQWA 4NATA 3DBLA 5DBIA 1PZNA 3RVJA 3B1JA 3FFAA 2CSUA 1Z34A 2BJWA 4RM3A 4RPCA 3RSOA 1KVUA 1N2CB 2HEGA 5SY6A 3KR2A 4JBIA 3T7TA 3ZWMA 2G1KA 1HQCA 2I6GA 4E5DA 2C8LA 4U7TB 4GM1A 4R7TA 2Q4DA 1N33B 2F3UA 3OECA 5CT4A 2QUJA 3PC3A 2ZEJA 1UFVA 4NICA 4BVAA 5KTTA 5D3MA 1BOFA 4O2BA 2GXQA 2VDMB 3GH1A 1U3FA 3KKQA 3MJRA 4PAMA 2XQGA 1S3GA 4PAWA 4ENRA 3AYZB 3HRHA 3CH4B 3CLSC 3FDZA 3QKRB 2OCPA 4OHKA 2RH4A 4YEDA 1W36B 3WYCA 4XDHA 5IKMA 3RYFA 1T0UA 3TNLA 2BSQA 4A0FA 2XQVA 2GAIA 4Y2XA 3BMQA 4KRYA 5K3FB 4EG1A 1Z5WA 2BHLA 3P96A 1O0BA 1YDHA 4W1RA 1I4TD 3HA5A 5TPZA 1D6JA 4F04A 5K2OA 3A1VA 3FCAA 3KX2A 1EP2B 5ER9A 4ZVMA 4V0NA 3ZDYB 3PEFA 2HBQA 4CGYA 2G8NA 4GQAA 1KH3A 4PC6A 4QSMA 3OQIA 5FO1A 1R5JA 1YZYA 3OHPA 1FL9A 4IF6A 4P83A 3IDFA 4RHTA 4C04A 4EGSA 2P9CA 3FMOB 3LY8A 3QG5A 1N6IA 4PLYA 5TQVA 4WZAB 2HK8A 3WFJA 2R0QC 4PVDA 2B4YA 1FOEB 3WK9A 2FWIA 1ZIYA 2Y76A 2L2QA 4OK3A 5BQ5A 4AYXA 1GVHA 4KQCA 1TTQB 5E4YA 1M8PA 1P5JA 1WSBA 4MNTA 4DW8A 3PNSA 1U3UA 3KYIB 5KTOA 5LXTA 1ZMOA 1REQA 1OFTA 2JFQA 3STXA 1BD3A 3OOEA 2LIVA 1U2TA 2AMLA 2IYAA 3HV2A 4YASA 1PS9A 3REFA 4BNMA 2GWHA 4EG3A 4TZ0A 3TZBA 1ECGA 2KYRA 2G9ZA 1UBLS 1AXGA 1VKNA 4B80A 2PGLA 3G68A 3UKJA 1BVUA 3L8YA 2VHEA 5AI4A 3RC7A 1J2EA 4KSBA 1T2AA 1P60A 2NZ2A 2JGEA 3A1DA 3E8MA 4WZ6A 3S2GA 3UJ9A 1E3MA 4PZDA 1OMOA 4CTNA 1A69A 4RTLA 4NPHA 3KQNA 3TL6A 1YF3A 2Z4TA 1GGNA 3HUUA 3LZCA 3TUJC 2M6LA 4DQKA 3DAGA 4KPYA 1ADJA 3HCCA 4FHZA 1C14A 2R5WA 3M3DA 1O0SA 3PVSA 4EW2A 1YFLA 3AEXA 2FSHA 1ZRNA 5BV7A 1TKBA 3LT4A 5EP4A 4IDNA 4FOLA 2OBNA 3V1LA 4CN9A 1N2CE 3ZBPA 3KZKA 3P0HA 1SK9A 3K0SA 3RUHA 3WBBA 5HOEA 3C5CA 4HEJA 4PSDA 3QEAZ 4R40A 4DJEC 5JZ9A 4KXYA 1Y80A 1PQWA 5FV4A 1UMDB 2GUWA 4KI7A 1GU7A 1JQ3A 1K4MA 4MVJH 2ZG6A 1K08A 3DFMA 5CJ2A 1YZKA 1YB4A 1ETUA 2GBLA 2RH9B 1SOVA 5TT0A 3G2LA 5DHUA 3SMVA 5K6AC 3PPWA 3UWSA 4FXOA 3GXBA 5HIIA 5BWOA 1FRFS 2IZ0A 3L0IB 2PEZA 5GINE 1NR7A 1UMBA 1NLZA 1NY6A 3F47A 2Y0PA 1N8SA 2G9VA 1NR5A 3D8NA 2ZBUA 3HGQA 4FFOA 4QNNA 4RU1A 5DEOA 2IIPA 5SYAA 2VHQA 1JT9A 4LI3X 3R7SA 3GT3A 3WLKX 2XWQA 4NBVA 1FTWA 3RT1A 4MV0A 3DZHA 4LTMA 5AOAA 1VDZA 2RHBA 3A2MA 1K63A 3CTMA 1IBLB 1KEUA 3W1WA 4IPTA 3AUJB 3U80A 2GBLC 2VYFA 2CMGA 3B5EA 2F1OA 3CR3C 4XM2A 2AWNA 3HCOA 3WZ2A 1XKQA 4EUNA 3MMNA 2ONZA 1T3ZA 4DMCA 4YT5A 1QKKA 1GZVA 2QLLA 2QAIA 4EHIA 1YGPA 1SOUA 2WUDA 3GPIA 5JSQA 5JRDS 5KNDH 1HI9A 1JVSA 3BKWA 3MMXA 4NQZA 1VE7A 4WY2A 2R4TA 3CLVA 1WOMA 3O8BA 4R3WA 1YDWA 3LFHA 3SWWA 1JG1A 4DR4B 3F3SA 1NXTA 4ROSA 3Q8LA 4WY5A 1KI7A 3LX5A 2HHLA 4PX9A 2OHJA 1DKOA 4MJLA 4LRSB 3F3MA 4XFDA 3W3AH 3ZWWA 3ZWAA 3K94A 4CLXA 1CLUA 1U31A 4E4YA 1J9ZA 1V6SA 2VQEB 3PXCX 5GIPE 3D6HA 3NM4A 1SK8A 3P9SA 5BPFA 5I5EA 2HPZA 1Q0TA 1GYRA 1K5GA 4X1IB 1IUOA 1GA4A 1JWBB 2XT0A 1VG0B 3R3HA 4YS6A 6REQA 4GUDA 3VTAA 5A0FA 3ZGYA 3NYRA 4HN9A 5CJPA 1DCKA 1Q22A 4OL0A 2RMKA 4F7DA 3A4LA 5KQLA 3QTLA 2BFCA 1JIVA 2NSHA 3AKYA 3RRMA 3ZS9A 4EQ6B 1PAUA 2ZWOA 1ICIA 4IDPA 4PZLA 3RVLA 5C5DA 1A9ZA 2JIQA 2FPOA 3C6KA 1XZDA 4D46A 3NWJA 4DANA 4N41A 1CRPA 1NN3A 5TARA 2W2PA 3RHTA 3V8VA 1A2QA 4BMNA 3IAFA 3PR2B 3Q9LA 3GG2A 1BEEA 3ZCSA 4ZGGA 4PCLA 4C4OA 3U61B 3VDQA 5ITVA 1E64A 1ZY2A 1VLQA 4Z8XA 4CU2A 1W94A 4M22A 1TU4A 1QXSA 4Y7CA 4PLHA 1ZBQA 1XPOA 2NVBA 3OCJA 4X65B 5LDHA 4HH0A 1T9GR 2XBLA 5DXJA 2CB9A 2VDWB 4MW6A 1KYZA 2ISCA 1C81A 3V34A 1HZZA 1K92A 3B1XA 2AUMA 4G07A 2WD7A 3HDQA 2GI4A 1JKJB 2GZMA 1R3DA 4CM4A 5REQB 5CFNA 3BMOA 3PX7A 4WEOA 3OURA 5FR2A 5IKXA 1CYEA 2XVXA 3JS5A 3K9WA 3MELA 1BE8A 3NG1A 4FDVA 4HGYA 4PBSA 3IE0A 3CRMA 2H7VA 1A72A 2DG2A 1IXKA 1T3SA 3RK4A 5LKRA 3BE8A 3TW8A 4N6OA 2IS6A 3UJCA 2QDKA 4ZAZA 5GY7A 3WSWA 3QVGB 5GJBA 1J39A 3PHJA 3TIXB 3URKA 1SD5A 2BEUA 3EEYA 2CVPA 2IHBA 2XWBF 4P9NA 4KKXB 2QYSA 1SKBA 2JD1A 1KMMA 1O95C 1P62B 1Z29A 2CKMA 3P2OA 4IGFA 1ZJ5A 3R4CA 3QJYA 5EIFA 2BGTA 3PJDA 3ZCQA 1FJ2A 3BB3A 4TKUA 1BROA 1ESMA 1HORA 1CRZA 2F7SA 4GWGA 4KN5A 3A9SA 1HZZC 5AQEA 3ESCA 3HEBA 4Q7EA 3M1IA 1O7JA 1YZHA 1OZFA 5DVZA 2H54A 4R69A 1YS7A 2HYDA 3IIIA 4EOGA 3LYLA 1NI3A 3F6BX 3ELYA 3IQWA 3K9GA 2P5TB 4B09A 4G4JA 1LLDA 2G67A 4UCWA 3LOPA 3MOIA 4L2IB 4LYGA 4B17A 4DSOA 5JPCA 3ZE6A 1H3EA 4TS9A 1JG6A 4LYFA 5EP2A 1LS6A 4MV6A 2F1RA 1QTRA 5AHXA 3LTEA 5T6BA 3G2MA 2HPHA 3PC8A 1K2VN 3F6YA 4G0NA 2EZ8A 2FPGA 3FPLA 5IWAB 2GR9A 3C3PA 5J4HA 3HUDA 1JU9A 4FSDA 3V4FA 8LDHA 4V0OA 4ZQFA 4RCVA 2Z5VA 1KEEB 4Q3KA 4WFJA 2D74A 2V59A 3MJEA 3SVZA 4WSOA 5CK4A 2I5PO 2XUHA 3RVBA 1GQFA 3RI3A 2VHUA 3NEPX 2WJ3A 4R8LA 1FTGA 1GRQA 1JDSA 3IR6A 1ODLA 1P6UA 2GXUA 2NXWA 2V3WA 3QBTA 4J1QA 4LSZA 5DASA 2OK8A 3TRDA 3AFNA 3ZIAA 4AJ1A 4BASA 4YYZA 4NZYA 2HNKA 2Q0HA 3K9QO 3M33A 4KPEC 2NXCA 3PC8C 5BY2A 2X6TA 1MC1A 2WJYA 5EIAA 1CQZA 3TLJA 2VSFA 4GX2A 2DKNA 3I5YA 4QBGB 5TQ0A 1WG8A 4CQMA 1GT91 3OJOA 1GAJA 3LG2A 1FDIA 2E18A 1JE0A 1LLQA 1WQ4A 2XYPA 3ILXA 1GNRA 4XVRA 5JS1A 3EIFA 1P9RA 1H85A 4BV8A 2X9GA 3K1AB 1T4CB 4IRXA 1W44A 2LCFA 1OOEA 3ZDBA 4QPCA 1DS6A 2QVXX 2VYND 3USZA 1XVIA 1QG4A 2QI9F 3NB0A 1L5NA 4K6GA 2VNSA 3HWRA 4DJFC 1ZC3A 2DQZA 3CB2A 4MV3A 3G0DA 3U31A 3SSAA 3BF8A 3A7DA 3OHSX 3OAAA 5AW2A 1CEYA 3QLUA 5D3ZA 4B4WA 3GJ5A 1HLPA 3QU7A 5KQSA 3TR5A 3N75A 1NONA 2EF0A 3GLRA 4JEIA 4XFJA 3PRKE 1H22A 1T9GS 3DT9A 1HQKA 2HFJA 1PIWA 4KGVA 2B5VA 3TQQA 1OX4A 4F4UA 3WLIA <