1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
2WJHA 1W46A 4LWZA 3EA0A 1W0KD 1SVSA 5CK5A 4DSNA 4TZ6A 4ASUA 2GRJA 2OLKA 4TQ9A 1UDXA 1BIFA 1A4RA 1JEDA 4DT1B 3LV8A 2CVHA 2W00A 2NO9A 1ZIPA 1QHSA 4KAXA 1XEWY 4DT1A 3HP1A 4BUJA 1E1QD 1KTVA 5EXTA 2AWNA 2H16A 4BZQA 4PZZA 4TZ0A 1E1RD 3K0AB 1AGPA 3LDAA 2YWHA 3QXSA 4B43A 3ZVNA 1TF7A 3GMTA 2G1JA 4F91B 4Q66C 1SVKA 1E9DA 1DOAA 4LV6A 1IY0A 2ORIA 1J8MF 4J0QA 1RVDA 2GAAA 2IYXA 1DAHA 2W6IA 3RVBA 5L8VA 1SVMA 3RABA 1CRQA 2QU8A 3B85A 3K09A 2QGZA 4P3YA 4P33A 2PZGA 1U8ZA 1LV7A 2ASEA 4RD1A 4G3XA 2UVQA 1AS0A 2L0XA 1LS1A 4B3DA 4OHVA 4URWR 2REXB 1XMSA 2V7QD 3THXB 3GLIB 4XVRA 3UG6A 4JLKA 2BMFA 5CJPA 4DCTA 3U61B 3THXA 3GLIA 3W6OA 1ZUHA 1G16A 2IYLD 3BE4A 1R0WA 3THOA 3SOPA 3EAQA 4N1AA 3FMPB 5K8UA 1SGWA 1X3SA 4LY6A 2CMKA 1HTWA 1D6JA 2VP6A 3AF3A 3OEHA 4ZI2A 4E07A 2IYRA 1T6NA 2FA9A 3BK7A 5J40A 2ZUBA 2ZE5A 3M6AA 1X1SA 2BM1A 1G8YA 1X8JA 3FOZA 2G6BA 2FSHA 3K9GA 1MO5A 3FGNA 3PENA 3FB4A 5DHAA 4EFNA 5SZIA 1YZTA 2J5XA 2BV3A 2NOAA 3B2EA 4ZDKA 1P60A 3F8TA 3GCGA 4ITRC 5AR1A 3BBPA 3PG5A 2CL0X 2IWHA 1BYUA 1KDPA 4B6FA 4LYHA 2KWIA 4G5QA 1Z08A 3OIYA 4YQFA 2BBOA 3SJAA 3AVPA 3WHKA 3NEJA 4QBFA 2CK3A 1E2PA 2VF8A 2W0MA 1G8PA 1KJZA 2EYQA 4OI1A 1JNYA 3AVTA 2PBRA 2LCFA 1EFHA 4BE7B 2BM0A 1A5TA 4NKRA 2YWGA 4PQYA 1U9IA 1B0UA 1OIWA 2H17A 3OESA 1E3MA 1S96A 2C04A 3CW2A 1W0JA 4QGAA 4TYQA 3RSLA 2VF7A 5B2ZA 3ND8A 1Q3HA 1E79A 2XITA 3L0OA 3O8RA 1Q1EA 1LS6A 3R9IA 4DLWA 1DE0A 4ABYA 2IS6A 3RHFA 4US2R 2G0NA 2IT1A 2NPIA 1ESMA 3H2YA 1UEIA 1KDRA 4GOJA 4L8GA 4P32A 4RD4A 3RDPA 3QXXA 4NYMR 3AQ4A 3TW4A 2F9LA 2QTVB 1XJ0A 5DNYB 3TSZA 2VHUA 3AKDA 1HV8A 1MH1A 1N6HA 4V03A 1Q44A 4ERNA 4DLZA 2YZ2A 3VNUA 2LWIA 1AKYA 2QE7D 2YYZA 4P4SA 1TEXA 3NH9A 1AQUA 1GL6A 4WA7A 1E9CA 2A78A 2DYKA 3IDQA 4DCVA 2IX3A 3QKSB 3UANA 4AURA 2O8DB 3VR3A 2JLVA 2Z4SA 3CZPA 3QKSA 2DWQA 2O8DA 4H9GA 4YXWA 1DEKA 2JASA 4JZKA 5FTKA 1NLYA 2H7VA 2ZQ5A 4QC2A 3LWNA 4Q7JB 3TR0A 4CEHB 4URYR 1NLFA 5EP3A 1CXZA 1HQCA 4DKXA 3K70C 3WNDA 3TAHA 3EASA 4CEHA 2WJYA 3LO5A 4PXAA 3ZVMA 1RRPA 2GZAA 3C7KA 4GPTA 4M53A 4Q9IA 4LJ6A 4YDSA 2FJUA 5FTJA 1KMHB 3LXRA 1OPXA 1SQ5A 4YC7A 1YZLA 4Y0VA 2D2EA 2PX3A 2GNOA 3WHLA 1KI1A 1KMHA 1CRPA 4L15A 4P4UA 4KSCA 1XBTA 3R8CA 4Z51A 2WIBA 1SULA 5FBQB 1HUQA 4QJ5A 1Q21A 3KKPA 3Q5EA 1PJRA 4RFVA 5AUQA 4JS0A 1T3LA 3AP1A 5JHGB 2F3RA 1P2TA 3B8HA 1G5PA 4YMSA 5E4FA 5LB4A 4NCHA 4HATA 1KI3A 1AK2A 4WOPA 2XGJA 1IN8A 1X8KA 3U44B 5KPJA 1XPRA 1J7KA 1ZU4A 1AS3A 1L2TA 1N0UA 3CNLA 4NDZA 3U44A 1G3RA 4QJ3A 5E7MA 3D6TB 3A58B 2IYUA 3PUVA 1W1WA 4KBGA 4ZDWA 1UKZA 1XXHA 2WM9B 1FP7A 1TQ6A 1QRAA 3DDCA 4F4JA 1H8EA 1GP2A 4BPBA 1UADA 4GMXA 5G3YA 3DKPA 2BCGY 2ORWA 4LOAA 2WWFA 4AYTA 1QHIA 1P75A 1RW4A 3ZZ0A 2RCNA 2JLQA 2ZRAA 2WWXA 2GK7A 4DSUA 4FN5A 2IS1A 4LRWA 5FPKA 4TLEA 1EWQA 3RWMB 5JMTA 1KJYA 2GEUA 4KODA 3BB4A 2AFIE 3EPKA 2VHQA 3UWOA 1XPOA 2QG6A 3U6BA 3CX6A 2X1VA 5L3SB 1MOZA 3X1WA 2PEZA 1P61B 1BO6A 5L3SA 2DCUA 2AK3A 3BH7A 2XX3A 1TF2A 3TQCA 2OXCA 2WBLC 4XVQA 4C4PA 5FBVB 4AKEA 1OW3B 3T1OA 2QA5A 1QHYA 4TYNA 2J1LA 1GNQA 4ZV4A 2PH1A 4CYMA 3BFKA 3JVVA 4FWTA 4U7DA 2FX3A 3QXHA 1TNDA 4O0MA 2NO7A 3PITA 1IAQA 3SBDA 2YJTD 3CONA 3TSWA 1ZNXA 4BQSA 3LRPA 3QXJA 3MJRA 5JS8A 1ELOA 5UKDA 3G5UA 4RD6A 3ZQJA 2GF0A 3NBFA 2QMHA 3LY5A 1KI7A 1Z07A 4X8MA 4GP6A 1S2MA 2FSGA 2O0KA 2E9SA 1DAFA 3PV0A 1XEFA 3QY0A 5HPYB 3GLGA 5BQ5A 1KK3A 1W4RA 3NIBA 3TQFA 1S9DA 4DUGD 2OBMA 5LB2A 3HR7A 1SVOA 4HAWA 2F43B 4HAXA 5EUQB 4DHEA 2VHTA 2CE2X 4RKEA 2F43A 2ODWA 3I61A 4IDNA 1KI9A 3PEYA 1VHLA 4EAQA 3GJ0A 4PHGA 4FCVA 3OIUA 1OJLA 1SHKA 2I1QA 5LPNA 3NDBB 2EW1A 4LHYA 4K8OA 4B6EA 1A2KC 2FFQA 2PEYA 3RWOA 1OT3A 4LJYA 1JR3D 1JPJA 1M8PA 5EXXA 4IDQA 5AJZA 1ZCBA 1RPZA 3CH4B 1UBGA 1H65A 4IJMA 1Q57A 3FFBA 2BMEA 1T3SA 4I1VA 4LCBA 3GLHB 4B2LA 3VNVA 2QAJA 1VYTA 5GADl 1ZC3A 2Q3HA 4MGKR 3U3RA 3GLHA 2BIFA 1SXJC 3BOSA 5IK2D 2ANCA 1PLKA 1GNRA 1DG1G 4MUAA 4KLNA 2WWIA 2D74A 2EFHB 1JI0A 4G01B 3MG9A 3T15A 3IIMA 3BFXA 1OH6A 2I4IA 3QG1A 4BRWA 4PQRA 3K70B 2ERXA 5TDHA 4BFZA 1GUAA 2H5EA 1OH7A 3RAPR 3C5HA 4ZPXA 2NPFA 1H8HA 1VYVA 2OSBA 3QIAA 4L9SA 1BS1A 2ZYUX 1IN4A 1T0HB 1XTIA 3X1XA 2QMOA 3ECCA 2ZYWX 1CR2A 4XSHA 4FINA 4YMWA 4XTRA 2VPPA 5DI9A 2J59A 2QGNA 2XOKA 3WRYC 4I99A 3EC2A 4DLXA 2JLRA 1W49A 2ZRJA 4Q4HA 3GLFE 3R7WB 1GTVA 4NH0A 3PFIA 1Z83A 1EWRA 1HQYE 4DDVA 3VX4A 4D4KA 4M1WA 2ZUCA 2EFDB 5J4VA 3X1DA 2JCSA 4CEIA 2VHJA 2P67A 1NL3A 4XWOA 4Z1MD 4QFMA 2GILA 4OKSA 4F38A 2CLSA 1PV4A 1E4YA 2NO1A 2AD1A 5F3WB 4EPVA 5TB5A 3SN6A 5DISB 4B44A 4IKEA 1D2NA 2CE7A 1L7VC 2XXAB 4FMDF 3SDZA 3B1WA 1NKTA 3L43A 3AGPA 4EPRA 2XXAA 2OE2A 4BLPA 4D0LB 2NIPA 2WOOA 3MAAC 3AGQA 4TMVA 4BGDA 1XFAA 4JLVA 2A9KA 5BN5A 4Q03A 2I3BA 3VR1A 1U0HC 3R9XA 1RRFA 1N6OA 5KSZA 3MUFA 2OCAA 3IILA 4JYBA 2Z43A 4A2WA 2UKDA 1I4DD 2HF8A 1JQLB 1IJEA 2ZSDA 1II0A 5JZVA 1CEEA 1UPTA 4OHWA 5C18A 2ZRPA 4JVNA 3MJHA 4HAVA 4XVUA 3OF5A 1N5LA 3W5IA 2NO0A 1WP9A 2IYQA 2V3CC 3CH5A 1Q0UA 3AUYA 3WMGA 4TLDA 1GKIA 3O8DA 4NHOA 1ZAKA 2VP9A 4HZIA 2IYTA 4CIDA 3W8RA 5C4GB 4EPTA 3A1UA 3LX8A 4HZUB 4DCNA 2O0JA 2ZJZA 3RANA 3C16C 4PO9A 1E0JA 1EFCA 1ZUNB 4HZUA 1KO1A 1LW7A 2CJWB 3PEWA 1NN5A 4M8NE 4ZCLA 3ADCA 1JAHA 2CJWA 3VKGA 2RB4A 3CUEF 1MKYA 3CZQA 2DPXA 3NEYA 2QSYA 4TLAA 3RRZA 4PAMA 1KY2A 1TL7C 3MD0A 1D9XA 4OBEA 1M7GA 2JJ1D 3LBHA 2RGNC 4GOXA 5KU1A 4TLCA 3FKSD 3ZIAA 4JKIA 2FSIA 4BZPA 4C0KA 4O3MA 3I32A 3KXLA 2PX0A 2GZHA 2VA8A 4PSVA 2J0SA 2YHSA 3ZVRA 1YRAA 3MMPA 4D4MA 1EFTA 2ZRBA 1G7CA 2XNSA 2XSZA 3QVUA 4A0GA 3W3AA 1M34E 5K8IA 2FZLA 4C0QC 1COWD 1SXJB 5CDFA 3QPUA 1SXJA 1VECA 2CNWD 2H57A 2P5TB 2OO7A 2R6DA 4AC9A 2GXQA 3VU9A 3DVLA 1OB2A 4C0AC 5H70A 3KFXA 3PXGA 5FUXA 4GSYA 3MRSA 4V02A 4WW0A 5A4JA 2VP0A 5FL7A 2YC4C 5LBIA 2XTZA 2QUZA 3UMFA 1Z6YA 2HT6A 2R8RA 2QORA 5FOSA 1OF1A 2ZRMA 2EWWA 2AHOA 1HE1C 4LBWA 8OHMA 2MSEB 3P4XA 4LSGA 3CM0A 3ZS9A 1W36C 2ZVPX 2ZI3A 1WB9A 1HT1E 2QN6A 5DH9A 2ZRFA 3KQHA 1RRCA 1KIMA 1MT0A 3CRVA 1NBMD 4FCWA 1NVVQ 2F1JA 3IIKA 5F9HA 5EE0A 1FNNA 3CPEA 2R6AA 2IXFA 4XJXA 1E2LA 1FMJA 2AK2A 2WAXA 4F7WA 2BDTA 2WWHA 3Q7QA 3AF0A 1YVDA 2WZQA 1G64A 1XEWX 5EZ6B 1CR1A 3EXAA 1G17A 2XJ9A 5P21A 1GL7A 3HR8A 3TUZC 3RRMA 1W44A 4IDOA 3SJBA 5JCPA 3KX2A 2XNDD 4PR0A 2R9VA 1E9RA 4ESHA 3C41J 4RZ3A 3LQRA 1CJKC 1AGRA 1F60A 3PUZA 2FPLA 2QP9X 2JLUA 2IC5A 2GCOB 1XNJA 3A36A 4F4IA 1Z0DA 3Q85A 5CLLA 3L0SA 2GTPA 2GCOA 621PA 3J81k 1X8LA 1ZD1A 3CF2A 1FQJA 1ZBDA 5TVKA 2CHQA 1A2BA 1KZ7B 1S8FA 5KPDA 1UBFA 2H8KA 4WIAA 4F93B 1EG7A 3AVXA 2WPDA 4R2IA 2J0QA 1XMIA 4TYPA 3E70C 3QBVA 2PL3A 3B1VA 4TT3D 1FTNA 4TL6A 5A5GA 3GLIE 1NIPA 2DFLA 3QVVA 1JXOA 3QNUA 3K0SA 3SFZA 1DAKA 4GZMA 3B7GA 4B2IA 1IY2A 3PUXA 2XAUA 2GJKA 4JL6A 4S35A 1EFUA 1E32A 4IOJA 2F7SA 5H8WA 2VP5A 1EX7A 2JDID 4GBMA 4PHFA 3UMSA 4O2RA 3I72A 1S1CA 1KI6B 1CJUC 2AR7A 5DI3B 4KI0A 5AUNB 4MRNA 5JRJA 1LVGA 4M1TA 3L82B 1KI6A 2RAPA 3LX5A 1G5TA 5DI3A 2WSSA 3CPHA 4PHHA 4UKDA 1V5WA 4Q1DA 3QSYA 3LBIA 4GOKA 1LY1A 1S4QA 2IYWA 3EX7C 2CLDX 5AJXA 3W6NA 1SVLA 2DY1A 2X8AA 3TUJC 3FMIA 1K6MA 3ZZTA 5AUPB 3MWLA 4W5WA 1U90A 4HLCA 2DWOA 4HEJA 3W6PA 2HXSA 1SZPA 4KU4A 1TQDA 1UBEA 5EP1A 2KSQA 4A2PA 5JEDA 1NNEA 2KJQA 4CF7A 3RNLA 3G0HA 2VBCA 1CIPA 4FW9A 3W8NA 2IWRA 3C15C 1KO7A 2REOA 4C0SA 3EG5A 1IN6A 6Q21A 2RGNA 2ZJ8A 3QF4B 1E1RA 3P1JA 2OBNA 1OB5A 4DDWA 4NYJR 4N0DA 1XCPA 1NMZA 4MRSA 2OCBA 1P4SA 3OFNA 1O87A 3Q72A 4V0LA 4B48A 2AL7A 1LTQA 1RE0A 2QPAA 1GSIA 4NTZA 3HU1A 5JI2E 5DE3A 2OCPA 1U99A 5FBRB 4EKDA 521PA 3B1ZA 3KKMA 5J5CA 1ZUIA 3HDTA 5JI3E 5KSPA 1T5LA 1YR7A 1T3HA 2ZRLA 2J3EA 5FPTA 1XF9A 4RD3A 5F2EA 4KFTA 2RKOA 2AN9A 3TRFA 2EFCB 1E9SA 3KQUA 1G8HA 4DLUA 4KFUA 3N2IA 5AWFC 4TMZA 3GJ7A 4IDHA 1FFHA 3WP1B 4BEJA 2FF7A 3PCRB 3AVWA 3CRQA 4X8LA 1E2MA 1P9WA 5FOWA 4A36A 3AF2A 2GKSA 4IEEA 1NVXQ 1XTRA 4XWKA 2P6UA 1W36B 2C77A 2QNRA 4OK3A 2KI5A 2RGAA 2ZR7A 2ZJAA 3VFDA 3BS4A 1ZCAA 3M0EA 4AI6A 1DTSA 5HE8A 3U7EB 3OAAA 3UIEA 4I1UA 1FW6A 4QGHA 4XWAA 4FD2A 2A5JA 4RZUA 3B78A 1NVWQ 1D8TA 2EFEB 2ONKA 3CPJB 5FI0B 4OHZA 4M1OA 5FTLA 2J9RA 1TQ2A 2SHKA 1T5IA 1TU4A 2O8EB 3FDIA 2UZ3A 3A4LA 4LHWA 4D2IA 2O8EA 4BLQA 3TLXA 4QM7A 4HLQB 1FL9A 2FEMA 1IXZA 2OEPA 2OZEA 1G6HA 2V9PA 1U94A 1GAJA 3AVOA 3W90A 1DAMA 1F5NA 5E95A 3DEFA 4PO8A 1NSTA 1K8RA 3CRW1 1NMYA 3WY9A 5JWHA 2HLDA 4QJ4A 1G7SA 1OH8A 1XXHE 1BMFD 4PTLA 4A9AA 3U7GA 4TMTA 1UEJA 2HCBA 3A8TA 2WKQA 2QL6A 4QOSA 1BOFA 4M9QA 3SNHA 3BB3A 5CIWA 421PA 5E7JA 1OYYA 1YKSA 3SS8A 1Z2CA 5JHHB 1GG2A 2D2FA 3DZDA 4QKQA 4LI0A 2IHYA 5GJWC 1JQJC 4HDCA 2C96A 4PANA 4EFMA 1D9ZA 3O8BA 4Q4JA 1NN3A 2I1VB 4Q02A 1YZNA 2Y8EA 2CVFA 2WWWA 4RZ2A 2J46A 1TX4B 1N6RA 1FUKA 2ZS7A 1KK1A 1JPNA 2C2HA 3CF0A 4YMTA 2R2AA 3G82C 1XEXB 4OJKA 3DKVA 3KJEA 1DS6A 2BVNA 4KVGA 4OJQA 2ZS8A 3KJHA 2BEKA 2A7QA 4PFSA 1XEXA 2JEOA 1IBRA 3JZMA 3FMOB 4NL4H 4DDTA 1N5KA 4QBHA 1SHZA 1CF4A 2PCLA 1G19A 2D06A 2NZJA 2ZI6A 4JMPA 4EDHA 2A3RA 3I5YA 5FR2A 5JJIA 1DBSA 4D81A 2X2FA 2QRZA 4U02A 2JLWA 3SI7A 4A2QA 3UMRA 2QMUA 1XU4A 3KL4A 4RFSB 1A1VA 4TL9A 2JJ8A 2Q21A 1E0KA 1IY1A 4RFSA 1OXUA 5HTKA 3AKEA 3SHWA 1J90A 3I92A 3OEEA 3BAFA 3UXMA 3AP3A 4JLOA 4US1R 4S2EA 3GLGE 3VKHA 3EZ9A 2V1UA 1KOFA 4DB4A 2V1XA 3K8YA 2GETA 4P4SB 1VG1A 5EXSA 3OEHD 1JJ7A 3ADDA 1YZUA 2FMXA 2HEIA 2XB4A 3U2QA 3WXMA 5DN6A 3EIEA 4Q4AB 1XMJA 1NG1A 1ZRHA 4U5XA 1T0JB 2ZYTX 4Q4AA 1VHTA 2OAP1 4BZXA 4DEXA 2RGCA 2R6CA 1P6XA 1PLLA 4LC0A 5CM9C 3ZH9B 4ZCIA 2FDCA 1GZSA 1W7AA 4C9BA 1QVAA 2Q0HA 4AK9A 2XEXA 4C7OB 1Z63A 5DSZA 1UAAA 2CK3D 1T4GA 3GD7A 4BFTA 4BLSA 4E5UA 3CLVA 1N2CE 2OV2A 3L0PA 3LW8A 4C7OA 4BLOA 1C1YA 3GLHE 2BKUA 3I5XA 1UKVY 2E1RA 2QPOA 4JLDA 2WJVA 2IL1A 2CCJA 2O52A 1R5OA 3CO5A 4IRUB 3LH5A 4MGYR 4DLYA 1P72A 3U5ZB 4G5OA 4L4UA 2QENA 4E09A 1WRBA 3BORA 5BN3A 1W0JD 2VSOA 1OHHA 1R10A 1JALA 1HA3A 1GOTA 3NC0C 1DVRA 2YOHA 4A6XA 2JLXA 3N5CA 2ZJ2A 2HYIC 2OT3B 1PZNA 2JLSA 3JZAA 1XXHB 1FMLA 2YVUA 4Q1FA 1E98A 4JVLA 1S3SA 1DG3A 2KB0A 2A5DA 2BJVA 3BIFA 4UJ5A 4C0JA 4JSYA 2CBZA 1U8YA 2NMVA 2WMNB 5JRZA 3TUIC 1OH5A 3RS0A 3U60B 4R9UC 2W2VA 4A6PA 5KHOC 1N3BA 4ZDJA 5JWOA 4MRPA 1QHXA 1FP6A 3OE7D 1FOEB 4MH0R 1G41A 4LPKA 5J47A 3T35A 4M1KA 4FWIB 4PZLA 4CZ2A 4YXWD 3BGWA 2ZJOA 2ZETA 4QHYA 1S0UA 4R71A 1QZXA 4LJ5A 3EPHA 3EZ7A 3W5JA 1DO2A 1KSHA 1PVOA 1G3QA 1PUJA 3PEVA 3U3KA 1EXMA 4OQFA 3SQWA 3HU2A 3K0FA 3RS5A 4JLNA 1F2TA 3SYNA 3TSOA 5JBQA 4PPNA 3C14C 4ZKEA 1DELA 4ZI3A 1ZD8A 1I4TD 1LFDB 4QHTA 3SZRA 5EXPA 4PC6A 2PT7A 5SZJA 1HYQA 1JR3A 1RIFA 4NCNA 2WWGA 1TU3A 3HYTA 2CLCX 2ZRIA 4GT1A 2ECKA 2RMKA 3K9HA 4F92B 1E9FA 2G1KA 3GLGB 4X8OA 1RYFA 1E9BA 1S3GA 4LJ4A 4POAA 4JLBA 5EE5B 4UXHA 3KXIA 4JT2A 2WICA 1R5NA 3OZXA 3RS7A 4BFUA 4URVR 4KJZA 2D7CA 5CM8B 4LJ8A 2OHFA 4OHYA 2PCJA 3QE0A 1M7BA 2DFTA 2J45A 2J87A 3KDSE 5BWMA 3AVYA 1KHTA 1OXVA 4Q7KA 3BC1A 3TW8B 5TY0A 3IEVA 3KB2A 3QI2A 4JBYA 2PLRA 2OM2A 2WJGA 1N6KA 1TQ4A 1WBDA 5FOXA 3O47A 1ZNWA 4ZO4A 1G6OA 3IKJA 1NKSA 2VRWA 4WZBE 5J4LA 1ZNYA 1TPZA 1YJ5A 1AA9A 4NYIR 4OI4A 1L4UA 3TNFA 1TMKA 3ZJYA 4F4CA 2F1IA 5JFGA 1G20E 1N25A 1XRJA 4V0NA 3KKNA 3NKVA 1ZP6A 2LKCA 2OXRA 4XSGA 3UG7A 3T1TA 3KTAB 2W2XA 4FI3C 4QNRA 2VSXA 3EC1A 2F55A 2CHVA 4OK5A 4DBLC 3KTAA 1KZGB 1FZQA 4AWXA 2LKDA 2BBWA 1WMSA 1OXXK 3WYGA 721PA 4NU0A 2BCJQ 1NVVR 4CDGA 2ZIAA 3IEUA 1E99A 3GQBA 5FTMA 4IDPA 3WRXC 3T34A 2ZE8A 3K9NA 2PZFA 4EQ6A 3ADKA 1MO3A 5HCNA 2ZPTX 2GESA 4R98A 1P73A 5CDFE 1ZW6A 5FR1A 2CCKA 3K0EA 1BKDR 1SXJE 2VP2A 3ZLJA 3O8CA 4NYMQ 5HZKA 3U7HB 4BRUA 4KXFB 4Q4HB 2C99A 5JECA 1NIJA 4W5JA 3U3OA 2ZJYA 3DM5A 5EE1A 1KSJA 1X86B 5FL3A 1KI2A 1UF9A 1E2NA 3PVSA 3TAUA 2ATVA 4CEIB 5C2JB 2C98A 3BJIC 3L2OB 2ZRKA 5ELXA 1ZIOA 2DB3A 4OL0A 2CL7X 2HF9A 2ZRGA 1XZQA 3UWKA 3AVUA 1Z47A 1IONA 3V9PA 1YU9A 4LDJA 1BYIA 1YZGA 3QBTA 3PIRA 4M2LA 4Z8XA 1U81A 1MO4A 2HCJB 1X1RA 2GEDA 4KO8A 1J70A 2GJAA 1G3MA 2KBFA 3IHWA 1W2GA 1SKQA 2ZSAA 3B1XA 2O8BA 1C4OA 3W3ZB 2GK6A 3UKDA 1E2JA 2AD5A 3TMKA 2GF9A 1Z0JA 2ZITA 4TQUS 4PHTA 2O8FB 1KI4A 3K0CC 4DLTA 3VR4A 1DPFA 2O8FA 2R65A 5C1BA 3U4QB 1NI3A 2GCNA 1VCNA 3BRWD 3K70D 2C95A 2XB2A 4TMXA 3FYHA 4NMMA 4QGGA 4B34A 1AN0A 1H8HD 3ETLA 3U4QA 1KSFX 2W58A 3EA5A 2FU5C 2VQSA 1UFQA 1R7RA 1Z2AA 4W9MC 1J2JA 4LX0A 3U6KA 2UZIR 2ZR9A 3TK1A 4GP7A 4KVAA 3TJZA 4DIDA 1RYHA 2JJ1A 2XOKD 3FKSA 1E2HA 4D0NA 3SQXA 2JJ2D 4EPYA 2G9NA 2WOJA 3IHLA 3MWKA 2G3YA 5EQTA 2VSFA 2YWEA 3LLMA 4EFLA 5HR5A 3RRNA 3T1VA 2F6RA 3N2EA 4JBWA 2BEJA 3VHXA 1OKKD 3AEZA 1KDOA 4LJ7A 4Q9HA 5L3RA 2IS4A 3DZ8A 5B64A 1SVWA 3KUDA 4N0EA 2O8CA 2IA5A 1OXTA 2MSCB 5KTYA 4JYCA 4BLTA 4A92A 4OQNA 1I4LD 1HURA 4Q9LA 3RC3A 4DLRA 1ZM7A 2ZI7A 3AKCA 2B6HA 3VR5A 2A5GA 3A1WA 3QENA 1XJCA 3I73A 2A2ZA 4M9ZA 4M9XA 1TUIA 4RZXA 4Q9JA 2ZE6A 4RKFA 1R4AA 4P4TA 3NG1A 4B32A 2D7DA 3CWQA 1TTTA 3DOFA 1G18A 1P2SA 4FMCF 1W2HA 2IXGA 3C8UA 5BXQC 3SYKA 2FGJA 1XD2B 2IBMA 3AF4A 3ONWA 2BHRA 2QT1A 4HDOB 4UNQA 4B76A 3B9PA 1XD2A 4QG7A 1F2UB 5GJBA 1Z6AA 4BFYA 3LQQA 4HB0A 1F2UA 2VIIA 4D6PA 2BWJA 1EFRA 2XTNA 3VQTA 1E2IA 1KMQA 4Q1CA 1R0XA 3VU9B 2QMEA 4TTPA 2QI9C 4KFRA 1V43A 3F0TA 1T91A 1G7RA 1FNMA 1XCGB 5IRCD 3CX7A 4ILEA 4Q7MB 1JXMA 2NO6A 3CR8A 3TH5A 3ZYCA 3P27A 1P9NA 1Q22A 3B9QA 4DXAA 1VDZA 2BOVA 2ZRCA 2AFHE 5J4HA 4K81B 4AIIA 5KOYA 4QGFA 5F98A 1AQYA 3MFYA 1G4AE 4C30A 1ODFA 4B73A 2AKAB 2JIZA 4K46A 5D3QA 1ZD9A 4XD7A 2NZ8A 4MYUA 1ZU5A 3R9WA 2V4ZA 3IO3A 1P62B 4TQAA 1Q1BA 4Q18A 4NCJA 2G83A 3KKQA 1AZSC 3MWYW 4M4SA 3BB1A 1G3IA 2J0VA 4TSFD 1E69A 4MITA 4RSGA 4TMKA 2QQ0A 4TTRA 3ZZUA 3THWB 4MDFA 2BBTA 2Q3MA 3GFOA 3ZIAD 4Q4LA 1D2MA 2KBEA 4WBSA 3QEJA 3THWA 2D3WA 4MGIR 4PPQA 4RD2A 3P26A 2R44A 3TIFA 5KSYA 3EPLA 1D2EA 1Z22A 4DVGA 1QHHA 4YMVA 1O3YA 4D26A 3WYAA 2JDIA 2XSZD 3H0KA 4QXAA 2XZOA 2C78A 3ZVLA 1N5IA 5ANRB 2G0TA 4I4LA 5K8TA 3LA6A 1SXJD 3NDPA 4Q9KA 2Q6TA 1YQTA 5JSZB 4BWYA 4Q21A 3L0IB 4QL3A 4G0NA 5JSZA 3P4YA 3SJZA 3ASZA 4M1MA 4QM6A 4LYAA 1E4VA 3K0CA 3F5FA 5H68A 3LD9A 1XD8A 1G5RA 5FL7D 3P20A 1DADA 1M6NA 4JVSB 5JCZA 2ZI4A 4FMDB 5AUOB 4NBSA 3SE0A 1PLJA 4D80A 2QZ4A 5B30A 1CBUA 3TBKA 3AM1A 5KDOA 1VYUA 2PLFA 4GI7A 1YHNA 1P9RA 2AX4A 3GJ3A 1ONBA 4G1UC 5FBWB 3GEEA 1T8TA 1DO0A 2IYVA 3BXZA 1RC8A 2OCYC 2N42A 1WDTA 1N6LA 5J4YA 2R6FA 4G5SA 2C5LA 4YONB 2RGBA 4D4JA 1R8SA 5BYJA 5FPHA 4OQLA 4RCZA 1KKMA 2GVZC 3IUYA 4DSOA 4LK2A 2J7PD 3LVRE 1G8GA 1CULC 2W6JA 4KFSA 1UM8A 1FPMA 3X1YA 2FE4A 3SEAA 5HKKA 4OYHA 4X8HA 2BMDA 2WMOB 4ZCMA 1Q1QA 4CRWB 5GVRA 1W0KA 3TR5A 1U0LA 2WJJA 2FFHA 3MWJA 4AKGA 1KKLA 2VLIA 4AKHA 3HJNA 3K9LA 4C0LA 3RS2A 1AM4D 2FPKA 1XJQA 5FUVA 5EP4A 2REBA 2YNMA 5JJKA 3HWSA 1NJFA 1R6BX 4L16A 1R0YA 5BYKA 4M22A 4GZLA 5IHPA 1E1QA 4QRHA 2QY9A 4Q1AA 1Z8FA 5G40A 4DC9A 2HJGA 4TN1A 1DAIA 4IXNA 2Z0MA 4HLDA 5CYOA 2V8OA 3B13B 4PC3A 1XTKA 4QNMA 4JJKA 5E3HA 3FE2A 3GPLA 1CJVC 1R2QA 1A7JA 1GRQA 3FFAA 2ZJBA 4JLAA 4BEBA 4PAQA 2G88A 5FI1B 3HYRA 3CX8A 1ZC4A 4HDQB 1HH4A 2RHMA 2IYZA 3B82A 3WYFA 1CKEA 3WBJA 2CEAA 5FPSA 4O2LA 3A1VA 3UATA 2QROA 4ACBA 2FN4A 4DSTA 4MQBA 1Z6XA 4Q5IA 2FSFA 3RLFA 4MRVA 1OYWA 1RZ3A 4WXRA 2V7QA 1NF3A 1J8YF 3DOEA 1US8B 4O25A 4DCUA 4DRZA 5L3QB 2IEZA 1NRJB 4ZIRB 1KO4A 1US8A 1CJMA 4ARZA 1VG0B 5L3QA 5JJLA 3NXSA 2ODBA 2IEYA 3NH6A 5EE3A 4ZIRA 1Q20A 1KDTA 5D3MB 3QPVA 3B1YA 1UKYA 3AV0B 3KKOA 3LFUA 2PJZA 4HB4A 4JIMA 1XB2A 4QBIA 4R2HA 5D3MA 5DO9A 4CGZA 1QBKC 1S9HA 4A8JC 4IVQA 1OSNA 2AXNA 5HCIA 1RJ9B 1VKJA 4KLZA 4E22A 2ZXUA 4M21A 1RJ9A 1XTQA 2DBYA 4PSAA 3RC8A 3CWZA 2FV8A 3LW7A 2P6NA 4GNKA 2QBYB 2NGRA 3LLUA 1QHNA 3OIVA 1G1MA 2QBYA 5FUYA 2MMGA 3T61A 2QM8A 3HPQA 4OQMA 3K0AA 5FH9A 4HAZA 2VTKA 4Z54A 1GKYA 3OFND 2N46A 2V6JA 2EVWX 4DJTA 1Z06A 1OFTA 3MGCA 5EP2A 1OXSC 3T5GA 4B2PA 4B33A 1IXRC 1U2RA 1UDWA 3VR6A 4PX9A 1AJEA 1VG9B 4L9WA 1Z0FA 3X2SA 1E2KA 1EK0A 2BC9A 4TWZA 4ASUD 2W0SA 1KNQA 2DFKB 3I8SA 4MYHA 4PAOA 2ZYVX 2ATXA 2QQEA 2R6GA 5BW8A 5C4MA 2HV8A 1GILA 2J7KA 5LDDC 1WQ1R 4GDFA 2X2EA 2ZRNA 4MRRA 3AVQA 4BFSA 3ASYA 1C9KA 3IGFA 4Q4JB 2WAYA 1F48A 4LHVA 3OIWA 5G41A 4DCSA 1P7CA 5DLQC 1GM5A 1R5BA 1J99A 3V4FA 1AIPA 5K8LA 1N0WA 4LYFA 4LHXA 4DEYA 2F9MA 4FMBB 1CJTC 1NN1A 2CXXA 2ZSEA 2IYYA 1W36D 5CLQA 2QE7A 2EWVA 4M9SA 3FHCB 2NG1A 3OAAD 1AS2A 3EZ2A 4CEJB 2GEVA 3NBZC 2AWOA 2W6ID 3EW9A 3NWJA 5FOVA 5FPYA 1IN7A 4E03A 4CEJA 4NCKA 1TUEA 4LJ9A 2WJIA 1IJFA 2JGNA 2BJWA 4MYCA 4N3NA 4NE2A 4WZAE 4EPWA 1VIYA 4KITB 3T5DA 1JR3E 1SVIA 2G77B 3H84A 1N6IA 1Q1ZA 2QAGC 3QJYA 4TMWA 5CITA 2IUSA 1KAOA 2ANBA 3QOFA 5TARA 4UNRA 3W34A 3UPUA 3AP2A 4GRAA 1GIAA 5CIQA 5TXGA 5L3VA 3KQKA 4QHSA 2Z4RA 2MSDB 3W9YA 3IPYA 2GZDA 2HLDD 3ICEA 1P3JA 4JJZA 2OAQ1 4GL2A 3EWAA 3Q5DA 3RS4A 1KJWA 3U7FB 3KQNA 1P2VA 1E9AA 5IDVA 2JA1A 3B5JA 2RGDA 2YINC 3L8ZA 4D82A 3V00A 3CBQA 4I1SA 3DM9B 2PMDA 4U00A 1Z3IX 3MLEA 5J4KA 4V0ME 2O5VA 1UKEA 2CL6X 3QXCA 3NTUA 1NG9A 1MR3F 1BH2A 2H92A 3TE6A 2ODNA 4IOLA 5DGXA 2XZPA 3D7MA 1D5CA 4PC7A 3GEIA 4PPFA 4L5BA 1ZINA 4MKFA 1ZYUA 3R8FA 5KDDA 1NLZA 1B23P 4PQFA 2KE5A 4B3BA 3H4MA 3IIJA 3VTKA 3OE7A 2FG5A 3KQLA 4MKHA 3QPWA 3CNNA 4NONA 4FXPA 2ERYA 2VL7A 4B35A 3SYLA 4D4LA 2RGGA 4CVNA 3CIOA 3C4JA 1U8AA 1W48A 2AKYA 4IOMA 1E79D 5DYIA 4UNSA 3WMEA 2P6RA 1LB1B 1QDEA 5A0FA 2FNAA 1GITA 1WA5A 4A8JB 1W4CA 3EARA 4HB2A 4XTCS 3KXKA 4A8JA 1IN5A 4NYJQ 4AYXA 1X6VA 3B6EA 3OEED 1G7TA 1ZMXA 5KSOA 2FGKA 1U0JA 1VIAA 5KNCA 2EYUA 2GVDC 4LJAA 3MSXA 3WP0A 1F3OA 5IF9A 4UNNA 4IW3B 1Y3AA 4C2TA 3TVTA 4TL7A 4KSBA 5CB6A 3VX3A 3ICQB 2ZUDA 3PQCA 4KBFA 5DN6D 3AKYA 2WIAA 5KNBA 2VYFA 2ZR0A 3SBEA 4URXR 3FVQA 3LNCA 4IVPA 2BBSA 1G4UR 3A4MA 4B3CA 3LXXA 4FCTA 3EZFA 4UQOA 1YR8A 5KUTA 4GFDA 4CT5A 4MKIA 3BERA 1XTJA 3T1QA 2FWRA 3EPJA 1E0AA 2C9YA 3DHWC 4DUGA 4LV8B 1TADA 3K0FB 4KCGA 1QG2A 1F2TB 1VTKA 3ND9A 1M7HA 1JECA 3K53A 3REFA 3VR2A 2YKGA 1WBBA 3VAAA 4DDUA 4HYYA 1P2UA 4HB3A 4DIEA 1G3UA 1Z6GA 3GJXC 5EJEA 2QEQA 3A1SA 4EJSC 3QUSA 2B8TA 3WMFA 2JATA 2V54A 2XTMA 1ZM9A 4MGZR 3KJGA 4ON9A 3QQ5A 1OHHD 3I62A 4TL8A 1FUUA 2QM7A 4DLSA 4B3FX 1RKBA 1KK0A 4JT4A 1LNZA 1JB1A 1T8UA 4I81A 4US0R 1FQKA 1IXSB 3TGPA 3QF7A 1HEIA 2F1HA 4XIGS 1KK2A 4IXMA 4QBGB 3PR1A 3H1TA 1KY3A 3PUWA 2QTFA 3PEUA 5IK2A 3N70A 2GJSA 5HE9A 2DHRA 1H8ED 4HAUA 3A6PC 1EGAA 2B7CA 2BKEA 2B8WA 4M1SA 2PZEA 3SU8A 1FTSA 2QAGB 1VMAA 4TYYA 2GJ9A 2QPTA 5LD2C 2QSZA 2IXEA 2YOGA 2YOFA 2QAGA 4V0MA 1XMVA 3BFVA 4D25A 3GJ6A 1ZM2A 1Z5ZA 2CDNA 1CP2A 1Q3TA 1DARA 4JLPA 3SHFA 2ZTSA 4JL5A 2P65A 4NPHA 1OE0A 1TAGA 1YZQA 2F3TA 2O0HA 3A37A 3M4YA 5KYKA 2VHCA 2WSMA 5DYGA 1M2OB 4LBVA 2OLJA 4IFBA 2Q9AA 1GNPA 3D8BA 1CU1A 1HT2E 1PUIA 3GJ5A 4NCIA 2EFGA 1UJ2A 4WVFA 1YR6A 2Q9BA 1NVUQ 1ZJ6A 4Q19A 2BMJA 3CKLA 2OESA 1JJVA 2EQBA 4II7A 1W5TA 4NZYA 5G53C 5TV2A 4I1OA 4W5HA 4WXPA 4URZR 2WHXA 2X19A 2Z83A 2H1LA 3C5CA 2WKPA 5FFMA 1W4AA 3CF6R 3FHOA 5GJVC 5TMPA 3NHBA 4M0LA 2IF0A 5E7IA 4Z1MA 4JLMA 4BFVA 2V6IA 1R8QA 2W2TA 4EQ6B 3ZD7A 3NC1C 4URUR 2IYSA 3GFPA 1E2QA 3NHAA 4Q1EA 1NBME 1VCMA 2HUPA 3ZS8A 4AD8A 4HUQB 1OLOA 4JBXA 1SKYE 1YRBA 1IOZA 4XH9B 4HUQA 1OV4A 2J41A 4RCYA 2J0UB 1CR4A 4R7ZA 1AKEA 2ORVA 3X1ZA 4B74A 1F6BA 3TKLA 1E2DA 3VMFA 5AJWA 2A5YB 4XOIA 4A82A 4TTQA 2J0UA 4UXJA 5AK0A 2WVJA 2WV9A 4WZ6A 3WBKA 4DWJA 2ONJA 3FTQA 1GRNA 821PA 2GXAA 3A4NA 3QKTA 3EWSA 5C46F 4B3GA 1NMXA 1LF0A 3U3JA 4V0KA 1W4BA 2JAQA 2PJRA 2Q9CA 1XDBA 1QF9A 4AY2A 1CTQA 4OQXA 1K5GA 3E5HA 1S1MA 3GEHA 3AB3A 3LVQE 5FOUA 3ZD6A 4DB2A 2YV5A 1MRNA 2TMKA 2PT5A 4P0TA 5GVSA 2PMKA 5AJYA 1E2GA 4KYUA 2JJ2A 4OI2A 3THYB 1KO8A 4AKIA 1XP8A 3PUYA 3QKUA 3THYA 1R0ZA 2O8BB 1Z0AA 4B75A 1JR6A 3AH8A 3NBYC 5JEEA 3R7WA 4A1FA 2FZ4A 1OKKA 3AUXA 1L8QA 4HLUC 4W7SA 4OK6A 4LHZA 2ZANA 2ZM5A 1KO5A 1YZKA 2GXUA 1NY5A 3QG5A 2QP4A 1E94E 2HDNB 2ZE7A 4JKYA 2W83A 1L4YA 1OIVA 1A82A 1I2DA 2P2LA 4Q01A 4RD0A 3ZGXA 3UK6A 1W47A 1OIXA 4BFWA 3CRMA 1TF5A 1DAGA 3KB1A 3REGA 4BECA 4EPXA 2OUKA 3EIQA 4EJSB 4P31A 1XTSA 4GMDA 1G8FA 4EJSA 2ZRHA 3KUCA 1M1YE 1U98A 4G5GA 3U3MA 4C2UA 1JBKA 4Q00A 1GL9B 4EIWA 2OFWA 1DAEA 3DL0A 2C9CA 4PO1A 1OFIA 1GRRA 4ESVA 5GJCA 4M1YA 3GJ4A 1EX6A 4A4DA 3S1AB 2ZVQX 2IS2A 3IQXA 1COWA 1VCIA 3S1AA 3WNBA 1MABB 2O8CB 1K5DA 4A0RA 2Z6VA 4YMUA 1T9HA 3LBNA 1GFIA 4HAYA 1GKUB 1MABA 1WCV1 1Z0KA 2CNWA 5H1YA 4Z8YA 2JLYA 2ZSFA 4BFXA 3I3SR 4UNPA 2WWYA 4UXIA 1YE8A 3DO6A 2N1BA 3BH0A 1ESNA 5BN4A 5LD2B 4LGMA 3A1TA 2QT0A 5JWRA 1KI8A 1N0VC 2YC2C 4A15A 2HT1A 1W5SA 3BWDD 1Z29A 3H86A 4LUCA 2VEDA 2GJ8A 1ZM4A 2ZU6A 4IFEA 1YR9A 1ANKA 2H18A 4KV9A 4LBZA 5SZHB 2FH5B 5JS7A 3NVAA 1RFLA 1OFUX 2GCPA 2HYDA 3P32A 3T06B 2OILA 3PJRA 1IHUA 1WXQA 1GWNA 3B60A 2FEOA 3CR7A 3WNCA 4MUBA 2K5UA 2F1RA 5EZ5A 2XJ4A 1KAGA 2GAOA 5FBLB 1Z6TA 1FX0B 2P0EA 1EESA 1NBMA 1SKYB 2IW3A 4HSEA 4AG6A 3E1SA 3TVDA 1FX0A 2NTYC 4MDEA 3Q8XB 2C03A 5CB8A 4TSFA 4D0GA 5DIFA 4BLRA 1XZPA 1IM2A 3HU3A 3JVUA 2GBLC 4CT4B 4DLVA 5FTNA 4B3XA 1JEEA 4ZDIA 1QHGA 3E2IA 2ZROA 4ZKDA 3I1FA 2XNDA 3RS3A 1II8B 4Y0AA 4ACAA 1I2MA 3K1JA 1II8A 5DHFA 2OG2A 4PZYA 3LAWA 3OHMA 1CR0A 3R20A 3KFVA 4H1UA 2IHBA 4IHQA 5FUWA 1OFHA 1G291 3BH6A 4MKGA 4KHZA 3RRYA 4IOKA 3GLFB 2VP4A 2XZLA 5AJVB 4A0FA 2CCGA 5CYPA 3GLFA 3Q3JB 4NYIQ 2OFOA 3IBGA 4TT3A 4LYJA 4G5RA 4Q7LA 2CHGA 5FOTA 5EE9A 3ZQ6A 1ETUA 4WAUA 4JSTA 1MO6A 4YLGA 3ZDQA 5KNDA 4HI0E 4TYWA 1QHHB 1VG8A 1LF5A 3IO5A 1TEVA 121PA 2GWHA 1MV5A 3T12A 2IF2A 3RSOA 4Q48A 4JL8A 3EZ6A 1RRGA 1XCMA 5B57C 4PC2A 1E6CA 1NSFA 5IT5A 4C0HA 3ADBA 3K09C 5CK4A 1E9EA 1EFRD 1E2FA 1KGDA 3HPRA 1XX6A 4LV5B 3FKQA 1KYIA 1XWIA 2FOLA 2R62A 2ZRDA 3V4RA 2ZI5A 2J7PA 4HLUA 1HE8B 2WTUA 2A30A 1CLUA 5JLJA 2JLZA 1JAIA 3VHLB 4DZZA 1NY6A 2MMCA 1QVRA 1ZVQA 1CS4C 2QRNA 3BD9A 3GJ8A 2DR3A 1WF3A 4IEIA 4OHXA 4B47A 2B7BA 4RVCA 4HUTA 3SC3A 2GHIA 2IK8A 2X77A 1HY3A 3DMNA 4NP6A 1MRSA 2ZEJA 3FMFA 1GVNB 2RHDA 2OBLA 2JIZD 4LC1A 3SJCA 1GDDA 1UBCA 3D3QA 4XD7D 2HXYA 4LBYA 4H1VA 2ZU0C 3CRRA 1VCOA 1KSGA 2OFXA 1G21E 1Z28A 2QP3A 2NQ2C 4MYTA 1E96A 3IBYA 4A0HA 3FWYA 4JLJA 3CB4A 3EIHA 221PA 2DFNA 1E2EA 2FFAA 3KZ1E 2QTHA 2ZI9A 1N6PA 3IQWA 5CJ2A 2C8VA 2ZAOA 1N5JA 4PC1A 5M04A 3FHTA 1P5ZB 2RH5A 5G3ZA 2P3SA 4PPGA 3Q9LA 4JVMA 3QEOA 1XPUA 1Q12A 2EU8A 3AVVA 4YDHB 2ZSBA 2V55B 1XD9A 4BASA 1NP6A 5KDLA 1U9IC 3NBXX 5HZHA 1QG4A 2WKRA 1II9A 1ZNZA 3IPXA 3GP8A 2WPDD 3I8XA 2HJVA 3MCAA 1M74A 2ZS9A 1N6NA 2A5FA 2C9OA 3CNOA 2B92A 4EUNA 1NN0A 4RY2A 2RGXA 2B21A 1G9XA 2D62A 3FPAA 4TLBA 1AZTA 2IUTA 5SZKB 3L8YA 3AF1A 2ZAMA 4CW7A 2GA8A 3RYTC 3SR0A 1NJGA 4LZZA 4B71A 2GXSA 1ZM3A 2ODEA 1WE2A 4OI0A 3GFTA 5F9FA 1E0SA 4C3ZA 2GDJA 3QKRB 4V0OA 2YWFA 2Z5FA 2E87A 2DWPA 5B58C 3QKRA 2IUUA 1KNXA 2ZJ5A 3Q7PA 1Y63A 2D4HA 4FMCB 4UJ3A 1VPLA 5KO2A 2GBLA 2VO1A 2AXPA 4RJLA 3I4LA 4Q47A 2Q3FA 1IQPA 2VH5R 4C0BA 3M1IA 3QF4A 4IVRA 3SFVA 4ARZB 4Q1BA 3D31A 3KJIA 3DPUA 4AYWA 3F3YA 2ZREA 4PSKA 4AG5A 5EUMA 2WSSD 2FPMA 3DMDA 4KYIB 4LPSA 3VKWA 2W6JD 2FFBA 4FIDA 1Z0IA 2RGEA 2P5SA 5HKKD 4MA4A 1BMFA
chains in the Genus database with same CATH superfamily
1JDSA 2WJHA 4LNHA 4I46A 5IM4F 1Q74A 4DJEC 5IT9A 5FYQA 1DJNA 1EX1A 2XDWA 3AHDA 1BWQA 4IJUA 4ASUA 3ZE1B 4IINA 4FYVA 2A1IA 1HYHA 1JEDA 2G5TA 3ZD9A 3IELA 4DT1B 3LV8A 4RKRA 4EMUA 2GN9A 2CVHA 2W00A 1K8ZB 4LGYA 1KR2A 1Z6QA 2J8ZA 5G02A 1GYPA 3GRRA 5CFZA 5C9ZA 2HA5A 3LUCA 3HP1A 2J9XB 1EINA 1J7JA 1E1QD 3FPFA 4CU2A 2AH5A 1KTVA 1X7YA 5JARA 2ES4A 1OCEA 2AWNA 3D64A 4HP8A 3SF0A 1XZBA 4EA7A 4NZNA 1D03A 4DY4A 1AGPA 4U7FA 4UDNA 1LCIA 3PXBA 2O8NA 4HPWA 4B43A 1W19A 1W73A 3KJQA 1J06A 4II3A 3TQHA 5TLSA 4DC1A 1SVKA 3VZDA 1E9DA 4GWKA 4F8YA 4OB7A 4DQUA 4QGSA 2G0AA 3KZOA 3OZUA 5JXWA 4J0QA 2EAUA 2GAAA 1IULA 3ND5A 4E14A 3RVBA 5TVGA 4GXQA 3K96A 2FI1A 1TZJA 1CY1A 4P3YA 1CQJB 1J97A 4X1IA 3SBXA 2UVQA 1BHO1 2O7RA 4ZO8A 5B1EA 2JFOA 1AS0A 2HXGA 1MHPA 1D2GA 2IE0A 2JRCA 2L0XA 3ASUA 4U5QA 4OHVA 1PZHA 4URWR 1GGMA 1ISJA 1QQ5A 3H9UA 2JPDA 4O4HB 2V7QD 2C1ZA 3FNRA 4QYMA 1PNVA 4CUJA 3THXB 3GLIB 3PUHA 2BMFA 5ER9A 3K5IA 3Q3VA 4Y0NA 4GE3A 3ZD8A 4FEAA 4MS3B 4D56A 4C05A 4H18A 4K9PA 4YRTA 1ORHA 4JB8A 3TG8A 1EA7A 3EAQA 3DUFB 3UAXA 1K8XB 4MI6A 4IM7A 1SGWA 1X3SA 3ETEA 3IQIX 1T1GA 1SU8A 3EIOA 3II6X 1SWWA 2VP6A 2IZ0A 2R6R1 1T6NA 3EFEA 1RC0A 2FPIB 2HK9A 1G8YA 1LU9A 5J63A 3BKWA 3NOXA 3FOZA 1KBQA 4GIBA 3QLEA 3PENA 5J1SB 1FTYA 2D1YA 4EFNA 4ZT3A 4B75A 2BV3A 2JGFA 4FW8A 1SH7A 3F8TA 3GCGA 3OIDA 4ITRC 3DXYA 5AM3A 1FJGB 1BXGA 4NJMA 4TV9F 3GA7A 1LC3A 1TE2A 4B6FA 4ZYWA 3D7LA 1PO7A 5DT2A 2KWIA 1B6RA 3NLLA 4H7KA 3QQPA 3RFTA 3N3BC 1G38A 3HDHA 2AC7A 3WHKA 4ENQA 2J09A 4F1KA 1KR5A 3BD7A 2AJCA 2CK3A 2DT5A 4INOA 4KXUA 1JNYA 1N4AA 4B7CA 2PBRA 5AD1A 4ZHQF 1B14A 3CNQS 3HLYA 1EFHA 4P7FA 2BM0A 3AINA 3OZ7A 2X7JA 2CKMA 4QOGA 3ES9A 2WTAA 3KNZA 1P2BA 2DQSA 3BCUA 3RTGA 4CWAA 2C04A 2JW5A 1KXJA 2VF7A 1E79A 3L0OA 2O2IA 1Q1EA 3PRHA 1LS6A 4DLWA 4L3OA 5COBA 1XTBA 3KQVA 3O83A 3A6DA 2ZSUA 2IT1A 2LGJA 4L8GA 1KDRA 4PRKA 2C88A 3RDPA 3U9TA 3OC0A 2ZXEA 3EB9A 1OAOC 1LRKA 4E1VA 1BJTA 3N07A 3ET4A 4BTEA 3IEMA 2JIBA 3R3HA 1OVGA 5KQGA 5J43A 2VHUA 5FYDA 3AKDA 3PKZA 3BMQB 1DL5A 1WCXA 3LK6A 1FLAA 1RYNA 4DLZA 3EUEA 3EY4A 4CKZA 1AKYA 1EP3B 3DBRA 2YYZA 5EJ7A 1GU7A 2ON6A 4P4SA 5DX1A 3NH9A 3N9IA 4WA7A 4HAIA 3IDQA 3RT7A 1GCAA 4J3JA 5EMNA 3VTZA 2ECFA 2IX3A 3I58A 3TKYA 2XYGA 5H80A 1FS5A 1HZZA 3VR3A 4AURA 2CFTA 2O8DB 4RHFA 4H9GA 4MP8A 2NYAA 1DEKA 2ZBVA 1MQAA 2DUNA 4HNGA 1T2FA 4CTOA 4L3WA 2ZQ5A 4QC2A 2OGWA 2ZSJA 2XB9A 5TNXA 2XQIA 5FJIA 4AKSA 2J9FA 4CN8A 6YASA 1GFWA 4AS3A 4URYR 2Q46A 5EP3A 3TOVA 1E20A 3IP5A 4LHEA 3EASA 1JSXA 1C4KA 2GZAA 3C7KA 3Q7RA 4YDSA 5BP7A 4Z49A 4AY5A 1J0BA 2O1SA 5DM1A 1A9RA 4LOIA 4YC7A 1NULA 2GNOA 4B3HA 4ENTA 1KMHA 4RF3A 4DMMA 2IH4A 1AMNA 4P4UA 1U9CA 3PIDA 1WJGA 2Z09A 3PZRA 4KSCA 1LLCA 3WE7A 1XRQA 3MWDB 2OCLA 5E6UB 3R8CA 4PNZA 4DV5B 2RJNA 1HUQA 3NTRA 5FBQB 1ID8A 3CT6A 5B5SA 4JS0A 1MC4A 5AK5A 4B6SA 1U0NA 3IP7A 1JDBB 3ONDA 4AMZA 5LB4A 2BN4A 2GYYA 4NCHA 1E3TA 2A0WA 3OT4A 3RAJA 1Z45A 3JWJA 2Q8QA 3ZJTA 3DLBA 3FLAA 5CB0A 1ZU4A 2B78A 2PV7A 2YFQA 3I04A 1DUSA 3OOEA 3RIXA 5EIHA 3H7AA 3U44A 1E9VA 5BN5A 2WWYA 2FSVC 2IYUA 5ERYA 1Z35A 4ZDWA 1UKZA 2WM9B 1KL7A 1FP7A 1PJLA 1QRAA 1TQ6A 3DDCA 4KKVA 3ZX5A 1H8EA 2PWZA 4BPBA 4PTZA 1UADA 4GMXA 2X0EA 4DQLA 2JGJA 3FBWA 2ORWA 2AEMA 1G98A 2YJZA 3AEKB 3RTBA 4PO3X 1ZKMA 1LQUA 1RW4A 3AHJA 1JWBB 2REQA 1XQWA 2WYUA 1QP8A 4IJ6A 2WNIA 2JLQA 3LWBA 3IURA 2WWXA 3W05A 1ZDMA 3U9LA 2R7LA 3N7AA 2WM2A 4Y8VA 2WYOA 1DKLA 2D0PB 2X0RA 3TEJA 2PBFA 3Q5GA 1KJYA 3TSCA 3A2MA 2VDOB 3WLIA 1ZD5A 3UWOA 3EF0A 3VZQA 2W2KA 3ICWA 4MR8B 1PBNA 2QRMA 3CX6A 3M9LA 2G9VA 2YXPX 4QPNA 2PEZA 1KERA 1BO6A 1P61B 2MYTA 5JO0A 4F4HA 2R4TA 3GI1A 2XX3A 2QYOA 2VAVA 2GX6A 1V26A 2Z3ZA 5I9BA 4ZI7F 5CW2A 5IC4A 5IN4A 1P3DA 4MUJA 4C4PA 1FRZA 4DQ0A 3LBFA 4DMGA 3WK5A 4XZ3A 2J1LA 2XXJA 1FFCA 1GNQA 1I7PA 5HG0A 3A1EA 2PH1A 1U3TA 3BE8A 5ALRA 3KZNA 3BFKA 4CYMA 3JVIA 4JH0A 2QVCA 3R7DA 1EHCA 3RYHB 5LLDA 5HKOA 1TNDA 2JBAB 5DXAA 4Y1EA 3CO0S 4ZARA 2GEFA 5CA0A 1O0BA 3BXXA 3SBDA 3PWSA 4BQSA 1ZNXA 3AC0A 4NBUA 3DW1X 3C3JA 3O9VA 4UBIA 5CJJA 2XQKA 3G5UA 4RD6A 3Q88A 4M89A 5BUSA 2NZWA 2FKNA 3BIOA 3D7NA 3ANLA 3VXKA 2FCRA 3AI1A 1BKSB 2PRSA 3D7RA 3ZDAA 2FSGA 4QRDA 3LCJA 4U6QA 1IHYA 1V71A 1PW5A 1KK3A 4IQGA 2RI0A 3TZBA 1W4RA 4IJVA 1RS0A 3NIBA 3AY6A 1NM5C 3KB8A 4KGVA 3JWEA 3CV3A 4OAOA 3TQFA 4WESB 3HADA 4K6HA 1ACMA 3B7PA 4BBZA 5LB2A 3K94A 2R47A 4PSUA 4HAXA 4V24A 3DE2X 3ENNA 4DANA 4DHEA 1TEHA 5K8CA 3ICPA 2CE2X 4KC0A 4IIGA 3SJ7A 1M9NA 5A9TA 3UJPA 3I61A 2RHJA 2C3OA 1XROA 3EGIA 3CUKA 4NU8X 3ZZ1A 4FCVA 2ZKIA 3OIUA 1QSGA 3AEYA 1GR0A 3K2IA 2O23A 5IARA 1SHKA 2I1QA 5LPNA 1Y8ZA 2EW1A 4YXFA 4LHYA 4CLOB 3CG0A 3MGBA 1A2KC 1SY7A 4RF5A 1E8NA 2RCYA 5B37A 4CQLA 1D1PA 1XCBA 2A59A 2H4HA 4HZGA 5FKJA 4BEWA 4F72A 3ETHA 4F56A 1M8PA 3ILVA 2VJLA 5I7WA 1ZCBA 3NVDA 3RT9A 1OYVA 4GPZA 4IJMA 4M0MA 3QA9A 1K3TA 1KEUA 3KD2A 5IVDA 1P2FA 1ZJYA 4U6SA 3S55A 3G8DA 5GADl 4CI9A 3U3RA 3AFOA 3GLHA 2QUJA 3OO0A 4IR7A 1WD5A 3K7EA 5IK2D 4EY5A 2ANCA 1JS1X 2DRIA 3PUIA 4IIJA 4LZLA 4O4IA 3ZWVA 4C7KA 1PLKA 1DG1G 3HXLA 4N8EA 5DDIP 4BGUA 1FMFA 4G4JA 5EFOA 3GXOA 4G01B 4UAUA 4RPKA 3IIMA 2GAFA 2C59A 3W4KA 4Y30A 2Q4TA 2I4IA 3QG1A 4BRWA 3K70B 1RYMA 2PUBA 1F4VA 3RBAA 2GHRA 5TDHA 2H5EA 3IB3A 1GT6A 4URFA 3RAPR 1PQYA 3HCOA 3I2HA 4L4XA 2NPFA 2ZIFA 4A0QA 1JTFA 1GTRA 3ZE7A 1Q7RA 2P79A 1BS1A 2ZYUX 3N05A 4HWOA 4CUKA 3KB6A 4X24A 2W70A 5AIBA 3ML1A 5LMZA 1ZOLA 2YN2A 1AT1A 1NZDA 3X1XA 2QMOA 3ECCA 2ZYWX 4HJXA 2AZ4A 2VPPA 1NUAA 2J59A 2INGX 4KH1A 5THQA 3ZHXA 2XOKA 4I99A 3TLCA 5EPUA 1W49A 4NF2A 2ZRJA 3GLFE 1E3JA 3GHHA 1VKZA 2QW8A 2I62A 2F48A 4NH0A 1FRQA 3PFIA 1Z83A 1EWRA 3PNQA 5A5EA 5A4AA 2P9CA 1D04A 3MEQA 3K70D 2DPHA 4A8PA 5CMLA 3X1DA 4CEIA 2VHJA 2P67A 2BRUC 3D6JA 3FZNA 1GDHA 3LSTA 4MV0A 3DLIA 4OOEA 4XWOA 4QFMA 1XQYA 4Y1GA 3D8SA 1PWXA 5ECDA 2XA2A 1P7VA 3D3EA 3PT9A 4B3RB 4F38A 4PRYA 3T7KA 2CLSA 2ZGVA 3COSA 4LVOA 1T4CA 3OLQA 3QELB 3SN6A 3TW6A 1PD0A 2W2LD 1L7VC 2OSVA 3I3OA 4DCGA 3V9AA 4RO0A 3AGPA 4IRMA 4WV3A 4EPRA 4BXOA 2R97A 1HMYA 1GCUA 1A9XB 4YGYA 1QTNA 3A7DA 4J90A 3WRVA 3OCZA 3HVJA 2NIPA 3D8HA 1UBOS 3MAAC 3AGQA 4C29A 4NXNB 3KSUA 1X9IA 1ID1A 1O94D 4JLVA 1ZKDA 3QEKA 4MS4B 4NMLA 4ZEOA 5KYWA 3R9XB 1QTIA 2SKEA 1K6IA 1LDMA 2I3BA 3LKBA 1PAUA 3GWZA 1U0HC 3TS1A 1RRFA 5CB4A 1XU9A 3IVXA 3STUA 3MUFA 5KSZA 3KHTA 4JYBA 3FDZA 1RLUA 2Z43A 1YMUA 4G0XA 1BKYA 2GWRA 2BKAA 1QFSA 1LJUA 1SU7A 1N5OX 3BULA 3FX2A 4ZAGA 3PFNA 4K2HA 2PZAA 1AQIA 3SZMA 2VUIB 4EW3A 1BMTA 1KEZA 1IDN1 1UPTA 1Z6PA 5HDBB 5C18A 2ZRPA 2QTZA 2O48X 2ZB4A 1LBQA 1SD2A 3EC7A 4UATA 3RARA 3OF5A 3AWDA 1QFJA 4D79A 4B8ZA 1N5LA 2BR4A 1IBSA 1U7TA 4KLRA 1KFCB 4KMRA 3VKUA 4PIVA 2V3CC 4JELA 3Q87B 1XT6A 5HILA 4AWBA 1ZHHA 1FLVA 2VT2A 4NE7A 2X5NA 4LY9A 1VE5A 4KNWA 4KLAA 5KYVA 4HZIA 3L3BA 2IYTA 2HCFA 3A1UA 1SBNE 2P0AA 3LX8A 3DKIA 2O0JA 3EIWA 2NVUA 3LYLA 4IJ5A 5KYNA 5ICGA 3FUXA 5LDHA 1YB2A 3ZJ4A 3G02A 1GTG1 3PL1A 1DAOA 4NWIA 1GZ3A 4IILA 4RXUA 2SNIE 3PEWA 4WX2B 5I4CA 4W4TA 5C80A 3VKGA 3IVRA 3CUEF 1WNTA 1G20A 1VL0A 5ALJA 5CDHA 1RSZA 2HSEA 1B93A 4BGVA 3HCPA 1OLSB 3P19A 3S5UA 2Z2ZA 3OT5A 3WO0A 1KY2A 3CKYA 2PVPA 3PL5A 1ZI8A 3K6KA 3ZIUA 3LBHA 2JJ1D 5F52A 3V32A 4GOXA 3FKSD 3WZLA 2FSIA 2EERA 3K5HA 5T57A 4EG1A 3QE2A 3TLEA 2PS3A 2PX0A 2RK6A 3CEAA 3ODGA 2ODTX 1YRAA 3MMPA 4RIGA 1NP7A 4RIIA 2XKKA 3QVUA 3EJWA 3OC6A 3RTAA 1M34E 3L1VA 4LCJA 1U63A 2FZLA 1LSUA 1XP5A 2QTWB 4QUHA 3HSYA 3A2NA 2VNAA 2G7MC 1WX1A 4L28A 3B20A 3GBPA 3MCTA 5A7GA 2P5TB 3HXPA 4OBWA 3LP6A 3IT2A 2QVYX 3LUBA 1CYDA 3MT0A 3GELA 4RNCA 1CEQA 1E3WA 1OB2A 4JQYA 2XVMA 4TSKA 2RI6A 4P93A 3I6YA 3MRSA 4B5LA 5C7IO 1ADBA 4JB2A 5A4MS 4KTTE 5TPZA 3VISA 4BQFA 3ET5A 2QUZA 3TMYA 3OETA 4KOEC 5FOSA 3W2TA 2J3MA 1GZUA 4J43A 4GPBA 1CYEA 3P52A 1OGYA 1TB4A 2R79A 5LXTF 2W2PA 2WVGA 2FN9A 4MZXA 4UC0A 3N7UA 1ZRNA 3P4XA 1KZYC 2XWQA 3CM0A 3OPXA 3ZS9A 2ZVPX 4HYTA 3GP3A 2WEKA 1NV8A 1E4OA 1YBFA 2QD5A 2QN6A 3T9AA 4F2HA 4IV5A 3HCRA 1E1NA 5F5LA 3W06A 3U4GA 1MT0A 1K7XB 2VH1A 3P2EA 2QVLA 2F1JA 3IIKA 3PNSA 1FNNA 3ORFA 1UBKS 2IXFA 2PR2A 1O95A 4F96A 2GEJA 2VOJA 3E7XA 2BDTA 3G2QA 2IE8A 3IP3A 7MHTA 2BEWB 5CAEA 1YVDA 4YBRA 2Y1LA 1WZEA 4ZMBA 1LXCA 2VAPA 1QANA 3DEZA 4LYEA 5P21A 3TZEA 4Z4EA 2HHAA 4R2JA 3Q3IA 1XHEA 3UAVA 5GTDA 2H2DA 4FS3A 3WTCA 3SJBA 5H4GA 2GAJA 5IH3A 4E2WA 4PR0A 4I1RA 1QGOA 5BW5A 2CUZA 1UOQA 4RE5A 3ONVA 4RZ3A 4JJFA 4L3VA 2O2XA 3OFKA 1CJKC 4BKOA 1F60A 2K4MA 2HA2A 2IC5A 2JD0A 3RQIA 2YDYA 4WBXC 1Z0DA 5CLLA 3UICA 2J3KA 4I55B 4MB2A 4ND3A 4OFBA 2GCOA 1P7WA 5JQGB 5KJCA 2Y6UA 1D1TA 4KXMA 2OBXA 3HEAA 1JHQA 1N75A 4I50A 4J0DA 2WJ4A 4PYOA 2X9NA 2Y77A 1UBFA 3TTVA 4HGQA 1EG7A 4LMAA 4DV0B 2H5JA 1JMYA 2WU8A 5L9AA 4RL6A 2XE8A 3NOVA 4FJ0A 2Y0PA 3SSOA 2I2FA 1TCCA 2Y0EA 3E70C 4YAGA 3BHJA 2X86A 4TT3D 2O54A 2YV2A 5LVAA 2Z1NA 3KT0A 1NIPA 2I2DA 2DFLA 3WICA 1VJTA 3KOWA 2FHSA 4Y67A 3K1AA 2EQAA 3SFZA 2XLBA 3P5BA 3TZKA 4GXNA 4MDHA 4XPIA 4O4JA 4B2IA 3DYBA 1YB6A 3HB9A 2I8LA 4KW7A 1NQUA 5DW0A 1JJFA 4FONA 3PUXA 3ZKAA 1Z18A 1QHEA 4N03A 1MB2A 4E4YA 5IXJA 1DCKA 1E32A 1A9PA 2VXCA 4LWPA 2RB5A 3GCDA 5JEEA 3WMWA 1FFSA 1EX7A 2JDID 4BX0A 5EY5B 3H5NA 5HQ3B 2W4IA 3T94A 1A7KA 4O2RA 1TRKA 2OGSA 4IHJA 4X92A 1KI6B 1DQSA 1VL5A 4NJEB 2JGEA 3BWYA 3RS9A 5JRJA 4AL4A 4XLZA 2Y68A 2LVBA 2OCXA 3HI4A 3LX5A 4TQGA 5DI3A 3VPCA 2WSSA 1MJGM 4JNCA 4WJKB 2DZDA 4UKDA 4C07A 2FUG1 2ST1A 3E15A 3K6SB 4BQOA 4GOKA 5DPMA 1S4QA 4Z0NA 2PS0A 3TOXA 2IYWA 1IPFA 5AJXA 3EX7C 4J7CA 3W6NA 3COJA 3FMIA 1XWWA 2CHEA 1ZG3A 3KPYA 2OBBA 4WHMA 1F20A 9MHTA 1QC5A 2Z5LA 4W5WA 2Q5JA 3QOXA 3TCKA 1UJ4A 1SC9A 2XMPA 4JXZA 4GRIA 1T5SA 3SM3A 2Z4TA 1NW6A 2KSQA 4A2PA 1YDMA 4JK3A 1JDTA 1EP1B 1GVHA 2Y9PB 3SD7A 3TLBA 3RSSA 4AT1A 1X0VA 3KQWA 4FBLA 7GPBA 4HGPA 1O9GA 3VZCA 4DCMA 3ND6A 1KDZA 2REOA 1IN6A 1YDHA 3LVBA 5MFPA 4F11A 3QF4B 1E1RA 4Y6SA 1DKQA 2VJOA 1DZIA 3CYFA 2WG0A 2NSYA 4GLFA 1XJ5A 2B9VA 4N0DA 1SJ9A 2R8PA 3ZWMA 1A4IA 1P4SA 3ITDA 3E18A 4V0LA 4PS1A 3SK0A 5EJGA 3LRTA 2OOSA 4NTZA 2H65A 2QJWA 3BHMA 1C3VA 3VNBA 5JI2E 3S2EA 5DE3A 3INRA 3B52X 3VDQA 5FUQA 4EKDA 3B1ZA 3KKMA 3Q3EA 5JI3E 1NHWA 1T2EA 1T3HA 1GSOA 2J3EA 4RD3A 3HB4X 4KFTA 2RKOA 3IDOA 5LYYA 2EFCB 1E9SA 4NESA 4DLUA 5KTSA 5EYPB 1N2ZA 3FBGA 3OCXA 1H05A 4JOSA 3LT0A 1BEEA 2I7VA 2NN3C 4CGYA 2I87A 2QW1A 3EULA 3E35A 1WWKA 5BMVB 4F60A 3F9CA 2MU1A 3R76A 3VO1A 4BEJA 2FF7A 4R8RA 4V3CA 3AVWA 2PMFA 1JKFA 1LH0A 1P9WA 1JFSA 4BNKA 3AF2A 3T3HA 3HJGA 3HVUA 2GQ0A 4IEEA 4MCHA 4EL5A 2QNRA 3UJNA 4GQBA 5D1HA 4OK3A 1YB5A 1JLRA 2JFPA 1C1DA 2ZR7A 2YWRA 3BS4A 1ZCAA 2A9VA 5U1PA 4AI6A 1DTSA 2CLLB 3HP4A 3OAAA 4JP3A 3T99A 1SB8A 3KKLA 4I1UA 4QGHA 5CT6A 1JV2B 1MEEA 1AZWA 4FD2A 1KGSA 4RZUA 1FW6A 2Z56A 3B78A 4FGWA 4JWKA 2LTAA 2IDKA 5FI0B 3ZCXA 1B1CA 3L7BA 2JI9A 1T5IA 1Y3IA 2CJFA 2QM0A 3UUGA 3LKZA 1UT5A 1RAHA 4JOQA 5BMOA 3V5NA 1H2WA 4D8XA 2O8EA 3AR3A 4QM7A 3OZGA 3FFWA 4M6WB 3DFIA 4UU0A 1IXZA 1G6HA 4J3NA 2ESRA 2R48A 3AVOA 3OY2A 5H59A 1IL0A 2GEKA 5AI9A 3T9BA 1M8GA 1ESDA 2CZQA 5AI5A 1UR5A 3DEFA 4CE6A 1UDBA 2IHTA 5IMSA 1W88A 1WQ3A 4L72A 4BNJA 4Y2YA 5JWHA 1E5LA 3ZV4A 2HLDA 2RONA 1JA1A 2ZIZA 5BYAA 3C8HA 4R83A 3AMVA 4UULA 3T7TA 3ICVA 1LLDA 4YNBA 1SOUA 3D1LA 2X0KA 4QQKA 1QWSA 4X71A 1S8AA 5L7TA 2X8JA 4QJBA 2GZ1A 3SS8A 1SD5A 4IYJA 3DZDA 4MCJA 2PUVA 3DDHA 4TVSA 5GJWC 1P5FA 2PQ0A 3ZXIA 5BWNA 2VKTA 2MINB 4HDCA 2DKOA 4YRJA 4PANA 5C8VA 1J9GA 3ADOA 1VPWA 3T5MA 1D9ZA 3DC2A 3RVSA 1VYHA 2JAXA 2NYVA 4F3YA 2P9EA 2Y8EA 1SUWA 4RZ2A 1TX4B 5ALUA 2CDCA 3PA6A 1NBOA 2BFAA 5HUJA 1KK1A 4XQEA 1JPNA 1W87A 3T3MB 3CF0A 5T64A 4YMTA 1JZSA 1YASA 3EXFA 3M4JA 4E08A 4FHFA 5IKPA 1NW8A 2BVNA 3W0LB 4EITA 2ZS8A 1DDIA 3IAUA 4O2BF 1IBRA 3FMOB 4TROA 4R0VA 4G8DA 4M49A 4KYTA 1N5DA 4BVAA 4CR8A 3UQYS 3GJZA 4Q82A 3F6CA 5IHXA 3G8CA 3IT0A 2H1FA 2BEUA 4FUTA 2X40A 1U0FA 4KLNA 4HMOA 4M86A 2D06A 2NZJA 2ZI6A 4MDYA 4MUIA 4TM8A 4KIUA 4DIMA 1EM8B 1WW8A 1CY6A 3HKEB 4EDHA 3F73A 3HA5A 4TTTS 2QRZA 3HNPA 5SV2A 1AKVA 1TVKB 1X7XB 1XU4A 2QMUA 5FHRA 4I5FA 3UMRA 4UFPA 2WG1A 4TL9A 1MAUA 2J32A 2H2IA 2JJ8A 1V1MB 2BUBA 5HTKA 3KOUA 4RIHA 3AIKA 3SHWA 1F12A 1SR8A 5HIKA 3I92A 4ANFA 4ADSG 5I7SA 3ADPA 3BAFA 4UM5A 3AP3A 4JLOA 4CM8A 3NRCA 4KQCA 4LNUB 1U9ZA 4M8IA 1K8QA 4NQRA 1XMQB 1EB9A 2WD8A 1UEXC 2C31A 1AKTA 3DBRB 4QU8A 3QTTA 4HTAA 2QAIA 4P4SB 3GFRA 1C0PA 5EXSA 4LZAA 5A04A 2PQ6A 1GUDA 1HBJA 1UUFA 3AFMA 1NZFA 2RAVA 2YMQA 1JJ7A 1XVAA 3OEHD 3QLVA 1YZUA 2FMXA 2XB4A 4NBRA 4X1YA 3ADDA 4DAOA 4IIDA 4N48A 2DQZA 5HOQA 3NTQA 4RMIA 4TTVA 2QHXA 1V5EA 3OU6A 1R9GA 4Q4AB 4UMEA 2G17A 3MOSA 4U5XA 4ZRMA 4RLQA 4ZO9A 4E2ZA 2ZYTX 4OLAA 3GRPA 5A6VA 3QMWA 4DEXA 4LC0A 8AT1A 4WD3A 4HT3B 3I28A 1GPWB 5E1DA 1X94A 2NO4A 3LPDA 4C9BA 1YVRA 1LX6A 3ZDYB 1I3LA 5DSZA 2JC3A 4BFTA 2JFYA 3DMYA 2BGWA 1Y6ZA 3CLVA 1YFZA 4ZC1A 3LZDA 4C7OA 3LQFA 1EFPA 4FDMA 3VKFA 3QPDA 2V4MA 3MWEB 3ESXA 5DM4A 5FWDA 1A5BB 4JLDA 4C4OA 4MW1A 2WJVA 4EI9A 2IL1A 2CCJA 3CO5A 1SCBA 1W76A 3LH5A 3NT2A 3RC9A 4DLYA 4TVOA 4CLXA 4G5OA 4DG5A 4EZEA 2GM9A 4E09A 5BQXA 1SBZA 2NAPA 3BORA 3IA7A 1OBCA 5BN3A 1OHHA 3F5DA 4PZCA 2AG8A 1JALA 1HT3A 5JG7A 1XLUA 3WWPA 1NMEA 1GOTA 4X7BA 3NC0C 4K1LA 4DCPA 5K6AA 3DW3X 4WH0A 4A6XA 5IM4A 2G9UA 2GB4A 1NI5A 3W79A 2ZJ2A 3PNMA 5A4FS 2Z5GA 1WUTA 3V7FA 5C1DA 4FYYA 2OT3B 1PZNA 2YCLA 1KZ4A 3JZAA 3VOBA 1G0OA 5KQPA 2FFRA 4H08A 4WZZA 2PFGA 1S3SA 2LE0A 3BIFA 4IGIA 3B1FA 1TU0A 2LV8A 4UJ5A 1PDOA 4JSYA 3N0RA 1U9JA 1XGKA 2JLCA 1R64A 4O59O 2WMNB 1ZH8A 2ZJ7A 5HRCA 5JBIA 3IMFA 1PJTA 4DIOA 4EHNA 1KJNA 1IPHA 1BGWA 3KBOA 3KSBC 3PC6A 4GGOA 3DZJA 3G1TA 4ZDJA 3CF4A 1PEKE 5EQDA 1QHXA 2IHUA 1HDYA 5CX1B 4M46A 4YXWD 4FWIB 1TW3A 3G2MA 3BUSA 4M83A 3E3NA 3GZJA 3UXHA 5CLFA 3EZ7A 3W5JA 2Z98A 1DO2A 1VE9A 3CMMA 3KM0A 5KNLA 1PT6A 2JB9A 1P39A 2X2OA 3CX4A 3K92A 1G3QA 5KAMA 5HHTA 1PQUA 3PEVA 1PVOA 1EXMA 1U8CB 1YD7A 4FEEA 1T9ZA 4OQFA 4RA9B 3UKOA 4KR7A 1KYQA 1QIJA 4XIYA 4ZQIA 1NPDA 1A9YA 1RQGA 1BWSA 4FEYA 2VYVD 5A7FA 2JGRA 2VAWA 2AN5A 2ZUFA 2FX5A 2P5YA 1ISHA 3NWPA 5AH0A 4ZKEA 4AF7A 5I3ZA 2DUUA 2PAAA 5LZ7A 4AVYA 4ZI3A 1QYCA 4EB3A 2AFRA 1WAMA 4LDNA 3MYRA 4PC6A 3O2NA 4BFCA 5B7NA 2VKQA 3ENWA 3BSYA 1JR3A 1KPGA 4NCNA 4DSZA 1RJGA 2RIPA 2HZ7A 4DV3B 1C8KA 2CLCX 2COKA 2ZRIA 1L7OA 2YY5A 3FWKA 4FZ3A 5AW5A 3X2FA 1WLYA 2RMKA 3IVCA 4MPRA 4F92B 5CM2Z 2A1UB 4OFXA 3ZWOA 3PU6A 4FFBA 3NUGA 1J0XO 1RYFA 3N6XA 4FYJA 1S3GA 1ULBA 2I6SA 2JCGA 3OFVA 1AGNA 4HWTA 4RV9A 2CMHA 3K15A 3Q4GA 4UXHA 5EE5B 4HV4A 2ORED 4NR0A 4H7DA 3RS7A 1UPFA 3B3GA 4BB6A 2ISSD 2LUOA 1A5SB 1M7BA 1UBMS 4NE9A 1VKNA 4TV9A 1JLLA 1KRXA 2J87A 2YZNA 1ZIYA 3QWIA 4F2PA 1OXVA 1Q15A 3TXAA 3NW9A 1JKJA 3HRIA 1I7QB 3KB2A 2HHHB 2X76A 2PLRA 2YZ7A 3TW8A 4CQLB 1P1HA 1NATA 5BY2A 1ADCA 1MOPA 5FOXA 5HF9A 2NZUG 5BV1A 1ZNWA 1SQFA 5A6SA 2PX6A 5I5EA 5IPFA 1YRHA 4ZO6A 1GRCA 2WA2A 4ZHQA 5AM2A 4WZBE 4LE1A 4OYLA 1YJ5A 3GRKA 5B4VA 1PT7A 3V42A 4NYIR 3WK9A 4Z9FA 3TNFA 2JFFA 3OLCX 1H2FA 3DDZX 4RWEA 1U3UA 4BQRA 4FFRA 2FZCA 2V7EA 2H1RA 3LUFA 3SM9A 1BWRA 3W8EA 4NRDA 1N2CA 1XQ9A 3PHCA 2LKCA 4KO1S 3UG7A 4IIJB 3PHHA 4D5GA 5BOSA 1AD2A 2IX9A 4ID9A 4QNRA 2GK3A 2CHVA 2I66A 1BD4A 1KZGB 4AWXA 4IIXA 4AXBA 3O93A 2LKDA 1PZMA 2BBWA 3WAKA 3WYGA 2J3QA 721PA 3PEFA 4NU0A 3GQBB 1MT3A 1UZLA 1NVVR 2PL9A 2ZIAA 4DIFA 1DWQA 3EVBA 3T34A 2Q6VA 3Q12A 2J0EA 3C3KA 4H6XA 4ROSA 5F21A 1RLIA 3Q9NA 2ACKA 1THZA 2PMCA 3IP8A 4R98A 4Y6LA 2R00C 4XYMA 4H60A 3NVKI 3F1LA 5CDFE 4LTDA 3G2KA 4PG6A 1ZW6A 2N47A 3PSHA 3QU9A 1SXJE 4X84A 2AMYA 3K2BA 3TL3A 3ZBPA 4FT2A 3O8CA 1XQVA 3O0TA 3MTDA 4AUEA 1K5HA 3UENA 5AHRA 3U7HB 1T8WA 4BRUA 3JZFA 3BDVA 1XLTA 3GZNA 1KEPA 3DDSA 3GNTA 5JECA 1ONPA 1RBMA 4WRRA 3U3OA 4AJNA 7YASA 4D7AA 5KYTA 2OC4A 3ABOB 3ED5A 4GECA 1KSJA 1DHTA 1UF9A 1E2NA 2A35A 3TAUA 4NZZA 4RH3A 2FDXA 5CH5A 3Q3CA 4G89A 4M7OA 4D98A 1J2EA 4EVQA 1GARA 1FA9A 1N7IA 1VHJA 2F00A 3KHKA 4ND1A 3L2OB 4C7MA 2EEZA 2ZRKA 5D3KA 1E1KA 3A3PA 1ZIOA 4LZNA 4OL0A 1Y6GA 4KHPB 2Z6QA 3OQOA 2ZRGA 3OZWA 2OKCA 5E3IA 1B41A 1MVNA 3FOAA 3MUEA 1MB0A 3R4VA 5FB3A 1IONA 2OVFA 4LDJA 1FEZA 1YZGA 4ZRNA 2FQQA 2EFYA 3PIRA 3RBZA 4G4GA 1U81A 1JYSA 1G60A 3D6NB 3ZQ4A 2EF0A 2H00A 2UZAA 2LDBA 3UB2A 1J70A 2G70A 2GJAA 3NYQA 3PZBA 5EWMB 1PUXA 5C8DA 1P1JA 4EO9A 4JP2A 3W3ZB 2BFEB 2GK6A 2A9OA 2HBQA 3DH0A 2C2KA 2D2IA 3TMKA 3OWHA 4H6PA 4MR9B 2VK1A 3COVA 1DT5A 1Z0JA 5JZ9A 1RPNA 5CB4B 1V16A 3VR4A 4DIBA 1AUPA 5JSKA 1DPFA 4R8SA 5KS2A 1EP2B 3NP9A 1G5QA 3ZDRA 4CIVA 2BPOA 1FDTA 4D1YA 2Z1MA 1VHWA 2FSUA 2HIHA 2QL9A 2YJ6A 1KMMA 2FZVA 3QUQA 4HH4A 3C45A 4N18A 4TMXA 4K9LA 5A5VA 3QFRA 4WLNA 1BU5A 1SPXA 2BY4A 1VSTA 1RYBA 1R7RA 1L4MA 4QSMA 5G0TA 4E2FA 2XHEA 1LBIA 3BZUA 1UJMA 3P2KA 4LX0A 4YJDA 3X0DA 4ONEA 1RI1A 2BHSA 2HY7A 3DPSA 4U8HA 3ZTWA 4N76A 1K97A 4GP7A 2JK0A 3TJZA 1P6QA 1RYHA 3W1VA 4BO8A 2C29D 1RZRA 2C5EA 3PDCA 2VDNB 2JJ2D 4EPYA 2G9NA 1J56A 1M76A 2P2SA 2WOJA 3GRUA 3FRJA 3C5WP 3OOJA 3B53X 1B8NA 4NXMB 4I9HA 1IH8A 4IL5A 4LMPA 4EFLA 1W5EA 3IAAA 2XOXA 5IULC 2BEJA 3BEDA 4ZI7A 3SEZA 4V1CA 3REOA 4OGGA 2NUPA 4Q9HA 1PYDA 2IS4A 1Z16A 2JVIA 5EJIA 4C21A 4G07A 2VRCA 4BUZA 1SVWA 4KTVE 4L1KA 5I7EA 2LBPA 3PDWA 3NYRA 5ES4B 3FDXA 3NU1A 1HFJA 1T3GA 2C0CA 3AEUB 3HHEA 2WB4A 3ANTA 4JYCA 4RZQA 1X2EA 1H2RS 3C6YA 1TA0A 3IOMA 4TZKA 4L4ZA 1HURA 4Q9LA 3RC3A 4UW9A 1SXQA 1CHNA 1DIAA 2ZI7A 3MT9A 3NM4A 2B6HA 1RWXA 4G26A 4NMHA 3D6FA 4Z0TA 2IH5A 3EPRA 1WCWA 3QENA 4KYVA 1A50B 3RREA 4OXXA 5F5NA 2E6UX 3FCAA 3FCXA 3KD3A 2ZTMA 4MLPA 1EFAA 1SZDA 2G1PA 2PV0A 1INLA 4I4TB 3D0OA 5C8YB 1TUIA 1ZFNA 4Q9JA 2ZE6A 4RKFA 4TTJA 3RV3A 3O03A 3NG1A 2D7DA 1JFVA 5FTWA 4BCDA 1KC3A 3CWQA 4G0QA 4XFKA 4NBWA 1CUJA 1TPYA 1G18A 1KVTA 1UFVA 3AXSA 4FMCF 3HG7A 4K3UA 4D3XA 2IXGA 5L6MB 1MA3A 3D0RA 3RVKA 3KG2A 2VT3A 2O3UA 2Q6OA 1CRZA 2IBMA 1VMIA 2B4QA 3E0QA 2BHRA 3ONWA 3ROPA 4MGHA 4UNQA 1BD3A 4OMFG 1F2UB 4QG7A 3SHTA 3I6BA 2CF6A 3A9CA 3KC2A 2XCUA 2YRFA 2M1ZA 3GXBA 3VHRA 4OQPA 2Y66A 4QO7A 1MW8X 1EFRA 3B2QA 1B8PA 2XTNA 4LJRA 4BNLA 1VIDA 1KMQA 4L4YA 1L5LA 2FEKA 2PO5A 2DCMA 4WINA 1JH8A 4B80A 1E3WB 3RF7A 4TTPA 4MHSA 4EVIA 3PJGA 5TT1A 4J4BA 3KS9A 1X7GA 4KUEA 3F0TA 1FVHA 1FNMA 1PEYA 2D0IA 2ZYRA 3R75A 3AOEA 4JITA