4DT1B

Crystal structure of the psy3-csm2 complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
234
structure length
211
Chain Sequence
LKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVNFNFQLRGIVIDNLSFLNDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVYPTKLPDSYMKGMDLIIYREVGRPQYRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
total genus 60
structure length 211
sequence length 234
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16836 PSY3 Shu complex component Psy3, DNA-binding description
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1B00
4M1MA 3I73A 4FMBB 5JI3E 4TMKA 2BDTA 5HCIA 1KSJA 2VF8A 4TTQA 3SZRA 3TLXA 1G6OA 2QENA 4Q1DA 1J7KA 1KSHA 2BBWA 4BLPA 1E1RA 1Q1ZA 4MRNA 1HYQA 1OFTA 3KKNA 4CVNA 4NH0A 4EDHA 3A4MA 1BOFA 1XU4A 1ZYUA 2PT5A 1R5OA 3GQBA 2ODNA 2J5XA 2WOOA 5BN3A 4FMCF 2D62A 2ZYTX 1HEIA 2QTFA 3E2IA 3TBKA 4A2QA 4DLSA 4MGYR 4RJLA 3IEVA 5EXSA 2GJSA 3TVTA 4C0JA 1R5NA 3GFOA 1W36B 4RD4A 2H57A 3GLIA 1G17A 2IEZA 1K5GA 5FI1B 2BMEA 5FPKA 1KSGA 821PA 1IOZA 2ZJ5A 5CIWA 1EFUA 3RSOA 2JLQA 2WMNB 4BLSA 3CF0A 2RGBA 2A5FA 2REXB 3SOPA 1U0HC 3MCAA 4DLYA 4QL3A 2XOKA 4DHEA 1OXUA 3AH8A 4JL6A 4Q7KA 1AKEA 3AKCA 2QN6A 4ZPXA 4JIMA 2JJ1D 2QBYB 5IRCD 1NP6A 1ZU5A 2QT0A 5IF9A 3FDIA 2DHRA 3KJGA 3MG9A 2EFGA 2P67A 4OJQA 1QDEA 2QSZA 3W8RA 2R8RA 4LGMA 4G5GA 3T1VA 3U7GA 1Q57A 1SQ5A 1GWNA 4OK5A 4AD8A 4QM6A 3RVBA 2X1VA 4Q1FA 2RHMA 1DTSA 1Q1QA 4JVLA 2J9RA 5E7JA 1N2CE 3RRYA 3NEJA 1KTVA 1T9HA 1WQ1R 1YQTA 3PVSA 3PV0A 4F91B 4X8HA 2BMFA 2OAP1 4TYQA 4F93B 3BS4A 1LF0A 2FEMA 2FA9A 3JZAA 4Q1BA 5CYOA 5KDLA 5DHAA 1JPNA 2QGNA 1KJWA 1NKTA 1W4CA 3QBTA 5J47A 5KNBA 1E6CA 1X1RA 3F0TA 2NTYC 4I1VA 4B3GA 2C78A 3VFDA 1MO6A 4KODA 1XPRA 3SNHA 1CJKC 1G5PA 3AUYA 4BLQA 2XXAA 2B8TA 1ZNYA 4A0RA 4AKHA 3GLFA 4BEBA 3AV0B 5D3QA 2WWHA 3IKJA 1XB2A 2A5DA 4AI6A 3KZ1E 2H92A 2Z5FA 2P5TB 3OIVA 1FNNA 1T6NA 4HLQB 3WMFA 3F8TA 3QBVA 4Q7JB 4Z1MD 3SJAA 3VR2A 3G0HA 1H8HA 2LKDA 2I1QA 3MWYW 1U8YA 1QHHA 1W5SA 4PO1A 2YWGA 4Q66C 2IYQA 1HQYE 1W44A 1O3YA 1RIFA 3FTQA 3OIUA 1K8RA 2DWQA 4TQAA 5GJWC 1Z6GA 1T4GA 1W4AA 3JVUA 3BB4A 1PUJA 1SXJA 1Z06A 4F4IA 1DOAA 2GXUA 1I2DA 1WMSA 3HPQA 1YRAA 4MGZR 4A0GA 4B2PA 2VO1A 1G5RA 3F5FA 2ZYWX 5JS8A 4AKGA 3UK6A 4ZIRB 3LDAA 1ZD9A 2R62A 3CKLA 3EWAA 4V0KA 4A4DA 4NZYA 2ZANA 1GKIA 4U02A 3TR0A 121PA 3WBJA 3LBNA 4HDOB 4NONA 4YMSA 1R2QA 2XZPA 4HUTA 3KUCA 4RZUA 2J0QA 2XJ4A 1N5IA 4A36A 1KJYA 4CIDA 5KPJA 1VYVA 3PENA 3WYGA 5DHFA 1IY1A 1FP7A 1CR4A 2JLXA 1N0VC 1U99A 3TRFA 1W2HA 1RJ9A 2ODWA 3RANA 4C9BA 3HR8A 4ESVA 3ZVNA 4PAMA 4URWR 2JJ2A 2V4ZA 3CIOA 4QKQA 4NYMQ 3I8XA 2G0NA 3FKSD 4B3BA 4KFSA 1EK0A 3A8TA 5J40A 1X3SA 3HU2A 1R8QA 4CEJA 4URYR 2XNSA 3Q9LA 2BM1A 4TMVA 4BRUA 1NN0A 4MKGA 2WSSA 3ZJYA 1MV5A 3VHLB 3HWSA 3SEAA 4GT1A 1OKKD 5FOSA 3BJIC 3RS0A 1G3UA 1G4UR 2QP4A 1WCV1 1Q12A 4LV8B 5G53C 1XZPA 521PA 3SU8A 3T15A 4AWXA 4EQ6B 3K8YA 2Q9BA 2X2EA 2QSYA 2AR7A 3K70C 1W49A 3TR5A 4LJ5A 4ACBA 2BKUA 1VCOA 5F9HA 3RS5A 3L0IB 2J0VA 2HXSA 5KDDA 2PEZA 2RGXA 2GCPA 3R9IA 4IVRA 1OT3A 4MUAA 1AJEA 5FPYA 4MYCA 1N0WA 2WICA 1R5BA 3VMFA 2D74A 4RD6A 3ZVMA 2GCOB 1H8EA 1XRJA 1CJVC 1ZIPA 3DKPA 1N5JA 4HDQB 5EP1A 3D7MA 3GLHE 2O5VA 3KQUA 2HCJB 4LBWA 4QJ4A 1OXXK 3AKYA 1QHNA 3CB4A 5EXTA 4Q1AA 2WJHA 4R2HA 3NG1A 1RRCA 2GAOA 1IY2A 3K0EA 3MRSA 5CK5A 5DGXA 4A0HA 5B30A 3NIBA 4PX9A 5FPHA 1VG8A 3SDZA 4YC7A 3RSLA 2PEYA 5J4HA 4JL8A 3SYLA 3A1WA 1GUAA 1G9XA 2IXGA 1G5TA 2WKRA 1E32A 4B47A 3HDTA 4B3XA 3P32A 5BWMA 1AGRA 5CLQA 1COWD 4EFMA 1NY6A 1E9SA 2NZJA 2ZRDA 4ZO4A 5C4GB 2D06A 2MSCB 2Z4SA 2OM2A 3WMGA 3WXMA 3ICEA 2V6IA 1FMLA 1N6IA 1T8TA 1FUKA 2H8KA 1UBEA 2IYWA 4WA7A 4I99A 2IC5A 2ZXUA 1IY0A 2ZUDA 3EZ9A 5IK2D 2ZRIA 3AUXA 2BCJQ 4DSUA 1G3MA 3GJ3A 3GD7A 1R0ZA 2QPAA 3EX7C 3U4QB 5G3ZA 2ZQ5A 1QHIA 5J5CA 3B13B 3CM0A 3LV8A 3QG1A 4B3DA 3OIWA 2IYVA 4YMUA 2ATXA 3U7FB 4AK9A 4Z51A 2A7QA 4NU0A 3PXGA 1GM5A 2JASA 1CS4C 1P5ZB 3LVQE 2A9KA 2PMKA 1JAIA 1P72A 1V43A 1ZM7A 4QJ5A 1SVWA 1W0JA 3HJNA 4EJSA 4PZYA 2AK3A 4UXIA 3KQNA 1NMXA 1SZPA 5HCNA 1RW4A 5CB6A 3O8CA 3GLGE 1FNMA 1XTQA 4XOIA 4DDUA 2JLWA 4W5WA 2WM9B 1Z0AA 4DDVA 4OI0A 5JS7A 3UMFA 1KI6B 5JWHA 3THYA 4JSYA 5JFGA 2W6JD 3DKVA 5J4LA 2H5EA 3GLHB 2P65A 1XTRA 1W1WA 4BLTA 1R7RA 4PFSA 3PEVA 4BZQA 4EFNA 5FL3A 3IBYA 1G19A 2ORWA 3IILA 4CF7A 1Z08A 4KFRA 3FMPB 5FOVA 4U5XA 3WNCA 4RD3A 4Y0VA 4U00A 2ZR0A 4EJSB 3D3QA 1PVOA 2QI9C 4TT3D 3KKQA 2CEAA 4Q4LA 1IAQA 1Q20A 2VQSA 1S3GA 1LB1B 2BBSA 4B73A 3KKOA 4F4JA 1NKSA 4LBYA 2JIZD 4C0QC 3AP2A 2FFAA 1KI4A 4XWOA 4EIWA 4B74A 2JLZA 1GIAA 2GF0A 4ZCLA 2XTMA 3BOSA 5E95A 3HYRA 1WBBA 3FMOB 4Q1EA 2GCNA 4DJTA 4QRHA 1P9RA 1TMKA 1IN8A 3R7WB 1TUIA 2BCGY 1SVSA 1CXZA 4A2PA 3PUZA 2CE2X 4A0FA 1YR8A 1BMFA 1LF5A 4NYMR 4DLTA 4KXFB 1T8UA 2WMOB 2Z83A 2R6CA 3IGFA 2JA1A 1ZNWA 2EQBA 4OI1A 5DNYB 2J7PD 4B6FA 1RVDA 1TU3A 5KU1A 5JBQA 4PTLA 3AF4A 2QY9A 3NBZC 4FMCB 3PR1A 4PQYA 4HATA 5IDVA 1E2IA 1X6VA 1CJTC 1FUUA 2C95A 3NKVA 2BHRA 4HB4A 4HZIA 4KJZA 5HPYB 5CLLA 1W36C 5CM9C 1GKYA 1VIAA 2QQ0A 2ZRNA 5HKKA 3I5YA 2QUZA 4YXWA 2DWPA 3CRW1 4BFSA 5CB8A 2QMEA 4PHTA 4QM7A 4M2LA 1ZUIA 3FMFA 4IDQA 2CCKA 1BKDR 3CH4B 3CPJB 4AG6A 3ZD7A 4GNKA 4YLGA 1NLFA 2CLDX 2QAJA 1SHKA 3PITA 4WAUA 3LXXA 4HLUA 4Q18A 1MRNA 4D0NA 1S4QA 1X8JA 1JEEA 4NYIR 3UWKA 1E2EA 2VHTA 4HB2A 4MRRA 3BAFA 1P3JA 3G5UA 4EPYA 4E09A 1G3RA 1C4OA 5KPDA 1E69A 4ZIRA 3EIQA 1K6MA 5KYKA 4EUNA 1E9DA 4WXPA 1MR3F 5A0FA 2MSEB 2NO1A 4ABYA 2DBYA 1N3BA 4HEJA 3NXSA 4RSGA 4DCNA 1E2MA 3T06B 4P4TA 2D4HA 2CXXA 5L3RA 1WE2A 1Z6AA 2YZ2A 2ZRBA 3IO3A 3KB1A 3EASA 2J41A 5FUWA 4CGZA 2IK8A 2IF0A 3DM9B 1BYIA 3AEZA 4M8NE 2VF7A 4TSFA 2FZLA 5C4MA 4BFZA 2XXAB 1ZRHA 2EWVA 3KXLA 4ITRC 4IDNA 4N0EA 2ZSAA 1N6LA 2H18A 2WTUA 3U3RA 1KZGB 2GXSA 1J2JA 1TPZA 4I1UA 1C1YA 3FYHA 3ADKA 2I1VB 1KK2A 1E4VA 3QEJA 3LW7A 2VP2A 4BFUA 2RGNA 2Q9AA 4K46A 3AF2A 4DLZA 1KI7A 4WZ6A 2EFCB 1CRPA 1MKYA 1MO5A 4PSKA 1FOEB 1YZNA 2G77B 2RGAA 2XTZA 4B44A 2P6UA 4JBXA 2UKDA 1HE8B 1MO3A 4BZPA 4U7DA 3GJ6A 2H17A 1G7CA 3R8CA 4DIDA 1CR0A 1G8FA 3RYTC 3CRQA 1RRFA 4DSOA 1JR3D 1UKYA 4RVCA 1TQDA 1NG9A 3PUYA 3THXA 1N25A 4TL6A 2MSDB 4GP6A 3AF1A 3FVQA 4PC2A 1ZC4A 2G3YA 1G8YA 4NPHA 4D0GA 1VG1A 3X1YA 3I5XA 1E0KA 2ZS8A 3W3AA 1ESMA 3WNBA 4QJ3A 3ADDA 3KL4A 1NVVQ 1UFQA 4PSAA 4O25A 2GEDA 2ZRKA 5HZHA 2ZSEA 4PZLA 3SHWA 4QC2A 1XD2B 3CRMA 3SI7A 3Q8XB 2IHBA 1KMHA 3T1OA 1P61B 5A4JA 3CX8A 1OSNA 2D2FA 2FDCA 4RZXA 1AS0A 1Z22A 2PZEA 2H7VA 2HLDD 4XD7D 4EQ6A 1QG2A 2QROA 3JZMA 1X8KA 5DI3A 5IHPA 4MDEA 1W4BA 5EP4A 1DAFA 3P1JA 5DSZA 4LJ8A 4B35A 1ZM4A 3DZ8A 2QM8A 1NIJA 1MOZA 3QXJA 1IXZA 1RYFA 4LPKA 1I2MA 2PL3A 4G5RA 4BEJA 5FI0B 3SFVA 4N3NA 3BB1A 4P33A 5E7MA 3U4QA 1XXHB 1CR2A 3SFZA 1U2RA 4RZ2A 1DADA 4OL0A 5EE0A 3T5GA 5DO9A 2QT1A 5GJCA 3FPAA 2P0EA 3ASYA 2FH5B 3ND8A 2CJWA 3IPXA 1Z6TA 2OBMA 2XX3A 1KYIA 4JVMA 4TMZA 4TZ6A 1NL3A 1SXJD 3P26A 4RFVA 5DI3B 1UKEA 1JR3A 3AB3A 1UAAA 1KI8A 1RFLA 1OIXA 4DLXA 2JATA 3PG5A 1SVLA 1XJCA 1YZGA 4B48A 1KI6A 3THYB 4ZDKA 3NWJA 5FOTA 4DDTA 1XTJA 4Q5IA 2DCUA 3P27A 4GL2A 3M6AA 3GJ4A 1SVMA 2A5JA 3NTUA 3QF4B 2VP9A 2QEQA 3T61A 1F2UB 5CITA 4DSTA 1Q3TA 2EFEB 4US0R 4LYHA 4AG5A 3QKRB 2RCNA 4IFBA 4KSBA 3EPJA 2F9MA 5JLJA 2HDNB 5L3SA 3A1UA 1YZKA 3QG5A 4MQBA 2IXFA 3WYFA 2FE4A 4TMWA 1VMAA 3X1DA 1DG3A 721PA 2ZE6A 1NNEA 3BXZA 5FOUA 4MGIR 3ONWA 3QVVA 4JLPA 4PO9A 3BH0A 3W3ZB 4LBZA 1Q3HA 4OK6A 4CT5A 4D4JA 3IO5A 3KUDA 1O87A 2F9LA 3KKPA 4TTPA 1D9ZA 3OFNA 4FW9A 1HURA 2WPDA 4QG7A 4KLZA 4O2LA 3C4JA 4DBLC 1DAGA 2F3RA 2XNDD 1F2UA 1P75A 3KXIA 4DRZA 4UNQA 2NG1A 4DUGD 3LX5A 3MUFA 5GVSA 4WOPA 3CBQA 1VYTA 5L3SB 1NLYA 1W4RA 3MJHA 3LW8A 3L82B 1HQCA 1KMQA 3SBEA 2EWWA 4V03A 1PLJA 2R2AA 4QHYA 4RCYA 3UPUA 1UJ2A 3DZDA 2IEYA 4QBIA 5FUVA 2YV5A 2QMOA 2DPXA 4M1OA 3KQKA 1P2VA 3HPRA 2ZVPX 2CL6X 1CRQA 2GVZC 5KNCA 3NVAA 4V0MA 1EFRA 1E9RA 1OV4A 1NVWQ 2DWOA 3KTAB 1KO1A 4XVRA 1E2NA 3VHXA 4LCBA 3ZZ0A 1NVXQ 1HT2E 4OQNA 5C1BA 4A6XA 1XEWY 4P0TA 1ZCBA 1EWRA 4KV9A 1TEXA 3T1TA 1N6OA 3GJ0A 4YXWD 3CWZA 1KJZA 1W0JD 1NSFA 3PEWA 1XDBA 3K53A 1GNQA 1TF2A 2AFHE 4KO8A 4CEIA 3JVVA 4HZUB 4BWYA 3MWLA 1EFTA 2QG6A 2XAUA 1KI3A 5JMTA 4LY6A 3OESA 4L9WA 2W58A 2PX3A 4FN5A 1JAHA 2DFLA 3IIKA 2QA5A 2CDNA 2WAXA 1QHYA 2IT1A 1DG1G 1VCNA 1W0KA 1LNZA 2WJGA 4PAQA 4R98A 5FR2A 4TL7A 3LVRE 3BK7A 1FPMA 2UVQA 1M34E 2R65A 3K1JA 1MRSA 2ZJYA 4OQMA 1G8GA 2XZLA 1Q1EA 2YVUA 5F98A 1E9AA 1JXMA 1NJGA 4C30A 4NBSA 1R8SA 2FG5A 2P6NA 2GZAA 4OHWA 3AVUA 4XD7A 4BASA 4C0KA 1A82A 4LHXA 1ZD8A 3B7GA 5K8LA 1KAGA 1VCIA 1YVDA 1GOTA 3EARA 2VSFA 5BW8A 1PV4A 4FD2A 2ZJZA 4C7OA 3C8UA 1SKYE 4JZKA 3MJRA 4BFTA 2GJ9A 1GP2A 1JQJC 1JECA 5HR5A 1IQPA 2OCYC 5TVKA 4P32A 3PCRB 4BUJA 4FI3C 3ZD6A 1W46A 3MMPA 3AVVA 1XJQA 1LVGA 1WP9A 2FFBA 3K70D 1M8PA 4PQFA 3KFVA 2OEPA 2N42A 1IBRA 4Q7MB 1H8ED 2J1LA 4BLOA 2ZJ8A 3OEED 4JKIA 1XJ0A 3ZS9A 3RS3A 3PEYA 1U94A 1GRNA 1ZUHA 3A4NA 4KAXA 3ADCA 5LPNA 2G6BA 2FWRA 3TSZA 2AXNA 3HU3A 5KSOA 2ZREA 2ZJBA 2WIBA 2F1HA 3K0AB 1X8LA 3QUSA 3ADBA 4Q4JA 5FFMA 4XWAA 1T3HA 2G0TA 4ZKDA 1DELA 3MGCA 4HSEA 1CULC 1TQ6A 2VEDA 3TJZA 1NBMA 1X86B 2JLVA 3B6EA 2A5YB 3IUYA 4N0DA 2KBFA 4GI7A 2J59A 1QHHB 1Z6YA 1KO5A 4GFDA 4Q4AB 4GMXA 3H1TA 3Q3JB 1QVRA 2FGKA 4LJ6A 3T12A 4B6EA 1E3MA 4A6PA 4Q21A 1KO4A 2VP5A 5BQ5A 3K0CA 1E79D 1BMFD 5JEEA 1JR6A 3VKHA 3QPWA 4OHVA 1R0YA 4PC7A 1II8A 3I8SA 2I4IA 4WIAA 4ACAA 1XNJA 2WBLC 2AWOA 4OI2A 3C5CA 2RGCA 1S3SA 4H1VA 1A2BA 1CJUC 1KK1A 4HLDA 4ON9A 3AGPA 2CLSA 2QU8A 3EZ2A 1AS3A 1E2KA 1LV7A 4IDPA 1E0SA 2WJYA 1Z0IA 5FL7D 1IN5A 3QSYA 4ZKEA 3TUZC 2PMDA 1KSFX 2F1JA 4II7A 4DCSA 4NCHA 1NN5A 2ZAOA 1VIYA 4MA4A 1HH4A 2CK3A 3REFA 1OHHA 4NE2A 3WY9A 2G9NA 2CVHA 2ATVA 1UDWA 2OILA 3DOEA 4FCTA 1MO4A 4L15A 1SXJC 2GETA 2CJWB 4V0ME 5LBIA 5BYKA 1II8B 1JB1A 4Q9KA 3THXB 2Q3FA 5D3MB 1OXVA 4L5BA 3CR7A 2VIIA 3EA0A 1CBUA 2AFIE 3ECCA 3WP0A 3CF2A 1GG2A 4Q01A 4L8GA 4TL9A 3DOFA 4AY2A 2FPMA 4YDSA 3AP1A 4GMDA 4KLNA 5EXPA 4I1OA 4M1KA 1FFHA 1CR1A 1JBKA 3A36A 1XCGB 1E94E 1EX7A 3FB4A 3QXHA 1J70A 3A58B 4MYHA 4PSVA 2QL6A 1GKUB 3FFAA 2CHVA 2GESA 2IL1A 1KMHB 1GRQA 4EKDA 2F6RA 1YZQA 5ELXA 3QF4A 3U44A 2ZSDA 4BFYA 3ZQ6A 3E70C 4NDZA 2PZFA 4TLAA 4OK3A 2A3RA 3ZZUA 1FTNA 4IJMA 1XXHE 1Z8FA 3GEHA 5LDDC 3VNVA 4LYAA 2A2ZA 4IEIA 1T0HB 4IVQA 3GLFE 2ZRFA 3K0FA 1DAEA 3N70A 4IRUB 4NCKA 2D3WA 3RDPA 3A1SA 3LBIA 4LC1A 4HYYA 4IEEA 1Q21A 4DLUA 5IT5A 3LLMA 4DUGA 1XXHA 2WIAA 5IK2A 4ZI3A 1XZQA 3E5HA 4IXMA 3THWA 2YC2C 4BECA 4AURA 4IW3B 2WPDD 3Q7QA 3VR3A 5A5GA 5FPTA 3P20A 3RC3A 1HUQA 1TQ2A 2VHCA 4I4LA 4JLKA 2C98A 2CHGA 3LD9A 2VLIA 5AUQA 1KKLA 4PPGA 1WXQA 1HY3A 3MSXA 4DEXA 2QAGC 1E1QA 3DHWC 4QGHA 2CL7X 2XOKD 4RKFA 5JCPA 3SQWA 4URXR 4GRAA 3RRNA 4LC0A 1WRBA 4G0NA 4WW0A 1UDXA 3VQTA 3B78A 2DY1A 2QNRA 2WWGA 2CE7A 3B1VA 1OPXA 5E3HA 3AP3A 4XSHA 4C0LA 4V0LA 2B7BA 2KE5A 2ZRAA 3LFUA 2B7CA 3ZYCA 2ZSFA 4BLRA 1KZ7B 4KVAA 4PPQA 3EAQA 2WWYA 3BERA 3KTAA 2GBLA 1VTKA 4O0MA 1IN4A 2RGDA 1ELOA 1TQ4A 4G5OA 5AUOB 1DARA 3O8BA 2FSFA 4QGFA 4XTCS 4PC3A 3RABA 4NL4H 1W36D 3OHMA 3S1AB 4GOXA 3THOA 1Z0KA 2VTKA 5E4FA 2P2LA 4IOKA 2OE2A 2FEOA 4PQRA 1KOFA 5FUYA 5SZIA 4Z54A 4JLVA 1NF3A 5DI9A 5HZKA 5UKDA 5TMPA 2VSXA 1MABB 2ZAMA 3X1WA 4Q02A 4CEIB 1II9A 1P73A 1PUIA 3GLHA 2NO0A 2IS1A 1CIPA 1FP6A 3GJXC 2ZI3A 5DISB 3RNLA 2KSQA 4JS0A 2BM0A 3VR6A 1E98A 5H1YA 1QRAA 3H0KA 2Q3MA 5EE9A 2E1RA 3S1AA 1SKQA 1G41A 4UQOA 2IYZA 4AC9A 3TAUA 1P60A 2HCBA 4ZCMA 4YMTA 3NH6A 1E96A 4ZDIA 1TAGA 3UMSA 3A1VA 4CZ2A 2C9CA 1J99A 3CPHA 4DB4A 1ZU4A 4J0QA 1S1MA 1HV8A 4CDGA 1WF3A 1XCMA 3TW4A 1G6HA 4G01B 2ZSBA 2WJVA 5GJBA 3FHCB 2IA5A 2CCGA 1US8A 1ODFA 4WZAE 1ZBDA 4C7OB 3KDSE 1BO6A 1GVNB 1LW7A 4C0HA 4MGKR 1ZD1A 2OESA 4GZMA 2D2EA 3I92A 3V4RA 2V7QA 1GZSA 1OE0A 4LZZA 4V02A 1F48A 2ONKA 3V4FA 2ZS9A 4D25A 3GLIE 1ZM3A 4PPFA 4A8JB 2HXYA 1GL7A 1S0UA 3AVOA 3C7KA 3A37A 3IHWA 3LQQA 4IOMA 5CJPA 4A9AA 4EFLA 4FMDB 2BWJA 2VP6A 1PLKA 1SKYB 4V0OA 2JDIA 1E2JA 4AYWA 2GEVA 4R2IA 2BKEA 1XMVA 4TYWA 2DR3A 2ORVA 5TB5A 3CZQA 4NTZA 3CLVA 5DH9A 2AN9A 2CVFA 2O8DA 1U9IC 4EPXA 2VPPA 1A4RA 4K8OA 1ETUA 3VU9B 2BIFA 4QBGB 1Z5ZA 4QGAA 4X8MA 3W5JA 1WB9A 3Q5EA 4LPSA 4JLMA 4QNRA 1NG1A 3U5ZB 1QG4A 3SJBA 4A8JA 3PQCA 1AK2A 2QQEA 1E1QD 3AKDA 4OBEA 2QGZA 3R9XA 1R10A 3B1XA 3B5JA 2BMJA 4UXJA 3U7HB 2OG2A 2QMUA 3X1XA 1KO8A 4TSFD 4R7ZA 3L0OA 4G3XA 4Z8XA 1DE0A 2FFQA 3FKSA 1XBTA 4LRWA 5EJEA 3AF3A 4MUBA 2J87A 3ZQJA 2ZE5A 2O8DB 2VL7A 3VR5A 3KJHA 3EIEA 3VAAA 3SR0A 3BORA 3QKSA 4JLOA 2GTPA 3X2SA 2C96A 5DLQC 1N0UA 3BC1A 4IFEA 2IXEA 3PJRA 1K5DA 2GDJA 2C03A 5CIQA 2A5GA 5FTMA 4YMWA 2WZQA 4AKEA 4MDFA 2ZYVX 2HYIC 1OYYA 3NBXX 1AZSC 3OIYA 5J4KA 1OH5A 3DM5A 4POAA 3KJIA 5LB2A 1G7RA 221PA 2ZRMA 3SS8A 3ZVLA 1BYUA 3LA6A 3K0AA 4Q4JB 2EU8A 4DLVA 2BVNA 5D3MA 3RS2A 1S96A 4UJ5A 2J45A 4MRPA 3NHBA 1E0JA 4ZDJA 2EFDB 2EFHB 3KXKA 2ZITA 2O8EA 3KB2A 1DPFA 3C41J 1SGWA 5AR1A 2OFXA 4WZBE 4XVQA 1VKJA 3B1ZA 1CF4A 4W7SA 3BWDD 4XSGA 3TSOA 1YZTA 3U3MA 3CH5A 4D2IA 4TZ0A 4Z1MA 1Z29A 2JLRA 1VHLA 4TLCA 3CO5A 1TNDA 4FXPA 1U98A 4LJ7A 2R6GA 1E2QA 4L16A 3GP8A 4NCJA 3U44B 3EPHA 4LHZA 1XTKA 1Z0FA 1D8TA 5TV2A 2J7PA 3K09C 5EUMA 4B3CA 2V7QD 2WSMA 3AVYA 5TARA 4DXAA 1DAIA 4QGGA 1U81A 2ZRJA 1DS6A 1MH1A 3N5CA 1HA3A 1UADA 4HLCA 3TE6A 3GCGA 3W6NA 1G291 1JPJA 3K0FB 2DFNA 1I4TD 1KDTA 1H65A 3VR4A 1DEKA 1LFDB 2B92A 1NRJB 1Z2AA 1ZCAA 2C99A 3QEOA 4GBMA 3VTKA 4DCVA 1N6HA 2BMDA 1P9WA 1W47A 2RAPA 2PLRA 5L3VA 4IVPA 4P4UA 2FMXA 2NMVA 4TN1A 2GA8A 3BD9A 1XD2A 2YJTD 4IDHA 3WBKA 5HE9A 2F43A 2IUTA 4NCIA 1XPOA 4Z8YA 3TUJC 5E7IA 2PJZA 3IBGA 3W34A 1W2GA 2IYRA 4KFTA 3EPKA 2W6ID 4A1FA 1GL9B 2B6HA 1T3LA 2FOLA 4N1AA 4M1YA 4EPVA 1N6RA 4HI0E 4IOJA 1ZVQA 4Q48A 5KSZA 1KDRA 1XWIA 3TIFA 1L4UA 3AVXA 3DMNA 1GFIA 3N2IA 4KYIB 2BJWA 4M53A 2ZTSA 1ZAKA 2ZIAA 3IIMA 1B0UA 4JT4A 4HAUA 3TW8B 2Y8EA 3W9YA 1LY1A 3LWNA 1IN6A 3Q5DA 3R20A 1II0A 2GWHA 4JVSB 2F43B 4JBWA 5BYJA 3GJ7A 4IKEA 4L4UA 4TLEA 5C18A 5FTNA 4LSGA 2R6DA 4D4LA 2KWIA 4C2TA 2W6JA 3OEHA 4UXHA 3FHOA 1DVRA 1JEDA 1EG7A 2YOFA 3CX7A 5K8IA 1AQYA 2FPKA 4AYTA 4RKEA 4OHYA 2XB2A 1KNXA 1JQLB 3Q72A 2XSZD 4B2IA 3AVPA 3DL0A 5CK4A 2H16A 5KSPA 5J4YA 4HUQB 1IN7A 3EC2A 3FGNA 4NMMA 1Z28A 5EZ6B 5EE1A 4M1TA 5LD2C 3K0SA 5CDFA 2W0SA 1AZTA 3QOFA 3E1SA 4NYIQ 4E03A 3NC1C 1G18A 2WWXA 4FMDF 2KI5A 3UG7A 1RZ3A 2CNWD 4B3FX 3QI2A 1XEFA 3DPUA 4RY2A 5ANRB 2AWNA 2IYUA 4RZ3A 2CBZA 3QQ5A 2OXRA 2QRZA 4KCGA 1W48A 1Q1BA 1XEXA 3I61A 4XH9B 1NSTA 5LB4A 1XEWX 1D2MA 3QPUA 2B8WA 4NHOA 4W5HA 2C5LA 1ZM9A 2V8OA 2R6AA 3I72A 2W6IA 1HTWA 2IWRA 1XD8A 4FWIB 4DKXA 2FZ4A 3QJYA 1KI1A 4FINA 5EZ5A 2ZVQX 3ZIAD 3D31A 1G7TA 2HYDA 1ZINA 2GZDA 3L0PA 3NBYC 4HUQA 4M0LA 4ILEA 4NP6A 4TLBA 4QNMA 5EP2A 1OH7A 3O47A 3T34A 2QORA 2LCFA 1XD9A 1S9DA 1XF9A 3MFYA 2YKGA 1W7AA 3BBPA 3BRWD 1QVAA 4RFSA 3KKMA 4M1WA 5DIFA 4DCTA 1CP2A 1EGAA 2NQ2C 1OW3B 1S8FA 2ZU0C 3AQ4A 2JIZA 3MWJA 2W00A 2J0SA 1A1VA 2O0HA 1E79A 2RMKA 4B75A 8OHMA 4Q00A 2HT1A 3LBHA 2CLCX 3U6BA 4YMVA 2ZU6A 1RYHA 2IWHA 2XTNA 3K9LA 3CF6R 1D9XA 2ZJAA 3B82A 2IBMA 2XZOA 4XJXA 1TEVA 5AJVB 2CNWA 2QZ4A 4LYFA 2V54A 5EE3A 5P21A 3RAPR 3KQHA 2MMGA 2OCPA 1OXSC 3O8RA 2NO9A 2ZRGA 1MABA 1NBMD 2ERXA 4Q4HA 1H8HD 1IXSB 4OQLA 3QKUA 5CJ2A 5KSYA 3EWSA 4KFUA 2VRWA 1T5IA 1I4DD 4BRWA 4S35A 4PR0A 1JNYA 1KO7A 2KBEA 1YR6A 1GAJA 2O8FB 2Z0MA 2BBOA 2GILA 4Q9IA 2ORIA 2AKAB 2Q21A 1ZNZA 3ZDQA 2YINC 3WYAA 3GFTA 2REOA 2PCJA 4HAVA 3OF5A 1SXJE 1YE8A 4TQ9A 1QZXA 2GK7A 2FSHA 1CEEA 2RH5A 1I4LD 3BIFA 4TTRA 2O8BA 5G41A 5KTYA 2IYTA 621PA 1TF5A 1IHUA 3QXSA 2H1LA 1KI9A 3IDQA 3VU9A 4Q7LA 4E5UA 1GDDA 1NVVR 2NOAA 4CYMA 4D4KA 4DB2A 4JSTA 2ANCA 4LYJA 2ZJ2A 3WHLA 1GITA 2QPTA 4Q4HB 2HV8A 5H70A 3B8HA 3M4YA 4HZUA 4UKDA 4K81B 4TYNA 1GRRA 3TGPA 1SHZA 4JVNA 5EP3A 2DFTA 4P4SB 1AIPA 5CYPA 1SULA 5L3QB 1Z07A 1US8B 1OH6A 1M7GA 1AA9A 2OAQ1 1KK3A 1PJRA 5L8VA 4CEHB 5F3WB 1EFCA 3W6OA 4TQUS 5FOWA 3TMKA 1E99A 2YNMA 3IHLA 1PLLA 3U61B 1YZLA 4HAXA 2OHFA 2ZRCA 3NHAA 3VR1A 1FX0B 1JJVA 4DT1B 4LV6A 3QY0A 1G1MA 3TH5A 3Q85A 4BPBA 1U9IA 2HF8A 5FTJA 1P2TA 4D26A 4YQFA 3UMRA 5B2ZA 4D4MA 1QF9A 2TMKA 4UNRA 3RRMA 1TX4B 5JSZA 4JT2A 4ZDWA 2FNAA 2BC9A 1F2TA 5KNDA 4QXAA 5H8WA 1OYWA 5JRJA 4QFMA 1N5KA 2F1RA 1NJFA 5AUNB 1FQKA 2WKQA 1D5CA 2G88A 5JHGB 5JJIA 2AKYA 1UEJA 2ZPTX 1E0AA 3IQWA 3WNDA 4RD1A 3GLGB 4R71A 2IF2A 2OLJA 2X77A 5KOYA 1R4AA 2OFWA 2JAQA 1DBSA 1YHNA 5K8UA 1BH2A 1E4YA 1KI2A 4M22A 1S2MA 4M1SA 5C2JB 1OH8A 2WV9A 2I3BA 4JJKA 2REBA 3OEHD 5JSZB 2N46A 2RGGA 3EC1A 1E2HA 1F2TB 4WVFA 3IPYA 4I81A 4P31A 2A30A 4Q47A 2OCBA 4GZLA 2NIPA 1UBFA 1NIPA 1JI0A 4DEYA 4LX0A 1NMZA 1V5WA 3LO5A 2PH1A 3W6PA 4Q1CA 2VSOA 3M0EA 4D82A 4ZI2A 1E2FA 1QHSA 2WOJA 2ZE7A 1OB2A 2ZR9A 5AWFC 3NEYA 3P4XA 2BBTA 4Q4AA 3I1FA 4B71A 2EW1A 4S2EA 1FW6A 2Q6TA 2PLFA 3U6KA 2V3CC 1Y63A 3L43A 3DMDA 3L8ZA 5FL7A 2WKPA 2XJ9A 4YDHB 4B33A 5DYGA 1YR9A 3K9HA 4KITB 3KQLA 1U0LA 2QE7D 1R0WA 1E9BA 4MH0R 3WHKA 2R44A 2VP4A 1AM4D 1COWA 3WRYC 1AN0A 1F6BA 1M2OB 3AKEA 5GADl 4H9GA 2FPLA 2X8AA 5BXQC 4D81A 2IUSA 3FMIA 2KJQA 4L9SA 4D0LB 3QKTA 5JEDA 3GLFB 1SVIA 1IJFA 1OXTA 1TL7C 2IYXA 3QVUA 3DVLA 3QXCA 3SQXA 1FMJA 5AJWA 3LH5A 1UEIA 1ZIOA 2NPFA 3GJ5A 3HR7A 3SJZA 1N5LA 4GDFA 3PFIA 3CNNA 3TSWA 1S9HA 2AHOA 2W83A 5SZJA 2ZETA 2ONJA 2V9PA 4EJSC 3W5IA 1E2DA 5AJYA 3C16C 4JLBA 2VBCA 2ZR7A 3B9QA 2BJVA 3WRXC 1P62B 1RC8A 2ASEA 3PEUA 2WWIA 3B85A 4GSYA 2UZIR 2BEKA 4ARZB 4US2R 3FOZA 2GK6A 3RWOA 3UKDA 5C46F 1RKBA 1G16A 1J90A 4C3ZA 1ONBA 3C14C 5AUPB 5JI2E 1N6PA 1DO2A 1NBME 4TLDA 2VA8A 4XIGS 1GILA 4B32A 1EXMA 3ZGXA 2P6RA 4US1R 3RC8A 3GPLA 3CWQA 4KHZA 3TNFA 5G3YA 1OFIA 3UIEA 3V00A 4EPRA 1OKKA 2QTHA 3OE7D 4LJAA 2G1JA 1Z2CA 3TKLA 5FBVB 2R9VA 2WSSD 1XFAA 3W8NA 2LKCA 1RJ9B 3NBFA 2EYQA 1SVKA 1DAHA 4AKIA 2YHSA 4OHXA 2Q9CA 2WWWA 4ARZA 2FFHA 3MWKA 4PO8A 5DN6A 4IHQA 4B76A 3BFKA 3B60A 1KNQA 5FUXA 1T3SA 3U3JA 3NH9A 4JBYA 1G8PA 4JYBA 3RWMB 5DN6D 3LXRA 4ASUD 4B43A 2WAYA 3PIRA 3TAHA 4OJKA 5HTKA 3LY5A 4PAOA 4RFSB 3V9PA 3THWB 4MKFA 3QNUA 3ICQB 5JJLA 5DE3A 4A2WA 4JLDA 2JLUA 2J0UA 1NVUQ 3TVDA 5TY0A 3CX6A 3VNUA 4Q19A 4AYXA 4NYJQ 2OSBA 2W2TA 2Z43A 3TUIC 3T5DA 2R6FA 1LS6A 4MYTA 2WJIA 2PBRA 1VHTA 2GVDC 3VX3A 1TTTA 4Q03A 2EVWX 2ZM5A 3HU1A 3QIAA 2DB3A 2VH5R 3BGWA 2E9SA 1HT1E 1N6KA 4F4CA 3TQFA 4C4PA 5LD2B 2Q3HA 4TMTA 4HDCA 4P3YA 2V6JA 2RKOA 3DDCA 1E9CA 4HAZA 2MMCA 3C5HA 4JYCA 1G64A 1NN1A 4M9QA 4RD0A 1KKMA 4X8OA 3PUVA 4FCVA 1Q22A 1KK0A 3ASZA 4A15A 1TU4A 2E87A 4BQSA 1VPLA 3F3YA 2ZI6A 3U3OA 4OKSA 2VP0A 2OXCA 2AD1A 2QAGA 2O8CB 3HYTA 4WBSA 4A92A 2C9OA 3AGQA 1KHTA 3O8DA 1R6BX 3NC0C 3W90A 4DLWA 3TQCA 1MT0A 1WDTA 4IXNA 3OAAA 4KU4A 4DCUA 1FQJA 1TUEA 1M7BA 2L0XA 2YOHA 4Y0AA 1RPZA 4EPTA 4TWZA 1VYUA 1F60A 1X1SA 3WP1B 4LJYA 1CU1A 4PHGA 4BE7B 3QF7A 4OQFA 4PXAA 2QP3A 3NDBB 2HLDA 4UNSA 2WHXA 1IXRC 4G1UC 2ZRLA 1NY5A 2QMHA 3T35A 2OCAA 2WJJA 3FHTA 2CCJA 4JMPA 1FX0A 5CM8B 2FN4A 3UWOA 2D7CA 2V55B 2A78A 5F9FA 1ZUNB 1JJ7A 1OIWA 1VG9B 2O8BB 3VKWA 2JLSA 4MKIA 4QHSA 2ZS7A 4CW7A 1W5TA 5K8TA 3OE7A 4E22A 4BZXA 2FV8A 4TMXA 1D2NA 3GEIA 3CONA 5EE5B 3TK1A 2O8FA 3OZXA 2VHJA 4BFXA 1YJ5A 2C2HA 2FSIA 6Q21A 2NO6A 3U7EB 3AM1A 3LLUA 3ZH9B 2PCLA 2G1KA 4W5JA 2IYLD 1EFHA 1P9NA 5F2EA 2XGJA 1M6NA 4ZV4A 2NO7A 3FE2A 3CNOA 1T0JB 1ANKA 1G7SA 1PZNA 3CR8A 2PX0A 1ESNA 2FX3A 3UATA 1D2EA 3DEFA 4OYHA 4P4SA 4HAWA 4I1SA 3P4YA 2KB0A 4XVUA 2C77A 2NZ8A 2ZJOA 1OB5A 4CEHA 2RB4A 1A5TA 1LS1A 1R0XA 2WVJA 3SE0A 4E07A 5SZHB 4R9UC 3KJEA 4URVR 1AQUA 4QBFA 1GTVA 3EIHA 3DO6A 2OBNA 1E1RD 2JEOA 2ANBA 3FKQA 5AK0A 4B34A 1XMSA 4D80A 1ZJ6A 3VX4A 1FZQA 5KO2A 4O3MA 1XTIA 4DT1A 3IEUA 4ERNA 3GLIB 3PUXA 2ZI4A 5FH9A 2ODBA 5B64A 1KAOA 3FWYA 2OT3B 2AL7A 1KIMA 2K5UA 2AD5A 1YZUA 1L4YA 2GZHA 2PT7A 2IYYA 3UANA 2AXPA 2GAAA 4PZZA 4OI4A 5HE8A 1XCPA 4KBFA 4UNNA 4DLRA 1OJLA 3R7WA 2F7SA 1M74A 1P2SA 2JCSA 3C15C 4M9ZA 4Q9JA 4DDWA 3H86A 4G5SA 4LK2A 3ZIAA 3SC3A 4LUCA 4X8LA 1J8MF 2CHQA 2LWIA 2HUPA 1G3IA 2AK2A 3QPVA 5FR1A 3GLGA 3MLEA 2GJAA 4MITA 4CT4B 4PHFA 2CL0X 4EPWA 1W0KD 3BH6A 4JKYA 1OIVA 3I4LA 3QKSB 1ZM2A 4TT3A 2C8VA 3CNLA 3U3KA 2ZE8A 4MYUA 3SYNA 3UXMA 4DVGA 2OO7A 1CKEA 4GOKA 4ZCIA 2BEJA 2YOGA 5JJKA 4QBHA 2O0JA 1BS1A 4H1UA 1XP8A 1YKSA 3B1WA 1EWQA 1UKZA 1UKVY 3D6TB 1FTSA 5KDOA 3H84A 3AVWA 1IM2A 2GEUA 4LJ4A 1U0JA 1JXOA 4LI0A 1QHXA 4LJ9A 4C0AC 4FCWA 2PZGA 1A7JA 3LX8A 4O2RA 3ZVRA 2ZRPA 1RE0A 2O8EB 3CZPA 1VECA 1YU9A 5JWOA 5HKKD 1EFRD 2ZI9A 3BFVA 3REGA 4DSNA 3HP1A 2ZI7A 4XWKA 3A4LA 2VHUA 2PJRA 1CLUA 2O52A 4QOSA 1XMJA 4G5QA 4M9SA 4HB3A 1P4SA 4IOLA 4F92B 3I32A 4GP7A 1U8ZA 1ZMXA 3EZ6A 4KVGA 1QHGA 1NN3A 3SJCA 2HEIA 2XEXA 2IW3A 2Q0HA 3ND9A 5H68A 4JLNA 4JJZA 3K9GA 4HLUC 2C04A 2QRNA 2C9YA 4TL8A 5JHHB 4FWTA 1OHHD 1L2TA 2V1XA 1E2LA 2JLYA 1GNRA 3K0CC 2CK3D 4CRWB 2ZRHA 4GPTA 2QBYA 2FSGA 3EA5A 5TXGA 2P3SA 4YONB 3I62A 4PANA 3GMTA 1P6XA 3IQXA 3RRZA 1WBDA 2XNDA 5CDFE 3SYKA 4LHYA 1N6NA 4BGDA 1ZW6A 3QE0A 1F5NA 2HJGA 1JR3E 2J7KA 4A82A 4C0SA 4HAYA 3I3SR 4JLAA 3N2EA 1A2KC 4KSCA 4DZZA 3L8YA 4BFVA 1LTQA 4PC1A 1E2PA 421PA 2RGEA 2VYFA 2J3EA 4JLJA 4V0NA 1G8HA 2HJVA 2JGNA 3LAWA 5FBQB 1UF9A 3BB3A 5AJZA 4PHHA 2QPOA 1XPUA 2FU5C 2DYKA 3EW9A 1XX6A 4EAQA 4W9MC 5FTKA 1E9FA 1JALA 1DO0A 2B21A 3K9NA 1SVOA 4IDOA 3RS7A 2GXQA 5FPSA 3EZFA 2ZROA 4QHTA 3K09A 4OHZA 5BN5A 2SHKA 4HB0A 4UJ3A 2WWFA 1RRGA 2XITA 3UG6A 5B57C 2G83A 2ERYA 2OFOA 1NLZA 1QBKC 1Z3IX 2IS2A 2X19A 4CEJB 1Q44A 2RHDA 2F55A 2GJ8A 2GJKA 4TYPA 5FBRB 2YWEA 5BN4A 1Q0UA 2RGNC 1Z63A 3K70B 2HT6A 1P7CA 5J4VA 1IJEA 5KHOC 1AKYA 2OBLA 3IIJA 5FBWB 1KDPA 5JCZA 2YWHA 2W2XA 2F1IA 5JZVA 1WA5A 1XTSA 3H2YA 3SHFA 2BOVA 1Z47A 3WMEA 3QENA 2QM7A 4TYYA 3KX2A 4KBGA 1U90A 1OF1A 1SXJB 4BFWA 3X1ZA 2OV2A 4M4SA 2W2VA 2GHIA 4LHVA 1G21E 2X2FA 3CUEF 2QAGB 1UBGA 4A8JC 2YYZA 2O8CA 5M04A 2AX4A 2IHYA 4LDJA 2GCOA 5JECA 3ETLA 4WXRA 5DYIA 4URZR 2QP9X 2CMKA 1KY2A 1XEXB 4OQXA 4ASUA 1D6JA 1G20E 1TF7A 1UM8A 2FGJA 2J0UB 3CPEA 4RD2A 3RLFA 2VHQA 3G82C 3GFPA 5B58C 2NGRA 1RRPA 2BV3A 3BE4A 3ZLJA 1G3QA 2F3TA 2ZI5A 1C9KA 3LQRA 1GNPA 1XMIA 1DAMA 1AS2A 1ZNXA 4FIDA 2W0MA 3R9WA 4B2LA 3L2OB 2JJ1A 1Z83A 2HF9A 2GRJA 3D8BA 3BFXA 4LWZA 3EZ7A 3PUWA 1IONA 1Z0DA 1BIFA 2ODEA 2ZEJA 3H4MA 3MD0A 4UNPA 3A6PC 1Z6XA 3FFBA 5JWRA 2IS6A 4PC6A 1GL6A 1YR7A 2IUUA 3EXAA 2Z6VA 3GJ8A 3AF0A 1VCMA 1M1YE 1TADA 2DFKB 2V1UA 4KI0A 4KYUA 2OLKA 5GJVC 3MAAC 2IS4A 3AVQA 2FJUA 3ZS8A 4URUR 1OLOA 2JDID 2GBLC 5G40A 4DIEA 5FTLA 2GKSA 1U8AA 1ZP6A 3EG5A 2IYSA 1UBCA 1YRBA 4MRSA 1J8YF 2XSZA 4Q9LA 5JRZA 2OUKA 1Y3AA 1KDOA 4M21A 3ZZTA 1HE1C 3SN6A 4C0BA 1OFUX 1FL9A 3CW2A 1L8QA 4PPNA 2IX3A 1DAKA 1S1CA 4RCZA 3B9PA 3QKRA 2GF9A 5FOXA 3OEEA 4LBVA 1VG0B 3KFXA 2O0KA 4MKHA 3EPLA 1EESA 3U60B 4NKRA 4JL5A 4ESHA 5EXXA 4DWJA 1M7HA 4DC9A 1F3OA 2Z4RA 2ZUBA 2GXAA 3LRPA 3VKGA 5FBLB 2D7DA 5TDHA 4MRVA 5AJXA 3L0SA 2XB4A 4F38A 1P2UA 2GNOA 3M1IA 1UPTA 2FF7A 3Q7PA 2J46A 4LV5B 4M9XA 3AVTA 1EX6A 3RS4A 4LOAA 1KGDA 4Q9HA 2UZ3A 3R8FA 3A1TA 2N1BA 5SZKB 3RHFA 2QE7A 1G4AE 1T91A 1ZC3A 2YC4C 5KUTA 4C2UA 1E2GA 1E9EA 2JJ8A 2ZYUX 1NI3A 3CRRA 2QTVB 4XTRA 4LHWA 2ECKA 5L3QA 5GVRA 3NDPA 1Z0JA 2JJ2D 3T1QA 1AGPA 2OZEA 3GEEA 3B2EA 4NYJR 3CRVA 1CJMA 3J81k 1VDZA 3U2QA 4F7WA 1B23P 2NPIA 4GOJA 3BH7A 2ZUCA 3LNCA 2EYUA 1L7VC 1NMYA 2YWFA 3B1YA 3OFND 2P5SA 5EUQB 3SBDA 4AIIA 1GSIA 1CTQA 3QXXA 4NCNA 4D6PA 1T5LA 3OAAD 1KY3A 1OFHA 5EQTA
chains in the Genus database with same CATH superfamily
1V1JA 1AHNA 3KXDA 4M1MA 2JIRA 3OTOB 1HLGA 1V71A 4PCLA 5ALJA 3SZRA 1FLDA 1G6OA 2QENA 3WL3A 4IDAA 1QQ5A 4Q1DA 1J7KA 2BBWA 1KVRA 1Q1ZA 4MRNA 1DL5A 1HYQA 1T9ZA 3R4CA 3Q87B 1YB5A 2QTVA 3K6KA 4R7GA 4NH0A 3HKEA 1GTG1 3RYHB 3P2JA 1K7SN 1Y4DE 4EDHA 3QEMA 1GZDA 1T4BA 1XU4A 2AOVA 1QYWA 3GQBA 1U5AA 4AJEA 3ESDA 1H0HA 4Z0PA 1ENYA 2XWBF 2W7TA 3QMMA 3HN6A 4NAUA 3RVKA 4DLSA 2ZYTX 3R5FA 4DQLA 5ITSA 4EF5A 3H2GA 5EXSA 2GJSA 5IULC 4JB0A 1A5SB 3C3BA 2GM4A 3WTCA 1G17A 4OHMA 2DPMA 2IEZA 3HWWA 4J0DA 4L95C 1DDGA 4E31A 1Y3HA 1K5PA 2VDRB 3PGVA 3PUJA 4KMSA 2ZJ5A 1KSGA 1N32B 2JVKA 3M4XA 2WMNB 5EJMA 2XRZA 1HDZA 3CF0A 4XYMA 1WXEA 1XLWA 5EJ6A 4CKZA 1FJXA 1HDYA 3IHKA 3M9WA 4ISBA 4IIHA 3MYRA 4BP8A 4BNGA 3FRJA 2XOKA 4YAEA 2XQIA 3E9MA 3T0IA 3V6MA 1ZA1A 2DUJA 4UTRA 1AKEA 4CIAA 3AKCA 1CDZA 2QN6A 1C2YA 2QBYB 4ABTA 5IRCD 2WC1A 3IDSA 4XZ3A 4G4SP 3FDIA 3MG9A 1VSQA 1YDWA 2EFGA 4WY2A 3EG9A 1GZHB 1QDEA 3QY9A 3HCDA 4YP5A 2XGOA 4KR0A 4RJ2A 3TRDA 2XCRB 4WKOA 1ZR4A 5I45A 1F12A 4I8XA 5ECDA 1D6MA 2H1WA 4LEIA 4ZGBA 1Q57A 5DU2A 1GWNA 3WDLA 5HX7A 5BXYA 1QFJA 3HP4A 1Q1QA 2F4NA 3B6KA 4JVLA 3TX2A 2GD6A 1BW9A 2XUFA 1KTVA 1WQ1R 2Q5JA 4ZCSA 1B3BA 3PV0A 2DVMA 4EB8A 4X8HA 4BJ1A 4Y18A 3EDRA 5TQ0A 1NUPA 4F93B 4Q24A 3ITKA 2FEMA 3JZAA 2NSJA 3SF8B 1RLMA 2A5LA 3PP8A 4CGYA 4OUDB 4HO1X 5DHAA 4MVYA 1JPNA 1KJWA 4C4RA 1W4CA 1LPOA 1WCYA 1KZ9A 1T1IA 3LQKA 1N2CA 1N9KA 4YUAA 2CVOA 2WM8A 4JFRA 4KODA 1J1IA 1SU7A 4MOWA 3SNHA 3UN1A 1XXLA 1XPRA 4BX3A 3DOIA 1DG9A 1SBQA 3NW9A 3PFGA 4KAFA 4DBLE 2VPTA 6YASA 5F7ZA 4MZDA 4DGSA 1RADA 1W25A 3LT0A 3GLFA 3NETA 2ZIZA 4PSUA 3Q2OA 1L3BA 3AV0B 5D3QA 3E9YA 1HOXA 2CNDA 2R8EA 4YCDA 3TOZA 1YS4A 5BN4B 1RHJA 2A5DA 3K72B 5EQDA 2BEVA 3WSTA 4CKBB 1C0PA 1WR8A 5EZYA 1ZICA 4MV4A 4F8EA 4FONA 3VH3A 4S0XA 2G04A 1SIUA 4WFJA 3DA8A 2FSSA 1K88A 1X9HA 3RTAA 4Z1MD 6REQB 1PIWA 3WYNA 1H8HA 1AURA 5B4TA 1JHYA 4EUHA 2I1QA 3JVIA 4MGEA 2DKFA 1NJSA 1OMOA 3KYIB 4PO1A 2E0IA 1A9QA 2YWGA 3IQFA 5DP2A 4D9EA 2D8AA 3V55A 1W44A 2CSUA 3FTQA 3QSGA 3JVUA 1M54A 1SXJA 5CU7A 2ID8A 4WZBA 2RGRA 1U1CA 4G0PA 4RU1A 1Z06A 1DOAA 4L22A 3HPQA 3UFXA 1JFTA 5CX1A 1YRAA 3T7DA 1QO0A 2W8BA 2VNHA 4MGZR 4B2PA 3Q0EA 1G5RA 2IXDA 4D43A 4IJKA 2HWWA 4J7CA 2HLPA 4AKGA 3MWDB 1QFZA 2W6OA 2G17A 1JIVA 2R62A 3CIFA 4MA5A 2Q3CA 3C6BA 3KAKA 4NZYA 1FRVA 4G97A 2I3ZA 1E8NA 4FJ2A 4U02A 3TR0A 4Z5XA 4PLWA 1SHJA 4MR8B 2BI8A 3D81A 4RZUA 1QYIA 1MV8A 2XJ4A 2WQZA 2C4MA 1WHTA 1OX4A 4O5AA 4OAPA 3PENA 1OU0A 3OP4A 4ND1A 5EMNA 2YWRA 4JP2A 3S28A 1FP7A 1KHHA 1VE9A 1JN0A 1NM5A 1N0VC 2C4HA 2QPLA 3N58A 4QXMA 4GZ5A 4BVEA 3G9QA 4OUKX 1MJFA 1H9CA 1W2HA 3GVPA 2WYOA 2B0CA 5CNJA 4C9BA 3HR8A 2P8SA 4ER5A 2GLUA 4PAMA 4ESVA 3ZVNA 2V4ZA 3CIOA 1KIAA 4QKQA 4FOPA 3I8XA 2G0NA 3FKSD 3AFGA 4QQRA 2OO5A 3A8TA 2DC1A 1KJ9A 2FLVA 3PIIA 4LNUA 5J40A 4S1NA 4LZLA 4XGIA 5KTPA 2QVCA 2BM1A 3AOGA 1CS0A 4XUCA 5DGIA 4BRUA 2EGGA 1N2GA 2OFFA 4BAUA 2Q45A 3NFRA 3PPVA 5AXBA 4I2NA 3HWSA 5T3YA 3SEAA 4A2PA 2VATA 3JU3A 4DSZA 3BJIC 1Z56C 2QP4A 3HXKA 4LV8B 2MCFA 1LJLA 3RS0A 2HMTA 3CEJA 4TWBA 5FX2A 1YIOA 2P1RA 2HMVA 4Z4GA 2Q9BA 3OQJA 2BGUA 3QNWA 4MEAA 4MUJA 1SCIA 1QGED 3RKRA 4D42A 3D0KA 4MVJD 4ZO7A 4JKOA 3WRWA 3K1ZA 3KM0A 4TSKA 2ENWA 3L0IB 3QBJA 2PO5A 4FYJA 3ZCSA 1I6MA 3ED5A 1Y9ZA 2HXSA 4RETA 5J2UB 1N75A 4YV7A 5HKOA 3FCSB 3SZGA 2PEZA 1EM8B 2VXYA 3AILA 4IVRA 1OT3A 3D7LA 2Q6VA 1FJ2A 4MQUA 1BXRA 2LW7A 4TPKA 4WECA 5FPYA 3HS3A 1HT0A 3HCNA 4YAGA 3TS1A 3DV0B 1TZJA 1V7PC 5HJ7A 1ZIPA 3FNIA 1W8DA 4N7BA 2X0FA 1AKNA 2EHDA 2R8BA 3A2LA 3D7MA 3I23A 2Q1WA 5CVVA 3RV4A 1X2BA 1DV2A 3KQUA 3GEDA 3PQDA 5E8RA 3M5DA 4H0NA 5GV7A 1QHNA 2UXDB 3EBPA 5IYZB 1KQOA 4AZSA 3HA2A 3DLBA 4Q3OA 1M72A 5DGXA 3MRSA 2E82A 2O6LA 1E8DA 3V97A 4ETMA 5FPHA 3SDZA 5IVPA 2J31A 1SM4A 4YC7A 3RSLA 4ZT6A 3IAS6 5KYWB 5L7YA 5IAKA 5J4HA 3SYLA 1CZLA 1E89A 3FPCA 1G9XA 2IP4A 2IXGA 1SU8A 3NBAA 3GOQA 5CPBA 5CT5A 2OB2A 4NS4A 5D8DA 5IM4A 1AT1A 1NJ5A 2DBVO 4O8ZA 4B3XA 2JKYA 1QBGA 3ZZ1A 1B76A 1AGRA 4C20A 3P9YA 5T8KC 3LQFA 2P7HA 2CJFA 5CLQA 2C54A 8ABPA 1VHWA 1R4MB 4X7BA 2PKQP 1NY6A 2F17A 2I4LA 3FZQA 4MRMA 5AK4A 1V5FA 2L42A 3OP1A 4YRAA 2XVZA 2D06A 5E4JA 4WUVA 1R66A 1FFWA 3WXMA 3FETA 2V6IA 4KWHA 1WDWB 2Q4DA 1N6IA 1T8TA 2IYWA 3I3OA 4F84A 1DZIA 4KDFA 5HA5A 1ADYA 2NU8A 3T9BA 1GKKA 3WYEA 4ZICA 2BSQA 3F9RA 2ZRIA 1EWKA 1MOPA 3MINB 3N8IA 4DSUA 4ZHQB 1GA1A 1XNHA 2BTQB 4Q6WA 5DIZA 1G3MA 3ZD8A 1C8BA 1DQPA 1U3GA 4ZVNA 3SLKA 3ROGA 3GD7A 4Q4CA 1E6MA 3MJSA 2R7AA 1MORA 1T36B 1WB6A 1XRNA 2FK8A 3U3DA 3UCFA 3U4QB 5L4SA 3MUNA 3LV8A 1LBQA 5THXA 3OIWA 4LMAA 3D2AA 3EFOB 3WL8A 1C5KA 2PA0A 2XE6A 3VYSB 4HNGA 5HM8A 1HFJA 4Z51A 1VGVA 1Q6ZA 1CY7A 1XCLA 1GM5A 1JLHA 3Q88A 1CS4C 2DTXA 2GM3A 2WU8A 3CTMA 3R3YA 4PZPA 2PMKA 1P1RA 2Q5CA 1JS1X 1JAIA 1V43A 3EQ8A 3ROZA 3SEZA 2YUIA 1XZNA 3NGXA 1SOAA 3CGGA 3NNSA 5KTOA 1WZEA 2JAOA 1DRUA 3DGEC 3L6UA 4QJ5A 3SMQA 5EHXA 2AK3A 5FJJA 2YQZA 5ESWA 1YOVA 3KQNA 1O6FA 1RW4A 3F6SA 4MV7A 2VYNA 3W79A 5ALIA 1A7UA 1I32A 2D0IA 2JFZA 3NB0A 4XOIA 5IDQA 1BJTA 1Z6PA 1T9KA 2WG2A 2XCLA 2GASA 3M83A 4QYXA 4AZTA 3UMFA 5JWHA 2A9QA 1AMUA 4JSYA 3THYA 2CXRA 3O3MB 3TO5A 2G82A 5TLSA 3LG2A 3GLHB 1ES9A 3L4KA 4NV0A 2DX7A 4BLTA 1R7RA 2EFJA 1NTRA 1TJ5A 4PFSA 1NBWB 1E7RA 4EFNA 5DEOA 2G5CA 4HUJA 1EVLA 4K3UA 5DTEA 3BIOA 1G19A 4NF2A 4LECA 3PFWO 3FMPB 1ID1A 1EB9A 3CEMA 4BKRA 3RUCA 2NU7A 3D6JA 4P3XA 2QW0X 2IY7A 4RDXA 1J21A 4WZZA 3QUTA 4Z9YA 4M89A 1JFFB 1QIDA 4U00A 4EJSB 1H2EA 1P7YA 2C5FA 2YFKA 4RVNA 4QEDA 5ECWA 4E15A 3SWWA 4HDMB 2Z1NA 3H1AA 2FRXA 3BSYA 4M83A 4L6IA 4YQEA 5LXTF 1BE0A 1NVMB 4Y2PA 4WKBA 3I45A 4BCCA 1LB1B 2HZ7A 4AY5A 2WVGA 3CNEA 5AK5A 1FDOA 3S55A 1NKSA 4LBYA 5A03A 1G5HA 2AW3A 2FFAA 1MG5A 3HFGA 5E3IA 1YF3A 1QQAA 4EIWA 1EFDN 1JI3A 4NULA 3S81A 4I55F 2VCYA 1HNWB 3TI7A 2GF0A 1U1GA 2G40A 3D02A 1YO6A 3GF4A 5PGMA 3HYRA 4DR7B 2B9VA 5LDHA 4HG2A 1QK4A 1VJGA 5BYAA 2RHTA 1C2TA 3WZ2A 3AUKA 1XRLA 1P9RA 1B2RA 2H4YA 3LVFO 4E5VA 1ZW1A 1JIXA 2H4WA 3ENVA 3QV2A 4FFLA 4GKKB 5KYTA 1GJRA 3PUZA 1QMGA 2CE2X 4YP6A 4A0FA 2HPZA 2XTAA 1ENZA 1BMFA 3RYFA 1I1OA 3ND7A 2W11A 2Q5EA 4D44A 3EJ6A 1JH9A 4KXFB 4PNHA 3OOSA 4IFTA 5DFAA 4AWBA 3CZ4A 4E33A 3PNBA 3MMNA 2O2CA 4L2IB 3OPYI 1GGVA 3OJCA 2J6HA 4FYPA 4OI1A 5IT9A 4CKWA 2EZ9A 3Q2IA 1V8FA 3IT0A 3ZWXA 4F8YA 1EVJA 5BSFA 3N76A 3EXHC 2QX6A 1N4DA 2QY9A 3N6XA 1T1EA 4LW8A 4W6ZA 2KYRA 5F4BA 2M9MA 5EWMB 2PZAA 1E2IA 1GADO 1PHRA 4KJZA 4UMEA 5HPYB 5CLLA 3DWIA 1NQVA 4RWZA 2QTNA 3K0HA 2M2IA 1GTL1 4LHEA 1GKYA 1UXKA 2QQ0A 3FPKA 3ICOA 3VR5H 4WASA 4AM8A 3CRW1 4LZNA 4BB0A 2Z2JA 3L6BA 4JJ4A 2QMEA 5BVHB 2GDZA 2X0RA 3TR6A 1ZUIA 3FMFA 3JWIA 1M34B 2XMDA 4IDQA 4BNDB 5K6TA 3CH4B 4X1IA 2OLEA 2SICE 4GNKA 1ICEA 1OBCA 1AO3A 3PITA 2QAJA 3CW8X 4WAUA 5ES4B 4KN6A 3UAYA 1MRNA 1IB0A 1V8OA 1X8JA 4C6TB 1TUBB 3BTSA 5DLPA 1MEJA 4MRRA 3RSZA 5B7PA 3KQPA 3BAFA 2A0XA 3NEPX 1M2VB 4BPRA 1E63A 2O20A 2PMBA 2X8JB 2Q3LA 3HBLA 3LCMA 3LYHA 4NX2A 1L5RA 3SOZA 3WWZA 4E09A 5I7SA 5F2OA 1E69A 3GRCA 5CPFA 4NZ9A 4ZIRA 2GLXA 3BTUA 1NXTA 2O5EA 1NVDA 2COEA 4X3OA 1LBSA 1E9DA 3R74A 3ZK8A 3OJ0A 2NO1A 3CNQS 2HDOA 1BVYF 2DBYA 1PT9A 3GXOA 4HEJA 5BSRA 4YV1A 3DZCA 3PXDA 3T06B 3WFIA 4XPZA 3CFYA 4OUDA 1L4MA 4FJ0A 1QS0B 2D4HA 1C9NA 2BGNA 2H2DA 4JUIA 5B1EA 4AQ7A 3IO3A 4TS3A 3VO2A 3EVAA 1SUDA 4D02A 5BMVA 2ET6A 2OGTA 3PE4A 1Z4QA 4L8FA 2NU6B 1OPRA 1UP7A 2BGJA 4F04A 2XXAB 1ZRHA 2ZUEA 1NYTA 2ZSAA 3IVMA 2FJPA 3BL6A 1Z5UA 5B3JC 3KQSA 4FYYA 3UOGA 4DR3B 2EKQA 2WTMA 3U3RA 1J2JA 1TPZA 4I1UA 3H11A 4ZXPA 4B8YA 5FULA 3FYHA 1I94B 2A0UA 3ADKA 2I1VB 4KQEA 3I09A 3TW0A 4O4IB 4W82A 5LUBA 4EO4A 1QO0D 1VZ3A 3SLRA 4C03A 5JMWA 3PX7A 1NW4A 2WV7A 3BCRA 5TT0A 1U0SY 4RBNA 4DLZA 5A4DA 2GN8A 4LYDA 2EP7A 1KJQA 2ON6A 4AX4A 3N87A 1JTVA 3PJEA 3E05A 2QJFA 3HBFA 4CODB 1I01A 4PSKA 3DAYA 1UBJS 1V3TA 3NVDA 2G77B 2RGAA 2Y1OA 4J16C 4EA7A 5HYVA 2P6UA 3GRAA 1S2OA 1J1ZA 3GJ6A 1DAOA 3RUFA 3NAQA 4RF5A 1G8FA 5A7HA 3T94A 2PH5A 2GEBA 3RYTC 3HJCA 2IHZA 1JR3D 1K68A 1NG9A 1Q95A 3PUYA 4BZWA 4X3PA 4R01A 3ZHQA 4PGHA 4PVDA 4GP6A 3AF1A 1XZHA 5A9SB 2C2ZA 2JBWA 4IIJA 1Z8HA 3X1YA 1E0KA 4XJVA 1UPCA 4OGKA 1OAOA 1V45E 2RI6A 3W3AA 2CF6A 3HN2A 4FZRA 1Q92A 3W04A 1OX6A 4IDGA 5C34B 5U4QA 4O25A 5GTDA 4EVRA 5CEJA 2ZSEA 3KSZO 2WFAA 1H6BA 4Y9RA 3DD5A 4LDRA 4PLPA 1BCRB 3OQOA 2VF5X 3Q8XB 4RTMA 3FOWA 2ZW9A 4WACA 5ALOA 4AMGA 3HJHA 4DMMA 5K3EA 3T1OA 1OWNA 2O54A 2ACWA 2QS9A 4BBZA 1NZFA 1C9DB 4ZEOA 1WD7A 1IU9A 1YR2A 3FWZA 1I5EA 2UVDA 5B6IA 5FWYB 2UZ1A 1BD3A 2HB6A 2WJ4A 8MHTA 4KNVA 1Z22A 3U81A 2H7VA 4XD7D 3X44A 1Q50A 2Q1SA 2Q46A 2QROA 3JZMA 1X8KA 4O4LB 3ANNA 1W4BA 3JTMA 1UAYA 2IU3A 4RXUA 1DAFA 4QA9A 1EE1A 4X1KA 1Z75A 3ISVA 1NIJA 2ENUA 2JGRA 2AQHA 3KC2A 4B84A 2QX7A 3DTVD 1MAHA 3JVEA 1U9JA 1V8DA 1XTVA 3BB1A 4OIMA 5ALZA 3SFVA 4BVLA 4DRXA 5AW7A 5JNRA 1XXHB 2Z57A 3G02A 4RA9B 2C92A 4JI5B 1U2RA 1NYRA 3ANLA 1DADA 1IQUA 4OL0A 3QK7A 2VH2A 4RF2A 5DO9A 4ZJYA 2HLHA 4Q7QA 1DGQA 1JQAA 2FH5B 2Y71A 3F8SA 3ND8A 3QHAA 3E7FA 2OBMA 3EOAI 3I0ZA 5FFFA 3PX3A 1W581 3TLAA 3ZIUA 1SUCA 4R41A 4JVMA 4KUGA 1XUOA 1NL3A 1GXSA 2YYYA 4NJEA 3RT1A 2BI7A 1W5AA 4RFVA 3G2IA 3AM4A 5DI3B 3UK2A 3C87A 5BMVF 3OCJA 1DKMA 2DQYA 3EVCA 4BTVA 1GEEA 5JISA 1OIXA 1BMDA 1H0KA 4ZU6X 4OMCA 4FN4A 4ZAZA 3ZWPA 1VIDA 5K7SA 1Z74A 3GX1A 3ZY5A 2VOEA 1FDWA 1KI6A 2WSIA 4ZDKA 5C81A 2TECE 4DDTA 1Z5WA 3A7EA 5DHSA 4JI1B 1RZRA 1PTJA 2IDKA 3O8OA 1KR2A 3R40A 3TQRA 5EIFA 4ARCA 1NUUA 2WQ6A 4JC5A 1TLFA 3WIEA 2AYYA 2VP9A 2B4KA 4XIYA 1ZGAA 5CITA 2EF0A 3TTVA 3PXEA 3RHSA 5KTSA 4XUEA 4US0R 2EX1A 1XCBA 5TGDA 3VC3A 1KEKA 4EH1A 1SCUB 2Y6UA 3F98A 5ENVA 3COZA 3QG5A 4WCFB 3FAKA 2IXFA 4KAAA 1NQWA 4RDIA 3OO0A 1DG3A 3BFPA 1M6EX 4MGIR 3JR3A 4JLPA 3P5SA 2JH8A 3QWHA 4PO9A 4WADA 3U80A 5MN6A 1I24A 3KUDA 4GOLD 4TTPA 3E9ZA 2V7EA 3HEBA 1P77A 3BK1A 3OFNA 4L5JA 2WIFA 4C4AA 3DLHA 1HURA 1Z7YA 2HMSA 2XMGA 4K1LA 4O2LA 5LOVF 1BQEA 3IYLW 2MR6A 2CXSA 4M8SA 3OUTA 1SELA 2JGDB 3DL7A 3AL2A 4KYVA 1C4KA 1F2UA 4UHJA 1K7FB 3SZOA 3TTTA 1H3FA 1D4ZA 3L92A 5GVSA 3LA8A 4WOPA 4REOA 4J9UE 5LQKA 1VMKA 2Q3BA 1ZFNA 3DMYA 2C82A 3AINA 3VM6A 5L3SB 3R2JA 1VMDA 4DLLA 1W4RA 4M7PA 3R75A 2ALJA 2ZR8A 3MJHA 3CVYA 2MIIA 1HQCA 1Z2PX 4Q39A 5LZ2A 3TRIA 1JIIA 3LYLA 5HVNA 1PLJA 3I04A 4QHYA 1YJBA 3VR6D 2X0JA 1BDMA 1FSZA 3CN7A 3DZDA 3F4KA 4LE1A 3A9CA 4PGAA 4PM4A 4QBIA 4R1OA 4RK0A 4W1QA 5I3CA 3MWGA 3KQKA 4HXEB 3HUTA 3MTQA 4C29A 3OCUA 2HNKA 1TK2A 3PSHA 5KNCA 1XT6A 3EEYA 3NVAA 1EWYA 1KA9H 2HU8A 4PIMA 1I14A 4RACA 2PMCA 1NVWQ 4XVRA 4B6PA 1J8QA 2FW8A 1M76A 1O5IA 4FU0A 1E7WA 1QF6A 2Z6AA 2PUGA 3JZFA 4P0TA 1UK8A 1KE1A 3H2KA 1XIVA 2FZEA 1NM5C 4H4CA 5FIUA 3TD2A 3QUCA 2B8NA 4TKVA 3C5VA 3K6SB 4YXWD 3I01A 3UYKA 2P68A 3GCZA 4HDMA 1WMDA 5SYAA 1IPEA 4NESA 3NJ8A 4U7WA 5F76A 1T3GA 2F3SA 2Q4TA 3DOCA 4HEHA 1DEAA 4N6GA 1T4DA 5I7EA 1NQAO 3IE0A 1CYDA 3FOCA 3M1AA 2AFHE 3L6EA 4KGVA 5I4BA 5IJZA 4HZUB 5FTWA 3G85A 3G6KA 2I2WA 3T5CA 4IXDA 1J0EA 5HK9A 1KAQA 3FNHA 2WF5A 2P69A 3O9VA 3MJVA 4OB7A 2PX3A 3WOVA 4Q1VA 2OECA 3VHXB 4JC4A 1WHSB 1AQIA 4DIBA 3Q1KA 3DZFA 3GEGA 1VCNA 1LNZA 1YI1A 2X1LA 3A4VA 4KK3A 1T26A 4TL7A 1ZCZA 4IRXA 3S2FA 2UVQA 4TKUA 5K09A 2B35A 2YXLA 4FE7A 5CRIA 5H0IA 4KR7A 3LC1O 2X8LA 5EHIA 1ZWLA 4FZVA 4A8HA 4FEYA 2RH9B 3RADC 2NUPB 5K6AA 1I80A 1JXMA 4IUDS 4J3FA 3EGCA 4EZEA 3KV3O 2RHOA 2UDPA 5E2IA 1ZIYA 1L7PA 2P6NA 4DBVO 3SC6A 4OHWA 1LRLA 4X91A 4XD7A 4ZV9A 3AVUA 1HT3A 1ZS9A 2X58A 3VISA 4V0QA 2P9QA 3F90A 4UULA 1YVDA 1AUOA 1R3DA 1JDJA 2OHHA 5KEIA 2VSFA 4ZT4A 2FWAA 1WSWA 3E82A 4J76A 1O97D 3O9MA 3WISA 2ZJZA 3ZCRA 2ODTX 4TKZA 1U02A 1GP2A 1D8AA 1JECA 3FXAA 3LT4A 1IQPA 5U9CA 1IEXA 1UBSB 3FUTA 3BKXA 4BUJA 1XP5A 4GE3A 4FEEA 4RWEA 2PTGA 1Y0BA 3D6NB 1PFUA 3D8NA 1UT6A 1OCEA 2DQZA 4TKLA 3KAJA 1XJQA 1RWNA 3PXXA 3LBAA 1WP9A 3K70D 4C43A 4X93A 3A3YA 1R0RE 3KFVA 3HBNA 1XROA 2OV4A 4Q7MB 1H8ED 2J1LA 1YAJA 2VZLA 4K6CA 4MS4A 4NXNB 5KOIA 2IU4A 3LLVA 5EMLA 2YDYA 1XJ0A 2YVKA 5TQVA 1AHIA 2GN4A 2AF3C 2H7CA 4Y2GA 5LPNA 1Y4UA 4XARA 3IT2A 4DFDA 5JPDA 2XLCA 3SX0A 2ZREA 2ZJBA 2C7RA 3KTFA 2Q07A 4ENUA 4YLYA 3MGCA 2QTZA 1CULC 2VEDA 3TJZA 1X86B 5L4LA 2E37A 2A5YB 2G7MC 4RHCA 4CDNA 4Q0MA 4Y6PA 3ZLUA 2JHGA 4B4WA 2XEDA 4GI7A 5AI8A 3INRA 3ESQA 3RPEA 4NNJA 1SVUA 2AMJA 3RAJA 3TFOA 3G0OA 3MTJA 4GFDA 1JG4A 2FQYA 3V34A 5BMVB 4E4YA 4PRLA 4KXLA 4B6EA 2I2FA 2NU6A 1OZGA 2VDOB 3K92A 4Q21A 1ID8A 4RSMA 2VP5A 3ZI7A 4TOIA 3IBTA 5BQ5A 3ZYZA 2PSEA 1BMFD 2VQDA 2ZSJA 3KT6A 3VKHA 4NU8X 3QPWA 3SKYA 1KOGA 4QPCA 1OI4A 3ENKA 1T8YA 4ACAA 3I8SA 2I4IA 2Z8ZA 3AERA 2AWOA 3A05A 4L07A 2YQ5A 4HDAA 4G0YA 3MLBA 2JA2A 3KQMA 3JQQA 2PLAA 4O4IA 2CLIB 4QQFA 2Q2WA 2CLSA 5AOCA 3NVKI 1K1EA 5ALHA 1QAMA 2FN3A 4DDHA 1LV7A 2NYRA 1ZEMA 2G1AA 4RY0A 2C7BA 4AJLA 5HF9A 2PKEA 1EJ6A 3FR8A 3QSYA 4IIEA 4HL6A 3L79A 1U3UA 4DCSA 4RH1A 4ZN6A 3VC2A 1TJ4A 3R9KA 1Y1PA 1YL6A 3IEXA 1OXBB 2CK3A 3KPVA 3NI2A 3VDRA 4BQRA 1KEUA 4YMIA 3H75A 5AKEA 1XDZA 4LNUB 1ZISA 3DOEA 1UDWA 3SIWA 1BE1A 1X1QA 1MO4A 4RXMA 4L15A 1AGNA 4BE4A 2WE8A 5KVAA 5BYKA 4XCVA 3ZV5A 1INLA 2EKPA 4QU0A 1OXVA 5H9VA 3WGOA 3DOOA 5LP1A 3WP0A 4IHKA 2YXDA 3CF2A 1YR1A 3IA7A 1EQUA 5D2CA 3DO8A 2EKDA 3VSDA 2AG8A 3Q0TA 3RREA 4KLNA 3WLIA 1G5QA 1UXOA 3FIUA 2IUFA 1R4NA 2ZB2A 5CCDA 3DAFA 5LXTA 1YFZA 5ALMA 2BEWA 3O74A 2Q1UA 1QIFA 4HFJA 1UC8A 3A58B 4NFYA 2C9ZA 3EGVA 4ZYYA 5KHLB 5AKGA 3FFAA 2BONA 5E9JA 3C4VA 1P91A 1UZNA 4EKDA 1YZQA 5ELXA 3QF4A 3O3NB 4KTVE 1GPUA 4JOCA 2QVXX 4EKIA 3ZQ6A 2WFMA 2W2KB 3WRXA 2XCTB 4MQEA 2A3RA 3EWIA 3SSOA 5FQOA 5GP1A 3AIKA 4LZWA 2PSDA 3OJOA 2H0QA 2X9QA 1Z8FA 4J2HA 2OZLA 4LYAA 1ESZA 2UVPA 3WGQA 2ZCVA 1G42A 1BRTA 3K0FA 4NCKA 1PJZA 2FPPA 2IP1A 4RKRA 3RDPA 3BRQA 1UBKS 2PAFA 4LC1A 4Z9AA 4IEEA 2L82A 4LY3A 2HQRA 1XK7A 1U3TA 2AI2A 2RHCA 5IT5A 2X8BA 1YDHA 3HUDA 4DUGA 4MKZA 3CG0A 1XXHA 3PGXA 4ZI3A 4GQIA 3GEBA 3EQ2A 4QBTA 4IXMA 3CURA 2I29A 3SJ7A 5A2GA 1PEKE 1Y8QA 3NIFB 3VR3A 5A5GA 3W8DA 1UJMA 3L46A 1W5EA 4W9NC 5JDIA 1SQSA 1CZKA 2CHGA 2X42A 3LD9A 3UMVA 3VZCA 4MRMB 1ZOLA 1ZJ4A 4UEOA 4NSNA 3EH1A 2JL1A 4PPGA 4XGQA 1U2ZA 1WXQA 1HY3A 4YQZA 3EMBA 2QAGC 5TQJA 3S1LA 1MC1A 4CV0A 4DEXA 2WLTA 1QYVA 1M0WA 4WGGA 5AI9A 2QKYA 2XRFA 3HE3A 4WUTA 4WW0A 3VQTA 2I2CA 2DY1A 2QNRA 1KZ4A 2WWGA 1CEYA 2CE7A 2E5FA 1OPXA 2XKAA 2XDWA 4K28A 4U0JA 3O83A 4R31A 4LQ4A 5EXEA 2B7BA 5HMMA 4RW0A 3LFUA 2QN3A 2R6HA 1JIJA 4D9HA 2QW8A 1JXAA 1XRRA 1QXSA 5T3UA 5AKJA 2DR2A 1FTQA 2GBLA 1MJ5A 1VTKA 3NO4A 3P9XA 4RK1A 2QRVB 3AL3A 3KE9A 1T1JA 1ELOA 4G5OA 4TUYB 4D9BA 5AUOB 1BVUA 1DARA 2I4RA 3O8BA 4Z0HO 3RABA 1EHCA 4HJXA 4NL4H 1FMTA 4YEDA 3H16A 1W36D 1P8AA 3THOA 1U1FA 2DPYA 1QKJA 1M0SA 4PPYA 4RMNA 4YFYA 5HG0A 1IC6A 4D97A 2P2LA 3AESB 1J23A 3PX2A 4R9NA 4E14A 4GM1A 5FUYA 1KOFA 1PWXA 4Z54A 4WCFC 1B8OA 2VSXA 2PL1A 3AMVA 3E61A 4Q02A 5LYJA 3X1WA 5CFOA 1T29A 4J7XA 1II9A 1PUIA 3GLHA 3VYTB 5BV7A 3K9FC 2I91A 4LDPA 1HNNA 2IS1A 1FP6A 3GJXC 1QX3A 2O48X 3G23A 4ZHSA 3MA0A 4OYRA 1JV2B 2KSQA 3ZHOA 4JS0A 1GLNA 2QLNA 4MUNA 5H1YA 3CUWA 3NUQA 4BYMA 2JG3A 3K3PA 1BJRE 3T9EA 3S1AA 2CEKA 2X2OA 3RG2A 3C98A 2BT4A 3VH2A 4QDUA 2FG6C 2IYZA 3OIFA 5AM5A 1C8KA 2Q7OE 3MMZA 4AC9A 2JLCA 3TAUA 3PL5A 3F5QA 2UZ4A 1IVNA 1CV2A 4F72A 3NH6A 4RF3A 4ZGWA 5CTAA 5KVCA 3UMSA 1IPHA 3A1VA 1ZUNA 4DCGA 4LF4B 5FPQA 2ZGVA 3T5TA 3OMXA 1ZU4A 4RJIA 4J0QA 5G02A 1T4MA 2H1FA 2ZDGA 4PLTA 4DG9A 3GDFA 3LUKA 1XCMA 1G6HA 2JBHA 2CYBA 1SKMA 5GJBA 2JGIA 1L4LA 1Q0QA 1WZ2A 4FM9A 4H60A 4BNMA 1ODFA 4OFZA 4E7PA 5A1TA 5JS1A 4JEIA 4MLPA 4WZAE 4LJKA 3JAWA 1BO6A 1GVNB 5LQAA 2DM6A 2HA7A 4KR3A 1I1NA 1ZD1A 3GVHA 4O63O 3BILA 5T5QA 1B26A 1GN9A 4GZMA 3QBDA 2VYVA 3V4RA 4OXQA 1GZSA 1VKHA 2V59A 1ZSYA 3FPBA 4E6PA 1ADBA 3NTRA 2OORC 4IUCS 4M0PA 4KLAA 2BGLA 2WDPA 4JJFA 1WY7A 1M8FA 5I6DA 3AR4A 3UV3A 1X38A 3GT7A 1KR5A 3C7KA 3IHWA 1PWYE 2B30A 3LQQA 4QDJA 3ROFA 2ZBFA 1WXGA 1KFBB 1ST3A 3OCVA 4EFLA 1J5PA 3IP6A 3IX7A 1JRLA 2P2YA 1XEAA 2VP6A 1SKYB 3MK31 2JDIA 2HK8A 1MZPA 1R3UA 3R24A 4R2IA 3G13A 1W4LA 4EHLA 1J5EB 4TYWA 1KQFA 4G9GA 2FPGA 2ECPA 4FJ1A 2V4MA 4NTZA 5DH9A 2I99A 3BMXA 3D4LA 3T9AA 3DEHA 5IEJA 1U9IC 3NGLA 3C8HA 1TT7A 4EJ6A 1FBTA 1QJ4A 2WTXA 4OH1A 1V9LA 1A4RA 4YRTA 3ZWWA 1ETUA 4DSAA 5JJ5A 5LQDA 3W5JA 4G89A 2D6FA 1YASA 2H5LA 3T4EA 4LFCB 2O3SA 4LPSA 3FZYA 3PNKA 2NVUA 3PQ7A 3QFFA 4EYQA 3U5ZB 1ULTA 5DTMA 3PQCA 1AK2A 2X7XA 1FXWA 4ZVKA 5L40A 2DKNA 5FPPA 4ZYLA 4N5NA 4C2BA 4PZEA 3ZLVA 4IS3A 4JASB 1KGSA 1FYFA 3L7LA 4D8YA 4L4XA 3U7HB 4MW4A 4MCJA 3UJ9A 2ILTA 2QMUA 4KRXA 1C50A 4KMRA 1Z4LA 5FOQA 1OTXA 3RFFA 1DE0A 1COZA 3FKSA 1XBTA 4YP7A 3AF3A 1Q7EA 2J87A 2JCGA 4MUBA 4WNAB 4OHCA 4IHJB 2O2YA 1QPGA 5BSUA 4J9VA 3DFZA 3JYPA 5LQRA 3SR0A 2GYWA 1P4AA 3BORA 5AIAA 1LI7A 1FY2A 1TD1A 5ILQA 2CLOB 4ZWNA 4LXXA 2E4UA 3RVSA 1ETHA 1N0UA 1M8JA 1P2GA 2PX6A 3PJRA 5CG2A 3TOCA 3FI0A 2A5GA 5FTMA 1LDYA 1HDRA 4EB6B 1DCTA 3DDSA 3FA2A 3VJLA 4EL5A 2HYIC 1ACMA 1QK5A 1Z0UA 2RHWA 3B5EA 1FLVA 5EJ2A 5LOVA 1UMBA 3GAMA 1E5XA 4POAA 4YRKA 3I2KA 4C01A 1QFYA 1W5BA 4HVTA 1IRIA 4X85A 1BHSA 1O96A 2I54A 4M99A 5ITWA 3SS8A 1FCJA 1GHTA 3LA6A 1PFWA 4GMKA 4BJHB 5D3MA 4ZPJA 2EFYA 1YRQA 4J1NA 5ALPA 3NDRA 4MRPA 4EJ2A 1Z2EA 3NHBA 1T9DA 3D5QA 1E0JA 3KU1A 2EFDB 2F1OA 3VVMA 4F2PA 4ZDJA 2ZITA 5BPFA 5AM0A 4YX9A 3GDWA 4EITA 1DPFA 2I2BA 1SGWA 2DPLA 5JFTA 1MB3A 2GEKA 1JBEA 3JR7A 4MTLA 1O5OA 2GT1A 4XVQA 5FWXA 3RTCA 3WB1A 5KOJA 1Y5RA 2LVBA 3FSEA 3BWDD 1XZJA 3NX4A 4GXNA 4KX5A 3TSOA 5E0KB 3U3MA 1X7YA 5D6NA 2PWYA 4Z1MA 5AW6A 1C29B 1TNDA 4FXPA 2XMRA 1WKVA 2I34A 4YROA 3PFNA 3UJ8A 3GPDG 1UJ6A 2R7MA 3E9QA 3L05A 4QD3A 3RFCA 1ISRA 1T2NA 4O33A 4PZCA 1ZI8A 3SE7A 4H3KB 1D07A 4EUEA 1QPBA 1XTKA 4LHZA 1RXUA 5C3MA 5TV2A 1LPAB 4G1MB 4YWJA 4B3CA 1AMNA 1EPUA 2YVQA 3W5CA 2O8VA 1OVGA 1DAIA 2H8GA 4QYIB 4I8DA 5HOQA 1UADA 3Q98A 4GBED 2XF2A 1FDSA 1J9EA 1XAGA 3FPGA 3V8VA 5LN1A 5DK6A 3X1MA 4G2TA 4J2TA 2AH5A 2B92A 1MVOA 3VTKA 3ZWBA 2DFVA 3V8PA 5FNVA 2OCIA 1YA6A 4IVPA 4P4UA 2NMVA 2GM5A 2AB0A 1XVAA 5EJ4A 1HORA 1R88A 4E21A 2GD1O 4O4JA 4D56A 5HGXA 5JZOA 3OZGA 1A77A 3AEQB 4Z8YA 4IUYA 2GCIA 4RK4A 1R0LA 5CFZA 3W34A 1W2GA 3TPZA 2IYRA 1U1EA 3UQYS 3X1JA 5ICGA 3QU9A 2W6ID 3ETNA 4EG4A 4Y1FA 5A7FA 2D2XA 1GL9B