1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
4V0LA 3REGA 4LBYA 4QJ5A 3SJCA 1G7SA 1P62B 2IYWA 3KXIA 4P31A 4URUR 4EPWA 4A15A 1OFTA 4LI0A 4D81A 2DFTA 2QAGA 5AJZA 2BOVA 5C1BA 4HAVA 8OHMA 1F48A 4FCWA 3TIFA 3SE0A 4LZZA 1OXVA 4O2RA 4OI4A 4TYYA 3W9YA 2DR3A 1VTKA 5FOSA 2OBLA 1IM2A 1Z06A 3AKDA 4GZMA 4HDCA 4JLPA 1EXMA 3TLXA 3VU9A 5EE5B 1TEXA 2KJQA 5AUOB 5IK2A 4DDWA 1JR3E 3U4QB 4I81A 1PVOA 1D9ZA 1R8SA 2YINC 4TQAA 4IDOA 4MKFA 4DIDA 4I1UA 1PUIA 1FOEB 3CB4A 3OFND 1KI9A 4N0EA 1GP2A 5KDDA 1NVWQ 2B7BA 3VAAA 4E09A 4K8OA 2B92A 3PFIA 5E7IA 4A6XA 4YMTA 4DSOA 1MABA 1NI3A 5KSZA 4KJZA 4WOPA 4XWKA 3E5HA 4KAXA 4LYAA 2ZUCA 2MMCA 3QF4A 1W0JD 3B7GA 4NE2A 3U3OA 1HH4A 2RGAA 3FWYA 2GESA 1Z6YA 5IHPA 3CRQA 4I4LA 1CKEA 1OSNA 4NYMQ 1Z28A 1Z0JA 2QAGC 4KSBA 3LAWA 5DI3A 1SKYB 2AFIE 1DBSA 2QUZA 1K5DA 3J81k 1U9IA 4MKIA 3BORA 2G83A 4Q4JA 2R9VA 3CUEF 4W5JA 2PZFA 5DNYB 2SHKA 5FTMA 2IYRA 5FR1A 5TY0A 3SS8A 2H18A 1I4DD 2XZPA 3GJ0A 3WNCA 821PA 3KQKA 2P6RA 3QVUA 4RZXA 3KJHA 4LWZA 2ATVA 4IDQA 3U7FB 3SN6A 4V0MA 4II7A 3KQLA 4R2HA 3HWSA 5KOYA 1DAMA 1Z22A 2VEDA 4JLDA 3K70C 2QROA 2ZRBA 2JLRA 4FCVA 2ZRLA 4L9WA 5KNCA 5FBWB 2FMXA 1XEWX 2CCJA 5BYJA 2QTVB 3GFTA 1G7TA 1P73A 3K9GA 4JL5A 1U90A 2GZDA 3K1JA 4BZQA 4A1FA 3IBYA 2RHMA 1XX6A 2FZLA 5JJLA 1VG9B 2PJZA 1M7GA 2XAUA 3B13B 4S2EA 1XZPA 4GFDA 1RYFA 4Q9LA 3CONA 1XU4A 3FMIA 5EP4A 4PSAA 1KSFX 3ZVNA 1ZD1A 1XFAA 1DG1G 2W83A 4P4TA 4M0LA 3EZFA 1OFIA 3RSOA 1U9IC 3U3RA 2W0SA 4JIMA 5JWOA 5TARA 4B33A 5CIQA 3RWOA 1IY2A 1T3HA 1CXZA 3NC0C 4L5BA 4XVRA 2GK7A 2QMHA 1CJVC 3T34A 3EZ2A 4ZDKA 1HTWA 2DY1A 1N6PA 2H92A 1E1QD 5B2ZA 3FTQA 2FSGA 5TV2A 4HZIA 3U3JA 4P4SB 6Q21A 3K0SA 3LLMA 3QI2A 2AXPA 1RFLA 2ZVPX 2EFGA 3V4RA 3U7HB 5H1YA 5H68A 4HDOB 4BFWA 2ZRPA 1VG0B 3LXRA 3KKQA 4B3XA 5FFMA 1Y63A 4RJLA 4UNNA 2WKRA 2FPKA 5LD2C 1SGWA 4M9QA 2WWFA 2C95A 3T61A 1SVKA 3QEJA 4DDUA 5JI2E 1J8YF 4WZ6A 5AR1A 5FUYA 1T9HA 1PUJA 3CPJB 4QNMA 3A1WA 4GBMA 1YQTA 1NP6A 3KB2A 1Z0KA 1IXSB 2OLKA 1CJMA 3QXXA 1RVDA 3KKOA 4RD0A 4TMVA 3L0OA 3LQQA 4NYIQ 3O8DA 3OEEA 3QXJA 4IVQA 2ZU6A 2QM8A 4L9SA 2ZE8A 3KXLA 4C30A 3ASZA 4HUQA 3C14C 2NMVA 3KFXA 4MA4A 1E94E 4LJAA 3U60B 1XXHE 1KZ7B 1XMIA 2FFQA 3TKLA 1KIMA 3QPUA 1KTVA 2OZEA 3EW9A 2AFHE 4DRZA 2ANCA 1TEVA 2I3BA 4LJYA 3B2EA 2F3TA 2BM0A 1YZUA 3VR5A 2ZU0C 4JL6A 4O2LA 2K5UA 3TMKA 1ZC4A 2MMGA 3QJYA 3RS4A 1TQ6A 4Q1CA 1AN0A 3IHLA 1OFUX 4NL4H 1NVVR 1MH1A 5EE1A 2VYFA 1HT2E 1A2BA 1Q0UA 5BN4A 2ZI4A 2ZRDA 4YMVA 1CEEA 3D6TB 2ZVQX 3NHBA 3VKHA 1P9RA 2YV5A 1XPUA 2CMKA 3B78A 3EIQA 4C7OA 2JJ1D 2ZUDA 1GL7A 2JLZA 3BWDD 1E96A 4W5HA 1D2NA 2CDNA 3M0EA 4ZIRA 1JXMA 2XNDD 2WSMA 1MRNA 1ZUHA 1ZBDA 1R8QA 3I3SR 1E2DA 3KQUA 1BYIA 3SHWA 4M1OA 1SHZA 3SHFA 1S4QA 2N42A 1G3MA 5GJWC 3N2IA 2A5GA 2CK3D 4TSFA 4ITRC 5GVRA 1FX0A 2N46A 5KYKA 2H57A 4D4LA 4LBZA 1OLOA 1Z83A 1DG3A 1Q21A 2G0NA 2GETA 1RZ3A 4A0HA 2PT5A 4ZCLA 1FNNA 4RZ3A 2NGRA 4Q01A 1L2TA 2GWHA 4TLCA 4NYJQ 5SZHB 4ASUA 3O8CA 4JSTA 2ZE6A 4NCJA 1N6NA 5E4FA 3RS7A 1P6XA 3I1FA 4C2UA 4TL6A 4BLQA 2PLRA 1TADA 3EC2A 2GILA 1A7JA 1N6KA 3PUWA 3FE2A 4M2LA 3QKRB 4BLOA 3R9WA 2GK6A 2WSSA 1P2SA 2CCGA 3MMPA 4WXRA 2XSZA 4TYNA 3WMGA 1JALA 1QHXA 1ZU4A 4A2PA 2BHRA 1WDTA 2JIZD 1I4TD 1CR1A 1VPLA 2P67A 3LW8A 3OE7D 4LYHA 4PXAA 4BLSA 3QPVA 4EFLA 1E2JA 1BS1A 2WKPA 5AJVB 3RRZA 1Q1BA 4B74A 4G5SA 4DCVA 1PLKA 3BB3A 2YJTD 3B9QA 5EE9A 2ZTSA 3H4MA 2W2TA 3H2YA 3DM5A 4BWYA 1WBBA 3FKSA 1G20E 3AM1A 2AD1A 2HUPA 1OHHD 2IBMA 1P3JA 4ILEA 2ERXA 1ZIPA 3ECCA 1VDZA 3CPEA 1P4SA 3IGFA 3D3QA 2ONJA 1U0JA 1KNQA 1IN4A 1E9EA 4UXHA 3BBPA 2GVDC 4NCIA 2BKEA 3B1YA 1YZQA 1W2GA 4URVR 4RD6A 1KDPA 1KI4A 1KNXA 3ZIAA 2G6BA 2BCJQ 2NO9A 1E9FA 1R0WA 2WOOA 3PUZA 3SYLA 1P2UA 1UBCA 1E9DA 3TAHA 2WJHA 4BFZA 3U61B 1M7HA 1OXSC 1GRRA 4Q4HA 4JT4A 1XTSA 1E0JA 1QG2A 4WBSA 2R6CA 4Z8XA 4OQLA 1Z08A 1YR8A 2FV8A 3L8YA 2PCJA 3D8BA 3PEUA 2J7PD 1IY0A 1IN8A 1ZMXA 3AUXA 3SC3A 4TL7A 3DO6A 1JR6A 3HYTA 2A30A 3GJ4A 5DHAA 4BFTA 5JECA 4NCHA 2EQBA 1H8EA 5J4HA 5EP1A 4FWIB 2KBFA 1S9DA 1EG7A 4A0RA 5L8VA 4E22A 2JA1A 4HLCA 3UWKA 1OKKA 2YWHA 4A36A 4AWXA 1X8KA 1PZNA 3LH5A 5KDOA 4YMUA 1XD9A 4FI3C 1S8FA 3OIUA 5F3WB 3NG1A 3VHLB 1W1WA 4IXNA 1W36B 5FTJA 4A8JB 3QF4B 3ZS8A 4JKIA 4FW9A 4KV9A 3SU8A 4HZUB 2IYSA 4EFNA 2WJJA 1ZD9A 2ATXA 4Q02A 4QL3A 4A92A 2WWWA 4BFSA 4FCTA 2O52A 3ZQ6A 3T5DA 1PJRA 3P27A 4KSCA 4RFVA 1TPZA 1XCPA 5HE9A 5FUXA 2QGZA 1J70A 1Q3TA 3U7EB 2QPOA 1XEXB 5KPJA 1NN1A 2Q3HA 1M8PA 1G3QA 3SYNA 2CNWD 2ZI9A 3CIOA 3OEHD 1VCIA 2GKSA 1KGDA 3U6KA 1T4GA 4BFUA 2E87A 1GAJA 2OFXA 4ERNA 5CIWA 4M1KA 2NPFA 3V4FA 3MWKA 4IOMA 4JVSB 2V7QD 1H65A 3LXXA 3FMPB 4HAYA 2A5YB 3EA0A 1RKBA 2IUSA 3UG7A 2FA9A 1Z0DA 3C4JA 1F60A 1G5RA 4IOLA 1LNZA 1XXHA 1E2NA 2Q9CA 1ONBA 3BJIC 4MKHA 1MR3F 3U4QA 4QGFA 2ZSDA 2QBYB 3AKEA 1ZJ6A 4LOAA 2ECKA 3HR7A 3TUJC 3GEEA 2VP4A 3CF6R 3KZ1E 4URXR 2ZYUX 1BO6A 1GKIA 4UNQA 1US8B 4O3MA 1NKSA 1GOTA 2R6DA 4W5WA 4M9XA 5DISB 2IYXA 1EFRD 4HAZA 2FSFA 3CW2A 3B1ZA 3MJHA 4RD4A 1DTSA 4JLOA 3ZLJA 3IIJA 3X2SA 2VO1A 4LHYA 4P32A 1KKMA 5K8TA 1N5IA 1VCOA 4YONB 3PEYA 4QGGA 2GHIA 1TTTA 1AQYA 3I32A 3CRMA 4PC2A 5AUNB 1FW6A 4UXJA 3SOPA 4WZAE 1SHKA 2C99A 4ZO4A 1DOAA 1E2FA 2PCLA 3EAQA 2KE5A 1N5JA 2EFDB 5JLJA 3F0TA 4P4UA 2ODNA 1ZM9A 4NP6A 2WWHA 4UNPA 5KU1A 4LSGA 2NTYC 2W6ID 4JKYA 1MKYA 3FOZA 4GDFA 1XNJA 3WNBA 3IEVA 2BDTA 2VL7A 4NONA 5C46F 1MO4A 3SZRA 5HZKA 2CL0X 4F7WA 1GG2A 1YR6A 1I2MA 3D7MA 2AKYA 1ZVQA 3F3YA 3FFBA 2C03A 3HYRA 4L4UA 2YVUA 2YNMA 2VP6A 1FNMA 3AVVA 1G8HA 1L4YA 5J5CA 1JJ7A 4HLDA 3QF7A 1FQJA 5CITA 3W3AA 1LTQA 4HSEA 5EJEA 2ANBA 4OKSA 3R9XA 3QVVA 5TVKA 3THYB 2D06A 3GJ5A 2Q3FA 1W5TA 4TWZA 1UADA 1E4YA 4TT3A 1TQ2A 4KU4A 1SVSA 2BC9A 3MFYA 1ZD8A 4G3XA 4GSYA 4M1SA 3AGPA 5F2EA 3RNLA 4DIEA 5JRJA 1ZCBA 3L43A 2FFHA 2QGNA 4KODA 4MGYR 1SVMA 4U02A 4ESVA 2XB4A 4MDFA 4C7OB 1FMLA 1UKZA 2A2ZA 4Z8YA 4LYFA 4P4SA 3UK6A 1WRBA 3QKTA 1UBFA 1TF7A 4B3CA 2IK8A 4AURA 4DCTA 2PMDA 2XZLA 1J2JA 2YOFA 1DE0A 4MQBA 3VR4A 1Q1QA 2BJWA 2BMEA 1N6OA 3ND8A 1JI0A 2E9SA 2IT1A 2O5VA 2GCOB 2OCPA 2N1BA 3PUYA 2EVWX 1IY1A 1E2QA 3PUXA 4IFEA 3KJEA 1T5LA 4B3DA 2V8OA 4YLGA 2J0SA 3T06B 2NQ2C 5KO2A 2JDIA 2BCGY 1RW4A 3SQWA 2GEDA 1Z0IA 3QNUA 2W00A 3EASA 4MGZR 4ARZB 4DWJA 2IHBA 4RZUA 621PA 1I2DA 2Z4SA 4DDTA 3ZD6A 3UG6A 2VSXA 2Q3MA 3MUFA 3T12A 1E0SA 1GKUB 5TDHA 5A5GA 1NBME 1XJQA 2P65A 1AKYA 5LB4A 4YC7A 4BEBA 2ZI3A 4QGHA 3OHMA 3QKSB 4Q9HA 1FFHA 2QM7A 1FUUA 2C9YA 1W47A 4HEJA 1NMZA 1IHUA 1DAEA 1OT3A 1Z6XA 2NO1A 3V00A 2JLXA 3HPQA 3VFDA 1NJFA 2ZETA 3A1TA 4MRSA 1JNYA 3LVRE 4R7ZA 1YU9A 1DS6A 1OW3B 4JS0A 4RSGA 4B48A 4CEJB 4FINA 3IQXA 1G8YA 2HJGA 1Z0FA 5M04A 2CLSA 4EPXA 1CS4C 4FN5A 3AQ4A 1ZUIA 5KHOC 3WYAA 1GFIA 3NDPA 3QBVA 1D9XA 4ACAA 5SZJA 2JJ8A 2HJVA 2JLUA 1AS2A 2GJ9A 3I4LA 2F6RA 2WIAA 2ZJ2A 3RS5A 3VKGA 2ZSAA 3EPHA 2B21A 5GADl 2J9RA 5GJBA 1TQDA 3X1ZA 1JQJC 1KOFA 1VCNA 1KMHB 2I1VB 1G3IA 4BPBA 3PIRA 1P9WA 5L3QB 2BJVA 2GDJA 3QKRA 2BBSA 5CYOA 1KO4A 5B64A 1R5BA 3WP0A 2GJAA 5DN6A 1FTNA 2ZI6A 4OHYA 1U0HC 1NJGA 1RC8A 1KAGA 1JAIA 4AIIA 3LX8A 2GJ8A 3AP1A 4HLQB 1J99A 4D80A 1P60A 1XMSA 5JWHA 4B76A 1EK0A 2VIIA 3TSZA 4HAWA 2QMOA 4YXWA 2X2FA 1OH7A 1KK2A 1KMQA 5EZ6B 2CVHA 3DM9B 1ZNYA 1DAKA 4KI0A 4W7SA 4B6EA 4QFMA 3PEWA 3ZJYA 4KFRA 2FGKA 1WBDA 2BKUA 1D2MA 2KBEA 4URYR 2Q9AA 2WTUA 1SXJC 4L16A 4AKGA 1NG9A 2HXSA 4LJ6A 5BN5A 2OFOA 5FUVA 4DKXA 4ON9A 2ZRMA 1CBUA 721PA 2X8AA 4ZKEA 4NDZA 4PAQA 2VQSA 4I1OA 2IUTA 4B73A 5BN3A 1CRPA 4DB2A 1UEIA 3EIHA 3I5YA 2EU8A 3VTKA 1C9KA 3LX5A 4H1VA 4NPHA 1E9CA 1E0KA 3NXSA 4WXPA 5E95A 2VBCA 4GL2A 3VQTA 2J59A 1CJKC 3B82A 4BEJA 4WAUA 5C2JB 3Q7QA 4LHVA 1UPTA 1TUIA 3GEHA 4GI7A 3U6BA 2BM1A 1XEWY 1SVWA 4GOKA 1TX4B 1Q22A 3QKUA 5JS8A 1XRJA 1NVVQ 1AIPA 2V6IA 5FUWA 4PPFA 1XXHB 3KKMA 2NIPA 3LVQE 3RVBA 2FGJA 4US0R 1QF9A 4BASA 2AHOA 3DVLA 5J40A 4LUCA 2XTMA 1KK3A 2OCYC 3RRNA 1OJLA 1ZP6A 2GCPA 4GT1A 4C0BA 1AKEA 1GTVA 2OLJA 4GOJA 3SBEA 3T15A 1G1MA 1CJUC 1M74A 5DSZA 3WNDA 4DLTA 4LJ7A 1ZINA 2AK2A 5A0FA 4D25A 4A8JA 1AA9A 3K9NA 4N3NA 3I5XA 5FOXA 1Q44A 1Z5ZA 3AF2A 4KLZA 1T0HB 4HB3A 1E1RA 4HZUA 1E3MA 4RD1A 1S2MA 2OV2A 3TUIC 4B43A 2ZRJA 3GPLA 2JLYA 3KKPA 2ODEA 1RRFA 1XPRA 2HLDA 4LK2A 1ZW6A 4NKRA 3K70D 2REBA 2DWOA 3T5GA 2QPAA 3QPWA 4PC7A 2F1IA 1XEXA 3E70C 4XIGS 2OCAA 1ZM4A 4P0TA 3N70A 2ZM5A 2FZ4A 3I72A 4Q21A 3S1AB 3CR7A 4G0NA 3X1YA 5GJCA 5GJVC 1Q3HA 3IIKA 1Z07A 3HR8A 1GKYA 2QE7A 4UKDA 4EFMA 4OI2A 1U0LA 4OQNA 4HB0A 4DCSA 2IC5A 3L0PA 4LV5B 5JCPA 1GRNA 2HXYA 3LBHA 4TZ0A 3X1XA 4A2QA 5GVSA 3CNLA 4B3BA 1XTQA 3GLFE 5KNBA 2XTZA 1W36C 3QG5A 4A8JC 1NBMA 1WMSA 2JATA 1T5IA 2ZJZA 3CRW1 3FPAA 4P33A 2JJ2D 2RGGA 2ZUBA 3L0SA 1YVDA 1ZC3A 2PEYA 3WMFA 2KB0A 2QBYA 1NY6A 2PJRA 5K8LA 3MWJA 3Q5DA 4J0QA 1G7RA 1R0YA 3F5FA 1GL9B 1US8A 4PSKA 2WKQA 2QQ0A 1E2EA 2XOKA 1GM5A 3P4YA 4NU0A 1N2CE 3TW4A 3WYGA 5SZIA 4LRWA 1QHYA 1VMAA 3PR1A 2VPPA 4JJKA 1BIFA 3W6NA 5IRCD 2ZJYA 1YR9A 2PBRA 2IYZA 3Q72A 4AG5A 4MRRA 1U8ZA 2PEZA 2IEZA 3Q85A 1Q20A 4M21A 4DLUA 2EYQA 2C9OA 4KCGA 3KKNA 2Q9BA 2I1QA 3WRYC 2IEYA 1YKSA 3AF4A 2A5JA 4GPTA 3DMDA 4PHHA 2J0QA 3A4LA 4IOKA 3U3MA 5JRZA 3KL4A 5CK5A 4IDNA 1HY3A 1GNQA 2G9NA 1COWD 3GJ7A 5E7JA 4NTZA 5KUTA 2IYUA 3P32A 1JB1A 5FOTA 1NVXQ 4C0AC 1YRAA 1YR7A 2ZANA 4LV6A 3P20A 4O25A 2QRZA 3HDTA 4RD2A 2D74A 4BECA 4DLZA 4ACBA 1NIPA 4M8NE 3CWQA 5AUPB 3PXGA 1CULC 3QQ5A 1XCGB 3BC1A 3VKWA 1N0VC 4AYWA 4B75A 2BMFA 1XF9A 2CHVA 1IN7A 1D5CA 1UKEA 1AJEA 2PX3A 4B35A 3T1OA 1GWNA 1WE2A 1T3SA 3A8TA 2QT0A 5BW8A 5AJXA 2BV3A 4PQYA 4M22A 4HDQB 4YDSA 1U94A 3BXZA 3QG1A 2P6NA 3THYA 1SVLA 4LHZA 4M4SA 3SFZA 1WP9A 4CEHB 3M6AA 3KTAB 1KSHA 2RKOA 2FSIA 3GFPA 3HP1A 3VX3A 1GZSA 2ONKA 1XDBA 5EP3A 2JLWA 2XZOA 1N0UA 4JLKA 5F9HA 2LCFA 3OEED 2CXXA 3GP8A 4M9ZA 4JLNA 5BXQC 2ZE5A 4Y0AA 4CVNA 2ZYTX 5B58C 5F9FA 4RZ2A 1G19A 3FHTA 2F1RA 1W4CA 4C0QC 4AKIA 1G7CA 4PPQA 2ZSBA 2F9LA 2QTHA 5KDLA 4AK9A 1FP6A 2WPDD 4RCYA 3BAFA 4M1YA 2R6FA 2OFWA 4D26A 2JASA 3KDSE 4DZZA 2UVQA 4JYCA 4US1R 5CM8B 1YZLA 1E2PA 3SI7A 3LY5A 2AKAB 4Z1MA 1GRQA 1F3OA 1XB2A 4US2R 3IILA 1Z6AA 2JEOA 2GVZC 5TXGA 1D2EA 3VNUA 1E9AA 4DCUA 3SEAA 1OXXK 2GCOA 2A5FA 1X1SA 4DEYA 4PTLA 3I92A 3QEOA 3UKDA 2C04A 1P9NA 3R8CA 4B2IA 3L8ZA 1JR3A 2CHGA 1II0A 5B30A 1VHLA 4PQFA 4ARZA 1R2QA 4QBHA 1B23P 4EQ6B 3FDIA 4Q5IA 2WWYA 2HCJB 4B44A 3U2QA 5JHGB 2VP9A 5CLQA 4F93B 5JHHB 3BH7A 4XSGA 3CWZA 4GP7A 3K53A 3H84A 4XSHA 2KSQA 3BS4A 3K9LA 1RE0A 2GTPA 4B47A 4TSFD 2NO0A 3Q7PA 3A4MA 3AKYA 4IEIA 1TU3A 4B71A 1UBGA 4PC3A 2DCUA 3AVXA 3QKSA 2GNOA 3C41J 4B2PA 4ZCMA 1ESNA 2W2VA 4PAOA 2QRNA 3AP3A 3QXCA 4HYYA 4ASUD 1XJ0A 2VA8A 4OQFA 4ZDWA 3OAAA 2WHXA 3Q8XB 1X8JA 1Z8FA 3FMOB 1FQKA 5HCIA 2WSSD 2XB2A 1YJ5A 3AKCA 1KJZA 5DIFA 1G8GA 1NVUQ 1BMFA 1TF5A 1FUKA 4AYTA 4JJZA 4C0KA 1L4UA 5B57C 4ZDJA 1M7BA 4CEJA 4TLBA 2IYTA 1KK0A 1EX7A 5DGXA 5C18A 1E32A 3TR0A 4TMKA 1FP7A 1KI7A 1II8B 3EWSA 4LJ8A 5CK4A 4V0OA 3GLHB 1MRSA 1HQYE 3TE6A 3HU1A 4OK3A 1PLJA 4LBWA 4I1SA 2VP2A 1K8RA 4QHYA 4DLWA 3FKSD 4WW0A 3RC3A 2QP4A 4N0DA 2D62A 4BQSA 1E2MA 1KO5A 1UDXA 5DE3A 3DZ8A 4LHWA 2QMEA 4OQMA 3B8HA 5CB8A 2UZ3A 1NN5A 1U2RA 1H8HA 1W0KA 3K0AB 1XPOA 3PVSA 4QGAA 3RS2A 2DWQA 1ZAKA 4IRUB 1NL3A 5TMPA 1W7AA 3DKVA 3KQNA 3UXMA 1KMHA 3GJ3A 5TB5A 5L3QA 3HU3A 3ZIAD 4FXPA 1A1VA 4QBFA 3OESA 4V03A 4Q1EA 3NBYC 1OB5A 2KI5A 1ETUA 5F98A 1GUAA 3X1WA 2R65A 2C98A 5FL7A 1DPFA 4K46A 5SZKB 4WIAA 4OHVA 1T6NA 5EXXA 4B6FA 3NEJA 2QENA 3DPUA 3GQBA 2RGBA 1UBEA 2Z5FA 3NBXX 4TYQA 4CYMA 1RRPA 4BLRA 1GVNB 3FMFA 2CJWB 1XZQA 1E2IA 3HJNA 3EXAA 1EFHA 1GNPA 1A82A 4HATA 3CR8A 1H8ED 1PLLA 4QJ3A 2BMDA 5P21A 3EWAA 3JVVA 3ZVLA 2X77A 2V3CC 1Z29A 1AS0A 4TQ9A 1XTJA 4CGZA 1OKKD 3L82B 2HT6A 3CX6A 4RVCA 4LBVA 4G1UC 4TYWA 521PA 1DELA 4D0LB 5FPKA 3AVYA 4OQXA 2ZI5A 1EX6A 4LY6A 3NC1C 2QAJA 1W2HA 2Z4RA 1N6LA 2FPMA 5EE3A 5L3RA 3THWB 1R5NA 1U98A 2H16A 3B9PA 4PPGA 4LYJA 3EPLA 3MD0A 3ZVMA 1SVOA 1ZNXA 4M1TA 3OIYA 2CCKA 4QHTA 4EPTA 2H5EA 3BH6A 4G5OA 4BRUA 2REXB 2FE4A 2O8FB 4OI1A 2QY9A 4LC1A 3QUSA 4F91B 1CJTC 1ODFA 1EESA 2MSEB 3E2IA 1FL9A 3AP2A 4FMDB 1FPMA 2X19A 4XH9B 4FMBB 1NLZA 4UNRA 1W48A 3R7WB 1G21E 3MSXA 3EZ6A 4Q7LA 5CJPA 4WZBE 4LDJA 4Q18A 1CLUA 4MRVA 4C0JA 2R8RA 2D2FA 2L0XA 1EFRA 1AM4D 5J4VA 5FBQB 4QM6A 1VYVA 1ZM3A 2W2XA 2OUKA 3JVUA 3NDBB 4YMSA 2WM9B 2G0TA 4QHSA 3W6PA 3MCAA 1S9HA 3RYTC 3ONWA 2C9CA 2ORWA 1HV8A 1JAHA 4D6PA 1PV4A 2IA5A 2F9MA 3UMFA 3RS3A 2E1RA 5FR2A 2YWGA 2PZEA 4Y0VA 3EG5A 1W49A 3SFVA 4A0GA 3IIMA 5G3ZA 2NZ8A 3A58B 1AK2A 4M1WA 4QBGB 2CEAA 1U81A 4Q4LA 3GFOA 1VHTA 2XGJA 2JAQA 4D4JA 2ZI7A 3WY9A 3S1AA 3GLHE 1G64A 4JLBA 1N25A 3EPKA 1S1CA 4L8GA 2DBYA 2YOGA 4KITB 2GA8A 4GP6A 3T35A 4FD2A 3KB1A 4ZDIA 4Q7KA 5JSZB 1IN5A 1LF0A 1IN6A 3P26A 3KJIA 5BYKA 1XTIA 1W4AA 2ZR9A 1RIFA 2R2AA 1DO2A 2DYKA 2ZQ5A 3O8RA 1KO7A 1D8TA 3LRPA 4X8MA 5L3VA 1OIWA 2WJYA 4XJXA 3OIVA 2V55B 4Q1BA 1GL6A 4RFSB 4PZYA 3TR5A 3AVQA 1EFTA 2IWRA 3WXMA 2ZYWX 4ZI3A 3B85A 1WB9A 4L15A 3SDZA 4GRAA 1HEIA 1HT1E 3KXKA 3NVAA 2H17A 4IHQA 4PZLA 4ZPXA 2R6GA 4GNKA 3WRXC 4JMPA 4CF7A 4DVGA 1X86B 1E4VA 1BYUA 2C8VA 2ZRCA 4LV8B 3NTUA 4M9SA 1G4AE 3CLVA 3PG5A 1II9A 1SULA 2UZIR 2HDNB 2B8TA 3PV0A 3LWNA 2WBLC 1E2GA 5JJKA 1NLYA 2PMKA 5JBQA 2OAQ1 2ZRFA 3FHOA 3DMNA 2A9KA 2X2EA 2ORIA 5KSYA 4LJ5A 1E99A 3MAAC 3DEFA 4GMXA 3ZD7A 1MO6A 3NBZC 4B34A 2GXSA 1GDDA 1NLFA 4UQOA 3TK1A 2ZSFA 1VYUA 2IXGA 5HKKA 1OIXA 4TTQA 4TT3D 2RGDA 1OYWA 2IUUA 2NZJA 4IXMA 1R5OA 4CW7A 4NHOA 1WF3A 3C15C 1ZNZA 1W4RA 3BIFA 1J90A 2EWVA 4A9AA 3EC1A 2O0HA 2FPLA 4FMDF 2YOHA 5J4KA 4UXIA 1HA3A 1GIAA 2VSOA 4QC2A 3ZH9B 3U7GA 1QHGA 4JLAA 2ZJAA 4MGKR 4LGMA 2CHQA 4R98A 2OSBA 2AR7A 2OE2A 2CE2X 4TMZA 1A2KC 3EZ9A 5FPTA 4DEXA 2VP5A 5DI9A 3JZMA 3P1JA 4Q9KA 2XX3A 2A3RA 4E5UA 1KI6B 3FHCB 3AF3A 4IEEA 2OXRA 3HU2A 1P61B 5CM9C 5HCNA 2OT3B 3GCGA 2BVNA 4IDPA 1U8AA 5CB6A 1EWRA 1IXRC 4XD7A 1G3UA 2O0KA 2RAPA 1C1YA 4KHZA 3SNHA 5FBRB 3ASYA 2Z6VA 3EARA 1XMVA 2ORVA 4AD8A 3QSYA 1E2KA 4DUGA 4CEHA 2ZITA 4V0ME 3KTAA 2G88A 3FFAA 4PC6A 2PLFA 4EJSB 2ZROA 3B60A 2IWHA 3LFUA 1G17A 3N2EA 1E9RA 3KQHA 3GLGB 3FB4A 1NSTA 1TUEA 1TL7C 2WIBA 1P75A 1R4AA 1YZGA 3NIBA 2F1HA 4JBYA 5JI3E 1F2UB 5FOWA 2D4HA 1G6OA 3CKLA 4MYTA 2C5LA 1TAGA 4BFVA 2ZIAA 1UF9A 2RGNA 1C4OA 4D0GA 1MV5A 2ZREA 221PA 3LW7A 4MITA 5LDDC 1WQ1R 4PZZA 4BZPA 2XJ9A 1M2OB 2B8WA 2QA5A 3Q5EA 1JJVA 3I62A 4C4PA 1IJEA 4EPRA 2DWPA 3ND9A 2F7SA 1RJ9B 2G3YA 1QBKC 1KJYA 3GEIA 2J0UB 1E9SA 5KTYA 3GLFB 2ZS9A 3K9HA 2QEQA 4DXAA 3PEVA 2FEOA 2Q0HA 3TGPA 4TQUS 2GAAA 1IJFA 2FOLA 4XVUA 5HTKA 2IS4A 1DEKA 4JVLA 4EQ6A 4TLAA 4PFSA 2OBMA 2ZJ8A 3UWOA 1EFUA 4DDVA 5HE8A 4JVMA 2BWJA 1NKTA 4HUTA 5FBLB 2RGCA 1G4UR 1SXJD 2GJKA 2D2EA 1E79D 2NG1A 5CJ2A 2IYLD 5UKDA 4Q4AB 2ZEJA 5G40A 2GRJA 2W58A 2RGNC 1GILA 1QHHB 3ADDA 3LA6A 421PA 1F5NA 2QNRA 3GD7A 2FFBA 3PCRB 3PITA 1TF2A 3RWMB 3SBDA 1O3YA 4EKDA 5JEEA 4H9GA 4U00A 5EXPA 1XTKA 4YQFA 5FTLA 4U5XA 1HE1C 3UATA 3UANA 2BBTA 4ESHA 3AVTA 1SQ5A 3LNCA 1QVRA 1DVRA 1XD8A 1T91A 4JZKA 5DN6D 2ZJBA 4LX0A 1M1YE 3TSOA 3IPXA 5FPHA 2P0EA 2DHRA 2Z0MA 1II8A 1A5TA 1KJWA 1Z47A 3GLHA 1KYIA 1F2TB 3THOA 2O8DB 2OCBA 3WBKA 4BLPA 4YXWD 2W6JD 4OK5A 1N3BA 2GXUA 5CLLA 3AVUA 2C2HA 2FWRA 1UDWA 2H8KA 2G1JA 2W0MA 1QG4A 4MH0R 2ZRAA 3AF0A 1DARA 2ODWA 1MO3A 2O0JA 3K0AA 2HYDA 2IS1A 2YC4C 1JEDA 1KDTA 1KK1A 1P2VA 4V0NA 4DLVA 2LKCA 4QBIA 5EUQB 3U3KA 5JZVA 4YMWA 3C5CA 5JWRA 2IF2A 3I61A 3VHXA 4TTRA 3C8UA 2YWFA 1OV4A 3CRRA 2VH5R 2WVJA 3OFNA 1QVAA 1UKVY 4DSUA 2B6HA 3N5CA 4OYHA 3DKPA 2PL3A 1QHIA 2REOA 4PHGA 3WYFA 1W0JA 5FPSA 2ZPTX 5FTKA 2TMKA 2NOAA 2FFAA 2FN4A 2BIFA 2CJWA 2QG6A 3CZQA 1KDOA 4Q1AA 5AWFC 3LBNA 4JLMA 5IK2D 3W3ZB 4I99A 4ZKDA 3GLGE 1NF3A 4QNRA 2B7CA 3IKJA 2EFCB 5IF9A 2WWIA 3CX8A 3U44A 1QDEA 2QMUA 4D82A 1NG1A 1YHNA 3B1XA 3H1TA 4URZR 3UMSA 2XEXA 2JCSA 4E07A 4G5RA 1W36D 5AJYA 2JGNA 5HR5A 1G9XA 1LF5A 2OG2A 2IYQA 1XBTA 1JQLB 3THWA 1KO1A 3ADCA 4QRHA 1E1RD 4HAUA 4TTPA 5G3YA 3TH5A 1LS1A 5EE0A 5EQTA 3CF2A 5JS7A 4O0MA 4ABYA 1M6NA 4E03A 3LBIA 1OXTA 4EUNA 4IKEA 4V0KA 2HLDD 2MSDB 2PX0A 2HV8A 4A2WA 2NO7A 3HPRA 4IVRA 2F3RA 5D3MB 3A6PC 2O8FA 1P5ZB 2QQEA 5JFGA 1MOZA 2G1KA 2JJ2A 1G8PA 3LLUA 4JLVA 3UMRA 3ZGXA 3AEZA 4HI0E 2ODBA 4BFYA 2FEMA 3FGNA 5HZHA 4UNSA 1UM8A 1IONA 1E2LA 3QENA 3I8XA 4V02A 4QM7A 3EA5A 1KAOA 2D7CA 2O8BB 3M1IA 2VLIA 2IL1A 3QXSA 3R7WA 2P3SA 1OYYA 2QE7D 1FZQA 1P2TA 5FI1B 5FL3A 3H86A 3GLIB 1AQUA 1OH8A 2RGEA 3BB4A 2QI9C 3ZDQA 1N5KA 2C96A 4HAXA 4PO9A 1QZXA 4Z51A 3A4NA 4CZ2A 4PAMA 4LC0A 4QJ4A 4RKFA 2JLSA 5BWMA 1F6BA 4Q7JB 1NBMD 5DYGA 2OAP1 1E1QA 2ZJOA 2IYVA 3AUYA 3OZXA 5J4YA 1IQPA 1Z0AA 2VHQA 2ZSEA 3EIEA 4ZCIA 5D3QA 3Q3JB 1Z6GA 2V54A 1ZNWA 1YRBA 2QTFA 4OHZA 1ELOA 1KY2A 5FOVA 3E1SA 1G18A 2XOKD 3C7KA 1YZNA 1XD2B 1G8FA 1Q1EA 2GF9A 2P5TB 1BOFA 1COWA 2QSZA 2WV9A 1J7KA 4QG7A 2YKGA 4UJ3A 4DT1B 2EFHB 5FBVB 4DLSA 4A4DA 1HQCA 3BE4A 4MUAA 2BBOA 4LJ4A 1OH6A 4TN1A 3SJZA 4XTRA 3B1WA 1EWQA 1E9BA 2ZRGA 2ZAOA 5C4GB 2WJGA 3KFVA 1UAAA 3W5IA 5JSZA 4HLUA 4S35A 5LPNA 2IYYA 4C0HA 4TMXA 2CLDX 2AN9A 2OILA 4C0LA 4TMWA 4NMMA 1X1RA 3RANA 2YZ2A 3NEYA 4ZI2A 2C77A 5J47A 4PO1A 1Z63A 2XXAB 4RFSA 3TVTA 3DL0A 3A37A 5DYIA 2BBWA 5EUMA 4PQRA 1T8UA 1T8TA 3R8FA 3FVQA 4PHFA 1OB2A 1YZKA 1KO8A 3MWYW 3BGWA 4Q03A 3BERA 1ESMA 3C5HA 2PT7A 4TYPA 2FDCA 4Q9IA 1ZYUA 3RLFA 3ZS9A 3ADBA 2JLQA 1LV7A 3O47A 3SYKA 1D6JA 2GXQA 4TL8A 3CH5A 3L2OB 4KFSA 3BB1A 2JJ1A 1LY1A 2WPDA 5DLQC 4DSNA 2XNDA 2QP9X 1K6MA 2CLCX 3PENA 3ADKA 2F43B 3QY0A 4JBWA 2ZXUA 2D7DA 1W46A 2AK3A 5CDFE 2VHTA 4HLUC 1Q57A 1V43A 2FJUA 4C9BA 1DAIA 3ICQB 4DBLC 3DDCA 1L7VC 1NY5A 1VYTA 2CK3A 4XOIA 3QXHA 3CX7A 1GSIA 4KBGA 3A1SA 3DHWC 1NIJA 1JEEA 1UJ2A 1G5TA 2VP0A 3F8TA 3K0FB 3K0CA 3M4YA 4KYUA 3C16C 3LDAA 1KI3A 2QP3A 4K81B 4A0FA 2FH5B 3MRSA 5FOUA 3FYHA 1SKYE 2IF0A 3MLEA 2QSYA 1S96A 4Z1MD 5L3SB 2O8CB 1KI6A 2R44A 1X3SA 2VF7A 1AS3A 2JIZA 1SXJB 2NO6A 2O8EB 3W8NA 4A6PA 4TZ6A 4PR0A 1JXOA 2ZR0A 3OE7A 1ZM7A 5LBIA 1R7RA 1G5PA 1Z2CA 1WXQA 4QXAA 4TMTA 4FMCB 4CEIB 1CIPA 3CO5A 4P3YA 1CTQA 2IHYA 2OHFA 4NYMR 2ZYVX 4EJSA 3GLIE 1JR3D 1BKDR 1HURA 4PPNA 4JT2A 1DAGA 1Q12A 4TL9A 3GLGA 4IW3B 1OHHA 1XJCA 4R71A 2XSZD 1O87A 3THXB 1F2UA 3QIAA 3OIWA 4EDHA 3MWLA 1R0XA 1RPZA 1JECA 1KHTA 1LVGA 3K0CC 1JBKA 4JBXA 1VECA 4M53A 3ZZUA 3WBJA 3UIEA 2JLVA 4AKEA 3EZ7A 3KX2A 4TLDA 3PJRA 4N1AA 2J41A 3IO3A 3G0HA 2IS6A 5JJIA 1GITA 1VG1A 3TAUA 3OAAD 2ERYA 4EAQA 1CP2A 1K5GA 1QHSA 1UEJA 2P2LA 4BRWA 1RJ9A 1R10A 1R6BX 2WOJA 3VR1A 4B3GA 3EX7C 1BMFD 2J0UA 3GLFA 1P72A 5E3HA 1RRCA 2LKDA 2J7PA 4G5QA 4Q00A 4Q48A 3NHAA 4B2LA 2WAYA 1S1MA 4F4IA 1QRAA 2WAXA 2F55A 1DAHA 1V5WA 4EJSC 3D31A 1DAFA 1XMJA 1ZIOA 2J87A 2BEKA 4BE7B 4Q1FA 2PZGA 3K0EA 4Q7MB 1MO5A 3ZVRA 1OFHA 4PX9A 3WHKA 4JSYA 2QAGB 2FU5C 2GBLA 3TQCA 4C2TA 2V9PA 2GF0A 3AVOA 2UKDA 3GMTA 1IXZA 1T0JB 4Q4AA 4DLRA 2DFLA 1DO0A 2GEVA 2WWGA 1W0KD 1H8HD 1QHHA 3VU9B 4DC9A 4JYBA 4DSTA 3SR0A 4KLNA 2HT1A 5DO9A 2WMOB 3NKVA 4MRPA 5G53C 1XEFA 1NMYA 1VKJA 1G3RA 2IX3A 4MGIR 1M34E 3AB3A 2WJIA 3RC8A 1E0AA 1CR0A 3I73A 3FKQA 4CRWB 2GEUA 1TU4A 3SQXA 3LD9A 3RDPA 3K70B 3LQRA 3NBFA 2QPTA 1LFDB 2EYUA 3U44B 1MABB 1MT0A 1N5LA 5FL7D 2J1LA 2IXFA 3A1UA 3UPUA 1Z6TA 2VF8A 3MGCA 2CNWA 1AGPA 3P4XA 2RB4A 2V4ZA 3LV8A 3OEHA 4IJMA 3AGQA 1F2TA 1UFQA 2O8DA 1FMJA 1VIAA 1LB1B 3A1VA 3I8SA 3AVWA 1VCMA 1CR2A 1T3LA 3AF1A 4NYIR 1Z3IX 3WHLA 2OESA 2V7QA 4MDEA 3IDQA 1L8QA 3BD9A 5DI3B 4OL0A 3NWJA 4KVAA 2GBLC 2GAOA 5FH9A 4FMCF 4OK6A 3RRMA 4BZXA 121PA 1W4BA 3W34A 1G16A 4Q4JB 2A78A 3RAPR 2P5SA 2J45A 2F1JA 2D3WA 3BFVA 5K8IA 4CT4B 1ZCAA 3CPHA 3ICEA 4GMDA 5JMTA 2EWWA 3B5JA 1G291 3GJ6A 3TRFA 2BMJA 2YYZA 1W44A 4C0SA 2VHUA 1SXJE 1N6IA 2VRWA 3BRWD 4WA7A 4EPVA 3TSWA 3IO5A 4FIDA 4CDGA 4PHTA 2DB3A 2FX3A 1OE0A 2IXEA 3QOFA 4H1UA 4OHWA 1EFCA 2VHCA 5LD2B 2OBNA 3NH9A 1NNEA 2DFKB 1CR4A 4G5GA 3TQFA 1Q1ZA 2NPIA 2GJSA 3VX4A 1KSJA 1RYHA 1EGAA 3MJRA 4I1VA 4LHXA 2R6AA 5CDFA 3BH0A 1LW7A 1OXUA 3CH4B 2Z43A 4Q1DA 2J46A 2ZS7A 3QBTA 4G01B 4HB2A 1S0UA 1NN3A 4D0NA 4CIDA 4BUJA 4LPKA 3ZZ0A 4NYJR 2QT1A 3JZAA 2RCNA 2OM2A 2WJVA 3CZPA 4KBFA 4JLJA 3QE0A 2W6IA 2A7QA 1TNDA 5C4MA 2CVFA 4IDHA 4MRNA 5CYPA 1OH5A 1KKLA 3RABA 4KFUA 2QN6A 2AWNA 3NH6A 3RRYA 4LCBA 2V1XA 3LO5A 4OBEA 2XTNA 3W8RA 4PO8A 2EFEB 1KI1A 3KUCA 5D3MA 1QHNA 1DADA 4POAA 5A4JA 3IPYA 4MKGA 5BQ5A 2WZQA 4DB4A 1XTRA 1ZU5A 4IOJA 1NN0A 1N0WA 4PSVA 3CRVA 3RS0A 5KPDA 2ZAMA 2AX4A 1JPNA 4JL8A 3R9IA 2OXCA 3VMFA 3X1DA 1BH2A 2Z83A 1GNRA 4UJ5A 2HYIC 2O8BA 2HEIA 1ANKA 3B1VA 4ZV4A 2XITA 3GLIA 2Q6TA 4OI0A 3IBGA 3IEUA 4RD3A 1R0ZA 4NH0A 3L0IB 3VR3A 4KXFB 4EPYA 4W9MC 2QORA 4RCZA 1NRJB 2OEPA 4HUQB 3CNOA 1CU1A 1Z2AA 3CF0A 1FTSA 3KJGA 3K8YA 4BLTA 3SJAA 5ANRB 4X8LA 1OPXA 2J0VA 4YDHB 4F4JA 1E69A 2GZAA 2C78A 4BFXA 1P7CA 1E2HA 2AL7A 4DHEA 5HPYB 2J3EA 3TW8B 1LS6A 1SKQA 3SJBA 5AK0A 3T1VA 4AKHA 1X8LA 2AWOA 2AXNA 4TLEA 1U99A 1XD2A 4C3ZA 2FNAA 4D4KA 3AVPA 4AC9A 3G5UA 5E7MA 3PUVA 3VNVA 2OO7A 2WMNB 5EZ5A 3ZQJA 5JCZA 4DLXA 2J7KA 2HF8A 1IAQA 4RKEA 4DT1A 2CL7X 1ZUNB 2Y8EA 5FTNA 4GOXA 1W5SA 5KNDA 4LJ9A 1WA5A 2CE7A 2RH5A 3H0KA 4Z54A 2V1UA 4A82A 4U7DA 4ZIRB 3U5ZB 1KZGB 2IS2A 1I4LD 1HUQA 1VIYA 3B6EA 3EPJA 1XP8A 1U8YA 4OJQA 3BFXA 5AUQA 3ZZTA 4DJTA 1J8MF 1YE8A 2YC2C 3AV0B 2QL6A 2FF7A 5HKKD 2EW1A 1SZPA 3DZDA 4AYXA 4AY2A 2XXAA 2DFNA 4X8HA 2DPXA 3T1QA 1FX0B 3MG9A 2R62A 1TMKA 2P6UA 4KYIB 2X1VA 5DHFA 2FG5A 5J4LA 4HB4A 1NMXA 3GJ8A 4X8OA 3O8BA 4Q47A 2JDID 3W6OA 1YZTA 3BOSA 3TBKA 2G77B 5H70A 2GXAA 1OF1A 4D2IA 2V6JA 2ZRHA 4LPSA 4Q66C 1E98A 5H8WA 3IUYA 4FWTA 2XJ4A 1A4RA 3AH8A 5G41A 3VR6A 4XD7D 4CT5A 4PC1A 1G6HA 4OHXA 4MYHA 5JEDA 1S3SA 3REFA 2RMKA 2F43A 2QZ4A 1WCV1 5IT5A 1AZTA 2YHSA 4DUGD 5K8UA 5FI0B 2MSCB 4NCNA 5EXTA 1IBRA 1E6CA 2KWIA 2ZR7A 2VTKA 1KY3A 1ZM2A 2WWXA 3PQCA 3ETLA 3WP1B 3K0FA 4F38A 4F92B 4IFBA 2GCNA 1ZRHA 3BK7A 3W5JA 4F4CA 4BGDA 1UKYA 1KI8A 4NBSA 4AG6A 4M1MA 2PH1A 4MUBA 4Q19A 1RRGA 2Q21A 3KUDA 5ELXA 4PANA 2CL6X 1KI2A 2I4IA 1IOZA 2ZS8A 3TJZA 1KDRA 5L3SA 4QOSA 2O8CA 1SXJA 4B32A 1E79A 2O8EA 1JPJA 2RGXA 1X6VA 4Q4HB 2IW3A 4KO8A 2ZE7A 2HCBA 4NZYA 3K09A 4XWAA 2BEJA 3G82C 4QKQA 4CEIA 3A36A 1XCMA 2RHDA 2VHJA 3GJXC 4D4MA 2ZRNA 5EXSA 1G41A 1VG8A 4RY2A 3RHFA 3TNFA 4WVFA 4MYCA 4Q9JA 1CF4A 4XTCS 3IHWA 3CBQA 4JVNA 1AGRA 2AD5A 5EP2A 1Y3AA 2ZRIA 3DOEA 2FSHA 2CBZA 2XNSA 4R9UC 1TQ4A 1NSFA 3TVDA 3V9PA 3THXA 4KFTA 3IQWA 3OF5A 3TUZC 1KSGA 4DCNA 2GZHA 2A5DA 3VR2A 5FPYA 5KSOA 3W90A 1AZSC 5KSPA 2J5XA 3RSLA 2W6JA 4KVGA 4XWOA 3T1TA 1S3GA 3CM0A 1N6HA 4AI6A 1XWIA 3R20A 4GZLA 5AJWA 4URWR 1HYQA 4XVQA 2YWEA 4EIWA 4NCKA 2LWIA 5DH9A 1SVIA 5IDVA 2ZJ5A 3WMEA 4IVPA 5LB2A 2H1LA 4OJKA 1HE8B 4R2IA 4DLYA 3K09C 3CNNA 3Q9LA 1N6RA 2H7VA 2VSFA 1OIVA 2WICA 2QU8A 2HF9A 1B0UA 4MYUA 3BFKA 1CRQA 3DOFA 3ZYCA 4B3FX 2ZRKA 2ASEA
chains in the Genus database with same CATH superfamily
3LGAA 3EHEA 2O2IA 3KXIA 2ERCA 2H63A 4MHOA 4F1JA 1OFTA 4V0QA 4DIBA 1KU6A 5A3QA 5AJHA 3U13A 3ZD8A 1KRHA 3HHPA 3GF4A 4O2RA 1Z5VA 3ANLA 2AG0A 4TYYA 2I3AA 2DR3A 1ENOA 3CLSC 4FLEA 4FYWA 2FWNA 5EE5B 4BNKA 4F5WA 2BI7A 1Z5PA 3EEYA 3IURA 4QD3A 3WSTA 3SXPA 1YB6A 5GY7A 2B2NA 1GCIA 1TYDE 4HBZA 4CMAA 1D9ZA 4TQAA 5CA0B 1KQFA 3N7AA 2NU8B 2X9LA 3VNBA 4ZCQA 2JGJA 3R4CA 2NX2A 5FXMA 2VPQA 3PWSA 3IV9A 5A4DA 5KDDA 1V7QA 1NVWQ 2B7BA 1JG3A 3HFRA 4K03A 1JWAB 5E7IA 4E09A 4DSOA 3WR5A 2YIVX 2UYYA 1QM5A 2A0WA 4KJZA 3SQOA 1FY2A 1NMEA 4IJ5A 1YZHA 2Y1GA 2MDTA 1S2IA 2XVMA 3E5HA 3IV7A 1U3CA 1NE2A 4RQBA 2GPTA 3B7GA 3I6IA 2VDRB 3A6GA 5DYWA 5A02A 3V9AA 4BV9A 3FWYA 2RGAA 3M6WA 1EUDA 2FMTA 1Z6YA 4HPXB 4R2LA 4KEAA 4KR9A 4YECA 2OQVA 3C1AA 3DE7X 4EHLA 4PLTA 3V1YA 2DB3A 4NYMQ 1Z0JA 1WM1A 1Z56C 3M4NA 4KSBA 2Z8ZA 1R6AA 3TLZA 2PSDA 1SKYB 1Y5MA 3AXTA 3PHBE 5EVJA 1DBSA 3ZKWB 4YRTA 2D1FA 1NBEA 5REQA 3D43A 1LTKA 2GM4A 2AOXA 4Q4JA 3K9BA 3MJVA 4W5JA 5A2GA 4CG0A 2YY7A 3A25A 3DL7A 4YFYA 821PA 3VA7A 3QVUA 2R1UA 1SEPA 3OOSA 1I7NA 1QK3A 3UMMA 1J49A 3DO8A 4B46A 1RHQA 2AR0A 2Q3CA 3KQLA 3EEBA 4P3OA 2CMDA 1V9LA 1N8SA 3HWSA 4MSUA 5KOYA 2VEDA 4HMOA 3K70C 5LJLA 3RB8A 3NUQA 2XXAA 5KNCA 3V8NA 5BYJA 3GFTA 1P73A 2R7NA 3UJBA 4DMKA 2VDMB 3Q98A 4UAJA 3FPLA 1HNNA 3LZ6A 4JEUA 4V1CB 1EWYA 4TX1A 2MCFA 3IOCA 5JJLA 1N33B 2ADOA 2H4FA 1M7GA 4B4UA 1VLZA 1UXHA 4P92A 3WGMA 2XAUA 5F7OA 1F4VA 1Z38A 3CONA 1XU4A 1G5FA 3S5UA 2PYDA 1RZRA 2AFVA 3GJZA 2PUCA 5LYJF 3NGXA 4YMGA 4G0YA 2UVPB 1DG1G 1RHRA 2W83A 5AKJA 5A7FA 4WK0B 5KWJA 5EIXA 1OFIA 4ZQIA 3PQ6A 3CT6A 4J49A 4ARCA 3O9MA 5IDWA 2VWHA 5JO9A 1Y7IA 1ZN8A 2A1TS 2FMUA 3ROFA 2JVKA 4EA6A 4ZO9A 2FZVA 4JGIA 3OPYI 4LQDA 4CT0A 1GDTA 3B1JA 2EERA 4WXYB 4ZDKA 2ZDGA 2DY1A 1BDJA 3PNLA 1Z7YA 1NP7A 4J75A 1E1QD 5B2ZA 1SUSA 5AHKA 3Q2IA 4H4DA 5JASA 2ACKA 1GQFA 6Q21A 3K0SA 2QLMA 3LLMA 1KYZA 3ODGA 2AXPA 3QI2A 4PNEA 1JUDA 3DYBA 3A9SA 4DM3A 1JFTA 2F4NA 2GGSA 2EFGA 2N75A 3LMKA 4PRKA 2FVYA 3VPDA 4E2FA 4FEYA 3V4RA 1ULSA 5IFLA 3SMQA 3F2VA 1PR5A 1V1JA 2FX5A 2QM3A 4PONA 5ENDA 4BX2A 2C4KA 4RJLA 4UNNA 2WKRA 3DTTA 4OY3A 3P9ZA 4P0QB 5ESXA 1YB2A 1LQTA 1NOJA 2FQQA 3OWXA 5LD2C 5JXWA 1J56A 3FFTA 2C95A 1MAAA 1O95D 2JH3A 4WZ6A 5FUYA 5L45A 3CPJB 3PFHA 3A1WA 4GBMA 4GXNA 2QD5A 4YMIA 2OLKA 2VWPA 4ZEOA 5IMBA 3ZLUA 3AUUA 2BF4A 2XDQA 4RX1A 3KKOA 4TMVA 4F1KA 2HF7A 4NYIQ 4X93A 1T35A 2FMHA 2QM8A 2ZU6A 3N2KA 1LD3A 5GTDA 4YRIA 2X76A 1OC4A 3NHZA 5IBPA 4C30A 3HRIA 4HUQA 3PQ7A 2YXBA 4IIEA 2I9KA 2NMVA 3JPWA 2PUVA 1IG3A 4JJ8A 3O26A 3EGOA 4M6WB 1XXHE 4EUEA 1YZ3A 3UMJA 4YJGB 3UOGA 2E49A 4H3KB 2FFQA 1TVCA 3TKLA 4DR1B 1P2FA 2KLHA 3N8NA 3GJTA 3K35A 5I4IA 2AFHE 4UREA 3D2AA 3OWHA 4KR0A 3L07A 3M4XA 1CRWG 4YREA 1GNTA 4PLGA 4IIFA 2A9PA 3GH3A 3TMKA 2Z6QA 2GWRA 2HRQA 3IHLA 4G1BA 5DSXA 3T1HB 2F4VB 1HF3A 3UA3A 3L0DA 4AMVA 4G4JA 1WPXA 2CC2A 3NPAA 3T9CA 1NVVR 1MH1A 2PX5A 3G7UA 3DW1X 3GXBA 5EE1A 3IT0A 1A2BA 4J4BA 1J09A 1MXHA 2ZI4A 1MVNA 3KE9A 1F9EA 2ZRDA 3OICA 3I83A 2ZVQX 2FY8A 2XTAA 1DRKA 3B78A 2PQMA 1ZMOA 1RYEA 2A5LA 2VEOA 2ZYHA 3BWDD 2IHZA 4MKXA 2R4QA 1E96A 1QQBA 2FQWA 2CDNA 3W4KA 1WCIB 5FKJA 4JNCA 1DTWA 2WSMA 5A03A 1MRNA 2P35A 2OY0A 4XCQA 1XROA 5JSFA 3VU0A 1U3FA 1AURA 3R0ZA 1G4HA 1DI0A 5DFAA 4TRJA 5LQMA 2GVNA 2JLVA 3SVLA 1R12A 1T2DA 5GJWC 3Q9UA 4ZP1A 4FSDA 3SOZA 2FN9A 3AJEA 2D1YA 1FX0A 4EHFA 2N46A 3FNGA 4I4NA 2H57A 1JRLA 3LLVA 5A6SB 3W5VA 2G0NA 3NAMA 5BUZA 2IEDA 4D3FA 2DSNA 2V9ZA 4ASUA 3LQFA 3O8CA 4JSTA 4L57A 3VPSA 4K9MA 4HEA1 5CFNA 1P6XA 1EGMB 3I1FA 3AOEA 4NPCA 1NBIA 1TADA 2FEWB 2GILA 1Y3FE 2X8JA 2FF5A 2YJ3A 5AM1A 3PUWA 4BLOA 5K0FA 1HNZB 1HE2A 1ZS9A 2GK6A 3LCMA 2CCGA 4Q6WA 4TYNA 3WMGA 5H4HA 3TQOA 1QHXA 1V45E 1QB8A 3FH0A 3G1UA 1U5CA 1WDTA 4YJFA 3VSCA 1I4TD 2Q2NA 4M1EA 1R4MA 5FWYB 1CR1A 3R6LA 3SS9X 1Q77A 4LJKA 4WD3A 3OE7D 1P45A 4LYHA 1VLVA 5L4SA 2ZXFA 1HDIA 3B3AA 5IKOA 1E2JA 3OLWA 4MV3A 5AJVB 3RGWS 1Q1BA 3JQDA 3RRZA 3SXJA 4EEKA 1XXLA 3T5BA 3PQ5A 4LTDA 3SIWA 4D9BA 1PLKA 3ZU4A 1ZXXA 3LYUA 1KXZA 2YJTD 4QXMA 3Q8KA 4O08A 2A35A 4D9CA 4PCLA 3S2EA 2B5OA 3FCEA 2HWYA 3TW0A 4BWYA 2SCUB 1R0CA 2F62A 3RTDA 4YASA 2IBMA 1OHHD 1AOXA 1P3JA 4TUYF 3O2JA 4YO8A 2MR5A 4E5KA 5I48A 4HS9A 5MGBA 4IMIB 2I6FA 1C7QA 1MUUA 1P4SA 2JF0A 3KYDA 4GXTA 3CG0A 1U0JA 4XI9A 1IN4A 3IAAA 5FI3A 3ZWWA 3UMYA 2Q0QA 1E9EA 1E7YA 4MUJA 5IAJA 4A7PA 1DFGA 1U2PA 4UXHA 3BBPA 1FNBA 2AN4A 4BNMA 1ECJA 1EKXA 5J5VA 1W2GA 2OV3A 3BTSA 3E22A 2ZBEA 3URMA 2BCJQ 1PVVA 5IUKC 3P2KA 5PNTA 3THRA 4D4IA 5LIRA 1JMYA 1KYQA 1WIWA 2WJAA 3MGGA 2HRZA 2JFWA 2V5VA 1XTSA 1EFPB 1E0JA 5JSKA 4Z8XA 3DL4A 3CTPA 1F14A 4KSYA 1YR8A 3D8BA 3HY3A 4PWYA 4ZAGA 1L7BA 1LPOA 4LGCA 5FHQA 4AY4A 3DO6A 1UQUA 4CIBA 3JTEA 3W6UA 1JR6A 1D6SA 3GJ4A 5DHAA 2CT8A 2YS6A 3C39A 3GL9A 3MB8A 3GMIA 2BHNA 4YHBA 3LDFA 1Y8ZA 2J08A 4FDUA 5J4HA 2X9NA 3BREA 1XQVA 1DCTA 3DZJA 1S9DA 4Q7QA 4ZHQB 2QVYX 3H05A 4N48A 5JMPA 5L8VA 4ZOLF 3UWKA 5D1HA 1OKKA 1UJ4A 4UULA 5JAOA 4A36A 4AWXA 4CF5A 1X8KA 1ZK4A 3EN0A 1QJ4A 2D2VA 3JRXA 7MDHA 1XD9A 1W93A 3OEWA 1S8FA 1P19A 4OB8A 3NG1A 3CXUA 3QKIA 1W1WA 4NY1A 1RC1A 4A5SA 2C4TA 2A58A 3ZS8A 4JP8A 3AETB 4M8LA 4MHSA 3WGOA 4GOOD 4HZUB 4DOMA 5KTPA 2IYSA 4EFNA 3DEAA 2R7LA 1U0BB 1XHLA 3IR7A 4R0NA 1QOZA 4WCFA 1Y8RA 3GZNA 4L6CA 2OZVA 2GK4A 5A9SB 1FFWA 5CUQA 1IZ8A 1A9YA 4BPRA 1HBJA 1WHSA 2GZ2A 3OZDA 4ZANA 2RAUA 3KSZO 3L77A 4J4HA 3DB1A 1NN1A 3K1TA 4LJLA 5LYJA 1NX6A 4F97A 3V97A 3ZDXB 4IJWA 5AW7A 4AJIA 3KR1A 2XA9A 2XMSA 1PFQA 1RLIA 2ZI9A 5L6LB 4FFLA 1W34A 1ZQ9A 1YFJA 1VCIA 5CA1F 1MU0A 1KGDA 4N40A 4IZ6A 1SA0A 1T4GA 2QDXA 1JGTA 2E87A 1NX9A 5B12A 3COVA 2O7QA 1GAJA 3NM5A 4ERNA 5FYDA 1I7SB 4M1KA 2XVYA 4PINA 4IOMA 1DCMA 1T1GA 2V7QD 4NVRA 3LOPA 2AEEA 4YP5A 4F4DA 3TJRA 1SZJG 4MIKA 1DX4A 4C07A 3UG7A 1Z5OA 4DIOA 1W5EA 1LX6A 3BSYA 3B5EA 3V34A 3JSXA 2HWKA 3IUPA 2X0EA 3I01A 1WUTA 4QDJA 5LSAA 3NRCA 4MUFA 2OK7A 4XGKA 1HGXA 3BJIC 4JGBA 4MKHA 3U4QA 2ZSKA 1NC1A 1L5KA 3JATB 5FPPA 5C7LO 3FAKA 2JAPA 4FNAA 5BUQA 2E5WA 4LOAA 5I5EA 5EJ8A 2VP4A 3TLGA 4WCFC 4URXR 2ZYUX 1BO6A 1GKIA 3H65A 4K7JA 4FZVA 1GTZA 1HT3A 4UNQA 5ITZA 2Q41A 2R6DA 4H0NA 4W5WA 2ZWPA 3KK0A 4NDNE 4NNJA 5C53B 4CMCA 1IPFA 3M34A 1ZSVA 4I55F 1JHQA 4F72A 5ICMA 5IKPA 2D5LA 2IYXA 1O6BA 3MC1A 1D4AA 1FFCA 4BMOB 4HAZA 4BX9A 3MJEA 2GN9A 3RYIA 2ZUVA 2AG1A 2B3TA 3HZZA 4CM5A 1TCAA 3OKFA 1UXGA 3X2SA 1LVHA 3LCCA 4G07A 4P32A 4AG3A 4BGUA 5KMGA 1KKMA 4GLFA 5K8TA 3CBGA 4BLVA 4DBVO 3QEMB 3WISA 1GQOA 2GHIA 1AQYA 2IYPA 3I32A 4O3FA 1TTTA 1CY4A 3CRMA 4PC2A 1H94A 1C1DB 2G76A 2OYSA 3ELYA 3MXTA 4NICA 2IYEA 4JSRA 4FS8A 3G2PA 3ZE2B 1SHKA 4ZO4A 1YI8A 3PC6A 5ED4A 3A6ZA 2C3OA 3UY4A 1N5JA 4WFQA 5BSGA 3LA8A 2B4KA 5JXGA 2Q0XA 5IKXA 1EK2A 3ONFA 1P31A 1I3CA 3SQMA 3LCVB 2V0CA 1GYPA 4PCAA 4ZJPA 1X9GA 2RDMA 3MRXA 3WYNA 4BE9A 2JGLA 1H69A 5C46F 2YVLA 2RARA 3AUKA 4F7WA 1T15A 3PRKE 4OHUA 4YRJA 1GG2A 2G70A 1I2MA 2V7EA 4FDMA 2AKYA 3W9SA 3HYRA 3L40A 1Z75A 1TMOA 2OPBA 1JDUA 3VAZA 1TU0A 1FNMA 2IIPA 1LDBA 4FYYA 2D13A 4XIJA 3WDLA 3QF7A 5IH3A 4X5OA 2A0FA 3PPVA 4E4TA 2G4LA 1EE1A 2HM7A 2WWTA 3GGCA 1E5VA 4CKZA 1WPGA 2QW8A 2XGOA 3NHPA 1RJDA 4GLOA 3R4VA 2BFOA 4UPVA 3L06A 3B89A 1BRTA 4X54A 3K6RA 5E4JA 5TVKA 1MT3A 4NWIA 1PJ8A 3BFJA 1R4ZA 2CF5A 3A3OA 4W1QA 5IULC 2RHWA 2CNDA 1W5TA 4NK5A 1E4YA 1H66A 1NONA 2ROQA 3BWVA 3NBKA 5HVNA 1UZLA 1SVSA 2GLXA 3RNLA 1R3DA 1ZCBA 2WAAA 3STHA 3E81A 1VLQA 2K6GA 3L43A 3M8KA 4N3CA 3SX2A 5A6VA 3IUMA 1ZJJA 3LP5A 4KODA 4MRMB 2DULA 1IXKA 2AC2A 4MGYR 3H9GA 1SVMA 4C7OB 4CM7A 1GCUA 3MEQA 4MVJP 1PDVA 2AJTA 5HIJA 3SM9A 1YS7A 2EDCA 3GVIA 3EEOA 1I36A 3UMBA 2A9JA 4B3MB 1CJSA 1WCXA 1ZONA 2DHCA 4P4SA 5T4FA 4B3CA 3TZLA 4CL0A 2IK8A 3L4SO 5TE9A 3CVWA 2XZLA 1EFVB 3QW4B 2XKKA 2YOFA 3FZQA 4CM8A 5CB0A 2V5AA 4YJHB 5KJ1A 5A0VA 5JTUA 1Y1TA 1YOVB 1QTRA 2Q4BA 3QI7A 3ND8A 4OUKX 5JY1A 3AHHA 4OAOA 3VKFA 1TK3A 1TAQA 2GCOB 2Y6VA 3EWNA 2MSWA 5AD1A 2QJWA 3PUXA 4TUYA 1UT5A 2V8OA 1PHPA 5H9VA 4C3OB 5JZBA 4ZC1A 1V8PA 3F7MA 4MP8A 4F3TA 2C1ZA 2TS1A 5F12A 2BCGY 5JANA 4UTPA 4UUPA 3MINA 2BONA 1Z0IA 3QNUA 4MGZR 3EASA 5KYWA 3GEPA 2IHBA 2Y0BA 3AX6A 3EY4A 1Q0SA 2Z56A 4AUMA 1JHMA 621PA 1I2DA 4K6CA 2PUBA 4YYZA 6CHYA 4JJ6A 2C2OA 2VSXA 4IH9A 2BT4A 1HPLA 4RHUA 3OOJA 3T12A 4ECEA 1VL6A 3VVMA 1WW2A 2DLDA 1TOAA 2H54A 4F71A 1NBME 1AK1A 3EEQA 3WDKA 3D5QA 3NALA 1T34A 1ARZA 1AKYA 4ND7A 5ILGA 5ALDA 4F5DA 1D4ZA 1VIMA 2QOEA 1LBSA 3CNQS 3OHMA 2I6UA 3GDOA 2QM7A 1F4LA 1FUUA 5F35A 4ARVA 3AIOA 1OT3A 2ZKLA 3AZPA 4G0PA 3RUAA 4HEA6 2XUGA 3WL4A 1ML4A 3HPQA 5FA5A 1QWSA 2R79A 1MC8A 2H2DA 1V0JA 5KWIA 3UJ8A 4CLEA 3IPLA 3CKMA 3LVRE 5IC5A 4C4AA 1PQ4A 1R0KA 4XPIB 2LGJA 2Q49A 1K7SN 3ADPA 3GMDA 4JS0A 4KH0A 4N7BA 1CLEA 4G9BA 2UYQA 1L9KA 5CGQB 5F51A 3Q3VA 4G1FA 5M04A 1QP7A 4JEIA 4DV7B 1YFZA 3H04A 5J59A 2MWMA 4Y6PA 1YCHA 5F5NA 3RT7A 3AQ4A 4J2OA 2IKSA 1TM3E 2OCDA 7ADHA 3QXGA 1P2BA 2V7TA 1Z2DA 5GWXA 3QBVA 4C20A 2G04A 4TKVB 4MA0A 1D9XA 3PQ8A 4KMMA 4X1IA 5SZJA 2O6LA 2I7DA 1UJNA 1TVKB 1M75A 3J81A 2ORED 4ZVQA 1J8QA 3I4LA 1ODJA 1DBVO 3C45A 3EGCA 4IILA 3S4YA 2PUTA 4IV5A 2F6RA 3JR7A 4R81A 1MJ5A 2R96A 1XTZA 2FCAA 1A98A 2Q46A 2YTZA 2ZR8A 1E6UA 3GRKA 3EPHA 4LOLA 2QX8A 3I05A 4X65B 5GADl 1TQDA 3GIDA 1N1MA 1LDGA 1BRMA 2JIBA 1JQJC 1KOFA 1EPUA 1AVTA 2I1VB 2O2XA 1S6YA 4GI2A 3BRQA 4W82A 5LP6F 4XB2A 3LLSA 2R5FA 4KOEC 3LC0A 5CA1A 1MX1A 3U4MA 3MT9A 1UMBA 5AVJA 3ESXA 2ZI6A 3UPTA 3INRA 3MILA 4C4RA 1U0HC 3DHNA 4J0DA 3TD6A 1NJGA 3ZU5A 1KAGA 4AIIA 4O4IF 4WJLA 1RC8A 1EJ2A 1XVTA 3ASUA 2A67A 3ENVA 1J99A 3FTPA 5K3BA 4D80A 2V0NA 3PHHA 2W2QA 2Y9PB 4LOJA 4RL6A 4H1HA 5JWHA 4H7DA 2YHIB 2VAVA 3FLBA 4FFOA 1RI1A 2QMOA 4E88A 1FX1A 2X2FA 3GGDA 4X60A 1R18A 1KMQA 1USKA 3PFCA 4E32A 3G6WA 3SP1A 1I94B 1PEAA 4RKRA 5GMOA 2WYIA 4D7AA 2PVPA 1SXJC 1TXGA 4TTSA 4E13A 2HXSA 3JX9A 5JJ5A 4NJEA 3P0HA 4FS3A 4PYQA 4DKXA 2P9CA 3RF6A 1SELA 3OM8A 3HA3A 2YY5A 2AYYA 3T54A 3EIHA 4DDMA 4I55A 3B3JA 2H59A 3D6FA 3MS7A 4J0EA 3FYCA 4R4JA 5E0OA 3BD8A 2QZSA 3LX5A 4OMCA 5A05A 1E9CA 3ZI7A 2UUCB 1H9BA 3C87A 4OHOA 4AT1A 3NXSA 1U6JA 3M81A 4KBYA 5E6UA 1C0IA 1YK1A 2CLLB 2VS1A 4YH1A 3VQTA 1AO3A 2TYSB 3AC0A 2M98A 5LDGA 1KFCB 3Q7QA 2VATA 5AXAA 2GMWA 4E11A 2HWUA 3MWGA 3BXGA 4GI7A 3EUAA 4FHEA 3U6BA 4BC1A 1LPMA 3L7KA 3MW8A 3FIUA 1NI4B 4DA7A 4WESB 5JS8A 1K0UA 1AIPA 4KXNA 5FUMA 1OXMA 1SCQA 2HIMA 5EGSA 1XXHB 2GZ3A 3CPSA 2H07A 4DJAA 4ZEMA 1RC0A 2ZWVA 4PPYA 3NHRA 1DEHA 1FS4A 4XGRA 2O19A 4D9HA 4G26A 3HJGA 1C8KA 1CQPA 1ZIDA 4LUCA 2O2YA 3BJEA 1BCSB 1L7EA 3RARA 3ZHTA 1MG0A 2R8YA 3SBOA 3U1BA 4GM1A 3AL0C 4BQFA 2C5SA 2PXXA 2PLWA 3MD9A 4N01A 1WQ4A 4NBRA 4ZARA 2PGIA 1GTVA 2D54A 2OLJA 2XT0A 3FVRA 1G1MA 1U1FA 3A6EA 4N03A 4IWNA 4EY8A 1TLLA 4GH5A 4QPJC 3RV3A 2D8AA 2QVBA 3M89A 4IQFA 4NJMA 1RACA 1ZGCA 2AK2A 4NSNA 5E4TA 4DPMA 2A9OA 3I5XA 5LLSA 3HKBA 1WMFA 3IVMA 3ORQA 3AW8A 4IQ8A 4REQB 4Z7QB 3C6YA 4JUIA 3CCBA 1K98A 1YQEA 2VJAA 1E3MA 2OXIA 3L0ZA 4RD1A 2YQ5A 3TUIC 2ZRJA 5EJ2A 1RRFA 2FXVA 3NHLA 1XPRA 4LK2A 1G6Q1 1M8FA 1ZW6A 1FXWF 4NKRA 5FJJA 2REBA 3KSDO 5A5EA 1B15A 1JG7A 2EKQA 3BVPA 3MCTA 4NI5A 4MVJF 3E70C 1LDEA 1Z0UA 2OCAA 4P0TA 2O3SA 2VA9A 4KIUA 1RTKA 3KZCA 5DV9A 4ESOA 1U31A 4CM1A 1U7OA 2N9UA 3X1YA 5GJCA 3IUSA 5AQEA 3W6ZA 4FT4A 5K4AA 2O6HA 1AMUA 3C7TA 4GPAA 1NF8A 1OZ0A 3FHLA 3C3AA 4GVLA 4Z4FA 3I8OA 1ZQ1A 4HFRA 5F3RA 4JXXA 2DKFA 1CUAA 2GM3A 2X8BA 1MRZA 5GVSA 4EG6A 1MVOA 1XTQA 4ZCRA 1JN0A 1EVKA 3D1VA 4MQEA 4ZZ3A 1UMKA 2KX7A 5AH0A 2EATA 2BY4A 1WMSA 1XCLA 2JH9A 3FPAA 4ND3A 3ITNA 5IWCA 3A6LA 4H59A 4LN1A 5DZSA 1JDBB 4P22A 3WV4A 1K7XB 2HTFA 2QBYA 4UU7A 1L7AA 1NY6A 1CHDA 4FQ5A 1KVSA 1C2YA 1G7RA 4RZQA 1AKVA 3NTXA 4B40A 2BFPA 1GL9B 1PR6A 1US8A 4PSKA 4YCCA 2WKQA 4HMPA 1AQ6A 3P4YA 4XX1A 1N2CE 1XVAA 2XMRA 3QY9A 5ADWA 1QHYA 3ICCA 4KXYA 2JFOA 5CLHA 3GWGA 4JQSA 2OECA 1YF3A 2VVTA 5FP0A 3T4PA 3T3PB 1L5YA 2VHYA 1NVBA 1Q20A 3VZPA 4DLUA 4BO6A 3QX3A 3FUTA 2Z8XA 2RHJA 4N49A 1M2JA 3KVYA 1S5PA 2H1FA 1DQZA 2Q9BA 4HO1X 1E64A 1MJHA 4MWBA 1A3CA 2YVQA 4ZODA 2I1QA 1JEOA 3ZXXA 1JG1A 2BKAA 3OTOB 3AF4A 1YKSA 3PVZA 4WBXC 3RBAA 3RC1A 4D3XA 1PIWA 4GPTA 1NJ2A 2DBVO 3NORA 3H2KA 1H2RS 4NZZA 2NN3C 3SF8A 5JRZA 1VGRA 4NMWA 3ZVKA 1R88A 3CQ9A 2G9NA 2X7HA 3A2NA 2DSTA 3GJ7A 3NYWA 3HUTA 3TMAA 4RMHA 4RVNA 1FDSA 1JB1A 2QD4A 3IBTA 4H60A 4M89A 1TAUA 3OZRA 4C0AC 1YR7A 1Z36A 2ZANA 3BA6A 4OG2A 1OTHA 2J9XB 1BDHA 1X94A 2WVAA 3HDTA 4JU8A 1GZ7A 2G9QA 3LBFA 4KG7A 4M83A 2V8BA 4RD2A 5EQDA 4UCXA 3RIXA 5LC1A 4HT3B 4INZA 5ES3A 3QQ5A 1RAAA 1HOXA 3UJCA 1N0VC 2QN2A 1Q74A 4LDRA 4AYWA 2IGBA 1OLSB 2J48A 1XF9A 2CHVA 2HC9A 1B8VA 4NBVA 3T1OA 1ST2A 5KJ6A 1JHXA 1ESEA 4ND6A 1P7WA 4AZWA 3A8TA 3QOYA 5AJXA 5KTOA 2PVCA 1CNEA 4M22A 1T1SA 5JS1A 1U94A 3BXZA 3VO8A 1CUJA 1E7RA 2PX4A 3I6QA 1SIBE 1AG9A 2VF4X 2WILA 3DW3X 5EJIA 1JFRA 2M1XA 3M6AA 4IHJB 4PGMA 2R48A 2AIRA 4WPGA 4DDKA 1PT7A 1EB8A 1CUWA 1W9HA 2WJZB 3HP1A 4L3VA 4C0WA 4U7TB 5KYYA 5EFZA 4RM2A 2ZWIA 1NJSA 1N0UA 4R8KA 3HYLA 4YWJA 3WWCA 2XZOA 3AKZA 3OEED 2CXXA 5LP6A 3GP8A 3BMCA 1BVRA 3STWA 1RXEA 2ZE5A 1PQUA 3CLUC 3B12A 5F9FA 1G19A 3LK7A 4ONEA 3W9BA 4PPQA 1SCKA 5FWNA 1KHHA 2ZSBA 1PT8A 5KDLA 4YGYA 1TEZA 4M1YA 3QYJA 1SO8A 4U39A 3G3EA 1E58A 1XA4A 4JYCA 3HUUA 4UAGA 4US1R 5CM8B 1RMYA 4MLDA 2KM1A 3ABSB 4HDRA 4WECA 1UXJA 2G1PA 1CDZA 2CXSA 3F6SA 4U1RA 3LY5A 2Q1WA 2VNJA 2PPLA 1ZRMA 2ECOA 1KEEB 1F3OA 3GP5A 3HDHA 1EBFA 3T41A 1QIIA 2JEOA 2GVZC 4LE1A 1CF9A 3G8AA 1D2EA 5TXGA 4BNTA 4CNQA 5FWDA 4DCUA 3K71B 3HJAA 3CJQA 3Q2KA 4FHGA 1CUYA 3UTDA 1BXZA 1B74A 4RZIA 2DT8A 3WWPA 1CW2B 1ENZA 1WSDA 3ZX4A 4A8TA 1WMDA 4HP8A 4MWCA 2WU3A 2XMDA 1RWPA 3AZQA 3PXXA 4PY2A 3ONNA 4AULA 1Q7RA 3ZTYA 5JH7B 3E1KA 4GHWA 1XQ6A 1SD1A 4LAFA 3O9ZA 4OFBA 1RAFA 4PQFA 3ZHZA 1R2QA 1V48A 4QBHA 2SICE 3TINA 2A4MA 4ZDIA 1U8UA 4Q5IA 3R9WA 3PNYA 4IJVA 1RLMA 5CLQA 1NM5A 5LP6C 3BH7A 4L22A 4F93B 3LECA 4GP7A 1DBWA 1H5UA 3NIWA 4ZICA 2AJBA 1NOKA 3KPUA 1XDWA 4UM5A 5K3CA 3K9LA 1RE0A 1WO8A 3NHJA 3ZH2A 4UEJA 2EC5A 2I3DA 3DZKA 2R751 3HL4A 5JFOA 3P9QA 4OREX 1P4HA 4MMXB 4ALNA 5AM3A 3QKSA 3U4DA 1CEYA 1F1BA 4B2PA 1ESNA 4F21A 4L2IA 4YRGA 4YAJA 5E7QA 3DZBA 1Y6RA 1HFWA 1Q0HA 3AP3A 3JWJA 4D98A 2R8ZA 4J0KA 1X7WA 2VZLA 1GZ3A 5G1OA 1U9CA 3HHEA 4JXZA 4P53A 4ZDWA 3OAAA 2PXHA 3SX4A 3WJ1A 2PRYA 1ZH6A 2GLUA 3Q8XB 3TTWA 1FQKA 2WHRA 1K6IA 1R4NA 1BE0A 3DTVA 3M6LA 1KJZA 3UBTA 1G8GA 2RI0A 4RKWA 5JSQA 3R6GA 4JJZA 4C0KA 5JROA 5FQOA 2I66A 4H2DA 4ZDJA 5B57C 4CEJA 1V5EA 1PHRA 2HH9A 2QUBA 2O3UA 1EX7A 1U7XA 4PW0A 4RH1A 2C0QA 2W37A 1FP7A 1UC8A 3EWSA 3GRFA 5CK4A 4RANA 4V0OA 5AHOA 3JWGA 1B0AA 3GC6A 4DZRA 1K1EA 2B8NA 4OK3A 2QVGA 3OY7A 3DUWA 4G4SP 1T36A 1GZHB 1PLJA 1TIPA 1H1LB 4A3SA 2XMBA 3MPOA 5JQWA 2C7VA 1NM5C 1Q0TA 5B1IA 1CUCA 3IALA 2F3PA 2P77A 2QP4A 3CCFA 4TOIA 3QJ5A 2D62A 5T6BA 5JXHA 2P6PA 1OI2A 4V0SA 4BQSA 4BTLA 1E2MA 5F9MA 1FXUA 1KO5A 1UDXA 3VC7A 4WCDA 4I9GA 2PA3A 3COSA 2FEAA 1W0KA 4J7UA 5D3KA 4BRSA 5IJ9B 1FXWA 3PVSA 1NLMA 2J6HA 4FE7A 4X3PA 2DWQA 1NL3A 3D3KA 4BBJA 4MVJA 1PNQA 1WB5A 4NNOA 3U4GA 3TTYA 3UXMA 1FNSA 3QNWA 1NURA 5TB5A 3VVLA 4F9GA 5L3QA 5ALZA 5DM2A 3ZKAA 2A0KA 2PMEA 1ZZEA 2X0DA 1HYHA 3IJRA 3NBYC 2BEUA 4U0JA 1ETUA 1GUAA 4CODB 2HQ1A 4CQMA 2R65A 2C98A 1GZUA 5FL7A 3S44A 2B99A 4WIAA 4G2TA 3WFJA 2R87A 4N5MA 3H5WA 4B6FA 3W5AA 2VK8A 3NEJA 2AGVA 1FJ2A 1IY9A 2ID7A 5F7XA 4DMFA 1H3EA 2X3UA 1J1ZA 2RGBA 3HA7A 3P9SA 2X5NA 3CKKA 4BLRA 3HJNA 3NUZA 2CJWB 4RIHA 5TF4A 2HK7A 2JAHA 2GO1A 3RBVA 4C4TA 5DXFA 1EHIA 4HATA 2IHVA 4KN8A 2Y1XA 1CVLA 1F0NA 1JLLA 3C4QA 1PLLA 4E7OA 5P21A 1KWKA 3ZVLA 3JVVA 3ZY2A 3I64A 4YJ2B 3NIDB 1SC4A 2PGOA 1Z29A 1ZW1A 1JA9A 2VUHB 2CXHA 3O92A 4NCXA 1NP3A 4PIMA 4RVCA 2HBYA 4YCAA 5B36A 4F1WA 4TYWA 4IF6A 4NV1A 5FPKA 2G09A 1JF8A 1I9GA 3HRHA 3LKBA 2ZI5A 2AOUA 4OQXA 1QKKA 4TV8B 3PVCA 4XB1A 2X2PA 5BWOA 3S7ZA 1QFYA 5EE3A 3THWB 1S4MA 4XLZA 2QG4A 3IOMA 2B1IA 4PPGA 2IPNA 3TZBA 5EHIA 1U04A 1Z7WA 3ZVMA 2RC5A 3A2LA 4M1TA 3TL2A 1V1MA 1Y7TA 4QHTA 2DOKA 2DPYA 4GDMA 4PWZA 1Y3BE 4EPTA 1CIVA 1IUKA 2DHQA 4YT5A 5HTOA 2BMAA 2REXB 1LQ2A 2FE4A 1XCBA 4HQKA 5JPDA 4QEDA 1AF7A 2O8FB 1HLFA 4EATA 3KU4A 4LC1A 5IJ9A 2Q7XA 4XOUA 3ELUA 1MD9A 4F91B 4G09A 2J0EA 3QX7A 1GFWA 4XVCA 4AWAA 3PFWO 1DDOA 2AUNA 2MSEB 2Q5EA 2QR5A 3B6ZA 3DJYA 4WT7A 3AP2A 4FMDB 2NU6A 1DBPA 2W2NA 2WR8A 3B20A 4ZCTA 1KA9H 2XE7A 5D84A 4UNRA 3S27A 4WZBE 1Q7GA 4J2TA 3WX0A 2JI7A 1CLUA 2PUJA 4C0JA 1QCCA 2FW0A 2R8RA 4KE6A 2M9MA 3KSAC 2RJ3A 1Z4LA 3KHSA 3FOWA 4O33A 3SNKA 5AK4A 1V8FA 1VYVA 1ZM3A 3JVUA 3ETHA 4BVGA 1TZCA 1JDJA 4QFBA 5IU6A 3D59A 2UZ0A 3RUCA 2WK1A 3W6PA 3QFSA 1QPBA 3FYUB 3ONWA 3V42A 1ECLA 3TM4A 1ECBA 2IA5A 1C4KA 3OLZA 3EFEA 2OC4A 3MVEA 2PZEA 3QOXA 4Y0VA 1E3IA 4GF5A 3ZY6A 4RE6A 2QLFA 4A0GA 4MCAA 5HM8A 1JQBA 1P77A 3CX4A 2AN5A 5D3ZA 4JQYA 1AK2A 4QBGB 4YRSA 4Q4LA 1U81A 2FPWA 5GV8A 5BSHA 2XGJA 3FJOA 2ZI7A 1SCIA 3I9MA 4MJ7A 3GLHE 1G64A 1P7VA 4K6OA 3O91A 1S1CA 3EPKA 3PR3A 1ZEMA 4NDAA 4RH0A 3HY6A 4E12A 3D3WA 4ETNA 2C88A 5A1TA 3DT8A 3T35A 3KB1A 4N7JA 1IQ0A 4M99A 3NXKA 4CLOB 5HW0A 3GAAA 1SPBS 4ZQCB 5JSZB 5A4FS 2HA2A 1IN6A 3P26A 3H42B 3KJIA 4WOJA 4AZ3A 2O5EA 2AC7A 1XTIA 2RBGA 1W4AA 2Q4EA 1CUXA 2ZR9A 2DYKA 1WKCA 2JHPA 3R40A 4OGFA 3O8RA 2UYHA 4J6FA 3UAWA 2XQFA 2I3GA 2C3UA 4XDHA 5JR3A 4H18A 1OY1A 2V55B 1BXRB 2Q45A 1ES9A 2ZTHA 4FDLA 4PLWA 2EX1A 5J1TB 3AVQA 3TWOA 4G67A 3F1LA 3ZTTA 4OUDB 1O5TA 1I33A 2XWJI 3FNBA 4F5EA 1MOSA 1HT1E 2R60A 1R8JA 2D5BA 3ILYA 5GZ1A 4ZPXA 5LKAA 1GR1A 3RG2A 1VCHA 4GNKA 5FDFA 1EGVB 2G9VA 2OZKA 3O3MB 5IEBA 4CF7A 5T57A 2VZ0A 1E4VA 1BYUA 4RELA 1YACA 4B09A 1MHTA 3PYMA 1G4AE 4UE3S 5TRTA 4DNFA 1KDVA 2HDNB 1OROA 3PV0A 4LVNA 4FE3A 5JISA 8ATCA 3HXMA 4FHFA 2XGMA 1BU8A 2JGKA 1ZOSA 1SQ0A 1M1YB 2OAQ1 2PMKA 2VDOB 3W3AD 2ZRFA 3FHOA 4OM7A 5E6SA 3DMNA 1XA3A 4RA6A 2ORIA 5KSYA 1AQNA 2JD2A 4MJXA 3QWHA 2XPCA 3SHQA 4GMXA 4KK4A 5HIAA 1AF4A 3B6KA 4UFOA 1UKCA 4QOGA 4G81A 4B34A 4QU8A 3TK1A 2HO4A 3QU5A 1TW2A 2WIFA 5DCLA 4BKRA 2IUUA 2NZJA 3E35A 4UVHA 4CW7A 1JDTA 2YZKA 4NHOA 1RI3A 3IPCA 1INLA 1B7GO 3WK9A 2PM8A 5TQ2B 1GGEA 2QQ5A 4E31A 1QOQB 3Q3HA 1OYOA 3EC1A 1NQXA 1ZGAA 2O0HA 1JSRA 2YOHA 3K8OE 1FSSA