4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
2A5FA 4IKEA 3T1VA 4A8JC 3WMEA 5J4YA 4B32A 1YZUA 2BIFA 2X19A 5L3VA 4CEHA 1ZC4A 2UKDA 4JLVA 5AJXA 3C8UA 1R10A 4Q4JB 3TRFA 4PC7A 4MYTA 2FOLA 2HLDA 2ZREA 4MRSA 3DMNA 1LY1A 3LX5A 1H8HA 2PX0A 5DIFA 1OXUA 2FX3A 2GJSA 3KUDA 5AJZA 5ELXA 1OXXK 2W2XA 3GJ4A 3EWSA 2Z5FA 1CR4A 3LO5A 4CEIB 1L4YA 1W5TA 1EESA 1ZM9A 1CF4A 5F9FA 3TLXA 3K0AA 3QKUA 3KXKA 2RGAA 4M1WA 3ZDQA 1Q3HA 4G5QA 2RGEA 2R9VA 5ANRB 1KJYA 2Z43A 3NDBB 3HU3A 1E2GA 4IVRA 3ADKA 2NG1A 3BERA 4HB2A 3FFBA 1D9ZA 4U5XA 1TQDA 3A4LA 1G3MA 4Q9IA 5BWMA 1W0KA 2J0QA 1LW7A 4JZKA 1F48A 1IJFA 2OFXA 2Z6VA 3CWZA 1RW4A 4TMWA 3OF5A 4Q9LA 1IXRC 2V7QA 1FPMA 3THYA 2GK6A 3KX2A 2AD5A 2VHUA 4MRRA 4V03A 4A8JB 4QM6A 1OYWA 2ZU0C 3AF3A 1IY0A 4YXWD 2Q9BA 3UATA 5DYGA 1M7GA 3KQNA 4QOSA 1SVLA 4PX9A 2YC2C 4RFVA 5CK4A 4PSAA 3GLGA 1FX0A 1AGRA 2ZRHA 3CF2A 1N6PA 2ZRCA 3O8CA 4RD2A 2ASEA 2OEPA 3SFZA 1IN6A 3KTAA 5L8VA 3SE0A 1A1VA 5AUOB 4GZLA 5FR2A 3EAQA 3GEHA 4LOAA 4QNRA 4Z1MA 2H17A 3P26A 3ZH9B 4PHHA 5B58C 3RSLA 2OLKA 2FPKA 3ASZA 3R7WB 5D3MA 3TSWA 2F1IA 3VR4A 2YWHA 4OKSA 1VCMA 2VF7A 4LY6A 4JLBA 1JXMA 2EU8A 2OUKA 1VHTA 721PA 4LBZA 1QHIA 4YQFA 1P60A 1AGPA 4JL6A 4A6PA 5J47A 3TGPA 3MMPA 4XWOA 4NTZA 1E1QD 4B3FX 1FZQA 1Z83A 5FBLB 2O0KA 4CVNA 2R62A 2XTZA 4KO8A 4UXHA 2GXUA 3NHBA 5GJBA 2X2FA 3SBDA 2CNWD 1R5OA 2W00A 3CX6A 4HDQB 4QJ5A 4YMTA 3ZD6A 1G7CA 4TSFA 2JJ1D 2MMCA 4V0LA 2VSOA 2FU5C 3IBYA 5DGXA 4LJAA 3TUJC 3GLGE 5LD2C 4BLOA 2VA8A 3VKWA 1QHXA 1DARA 3KXIA 4Q18A 2F55A 2WAXA 3VQTA 5J4KA 1W4AA 1OFUX 2BMEA 4IFEA 3PQCA 1PLKA 3U44B 1OH8A 1RPZA 3CKLA 4RD4A 2WJGA 3TJZA 2MSCB 1HQCA 3B1ZA 2HUPA 3VMFA 4R71A 5E4FA 3H4MA 4M2LA 5KO2A 2XNDD 3O8RA 5EZ5A 1ODFA 2NOAA 4LGMA 4WZ6A 2WWWA 4CT5A 4DCNA 5HCIA 1G7RA 1G7TA 1E96A 1SVWA 4G3XA 1HY3A 5DO9A 2NZJA 4US0R 2ZR0A 1CR2A 4Z8XA 5JRZA 2D74A 4RKEA 4IOKA 1GOTA 3MAAC 3EIEA 1UEIA 2P0EA 4IW3B 3TKLA 5JFGA 1CIPA 1DADA 1W4RA 4NU0A 2PLFA 2EYQA 3IDQA 4M1YA 2XJ9A 2IXEA 4LBWA 4DEXA 1XFAA 2WWGA 3BB3A 3B1YA 4NONA 3PUXA 1TL7C 3U7HB 5FH9A 4A4DA 1VG0B 2DY1A 1W4CA 2IWHA 2P67A 1ZUHA 3NH6A 5EE9A 4JVLA 2YC4C 5FTKA 1E0AA 1GNQA 1ZUIA 2F43A 2O0HA 2QU8A 4P4SB 4WXPA 4Q4HA 4HB0A 2FMXA 4B6FA 1BS1A 2QORA 3AGQA 3BK7A 2XXAB 1TTTA 2ZS9A 1NBME 1N6IA 2NTYC 4URUR 521PA 1S1MA 4UNPA 4L16A 3RAPR 1ZP6A 2BOVA 1N0WA 3C14C 3QE0A 1AZTA 1JNYA 1G19A 2F1HA 2JDID 4MKGA 3RS3A 3WP1B 4O2LA 3U3JA 3JZMA 3ICQB 1U81A 2O8EB 1Q1QA 4DXAA 3JZAA 4PPNA 1GRQA 2DFLA 1NKTA 3CPHA 3PIRA 3I8XA 5A5GA 2QQEA 1N0UA 3D8BA 1FFHA 4RZXA 1NF3A 1G5TA 3DOFA 2GZHA 3GJ6A 2CXXA 2IWRA 1NLZA 4BRWA 2PT5A 4DSUA 4DRZA 1E98A 1KKLA 3EXAA 2YOFA 4FCWA 3RS5A 1K5DA 2ZVPX 1RKBA 1X3SA 4I99A 2BJVA 4AYTA 1G17A 2BCGY 4QNMA 4DLXA 2A3RA 3IIMA 2EFCB 3KZ1E 3NEYA 1YZGA 5DYIA 2EFHB 3AP1A 4NDZA 1W2GA 2PL3A 1P9RA 1YZNA 5B2ZA 2BMFA 1LTQA 4E22A 3A1VA 3N5CA 2OG2A 3FE2A 1HYQA 3R9IA 4BQSA 5G41A 1NNEA 1VYTA 4WZAE 2ZRAA 2KWIA 4OQNA 3DHWC 4TTPA 4DSTA 1EK0A 4FW9A 3UWOA 2EFGA 1PLLA 1XX6A 2OCYC 1BYUA 1CP2A 3CR8A 4OI0A 1SVOA 2H57A 3M1IA 4JLJA 1Z28A 4F4IA 2CBZA 3PR1A 3EPKA 2BVNA 4JLPA 4M53A 4B3CA 4BZPA 2XZOA 1E1RA 1JAIA 3K53A 1Z08A 4JT2A 2QAJA 4P0TA 3G5UA 4R2HA 1OKKA 3BD9A 4AC9A 1DEKA 2C9OA 4JBXA 1A4RA 4EJSC 4TN1A 5KHOC 1UDXA 1TEVA 1R0ZA 4DSOA 3TQCA 1F2TB 3P27A 1YKSA 3M0EA 1AS0A 3CBQA 1X86B 1ZVQA 3IHWA 2NO7A 1NKSA 3B1VA 2GXSA 2W6ID 2DWOA 2X2EA 1Z0FA 1UBFA 4JL5A 3VU9A 4DJTA 3G0HA 5HKKD 3U5ZB 2ANCA 1CS4C 2ODWA 4UQOA 3WNDA 3DEFA 3RVBA 5JLJA 2OT3B 1MKYA 1ZU5A 2FFQA 3AKCA 4OK6A 4ACBA 2PZEA 1YU9A 2WKQA 3FMPB 4BFTA 3MD0A 4GBMA 4CF7A 1W47A 2ZRDA 3F3YA 2GAAA 3AVUA 4AY2A 1QHSA 4DB4A 1XTIA 1CJUC 1GNPA 4A0HA 4GP6A 4B3BA 4E09A 3E70C 1KMHA 4L4UA 2HJVA 2ZYVX 4XOIA 3BS4A 1Z0DA 3T5DA 2G6BA 4F91B 1DOAA 2IBMA 4EAQA 2ZJ8A 3LV8A 3IQWA 3VHXA 4NYJR 1L7VC 1LF0A 1G6HA 4EPTA 4EQ6A 2WPDA 2GAOA 2ZUDA 1Z8FA 4JLKA 4XH9B 2O5VA 4K8OA 4NCHA 4LJ7A 2PMKA 2A30A 1MABA 2R6FA 1AA9A 3DVLA 4F93B 5C2JB 4DEYA 3I1FA 2R6AA 2QI9C 2LCFA 2AD1A 4ZI3A 1RRCA 1KI3A 1U98A 2VSXA 2A5JA 3P1JA 2BCJQ 3QPWA 1XXHA 2O52A 4CYMA 5TVKA 5DN6D 4XVRA 1E3MA 1EXMA 2IF0A 4HZUB 3I5YA 3I92A 3HU2A 3GCGA 3AVTA 4G01B 5KPDA 1KY2A 1KKMA 2DFNA 1ZBDA 2HT1A 2FE4A 3B6EA 4P4TA 3RWOA 4DLZA 3I61A 4TYWA 2GEUA 4BWYA 2WJYA 4BEJA 4AKGA 2WJVA 1OT3A 1TPZA 4BLPA 2IYQA 1RRGA 2GZAA 3GLHA 2DCUA 3GLIB 1NP6A 1ZYUA 1T8UA 2R6GA 4QGAA 5HCNA 1QHHB 2REXB 2YWFA 3DPUA 4W5WA 4HLDA 4XVQA 1RJ9B 3SBEA 1QF9A 1K5GA 3T34A 5AJVB 1T5IA 3LBIA 4H1VA 4LI0A 3QBTA 4B73A 4EIWA 1XD9A 2ZJ2A 4JVMA 2CHQA 3W3ZB 5KUTA 4KV9A 1E2EA 1MO3A 3E2IA 3TR5A 1OF1A 4LCBA 1K8RA 4TYQA 5KSOA 1QBKC 1U2RA 1S0UA 2JLVA 1PUJA 3B13B 2IS1A 4FMBB 4GOJA 1P2TA 2RB4A 1A2BA 2OBLA 3UIEA 4JYBA 4MGIR 4DBLC 3EZ6A 3T5GA 3B5JA 3M4YA 1Z0KA 2EYUA 2PEYA 2BDTA 4FMCF 4GNKA 1W4BA 3K0CA 4MRVA 2IYWA 4AG5A 3T35A 4URWR 2V55B 1HE1C 5AWFC 2AK3A 2RGDA 3EW9A 1R0YA 4KITB 4UNRA 5EXSA 2QSZA 5FFMA 4B3DA 4FWIB 2O8BA 3NHAA 1ZW6A 2YZ2A 3QF7A 4NMMA 1YRBA 3GJ8A 2ZYWX 1VG9B 5AJWA 4DDVA 3F5FA 2J0UB 2ZANA 3HR7A 4LYFA 3WXMA 4FN5A 3QKRA 1ZD8A 1ZUNB 2GRJA 3OE7D 5KNBA 4A15A 4DVGA 1SXJA 3NBFA 2AHOA 2IHBA 2YHSA 5TDHA 1UBEA 4PTLA 1PJRA 4BFUA 1CJKC 1EGAA 3P4YA 4WZBE 4GMXA 2Q3MA 5IRCD 1IM2A 2KBEA 3X2SA 1KK1A 5JS7A 3LAWA 3NBXX 2HCJB 1HV8A 2QTHA 1UKVY 2JLXA 2XZPA 1DAGA 4TLDA 4NCJA 5UKDA 5DHAA 2PJZA 4W9MC 5A4JA 2P2LA 1Z0IA 4HLUA 3SC3A 2BMJA 2VF8A 1G3RA 1E69A 4LSGA 2DBYA 3BFKA 2FSHA 5FTJA 4G5GA 1Z6GA 1W0JD 2BWJA 2ZRJA 3I3SR 5SZIA 3U4QB 3AVXA 2ZVQX 1P9NA 3GLFA 2WSSA 1SHZA 2H7VA 1KI6B 1C1YA 2ZM5A 1GL9B 2IK8A 2WVJA 4JYCA 2HXSA 1J99A 2DHRA 3ZIAD 1H65A 4BFXA 1KDOA 3ZYCA 4BLTA 3FPAA 3RABA 3T06B 4BEBA 2Q21A 2BV3A 2HF8A 2KSQA 121PA 1JJ7A 1US8A 3A37A 4NH0A 1SKYB 1R8SA 3I62A 1SXJE 3F8TA 4PPQA 2ZAOA 3I4LA 4TMKA 3SZRA 3GFPA 2ODNA 3BAFA 4BFZA 4C0AC 3EASA 1LV7A 1V5WA 2QAGA 1WA5A 3HPRA 3FWYA 3IKJA 2IYTA 3GPLA 3WNBA 2NQ2C 1VPLA 2XZLA 4OK3A 3AVYA 1Z63A 4KU4A 2CK3A 2WTUA 1IN5A 1P72A 4O2RA 2IUSA 4PC3A 2P6UA 2WJHA 1G5PA 1ZM3A 1R8QA 2XSZD 4DT1B 2NO9A 3FDIA 4R2IA 3GLFE 3L0IB 4JLNA 1NY5A 1BMFA 2XNSA 4C3ZA 4CEHB 4LJ6A 4POAA 5KNCA 1GTVA 4N1AA 1H8ED 2JJ2D 4PZZA 5BN3A 3KFVA 2EWVA 3DZDA 1NRJB 4PC6A 5CB8A 1S2MA 3K9HA 4JSYA 1XNJA 4C9BA 3T1TA 5FPKA 2ORVA 1NL3A 1OIWA 4D81A 2V6JA 1TU3A 2RGNA 1II0A 3UKDA 4BRUA 2VHQA 4EUNA 4BPBA 1KO7A 4CGZA 1EFHA 2OXCA 1OLOA 2WHXA 1N25A 2IX3A 3QJYA 3QKSA 3IPXA 5CJPA 5C1BA 3MWYW 5AJYA 4LYHA 1QG2A 4X8HA 1P4SA 4B71A 3B1XA 1KK3A 2VP2A 2ZRBA 3HPQA 3L0PA 1U8AA 3FHCB 1QDEA 3ND9A 2GEDA 2QE7A 3QEOA 5JWHA 4PQRA 1GIAA 4RZUA 1OXTA 4BUJA 2RHDA 2HJGA 5DI3A 3FGNA 1XD8A 1O3YA 2RGCA 4HAYA 4IOLA 4OQLA 5K8UA 3THYB 3D7MA 2CHVA 3DMDA 3A1UA 2QZ4A 3KJHA 1IJEA 1KSHA 3U3RA 2ZJOA 4DWJA 4G0NA 2B7CA 3EA5A 3QUSA 1KI7A 2PLRA 3WRXC 2A5DA 3GLGB 1FX0B 3O47A 2QENA 3DKPA 2J87A 3KTAB 3WRYC 2IF2A 1ZD1A 1KSFX 1W49A 3OIYA 5FBVB 2BBTA 3TE6A 4C2UA 2GK7A 3SOPA 4MH0R 4TMTA 2OESA 1Z0JA 2EFDB 4LHVA 2CL0X 2ODEA 2F9LA 5E95A 4MUBA 4QJ4A 1DPFA 1ZINA 2FPMA 4DKXA 3IBGA 2C03A 2ZYUX 5D3MB 3VX3A 4TMVA 4WIAA 2FV8A 1KI9A 2VIIA 3K09C 5EE5B 2QP9X 2QMOA 3B60A 1UBGA 3B2EA 4IOMA 3DO6A 1C9KA 4XJXA 3TMKA 4IFBA 1S4QA 5FPSA 1OHHA 3EG5A 3T12A 4ABYA 1NJGA 3THXA 3K9NA 4D80A 4XD7D 2RMKA 3QIAA 5M04A 4QBIA 2QQ0A 1G3UA 2G83A 2O8CA 3RDPA 4RSGA 4GI7A 4WW0A 1P2SA 1O87A 3HP1A 1FQJA 4O3MA 3EX7C 3E1SA 2I3BA 2UZ3A 5EE1A 2F1JA 2GF0A 5BQ5A 3U6KA 1OFIA 2B92A 1OFHA 3ECCA 3OHMA 3GEIA 4M9QA 4FINA 4UNSA 1IN4A 1GP2A 3KQKA 2CE7A 2ODBA 4TL9A 1OB2A 1E9EA 3LNCA 5CYOA 8OHMA 1NG9A 2A78A 4LYAA 3K9LA 2AN9A 3ZS9A 1G8FA 1E2NA 2IYXA 4KFRA 3B78A 3CX8A 4GOKA 5JI2E 2H18A 1FMJA 3IO3A 4FWTA 2WMNB 1XD2A 1TF7A 1OIXA 1ZD9A 4G1UC 4ZO4A 2JCSA 4D0GA 1VG1A 2Q0HA 3HWSA 5HZKA 4DCVA 4HSEA 3Q5DA 2GXAA 1N6HA 1VIAA 4CIDA 3LRPA 1W48A 2ZRIA 2IHYA 3OFNA 1G18A 2J7PA 1GM5A 3T15A 2B7BA 3V4RA 2GCNA 2WWFA 1KMQA 2G1JA 6Q21A 1PV4A 2KI5A 3OEEA 5IK2A 1CJTC 3GD7A 4LDJA 2VBCA 3RLFA 1R6BX 1G3QA 2VP5A 3TW8B 4B43A 1W44A 2H8KA 3GJ3A 4DLTA 1NLFA 2F43B 2GHIA 4NYJQ 5EE0A 4Q4HB 1XDBA 1MH1A 1T3HA 2C9CA 2FWRA 2NO6A 4DIEA 1P2UA 2X77A 1DAFA 2WIAA 3AV0B 3L0SA 4Q48A 3R8CA 1II9A 4IVQA 2QP3A 4QL3A 2JAQA 1KI4A 3FHOA 4Q02A 2DR3A 4MKHA 5GADl 3AH8A 2FSGA 4RFSA 1NMXA 2EFEB 2AFHE 2QSYA 2QY9A 2R65A 421PA 2IYUA 2RHMA 4XWKA 1U9IA 3AGPA 2XAUA 3BRWD 1XTRA 3C5HA 3OAAD 5B30A 1E9AA 5CITA 5JZVA 1LF5A 2BC9A 2G1KA 1YZKA 1MO6A 4M1KA 4ASUA 4AD8A 5KPJA 5LB4A 2ZE8A 3H1TA 1F5NA 1VCIA 5FL7D 1E2HA 5DLQC 1OYYA 1KO5A 4C0JA 1CJMA 2OM2A 2DWPA 4WBSA 1UEJA 3EZ9A 2NGRA 4A2WA 1WDTA 3PUVA 5FUYA 1VMAA 3EIQA 3K0FA 1JR3D 2LKDA 1CR1A 3EIHA 4EPXA 2V3CC 4L8GA 2GJ9A 2CLSA 1ZC3A 3CH5A 2A2ZA 3LVQE 1JQLB 4L15A 4ZKEA 4JS0A 4QBHA 2F3TA 2F1RA 3P32A 1GILA 1DAEA 1ZCBA 1ZCAA 3IEVA 3CRQA 3I72A 4TMZA 2VHTA 4BASA 1D2NA 1N6OA 4G5OA 5C46F 1CXZA 3I5XA 4V0OA 4KCGA 3RRZA 4C2TA 2B6HA 2WMOB 1Z2AA 2PCLA 4LC1A 3MWJA 3T1QA 5BYJA 5F98A 1JEEA 4MGKR 1XMJA 3L82B 1Z6XA 4X8OA 1XBTA 2GCOA 1DVRA 1VCOA 1XTJA 2ZROA 4PFSA 4PO8A 4ITRC 2O0JA 5FUWA 1HT1E 4M1MA 1NBMA 3VU9B 3OEHD 1GSIA 2ZR9A 4O25A 1ZAKA 2JASA 3TVTA 2GJAA 4AYWA 3TUZC 5FOWA 5KSYA 1G3IA 3EC2A 4JBYA 2NPIA 4KVGA 4Q00A 1EFTA 5JCPA 1NG1A 1S3GA 2AR7A 3EARA 4KXFB 1YVDA 4IHQA 3WYGA 1EFRA 1TEXA 2N42A 3PUWA 4Z51A 5G3YA 5CB6A 4IEIA 1KMHB 2QNRA 3CO5A 3P20A 4OBEA 1Z06A 4C0SA 3SJBA 2ZSEA 4N0EA 5JRJA 1KDRA 2NO1A 4TLBA 4D2IA 2E9SA 4N0DA 4ZCMA 3B85A 3P4XA 4GMDA 4EFNA 4EQ6B 4Q4JA 1T91A 2CJWA 2WWXA 3QVUA 4XSGA 1VHLA 4DIDA 2IL1A 3F0TA 3CZPA 1SZPA 2VRWA 4C0HA 3UMRA 3Q72A 3Q9LA 1GITA 1CRQA 1MABB 2ECKA 4WOPA 2P5TB 2VEDA 1PZNA 1UADA 3C7KA 2P6NA 3LWNA 1LNZA 4HEJA 1FL9A 1G1MA 4UJ5A 1VDZA 1DG1G 2WJJA 2VO1A 5SZJA 4A2PA 1NLYA 1SGWA 3DDCA 4DDTA 3LLUA 1XXHB 3DKVA 3AB3A 4PAMA 3VR1A 1CBUA 2IS2A 4ACAA 1A5TA 2Q9AA 3EPJA 2JIZA 3VHLB 1S1CA 2Z4RA 4KLZA 1U94A 5JWRA 1QHYA 2JLQA 3LXXA 3K0CC 1ZNZA 4BLSA 2VYFA 3BB1A 2QRNA 2FZLA 5FBQB 1OXVA 2BBWA 1J8MF 2WWIA 3FKSA 3HU1A 2LWIA 1COWD 2W58A 1KYIA 1P2VA 4DUGD 4Q7MB 2I1VB 5TV2A 5FUXA 4Q9KA 4HAWA 1XCPA 3GLHB 2P6RA 3K8YA 2OBMA 4PAOA 2C9YA 2XOKA 1T4GA 5K8IA 1SXJC 3QG1A 2AWNA 4HAVA 4L5BA 4LHXA 2OAP1 3ONWA 3PENA 2ZI6A 3BXZA 2GJKA 4NYIR 2K5UA 2PH1A 1A82A 1KAGA 4QRHA 4LHYA 3FB4A 1W1WA 2GEVA 3CLVA 4URXR 1IXSB 3NTUA 1LS6A 1DO0A 3SQXA 4X8LA 3QXXA 2Y8EA 4ILEA 1Q1BA 5F3WB 1E4YA 4LC0A 3R7WA 4Q1DA 3BH0A 1S3SA 1J8YF 1NVXQ 3KUCA 3D31A 4RVCA 5EXTA 3NG1A 2FDCA 1YQTA 4HLUC 3X1DA 1P61B 4OQXA 3VX4A 3PVSA 4RD3A 5FBRB 4B3XA 3BIFA 4YMWA 4IDQA 4V0MA 2WAYA 1P62B 2O8BB 2JEOA 1KI2A 4TT3A 4PAQA 4R98A 5DE3A 4X8MA 1ZNWA 4BZXA 1FTNA 4CT4B 1MR3F 2FF7A 2HYDA 2QG6A 3WHLA 5L3QA 4GSYA 1N5IA 5HPYB 2MSEB 1RRFA 3QKRB 4MQBA 1BKDR 2OO7A 2ZTSA 1G291 1SXJB 3PUYA 4NBSA 1YZTA 1XPUA 4W5JA 2XTMA 1D6JA 2QAGC 4KHZA 2W6JA 2WOOA 1UDWA 1WBBA 3X1WA 1CJVC 2YYZA 3QG5A 3T1OA 3VKGA 4A82A 4M0LA 3QOFA 1YHNA 1JR6A 1JJVA 3WNCA 4LRWA 3VTKA 2GILA 1E79A 1T3LA 4TQ9A 2HDNB 4V0KA 1T8TA 3KB2A 4Q47A 4HAZA 2JLZA 1RE0A 2IW3A 1QRAA 1S96A 1RYHA 2ZI5A 3QXJA 1E9FA 2HLDD 4JKIA 3L0OA 4C0LA 1H8HD 2H92A 4KSCA 4YMSA 4A1FA 4RJLA 4V0ME 3GLFB 5BYKA 2QBYA 3BFVA 1CULC 5C4GB 1YZLA 3H0KA 3LY5A 2IUUA 3MJHA 3AKEA 4LHWA 3ZVMA 3REFA 3HYTA 5J4LA 1E9SA 3VR3A 2CCKA 1OH6A 4D0NA 5JEDA 5FOTA 4AIIA 4TL6A 4F38A 4NCIA 3LXRA 1JPNA 2JJ8A 3EWAA 2IT1A 5IHPA 1FNNA 4Y0AA 2B8WA 3H2YA 3J81k 3RHFA 3CB4A 1Q21A 2QGZA 1W0KD 4C7OA 2QAGB 3UG7A 1XMVA 4PR0A 1HA3A 4URZR 1T0JB 1JBKA 5K8TA 3KKOA 1ESNA 1UKYA 2V7QD 3QNUA 4XWAA 4OHZA 4UJ3A 5AUNB 5KSZA 2J7KA 5FTMA 1QHNA 4M22A 4WA7A 5GJWC 4B2IA 5CK5A 2DPXA 2YNMA 4CRWB 4D0LB 1UBCA 2HF9A 3RS2A 3WMGA 4BFSA 4MKFA 2BM1A 3BOSA 5EXXA 2ZAMA 2I4IA 1HUQA 4LWZA 3UANA 4JLMA 1PLJA 1GRRA 4HZIA 2CHGA 2HXYA 2ZRLA 3NVAA 3TSOA 5JEEA 4OK5A 2WKPA 5KYKA 5LDDC 4CW7A 2X8AA 1XCGB 5H1YA 4Z8YA 5AK0A 2UZIR 4Z1MD 1AJEA 1EX6A 4Q4AA 3QXCA 4LJYA 2ZR7A 4EPWA 2QTVB 4TZ0A 2OLJA 5HR5A 1DAKA 2ZI9A 2ZRFA 4TYNA 1TAGA 5EQTA 4OHYA 1GKUB 5H8WA 3AVOA 1F3OA 4GOXA 2P3SA 1FUUA 4B3GA 2GDJA 3U3OA 1TF2A 3OIUA 3V00A 3AKYA 1R2QA 3QQ5A 1D9XA 3QF4A 1W5SA 3FOZA 1E2JA 1XZQA 2QP4A 3CRRA 1E9CA 1P7CA 3QKSB 2PT7A 1D2MA 2G0TA 3EC1A 5DSZA 1KK2A 1AK2A 3K70B 1E0SA 2F6RA 3M6AA 2BBSA 3MG9A 4TSFD 4DLYA 4DLVA 1WBDA 1TMKA 3LW8A 2PCJA 4HYYA 5EP2A 1WP9A 2VP0A 5H68A 3TVDA 4DCUA 3UK6A 1XP8A 1ZIPA 5DI3B 5FOSA 1DE0A 3ZVRA 3C41J 3VNUA 1FP7A 2Z0MA 4JSTA 1F60A 4CZ2A 4E5UA 1DAMA 4LUCA 1VKJA 1NVVR 1JAHA 4F4JA 1LFDB 3K1JA 4B35A 3VFDA 2FN4A 1OFTA 2IXGA 1N6NA 4KI0A 3IPYA 4XTCS 2YJTD 5E7JA 4YXWA 3PJRA 5CDFE 2GKSA 3W3AA 4NP6A 4AI6A 3AF2A 2RH5A 3QPVA 1AS3A 4LBYA 3VR2A 3PXGA 4KAXA 3AP3A 5JHGB 4M1SA 4Q01A 1T9HA 4BFWA 2HEIA 3FMFA 4RY2A 3AVWA 3SS8A 2GJ8A 2VP4A 4C0BA 4D4JA 3KQUA 2ZETA 2WV9A 4E03A 3B7GA 3MSXA 2AX4A 4QBGB 2YWGA 4KFSA 4QG7A 4ZDWA 2BJWA 3WYAA 1BO6A 4ERNA 4TQUS 5GVSA 1E2DA 5FTNA 3S1AA 2TMKA 4FMCB 3W6OA 2AFIE 4BFYA 1AM4D 4LV6A 3THXB 5FPTA 1OH5A 4C30A 3LX8A 4QGFA 1E2KA 1ZNXA 4YDSA 2SHKA 3BH6A 4PPGA 2Q3FA 2YKGA 4IRUB 1E1QA 5IF9A 4EJSA 2ZUBA 4U7DA 3LDAA 2O8CB 3GEEA 1MV5A 2D3WA 4LJ8A 2CNWA 3NDPA 4TL8A 2JJ1A 1E2IA 3A1WA 1VECA 4W7SA 2XB4A 3U61B 2YWEA 2ZQ5A 4TLEA 1A2KC 1JB1A 1ANKA 3CNOA 1D2EA 3BWDD 3PEYA 1Q1EA 1Y3AA 2R6DA 2E1RA 1GRNA 2ZI4A 3IUYA 4URYR 1AQYA 1Z6YA 4MYUA 4PQFA 5FOVA 4PC1A 3DL0A 1II8A 3W6NA 2CL6X 2FEMA 2QUZA 1OE0A 3AUXA 4LPKA 1XD2B 5H70A 1VIYA 5JSZA 3GJ7A 3TK1A 1IONA 2F3RA 2N46A 3K9GA 2XNDA 4DCTA 1ONBA 1W36C 3PG5A 1XU4A 2GXQA 4FIDA 1RFLA 4YMUA 2QT1A 1WB9A 1OSNA 2D2FA 3WYFA 2C96A 2PZGA 1RVDA 5E7MA 4GDFA 1P6XA 2DB3A 1G8GA 4US2R 1GDDA 4EPYA 1KDTA 4WXRA 3CZQA 1Q12A 3X1YA 2J3EA 4P31A 1G16A 4LZZA 1X8LA 2QPAA 2PMDA 3K0AB 1GFIA 2ZJYA 1QHHA 2H1LA 2KE5A 3QENA 3QSYA 2IS6A 4ARZA 3GP8A 1UPTA 5EZ6B 1RIFA 2Q9CA 1IN7A 1YE8A 1XF9A 1MO5A 3CH4B 5FR1A 1MRNA 2P5SA 1EFCA 2OCPA 1E1RD 2QL6A 3IIJA 3KJIA 4ESHA 4OYHA 4QHTA 3HR8A 2OILA 1OKKD 5TB5A 3ADBA 1P75A 5DH9A 3D6TB 3MFYA 2JATA 3MWKA 1KAOA 1L2TA 2AL7A 1YJ5A 4Q1EA 3WBKA 3QEJA 2CLDX 5JJLA 4BE7B 2AKAB 3AKDA 3LBHA 4JT4A 4RFSB 3WBJA 2JDIA 3KKNA 2R44A 2NMVA 2FJUA 4AYXA 4MDFA 1W36B 3NEJA 1GWNA 1GL7A 1X8JA 3B1WA 2CLCX 2N1BA 4BFVA 1S9DA 1SQ5A 4RCZA 2B21A 1J7KA 2WWHA 2VP9A 2DYKA 2HYIC 3V9PA 2LKCA 4NHOA 2GTPA 2ZJZA 3QI2A 1XEXA 1AKYA 4PHTA 3GLIE 4J0QA 1P3JA 2CDNA 2D2EA 1J70A 1JI0A 2WOJA 3NC1C 1ZRHA 3RS7A 1KHTA 3Q8XB 2W0SA 3GFOA 2PJRA 1N0VC 3BBPA 1YR8A 3K0FB 1B23P 4PQYA 4A2QA 1I4LD 5KDOA 3BC1A 3QXSA 4B34A 1G4AE 4MYCA 2BBOA 1CLUA 2ZJ5A 4G5SA 1ESMA 4DDWA 2C98A 4F7WA 4DDUA 3EPLA 4NYIQ 5DHFA 3THOA 3ZQ6A 4NYMQ 5KU1A 1Q57A 3OIVA 3CF6R 1G8HA 5GJVC 2C95A 2WPDD 3NKVA 4FMDF 3UWKA 2WICA 4D6PA 1I4TD 2PEZA 2EWWA 2ZIAA 2ZJBA 5FI1B 5CM8B 1NIJA 3NXSA 2J59A 2J41A 2H5EA 1F2UA 4I1SA 1GKYA 4KFUA 3X1XA 3K0SA 4P3YA 4PXAA 3ZGXA 1E2MA 1QG4A 4KJZA 4DLWA 4OHWA 2VLIA 2G88A 4IXMA 1OV4A 4V0NA 4Z54A 1FNMA 4D4KA 2GCOB 4ZIRA 4M1TA 3IEUA 3DM9B 4NKRA 4GRAA 3THWA 2BM0A 2CE2X 4B44A 2D7DA 1R5BA 2WIBA 2ZE7A 2YOHA 2W6IA 1NSTA 1FMLA 2NIPA 3RRNA 1DAIA 1L8QA 4AKHA 5HKKA 2ERYA 3CPJB 3RRYA 1IXZA 5J4HA 2ZU6A 4HUQA 3JVUA 1QVRA 3FMOB 3EZFA 5JBQA 3C5CA 4EKDA 5DISB 2ZRMA 4JBWA 3UMFA 4OHVA 3SU8A 1SVKA 3CF0A 2AXPA 4FCVA 4FMDB 5EXPA 1CU1A 2FFBA 3O8DA 4BGDA 1BH2A 1NMYA 1JECA 4Q21A 3CWQA 2FEOA 4P4UA 1M8PA 4EPRA 3LQRA 4JVSB 5JMTA 1XRJA 1Z0AA 2CJWB 4E07A 3B9QA 1Q0UA 2ZI7A 1IY2A 1SKYE 2QEQA 4YC7A 4I1VA 1NVWQ 4Q1FA 1EWRA 1G7SA 1KSGA 621PA 2IYVA 2BEKA 5L3SA 1OIVA 1KZ7B 3PFIA 4NE2A 3G82C 4JLAA 4IDNA 5HE9A 4R7ZA 1Z6TA 5CM9C 5CIQA 1IY1A 2XTNA 2F9MA 4DLUA 3UXMA 4HDCA 1MT0A 2ZRGA 2D7CA 2GESA 2BKEA 2YV5A 2G3YA 2JLWA 1NJFA 1ZMXA 2PBRA 4TTRA 3RS0A 4DZZA 2C04A 5KNDA 4GL2A 1Z47A 5JJIA 4UNQA 4DLSA 3MUFA 4M8NE 5CIWA 1VCNA 3CRVA 4HUTA 5DN6A 2FSIA 3N2EA 1UKZA 3SYNA 2EVWX 1ZNYA 2CEAA 1SXJD 3W34A 4XVUA 2OAQ1 3CIOA 4M21A 4AKIA 4QJ3A 1U8ZA 2D62A 3ADCA 2A5GA 3BB4A 4DCSA 1DTSA 2ONKA 4MYHA 5SZKB 1RC8A 4P32A 1FW6A 1GKIA 1TQ6A 1EWQA 1G41A 1IAQA 4ZV4A 4JL8A 4C0KA 1Q44A 1UFQA 3PEVA 3CNLA 1U99A 4BZQA 1SHKA 1FOEB 3ZJYA 5JECA 4TLCA 3WY9A 1N6LA 1RYFA 4OI1A 5KTYA 5CLLA 1M7HA 2GETA 1BOFA 3TIFA 1X1RA 1DG3A 1XEFA 4XSHA 2WSSD 3BFXA 3A6PC 2A5YB 2ZRNA 1R5NA 1JALA 4ZDIA 4CEJA 4PZLA 4QXAA 1Q20A 1N5KA 1TX4B 1T0HB 4IOJA 2IC5A 4IDOA 2WBLC 4D4MA 1E2LA 3CW2A 4I1UA 1OJLA 4LJ9A 1N6RA 4Q7JB 2V54A 2QTFA 3ICEA 1XB2A 1TU4A 2MMGA 4A92A 5FBWB 2JLYA 1L4UA 1IN8A 1VYUA 1D5CA 1XMSA 3B82A 4QGGA 821PA 2R6CA 1G8YA 5E3HA 3BORA 1HE8B 2O8FA 221PA 4PANA 4Q19A 2GBLA 2ZSFA 3LD9A 3AVQA 5L3QB 4S35A 4TTQA 5FI0B 3OZXA 4MGZR 4DB2A 4QGHA 2GVZC 2O8DA 4KYIB 1XJCA 2CVFA 1NVVQ 2CK3D 3EA0A 4R9UC 3ZLJA 4Q4LA 3SNHA 3FHTA 5TARA 2QRZA 3OE7A 1NSFA 2ORWA 2GF9A 4F4CA 4HAXA 4GT1A 1T6NA 3A1TA 3ZD7A 3ZZTA 4EDHA 1GNRA 4KYUA 2MSDB 2XITA 1BMFD 2FFHA 3AVVA 5TY0A 3WMFA 5HZHA 4QBFA 3AF4A 1XMIA 4PHFA 2BHRA 3VKHA 4FI3C 3KKQA 3R9XA 5TXGA 2ZSAA 3K09A 3TSZA 2OSBA 2Z83A 1E99A 2V1UA 4P33A 3AF1A 4IDHA 3HYRA 1JXOA 2QMEA 4W5HA 2CCJA 2WJIA 4UXIA 4LPSA 4RD0A 2WM9B 4LJ4A 1ZM7A 1GUAA 2QBYB 4YONB 3C15C 5HTKA 5JJKA 1W0JA 1LVGA 4A6XA 1NIPA 4RZ3A 1HURA 1U0HC 3LFUA 2ANBA 2QMHA 4HB4A 3RS4A 4ESVA 4CEIA 3MGCA 3ZIAA 2KJQA 5LD2B 3EZ2A 4B33A 3VNVA 2R8RA 1XJ0A 2FG5A 3SR0A 3Q3JB 3K70D 4HDOB 3KQLA 3OESA 1I2DA 3I32A 2AWOA 2G77B 3A4NA 1HQYE 1XZPA 2CVHA 2QE7D 2WZQA 3VR6A 3SN6A 5KDDA 1OH7A 1XPRA 1E94E 1W46A 2VHCA 2D06A 4K81B 2QROA 2IYRA 3Q5EA 2XJ4A 4FXPA 3TNFA 3TBKA 1JEDA 2Q6TA 4UXJA 1KK0A 1SVMA 2ORIA 2QPOA 4TL7A 2ZXUA 1WXQA 1KDPA 1XTSA 1YR9A 1KJZA 1NVUQ 1KGDA 4A8JA 4CDGA 2V1XA 2ZI3A 3FFAA 4HB3A 1E6CA 1XCMA 2ZITA 1RRPA 4O0MA 3D3QA 2IEYA 3NC0C 4A0RA 5JWOA 4PHGA 4PSVA 1VTKA 4S2EA 1Z6AA 1E4VA 1P73A 2BEJA 3L8ZA 4H9GA 4JJKA 3SYKA 2XSZA 4B2PA 4FCTA 4GZMA 2ZYTX 2OCAA 4TZ6A 4Q4AB 3TH5A 3R20A 3MRSA 4NYMR 1YR6A 1DAHA 1U0LA 1TUEA 4OHXA 4OI4A 1Z2CA 3I8SA 1H8EA 2JJ2A 4QHSA 5FPYA 3X1ZA 2QN6A 1Z3IX 2B8TA 1ZM2A 2VP6A 4PSKA 3IIKA 2NO0A 1EFUA 1M1YE 1QVAA 3A8TA 1IQPA 3MCAA 3KQHA 5FL3A 2ZRPA 3FKQA 3IHLA 3VAAA 3QF4B 1NMZA 3GJXC 1OHHD 4K46A 3RANA 4B2LA 5D3QA 4ZPXA 2C77A 1NN0A 3O8BA 2BKUA 4QKQA 2FSFA 2QA5A 4I1OA 1NI3A 2YOGA 3AM1A 3QPUA 5FTLA 1DO2A 3N2IA 2EQBA 3ZZ0A 4MITA 4MUAA 4BLQA 5EE3A 4MA4A 1GG2A 2EW1A 3MWLA 5JHHB 4Q5IA 3IO5A 5KDLA 1W2HA 2J46A 4ZCIA 1UF9A 2P65A 1MO4A 5CJ2A 1T5LA 4TWZA 5FOUA 5CLQA 2DFKB 1VYVA 3U44A 1CRPA 4Q1AA 3KKMA 2XEXA 3R8FA 1G6OA 4HLQB 2HCBA 4LX0A 2FGKA 2AKYA 3I73A 2OFWA 1ETUA 3LW7A 3B9PA 2UVQA 5J5CA 3KB1A 2WSMA 4V02A 1FTSA 4NZYA 1NN3A 2QM7A 3OFND 1DELA 2J7PD 3GJ0A 4LJ5A 4B6EA 1X6VA 1YZQA 1VG8A 4KVAA 4NL4H 5GJCA 3KXLA 2OCBA 1T3SA 3WHKA 2PX3A 3OEED 5IK2D 3W8RA 3GQBA 3BE4A 4MRNA 4RD6A 1IOZA 3Q85A 3S1AB 4DHEA 4IVPA 1N6KA 4OJKA 4ZCLA 2REBA 5GVRA 4B74A 1PUIA 2V4ZA 3QVVA 1TUIA 3AP2A 4IXNA 4L9WA 4Q03A 5EP4A 3FMIA 3MJRA 1QZXA 1UJ2A 4EPVA 5E7IA 1US8B 1Z07A 4HATA 4D26A 1XJQA 3PEUA 4PPFA 4EJSB 3R9WA 4OQFA 3U3MA 2VHJA 4U00A 4Q9JA 2RGNC 3BH7A 3CNNA 3SQWA 4HI0E 3UG6A 1MOZA 4XD7A 2C2HA 1UM8A 2C5LA 3N70A 2V9PA 2VPPA 4P4SA 2RCNA 3LH5A 5F9HA 2RAPA 2IS4A 2H16A 4AK9A 3KJEA 1W7AA 2HT6A 2XXAA 5P21A 1R0WA 2RGXA 5HE8A 3ETLA 5EUQB 3K70C 3PV0A 1Q3TA 2G0NA 1UKEA 3RC8A 3GMTA 4AWXA 1W36D 2W2VA 2O8EA 1II8B 3SJCA 3A58B 3FTQA 4RCYA 3ZVNA 3EPHA 2FPLA 3A1SA 3CX7A 4PO1A 3ZZUA 2ATVA 4A0GA 5B57C 5JSZB 4OI2A 2IUTA 4ASUD 2IEZA 3QKTA 3DM5A 1E0JA 1G20E 4HAUA 4XTRA 1E2PA 3U7FB 1WE2A 4MDEA 3RC3A 4TMXA 1WMSA 2ZEJA 3VR5A 4URVR 2PZFA 4DLRA 2A7QA 4Q1BA 5CDFA 2GVDC 1FP6A 3JVVA 4YLGA 2W2TA 4NPHA 3PCRB 3C4JA 2OV2A 4M1OA 3TR0A 2YINC 3KDSE 4PO9A 3CM0A 3E5HA 1G64A 3HDTA 2OZEA 4JJZA 1E9BA 2VSFA 3SFVA 1J90A 3WP0A 4MGYR 4YDHB 2ZSBA 4WVFA 5G53C 4MKIA 4ARZB 4D82A 1KO4A 2ZS8A 3GFTA 2OBNA 3U60B 3UMSA 1BYIA 2E87A 4M9XA 1X1SA 2WKRA 1U8YA 1R0XA 3SYLA 4BLRA 2QM8A 4GP7A 1R7RA 3NBZC 5FPHA 2GCPA 2J0SA 2J1LA 4I81A 4JIMA 1DBSA 4GPTA 4OL0A 1XXHE 4A9AA 1G5RA 1SVSA 2X1VA 1KOFA 1HTWA 3SJAA 5AUQA 2GNOA 2ZPTX 1N2CE 1E9RA 2JGNA 2JA1A 2ZE5A 5CYPA 3CRMA 2NPFA 1F2TA 3U6BA 1U0JA 4XIGS 1X8KA 3IQXA 5BW8A 4TYYA 4YMVA 3HJNA 1NBMD 5JCZA 1XPOA 1S9HA 3KJGA 1GAJA 4JVNA 1GVNB 4UNNA 3OAAA 2JLRA 1OPXA 2RGGA 4RD1A 2REOA 3ASYA 4UKDA 1XEXB 2OXRA 3GLHE 3TAHA 3Q7QA 3CR7A 5LB2A 4M9ZA 4PC2A 1FUKA 1E32A 2BMDA 5JI3E 3ADDA 1C4OA 4B48A 3NIBA 2V6IA 3OIWA 3GJ5A 1KI8A 4KFTA 5FL7A 2JLUA 3MLEA 1EFRD 4ON9A 3C16C 4KBFA 1WCV1 1N3BA 1EG7A 2FFAA 1JR3A 1RZ3A 2CCGA 2AXNA 2FH5B 2QMUA 2VH5R 4EFLA 3W90A 4BECA 4DC9A 4B47A 4IJMA 1SKQA 1UAAA 4D25A 5KOYA 1M7BA 5DNYB 1CKEA 1N5LA 4NCKA 3TUIC 1TQ2A 4D4LA 2C78A 5BN5A 1P9WA 5BN4A 1P5ZB 3W8NA 3U2QA 1G4UR 4F92B 3SEAA 2FZ4A 2QGNA 3IGFA 1QHGA 4ZDKA 5KSPA 3PITA 3REGA 5G40A 3TAUA 4C7OB 1F2UB 2OFOA 3QXHA 3DOEA 5C4MA 2OHFA 1KTVA 2W0MA 1TQ4A 1F6BA 3LLMA 3T61A 4ZKDA 4B75A 1M2OB 3KL4A 4QM7A 4ZIRB 1KJWA 1MRSA 5F2EA 1CEEA 1K6MA 4FD2A 3THWB 1KO8A 1KI1A 1KNQA 3RSOA 4L9SA 1U90A 2ZRKA 4WAUA 3BJIC 5IT5A 2ZSDA 4G5RA 2JIZD 4Q66C 2IXFA 2WWYA 2JLSA 2AK2A 3NH9A 4LYJA 3NBYC 4PZYA 4H1UA 3ND8A 3SI7A 3V4FA 1TADA 2QT0A 3W5IA 1SVIA 3OEHA 3DZ8A 1E2FA 1JR3E 2HV8A 5DI9A 1U9IC 3LBNA 4C4PA 5LPNA 1Q1ZA 3FKSD 1AN0A 2ZE6A 4HZUA 2IYZA 1CTQA 2F7SA 4HUQB 3ZQJA 1CR0A 4Q9HA 4LV5B 3EZ7A 1IBRA 5FOXA 2VQSA 1Z29A 2V8OA 4B76A 1KY3A 1Q22A 2ERXA 4QC2A 2CL7X 3RWMB 3W6PA 1Y63A 2XOKD 3A36A 1TF5A 1E2QA 2NZ8A 3GLIA 1E9DA 1PVOA 2XGJA 1ZIOA 1ZJ6A 4HLCA 1RJ9A 1WQ1R 1WRBA 1Z22A 4KSBA 1XWIA 1ELOA 2Q3HA 3KKPA 2KBFA 3SJZA 5K8LA 1KIMA 1V43A 1Z5ZA 2J5XA 4IEEA 2Z4SA 5C18A 1OXSC 1XEWX 1XTQA 3U7EB 5B64A 2DWQA 1OB5A 2YVUA 4A0FA 1FQKA 1D8TA 1TNDA 4I4LA 5SZHB 3AUYA 2IYYA 2FGJA 3LQQA 4AG6A 1NN1A 1A7JA 5EP1A 4LV8B 5L3SB 3IILA 4M9SA 2I1QA 4OJQA 1KZGB 5G3ZA 1N5JA 4NCNA 5EUMA 3AEZA 4US1R 3NWJA 4KLNA 5EJEA 1B0UA 3BGWA 3K0EA 2ATXA 2KB0A 4OQMA 4TT3D 3CUEF 4ZDJA 4A36A 1IHUA 4JMPA 1E0KA 1SULA 2ONJA 3FYHA 4AURA 5TMPA 1GL6A 1HEIA 3W9YA 1AZSC 2ZJAA 2GZDA 4Y0VA 1I4DD 1ZU4A 4LK2A 2ZS7A 3H86A 2J0UA 4TLAA 4EFMA 4KBGA 1YRAA 4JLOA 5J40A 5L3RA 2C99A 2J9RA 2W6JD 2CMKA 2GBLC 1GZSA 4IDPA 4II7A 1XEWY 1NN5A 3PUZA 1ZM4A 5EP3A 2C8VA 3CPEA 3RRMA 1COWA 3AF0A 3U7GA 4RKFA 3SDZA 3SHWA 4DUGA 1EX7A 2A9KA 2QPTA 1KSJA 1OW3B 5AR1A 3U3KA 1G21E 1S8FA 2J0VA 3KFXA 5J4VA 1E79D 1JPJA 1AQUA 1XTKA 4RZ2A 3A4MA 2OE2A 3RNLA 2W83A 4MRPA 1AS2A 2FNAA 5A0FA 4TQAA 1AKEA 3B8HA 2RGBA 2XX3A 4DSNA 4AKEA 3TQFA 1AIPA 4M4SA 4TYPA 4CEJB 3U4QA 1M74A 4ZI2A 1KNXA 1J2JA 1G9XA 2RKOA 3RYTC 1KI6A 4U02A 2DFTA 1BIFA 2VTKA 3L2OB 4JKYA 5IDVA 1LB1B 2XB2A 1I2MA 1WF3A 3L43A 4GFDA 4QFMA 5FUVA 4QHYA 3ZVLA 3AQ4A 1G8PA 3FVQA 3ZS8A 2O8FB 1HH4A 1JQJC 2IA5A 2IYLD 5LBIA 3UPUA 4JLDA 3CONA 1DS6A 2ZUCA 3QBVA 4KODA 4Q7KA 1R4AA 5BXQC 3H84A 2J45A 4Q7LA 2GWHA 1M34E 2G9NA 3AVPA 2L0XA 1NY6A 2O8DB 2D4HA 2FA9A 3L8YA 4LBVA 3W5JA 1KO1A 4C0QC 5AUPB 3PEWA 2GA8A 5JS8A 1YR7A 3Q7PA 3QY0A 4N3NA 2R2AA 3CRW1 2VL7A 1M6NA 4LHZA 3LA6A 1LS1A 3LVRE 1HT2E 3TW4A 3SHFA 4DT1A 2IYSA 4Q1CA
chains in the Genus database with same CATH superfamily
3L7IA 3OQHA 5J5AA 4CV1A 4YRLA 1A3CA 1LTKA 4B32A 2QR3A 4BP3A 3IVAA 1EX9A 1TC2A 1W8IA 4NRDA 5AVSA 1BVHA 1FS5A 1LDYA 3P9KA 5CDYA 1OVGA 5C37A 3C8UA 1RQ2A 4J0JA 4RPCA 5FUMA 4TN5A 1KQOA 3LC0A 3UK0A 3LVBA 4DR4B 2K2WA 4ZQEA 3EOBI 2NV6A 1LY1A 3ANNA 1H8HA 1JIUA 3GZNA 1Z16A 3OI7A 2RAUA 3NHWA 3KUDA 2OAEA 4G0QA 3JXEA 3AC0A 4K9SA 4YJGB 5AJZA 1HNWB 1XOIA 2JHPA 1SR8A 1H4SA 3EWSA 2Z5FA 4BQFA 3REQB 1L4YA 4HSGA 1EESA 2I6SA 3ITDA 5A0TA 1J42A 1DQNA 3ZDQA 3DMGA 4HT3B 1CZKA 1Q7TA 1JHQA 3KZMA 4QUJA 4HQ6A 3NDBB 5KJCA 1E2GA 4JP5A 1UWKA 2XUJA 2V5VA 4OIFA 1YB5A 2P7HA 5E9QA 3LCCA 4LXIA 4JBHA 4Q9IA 3C3KA 5F1YA 1T13A 3T8YA 2MHCA 3ANYB 4Z4FA 4JGBA 2W22A 1ATIA 2OFXA 4IINA 3BGSA 3CWZA 3TNJA 1EXDA 2GGSA 3INYA 3OX3A 1IXRC 4ADSG 2V7QA 4KIGA 4CL0A 4M46A 1FPMA 2DZDA 1J49A 2VK8A 3OC0A 1JFFA 4OXRA 4A8JB 4B3SB 4YASA 1OYWA 3AF3A 3CMMA 1IY0A 3NFRA 2A67A 1DKMA 4GZ6A 3UATA 3AWIA 5DYGA 2QWXA 3IUQA 2ASVA 2BH9A 2E4ZA 4QOSA 5AHWA 4QLBA 3PR3A 3IRUA 5CK4A 4HWSA 4PSAA 1FX0A 3NYRA 1AC5A 1N6PA 1SPXA 5BR4A 3O8CA 1Z5WA 3D4LA 1CIJA 3GUCA 3KTAA 2NU9B 3SFZA 1Z0ZA 3KTOA 3E7WA 3T4EA 6ABPA 3LQ2A 1ZICA 4OGFA 2P6OA 4QEKA 4XWTA 5DYYA 4LOAA 3MJCA 2QTLA 3ZH9B 4OGLA 4ALKA 3PQ4A 3VDXA 5ADVA 2GNAA 3FOEC 4QODA 2OOSA 3IUPA 3ASZA 3VPAA 1C3EA 2AOUB 2F1IA 4H7IA 4O0LA 2O19A 1P4AA 1E58A 3GHHA 2QSUA 4MSUA 5AESA 1JXMA 2OUKA 3WB1A 3WL7A 721PA 4LBZA 2HWWA 3GT3A 1QHIA 3BPSA 5G0TA 1BDJA 1J0BA 1P60A 3C2QA 4RVDA 5JCOC 3BMQA 2VOJA 3MMPA 4FNAA 5EJGA 3EGOA 3TG8A 5GIOE 4G8DA 4MI9A 4J4TA 2XTZA 4PM4A 5AOBA 4DQ0A 1A8SA 4TXLA 5LQCA 3F6SA 3N6RA 1YCDA 1JKXA 4KXVA 5TGZA 1R5OA 4QQKA 5JAIA 5KYYA 3I01A 3N58A 2R68A 3H2SA 4PINA 3URMA 1V11A 1ZVJA 4ARIA 5DGXA 1ISIA 5ESDA 1MD9A 3VKWA 3KXIA 2VNIA 4Q18A 3WRXA 3VQTA 2BP7A 3U09A 3L7BA 4LGVA 1V5GA 1W75A 2B9VA 2CVQA 3O94A 1OFUX 2BMEA 3JQFC 2QM3A 3UCEA 3GVXA 3S5JA 4DV4B 4XX0A 4NZZA 3OQ6A 1UODA 4BNJA 3U7JA 3C43A 4MW5A 4GLBA 2HLPA 3TJZA 4DMGA 1ZOLA 1GCGA 3CS3A 1LBSA 2H4JA 4N8EA 2RCYA 4ZI7F 1WXHA 3PK0A 5DX8A 4B81A 4L5AA 4B7UA 4D9KA 5CBPA 1JSXA 2I3AA 3GK3A 1ODFA 2AMFA 2NOAA 4C4XA 3CURA 4LGMA 1WY7A 1YVUA 2WWWA 2QUKA 3N8NA 5LC1A 1Y0BA 5HCIA 1SVWA 4G3XA 4IUYA 4RAQA 1HY3A 5DO9A 2NZJA 3GDHA 1W93A 1CR2A 2ZPAA 3PS9A 1MB0A 4XR9A 4M54A 4ZOBA 2POCA 4RKEA 3IDSA 1N2IA 1GOTA 5FKJA 3QX7A 3D4PA 1UEIA 3S8MA 2DQSA 1JG2A 2MIIA 5JFGA 1WR8A 3UW1A 5K0ZA 1PWEA 5LNK6 3NIGB 4NU0A 2JFFA 1T5TA 4P5PA 4ZU1X 2WHRA 2IXEA 1Y98A 4IO0A 4U3JA 4ZO8A 1TUGA 1XK7A 2WWGA 3FTEA 3B1YA 3T94A 5B6PA 5LQKA 1TL7C 3L7AA 5DBGA 4XM1A 2GUGA 3JQEA 3F8SA 2DY1A 5DHSA 1XLUA 4C08A 3DT8A 1D0SA 4MQ4A 3ZJUA 3NH6A 2G36A 4UBOA 5EE9A 2AJDA 4ZEMA 5B3LA 3TXXA 3UFBA 2OBXA 2B3TA 3E0QA 5FTKA 5G02A 1GNQA 1ZUIA 3Q40A 3WGNA 4WXPA 3M9WA 4HB0A 4Q4HA 1BS1A 1RXCA 5DX0A 5IJ9B 2XXAB 5HWSA 4B7CA 1TTTA 2ZS9A 3E0XA 1N6IA 3I2KA 2L17A 3VKGA 2D0DA 1OUMA 1AZTA 2JDID 2XE4A 5JSUA 3AW9A 1U8XX 2JIPA 1YKFA 2XDQB 4B4UA 1U81A 1WVIA 2MSWA 1X7YA 3FYDA 3UJAA 1GRQA 1NBAA 1PIWA 2GBIA 2IYPA 3CPHA 3E15A 1XFDA 3DDWA 3PIRA 4O4LB 1V4VA 2R87A 3OCUA 1MB2A 1IZ7A 3R3YA 3FNIA 3H9JA 1G5TA 2E89A 3DOFA 4ROTA 2CXXA 4CIAA 4WGGA 1SURA 3AUTA 1E98A 1KKLA 3ZGNA 1NVMB 2GFQA 1M10A 3HWX1 4L4SA 2ZVPX 4YROA 3SQOA 3Q0IA 2BJVA 1E1DA 4AYTA 2BCGY 2F1OA 2JF0A 2A3RA 4HGZA 1SUDA 3IIMA 1N2EA 3LUPA 1YZGA 1LNQA 4ILKA 1S7GA 1P8JA 3H8JA 4BBAA 1W2GA 5AKYA 3GUHA 1P9RA 2GUWA 3PZBA 5B2ZA 2C29D 3D3KA 3P0JA 4N3BA 1J0EA 4E22A 2MYTA 2OG2A 1HYQA 4BQSA 4Z9FA 3AZOA 4FEGA 1SRRA 3UWSA 5SICE 5TIIA 5ALLA 4DY6A 1JFRA 4OQNA 4WZAE 3VNSA 5HRUA 2I22A 4FW9A 3MOIA 4F3KA 2R96A 1B74A 4JENA 4KN9S 2G25A 4JXJA 1PLLA 3RUDA 3ND7A 1Y3CE 2OCYC 4R1MA 4YCMA 5A6VA 3RRBA 1CP2A 4DQLA 2PUCA 3UV3A 1SVOA 1GPYA 1FDTA 2GN8A 4QSMA 2O50A 4F4IA 1ZVMA 2BVNA 3SQLA 3C6XA 4HGNA 4E5DA 3O1HB 4BZPA 3DG9A 1E1RA 4JT2A 1Z08A 4P0TA 2QAJA 1QKJA 5EMHA 4R2HA 2Q7XA 1DEKA 2CXQA 1H5UA 4R7GA 1VSBA 1RTTA 4GXQA 1DXHA 1G5HA 4MS4A 5KHOC 1YIAA 3UAWA 1TEVA 1RM4A 3HEMA 3TQCA 1F2TB 3BDAA 3LSYA 4UW9A 3R75A 4D74A 2YXDA 2PD4A 4W9RA 2VYNA 3M0EA 4L5CA 2P9FA 1EFLA 2PKCA 4R68A 4M7OA 4D9MA 3PJDA 4J4HA 1N33B 2NO7A 3GG2A 3X3HA 2AHRA 5LDGA 5AT1A 3VU9A 1H2WA 1GQFA 2HNAA 5HKKD 2VDOB 2WT9A 4DV2B 3CZ4A 1CS4C 3TD9A 3IKTA 2VNSA 4P08A 3WNDA 3DEFA 1U65A 4P7FA 1YDMA 4K8RB 1SQ0A 2AE2A 3MB8A 2OT3B 3F67A 2HK8A 5AXBA 3EA4A 2FWIA 2OQ2A 2RHTA 2ZBRA 3EVEA 2GX6A 2H9IA 3O9ZA 1EX1A 1YU9A 4S2UA 3MD0A 2Y2VA 3RFFA 1HZZC 1RXUA 4Q6BA 3H11B 4Q6WA 1T1JA 3EXG2 2K4MA 1YAHA 3AVUA 4MV0A 5TPWA 4RJTA 4B6OA 5AVXA 3QFFA 4A0HA 3EW7A 1H1TA 4C3VA 4AVYA 3NVMB 4IIXA 3AYZB 4HC4A 4E09A 2RK4A 4L75A 4DMCA 1BX1A 3ICPA 1NVBA 5FHQA 3BS4A 3FBGA 4LTMA 1DOAA 1LRLA 2IBMA 4EAQA 2OV1A 3ELUA 5BN5B 4DIBA 1AQLA 3CGGA 3ESDA 3OLWA 4ZYTA 1NJ1A 3PKJA 1W6UA 2H8GA 3KQMA 3MF4A 1L7VC 3VHXA 3WZMA 2QTBA 1X13A 2WP8J 3ZU6A 5JXIA 1WEHA 4BNZA 1LLQA 3GYBA 3LUBA 2G28A 2R85A 4JLKA 5K45A 2R6ZA 1FP1D 3GB9A 4LJ7A 3KOMA 2C9BA 2QI9F 3NTOA 5JQWA 1MVOA 4TXHA 2QN8A 3HM9A 3GJYA 4E7PA 1XUOA 3W1EA 2BL4A 2GO1A 4YRAA 4BAZA 4DEYA 3PGA1 2QI9C 4RHFA 4JI8B 8ADHA 1AH2A 5A2QA 3E9EA 3SP1A 1KI3A 1V4NA 1Y8QA 4I08A 4ZGGA 1AQNA 3AESA 4QOGA 2GHRA 3QPWA 5DCWA 1VL0A 4QT4A 1FTGA 2HOQA 1WPQA 3DUFA 3WKDA 2NSJA 9GPBA 5KNDD 1GFSA 1PJ3A 3E48A 3ZR4B 4CYMA 1XKTA 3V1MA 5KYWA 5ICFA 1JU9A 3FNBA 2ZT7A 4YJ3B 5B7GA 3KSUA 3SZOA 2IF0A 4EHIA 4HZUB 3F46A 3HU2A 3LX6A 5A4IS 3OO0A 1T2NA 1RKXA 4H31A 3ZNOA 4DNOA 4NCAA 3AVTA 1MDFA 4FR2A 1I5OA 1KKMA 1KY2A 1SQSA 1ZBDA 5DNUA 4U7TB 2ZOSA 5AVVA 1GAWA 2Q29A 2JFVA 4P4TA 3RWOA 3N0TA 4DLZA 1FFEA 1NXOA 1XAGA 3F1KA 3OZEA 5B7QA 3I61A 4E2XA 4AKGA 1WW3A 1OT3A 2J9FB 1TPZA 4LRTB 4KVFA 1RRGA 4XASA 3UHAA 3GLIB 1GG8A 2Q1SA 5HCNA 3DFIA 3SQNA 1YB4A 3ME5A 4J94A 1R6UA 4X5OA 2HAEA 3TBFA 5AJVB 1NQVA 4Q3NA 5JV5A 1IU9A 1T5IA 4LI0A 1XD9A 4BKPA 3JAMA 1J8VA 1N8KA 4O5AA 5KUTA 3M6MD 1DBVO 4KV9A 4YCLA 1M5RA 1E2EA 3E2IA 4MRMA 1VIVA 1K8RA 4GC9A 5KSOA 1CUWA 3UXHA 1S0UA 2CNOA 4LE0A 3WQQA 3BHIA 1PUJA 1CERA 3B13B 4UFPA 1GZ6A 4JWKA 1WKBA 4FMBB 5AJUA 4ZC8A 2IS1A 1A2BA 4GLFA 3UGJA 2AC7A 3MUNA 1APBA 4HTFB 3LTNC 3Q15C 1JGTA 3LA8A 3OU7A 3TQOA 3CUKA 3T5GA 3FIUA 2VSQA 5HUJA 1CEQA 2BZGA 3RUIA 3U37A 3AFOA 2BDTA 2Q46A 3MTIA 4GNKA 4FDLA 3D3NA 4BVLA 4MWDA 4QUEA 4ZVUA 3FRJA 4QARA 2FK8A 3DBHA 1UBHS 1I3OA 2FMFA 1IQUA 2QSZA 1ORIA 3IOMA 4BVKA 4EGJA 3EEQA 3MAGA 3LLVA 4Z9BA 4NMMA 1JKJB 4R8VA 4J3JA 3V4VB 1H3EA 4U2BA 1UINA 2CB0A 1JKFA 4KN5A 1V16A 4G1FA 1KYVA 3EXIB 2UYQA 4DR3B 3A6KA 4QLOA 2J0UB 1TB4A 2ZANA 3MJFA 3KJNA 5D7NA 3CISA 1ZD2P 4BCBA 1RPJA 1SXJA 2MJLA 3LI2A 2QV7A 5K4GA 4DV7B 1KEZA 1LSOA 2E4UA 5TDHA 4PTLA 1QIIA 3RS9A 4BFUA 3PVCA 4MWOA 1U04A 3Q1KA 2OFFA 1L7AA 3HGTA 4CM8B 2Q3MA 5BPHA 1EUQA 3X2SA 3R0JA 3E4DA 4COKA 1KK1A 4QYIA 1NXWA 1P0CA 3NBXX 1XG5A 3EGXA 8GPBA 5JS7A 3IP1A 1DAGA 1XPJA 2CZCA 2PZMA 2PJZA 2XYQA 2Z8YA 3OWXA 1L9XA 1IM5A 5SYAA 4P9NA 2WJ4A 5IKEA 3QBEA 4E5NA 4HLUA 3RU3A 1X2BA 4CKYA 5JZOA 2BMJA 1YULA 2VF8A 1G3RA 1O5OA 4NCXA 2OZPA 1KZ1A 1PW5A 4HXEB 4JWTA 2FSHA 4G5GA 1XZAA 1VCHA 2GMWA 3I3SR 4S1TA 3TLZA 5A6SA 3CA8A 1P9NA 3GLFA 2WSSA 3ITKA 2J5KA 3WGYA 1GL3A 5CRIA 4OJMX 3NOQA 1GL9B 2WVJA 4CL8A 1L4MA 2HXSA 2PY6A 3FM9A 3UTCA 2HV9A 3TRDA 2B5WA 4BFXA 3B6KA 1C2TA 1NRWA 4BLTA 2IHVA 1L5YA 2R25B 1SBNE 3CBGA 4FZRA 3T06B 2PV7A 2BV3A 1PFQA 2KSQA 3OZVA 5ECDA 2ONCA 3G23A 3A37A 3VR6D 1PJBA 1WW2A 1E5QA 3MQFA 4EG1A 2H0RA 4D9CA 5EPUA 3F8TA 4PPQA 3D6AA 4BFZA 1AKRA 4EYEA 3EASA 2R1UA 3FSGD 1Y1SA 5CCEA 1H6CA 2GN1A 4DR6B 3IKJA 3ZCUA 5CLGA 2Q2QA 3NHFA 4JX9A 4IO1A 2QK4A 5IAAA 4OXIA 3MLAA 1JHDA 3EE6A 1WCYA 1QP4A 3DE7X 4MWEA 1JKMA 3KXPA 4YDRA 3ZE7A 5K0TA 1Z63A 4JUIA 4KU4A 2BGMA 4G4GA 3WZLA 3OT1A 4LOJA 4LKOA 4LE2A 4WZZA 4MS1B 5ALVA 2P6UA 4U9UA 5ARCA 3C4VA 1I94B 4OM7A 4PIVA 1DUSA 1R8QA 2NO9A 4YJ2F 1RQLA 2QE6A 2VYVA 2PXHA 3A2LA 3D7NA 1EVQA 1B6RA 1U80A 3L0IB 4JLNA 3UBMA 3CXUA 3PNVA 3VA7A 1BMFA 4J91A 1VMKA 1YFKA 2J0EA 4FLFA 1P0PA 5E6UA 5ICMA 1SCQA 1RAIA 3KSRA 4CEHB 1W94A 4LJ6A 5A1JA 4HNGA 3EZYA 5KNCA 3H7AA 1J06A 1NBOA 4MTCA 3VO2A 4RK6A 1XKXA 4YCBA 2Y66A 4PZZA 1VZ3A 1DJPA 3DT6A 4UVHA 5JJBA 3K9HA 2AG1A 1TVCA 3RV3A 4N39A 4WV3A 2ORVA 3G9QA 2W71A 2VP3A 2H7CA 1SQ6A 2YN4A 4PPYA 4R2XA 4OQYA 2OOKA 2R5NA 3AIMA 1SB8A 1PG5A 3K8OE 1ZBQA 3GRKA 3Q7IA 4EI7A 4BRUA 1TRHA 1XKQA 2VHQA 3DKKA 3A31A 4OD0A 4CGZA 1PFYA 2YFYA 1VP3A 3D4NA 1OLOA 1REQA 1DCMA 3KHUA 4XD2A 4GQBA 2P9TA 2IX3A 2HNBA 2OMEA 3IPXA 5CJPA 4ZVSA 3FPBA 5AJYA 4ZN6A 3ETEA 2AZXA 2G6TA 1QG2A 3HP7A 4RK0A 2XQVA 2DWUA 3LUAA 5EWLA 4A6EA 4B71A 3K32A 2XQIA 5AP9A 3B1XA 5EVCA 1CYEA 1RSZA 1UIMA 2VF2A 1G2PA 1J0AA 3OBIA 3FHCB 4JI1B 4DJAA 3HB1A 2IKQA 2PU7A 4QWMA 2WF7A 1AKVA 3G6WA 5F9MA 1GIAA 4QUHA 4RZUA 2NTNA 2OC4A 1Y1PA 1JE1A 3EXFB 3FGNA 5DI3A 3KOXA 2I2WA 4F9FA 4QE3A 1QR2A 2IOYA 2BSAA 2VAVA 4CCWA 3GRVA 2QYHA 2W2LD 4XA8A 1GA6A 1IUNA 1XVLA 3LBFA 3RAJA 1JU3A 4F1WA 3KJHA 2CKDA 1QTQA 1IJEA 1KSHA 4KO1S 3U3RA 4YMLA 4BU1A 3E27A 2M2IA 4O4IB 2O6HA 1KRHA 2PLRA 4U2FA 2A5DA 3GN2A 1E1CA 2C1ZA 4INZA 4QELA 4AJOA 3LGXA 5C5DA 3O47A 3I2GA 2FHPA 5MN6A 4YMHA 4YIKA 5B53A 2Y1EA 2IHKA 3GIWA 4Y1FA 1W49A 3V4LA 3AMVA 4X61A 3TE6A 4C2UA 2MOKA 1I1NA 2O8VA 1NQ5A 2OESA 2QTRA 3G2OA 1U5BA 5CNKA 1WM1A 1X7DA 5AH0A 1G8MA 3PE3A 2EFDB 4Z7QB 3N74A 3H2ZA 1AF4A 1BQ4A 4DKXA 2AN3A 2B35A 2P4EA 3PF8A 3FHLA 3HS3A 4Y2GA 4FT2A 1ZA1A 2C03A 2EF1A 5D3MB 4MS3A 2A9QA 3F7TA 3TTTA 2HSDA 3VKVA 3W2FA 4DLKA 4PNEA 1KI9A 5IWAB 4GL4A 3TSYA 3KRTA 1C3LA 1MQSA 1ES9A 1Y1RA 2B99A 2BEVB 2EEPA 1DIBA 2V8BA 2QP9X 1NUHA 2QMOA 3B60A 3DQQA 5E0KB 5ISMA 5CA1F 1S4QA 1AK9A 3NOXA 1OHHA 3EG5A 2ZIFA 1JTEA 4Y2HA 4ABYA 1J21A 3V7FA 1JR2A 2BR5A 1L4GA 1CB7A 3LZ6A 4RVFA 1CUXA 1NNI1 1LC0A 2B25A 2PZBA 4OQDA 5BP7A 4O8CA 2X0KA 3K9NA 3FY4A 4D80A 1NWCA 1ORVA 2RMKA 3QIAA 4QOJA 3WL4A 3BXFA 1T6BY 2LIPA 1G3UA 4L3VA 1P1IA 1RLTA 4R3NA 2QMYA 4IQGA 2PPLA 4YN3A 1XN4A 5K3OA 2JI7A 1NLMA 3LZDA 2JBWA 3E1SA 3L9WA 3EX7C 2W9XA 5EE1A 1JEYB 4GRDA 2AOTA 1FLDA 3K9QO 3X0DA 2X41A 3W4IA 1OFIA 2A59A 4RM2A 3OHMA 4WPGA 3BMOB 5J58A 4BMSA 3WOVA 1IN4A 4RZHA 5K0NA 4IV8A 4TL9A 5EA2A 2H3EA 3ND6A 1E9EA 1ND5A 3HNRA 3LNCA 3OA2A 3P9QA 3QYJA 2A1UB 2JCGA 3R0XA 2QW1A 2AN9A 3ZWXA 5BRAA 1E2NA 3IT1A 4KFRA 2F17A 1XDGA 2VJLA 1CF2O 1RXSA 3B78A 2E55A 3M2TA 4K05A 2OHJA 4O4JB 5C8VA 2EZ9A 2H18A 2WHQA 3OE5A 1V3VA 1KAEA 2WMNB 2OQIA 3LPCA 4GPEA 4XB6B 2JCSA 1G9SA 1EE2A 3CN7A 2J33A 2GTIA 2M1XA 2P9YA 2W37A 3IOYA 2G1UA 3HWSA 4L8LA 2OA0A 3L77A 4DPKA 3FW1A 1F9EA 1N6HA 3OY7A 2JD1A 4XEHA 3RYCB 3PRJA 4CXMA 2IHNA 3D2AA 1HG1A 1R8XA 4LRUA 1G18A 1XQWA 3DTNA 4NENA 1XRLA 4NOMA 3G5MA 4CCYB 2FX5A 3LOUA 3I2FA 2VUIB 4PGMA 2CXPA 4PQGA 2EJTA 3V4RA 2GCNA 2WE8A 3OM8A 1SXPA 4X7RA 1FSSA 1PV4A 2QY6A 2YDYA 3JQAD 4FZVA 4TKZA 4UE3S 3L0CA 2IEIA 3OEEA 4L1KA 1U31A 2ILTA 2OK7A 1JLKA 5L7WA 2FW7A 5LLTA 3T3OA 3RLFA 5JXJA 4JLUA 1UT6A 3MS2A 4I14A 1R6BX 2C57A 2C4HA 3HJGA 3HM2A 3R7FA 4H3KB 3ZJ4A 4BGEA 4B43A 4LHSA 5I01A 4BJ6A 3A06A 1CJCA 2JGFA 3EDMA 2OCLA 3GJ3A 4KRYA 1MOSA 5FBKA 4YRGA 1YJ8A 2J3IA 3PPIA 1TCBA 1T3HA 5AJTA 5LOVB 2CC2A 3DE2X 2Y6UA 1DAFA 3ZIUA 4UCXA 3L0SA 5H02A 4N76A 2GPWA 1XYYA 1MJGA 4MPDA 4AJPA 4IVQA 1SQFA 2R8YA 4KAAA 1P0IA 4QL3A 3TL6A 5K6RA 3TB6A 4WBNB 3P2YA 3GVPA 5EC8A 4MKHA 2D5AA 2SCUB 4X3CA 3D5QA 1EHIA 4N5HX 2WWVD 2CUTA 5FD8A 3SD7A 2EFEB 3WGGA 2AFHE 2QSYA 2R65A 421PA 4CMIB 3JW8A 2Q3EA 2RHMA 2Q62A 1JDZA 4RF3A 5K05A 3C5HA 2H08A 13PKA 4KPEC 1E9AA 1GADO 3DZCA 5TQ2A 1YRLA 1GTJ1 5CX1B 2G1KA 4DMKA 1Y4DE 4ZEVA 1QH8A 2CNNA 4TUYF 1MHTA 4UARA 3GJRA 5ICGA 5KPJA 3DONA 1UPCA 2ZE8A 2XRFA 5LB4A 3RYHB 4AZ3B 1VCIA 1W88B 3BULA 1BJTA 4EAAA 1OYYA 1KO5A 3L18A 5CTAA 4A91A 5AI6A 2A94A 2F2TA 3AJEA 3EZ9A 2AFVA 5DVZA 4EL0A 3NR2A 2PKYX 5AW8A 1WDTA 1RI2A 3PUVA 5FUYA 1W30A 3HMKA 4DGQA 2DLNA 3BXHA 4FYMA 4ZMRA 4NSNA 2GPNA 3KU1A 2PMCA 5LQNA 2IXAA 3PFHA 4JC4A 4EPXA 3KWMA 2VYCA 3U1TA 3VU3A 1FE8A 4F04A 2GJ9A 1ICEA 1ZC3A 3AY0A 3CH5A 1YJQA 2A2ZA 4I36A 5ALEA 4L15A 2P2SA 3GWZA 3UOGA 2F3TA 4IHAA 1G8JA 1JHMA 1P7ZA 3O2SB 1DAEA 3UJPA 3WB9A 1NUUA 4W6QA 2QIOA 2OCXA 1UZUA 1AZWA 1T2CA 3VNRA 4E4RA 2PZAA 3DJFA 1D2NA 2B5OA 4OMFG 3SSAA 4K1XA 1SOMA 5C46F 3G7NA 4IQ4A 2FVXA 3MMZA 4ZCTA 1WZ2A 4KCGA 5LQDA 5LLDA 4E11A 5IBQA 1ZQ9A 2F8MA 1AOXA 1OMOA 1Z2AA 1EDEA 2BT4A 3DC2A 3MINB 3MWJA 2QX9A 2YTZA 5BYJA 3WWDA 1JEEA 3BZWA 4MGKR 5F98A 3FCYA 4CCAA 3EG9A 3L82B 4X8OA 1XBTA 2E21A 2JVJA 5C5CA 1KVQA 3KLOA 1VQ1A 1GN8A 3HFJA 2ISCA 3ORRA 5LFAA 4ITRC 1Z25A 2EV9A 1KJNA 4BMZA 1NT2A 1USKA 4UBJA 5HCUA 1TM2A 1U1CA 4OTZA 3T5PA 1PYGA 1R6TA 3FTCA 3IR6A 4X54A 5H16A 1JLLA 2Y4NA 2JASA 3E22A 3O1JC 2I6TA 3FYSA 1YDGA 4HVTA 5TMEA 4P5EA 5J59A 4L85A 3UJ3X 2JL1A 3TUZC 5FOWA 1SOVA 1XLTA 2B98A 3GT4A 4KVGA 1Y34E 4QPJC 1EFTA 1M8GA 4S3MA 5CTJA 5AKEA 5JCPA 5BQPA 4I50A 5T6BA 1G5FA 5CB4A 2IODA 5HRCA 2ZWVA 4JP1A 1BNCA 2ZIZA 4EP1A 2V0GA 1A96A 3EVFA 4IHQA 3WYGA 1BC5A 1TEXA 4DL9A 1EI9A 1FNDA 4FI3F 5CB6A 3ZHCA 5JAUA 4YVFA 1KMHB 2QNRA 5FWAA 2P40A 5LBUA 3DL7A 2YZKA 5KNCH 3MCWA 1D6SA 3SYMA 4ROSA 3ZQ4A 5BURA 2OPHA 3DTTA 1K7SN 2L2QA 1H9BA 2X7JA 4OHFA 1P19A 4FN4A 3AT1A 4RTNA 3B7PA 3OURA 2NO1A 1XQXA 4NE9A 4D2IA 2E9SA 4N0DA 4EGFA 3B85A 4ZCMA 3P4XA 2CUNA 4NPCA 1KOJA 1VLVA 1XZHA 2CJWA 3EK2A 2O2HA 4UD2A 4XSGA 3C6KA 4DIDA 5C7OO 1GV1A 2IL1A 3CJRA 3OJOA 4F4DA 2VRWA 5KJ6A 3KKEA 2VRCA 4EVIA 4BPRA 5HQ3B 5IG2A 1PRYA 4AN4A 1JT2A 4Y67A 3CZMA 4ZV9A 1MABB 2ECKA 1PR2A 1PZNA 2UU9B 4Z86A 3HB5X 2J6BA 1IDN1 4QGSA 5KYXB 1WEKA 1SBQA 3OPYA 5SZJA 1DC7A 3EUEA 3MWGA 3FSJX 3IQIX 4EA8A 4MX8A 4RVNA 1GLGA 3MRXA 5B4VA 2Q4TA 1PP4A 1XXHB 2XUHA 3M33A 4OU4A 2CV1A 4ZAVA 1JMKC 3WKCA 2ID4A 4DCOA 2B37A 1PVDA 3S55A 2J5BA 2JIZA 3EXEB 1M5UA 4KLZA 3GAFA 5HDQA 5CEEA 3IKVA 2ZIWB 3S3TA 2JLQA 2RBEA 4Z0NA 4AZVA 2RC5A 3EQ9A 1ZNZA 1P7WA 3HG7A 2VYFA 1A5BB 3NTLA 4ZT5A 3C6YA 2QRNA 4LQCA 2FZLA 4ZEOA 2KM1A 5I7VA 4PV7A 2A9FA 4BATA 1S3IA 1USIA 3KB8A 4KXXA 2I1LA 3HU1A 1SG9A 1YMUA 4MUFA 2GR9A 4RPLA 3PC6A 1PNOA 4EG7A 3EH1A 1AKQA 3UOAB 2W93A 1UXJA 3GLSA 1WUYA 1JHVA 1O03A 4RKWA 3U9SA 3UT5B 5FUXA 1IJKA 4B31A 1R0KA 2QQGA 3IKMB 5CA0F 3K8YA 3L01A 1FYDA 3HDJA 2R66A 2C9YA 2XOKA 2WZCA 1U3VA 2C5FA 3OFJA 5K8IA 3QG1A 5L95A 2HLHA 3WQHA 2D2IA 1I5EA 3H6HA 4LHXA 3ONWA 2QTGA 2ZI6A 4NYIR 3H75A 2BTQA 4TWBA 3PNSA 2YZGA 5H5JA 4LHYA 5C1OA 2RHCA 3FB4A 2Z3VA 2AEMA 5DGHA 1T1IA 2V3VA 1NC1A 3JYLA 1VGQA 4JUDX 4OLAA 1DO0A 2TMDA 4UUMA 4CMEC 4WX2B 2Y8EA 5LQAA 4LC0A 5ALWA 3BH0A 2ODQA 3V8QA 1FBTA 1K0FA 1YR1A 1J8YF 1ZI8A 3AHDA 4RVCA 5DEOA 2WD8A 1RMTA 3GLVA 3NG1A 1RXIA 3DWGA 3X1DA 3H0CA 5KCZA 4K6KA 3PVSA 5FBRB 4W1RA 2XEDA 3DCNA 3SBXA 3A6LA 1HQKA 3OLQA 1OXKB 5WRFA 4ENWA 3A9WA 1GEGA 4Y1RA 4TTVA 4EJMA 2ZBDA 1P62B 4EHDA 2JEOA 3D0KA 2PZ8A 4UOQA 2O8BB 4R98A 2Q2WA 5E3IA 5DE3A 5KYGA 2I71A 2V6GA 4TUYA 3P7MA 2CLMB 4JAVC 4TX1A 4Y6SA 3ZXIA 4EY8A 2HYDA 4HS4A 2C2MA 2NXWA 4Y6LA 3G2IA 3OUZA 1CZNA 1HZJA 3QKRB 1BKDR 2OO7A 4PLVA 4L0QA 1WB5A 2HFKA 4BOYA 1ZSVA 4GVPA 3OOYA 2XTMA 3DD5A 1D6JA 1ZD3A 3CX4A 3JWHA 4RL4A 5CW2A 3WNVA 1FYEA 3S1LA 4ENRA 3O4RA 1T1RA 1VJ5A 3E8MA 4FYWA 3X1WA 2YRXA 3T1OA 2Q28A 4MVYA 2OD9A 1N2OA 3ZOKA 4L7QA 5EXDA 3WJ7A 1JR6A 1CK4A 3I30X 1AQJA 1JJVA 3G9UA 1QE0A 2WNSA 4FFOA 4D9JA 4XRGA 3VPHA 1R0SA 3DE0X 3JU3A 4Y2JA 5DF1A 5FNVB 5G4KA 2X7XA 4V0KA 2ZTLA 4UEKA 5LYJA 4GI1A 3VRHA 3D8SA 1XRNA 2IW3A 1EM8B 1IUOA 1QRAA 2TS1A 1KJ8A 1RYHA 1HE5A 2I7VA 2QTAA 3M1AA 1GUBA 4JKIA 5JANA 1BS2A 5A7GA 3RE1A 3BAZA 1YL5A 1HLDA 2O05A 4WEOA 4R8MA 1Y9AA 3NM4A 3ZDAA 1IRXA 5JSHA 2HSEA 4XGIA 3H5RA 4MUHA 3QVTA 1C3OA 2JGEA 2JD0A 3AKEA 4NNJA 2G9QA 4GYJA 5J4LA 5CLJA 2YHUA 3VR3A 1AV7A 4GSLA 4NFSA 1FFCA 2CCKA 2QN7A 2VJMA 4I8DA 4QDTA 4F6RA 1OH6A 1QX3A 2DTDA 4D0NA 3PC8A 5JEDA 4F38A 4EF4A 4NCIA 3RAGA 1JPNA 2I66A 4JFAA 1RXEA 5CH8A 2IH2A 4BO8A 1XRMA 3VZRA 2QAGB 1A9ZA 3Q12A 3VPXA 1SHTX 1XMVA 4Y6GB 3QOWA 3E61A 4YAEA 5FWYA 1ESNA 1UKYA 1VIMA 3BL6A 2XUPA 4M0CA 2HPZA 4BNHA 2PQ2A 5AUNB 1WABA 5FTMA 3GPDG 4MWZA 1HFJA 1QHNA 1BXRA 4M22A 4WA7A 5GJWC 2WFMA 3U4AA 2DPXA 2XTAA 4AKTA 3KUXA 1DFIA 1J2YA 3LOPA 4H7HA 4KPUB 2B0CA 1T2EA 4MKFA 1J24A 1TUBB 2I8AA 4MLPA 4GO1A 1PS9A 1WW8A 4NX2A 4YRDA 3P8ZA 4P53A 1JEOA 2IU0A 1Y5MA 4OO3A 3TZ6A 2CHGA 2HWKA 2HXYA 2I6XA 1XDDA 3QMWA 2JIRA 4LF4B 3TKYA 5LDDC 3FZGA 3RJTA 1A98A 1KY4A 1VPTA 3DE1X 2DBQA 4LRQA 3WMWA 1EX6A 4Q4AA 1AKMA 3UENA 4A0QA 3AXTA 4OX9Y 1C3XA 2QTVB 2X4IA 3KT8A 3VU0A 4RMIA 3FLMA 4TYNA 1LRKA 3NNDA 2NYUA 3QFHA 4X6XA 4M49A 2WUFA 3VR4D 4HNAA 3DTVB 1TAGA 5HJ7A 1QK4A 1Y3DE 4OHYA 3E5MA 3RM3A 2IGTA 2P3SA 1FUUA 2GDJA 4F2WA 3U3OA 4D9FA 4DQUA 4HD8A 1PKXA 1Z45A 1D9XA 3QF4A 3FOZA 2AZ4A 4YA6A 4D3DA 3CRRA 1PDOA 4IV0A 1JTVA 5D7BA 1DO8A 3SEQA 4WGFA 2C2XA 2GD0A 5HVNA 2F90A 2G0TA 1F38A 3GBPA 1KK2A 4GPBA 1BX0A 2W42A 1OAKA 2QQ5A 4JV5B 1AK2A 1NA5A 2XPCA 3K70B 2BFCA 2F6RA 3LL4A 1T2FA 3M6AA 4UE6A 3TS1A 4HNUA 3KLPX 3L4BC 3BWYA 1MC5A 3LDUA 1W6RA 2OXIA 5BWCA 1TMKA 2OO5C 2PCJA 3GNLA 3JQGA 3KTFA 3UGTA 1CUVA 1V1MA 2X0NA 4U2GA 1VBKA 2VN8A 4R6XA 2YV3A 5LXTA 1KJJA 1ZIPA 1JXQA 3C41J 4RO0A 3DYIA 2Z0MA 3RB8A 1N5OX 5KTKA 2REQB 1A8PA 3M9LA 3UBTA 2W70A 1HKUA 3RBAA 2DPHA 3WWEA 3HO1A 1OFTA 4KE6A 1N6NA 4KI0A 3IPYA 4XTCS 3R40A 3PJRA 3F78A 1RHKA 2AVNA 2N3ZA 3IE0A 2GKSA 4AI6A 3QA9A 1CUDA 3IP9A 3AF2A 4KQ9A 1RXWA 3WJAA 1A9SA 4G9BA 4JH0A 4LZNA 2BGRA 3UVEA 4Z3OA 4KQ6A 1TMYA 4PLHA 1CS0B 2PXCA 2Q50A 5LUBA 4FGSA 4ZHQF 3KWFA 4M1EA 3SS8A 3AVWA 1EDOA 4C0BA 2AVDA 4EG6A 1J25A 2WV9A 2ZETA 1OC2A 3AI2A 4MWBA 2PTHA 3B7GA 1ZD5A 1R4NB 1TEHA 4QOIA 4QBGB 1OREA 2EBWA 4TXNA 2WDPA 4KFSA 1EWQA 2HSGA 4TQUS 1E2DA 3UJHA 3S1AA 1YUBA 4FMCB 4LRSB 2AFRA 2BF4A 2CKMA 3DZBA 5K0GA 2HHHB 1NJSA 1BQ3A 1Y5NA 2LTAA 4R1PA 3THXB 4G0OA 1TVKA 4MAFA 4HH0A 2SHKA 4YDSA 4YV2A 3H8VA 2XKAA 4L2IA 4P35A 4QQFA 4EJSA 2ZUBA 4PNZA 5C80A 5LL6P 4U7DA 1R00A 4BO0A 1JNXX 1GQRA 2D3WA 3NDPA 3BREA 1LRJA 4K6FA 2C0QA 5JQGB 2NSYA 3L6RA 1C1HA 2ZQ5A 4TLEA 5HIIA 4DY4A 4N5MA 3M4ZA 2UYHA 3BKWA 1XMOB 1SD1A 4EYOA 4CFZA 1D2EA 3PEYA 3IUYA 4OAQA 2ZI4A 1PT8A 4GH5A 4URYR 5KB3A 4MYUA 3PDIB 4YRQA 5DMXA 4PQFA 1BTOA 1DRJA 2QRGA 3CEPB 1W52X 4Q0MA 2XCTB 1E8NA 1W9MA 1O58A 5D51S 3SSNA 3TRJA 3PXUA 3U62A 1XD2B 4JB8A 4B45A 5C32A 1VIYA 2GN2A 4Q9AA <