4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
b'LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
1XEXA 4JSYA 1DARA 3NBFA 4PXAA 1IJFA 2XX3A 5DI3B 2ZM5A 4PZYA 4RD4A 2EFEB 1OT3A 4Q9KA 2H92A 2OXRA 1OFIA 5JSZA 5F2EA 1XTJA 3H0KA 2O0HA 2J0SA 3SZRA 3VKHA 2GESA 2YJTD 4DC9A 4E22A 3X1YA 1MABA 1LW7A 2IT1A 4LBWA 4Q5IA 3U5ZB 4RKEA 1Z2CA 1KTVA 1LTQA 4OK3A 5J5CA 1DAGA 3LBHA 4DSOA 1KO5A 1W46A 2WSMA 4M22A 3TBKA 2P6RA 3KJHA 3A4NA 3ZD6A 2E87A 3RRMA 2QY9A 5KSYA 4LJ4A 3BRWD 5KSPA 4IJMA 4KLNA 4Q48A 4D82A 1X86B 1GFIA 4IDOA 5DI9A 2ZSFA 2IYLD 3ZYCA 3C5HA 1DAKA 4MRSA 3U60B 2F43B 4CEIA 1IOZA 5B58C 2WVJA 2H7VA 3QF4A 4IRUB 1MH1A 3AF0A 2J46A 1XTSA 1K5DA 4PTLA 4IDQA 5J4VA 2HCJB 2QP3A 3K0FB 1EX6A 5C4GB 3GJ5A 4Z1MA 3TMKA 2DY1A 1FFHA 1QHSA 1UADA 1ZCBA 3BE4A 4CF7A 5KNCA 5ELXA 3GLGB 2AFIE 4Q1EA 1E2LA 2DBYA 5FOUA 3FMPB 3QBTA 3L8ZA 5DHAA 1Y63A 2GCOB 2N42A 1OB5A 4CEHB 3U4QA 5HZHA 5CB6A 3IUYA 2Q6TA 1PV4A 3ADDA 3CRW1 3UG6A 5FTLA 2FF7A 2IXEA 4MH0R 1S8FA 1YZTA 3REFA 3AF2A 2IHBA 2VSFA 2ZRCA 3BH6A 5DO9A 5G53C 1J90A 2ATVA 1DELA 2ZRMA 3A58B 2D06A 4A8JC 4BUJA 4M9XA 2GXAA 1NVUQ 2IHYA 4OQMA 2QAGB 5FI0B 4WXRA 4G5SA 4BZPA 2ORWA 2BCGY 2CK3A 4D26A 1Q22A 3V4FA 4AY2A 1G4AE 1F60A 1PUJA 2J7PA 4Z51A 2DWPA 1DAIA 4PQFA 3WYGA 3PITA 3DOFA 1VG8A 2BC9A 3ONWA 3W90A 3GLHA 1CR1A 1D6JA 4WIAA 3KKNA 1II0A 4IDPA 2ZRKA 121PA 3QKTA 4D4LA 5HE8A 5M04A 1PZNA 4LCBA 4ASUA 3A1UA 3P27A 3R9XA 1Q1QA 2BKEA 3AVPA 1VG1A 3U44A 4DCTA 4JKIA 1D2EA 1YZGA 1ZCAA 2NIPA 4OQXA 4PAMA 4Q7JB 3A37A 5AR1A 3UWOA 4KI0A 1XZPA 5TXGA 1XJCA 1G7TA 2GBLC 3GLIB 2RB4A 4W9MC 4CGZA 3CO5A 5L8VA 3B1VA 3JZAA 1XFAA 5CJPA 3QI2A 4QXAA 3RDPA 1E2QA 5DN6A 3K70C 2OEPA 1YJ5A 1CR2A 3GJ8A 2XEXA 3E5HA 2FPMA 1Z0FA 3WNBA 4D0NA 5HCIA 1YZNA 2VLIA 4PR0A 1EFRA 1CLUA 3NBXX 2YYZA 4BFSA 8OHMA 1BIFA 1E2DA 2F1JA 1EK0A 4EFLA 3AKYA 1GL6A 2ANBA 5LB2A 2BOVA 4DSNA 2J9RA 3QXJA 2VO1A 2ZPTX 4D0GA 2GEDA 4BE7B 3H2YA 1ZUHA 3RLFA 3TIFA 3I62A 2UVQA 1SKYB 3KJEA 1PLJA 1KDTA 2X1VA 1VYVA 2A2ZA 1H8EA 1P2UA 1HT1E 621PA 3U7GA 2JA1A 3C14C 4EQ6B 5JLJA 4C0HA 4H1VA 2NO9A 5GVRA 5J4KA 1Z0DA 1YU9A 3WHKA 3W6PA 1TUIA 4BRWA 2DYKA 3IIMA 1KIMA 3PV0A 4MUBA 4FCWA 2CL7X 4JL8A 1TUEA 1GWNA 3THYB 3PFIA 3RABA 2B6HA 4ZKDA 2IWRA 2CCJA 4ACBA 1E99A 4EUNA 3FKSA 4LUCA 2Y8EA 5F3WB 3VR2A 1XCGB 4DJTA 1Q3TA 1YRAA 4Q9HA 1Z0AA 4R2IA 4HB0A 2F3RA 1HQYE 4DIEA 2H18A 2QT1A 2OXCA 1IY0A 2AXNA 1AJEA 1AN0A 1MO4A 1SULA 1FX0B 3P32A 2X2EA 1US8B 4RFSB 3EC2A 5KDOA 2BV3A 4HLDA 3RVBA 3MD0A 4CIDA 2LWIA 4M53A 1NVWQ 4KFUA 4C0JA 2WZQA 1ZIPA 2ZU0C 3I73A 5CITA 2Z6VA 2ECKA 3AEZA 4GI7A 2IYYA 4L4UA 1XCPA 2FFAA 2FFQA 3M0EA 5FUVA 1YR7A 1X8JA 2P0EA 3MJHA 4Y0AA 2BMJA 5DH9A 5DHFA 3U6BA 1KI1A 1N6LA 1NI3A 2EFDB 3NBYC 2B8WA 2AR7A 4DHEA 3UMSA 3EW9A 4LSGA 4OQFA 2N46A 4AKHA 5B2ZA 1Z06A 1HURA 2QROA 1AS0A 2CCKA 1II8A 5JJKA 1F5NA 2ZROA 4O25A 3U3MA 2I1QA 2R6FA 4UKDA 1E0AA 2Z4RA 4IOLA 1XD8A 5EUMA 1SVOA 2JLXA 1E1RD 1E0JA 4A36A 3LVRE 3QKSA 1D9ZA 3B82A 3ECCA 2VP5A 1UKZA 1I4LD 1FPMA 2XSZA 4NP6A 4Z8YA 3TW4A 4DBLC 2IYSA 1G8FA 4ZKEA 3F3YA 4KVAA 3AP2A 3C8UA 1KK1A 4B33A 2XNSA 4RD6A 1M34E 5CK5A 3ZVNA 2OE2A 4I99A 3TAUA 5EE3A 4AKGA 3IO5A 5H70A 4NYJR 2IXFA 4TMTA 3CX6A 5GVSA 1CJVC 2GXSA 1L7VC 1G291 1U99A 2YOFA 2CHVA 4V0OA 3BFVA 3EPHA 4LY6A 1NVVR 3LD9A 2HYDA 4B75A 4IOKA 1ZU4A 3GLHE 1OIXA 1J70A 2HCBA 4R71A 2B7CA 1P6XA 2P2LA 3GEEA 2EYQA 1G3RA 1CEEA 2OSBA 5B57C 1KNXA 4PC2A 1G9XA 1KJWA 3L2OB 3I32A 2BKUA 3V4RA 5G40A 4DDWA 2G1JA 2RGNC 3GLFA 2RGEA 1Q21A 1S4QA 2BWJA 3QQ5A 3OFND 2W6JA 3WRXC 3K0CC 1NBMA 3WMFA 2PX0A 2VP9A 4NDZA 1VECA 3EZ6A 2IA5A 1SQ5A 2ZR0A 3BXZA 2F55A 2ZVPX 1W36C 1Q3HA 4NPHA 2IS6A 2ZJ8A 3WP1B 2RMKA 4F93B 3CNNA 2AKAB 3KX2A 4HZUB 1N5LA 3U3RA 4YONB 4PO9A 1CJUC 4AI6A 1GNPA 3CZQA 3EWSA 5SZJA 4BWYA 3CM0A 2W2TA 1WMSA 4TQUS 5HKKA 2HT1A 4FWIB 4MYUA 1N6KA 1TQ2A 4A8JA 5CLLA 5IHPA 5K8TA 3WNDA 4Q4HA 1KDPA 1KMHB 5JI2E 1ZD1A 4LYHA 3THWB 1KI2A 3N2IA 3K9HA 4C0QC 5JWRA 3MRSA 1Z6TA 1P5ZB 2GETA 4P32A 2VA8A 1UF9A 1JR6A 2IYZA 1JEDA 1NF3A 2GVZC 3GJ4A 4OK6A 2ORVA 1AKEA 2ODEA 2D3WA 3OEHD 4LBVA 4A2PA 1S3GA 3LX5A 5JHHB 2CLCX 4XTRA 4XVRA 4DSTA 5K8IA 2CNWA 3EWAA 3EX7C 1JPNA 3U7EB 4JLKA 1U0HC 2Z5FA 2QE7A 2QG6A 4FD2A 2A5GA 4BPBA 1IBRA 2QRNA 5HCNA 4DCUA 4CZ2A 4A0RA 3TVDA 1R8SA 1P9RA 4BGDA 3B9PA 4FCVA 1N6IA 4AC9A 2GBLA 1QHHA 3PUVA 3VR4A 1D9XA 5E95A 1BYIA 2ZI3A 3FKQA 5EQTA 3TVTA 1NRJB 1R5NA 2RGBA 3QVVA 2VSXA 1NJGA 1Q57A 4PANA 5L3QA 4XWOA 1A1VA 1XJ0A 4URZR 1Z29A 3WHLA 3SYKA 3E2IA 5JECA 4D4JA 1N6RA 2NOAA 4IDHA 1EXMA 4AG5A 2J0UA 4EPXA 4I4LA 3HPRA 3NWJA 1KSGA 1DBSA 2G0TA 2GWHA 4OK5A 4EJSA 2OFWA 4JT2A 5E7JA 2R2AA 2ZI4A 1QF9A 4ARZA 2JLZA 3N5CA 3TH5A 1WB9A 1YVDA 3HU2A 1KAGA 5FTJA 4OI4A 3LY5A 4KYUA 2N1BA 2BHRA 2ZRHA 5CK4A 3SQWA 2BBWA 2Q3FA 5LD2C 2B8TA 1X1RA 2KWIA 2IWHA 5JMTA 4QBFA 2BBSA 2ZRBA 1FUUA 2V9PA 2WJHA 5FPTA 1NSTA 2O8BA 2PT7A 1ZAKA 4UNPA 3C5CA 2QBYB 3I8XA 1FMJA 2ZS9A 4QNMA 2QSYA 2VP4A 4NTZA 3FVQA 4ZDIA 3VX3A 3BFXA 3EZ2A 1T6NA 5EP1A 2FGKA 1E79A 3CR7A 4QL3A 3QEOA 3I1FA 3MAAC 3VR1A 3WRYC 1HA3A 2R6GA 2GJ9A 5KPJA 1XP8A 3UMRA 4IHQA 1OXXK 2ZRGA 2ZI6A 3H1TA 4HI0E 1OFTA 3ZIAA 1TF2A 1Q44A 1J99A 4B3XA 4QM6A 4KFTA 4Q4JA 2D2EA 5FR1A 1E1QD 5EXSA 2ZE6A 5GJCA 4ZCLA 5KTYA 2QENA 5KSOA 2TMKA 1IN7A 1XD2B 3NKVA 2CE7A 4L9WA 4R2HA 1G8HA 1X3SA 1YRBA 2ZI9A 5KOYA 3SQXA 1A82A 1XEXB 5EXPA 4D81A 4YMTA 2BMFA 1P72A 3WXMA 2V7QD 4DLSA 1E9AA 1NN1A 2A5JA 4MGZR 2IYTA 3KUCA 3GLFE 1R0XA 2H1LA 2G1KA 2FZ4A 4V0NA 3FMOB 1CJTC 1NBME 2ZITA 3O8CA 1AS3A 1XCMA 1Z5ZA 3O8RA 3ZZUA 1T4GA 3I4LA 4XOIA 4GRAA 1MABB 3RC8A 1T0JB 2JLUA 3CRQA 5FPSA 3K1JA 3KZ1E 5JRJA 1F48A 3R7WB 3NXSA 4US2R 2L0XA 2D2FA 4UJ3A 2CCGA 4URYR 1Z47A 4NMMA 1UKYA 4V0KA 4AKIA 1IN6A 2OFXA 5HTKA 4HSEA 1TU4A 4B3FX 4NYMR 4MRRA 1I4TD 2JJ1A 3B5JA 1DVRA 2PBRA 5C4MA 5CIQA 1YR8A 3MWLA 3B1XA 5SZHB 5BXQC 2O8CA 2A30A 2V1XA 3CH4B 2WJGA 3QJYA 3VR3A 5JJLA 1MKYA 1E94E 1JR3D 3QEJA 4DT1A 1W0KA 1FTSA 4NYMQ 2JGNA 3I3SR 3QF4B 3QXSA 4B73A 4D6PA 3VU9B 3W8RA 2O8EA 3IPYA 4LHWA 3NDPA 2D62A 2FEMA 2OFOA 4YMUA 3AH8A 2OAQ1 4Q4AA 1U0LA 4KLZA 1NLZA 3VX4A 4BQSA 1Q1ZA 3U7FB 3T1VA 2JJ2D 4X8HA 1UM8A 3W34A 1N6HA 2CVHA 4WVFA 1SVIA 1II9A 2RGNA 2E1RA 4Q9IA 3RWMB 5CB8A 4D4KA 1J7KA 1EFHA 1NY5A 4MGIR 4G0NA 3SJAA 1SHKA 3U4QB 2V6JA 3HJNA 1SVSA 2OG2A 4C9BA 5GJVC 2YV5A 1XMSA 4NHOA 4RZUA 3ZDQA 2J0QA 4O2RA 4JS0A 2WMOB 3OIVA 1D8TA 1OFHA 2ZJYA 2Z43A 1H65A 3ADCA 1KJZA 2IW3A 1ZP6A 4S2EA 3TLXA 4X8OA 1YR9A 3FB4A 3H4MA 4RD0A 1NN3A 4GZMA 1DG3A 1T3SA 1XTRA 4P33A 4JT4A 5DN6D 1RYFA 3BGWA 2I1VB 4G3XA 1EGAA 1S1MA 4MKIA 1G7SA 4OBEA 5FFMA 3N2EA 3GLHB 2GRJA 4UXHA 2H16A 1DO2A 1GKUB 2GKSA 2G9NA 2JLVA 1T8TA 4DEXA 4Q1AA 1JALA 2SHKA 3EPJA 1XEWY 2XOKA 2QL6A 4PC1A 2XZOA 3CR8A 4TYQA 4F91B 3FE2A 4TT3D 4BFVA 1O87A 5K8UA 1W0JD 1IXSB 4EPWA 4B3DA 3U44B 2GTPA 4KFRA 4NBSA 4CW7A 2QP4A 2ODWA 4JJKA 3IQWA 4KU4A 1KY2A 5TMPA 3QXHA 3T5DA 3ZVMA 3TK1A 1B23P 2IS2A 3JVUA 3BFKA 3KQKA 1SVLA 1T3LA 5BN3A 1X8KA 4Z54A 1OFUX 5FTNA 3KKPA 3SFVA 4AG6A 1G5TA 2A5DA 4B48A 1E4YA 4RJLA 1G20E 3T34A 3AVYA 4MUAA 2QAJA 5SZKB 2FFBA 1H8HD 4XIGS 5TVKA 2YHSA 1MRNA 3P4YA 2QGZA 3H86A 1TQ4A 3AP3A 5J40A 1CRQA 4Q21A 1GNQA 1JJVA 4A2QA 2FOLA 3FFBA 1UDXA 2KSQA 2ZAOA 4NCNA 1XEFA 4HUTA 3BC1A 3B85A 4DRZA 5FOXA 1ZVQA 3VQTA 2GCNA 2WKPA 4JKYA 3EZ7A 2CJWA 2RGAA 1CRPA 3AF4A 1CS4C 3DHWC 3VAAA 4A6PA 2NO7A 2V8OA 4N0DA 3TNFA 4NYIR 3T15A 3IBYA 4PAQA 1VIYA 3A1SA 4PQYA 2WWXA 2J45A 2PL3A 1NMYA 1KO4A 5JHGB 2H17A 1KY3A 2ANCA 4LI0A 4UNSA 1EWQA 1G1MA 1T5IA 2QM7A 2ZYWX 1CTQA 1W5SA 2ZI5A 2DFTA 4B35A 4N3NA 2WAYA 4IXMA 4BRUA 2WAXA 3BORA 5E7MA 1XPUA 4Q7MB 2QMHA 2ZJBA 4B43A 3GFTA 1PVOA 5FOVA 3GJ3A 2RGDA 3TUJC 4POAA 2GK6A 4YXWA 2ZS8A 4DUGA 1W1WA 2WTUA 1JECA 4G5OA 2ZXUA 3WMGA 2F9LA 3OE7A 3SYNA 3EIEA 4P4SA 5BQ5A 4UNRA 3VNVA 1XD9A 4MRNA 3CX8A 4B2IA 4RVCA 3DKVA 4JLOA 5F9HA 1L8QA 1XTIA 3GEHA 2WKRA 3QG5A 4TLBA 4HATA 3C15C 1M6NA 2WPDA 3LA6A 4JYBA 4CEJA 4C7OA 4YC7A 3SBDA 4GP6A 4JLNA 2OCBA 1OIVA 5F98A 4JLDA 4XVQA 1T5LA 1JB1A 4LV6A 2W6IA 3S1AA 2GA8A 1SZPA 4IW3B 3CRMA 5BYKA 5LDDC 3RC3A 2E9SA 3ZQ6A 4RSGA 4Q18A 4DLRA 4D80A 4QRHA 4FCTA 1II8B 5IT5A 4PPFA 3EIQA 1EFTA 3VTKA 1KI9A 3DOEA 3LDAA 2GJKA 2XJ4A 4ZCMA 1P2TA 4ZIRB 1U98A 2QEQA 3HWSA 3Q7PA 4JVNA 2GJAA 4YMSA 1W7AA 3RS4A 3QBVA 2IXGA 4UNQA 1GKYA 2ZUCA 3EC1A 1RYHA 3QKSB 3DM9B 2OV2A 4GFDA 3FWYA 3NC1C 2BIFA 2REXB 5H8WA 1G3UA 1SXJA 3BJIC 4LHXA 2X19A 3BIFA 3BK7A 1VCNA 1U9IA 1K6MA 4QJ4A 3THOA 4ACAA 4MKHA 1GSIA 1ZM4A 4OJQA 4IVPA 3AM1A 1OHHA 5E4FA 4KSCA 4HB3A 2P5SA 2IUSA 3KTAA 5FTKA 1QHNA 4M2LA 4AIIA 3AVXA 4PC6A 1M7GA 2JAQA 3DPUA 4TSFA 4DB4A 5JRZA 5JJIA 4LWZA 5G3YA 5FPKA 4WW0A 1QG2A 1XBTA 3SE0A 4ZDKA 2IYWA 1F2TA 1XWIA 1GM5A 2WSSD 4M21A 3B8HA 4PSKA 3GLFB 1LNZA 2VHJA 1CIPA 3RWOA 2AKYA 2OCPA 2NGRA 4IVRA 4X8MA 3P26A 2NMVA 1VYUA 2HXYA 2K5UA 2ZAMA 2VP2A 2PX3A 4ABYA 2ZRAA 2ZUBA 2IYQA 5FOSA 2YC2C 3LH5A 2QE7D 2UZ3A 2GJ8A 1XRJA 1BO6A 5C18A 5IK2D 3SN6A 2BVNA 3P1JA 4BZXA 4IFEA 3T61A 1IONA 3AVWA 4MYCA 2WWFA 2OBLA 2GF9A 3AF3A 4HAWA 2QORA 2BEJA 2QN6A 1AS2A 4LPSA 2GNOA 1TEXA 4Q4HB 5L3SA 4L15A 4BZQA 4WXPA 2QAGC 1CJMA 2LKCA 4B47A 2ZYTX 3C41J 5KDDA 2QTFA 3FTQA 2YVUA 2ODBA 2IC5A 1W47A 2LCFA 2FU5C 3NBZC 4IEIA 4Q00A 4BLSA 2GDJA 4GPTA 1T91A 1CXZA 1VHTA 1A2KC 1MT0A 4HEJA 1ZNXA 3F0TA 2ZRJA 2WWYA 4M9SA 1XB2A 4QFMA 2HLDA 1WA5A 5JWHA 3RS0A 5BWMA 1TADA 3U3OA 2HV8A 4U5XA 3QXXA 1MOZA 2KBFA 1QHHB 2FSHA 3KDSE 4P3YA 3ADBA 1IQPA 3Q3JB 2Q0HA 2VP6A 1B0UA 4UXIA 3K70B 3IEUA 3IGFA 3QNUA 4FW9A 5DSZA 4P4UA 3WY9A 1DS6A 4DLTA 2ZYUX 3GD7A 2DHRA 1G5PA 5L3QB 2QTVB 1CKEA 4A2WA 2QM8A 3EASA 4RFVA 5EE5B 1D5CA 1OJLA 3QVUA 3RSOA 2CL0X 3X1DA 3D7MA 2PLRA 1OXSC 4DDTA 2F1RA 1N3BA 3RANA 1BKDR 1VCIA 2WJIA 2YC4C 1NKSA 1NY6A 2PT5A 4Q1FA 1AA9A 5AUPB 4EJSB 3U61B 1JEEA 5FBLB 3ZH9B 2QI9C 3R8FA 4DLXA 1P61B 4MDFA 4ARZB 1HE1C 4RY2A 1OKKA 2ZANA 1U8AA 3LVQE 3TAHA 3ZIAD 3MFYA 4Q1BA 2AWNA 2OZEA 3MSXA 1E96A 1ZM3A 2GXUA 3U3KA 5J4LA 3I5XA 3DMDA 3EPKA 1P4SA 4LC1A 4TLEA 2FSGA 4WAUA 2V55B 3Q7QA 1GRQA 2JLRA 3LV8A 4XSHA 1TAGA 5SZIA 1WXQA 3NEJA 1VMAA 3QKRA 2NQ2C 4JBYA 3K8YA 3W6NA 2C99A 3OAAA 4YMVA 1NMZA 2FEOA 4CRWB 3PUYA 4DDUA 2OT3B 2ERXA 2D7CA 2W58A 2WWWA 4WZ6A 2BM0A 1KK2A 1SXJE 2B92A 4LJ9A 1MR3F 4F7WA 3FHOA 1KOFA 5TDHA 2O52A 4ESHA 2JLQA 3OF5A 2HF9A 4JBWA 3L82B 421PA 5KO2A 2QRZA 5AJZA 3NHBA 4JIMA 3T1TA 3QIAA 1KHTA 3NIBA 4BEBA 4DLVA 2IEZA 1DPFA 1XMVA 1VDZA 4URXR 2G83A 2ZTSA 1CU1A 4XD7A 1RRFA 2G0NA 2VP0A 1XTKA 2JCSA 2F1HA 3O47A 2PJRA 4KSBA 5KDLA 2VHUA 3DEFA 3MMPA 1N6OA 4HAXA 4JVMA 4A1FA 2YZ2A 4V03A 3ZQJA 1RRPA 2DR3A 2QTHA 4KBGA 4FIDA 4OHVA 4BLRA 4DCVA 3QPVA 2Q9CA 4A9AA 4TWZA 1RIFA 3ICEA 4WZAE 3AVUA 1DTSA 4YMWA 5FL7D 4GMDA 3EG5A 1OV4A 1DAMA 1TNDA 3KKMA 1Z3IX 1GAJA 2A78A 5CDFA 4HYYA 2QMEA 4KJZA 2ZE8A 3UWKA 5AUNB 4FWTA 3P4XA 2QPOA 2WICA 4QGAA 1CP2A 2JDIA 3FMFA 2ZRDA 2EWVA 3KFXA 2QSZA 2G3YA 1FUKA 4LJ5A 1JAHA 2HEIA 5EP4A 4M1TA 2RGGA 3MUFA 2W0SA 4OI0A 1X6VA 4NYJQ 2DCUA 2FG5A 1VKJA 2O8CB 1L2TA 3R9IA 5ANRB 2FE4A 1NVVQ 3SDZA 3EXAA 4DT1B 2ZJZA 1UBEA 4LYAA 4PPGA 4QGFA 4M9QA 1UKEA 2AXPA 1M7BA 3BB1A 4KXFB 2OHFA 3MG9A 5JEDA 1T3HA 4HAUA 2IBMA 3A8TA 2C98A 2V3CC 3K0FA 4Q4AB 3WYAA 2QA5A 2GCPA 1AZTA 2OM2A 4Q47A 2W00A 2BBTA 1Q1EA 4HDQB 2WKQA 2AL7A 4C2UA 1LB1B 3GLGA 1G7RA 4LRWA 1F6BA 3CX7A 2R62A 2NTYC 2KE5A 2V54A 4F4CA 1LS6A 4QGHA 4PHFA 1E9RA 2V4ZA 1KI8A 3OEED 5EJEA 2C8VA 1K8RA 3HPQA 4QHSA 4URWR 2A7QA 2XOKD 4RKFA 1W36B 5EP3A 4NONA 2W83A 3WBJA 3BWDD 1GKIA 4TYPA 1P2SA 3THXA 4EFNA 2W2XA 4TZ0A 2VQSA 3OIUA 4D0LB 2VHTA 2ZE7A 4KVGA 1UBCA 2O8FA 1QZXA 2QAGA 3GP8A 1E32A 2ZVQX 4TTQA 1HTWA 2XTZA 4KAXA 1YZQA 3FFAA 4QKQA 1HE8B 1OYYA 4HDOB 2WJVA 4HUQA 1G3QA 1FW6A 1IXRC 3D6TB 1ELOA 4DCSA 2R6DA 3TGPA 3Q72A 2GHIA 3GJ6A 1OLOA 2HT6A 4JL5A 2CDNA 4Z8XA 2MMGA 1T8UA 4PAOA 2QQ0A 3AB3A 1LF0A 5HR5A 3L43A 1IN8A 2C04A 1ZBDA 2ZEJA 3K0AB 3UG7A 5J4HA 3AVTA 2G88A 3KXLA 3L8YA 2V6IA 3SS8A 5L3RA 4D2IA 4DDVA 4B44A 4JJZA 2IYUA 4QHTA 4G5QA 4TMVA 4MYTA 1E0SA 3FHCB 1WE2A 4V02A 4A0GA 2YINC 2VPPA 3TSWA 4MDEA 1CF4A 3LQRA 3PVSA 4HLCA 4A0FA 1SVMA 4G01B 1TF7A 3B1WA 3TQFA 1W2GA 1GRRA 2FMXA 4LJ8A 5TY0A 4MITA 4L16A 1R6BX 3CNLA 2Z4SA 2CBZA 1G6OA 4GL2A 1KSHA 3LQQA 1QVAA 2EWWA 3LX8A 3OE7D 2CJWB 1Q0UA 1G17A 1W4RA 4LJ6A 4XH9B 1F2UA 3A6PC 2QT0A 3LBNA 2Q3HA 1E4VA 1Q20A 3AVOA 3TJZA 3UATA 4BECA 4ZO4A 2WOOA 5G41A 1N2CE 3V00A 4GP7A 1SHZA 4PHHA 4AYWA 3T1OA 2QUZA 3CLVA 5CDFE 2W6ID 4TQ9A 3GFPA 4LX0A 3UK6A 4A15A 2ZYVX 4U7DA 5E7IA 1I2DA 1EG7A 2GJSA 1MO6A 3GFOA 1CULC 2BBOA 1WRBA 2BEKA 3SHWA 1ZNWA 2VRWA 4FINA 2VIIA 1VCMA 1US8A 1KKLA 2OBMA 3ASZA 4DLZA 5DYGA 4P4SB 3LW7A 2IS4A 1P62B 4TN1A 1UEJA 3ADKA 3SI7A 1YZLA 3CF6R 1JJ7A 4UNNA 5KHOC 1N6NA 3C7KA 4LDJA 1PJRA 4LC0A 2NPFA 4P4TA 4C7OB 1OIWA 4TMWA 1SXJD 2X8AA 3NTUA 4FI3C 4Q1CA 4TQAA 3U2QA 2GAOA 1NG1A 1I2MA 4MYHA 4KO8A 5FTMA 5JSZB 1G8YA 3MWKA 3QOFA 5C2JB 4GOJA 2P65A 3W3ZB 2VF8A 2H5EA 4QNRA 3S1AB 4I81A 3AKEA 5LBIA 4QG7A 3ZGXA 4B6EA 4ZDJA 5JBQA 3GLGE 3U3JA 1ZUIA 3M4YA 4M1WA 4Q02A 3UKDA 4Z1MD 2QMUA 1XPOA 3A4LA 4ZI3A 4TL6A 3REGA 1DE0A 2P3SA 1E2HA 1P2VA 1BMFA 2PLFA 4ERNA 4R9UC 1RC8A 3L0PA 2AWOA 3RRYA 3ZS9A 1V5WA 1RRCA 1R0YA 4KHZA 1MV5A 2CMKA 5E3HA 1IY2A 4TL8A 3ND8A 3E70C 1KSJA 2KBEA 4Q66C 2QZ4A 1OH5A 4LHZA 2C2HA 4C3ZA 1QHYA 4C0KA 4QC2A 1SXJB 4CYMA 4Q1DA 4RD1A 2P67A 4CEIB 3D31A 1KZ7B 4B3CA 1SVKA 1A5TA 4URVR 1UAAA 3KL4A 3P20A 3HU1A 4DSUA 2XTMA 4W5JA 2NO0A 1E69A 2A5YB 1R4AA 1ZM7A 2JEOA 3NHAA 2CK3D 5KPDA 3KTAB 2J7PD 4C0AC 1GILA 4W5WA 4MGYR 5EXTA 1KK3A 1BYUA 1TL7C 3ND9A 1E1RA 3K0CA 4P31A 3QSYA 1N5IA 1XDBA 2G6BA 1VG9B 1XTQA 1F2TB 1CR4A 4N0EA 1QRAA 4PHGA 4ASUD 1COWA 1KI4A 3K53A 4M8NE 2YNMA 1VPLA 3AUXA 1OW3B 4PSAA 4XWAA 4A4DA 1OYWA 5D3QA 1KI6A 3T1QA 4HLUC 1NLYA 4EIWA 3GJ0A 3IIKA 1EFUA 4K46A 4DB2A 3KKQA 2VSOA 3F8TA 3QENA 2IX3A 2ZE5A 4M9ZA 1LVGA 1G3IA 6Q21A 2GF0A 3PXGA 2DPXA 3CPEA 2KI5A 1UJ2A 1EFRD 5L3SB 4HB4A 5EE9A 3AGPA 4AD8A 3K9NA 1DOAA 2RHDA 3WBKA 4OHYA 2DWOA 3VKGA 3RS2A 1UPTA 1LF5A 3B1ZA 4L5BA 5EE1A 1P73A 1W2HA 2KJQA 5B64A 1E2IA 4MKFA 2HUPA 4KFSA 2F3TA 3AGQA 3VMFA 4JVLA 3OFNA 4BLTA 4C4PA 3ZD7A 3DO6A 1AK2A 1H8ED 2BJWA 2C77A 1HT2E 3SFZA 1TMKA 1ZUNB 5D3MA 3EPLA 5J47A 1NMXA 1E2GA 1U90A 2QMOA 3M1IA 1N0VC 5FR2A 2QNRA 4II7A 3RS7A 1KI3A 5JZVA 5K8LA 1WDTA 4BLOA 4O0MA 5C46F 3KFVA 1DADA 2EYUA 2RH5A 3FKSD 1E2PA 4QGGA 4RCYA 4B76A 4WBSA 3R9WA 2D4HA 4S35A 1GZSA 2EFHB 2F7SA 4KODA 4OHWA 2GZAA 1ZYUA 5DIFA 1P75A 1S9HA 1XF9A 1FP6A 3ZZ0A 4AURA 5TB5A 3EA5A 1C4OA 3PQCA 3KQLA 3ASYA 2YOGA 1U8YA 1BOFA 3W9YA 3O8BA 3B1YA 4GMXA 4TZ6A 2ERYA 3PG5A 1M2OB 5AUQA 4BFWA 2BDTA 2FH5B 2O5VA 3AKCA 1U2RA 2WIAA 1KZGB 1CR0A 1O3YA 2B7BA 4I1OA 3CBQA 1SGWA 4E5UA 1GOTA 2XXAA 4NYIQ 4C0BA 4ESVA 4F38A 5GADl 4JSTA 3NH6A 5JFGA 3TSZA 4A82A 4GZLA 1R0WA 2QBYA 1VCOA 5HE9A 4PQRA 5FBWB 2FA9A 1ZNZA 5UKDA 1JAIA 2VYFA 4CT4B 2O0KA 2HF8A 4GNKA 2VHQA 1GTVA 3X2SA 4B6FA 4UQOA 1U81A 3VKWA 1KKMA 3CUEF 1Z6YA 4PX9A 1G3MA 4RZ3A 4B3GA 3SEAA 4QJ5A 4HZIA 4PC3A 2XSZD 1TF5A 3CH5A 4L8GA 5BYJA 1WCV1 3IBGA 3QXCA 3VHLB 2IF0A 2HXSA 3QG1A 2CE2X 1DEKA 4LJYA 2FX3A 1M74A 1MRSA 2ZJ5A 2A5FA 2JIZA 3TE6A 3BS4A 3EARA 5A0FA 1GP2A 3SJCA 1Z22A 3I92A 4EPYA 1IJEA 3NDBB 2DFNA 2VBCA 3D3QA 1HUQA 3NH9A 4LYFA 4F4JA 4IOMA 5JS7A 3QY0A 4NCKA 3SR0A 5BN4A 1DO0A 2A9KA 3HYTA 4FN5A 4G5GA 3J81k 2C9YA 1OXVA 4B3BA 1NIPA 1GUAA 4R7ZA 5FBQB 4TL9A 1G21E 4CVNA 2H57A 4DWJA 1E2EA 2ZSEA 3SNHA 1SKQA 3UIEA 4XWKA 1WBBA 2EVWX 1K5GA 3I8SA 5CJ2A 5CM8B 3ZVRA 4LJ7A 1KGDA 5FUYA 1ZD9A 2W6JD 4MQBA 3ZLJA 3KB1A 3IDQA 1NBMD 3SJBA 3R7WA 1E1QA 2CHQA 2GXQA 3LBIA 1OXUA 2IYRA 4EFMA 5BN5A 2VHCA 3B2EA 1N5JA 5DISB 4LHYA 3T12A 2AK3A 4M1SA 5HKKD 2X77A 4YLGA 3B60A 1SVWA 4H1UA 1E2NA 1Q1BA 2I4IA 5CYOA 4Q7LA 2V7QA 5AJXA 721PA 4I1SA 3WP0A 3A1VA 1A7JA 3HR7A 4LHVA 1JBKA 4PPQA 4EDHA 1OF1A 1MO3A 3CF0A 5DNYB 4AYTA 4B32A 1LFDB 3IKJA 2GZDA 4MRVA 2F1IA 2J0VA 5GJWC 2IYXA 4JLJA 1HEIA 3VU9A 2GEVA 2OESA 4Q01A 1OB2A 4GDFA 2HJGA 1E9EA 3LO5A 3GQBA 4ZDWA 1X8LA 3CNOA 3G0HA 3MJRA 5EUQB 1VTKA 1IN4A 2A3RA 3EA0A 5G3ZA 3W8NA 1U0JA 4NZYA 2CNWD 2XITA 3BAFA 4XSGA 1R5OA 2PMKA 2QPTA 2PMDA 3SYLA 1G7CA 1IAQA 2R65A 4JBXA 4NU0A 4X8LA 4UJ5A 3UANA 3Q5EA 4KITB 3AKDA 3A1WA 2VH5R 4Q7KA 1LV7A 3L0IB 3A36A 3LNCA 5JEEA 3HU3A 3JVVA 1TQ6A 4GT1A 2PCJA 4HLUA 3U6KA 5JS8A 4A8JB 2GILA 3AVVA 4V0MA 2OLKA 4DCNA 1RW4A 3WYFA 1FNNA 2C03A 1ESMA 1JR3A 2NZJA 2WBLC 3THXB 3K70D 2J3EA 1XU4A 2OAP1 4NL4H 4QBGB 4HAYA 4BLPA 3A1TA 5FBVB 2O8FB 4JLBA 1EX7A 1Z83A 1HYQA 1W49A 3KKOA 4FXPA 2ZJ2A 1U94A 5CIWA 2JJ2A 221PA 4FMCF 4HUQB 1LY1A 3MWJA 1KSFX 2FZLA 5A5GA 2G77B 3TR0A 1A4RA 1HV8A 1W44A 1E2KA 3FGNA 1Z6AA 1VHLA 4EAQA 2NO1A 1ONBA 1S3SA 4Q9LA 2AN9A 1KDOA 1L4YA 2BCJQ 3BH0A 1KK0A 1M8PA 4XTCS 4QBHA 3KJGA 1C9KA 3DVLA 2ORIA 2JLSA 4LZZA 3X1ZA 4RCZA 2B21A 2P5TB 4LBYA 4QJ3A 1VG0B 3BH7A 1YZKA 4Y0VA 4GOKA 1FNMA 2AD5A 1X1SA 2JATA 3LXXA 3W5IA 1KO7A 2ZRIA 1ZMXA 2OO7A 1UFQA 2EU8A 4NKRA 4FMCB 2KB0A 1NLFA 5DGXA 1YKSA 1G41A 3PEYA 1QHXA 1OPXA 2YWFA 3FHTA 2J0UB 1BH2A 3BB3A 2IS1A 3SHFA 4WOPA 1E79D 1NJFA 2EQBA 4MKGA 4TYYA 2O8DA 1R2QA 2CLSA 4IKEA 1FMLA 4TTRA 2QPAA 2XZPA 3GMTA 2JLYA 2XAUA 1ZM2A 3DZ8A 3PJRA 4LGMA 4YDHB 1AQYA 3DZDA 1E3MA 3KQNA 1Z0JA 1R7RA 5GJBA 4EJSC 1AM4D 1S1CA 3EIHA 3GJXC 4TT3A 2ZIAA 3I72A 1W0JA 4K81B 2R6CA 4MA4A 1XXHA 1OSNA 4ON9A 4YDSA 4JLVA 1RJ9A 4L9SA 1QBKC 5CYPA 5FUXA 4B71A 1CBUA 1ZIOA 5AJYA 4TMXA 3RNLA 1PUIA 1AQUA 4I1UA 4AKEA 4C0LA 2O8BB 1F2UB 2ZETA 5IDVA 4DZZA 1RZ3A 1KYIA 4LK2A 3CKLA 4RD2A 2FDCA 3Q8XB 3UMFA 4Q19A 4MRPA 3I5YA 4TYWA 1GL7A 3VFDA 3CIOA 1NN0A 1EWRA 1H8HA 2CL6X 3AVQA 1ZINA 1Z28A 2NZ8A 5FH9A 4K8OA 4JL6A 4MGKR 2ZI7A 3CRRA 4M1OA 3X1WA 4JLMA 1L4UA 4TMKA 3FDIA 4Q03A 1NN5A 1QG4A 5H1YA 4EPVA 3FPAA 4Q4JB 3N70A 2YKGA 2IEYA 1RE0A 4KBFA 1IY1A 1W5TA 4HLQB 4XVUA 1BMFD 2WMNB 5C1BA 1ETUA 1QHIA 3IQXA 2VL7A 2PEYA 2WWGA 3AV0B 3LLMA 4HB2A 1W4CA 3WMEA 3IEVA 2JJ1D 3V9PA 4F4IA 2J7KA 4C30A 1TPZA 5DI3A 4OI2A 3HR8A 2GAAA 3PIRA 2XNDA 4TYNA 5KNBA 1W0KD 4IEEA 1BS1A 4PZZA 4ZCIA 4AYXA 4B74A 5KYKA 1DG1G 1G4UR 3NEYA 4E07A 1DAHA 1AGPA 3B13B 3X1XA 2WJYA 4RZ2A 4JLAA 1KDRA 2LKDA 4NCHA 2XZLA 3OZXA 2YOHA 1E0KA 2ATXA 3DM5A 5JCZA 4LV8B 1TQDA 3G5UA 4P0TA 4U02A 1E6CA 4ZIRA 4V0ME 3T06B 1IHUA 2JLWA 1JR3E 1ZM9A 2UZIR 2FSFA 1PLLA 2FWRA 2ZJAA 2IYVA 4ITRC 5LB4A 1W36D 1S96A 2PH1A 1COWD 1J8YF 3BBPA 4NCJA 3EZFA 4XJXA 4EKDA 2ASEA 2AHOA 2F43A 4JVSB 2ZRLA 4IXNA 2AD1A 2C95A 2ZR7A 3PUWA 1XPRA 3BOSA 2H8KA 1W4AA 2D7DA 4DKXA 1DAEA 4PFSA 2O8EB 3IPXA 1AGRA 3Q9LA 2HJVA 2HYIC 5FUWA 5TV2A 4M1YA 2C9OA 3B6EA 1OH6A 3D8BA 5J4YA 3LLUA 5EP2A 1IN5A 3TUIC 2BMEA 2MSCB 4FMDF 1FQJA 4JLPA 4N1AA 3TSOA 4BFTA 2WWHA 5JWOA 4NE2A 1V43A 2GCOA 1UEIA 4CEHA 4JZKA 2RCNA 5HPYB 1E9SA 1DAFA 1JQLB 3GPLA 1WP9A 3VR6A 2PCLA 4TTPA 1P60A 4QOSA 1D2NA 2WV9A 4OHZA 3VR5A 5KU1A 1YHNA 1NNEA 1LS1A 3TQCA 2R6AA 2XTNA 5JI3E 4BASA 1KI6B 1GITA 3HP1A 3MWYW 1ZC3A 3IO3A 1MO5A 5FI1B 1YZUA 1Z0IA 1YE8A 1GVNB 1ESNA 2OILA 3QPWA 4HAVA 4FMDB 1W4BA 1N25A 5KNDA 3LAWA 3CWZA 3R8CA 4C2TA 1ZRHA 4LYJA 3SU8A 4WA7A 1E2FA 1Y3AA 2F9MA 1JQJC 2IF2A 5AK0A 1GDDA 4OYHA 5AWFC 4DLYA 1G19A 1PLKA 2WHXA 4LJAA 2C96A 4ZPXA 1WQ1R 2ZSBA 4CDGA 1XXHE 2V1UA 2WSSA 1FZQA 5EE0A 1UDWA 1ZJ6A 4PHTA 1JNYA 4BFXA 4J0QA 3CWQA 1C1YA 2Z83A 4LBZA 4JYCA 1U8ZA 2J87A 3IIJA 3L0SA 4WZBE 521PA 2ZSAA 3GLIA 1TTTA 3K09C 3I61A 4M1MA 1QVRA 2WIBA 2ZS7A 2ZUDA 5D3MB 2C78A 2YWGA 5IK2A 1FL9A 2ZR9A 1VYTA 2DB3A 1S0UA 2PZFA 1KJYA 1P9WA 5CLQA 3ZZTA 2ZRFA 1RVDA 4URUR 1RPZA 4CT5A 5AJWA 3FMIA 4D25A 1Z8FA 2QP9X 3C4JA 3OIWA 3K9GA 2O0JA 4M0LA 3M6AA 4QHYA 1IXZA 3CW2A 1E98A 3NVAA 5P21A 2GEUA 5JCPA 3LXRA 2X2FA 3SJZA 1W48A 1TEVA 1GG2A 2AX4A 4AK9A 4YXWD 4OKSA 3W3AA 3ZJYA 4IOJA 2WWIA 3ETLA 2YWEA 4DUGD 4A0HA 1IM2A 1KI7A 3QUSA 4M1KA 4DVGA 1G16A 2ODNA 3VNUA 4EQ6A 1XMIA 4NCIA 2PZEA 5KSZA 1KAOA 2GVDC 4ZV4A 2REOA 4TLAA 1E9BA 4IVQA 2UKDA 1HQCA 5LD2B 3PR1A 5DLQC 2ONKA 2WPDD 3THYA 5IF9A 3TUZC 3PEUA 5HZKA 1E2MA 3PENA 5EZ5A 1NL3A 3W6OA 1G6HA 2XXAB 3T5GA 1UBFA 1QHGA 2JIZD 4UXJA 2QU8A 1ZC4A 4G1UC 2Q21A 3MGCA 2ZRNA 2OUKA 1NP6A 3DL0A 2FN4A 5DYIA 4HAZA 4OHXA 2FJUA 3KXKA 2CLDX 4LOAA 1XMJA 1NG9A 5EXXA 1FX0A 4RFSA 2ZQ5A 5H68A 3H84A 3AQ4A 1RRGA 2ZRPA 5BW8A 2XB4A 2ZSDA 3UXMA 2W0MA 3RAPR 1ZU5A 2BM1A 3OIYA 2J41A 1NSFA 3JZMA 1GIAA 3W5JA 4A92A 3QKUA 5AUOB 2AFHE 3R20A 4YQFA 4CEJB 2FGJA 2RGXA 2FFHA 3L0OA 1P7CA 5EZ6B 2ZREA 1T9HA 1OE0A 3MLEA 1S2MA 1G8GA 5IRCD 4PSVA 4ILEA 1UKVY 1J8MF 3KJIA 3RYTC 3LWNA 1Z63A 1OHHD 3SC3A 1OH7A 1FP7A 2Q3MA 4BEJA 4EPRA 3BB4A 1F3OA 2HDNB 2EW1A 4O2LA 5FOTA 2OCAA 1XX6A 3PCRB 3B7GA 5FL3A 3AP1A 2DWQA 4LPKA 1GRNA 3AF1A 2CVFA 4TSFD 1XNJA 4I1VA 3T35A 3RSLA 4ZI2A 2GZHA 2WM9B 1Z08A 2RHMA 2EFGA 2OLJA 1G8PA 2NPIA 3PUZA 4B34A 3OHMA 1GL9B 4AWXA 5B30A 3Q85A 3CPJB 2RGCA 2R9VA 4B2PA 4TLDA 2VF7A 1NVXQ 1D2MA 4DLUA 4M4SA 4OI1A 1N6PA 2P6NA 3WNCA 1SXJC 4EPTA 1AKYA 4HDCA 2PZGA 1E9DA 1Q12A 3FYHA 3TR5A 1U9IC 2P6UA 4F92B 2C5LA 3TW8B 1M7HA 2J5XA 4PPNA 4TLCA 3RRZA 821PA 4DXAA 3QPUA 3F5FA 3ICQB 4RZXA 2CEAA 5FL7A 3GLIE 1YQTA 4O3MA 1P9NA 4KV9A 3B9QA 1JXOA 4W7SA 3TRFA 2DFLA 1R8QA 4OL0A 3LRPA 3PEVA 4G5RA 2XJ9A 2WJJA 4DIDA 2XGJA 4TMZA 4HZUA 5FOWA 4DEYA 1E2JA 2FNAA 1JPJA 2HLDD 2NG1A 3KXIA 2OCYC 4GSYA 2MMCA 2DFKB 2J1LA 2VTKA 5KUTA 3CZPA 2R44A 3THWA 1A2BA 1KMHA 4R98A 1FTNA 4TL7A 1E9FA 4V0LA 1NKTA 4KYIB 3KB2A 1KO1A 3O8DA 2R8RA 4BFYA 2VEDA 1N0WA 1SKYE 3HYRA 1E9CA 1OH8A 3EAQA 5FPHA 2MSDB 2D74A 3DMNA 5FBRB 3SOPA 1UBGA 2FV8A 1CJKC 1ZW6A 1N0UA 1Z6GA 4IFBA 1AZSC 1G18A 1ZNYA 3RS3A 4GBMA 2QQEA 1YR6A 1M1YE 3IHWA 3QE0A 2FSIA 4H9GA 3PEWA 4RD3A 1ZD8A 4US1R 1XJQA 4BFZA 3VHXA 1OKKD 3K0EA 1WF3A 3NG1A 3OEEA 1R5BA 2IUUA 1G5RA 4B2LA 1JI0A 4PC7A 2IK8A 4BFUA 1T0HB 3K09A 2ZJOA 1JXMA 3G82C 3HDTA 1VIAA 3GJ7A 5AJVB 2XB2A 1Z0KA 2NO6A 2QGNA 3KQHA 3ZVLA 4E03A 2GK7A 4DLWA 3CONA 3K0AA 1FQKA 2CXXA 1ANKA 3QF7A 3CPHA 2BMDA 3KUDA 1R10A 3GEIA 2ONJA 5F9FA 1P3JA 1Z6XA 3OEHA 1J2JA 3OESA 5CM9C 5FPYA 2Z0MA 3OAAD 4D4MA 3RS5A 3RRNA 2IUTA 2YWHA 3MCAA 4Q9JA 1QDEA 1HH4A 3AUYA 3BD9A 4C0SA 4OQNA 3KQUA 2J59A 2CHGA 1OXTA 4BLQA 3CRVA 4QM7A 3LFUA 2C9CA 2O8DB 3E1SA 1FOEB 2I3BA 2IL1A 1G64A 5L3VA 4NH0A 2WOJA 3Q5DA 4PZLA 3RHFA 1S9DA 3A4MA 1KNQA 3B78A 4PO8A 3ZS8A 4KCGA 1Z07A 1TU3A 4US0R 3LW8A 1KMQA 1XXHB 3C16C 3DKPA 1KO8A 1RJ9B 4LV5B 4PO1A 2Q9BA 4OQLA 3QKRB 1I4DD 2PJZA 4XD7D 5TARA 3NC0C 2REBA 1HY3A 3U7HB 2FPKA 1Z2AA 3IILA 2Q9AA 4JMPA 4U00A 2JJ8A 5A4JA 3CF2A 3CB4A 4QBIA 1EESA 1AIPA 2JASA 2MSEB 3K9LA 4W5HA 2XNDD 3TKLA 4A6XA 2FPLA 1XZQA 2AK2A 2OBNA 1GNRA 3IHLA 2W2VA 2RAPA 3GCGA 5LPNA 2PEZA 5DE3A 1WBDA 3UPUA 1EFCA 1NIJA 1TX4B 3DDCA 3BERA 4E09A 1RFLA 2F6RA 2JDID 1R0ZA 2ZU6A 4FMBB 3EZ9A 4OJKA 3K0SA 1N5KA 2EFCB 2RKOA 3PUXA 4GOXA 4Q4LA 4IDNA 1ODFA 1XD2A 3SBEA 3FOZA 1RKBA 1XEWX 2BJVA
chains in the Genus database with same CATH superfamily
1Z2PX 4BP3A 1C7RA 1C3LA 4GDMA 1B8NA 1IJFA 2W98A 3AETB 3D3WB 3NLLA 2XT9A 3VDMA 1BHQ1 4Q3LA 5CVCA 2M6LA 2OXRA 1KMMA 3AFGA 4C6TB 5JSZA 3NHRA 4EHKA 3DNMA 1SBHA 4H08A 3C1TA 1UZMA 4QPJC 3SZRA 2GDZA 3LO8A 3WG9A 1CQXA 4BNIA 4BN5A 5TGTA 4EMUA 3UC9A 3TBHA 4E22A 1FFYA 1MABA 1X94A 4L2IA 3U5ZB 3EEYA 1Z2CA 1LTQA 1C4KA 3LUKA 4YFYA 5J5CA 4DCGA 1YMUA 4Z2AA 3F6EX 3RF6A 1H2HA 3BK1A 4KN5A 5IVKA 1K0FA 5DVZA 5JC8A 3TBKA 5I7HA 4Y6PA 2H1SA 3KJHA 3A4NA 3CLKA 4GGOA 3MD9A 4RGVA 1N8NA 5ISMA 2ID9A 3L4BC 2PUFA 3CFYA 4NBNA 3O7MA 4LJ4A 5KSPA 3R44A 1JYFA 3RG8A 2CLMB 1RIIA 1BJTA 2DPLA 4YJ2F 1M2KA 1OZGA 5CVUA 4E33A 1YF3A 3P96A 3KWJA 2CHUA 2JFUA 5EY5B 4IIHA 4F45A 5B58C 4IGIA 3VR4H 5FX2A 2WP8J 1NNUA 4GM0A 4QOFA 4RVOA 4W9NA 3V7YA 4CG1A 3C1OA 3RAJA 3UYKA 1RYBA 4TXNA 1L5LA 4IDQA 2Y1FA 2Z8YA 3K0FB 3ETGA 3DAFA 1BQ3A 4MVYA 3RUCA 3TMKA 2PUGA 1GU7A 1NZJA 3DQQA 2A9VA 4LXHA 3AT1A 4QATA 4R7GA 4CM9D 5KNCA 1M83A 1I7NA 4LE0A 3UT5A 3AWIA 5BSGA 2BTEA 3AEYA 5FOUA 1E2LA 2ZWPA 2C4UA 3NDRA 1S2IA 3L8ZA 5BUCA 3A3NA 2DX7A 2BLLA 2J3LA 3H11B 1PQPA 1IUOA 1NASA 3LJKA 3IPLA 3EXFB 4Z4CA 3TDMA 3TOZA 1E92A 4N3GA 1YUMA 2J3IA 3FUWA 3O8NA 3DZBA 5HZHA 5HFAA 3DWIA 5K0SA 4YPOA 3M89A 3ADDA 1NXTA 2A0YA 1TE2A 3QEMB 3FLMA 1FDUA 3GHYA 4ZT3A 2IXEA 1CR6A 3ZQ4A 1P1HA 1L4BA 3T3OA 1S8FA 5TSDA 3M6IA 4PWYA 5CFQA 4TSRA 2FAXA 1T9KA 2ZBFA 1HQKA 3ON5A 1J90A 3R5JA 5D7BA 3UICA 1ZNQO 4AS3A 1DT5A 3BWVA 1SWVA 1VLVA 4M9XA 1FFXB 4NBKA 4TMYA 2QAGB 4WXRA 4I66A 4ZALA 4F1KA 3QX8A 1FA9A 1SIWA 1NPYA 1TMYA 2Z4TA 2OPHA 2CK3A 4W1SA 2B35A 4HP8A 4EY3A 1F60A 4AY2A 4EJFA 3KLPX 4DPLA 4BKUA 1DHTA 3HP4A 4PQFA 5EWMB 1G38A 3WYGA 3DOFA 2GFQA 4XIIA 3CO0S 2HPHA 1QRUA 3RFCA 2ZTLA 3HCPA 2X0KA 1II0A 2V7WA 2XW6A 1TJ4A 3ORSA 2ZJ7A 4FNOA 4IDPA 4NC9A 3T38A 3M9LA 3A2KA 3AZOA 4ER0A 3TD6A 1UKBA 2I3GA 1M2FA 2XT0A 3U44A 2LRHA 4ND7A 3UWOA 1YZGA 4M0CA 3N8GA 3BA1A 2I4LA 1LBHA 5F21A 1AURA 2YQ4A 3I04A 1G7TA 1PWZA 3NAGA 4W9MC 1C0PA 1AUVA 1CV2A 3KYCA 3B1VA 1N1DA 2Q99A 1PNQA 2Z58A 4MW7A 2PUWA 1R4NB 4IWNA 4QXAA 1EUQA 3NJ8A 1CR2A 1OTHA 3GJ8A 1GSHA 2IIPA 1UMCA 1Z0FA 2ADMA 3NGMA 3OT1A 3W2GA 4D0NA 2VLIA 4PR0A 5DASA 5CVDA 5JSKA 1J49A 3LT0A 1KAHA 2KYRA 1QF6A 4AY6A 2EBWA 4QECA 1U0EA 1JWAB 3TPFA 4H17A 2NZWA 5EIHA 2VSYA 1YFLA 4E5DA 2X6QA 2J9RA 4ZAWA 2ZPTX 4D0GA 1EGMB 2I33A 4KLRA 2DJ5A 3C6YA 5ALRA 4BE7B 1FP4A 2XRZA 3RJ5A 2WG2A 2I34A 5SYAA 5EMMA 4DBZA 1V3VA 4WKGA 4KQJA 1KDTA 1BKYA 1PS0A 2R8YA 5DX1A 3CEJA 3TI9A 1P2UA 2JHFA 4MUNA 4KE9A 4LRSB 621PA 1XDSA 2AC2A 2C2OA 2YWRA 5JLJA 4B81A 1N3IA 5J4KA 1IRXA 3KVOA 1MQ8B 4W8OA 3SHVA 5GMOA 4BRWA 2DYKA 5JH7B 5LSAA 3PV0A 4R6XA 4YAFA 4LJLA 5EUBA 1FU8A 2CL7X 4JL8A 4MA0A 3THYB 3PFIA 3RABA 2GLUA 2LE0A 4ZKDA 4PLVA 2CCJA 5JOQA 1XMOB 1JL3A 1W75A 1Q7GA 3ZWYA 4EUNA 4CT0A 4R3WA 2W8BA 3FKSA 1NP7A 4P1ZA 1TZBA 3AUAA 4X0EA 4DJTA 1XCGB 2QRVA 1YRAA 3FHJA 2VXCA 3I9LA 3YASA 4HB0A 4C2AA 3ZKAA 3H2ZA 2F3RA 1T6YA 4L8WB 3AM5A 3Q9UA 3K31A 4G5XA 4GR5A 2P90A 2OR3A 1RAIA 2OXCA 3CTMA 4XIJA 2AXNA 4HFJA 1AN0A 1SULA 5KDOA 3E58A 1QMGA 1ESZA 1E64A 1T26A 2BV3A 1IDOA 3MD0A 4AJIA 4CIDA 3TLZA 2VEOA 2R8ZA 5CAEA 3PQFA 1MB2A 4KFUA 3KT8A 1ZIPA 3JARA 2I2XB 3LHIA 2Z6VA 1SN7A 2ECKA 1OBOA 4HSGA 5CXSA 5B7PA 1CUSA 1VM6A 4GI7A 5JQGA 1GUYA 2JIQA 3LYHA 1XCPA 1LEHA 4R9NA 4WA8A 3M0EA 4WLOA 1R18A 3NATA 1ADCA 2QVGA 3AM3A 4U9UA 5LA6F 2W2KA 3C8DA 3OC0A 5FEMA 1H4SA 2E21A 2AR7A 1JDBC 2F00A 2K6GA 3I83A 3IYLW 3QVGB 4IX9A 3PCTA 1OZAA 4QWMA 4RZHA 2GVNA 3CT4A 5ALKA 4C4XA 2UYGA 3LPNA 4OQFA 2N46A 2GTIA 4AKHA 2OCXA 1ADGA 1HURA 4ES6A 4UHKA 4X91A 2XB9A 3UAYA 2WB2A 2F4VB 1II8A 1F5NA 4O25A 2I1QA 2ZCJA 5E0OA 1H3EA 1X2EA 1E0AA 3DCYA 4TV9F 2Z4RA 3EIFA 2V7EA 4N8EA 3BGIA 4J1SA 3ZCRA 4RHEA 1MIOB 1GTG1 3GA0A 3DBLA 5DM4A 3LVRE 4W6QA 3B82A 3WTCA 3ECCA 1GR0A 2VP5A 3EQZA 2ZAIA 1UKZA 1I3OA 1DAOA 4FEGA 5C5IA 5FO1A 2PGOA 4AECA 2WE7A 2PSSA 4ZKEA 1ABEA 4F7DA 3JWJA 3NNSA 4KVAA 3M6LA 3NHYA 4EZEA 4B33A 1Z8NA 4QYWA 2LR0A 3AY3A 1HMYA 1M34E 2IGTA 2VK4A 3DE5X 3M4ZA 1MHPA 5EE3A 3TAUA 5ICFA 4JGBA 1GL3A 2ZDQA 2IXFA 4FGJA 1Y3CE 4Y2RA 2VH1A 1CJVC 4U2DA 2GXSA 2QTZA 3T54A 2YOFA 4FYXA 1QCDA 2H0AA 3BFVA 1NVVR 3LD9A 4N03A 1F0KA 3UWMA 2XYVA 1ZU4A 4IR7A 3MWFA 5B58T 3TOXA 5BR8B 1LU9A 2HCBA 4KX3A 4OXYA 3MPOA 4R4JA 1QHEA 5JVDB 3FPGA 3N6RA 4F1JA 2D1QA 3CR3C 1TLLA 1M6EX 3GEEA 3WLOA 1L7RA 7YASA 1HE3A 1CEEA 4CODB 5B57C 4PC2A 1G9XA 1OYVA 3NT4A 1A9TA 5U1PA 2XDWA 1V16B 3CZ9A 4DDWA 5B4UA 2G1JA 4B82A 4LF4B 2WD9A 1VJDA 2RGEA 3KCQA 1BQEA 2BWJA 2P9CA 3QQ5A 4W9RA 4EHFA 2OZPA 3UAOA 4DWOA 3NT5A 3DYVA 3EBOA 5AH0A 2VP9A 4UAUA 1OGYA 4NDZA 5K8CA 1SUWA 2I9KA 5TIIA 1W36C 3W6ZA 4PVCA 2OB1A 2R0QC 2IS6A 2RMKA 1MVLA 1M2NA 3CNNA 4LZJA 1FYDA 4HZUB 1GPLA 4G0OA 3BICA 4WCVA 3RSGA 4XQ0A 4E4TA 1AB5A 1Y5MA 4BWYA 2B2CA 2W2TA 4IDFA 4G8BA 2CSXA 3DUWA 3KEFA 1EMDA 1EUDA 3DLTA 2ZSKA 4J16C 1QYCA 2JLBA 3WNDA 3WV4A 1P8AA 3FVVA 3ZHTA 1JFLA 5JI2E 3K9HA 1GPNA 4C0QC 3MRSA 4JWTA 1GTSA 1J5PA 1CRLA 1I3CA 1SKMA 1TYBE 2ORYA 2ZG6A 3OUZA 4KAAA 3PGMA 5TGZA 1FYVA 1PBNA 1W5AA 1VJ0A 3GJ4A 4PX2A 1AKQA 3RVRA 2C7OA 4RMNA 1K88A 1LUAA 1Y3FE 3GFGA 3HCNA 1X77A 2H4HA 4WNIA 1DUVG 3AYZB 4LBVA 3ZGOA 4A2PA 2QRKA 1W34A 1KJQA 4O5OA 2FPIB 2CLCX 4OBWA 3D0OA 4XTRA 5K8IA 2H9AA 3ZJVA 4EG8A 1M0TA 4JLKA 1YNOA 1Y9JA 2BKAA 4L0QA 2QE7A 4O2BF 5JNVA 2A5GA 2UYYA 4RKYA 2QRNA 4BWVA 2BUAA 2XDYA 1ZKDA 4RE5A 1R8SA 3UZUA 3IXQA 9MHTA 1H3NA 1BXGA 1MEJA 1GGVA 2K7FA 2X7HA 4AC9A 5B3JC 3K1YA 1V1RB 3DDUA 3OJ0A 3OPVA 1JJAA 1DKMA 3EOBI 5AJHA 1TJPB 3GFVA 1R37A 3ITNA 3LPAA 1BYIA 2X3UA 3FKQA 4EB6A 3TVTA 1NRJB 4BMZA 1GPDG 2RGBA 2WU0A 5THQA 3EZGA 1NJGA 4P7JA 3DVRX 1DIRA 2I3DA 1IFXA 1TKCA 2IPOA 4M7RA 1UAGA 1XJ0A 5AVWA 3DCNA 1WPRA 2FUEA 4CHGA 2BFCA 1SCUA 2EX1A 2WU1A 1XLTA 1N6RA 3E2IA 2JI6A 3MM4A 4IDHA 1WDKA 2G8NA 3GG9A 2KW5A 4NG5A 1LH0A 1B26A 4AG5A 4O5AA 3IDFA 5HKBA 3HPRA 1LK5A 4X5OA 1XDZA 3R3HA 5CCXA 1IEWA 3KVRA 4JT2A 1J20A 5KINB 1QF9A 3JRNA 5IPFA 2JLZA 3N5CA 3IR5A 1WB9A 2FR1A 1YVDA 3K6SA 1V9CA 2ZK7A 1KAGA 3QLEA 5FTJA 3ZR4B 4C76A 3TOVA 3LY5A 4CTOA 3KUUA 4KYUA 2BHRA 5F4BA 3ND7A 5FA6A 3NBKA 2I4TA 1JKJB 1Y82A 2BBWA 2Q3FA 1FDTA 3LPLA 4UBIA 5LD2C 1UXHA 1K7XB 2IKSA 4M60A 5DBFA 4UE6A 2V9PA 2BR5A 1D4ZA 4RA6A 3H2IA 2FZEA 4UNPA 1ZAKA 2CJYA 4U2CA 2EJVA 5CDSA 2QBYB 3I8XA 1JHXA 4M87A 2ZS9A 3KEGA 4XDYA 5EPUA 1JVBA 1VJCA 1XL1A 2XVMA 4M38A 4MTCA 1YRLA 2VP4A 4NTZA 1I1NA 1M1XB 1PYGA 4FKZA 3FR8A 4BN0A 1B41A 3VRHA 4K3UA 3VOBA 3HI4A 1T6NA 1WDWB 2BUCA 4NCXA 4RJKA 4C04A 3CR7A 3NAZA 4G26A 4QL3A 3QEOA 4BMNA 1RYYA 3EWNA 3IVAA 2HLNA 3M83A 3BAZA 3F49S 1HA3A 2F48A 2C00A 4G2TA 4ZYWA 3ED1A 1OVMA 1NYRA 2ZRGA 3UK2A 4DQKA 2VZLA 3S2IA 3P2JA 1Q44A 2FQQA 3RYFA 5C51B 3SLKA 3PD7A 1A9XB 3BL5A 3LT4A 5AW6A 2P8JA 2V59A 3PUIA 1MN6A 4GLLA 4X24A 5D1HA 4ZOCA 4K9SA 2IW1A 3HU5A 3ZK7A 1E1QD 1ONPA 5DHPA 2ORED 1BJRE 3X3HA 2I03A 4EATA 3K0HA 1WXIA 3I2YX 5KSOA 3DVAB 1LZLA 2MU1A 4H0NA 1C9DB 3SZGA 5AHWA 1M10A 1XD2B 1O2DA 3IAAA 4R2HA 3D7KA 4KQ9A 1YRBA 3LL7A 4CBVA 2ZI9A 4QD3A 2AE2A 2DFPA 1P45A 2BMFA 1TOAA 5EXPA 3BE5A 2YMMA 2DSNA 4DANA 1F8GA 5B3KA 5K5EA 1E9AA 1L4NA 1WZ2A 3EF0A 1NN1A 1GXSA 1RJEA 2FR8C 5I7AA 4MI6A 2FZ4A 4V0NA 3FMOB 5H81A 2OAEA 1DMRA 3KHSA 2PFGA 5FIUA 4MIYA 3E61A 4ZZ1A 4YCDA 2WJ3A 3KXDA 5HCUA 1MVOA 2GSWA 1BU5A 1WPXA 3JWPA 4QARA 1LQTA 4XOIA 1MABB 1T0JB 2BGJA 3S1SA 1G63A 1HX7A 4YRMA 2BEVA 3KZ1E 3UFBA 3ULKA 1ID8A 4YMIA 4PYNA 3HRKA 1JDUA 4Z9FA 1Z47A 1OH6A 1U3CA 1UKYA 1QRTA 3HACA 3FRJA 2OA0A 2FF5A 4GD3Q 1C0EA 2PSHA 2OFXA 3Q88A 3T9AA 4I9FA 1IPHA 2UVDA 1KVQA 4OGWA 2UUBB 4MRRA 2VAWA 3HKBA 3N76A 2Q1XA 3F8SA 3IA7A 3CEHA 5CIQA 4B6GA 3MWLA 3B1XA 5JEEA 1H2WA 1SUSA 3CH4B 3L18A 1ZOIA 2HKIA 1M2GA 3QJYA 2PPVA 3C5WP 4N01A 1JR3D 3MS7A 5EGSA 2WMYA 3U37A 2CLEB 4TTTS 3HWX1 4EGCB 3DD1A 3I3SR 4QSHA 3PPWA 4V2IA 3LFHA 4Z9BA 2O8EA 4LHWA 3ZBQA 2AE1A 2FEMA 2OFOA 2YXLA 2OAQ1 1OAOC 1PNVA 2YV4A 1U0LA 3ZV6A 2QX9A 4BQSA 1Q1ZA 2K2QB 4OHUA 3MRTA 3T1VA 3W2FA 4AMUA 3U7FB 4C4YA 2CWWA 4WKCA 1KYTA 1XA3A 1UM8A 3CRNA 3ZDCA 1JDVA 4PFJA 4LI3X 3RWMB 5CB8A 1ES9A 2C9ZA 3IEIA 4D4KA 4QYIA 1Z62A 3EH1A 4FFLA 1F9AA 3CVYA 5ECYA 1XQXA 2J08A 3CLTD 1SVSA 2NSJA 2P9JA 3LF1A 5AVZA 4LYYA 3B9BA 2JRLA 4KEAA 4HD8A 5DMHA 2BT4A 4NHOA 1B15A 1K86A 3VYWA 3CSDA 4DC0A 4O2RA 1I94B 1FBTA 3VZBA 4S05A 2WIKA 3OIVA 4F9FA 2ZJYA 1SOAA 1KJZA 3R3JA 3TLXA 3NFYA 2TYSB 5KTTA 4RD0A 8ADHA 1EUCA 3G2MA 1RVV1 3FTDA 4Q3KA 3BGWA 1SQFA 3MYRA 2I1VB 3ZWAA 4GI1A 1K7SN 2Q3CA 2C1EA 1ZIYA 2QXYA 1XZGA 2B1IA 3GPDG 1ADYA 5K3CA 4OBEA 2BP7A 5K6TA 1MG0A 1I1OA 1XTUA 5FFMA 1DC4A 1I6LA 5C35A 1YL6A 2AV6A 2CNLA 2H16A 5T4BA 3PUJA 3SQNA 3WKDA 4E1BA 3EIUA 5A62A 1T8TA 4ER3A 4DEXA 4HUJA 3IQHX 2JLVA 1X39A 5JZMA 4ZT6A 4AQ7A 4GVLA 2AJTA 3FE2A 1JKIA 3U44B 3AJ8A 3TJMA 4EPWA 4B3DA 4U6NA 1BRTA 3SQDA 2GTPA 3S6JA 1KU6A 3P9IA 2ODWA 2JI4A 2IHTA 4KU4A 3NMUF 4N3BA 2CDCA 1FTQA 1SVLA 2XVZA 3KYCB 3V2UA 1X8KA 4EX7A 1MDFA 1YS1X 1U0GA 5FTNA 3V5NA 3VHRA 4BKMA 4HXGA 2Q5EA 3CCFA 3KKPA 1KYZA 4M0EA 3SFVA 2W2OA 3CLUD 3SKXA 2A5DA 3U1VA 1RRVA 5BURA 1JI3A 1WKCA 4YQYA 1UMCB 1G20E 3OT1B 3AVYA 4ZA2A 3HYCA 2JFVA 3P97A 1YFJA 3AHGA 3USCS 3S40A 4NV3A 4XIGS 4C1BA 4PN7A 3F73A 5TVKA 1XCLA 2YHSA 2G5GX 7ADHA 3BJEA 5J40A 1R0BA 1CZHA 2ID8A 4LWPA 3MCZA 3QEKA 2VDVE 3HGTA 4A2QA 1J1ZA 5AKGA 5KX5F 1UDXA 1PL0A 2AZMA 3E6AA 2ZAOA 3FUTA 1FP4B 2AZTA 3BC1A 3N8NA 4ZVUA 2ALJA 4LSZA 2I2DA 3DZHA 4CHTA 1BWSA 2V98A 4JKYA 5I9LA 1KBQA 5C7OO 3GLTA 3AF4A 3VAAA 4N0DA 1R0CA 1NZDA 1OI7A 1IZYA 4JI6B 1O1YA 1RWKA 1WWKA 3A1SA 3MAJA 1ORRA 2JI8A 3FCAA 4HJRA 3N1UA 1IHOA 4YS6A 4HTFA 5FF9A 2V0NA 2HXGA 3CJQA 3FFTA 3RVLA 1PKXA 4LI0A 1TKAA 1E9VA 1KXZA 2QUAA 3DMHA 1G1MA 1T5IA 2QM7A 3PXEA 2ZYWX 4MYDA 1W5SA 2W8BB 3G0GA 5LU9A 4DLNA 3FA2A 3B5IA 4LMAA 1XHFA 3WJ1A 5CFMA 3IFSA 1QQTA 1DC3A 4IXMA 2QRVB 4JJAA 1F7VA 2YIMA 2ZJBA 2FFRA 1PVOA 1JLKA 2XF2A 2RGDA 3GJ3A 1BMQA 1VL5A 4YRFA 2R85A 3FCSB 1VMEA 3LY8A 1RJDA 2ODPA 1DRKA 1IXKA 4QVGA 5L4NA 2VUUA 5I7VA 1YH3A 4Z0NA 1GAEO 5CAEB 3VNVA 1XD9A 4GPEA 4NZNA 2JLAA 1JLRA 3OQ6A 2RONA 3JARB 3OCCA 1I1QB 1U2EA 2Z2JA 1QWOA 4YASA 5JQGB 2E37A 3WQRA 4Z3OA 1HLPA 2YWJA 2WKRA 3FMVA 3QG5A 4HATA 2WPDA 5A9RA 4OXIA 4UNRA 1JHYA 3W1WA 4GP6A 1KF0A 4JLNA 5ALSA 1X1EA 3KKLA 3RVNA 1YSCA 5LYJA 3IQFA 1OIVA 4ZAVA 5K45A 5I8PA 1JB1A 2W2KB 4LV6A 3T4EA 4I5FA 3S1AA 2GZ2A 4FHEA 1SZPA 4HFRA 4EITA 4YUAA 3AU8A 1EKXA 5I7OA 4P6VF 2NAPA 3Q6IA 4IG9A 3T7KA 4Q18A 4WY5A 1APBA 2B2XA 4QRHA 1NUPA 4FCTA 3DGFC 1SXPA 1II8B 4BVKA 5KYWB 3LHDA 3EIQA 4PPFA 4QG3A 1KI9A 3WLKX 2VJKA 1NKVA 1C81A 1TKBA 1U98A 2PMCA 4LGCA 4M8LA 1W7AA 1FMFA 3UB3A 3QBVA 3AI7A 3DBLB 4RHXA 3OZTA 3EC1A 3BVPA 3UTCA 1GFWA 2BIFA 4B87A 1G4HA 4YRTA 5GIPE 2YRFA 2I7XA 1BVHA 3BJIC 4YIKA 5DCLA 1PJLA 4QRIA 1Z15A 1GG9A 3GFQA 3F96A 3BDIA 1GTJ1 1R16A 3HJHA 4GVPA 2E4YA 4J4TA 4LISA 3UAGA 4BNTA 2YN0A 4OMCA 3Q6MA 4CV2A 2XCQA 4OJQA 3WQHA 4UFPA 4UFOA 5DBHX 3GF4A 1OHHA 1NMQA 3BK2A 4OATA 5JAHA 2K4MA 4W8GA 5KAPA 4EI2A 1SCNE 2IUSA 2X5XA 2YS7A 4BDTA 4YCMA 4KMRA 1IY9A 3DE4X 4QUIA 1QHNA 1PIWA 4M2LA 4AIIA 1AQNA 2FUKA 3FD8A 4UHDA 3DPUA 4DB4A 3PEEA 1XN1A 1H23A 2B20A 4U3JA 4B80A 5FPKA 4WW0A 1XBTA 4J3FA 3SE0A 3WAKA 1CUGA 3GVXA 2AN1A 4QU5A 4C21A 3GGJA 2GNPA 1O57A 1Y6ZA 4AWBA 1GM5A 4BX0A 4Z6KA 1ESDA 1VC2A 2FVYA 1LC0A 3RWOA 5K6RA 4C08A 5AMXA 2OCPA 2NGRA 4UE3S 5EZYB 3ME5A 4IVRA 3PFWO 4K3VA 3OKAA 3DDOA 1OWNA 3CUWA 1L5MA 1YTUA 3PF8A 4WZAA 4A6DA 2IYNA 2ZAMA 2PX3A 1DC5A 4ABYA 1VHDA 1LPOA 3LH5A 1RHJA 3L0YA 1UXKA 2B7LA 5IK2D 2ATEA 4BZXA 3P1JA 4QOEA 4EJ2A 2QQFA 4DCPA 3AVWA 2ES4A 5B37A 1UXOA 2WLSA 2ON6A 4TTSA 1L5OA 4I9HA 4D44A 3QUQA 1EUDB 1NU8A 1PFYA 1AN9A 1VJ1A 1XAHA 2BEJA 2PAFA 2W43A 1DJLA 2BYTA 2GBPA 4UAVA 3IT1A 1YCGA 4WXPA 3RWBA 5K3OA 2LKCA 4M99A 2C2YA 2ZYTX 3C41J 3Q8LA 1M33A 2YVUA 2EZ4A 3WSWA 1GPUA 4BKPA 3ZE8A 2ODBA 4EI9A 2LCFA 1JEQA 3II6X 3NBZC 3SVZA 4G0VA 2JH8A 4AW9A 2QN9A 3Q4GA 1V5GA 4M7OA 2VKQA 1LA2A 4GPTA 4QPZA 3ROZA 3W3AD 3PJDA 4ENSA 3OM8A 4M88A 2F3QA 1D3AA 4HNVA 1MT0A 4BGVA 5GM2A 2WWYA 2G1AA 1X7HA 3R6DA 1L4EA 5JWHA 1DJPA 2IY9A 1QKIA 1U63A 3RS0A 3VSAA 1BXGB 1ETHA 3U3OA 2RJ3A 4OP2A 2OHVA 1FNDA 2OBYA 1RZRD 2PVCA 3KDSE 2WZDA 3WDMA 3RTBA 4BB6A 1RQ2A 4EUEA 1JT9A 1JS1X 2QB5A 2WYVA 3K70B 3IEUA 4RXUA 1VSVA 4FW9A 3TRIA 4EB6B 1XA0A 3M82A 3ZH2A 2HADA 2R6R1 2ZYUX 3KZXA 4WEQA 1G5PA 2K87A 4N39A 5EKTA 5DJ5A 3P9KA 4A2WA 1TK9A 5EE5B 5BSTA 5IFLA 4ML3A 1OJLA 3RSOA 3VZCA 3QPBA 4E5PA 5JUWA 5CNKA 2BFCB 4C87A 5BRJA 1TVMA 2CL0X 3X1DA 3D5TA 2V03A 4YJ3F 2Q27A 1X74A 3HZZA 1BKDR 2E4AA 3O4FA 4R3UC 4TRNA 4JI8B 1R8XA 1AA9A 2HO4A 1JEEA 1S4MA 2QI9C 2OYCA 3R8FA 3F4BA 2ZDGA 1P61B 3C7AA 3TAXA 3SIPA 2H0RA 1TJYA 2PNJA 4RIEA 3TAHA 3WJ2A 3K6SB 1LQUA 4FR2A 3K6KA 1ZN7A 2AWNA 2CBGA 2YJNA 4MJLA 1XV5A 4U7HA 5J2UA 1R0SA 1EVYA 1ZM3A 1FS5A 3BTOA 4GI3A 3U3KA 3OSZA 5J4LA 2WZCA 3NWPA 2DQSA 2FSGA 4UVDA 2RKWA 4TKMA 1ATZA 4MVJM 1YDHA 1FU7A 3Q7SA 4DF3A 5ICGA 4KQCA 2FLWA 3LV8A 4XSHA 2C83A 3QKRA 4DMKA 4WT7A 3WMXA 1DU4A 1YT5A 4DC1A 5I47A 2WWVD 2QRPA 2C99A 4YMVA 1I4OA 2HRQA 2FEOA 3LKVA 4J6EA 4JQCA 4AN1A 2VXBA 3P4UA 4CRWB 3KAKA 5HBGA 3GRVA 1FUYB 4L0MA 3EDRA 2PRJA 3OM9A 4DDUA 1QH8B 1MGOA 1RYMA 3OY7A 3V46A 1ZUWA 1CNMA 1GKKA 2B92A 4HNRA 1ENPA 1HFJA 4R8MA 1TC2A 1ISRA 5L9AA 2VUIB 2OYSA 3OF3A 1NJ5A 1PTJA 1RKQA 2WYUA 4WUVA 4DMGA 1QWSA 4EHJA 4ND2A 3AIOA 3JX9A 1ORHA 4TM8A 2V4UA 2ZXEA 421PA 3I09A 5IW8A 4AF8A 1BWQA 3HM9A 3RYFB 1SZDA 3PLAE 1WCYA 2OD7A 1KOLA 5A1TA 4Z3KA 1TCAA 4TS3A 3HVUA 4CG2A 4OJNA 2AW5A 2IEZA 5KOJA 1DPFA 1XMVA 4D5EA 1VDZA 3HKEB 2G83A 1UBLS 3LC1O 4RLHA 1FDRA 5LP6C 1SH7A 2IFTA 3N2GA 1CU1A 1RD4A 3H17A 5IARA 3HYNA 4WN9A 1EFPB 3AI2A 4OHFA 4MVJE 1A8PA 3MMPA 1IOVA 3PGA1 4HWKA 2ZIFA 3GDOA 3C1AA 1XHEA 1RRPA 3ODGA 4N40A 4ZHSA 3D1VA 4PEVA 2AG1A 2XMDA 4ZCQA 3RODA 1GXSB 4EHBA 2R8OA 4BLRA 1C80A 1O95D 3QPVA 4DADA 2CFTA 2H1RA 2Q9CA 1G8KA 5KU7A 1Y9ZA 1OZFA 3HB7A 1ILWA 1ECJA 3KWFA 3HCDA 1RIFA 4MARA 4CDMA 1RC0A 4CR7A 4KIUA 3CZ5A 5CDUA 3ICEA 1DTSA 4YMWA 1XTVA 2FW9A 5FL7D 3JWIA 4GMDA 3T8YA 3EG5A 3UJPA 1OV4A 1JHOA 2BELA 2XV1A 5AKLA 3O1HB 3UWKA 2DBRA 1IG0A 1JSXA 1J97A 3JSAA 4QGAA 4WACA 2V6MA 5FQOA 4FB5A 1ULSA 1XCOA 2D6FA 3FJ1A 1C9NA 2QSZA 5CU7A 4J7UA 2XI4A 3C6ZA 5BT8A 3HRHA 3UW1A 1JAHA 3D2LA 4N41A 2RGGA 4PS1A 3H5RA 4YAJA 2P68A 2ABWA 4PGMA 2ZJ4A 3PGKA 1UCFA 3HKBB 4S2UA 5CEFA 1FE8A 1ULHA 2DCUA 2FG5A 4HMOA 4NYJQ 3GLRA 4MWSA 3SSMA 4RTQA 3J80A 5AHRA 2LTAA 3I2JA 3TQIA 1ISHA 2DMRA 3ZCSA 3N7TA 2IX9A 5AVSA 3IAXA 4A16A 1T5SA 5CHYA 2AEEA 3O6VA 4IQ0A 5F51A 5IAJA 3C8ZA 1N77A 4OA8A 3OWXA 3SE7A 1UKEA 3BB1A 5G2OA 3HWRA 1T3HA 1V3UA 2EATA 4HAUA 3QYFA 3RQSA 1NF2A 3KPJA 2XEDA 5A02A 1RS0A 1NNSA 3FF4A 2V3CC 3WYAA 1YB1A 5C80A 2R5FA 4Q47A 2H8GA 2BBTA 3V7UA 4C2UA 3A1CA 1G7RA 3IUSA 3QMVA 4LRWA 1F6BA 3DH0A 3T9DA 3PGJA 3PE6A 2W4QA 2V54A 4QYIB 4F4CA 5A04A 4PHFA 2VPQA 4YB8A 3GDHA 4NFLA 3BRWA 4MV6A 2DH6A 2V4ZA 1OBCA 3LC2O 4UHEA 2X0FA 4P7FA 1EX1A 3AXTA 3KDAA 3TXYA 1P6QA 1RM4A 3QU5A 1VE5A 3MT0A 5TS3A 1PR4A 2HA7A 4IEFB 3H8WA 3I9V6 2RI6A 2W2XA 3L7IA 3HBNA 5F2NA 3FPKA 4D0LB 1P1KA 2GHRA 2AS0A 3A3KA 1TMOA 3KIPA 1I0LA 4C88A 1GPKA 2FOXA 3UXEA 2ZVQX 3H2GA 1I5OA 1NJ8A 3HZOA 1LI7A 2Y1KA 5ICSA 1Y3IA 1ZITA 1OYYA 1Z56C 2D0DA 3N53A 3O2SB 5ILQA 1TM5E 3OCWA 4CCYA 3HK2A 4O08A 1LPSA 1GGHA 2RGWA 1OYOA 2OYRA 2BP7B 1IXRC 1NVTA 3IKTA 3DGEC 1TI7A 3I42A 3TGPA 1MJNA 3K2BA 1OLOA 4JL5A 2CDNA 2MMGA 4Y2HA 3O3MB 2QQ0A 2JIRA 4F2PA 3AB3A 1DOZA 4TXJA 3DTVB 3L43A 3NWOA 2EJUA 1FDOA 1PBTA 3DMTA 1RPAA 5E4TA 4QDKA 1E3JA 4LZNA 2ZEJA 4XIYA 2O6LA 3V4LA 4HXYA 4BX2A 2JFNA 1ENOA 4D2IA 2WD7A 3VU3A 1MW8X 3AFOA 4B44A 4UCXA 4E51A 5JROA 4MQEA 4G5QA 4TMVA 4D8VA 4DIFA 4MYTA 3O94A 4U0KA 3FHCB 1WE2A 1QOZA 1TB4A 5I7UA 3UMJA 1QU3A 2VPPA 1UJNA 3JTMA 4R68A 1LLFA 4QQNA 2RHHA 4YQEA 3H05A 3LQRA 1FYEA 4HLCA 2WSIA 3ABIA 4ZTUB 1HDGO 3PF9A 1ZJJA 5AI6A 5C37A 1SVMA 4BO7A 4G01B 1LDEA 1AGNA 1TF7A 4W5RA 2VAPA 4X65B 5L95A 1GRRA 4MQLA 2HJWA 1BGWA 3BMNA 1GVHA 1E66A 1FFDA 1YA8A 3FCYA 1EQUA 3GRAA 2EJCA 3ZU6A 2VOJA 1R6BX 1SPXA 4H7KA 2OCIA 1ZRSA 2Q5IA 2V97A 4HGRA 5D6OA 3ZV5A 1AKTA 4BQQA 2B6NA 3HA5A 5HIIA 3ZDAA 2EWWA 4EHLA 2CHEA 2YL2A 3HY6A 3HCBA 1MCZA 5FYQA 4Y2TA 3DAHA 1YBAA 2QLNA 3IAFA 4YP5A 5C8VA 2HSJA 1WW2A 4LTMA 2OWDA 2B37A 2R4TA 1L4GA 5JY1A 4I7EA 3TJZA 2QZZA 2WB4A 5IYZF 1L5FA 2WIDA 3VSCA 5FBHA 3JQAA 1SIOA 4HTFB 3TCKA 4PHHA 2AG5A 4AYWA 2CXPA 4HGZA 2CVQA 3GLUA 4MXDA 3GRCA 4MVJH 2W6ID 2O1SA 2C4MA 2VWQA 4O2AF 4RELA 1WQ4A 1LNQA 2ZIVB 3QBDA 2H5JA 5F3RA 3UK6A 4B9AA 2ZYVX 4ZAGA 4LY9A 1IC6A 2VDQB 1T8WA 2XMGA 1X7XB 3O03A 5IX8A 2BZ1A 4Z99A 2QZSA 1ZH4A 5CT6A 2BBOA 2GAIA 3CKYA 3VSDA 4BO2A 2BEKA 5IAAA 4FINA 1FJ2A 3OZSA 3AXSA 1VCMA 3ZY2A 2NYRA 3GGSA 1KKLA 2P1DA 3ZD8A 3IOMA 2C2ZA 2YYAA 3LW7A 5ALJA 1P62B 2PLWA 4BQFA 4EW1A 3W2HA 2W37A 3CF6R 5KHOC 4JEHA 2BH2A 2JNWA 1PJRA 1A2QA 4MKXA 3GT0A 2VF4X 4K88A 5BQPA 2NPFA 4H1TA 1SXJD 3QE3A 4Q1CA 3R24A 4FI3C 4CVNA 4WECA 5FTMA 1M8KA 1G8YA 2EG9A 3HDHA 3QUAA 5LYJB 1IM8A 3V8BA 2P65A 3IUEA 3S1AB 4BUZA 2ZUVA 3G7UA 4I81A 3IPCA 3AHCA 1YOVA 1R6XA 2EF0A 4QG7A 1Y5NA 3U3JA 1E7WA 2EKBA 4RWZA 1P33A 5MGBA 4M1WA 3UKDA 2YDXA 3RGGA 1XPOA 3AYXB 3IMKA 2XRFA 2XODA 1B2LA 1VXOA 4FOSA 1DE0A 1P2VA 2RIRA 1RRCA 4JI7B 2AWOA 2HDWA 4BNDA 3FTFA 2PS0A 2F62A 1M54A 1LK0A 4JHLA 1BVUA 3DVSX 3T1YB 2VPXA 3MAGA 1ZRNA 4Q66C 1C50A 1QRDA 4HGNA 4R2LA 5LXTF 1PL6A 3T3DA 3UAZA 5BOSA 1OH5A 4C0KA 2E5WA 5CGZA 4J76A 4Q1DA 1PL8A 4QO7A 4P0QB 3JW8A 3D31A 1KZ7B 3D8TA 4CTKA 4CJXA 5AHXA 3EMDA 4AWAA 1K7CA 3T3EA 5KYTA 2O1WA 3N5KA 4WEOA 1XOIA 4EOGA 2XTMA 3H83A 1MIHA 4HWSA 1B6TA 3WC4A 2H9IA 1NXWA 2NO0A 1CZNA 3KOYA 3NTVA 2RARA 1R4AA 4UOEA 2AJCA 1E3LA 4DV3B 2CK3D 1ZN2A 3D6UA 2PKEA 1T2FA 4ZEVA 3PQ5A 1GILA 2P79A 3BXFA 4MGEA 4W5WA 5TJ9A 2UZAA 3TLGA 5HZGA 3W6UA 1G98A 3C3XA 4UHJA 4ZQGA 1KK3A 3K71B 2WP0A 1YK1A 2WYWA 5DLPA 3F7OA 1BYUA 3X0DA 3D8HA 1E1RA 2EIXA 2GUGA 2G6BA 4U3JB 3WYBA 1K8XB 4KUHA 3X1MA 4BZZA 4WJZA 4AQDA 5HTOA 1DQNA 2XLCA 1COWA 1GTMA 4UQPA 2W9XA 1IRIA 2YNMA 4H1WA 1G21A 1M76A 1QR6A 3TFWA 4AJOA 3DOIA 2ZQZA 4KIFA 1N33B 4A4DA 1OYWA 1Q15A 4EX6A 5D3QA 1KI6A 2Z09A 4WZAB 5BVGB 1NLYA 1QV7A</