1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
3R9WA 2W00A 1NBMD 4EUNA 2YOHA 1JPNA 3AF1A 3MJRA 4OK5A 1JR6A 2J59A 2O0HA 2XTMA 2GCOB 4BZQA 5JJIA 3BS4A 3C14C 4HB2A 4ERNA 4OQNA 5JEEA 3FMPB 4KSCA 4W7SA 1US8B 1W4CA 2GXAA 4E5UA 2HT1A 2ZRJA 3SC3A 3RNLA 3CNOA 5TDHA 1T3SA 3QKRA 4KJZA 4M21A 3W5IA 3ZVRA 1KI6B 1C1YA 1NL3A 1VCNA 1P9NA 5FL7D 1N5KA 1EFUA 2BMDA 2IYRA 4G0NA 1ZINA 2VHJA 3OHMA 4LBYA 1O3YA 3NXSA 1ZU4A 1J8MF 2R8RA 4W5WA 5G40A 1NMZA 2F1RA 5J4KA 1Q22A 2ANCA 2DWQA 3IIKA 3PJRA 3P32A 1UEIA 3W3AA 2ATVA 4WA7A 1IHUA 1Z6AA 4JJZA 2QNRA 4YDSA 4RCYA 2G83A 1LTQA 6Q21A 1KO7A 1U8AA 1O87A 2QPOA 3HP1A 5LDDC 1Z63A 3SYNA 4AYWA 2O8BA 1ZMXA 2OXCA 4D81A 5CDFE 2A30A 3REFA 4M1WA 4QC2A 1NSFA 2FZ4A 2P5TB 3AVXA 3RS4A 2O8EA 2MMCA 1KJWA 2PZGA 3GLHA 2G1JA 2QGNA 3NEYA 1R10A 2VSXA 2SHKA 4US0R 4OI1A 5BYKA 5FTJA 5LD2B 3GPLA 1E2MA 3NEJA 1KI6A 1KDOA 1QHYA 3CF0A 5GJVC 2ZRLA 4YC7A 2CK3D 5IK2A 3WNCA 2WMOB 1HE8B 4GOXA 1XB2A 3BJIC 3FFAA 4PSVA 4X8LA 1XX6A 4HLDA 1ESMA 1G6OA 3CR8A 3X2SA 2MSDB 1FNMA 1JAIA 2OEPA 4OKSA 1NSTA 5KNBA 4IFEA 2IS4A 1XNJA 1J70A 5CM8B 1OT3A 2EFGA 3OIUA 3VR2A 3ZZ0A 3ICQB 4XVQA 1TEVA 3LX5A 2DFKB 1MRNA 3I8SA 4ESVA 1XJCA 2VQSA 5JJKA 3JZMA 2FA9A 3LH5A 3GJ7A 3QNUA 3AP3A 5FTNA 2CCJA 3OZXA 2ZSFA 4QJ3A 4LJ9A 5D3QA 1KIMA 1FX0B 4EPYA 3GJ4A 3KFXA 4XD7D 5JWRA 3A1TA 4PTLA 4BEBA 2IF0A 5H1YA 4D4MA 2IUTA 4XD7A 3WNDA 1BS1A 3RVBA 3VMFA 4NCHA 1P60A 1Y3AA 2NPFA 1D5CA 4FCTA 5LPNA 5FFMA 1RYHA 1PUJA 3KTAA 2VTKA 1FPMA 5CLLA 3PUVA 4CEHB 3B60A 3LBIA 2WKRA 2ONJA 1E2PA 2GK6A 1VYUA 3OF5A 2JLVA 1E2FA 4TSFD 5GJCA 1JR3A 3QKRB 3I5XA 2PCLA 3LA6A 4CT5A 4L16A 1AK2A 2A7QA 3U7EB 3CB4A 3WY9A 2ZRPA 4WVFA 1EFRD 5E95A 3U3OA 2HUPA 2IEYA 2JIZD 3SFZA 3ND9A 3K53A 2BCJQ 1W7AA 3B8HA 1RRFA 1GL9B 4NONA 4JLAA 4P4SB 1Q0UA 1UEJA 3GCGA 2PJZA 1KAGA 4BE7B 4YMVA 3KKOA 1V43A 2ZJYA 2FDCA 2IYVA 1PUIA 1ZUHA 3GFOA 4LBZA 2FPLA 2J0SA 4URZR 4DSTA 2BM0A 2NO7A 2HXSA 2GHIA 2YZ2A 1ZNXA 3VAAA 1YR8A 2GZAA 3GJ6A 3Q85A 4ZI2A 2BEJA 2QY9A 1ELOA 2HCBA 1Q44A 3IHLA 3R8FA 1SQ5A 4AD8A 2F9LA 2ZI3A 1GM5A 5HCNA 3TR5A 2P6RA 2FSGA 3BB4A 2GETA 1AGPA 1XEXA 2ORIA 3RSOA 3U44A 3PVSA 3UMSA 5EP1A 1BMFD 3L0SA 5FL3A 2OESA 1R0ZA 3DM9B 4H1UA 1WA5A 2GK7A 1E1QA 2FF7A 3AV0B 2CCKA 1NI3A 2PL3A 1OH6A 1NBMA 4FXPA 4E09A 2EFDB 1T4GA 2D62A 1ETUA 3ASZA 3Q8XB 3UXMA 4A2PA 5BW8A 1ONBA 2J0QA 3EARA 1E1RA 4ESHA 2QG6A 3M0EA 4JKYA 2RGDA 2YC4C 5FPYA 5KSYA 4TL6A 2V3CC 1KGDA 4D82A 1IY2A 1ESNA 3AVOA 3REGA 3AVUA 4MITA 4D4LA 2JLZA 4ABYA 4FCVA 4L5BA 5CM9C 1F2UA 1QHSA 3I8XA 1XFAA 4A15A 1XMSA 2H92A 2OFWA 2WJHA 1G9XA 4C7OB 3GLIE 3GFPA 4WZAE 4MUAA 2FWRA 2C9YA 3VNUA 2JLUA 1QDEA 4XVRA 2R2AA 2WTUA 5FUVA 2FU5C 5JCPA 4CGZA 1GP2A 1A5TA 4IEEA 2P65A 1Z0JA 4QRHA 3BWDD 2CL7X 2IUSA 1CULC 4B47A 2A78A 1S3SA 4YMUA 2ZE7A 1XD2B 2FMXA 1G1MA 3AUXA 5JI3E 3K0FA 4UXIA 621PA 2RGBA 1WXQA 2CJWA 4MQBA 3PUZA 4TL7A 2NG1A 1HUQA 2QROA 3KUCA 1L4UA 3CH4B 4CEHA 3R7WB 3H0KA 2OFOA 2H1LA 5EP4A 1G7RA 3TQCA 1HE1C 2ZUDA 4PPQA 5J40A 4JSTA 4BLSA 4D0NA 5HKKD 4KHZA 2PJRA 2O8EB 1DAEA 4TZ0A 1DADA 4YMSA 3PUXA 2J0UB 4XTCS 5HZKA 2VYFA 3FVQA 1OH8A 3PV0A 4FW9A 2REXB 2WV9A 2ZI9A 3A8TA 1G3IA 3C16C 4WW0A 3TQFA 3LW8A 2EWVA 1K5GA 1DAGA 2OUKA 3NBFA 1VKJA 4PC1A 4NH0A 4YMWA 4PC7A 4HZUA 4OJKA 1J7KA 1P73A 1UBCA 3OESA 4NDZA 3TIFA 3LQRA 3A1UA 4LSGA 1II0A 1MRSA 2AD1A 2QM8A 2V6IA 3K0CA 1IN5A 1JPJA 2WZQA 3Q9LA 2QTVB 1II8A 3MWJA 1CEEA 3EX7C 4DJTA 3OE7D 2W58A 1S1CA 2R62A 1IXSB 1J90A 3P20A 1DS6A 3TUJC 4ZO4A 4B6EA 4URWR 3S1AB 1UKZA 2REOA 2UZIR 4OL0A 5EUQB 2JJ2A 3SHWA 4EPWA 1ZD9A 3CKLA 3AKCA 3O47A 1IN6A 1FFHA 2DFNA 2OILA 2V54A 4WZBE 3TE6A 1TQDA 4DB4A 1CRQA 1QHHB 2ZYWX 4M2LA 3FKSA 5GADl 2WWYA 2BDTA 1F48A 3A4NA 2XITA 1NN3A 4PQFA 5SZKB 4I99A 1VECA 3T12A 3T5GA 3KKMA 5FTLA 2Z5FA 1Q21A 1N25A 3K9HA 2IYXA 2XJ4A 2BM1A 3SDZA 3K70D 3KJIA 1K6MA 2F1JA 1W44A 4HEJA 1Z6TA 4O0MA 4V0ME 3UANA 4UJ3A 3VNVA 3FHOA 4LCBA 1JALA 2CHQA 3V4RA 1XCGB 1XWIA 5FTKA 2QI9C 4DUGA 1G3MA 1OJLA 1ZCBA 2HT6A 1S3GA 3FOZA 4GPTA 3H2YA 3PCRB 4TZ6A 1US8A 3VTKA 421PA 3AP2A 2RGAA 1R8SA 1T91A 4JLPA 4A8JB 1E2QA 4BRUA 1ZYUA 2HF8A 2PLFA 4KYUA 2V9PA 2CHGA 2LKDA 1SXJD 4G5QA 1IOZA 3K0EA 2CLDX 4Q1EA 4MA4A 1EFCA 1RRGA 1FQJA 5IDVA 1WBDA 4LHWA 4FMDB 5GVSA 3RABA 5H8WA 1G21E 4FCWA 4DDWA 1J2JA 4IXNA 4E03A 4JVLA 1OH7A 2VSFA 2WM9B 3BB1A 4XOIA 1E9CA 2ZI6A 1BYIA 2YKGA 3GJ3A 5C2JB 4QBGB 1GFIA 3GD7A 3WMGA 4CIDA 4DB2A 1J8YF 1VIAA 2IC5A 1W4RA 4PFSA 4HLQB 1OXVA 1UKYA 2ZI7A 2REBA 4HSEA 3Q72A 4N0EA 5P21A 4F92B 2ZSAA 1KI4A 1S9HA 3K9GA 3U3MA 4BZPA 1KDRA 1YRAA 2NQ2C 4I4LA 1E2LA 1WBBA 1Q57A 1AJEA 2OZEA 3ZS9A 2Z4SA 2VBCA 4KBGA 3K9NA 3RYTC 1TQ6A 3F5FA 4PHFA 3L0PA 3QEOA 5G3YA 1NG1A 1KHTA 3CWQA 1WF3A 1DEKA 4ON9A 3WMEA 1S2MA 3QUSA 1KI1A 1KI9A 3D31A 3QIAA 4EPXA 4LC0A 3BH7A 3EC1A 1TF7A 3TMKA 3THXA 2HLDD 3UKDA 2JAQA 1OYWA 2BMFA 4M9QA 4TTRA 5FPHA 3FDIA 4BFVA 4LHYA 4Q9LA 5A5GA 2B21A 4B71A 2NZJA 4DLWA 1RPZA 2Q3HA 5HZHA 1NF3A 5BN4A 4IOLA 4B35A 1E2HA 4RSGA 2JDID 4YQFA 1G3UA 1LF5A 1G8GA 3MLEA 1YZUA 2JEOA 1WCV1 2ZREA 5CJPA 4B75A 2XZOA 2Z43A 1ZNYA 2F6RA 3CNLA 4TQAA 1S0UA 1E94E 2ODNA 2RKOA 5KDOA 5EXXA 2OAP1 2WICA 2YWEA 2EU8A 1G41A 5KSZA 2GEDA 1E4YA 3LBHA 4US2R 2G9NA 3OEED 4ZCIA 3DO6A 2QSZA 2ZRDA 2VH5R 3FKQA 4C0QC 1CU1A 4Q1FA 4GMXA 4WOPA 2IF2A 1IY0A 4HAYA 3S1AA 5KDLA 3CRMA 1SKYB 4OK3A 3AKDA 1KZGB 3BORA 2RCNA 2EWWA 5DI3B 1UKVY 3KUDA 4TT3A 3IEVA 1NJFA 4R98A 1FQKA 3QXCA 4QGGA 1SVSA 2C78A 2ZS9A 4II7A 1U8ZA 4Q9KA 2CXXA 3TAUA 4TLCA 2IYQA 3KQUA 5KO2A 1XCPA 1RIFA 3IO3A 2ZJBA 2ZJ2A 4LV5B 4BFSA 1YZGA 4QHYA 1JQJC 2UVQA 1HV8A 2GJAA 4DLSA 2CL0X 1Z47A 3TW4A 2X19A 2ZXUA 3IBGA 1WB9A 1LW7A 4UNRA 4M4SA 3T35A 5JBQA 5JEDA 1G291 1W2HA 1W36B 4MGZR 5E3HA 5DYIA 1XD9A 2FEMA 1AS2A 1DAMA 1S8FA 4RKEA 121PA 1OKKA 5F3WB 3QI2A 2X2FA 1X8KA 1WRBA 1KSJA 3I72A 4A36A 1Z22A 1Z28A 5TXGA 2FE4A 5AUNB 2NMVA 4IDQA 1MO5A 1IJFA 3KX2A 3BFVA 2NOAA 3PR1A 3CPHA 4B73A 3H86A 3D3QA 2RGEA 1ZM2A 3KKQA 1E9DA 4BLOA 1E9BA 3UWKA 5E4FA 1IBRA 1WQ1R 4TL9A 4DDVA 4QHTA 2GCPA 2QGZA 5KNCA 1FW6A 1S4QA 3GLGE 4IOKA 4R9UC 2NO1A 4CDGA 5H70A 1E3MA 1W0JA 1P2UA 2JIZA 1GG2A 3L82B 3LRPA 1M34E 1QVAA 2PMKA 2ZAOA 4MGKR 5AR1A 2ECKA 4V03A 3HR7A 2OBNA 3QVVA 3TGPA 1OB2A 4TT3D 3R9XA 4LGMA 4CVNA 2DPXA 4X8MA 2XB2A 1DAIA 4UXHA 3ZVLA 3B85A 4URYR 1ZAKA 2QN6A 4IOJA 2ZM5A 2J41A 2E1RA 4AWXA 4ZCLA 1HEIA 2V1UA 1SHKA 5KHOC 1YJ5A 2EFEB 2EW1A 2JATA 2XNSA 4D26A 1GTVA 1NY5A 2OT3B 3DZ8A 3U6BA 1G7SA 2G1KA 1N6KA 1P3JA 2HLDA 3SE0A 1DAHA 3KB2A 3DOEA 2WSSA 2GJ9A 1LB1B 5L3VA 3GEEA 2AKYA 3RS3A 2QBYB 5BYJA 2C96A 4Q9IA 4BUJA 1Z0FA 4MKIA 2CMKA 2ZE6A 2DBYA 4B76A 1EWQA 3X1XA 2QAJA 1KZ7B 1UBEA 4TL8A 1KO1A 2QPTA 1L4YA 5TY0A 3DKVA 4KYIB 1SXJA 4DBLC 3CF2A 3D7MA 2RGXA 3KXKA 1NJGA 1YZNA 2O0KA 4U00A 1G5PA 4RZUA 4R2IA 3A37A 3AUYA 3FPAA 1MO3A 2F3TA 4PQRA 4M9SA 2XOKA 4OQXA 1E9EA 1XTIA 2AWOA 3PFIA 1XXHA 4PPGA 4V0LA 4DLRA 2IT1A 4GP6A 3F0TA 1YE8A 4MYCA 3QOFA 2W6ID 2A3RA 1KSHA 2AX4A 2PT5A 2R9VA 2QTFA 2ZR7A 5EXPA 3GLHE 2WIAA 3K70B 2O0JA 4CEJB 1CJUC 4DKXA 1W0KD 2XAUA 3B2EA 4Q4JB 4A82A 1E2DA 1CS4C 1GWNA 4DCTA 3MRSA 2GXUA 2CEAA 2VLIA 4A0RA 1ZM7A 4DSOA 3LNCA 2F9MA 1KDTA 4BGDA 5KNDA 3OIYA 1PVOA 3AH8A 1KI3A 3KQHA 4A0FA 4M8NE 2H57A 4HAUA 1R0XA 4IFBA 1GRQA 1MR3F 2OCYC 2AL7A 2ZVQX 4IRUB 4UNQA 2YNMA 3A58B 4LV8B 4C0KA 5J4VA 5JJLA 2W0SA 5EXTA 1RYFA 1E4VA 3TVDA 1ZC3A 3AVWA 1N6IA 2V4ZA 1RRPA 4LI0A 2V55B 821PA 2WKPA 2CBZA 2I1VB 1DG3A 3VR6A 3LXXA 3U7HB 1HA3A 1S1MA 4N1AA 5DSZA 1KK1A 1FUKA 3QF7A 521PA 1D2MA 5JFGA 1TADA 3GLFE 4KITB 1HY3A 3ZLJA 2B92A 2Q9AA 2WWXA 4FMCF 4R7ZA 3AVYA 2F3RA 3IIJA 1DO0A 2HJVA 4IVRA 4B6FA 4F4IA 4UNPA 2XNDD 5AUOB 3WRYC 2GZDA 1A2KC 2WOJA 3IIMA 4JLDA 3B78A 1YQTA 1EWRA 4ZKEA 4P4UA 5FPSA 1Z0IA 4F91B 1KO8A 1NRJB 4PO9A 2BKEA 1E9FA 4RD2A 3I62A 1P2TA 3Q7PA 3WXMA 1AA9A 4TSFA 4HZUB 4LJ8A 4RZXA 4ZIRA 1IQPA 4JT4A 5BXQC 2O8BB 4QBIA 3NBYC 1F2UB 5DE3A 4Q47A 4BWYA 4C2UA 1E32A 3KFVA 1JJ7A 1KDPA 2F43B 2C04A 2ZYVX 4I1OA 2DR3A 3HU3A 5TARA 1VIYA 4JVMA 3KKNA 2QP3A 2FFHA 3EZ9A 4OQFA 3BRWD 1J99A 3MUFA 1ZIOA 5J4LA 3TUIC 4EPVA 3K0AA 1VCIA 1NG9A 2RMKA 4RD4A 3B1VA 3OFNA 4HDOB 4PR0A 3WHLA 4ZKDA 4PSAA 2Z6VA 3W9YA 4ASUD 5TB5A 1BOFA 2CJWB 4HZIA 3O8BA 4B3FX 3ZZUA 5JZVA 4D0LB 1E6CA 1X86B 5EE3A 1Y63A 2ZUCA 4I81A 3QBVA 4JLBA 2EQBA 1JAHA 1M7HA 4QFMA 3RC3A 2QMUA 2I4IA 4OQLA 4L15A 3NDPA 3RRZA 1SVLA 3FWYA 4P0TA 1BIFA 1P9RA 4RZ2A 2IYUA 2CDNA 5HE9A 1E0KA 3DHWC 1ZC4A 1VPLA 3TVTA 1GNRA 3PITA 1N5IA 2ZJ5A 3QXHA 2HV8A 3IUYA 2EYUA 1GL7A 1WDTA 3AM1A 1TF5A 3C8UA 2CLCX 1F2TA 1DAKA 1JECA 3QKTA 2D7DA 2BBOA 1V5WA 1PV4A 4B3DA 3AF4A 5EE1A 4US1R 4YMTA 1KO5A 4Q7KA 4KXFB 1OFHA 2R44A 1CJTC 1M7BA 1T9HA 3DM5A 1KK0A 4BFWA 1JNYA 1N6OA 2WJJA 3IEUA 3ICEA 1M7GA 1XDBA 2E87A 2A2ZA 1GRNA 1D8TA 2ZRIA 1H8HD 1M6NA 1OPXA 4A6XA 2OXRA 5FUWA 1OSNA 4LK2A 1TF2A 4BLPA 2ZRKA 4BFYA 5DNYB 1XZQA 4OI4A 1NP6A 1BMFA 2IYSA 3QKSB 3FB4A 4ILEA 1Z8FA 3VR3A 1XTQA 2VPPA 3FFBA 2ZRFA 4C0AC 4XSHA 4GI7A 2AN9A 3CRW1 4IHQA 2Y8EA 1OFUX 4M9XA 2QQEA 2KB0A 1F3OA 4MDFA 1M2OB 2ONKA 3ZGXA 4PHTA 4B34A 4F7WA 2ATXA 4AYXA 3HJNA 2B7CA 1ZP6A 3EZ2A 1F60A 3KJHA 4JVNA 1OFIA 1DPFA 3ONWA 4HB3A 2NO6A 2XSZD 1B0UA 2WWHA 2DFTA 3RANA 2V7QD 3GEHA 4NMMA 1XTKA 2PEZA 4PSKA 3CM0A 2QMHA 4I1UA 4Z1MD 1ZCAA 3IPYA 1DBSA 2Z0MA 4Q19A 4MDEA 4UNNA 1XJ0A 2GBLA 1N2CE 3B82A 2Q6TA 1DARA 3B5JA 3IGFA 4S35A 5L8VA 2C9CA 1P4SA 1CF4A 1A4RA 5JECA 2J45A 2VP9A 4DCNA 4ZCMA 4AKGA 4QKQA 1HH4A 3RHFA 4IEIA 3MGCA 2RHMA 1QHNA 4J0QA 3LWNA 4WZ6A 1OF1A 4DVGA 2CE7A 1G3RA 1H8ED 2C9OA 3GFTA 4KAXA 3NBXX 3LQQA 3T1VA 3MWYW 1NN0A 4CEIB 1R0WA 2J5XA 4H9GA 4QJ4A 2PEYA 1Q20A 4P33A 4NYJR 4XSGA 4GL2A 2J1LA 2XJ9A 4O3MA 1SHZA 4MKFA 5DN6A 4QBHA 3HR8A 1T3LA 4TYNA 3PG5A 5KOYA 3OEEA 1G7CA 4AY2A 2OLKA 4X8OA 4MGYR 4DIDA 1U0HC 4RFVA 2F1IA 4UKDA 2Q3FA 8OHMA 3DZDA 3ADBA 2ZR0A 4JLKA 1R5NA 3SBEA 2BVNA 5JCZA 5TV2A 2D3WA 1UDWA 2QT1A 3ZD7A 1E2JA 1F2TB 2WIBA 2MSEB 5FUYA 4PO8A 3ADDA 4HAXA 2NIPA 2R6GA 2GVZC 4YXWD 2CNWD 3D6TB 1NIJA 3SNHA 2I1QA 4N3NA 2GRJA 3A4LA 2CNWA 2FPKA 1EX7A 3EASA 1XMJA 2GAAA 2XZLA 2AK2A 4JLMA 5D3MA 1IN7A 3RS5A 2ZAMA 5JI2E 4DT1A 1VDZA 4LJ4A 1E69A 2JLSA 2CK3A 1W4AA 2ZANA 1VTKA 5UKDA 2A5DA 1Z07A 1Z2AA 4Q1BA 3C41J 1UDXA 4JL6A 1R0YA 4ZDWA 1TU4A 2QRZA 5DI3A 5TMPA 3HDTA 1CIPA 3NVAA 1E2GA 1NVWQ 4Q1DA 4OHVA 4S2EA 4RY2A 1YZTA 2JASA 4GFDA 2W83A 5AUPB 2YHSA 4UQOA 4OHWA 1II9A 4R71A 3OIWA 4AI6A 4M1YA 1PZNA 3SFVA 2VHTA 1DE0A 4C0HA 1KJYA 3I4LA 4XH9B 3MSXA 4WAUA 2BIFA 1MT0A 5FI0B 5AJVB 5LD2C 4W9MC 1DO2A 5FOWA 2ZSEA 2J7PD 4G5SA 3THOA 1P62B 2K5UA 3MWKA 1GOTA 3SU8A 5CK5A 1KTVA 2FSFA 3RS7A 4DXAA 1H65A 3SJCA 2A9KA 2H17A 1RC8A 5FTMA 1N6PA 1SXJC 4HUQA 1COWA 2GWHA 3KB1A 4HLUC 1JR3E 4HUQB 1R8QA 2ZSBA 4PC6A 3KQNA 3C5HA 4A6PA 4TQUS 2QTHA 1HURA 3BE4A 3CBQA 4LHVA 3SJZA 3FMOB 3HU2A 3CZQA 5EP2A 1I4LD 3RAPR 4JLNA 3W34A 2FX3A 1JXOA 3QENA 3TSOA 4OJQA 4MUBA 4PAMA 4AYTA 3B9QA 1EGAA 1G17A 3I61A 4FMDF 3VHXA 1I4DD 3M4YA 1L8QA 4O2LA 1OKKD 1E1RD 5CJ2A 5EE9A 3ZS8A 5ELXA 1RE0A 4LC1A 2WMNB 4RJLA 1NMXA 3R8CA 4DEXA 5B58C 4AIIA 4TMKA 1ODFA 3QPVA 3SJBA 2IK8A 2IS1A 4HATA 2XGJA 2FSIA 3WYGA 5IHPA 5F9HA 1CR4A 1JQLB 4I1VA 4PC3A 1RRCA 1NVVQ 2QT0A 1SZPA 3NC1C 5DHAA 2WJGA 4URVR 4TMWA 4QNRA 3NHBA 2GXQA 3GLGB 4UJ5A 4DLXA 3FGNA 4Q5IA 3GLFA 4WXPA 2JJ8A 1XU4A 2ERYA 5J4HA 4M9ZA 1KI8A 4TLEA 2JLQA 1AM4D 4BZXA 1D2EA 1Q3HA 2W6JA 4W5HA 4KFSA 4FN5A 3KQLA 3CF6R 3E1SA 3VX4A 4P31A 3CR7A 4A1FA 1ZU5A 4HYYA 2GCOA 4KFUA 4F38A 3UPUA 3FYHA 3U7GA 4Q4AB 2LKCA 4C0LA 3I32A 2FG5A 3B1XA 4JZKA 3WBJA 4PZZA 1GSIA 3AF2A 2C98A 4Q1CA 1GUAA 2AR7A 3KJEA 2OCAA 2HYDA 4V02A 1ZD8A 4EFLA 2P6UA 5JS8A 3TKLA 5KPJA 3J81k 4RZ3A 4B3XA 1XEWY 3AKEA 1KO4A 4F4CA 2ZU6A 1OV4A 2HJGA 5F9FA 2A5JA 4KO8A 3U4QB 1CR2A 3QXXA 1VHTA 1COWD 4U7DA 4GMDA 4AKIA 2IXFA 3TSWA 2QAGC 2AKAB 1YZQA 3SN6A 1OHHA 4CRWB 3OFND 4EJSA 3H1TA 2P2LA 1W36C 1TL7C 3M1IA 1SVWA 1QVRA 5FOXA 4AKEA 4MYHA 2O5VA 1JEEA 1WP9A 3A1VA 4U5XA 1G64A 3EPJA 1NLYA 4Q4HA 1RJ9A 4FINA 5AJXA 3U7FB 1E2NA 4Z8XA 4O25A 4P32A 2DB3A 3R20A 1AGRA 1NN1A 4Z8YA 5CIQA 5FBWB 4B32A 2G88A 2XEXA 1PLJA 3BH0A 1UAAA 1RVDA 4AURA 3QG5A 3AB3A 2C5LA 1AZSC 3KTAB 3NTUA 2AWNA 4NYIQ 1Q3TA 4JYCA 1SXJE 1UF9A 2IEZA 4MYTA 2JLXA 1G7TA 1FZQA 3W6NA 4TLBA 5DLQC 4HAWA 1OXXK 1FX0A 2E9SA 2RHDA 5E7MA 3T15A 5AK0A 4F93B 1E79A 4QNMA 4DCVA 4TLDA 4Y0VA 3AGQA 2UKDA 2WSMA 2D2EA 4D0GA 5KSOA 3EW9A 2X2EA 2Q9BA 4GNKA 2FJUA 4KSBA 2ZYTX 3W8RA 3QEJA 4XWKA 3B7GA 1N6RA 4HI0E 5DIFA 4FWTA 3K0SA 3L2OB 2QEQA 2BC9A 2XZPA 5DGXA 2V8OA 4B3CA 4G5GA 5J5CA 2BBTA 1YR7A 4A0GA 3DDCA 1OH5A 2YVUA 2IHBA 1SVIA 2ZU0C 4L4UA 4V0MA 2H16A 3PEWA 3V9PA 2O8FA 3QXSA 4HDCA 4EFNA 4M1SA 3Q5DA 2RGNA 3GP8A 3A4MA 3T5DA 3ZQJA 2GBLC 3U2QA 1U0LA 2WHXA 1VYTA 2QP4A 2ZUBA 5KU1A 2QE7D 1E9SA 3N2EA 3VU9A 1E79D 3UG7A 1OXSC 2ZS8A 1E0JA 4JYBA 2GILA 1KYIA 3C5CA 3NG1A 3DPUA 2GF0A 3ETLA 4DUGD 4JBYA 4KLZA 5ANRB 1A1VA 2I3BA 2YOGA 4ZIRB 4D25A 4TWZA 1U98A 2IYTA 2ODEA 2PX0A 5LB4A 3K70C 2WWWA 3QSYA 1G6HA 1GNQA 3LX8A 1EXMA 4RD6A 1Z6YA 3RRMA 1KSFX 4KBFA 2H18A 5FBVB 4NZYA 4IOMA 3RRYA 3SEAA 1XTRA 3WRXC 2NTYC 2BV3A 1KSGA 1YZKA 2QMEA 1HT2E 4CEIA 4DLUA 3GLIA 1G19A 2J0VA 1NKSA 1XXHE 2OV2A 4C0SA 4R2HA 1P61B 2C77A 4HUTA 4DHEA 1RJ9B 2GZHA 5DO9A 2LCFA 4QBFA 4PXAA 3MCAA 4G01B 1CLUA 3QF4A 1BYUA 3VKWA 4JS0A 3BD9A 2W2VA 4M53A 1LS1A 3LVRE 4A2QA 1X1SA 5EQTA 1FMLA 1TNDA 5IK2D 3HWSA 3CX7A 1UADA 3EZFA 3FMIA 4EAQA 3R9IA 1XBTA 4NU0A 1T6NA 1U99A 2YWGA 5EZ6B 4A0HA 1Z08A 4KVGA 4URXR 4DSUA 2P0EA 2DFLA 2KSQA 1QHXA 3CNNA 1TMKA 3I1FA 4JLVA 3EZ6A 3T34A 3R7WA 5C18A 2G0NA 3L8ZA 4LY6A 1OFTA 3U3KA 2QBYA 5JSZB 4IDNA 1PJRA 3MMPA 1IAQA 5E7JA 3SHFA 5CK4A 4TTPA 3THWB 2OBLA 2DWPA 2J87A 1XD2A 1Z29A 2WSSD 3CRQA 2H5EA 1GNPA 2ZS7A 3E5HA 3PIRA 5L3RA 4WXRA 1LS6A 4MRNA 1W4BA 1VYVA 4RFSA 5FOUA 3ZZTA 3A6PC 2RGCA 2C95A 5K8IA 3GJ0A 1IJEA 2J9RA 1LY1A 1DOAA 4NCIA 2QM7A 2FGJA 1IXRC 3DOFA 3TSZA 1CRPA 2RH5A 1JJVA 1Z6GA 2H7VA 721PA 4B2PA 1IN8A 3X1WA 1GVNB 4JLOA 2QUZA 3RS0A 4A8JC 4M0LA 3F3YA 1SXJB 5DISB 3SQXA 2GNOA 1OHHD 3SBDA 3CX6A 4FMCB 1NN5A 1XCMA 1AKYA 1ZVQA 3K8YA 3TJZA 1I2DA 5J47A 2GAOA 3NH6A 2X1VA 1VCMA 1N0WA 1TQ4A 2G77B 5FBRB 5FOVA 4LJ5A 3DVLA 3BFXA 3EIHA 2DYKA 3H84A 1QHIA 4TLAA 4NCKA 3GJ5A 3I5YA 1N3BA 1E2EA 2ZEJA 1BH2A 2B8TA 1U9IA 3WP0A 4ARZA 5IRCD 5F98A 4M1MA 4BLRA 4D4JA 4G5OA 4TMZA 5K8UA 4FD2A 2ZRAA 4K81B 3V4FA 1QHHA 1ZNWA 1R7RA 1E9AA 5EE0A 2IXGA 1LFDB 4OQMA 2JJ1D 5BN5A 3SOPA 4IW3B 1XD8A 2YC2C 3O8DA 2BJVA 1CKEA 2ZROA 4LBWA 5L3QA 4NP6A 1T3HA 5EUMA 4AC9A 5AUQA 4QOSA 4TMTA 3GEIA 3T61A 2QU8A 1BKDR 2AXPA 2NO0A 2ZI5A 3CZPA 2VP5A 4F4JA 4BPBA 2JJ2D 5JHGB 3CRRA 3PEUA 1DG1G 1AS0A 3U3RA 2VEDA 1GZSA 1N0VC 1P5ZB 3W3ZB 3A36A 5C4MA 1F6BA 2PZEA 3BERA 3BAFA 5DH9A 4DDUA 5L3SA 1NBME 4GT1A 2BMEA 3VQTA 2PMDA 1OB5A 4E07A 3HU1A 5HCIA 4CF7A 1D9ZA 1JBKA 1E2IA 1E0SA 1L7VC 2VF8A 1OIXA 4LRWA 1VHLA 2JGNA 3KJGA 4HB4A 3K0AB 1X8LA 4EQ6B 2IYLD 5IF9A 5JRJA 2XB4A 2ZRNA 1XMIA 1ZW6A 4HLUA 1VMAA 3X1DA 3MD0A 1EK0A 1T5LA 4OI0A 1OW3B 2R6CA 1AS3A 4LBVA 4BEJA 2OBMA 2B8WA 4Q7LA 2OCBA 2JLWA 3AVQA 1RFLA 1DELA 1QRAA 3U4QA 2NGRA 2FFAA 5DHFA 4LOAA 1R2QA 3TW8B 4LX0A 2GESA 4GBMA 1M1YE 3FHCB 3SZRA 2JCSA 1HTWA 3BGWA 2P5SA 3NBZC 4NCJA 4Q01A 3CONA 4IKEA 1SKYE 2GA8A 2JLRA 3K09A 3HPRA 5GJWC 1FTNA 2FSHA 5LB2A 2UZ3A 2ZSDA 1JI0A 2OM2A 2LWIA 3B1YA 4K46A 3THXB 4BECA 5JLJA 2VF7A 2WWIA 5CB8A 1G8PA 1ZM4A 4B2LA 4TMVA 3AF0A 1C9KA 5FOTA 2BBSA 3I92A 2JDIA 3RRNA 3C15C 2FFQA 5EJEA 5JRZA 5DN6D 1ZJ6A 2RGGA 2VHQA 3ZVMA 5FBLB 1DTSA 1QBKC 2YINC 3EA5A 1NKTA 4DWJA 4YONB 3ASYA 4Q00A 4MRSA 2XXAA 3BIFA 4EPRA 3PEVA 3EPLA 2TMKA 3EWSA 1GKUB 3LBNA 5CLQA 4Q7MB 3OIVA 2GXSA 4TN1A 2IS6A 2H8KA 5CYPA 4NYJQ 4V0KA 3B9PA 4C30A 3IHWA 2C2HA 3SYLA 4UXJA 4EIWA 3CIOA 1YHNA 1M74A 1VG8A 3B1WA 2ZRGA 5CB6A 4M1TA 2XX3A 3PENA 4NYMQ 4ZDKA 3AP1A 2IS2A 2BWJA 3QJYA 3PEYA 3T1OA 1OXUA 1YRBA 2W6JD 2Q21A 2IL1A 3EPHA 4TYPA 1OE0A 1OLOA 2ZR9A 4KU4A 1TUEA 1NVVR 2DHRA 2A5YB 1MH1A 4BASA 2KI5A 1IY1A 4FWIB 1R5OA 5KTYA 3RWOA 3ZJYA 4BLTA 3VKGA 4YLGA 3E2IA 5C46F 4JBWA 1G4AE 4MH0R 2IYZA 3TBKA 2GEUA 1E0AA 4Q21A 1GAJA 1W46A 4RKFA 1Z0DA 2MSCB 4DDTA 1K8RA 3V00A 3GLFB 3CH5A 2QMOA 3AVPA 1KMHB 5KPDA 3LAWA 4HAZA 1GITA 3IQWA 2GF9A 1H8EA 4B48A 1EESA 3KXIA 2FN4A 1JXMA 4NCNA 3PUYA 4MRRA 3QKUA 4MGIR 1ZM3A 1W0KA 4JL5A 1RW4A 3NWJA 1TUIA 5TVKA 4B44A 4BFXA 1GIAA 4NE2A 3NDBB 3AF3A 3LXRA 1VG0B 3ECCA 3FE2A 4DLZA 3K0CC 1Z5ZA 1UBFA 1U8YA 1ZUNB 4UNSA 3P26A 4DCSA 3UATA 4NTZA 4RD1A 2O8FB 4BFZA 2OSBA 4O2RA 1JR3D 2YWHA 3GLHB 3CLVA 3TNFA 1FUUA 4TTQA 1MV5A 1QG4A 1T0JB 5A0FA 4FI3C 2ZI4A 3AVVA 2RB4A 4OBEA 4CZ2A 2VO1A 4P4TA 1PLLA 2F43A 4QJ5A 2P67A 3WYFA 3CX8A 3QVUA 3EG5A 1GL6A 1U2RA 1B23P 2YJTD 1ZD1A 1X1RA 3EAQA 2G6BA 2O8DA 4XWOA 1IONA 1G16A 4DC9A 2FNAA 2NO9A 1H8HA 3AGPA 1SVMA 3TK1A 4ZPXA 3MFYA 5F2EA 1EX6A 4BFUA 4D4KA 4C7OA 3VFDA 2O8DB 2QAGA 1Q1BA 3RS2A 1OYYA 4JMPA 2D4HA 4YDHB 4LWZA 3VR4A 2BHRA 1N0UA 5FR1A 1ZM9A 4NYIR 1ZBDA 1L2TA 3RLFA 3HPQA 1ZUIA 4RCZA 4QXAA 1TX4B 2BBWA 4TYYA 2DCUA 4V0NA 3UG6A 4DZZA 4OHYA 4C9BA 3TR0A 3W6PA 1KY3A 4IVPA 2VL7A 2ZE8A 3QXJA 4KI0A 4N0DA 1E1QD 3OAAA 1Z3IX 3Q3JB 1OIVA 2EYQA 2QENA 4PPNA 2ASEA 4PX9A 1KAOA 1UPTA 4B43A 1QZXA 4CT4B 5IT5A 5SZHB 1YZLA 4DT1B 3RSLA 1D6JA 3QKSA 1CR1A 1N5JA 3QQ5A 1KI2A 5K8TA 3GJXC 2IYWA 2W2TA 1MO4A 4LZZA 5B30A 4QM6A 2FZLA 5CDFA 4X8HA 2WAYA 2AXNA 2VHUA 4Y0AA 4Z54A 2PZFA 2ZITA 3UMRA 4RD3A 5AWFC 1KKLA 1D2NA 5KUTA 3CW2A 2QL6A 5LBIA 1KKMA 3C4JA 4P4SA 4ACBA 5GJBA 4AG6A 1W1WA 4URUR 2X8AA 3DKPA 3MG9A 1JEDA 2GKSA 4WIAA 2OO7A 4RD0A 3SJAA 3ZYCA 2O8CA 2O52A 5CIWA 2V6JA 3GLIB 2Z4RA 3U61B 4G3XA 2N1BA 3AVTA 1TPZA 2N46A 1CJKC 1WMSA 2W6IA 1P72A 2OHFA 3EXAA 2ZYUX 3ZDQA 3WMFA 3ZH9B 2ZVPX 5SZJA 3RWMB 1KI7A 4E22A 2VHCA 3O8CA 3DEFA 4IDHA 4JJKA 3IILA 2FV8A 4KLNA 5JHHB 2QE7A 3IPXA 3FKSD 3LLMA 3KXLA 4PAQA 4EPTA 4K8OA 1XJQA 4ZV4A 5FI1B 1W36D 4G1UC 4PHHA 2VP6A 4GOKA 1N6LA 4PAOA 4B33A 5FR2A 5BQ5A 2J7PA 1XPRA 3ADCA 3M6AA 4FMBB 3QE0A 2KBEA 4JL8A 1E96A 4PZYA 1NLFA 3VU9B 2ZJAA 2W0MA 4B3GA 1W5TA 3HYTA 1NVUQ 3B13B 5B2ZA 4TQ9A 1W49A 1E99A 3SQWA 3NC0C 3NIBA 3P27A 4OI2A 4ZI3A 1W47A 3G82C 3UIEA 1CJMA 2AD5A 3SI7A 1A2BA 3F8TA 2C8VA 3I73A 3U6KA 3O8RA 2VSOA 3SR0A 1HQYE 2DWOA 1FMJA 3CUEF 4B3BA 1LNZA 4KFRA 2QPAA 1FTSA 4OHXA 2A5GA 1GILA 4BLQA 4QGFA 2YOFA 5FPKA 2VA8A 4LYFA 1TAGA 4MKHA 5HTKA 2RGNC 5C4GB 2J3EA 4LDJA 4KV9A 2V1XA 3JVUA 4IVQA 2G3YA 4HLCA 1R4AA 4QM7A 3EA0A 4JT2A 1BO6A 1LV7A 1GDDA 3LW7A 4C3ZA 1YU9A 4IDOA 2IBMA 1XZPA 3CO5A 4ASUA 4C4PA 2BJWA 4D6PA 4GRAA 2OG2A 1Q1EA 5CYOA 5G3ZA 2ZJZA 4LYAA 4D80A 2ZRMA 1NIPA 3AEZA 5HKKA 4XTRA 2XXAB 3BH6A 3VKHA 2IW3A 3PQCA 2F55A 4AK9A 3Q5EA 4NBSA 1P6XA 4PC2A 2DY1A 3WHKA 5JWHA 2EFHB 5G41A 3QY0A 3QF4B 5AJWA 1T8TA 1YR9A 4EQ6A 4GZMA 5A4JA 1A7JA 5HE8A 3TAHA 2ZJOA 1KMQA 1MO6A 2J46A 4M22A 1KJZA 1MKYA 1T5IA 2F7SA 1HYQA 2ODWA 3W90A 2B7BA 2WWGA 3NH9A 5C1BA 3EIEA 1NNEA 3T1QA 3D8BA 4EKDA 2CL6X 3EPKA 1U90A 4LPKA 1P2SA 1EFTA 4PO1A 4GDFA 1XRJA 4KODA 4Q1AA 3PXGA 2VP4A 4ARZB 3L43A 2QAGB 3QG1A 1KNXA 3UMFA 1XXHB 2HYIC 2ORWA 2WBLC 1VG9B 4AG5A 2CCGA 4BFTA 2OE2A 3X1YA 4LPSA 2FFBA 2QZ4A 1W48A 1CXZA 1FNNA 3BB3A 2D06A 1CR0A 1VCOA 2OLJA 4C0BA 3G5UA 4XVUA 2ZETA 2J7KA 1TQ2A 2VRWA 2ERXA 4V0OA 4W5JA 2HF9A 4RVCA 4Q9JA 2ZQ5A 4MRVA 5GVRA 1G3QA 1W0JD 1T0HB 2ZPTX 3A1SA 3BXZA 1X8JA 4OK6A 2ORVA 3WP1B 2B6HA 4QGHA 3LD9A 1XPUA 4CW7A 5KSPA 4EDHA 3IKJA 4TYQA 1EFHA 2BCGY 4EJSC 1Z0AA 1U81A 1XMVA 2AFIE 1U0JA 4XIGS 1OXTA 1G20E 4HDQB 3W6OA 2V7QA 2QSYA 5FUXA 2WJIA 4GSYA 3P1JA 4G5RA 3CRVA 3ZQ6A 4Q18A 3WNBA 1EG7A 1FP7A 2QA5A 1X6VA 1XEXB 3U44B 1UFQA 4C2TA 3W5JA 3LY5A 1DVRA 4L9SA 1W2GA 3EZ7A 4NL4H 2IX3A 1TU3A 4JLJA 4WBSA 5EZ5A 4Q66C 1ZRHA 2NPIA 3MWLA 4QHSA 3IO5A 1AZTA 4QL3A 2G0TA 2OAQ1 4POAA 4BQSA 2HXYA 5G53C 1S9DA 3MAAC 2OFXA 4M1KA 1KMHA 4Q02A 1N5LA 4MYUA 2BOVA 1P7CA 1Q1ZA 1W5SA 1ANKA 2CE2X 3LO5A 2J0UA 1G8HA 4LYJA 1N6HA 4BRWA 5M04A 3U60B 1CP2A 3IBYA 1P2VA 1F5NA 2IUUA 4TYWA 1D9XA 3GJ8A 5K8LA 2XTNA 1XTJA 4B74A 4NHOA 4XWAA 4QG7A 4GZLA 2FPMA 1TTTA 1G8FA 4B2IA 2NZ8A 3ND8A 4RFSB 2GTPA 2P6NA 1I2MA 3DMNA 1EFRA 2FOLA 5SZIA 4NKRA 1Z0KA 2PBRA 4LHXA 1MABA 4NYMR 4ZDJA 2IA5A 3B1ZA 3EWAA 4Q4HB 2IWHA 4A8JA 3G0HA 3X1ZA 1Z06A 2WPDD 3N2IA 1MABB 4H1VA 3TRFA 4CYMA 1K5DA 1QF9A 1SULA 1XF9A 3N5CA 5DYGA 1PLKA 1C4OA 4JBXA 1UJ2A 1SVKA 2A5FA 2BKUA 3VR5A 2BMJA 1Z6XA 2X77A 3RDPA 2GVDC 1HQCA 1T8UA 1OIWA 2GJKA 1E2KA 1U9IC 1GKIA 5BN3A 1FOEB 4PHGA 2WWFA 2W2XA 3EIQA 2WKQA 3DL0A 1RKBA 1Q12A 5CITA 1YVDA 2ZIAA 3IDQA 1Z2CA 5FOSA 4KVAA 3QPWA 3ZD6A 4MKGA 1N6NA 1UBGA 5B64A 4CEJA 5AJYA 2WPDA 2HEIA 2PT7A 1SGWA 5EXSA 4YXWA 4NPHA 3THWA 4IXMA 2QQ0A 2QRNA 3ZIAD 5HR5A 4OHZA 2Q0HA 3E70C 2YYZA 3Q7QA 2VIIA 1AQUA 2ZRBA 3WYAA 1JB1A 1NVXQ 4IDPA 1KY2A 2GJSA 3CPEA 4PQYA 2WOOA 3LVQE 4A9AA 1NY6A 2PX3A 2WVJA 2AK3A 1R5BA 3NKVA 3UK6A 4AKHA 4LJ6A 3KKPA 4PPFA 3TUZC 1KK3A 3FTQA 2ZJ8A 3BOSA 3SS8A 3HYRA 4MRPA 3KQKA 2ODBA 2D2FA 2R6AA 1FL9A 3TH5A 5FL7A 2L0XA 3OEHD 3THYA 3K09C 4LHZA 1AKEA 2MMGA 2F1HA 4JKIA 1AN0A 1E98A 4KFTA 2N42A 2QORA 4D2IA 1Q1QA 3THYB 1CTQA 4DLYA 4PANA 1ZIPA 1CJVC 3W8NA 3QBTA 4PZLA 2CVHA 2XNDA 5FH9A 5JWOA 3GQBA 1XTSA 2QP9X 1GRRA 3AQ4A 4JSYA 4LYHA 3FMFA 4GOJA 4Q4LA 4Z1MA 2IWRA 5L3QB 5DI9A 2R65A 2VP2A 2XOKD 2AHOA 3L8YA 3VHLB 1ZNZA 1CBUA 3ADKA 1G18A 4M1OA 5B57C 3FHTA 3OEHA 5J4YA 221PA 5H68A 4LUCA 3CWZA 1G5TA 1SKQA 1YR6A 3IQXA 2ANBA 2IXEA 2FEOA 3BFKA 3I3SR 3TLXA 4I1SA 1M8PA 3H4MA 4LJYA 5E7IA 3VX3A 4DCUA 1TEXA 2IYYA 2VP0A 4A4DA 2FGKA 2JJ1A 1IM2A 5D3MB 5EP3A 5L3SB 1UKEA 3K1JA 2GCNA 5KYKA 3PUWA 4TMXA 4KCGA 4DRZA 1AQYA 1LVGA 2XSZA 4DSNA 4DEYA 5BWMA 2PCJA 3JVVA 1IXZA 2Q9CA 2CVFA 3LV8A 4L9WA 2GDJA 4XJXA 2HDNB 1I4TD 1R6BX 2ZTSA 3P4YA 4Q48A 5FBQB 3WBKA 2OCPA 1QG2A 1AIPA 1XEFA 5FPTA 3BBPA 3K0FB 3N70A 1VG1A 2PLRA 2RAPA 2C99A 1IN4A 2ZRHA 3KL4A 1FP6A 4Q4AA 3CPJB 3UWOA 1XPOA 3NHAA 3RC8A 2YV5A 1HT1E 2BEKA 2YWFA 3L0OA 1KK2A 2ZE5A 4P3YA 4IJMA 2GJ8A 3OAAD 2D7CA 2PH1A 3P4XA 3B6EA 2GEVA 2R6DA 3LFUA 4LJ7A 3BK7A 1G5RA 4ACAA 5HPYB 5JS7A 4EFMA 1XP8A 2Z83A 1X3SA 1MOZA 3ZIAA 4OYHA 3GMTA 4C0JA 4GP7A 4JIMA 1G8YA 3OE7A 3ZVNA 1RZ3A 1GKYA 1WE2A 2IHYA 3DMDA 4LV6A 5JSZA 2KBFA 2P3SA 1SVOA 3K9LA 2KJQA 4QGAA 5JMTA 1KOFA 3VR1A 3U3JA 2R6FA 2WJYA 3LLUA 4Q03A 3QPUA 4L8GA 2KWIA 4Q4JA 4ZDIA 3KDSE 2WAXA 4HAVA 3A1WA 5KDDA 1QHGA 1UM8A 1U94A 3L0IB 2XTZA 4A92A 1G4UR 1NLZA 2D74A 3T1TA 2O8CB 4HB0A 4U02A 5EE5B 2CLSA 1S96A 1NMYA 1E9RA 1A82A 4Q7JB 1DAFA 2EFCB 3U5ZB 2HCJB 3MJHA 3AKYA 4DLTA 2AFHE 2FH5B 4JVSB 2Q3MA 2ZRCA 4ITRC 4EJSB 2EVWX 3T06B 3BC1A 1P75A 2WJVA 4LJAA 3C7KA 1LF0A 1Z83A 2CHVA 3KZ1E 3SYKA 2KE5A 1II8B 1YKSA 4FIDA 5AJZA 4DIEA 3GLGA 2JLYA 1XEWX 2C03A 4Q9HA 4A2WA 1KNQA 3EC2A 1P9WA 3LDAA 4Z51A 2JA1A 4DLVA 3JZAA
chains in the Genus database with same CATH superfamily
3K15A 1YB2A 1NBMD 3ORFA 1A9QA 5B37A 2PUFA 2ABWA 3BMQB 2BSXA 4NK4A 4TYMA 1NBWB 4OK5A 2WQ7A 1L8XA 4RTKA 1WUHS 1JR6A 2BMVA 3E84A 3VR6H 3Q15C 1B8OA 1C9DB 4N7JA 3BS4A 1CYDA 3GU3A 5EJAA 5BSKA 5LQAA 3ETHA 4OQNA 1QDLB 5CB0A 1IBCA 3VHXB 4PLCA 1YS1X 1DFGA 3BULA 4W7SA 1BD3A 1US8B 4CIVA 1W4CA 4MTLA 5D01A 4E5UA 2HK6A 5L4NA 2HT1A 1CYEA 1XFDA 3UENA 2HWUA 3CWCA 1TK2A 4CFZA 3CLSC 3SC3A 3RNLA 3DE5X 5BW6B 1QYRA 4EEXA 1M54A 3PPVA 4ZXPA 1SVNA 1T3SA 3PX3A 1KFBB 5LWHA 1AX9A 3W5DA 3MHTA 4KPYA 3O90A 2FUG6 1WSWA 2XE4A 1PQUA 4YREA 3WQQA 1C1YA 1ZICA 1P9NA 2FK7A 4TM8A 2EQ5A 5T4FA 3HV0A 1EFUA 1K8ZB 3P71T 1E6KA 5G2OA 1ZINA 3OHMA 4YYZA 1QFYA 4LBYA 1ZU4A 4AW9A 1NMZA 2C2XA 3Q1KA 2F1RA 5EWLA 1T24A 3GDOA 3A7DA 1Q22A 4LRXA 1CUEA 3D3WB 2GAJA 3QP9A 4ND1A 1YRHA 1CWUA 3GLKA 4MKXA 4OM8A 4ENWA 2WINI 3CSSA 4WA7A 2P91A 2ZPUA 1EIZA 4JJZA 1M2FA 4RCYA 3OEWA 3UWDA 2AFHA 3MUOA 4B4DA 3F6YA 4C88A 4EATA 4EG1A 2HRBA 4B84A 1QX3A 2AFHB 4F5WA 1YQEA 2A67A 2L18A 3SYNA 1U04A 3OQIB 2O8BA 3M9LA 1EBFA 1QTIA 1ZMXA 2O2DA 4Y7CA 3S2SA 4D81A 5CDFE 5JRDS 1NSFA 4HFMA 1EK5A 5AI0A 4WLNA 2CW5A 2CFRA 5CH8A 3AVXA 1Y80A 1GLVA 1KJWA 1XCJA 2MMCA 1MJ5A 2PZGA 1R10A 1ENOA 3DVRX 3KCQA 3L7OA 3R3WA 4GYKA 4LYGA 5C34B 3SC4A 3V7NA 4OI1A 1Q2UA 2PYDA 5CJJA 1P3DA 2XNKA 3RLIA 3GPLA 4UAUA 4IJVA 1QHYA 3LZ6A 3G9QA 4IH9A 2GPYA 4GSLA 1PFYA 4IAOA 4UQLA 5KOHA 2UXBB 4GG1A 2I3ZA 1YU6A 4NMHA 4JZYA 4PSVA 1E59A 2XB8A 1DRKA 4H6WA 4GWKA 1ESMA 1G6OA 2XF8A 4HLDA 4KVFA 3UH0A 4ZJYA 5IVPA 1JIJA 5KNBA 4OKSA 1AV6A 4G26A 4GP9A 3GEDA 1ECFA 5EJIA 5EA2A 2CLHB 2DFKB 1MRNA 4R3UC 4ESVA 3H6KA 1XJCA 2VQSA 4IV5A 5JJKA 3JZMA 2FA9A 3P9QA 3QNUA 3QX9A 3U0VA 4J1NA 3AW9A 3S44A 2ZSFA 4JNCA 4EPYA 5D3QA 1KIMA 4QJ3A 4AZ3A 5AVTA 3RBVA 1Q1NA 1DINA 3A9WA 5HDQA 2QSJA 4EJ2A 4H60A 4CL0A 2IUTA 3ZQ4A 4EGCB 1A4IA 4YYEA 4HT3B 1NDQA 1ICIA 5TPZA 4YS6A 1Y3AA 1R00A 1QPBA 1O4WA 3KZKA 4HNUA 4NH4A 5DMHA 1EP1B 1ZAYA 1D7OA 4UUAA 4EUFA 1E3TA 1PUJA 1Q2XA 4JI0B 4BMXA 1Q7RA 4BV8A 1Q0ZA 3ROKA 4KO4S 1IPHA 3LBIA 1KRHA 3S2UA 7MHTA 1QBGA 3OF5A 5IKMA 3VDQA 2O7QA 2A7XA 1E2FA 3NOQA 4CV2A 2CKDA 1NAIA 3HUEA 1QFMA 1F20A 4WXMA 2GSWA 3LA6A 4GC9A 1SKUA 2C92A 4CT5A 5AM3A 5CYGA 4WX2B 1AK2A 3NAZA 4RLFA 2X41A 3NALA 1SUWA 1Z35A 1YI8A 1AN9A 2FI1A 3K53A 2BCJQ 4JN6B 2O2CA 1W7AA 1C7JA 4JEMA 4KLAA 1NW3A 1RRFA 3KUXA 1GL9B 1N78A 2B34A 1C7ZA 1Q0UA 1UEJA 2HO4A 1PJCA 2PJZA 4BE7B 1DI0A 5MDHA 3KKOA 3KLBA 2BI4A 4HGYA 4N5IX 2VSNA 4DLBA 5A5FA 2W5UA 4QXQA 3ANSA 3GFOA 2CNOA 1QVVA 3IAFA 5P8WA 2FPLA 4D3YA 4G56A 5CCEA 4BVKA 2NO7A 1CJCA 2HXSA 4L75A 2IE0A 3RV4A 1ZNXA 3GHHA 2ZWOA 4FXOA 1YR8A 3HE3A 3BL8A 4F11A 4V24A 3GJ6A 1DCKA 1UT5A 1YE5A 1E8DA 1SU7A 3PQEA 3VPXA 4NEHB 3WLJA 4ZI2A 2P0YA 2LGJA 1U4NA 2HCBA 2VJQA 3BDAA 3IHLA 3K4PA 5B6PA 1SQ5A 1U2DA 3A27A 1I6KA 2BKLA 2F9LA 1BS2A 4BB9A 1K5HA 3AW8A 3L77A 1KZ1A 4R8SA 5E9QA 5F2KA 3ZCRA 4EY5A 3DKKA 2G07A 1MZPA 2C4TA 1JVSA 5HCNA 3KP1A 4H1WA 3BB4A 3GP3A 4RTNA 2ORIA 5CLJA 2V74B 1R6AA 3PVSA 1UJBA 1OFUA 3LIPA 4YP7A 3O4RA 4P3NA 3BRCA 4PM4A 3MWDA 3FZEA 4KWCA 1X92A 2Q5EA 2EP7A 5KC8A 3Q41A 3LC1O 1AE1A 1ODTC 5K9ZA 2UUCB 4MVJF 1OH6A 1QIFA 5HVNA 4FXPA 3T5BA 5K4AA 3DEKA 3ZU6A 4G23A 2EAUA 1JEQB 1VXRA 2EFDB 2D62A 1Q91A 3LPMA 3ASZA 4BX0A 1UQUA 2IUEA 4A2PA 4RS4A 3KZMA 5BW8A 1PWEA 1IWPB 3D7LA 4ESHA 1T1EA 2CB0A 4Z3OA 4MUKA 3GGSA 1JDZA 2V3CC 4D82A 3REGA 4RZIA 3AVUA 3GGDA 1W88B 3RKSA 4I1IA 4BBPA 5CM9C 3PHBE 3OG9A 2XGSA 6ADHA 1F2UA 3I8XA 4JHLA 2VJAA 3O4IA 1I80A 1XMSA 2AFVA 4Q3KA 1LSJA 1MEOA 2REQB 1JT2A 3ANLA 3GFPA 3LPAA 4WZAE 4M0KA 1TW3A 2E82A 2C9YA 2DE0X 2FWRA 2JLUA 3M8KA 5EWJB 2XCSB 4XPIA 1W87A 3CINA 5FUVA 3UY4A 4EARA 4R69A 1L4EA 1WKCA 4TWIA 4Z99A 2IUSA 4GGPA 4J0CA 3U0BA 2BZ1A 2DT5A 2Z5LA 2HBQA 2O0MA 3JALA 3JQ8A 1JDBC 3S7TA 2CJWA 4BMNA 4TV8A 2GRUA 3KZCA 4M0UA 3TGWA 1N32B 1TB4A 2EGGA 1L4UA 2IOFA 1TDJA 2V3WA 1MENA 3CH4B 3CX4A 3I01A 1M8GA 1MX5A 3H0KA 4K6GA 3P0IA 3RU7A 1HE1C 3WLAA 3HEMA 4PU0A 1HZJA 2PJRA 5ENVA 4OAPA 3R0QA 1DADA 2H8GA 5DBEX 5T4EA 5AICA 4D9GA 3PV0A 4MS1A 2CWWA 2GD0A 5HDBB 2YFYA 4RIEA 1BDMA 3C16C 1V48A 3DE3X 3CX3A 4PN3A 3CUVA 2GD2A 4AG3A 1W52X 2EWVA 3FNBA 2EP8A 5HM8A 1TVMA 4RDIA 4FEGA 3R76A 4F8JA 4YMWA 5FV4A 3L4JA 2FETA 4HZUA 4KRXA 4KI7A 2D1FA 5AK5A 1UBCA 1NVKA 3K96A 3LQRA 4NQZA 3SHQA 4LHEA 5G1NA 4AKTA 5FLKA 3OJFA 4LSGA 3EBOA 3KALA 1BJKA 3ZHRA 1NQ5A 3K4QA 1SHTX 2GAFA 4C4ZA 1RLOA 2NU7A 5ECDA 5JDIA 5ESDA 2E4XA 3WGOA 1IN5A 1MIOB 3WKCA 4TV8B 1Y7IA 2XMGA 3FPGA 1EUZA 3O73A 2Z8YA 3EX7C 3OE7D 1JHYA 1WQ4A 3ZBTA 4RTJA 4BO4A 1IXSB 2IZ0A 3LTNC 2B8JA 2SECE 1C5KA 4CKCA 4BO7A 1WUJS 1UKZA 3S3TA 3SHWA 1SQFA 1Z8DA 4DG8A 2AXEA 4DREA 3CKLA 3AKCA 1BSVA 3O47A 4KWHA 5KQPA 3F9RA 2DFNA 2OILA 1JGTA 2C5FA 2RHJA 3T0IA 2ZYWX 5JCJA 2WWYA 3D5EA 2BGUA 4EUHA 5AXDA 3ODGA 2A9JA 1UANA 1NN3A 2QT9A 2ZYSA 4PQFA 3E7DA 1KZHA 3RVOA 5K45A 1YGPA 4RTSA 1PR9A 4JUIA 3T5GA 2AN3A 4YCSA 3VI4B 2WD7A 2D2XA 4POOA 4LQCA 3ZGLA 4V0RA 4N5NA 3L5KA 3LWBA 4HGPA 4GEKA 4CDMA 3WRWA 3G68A 3GA5A 3E35A 3K70D 1K6MA 1Y42X 2A0WA 2F1JA 4HEJA 2Q5FA 5AHWA 2WNSA 3MIIA 4Q3CA 1C7EA 2H2IA 4V0ME 4BBJA 1NW6A 3D0QA 4UREA 1JF8A 1N57A 4EYGA 5C51B 3FHOA 4LCBA 5ALDA 3ASUA 3FIUA 4FDMA 1X7DA 1YC2A 1FSZA 2CHQA 3AK4A 4FFWA 5D85A 5AKJA 2QJTA 2ADFA 2GN2A 4DV5B 1XWIA 3EVFA 3UT5B 5JO0A 3JAMA 1S3GA 1Y8ZA 4YRDA 3H1GA 1SHJA 1XZCA 3RHTA 1Z8HA 4KH1A 4EGAA 1AKVA 3BAZA 3PCRB 4IMRA 3UYKA 3E9QA 2RGAA 1HORA 3ENNA 5ALUA 3TYXA 1RWWA 4MWZA 3ZQUA 4BRUA 1MBZA 1EJ2A 2HF8A 1I2AA 3K5PA 4KYUA 1KEVA 3G59A 4MRMA 1WEHA 3KAKA 2GZRA 2H1HA 2DEUA 1BXZA 4CKWB 1QPZA 1SXJD 3GNTA 1LA2A 2C5SA 3LT5A 1ADGA 1RRGA 4UM5A 1U3UA 1FFEA 1ZPDA 2XDAA 1RRMA 2CUZA 1YZ3A 4RHXA 1C2YA 2J32A 4FHDA 4IXNA 2B5VA 2QN2A 1YR1A 4DMLA 2VSFA 5CVEA 3O8OB 5EOVA 4A6EA 2WM9B 1HGXA 1E9CA 2ZI6A 1ZOOA 2G8LA 2YKGA 3GJ3A 2VR1A 4CIDA 3LLVA 4NV0A 1G0NA 2IC5A 2R0QC 4HLQB 1OXVA 2VZ9A 3A3NA 1X39A 1BCSA 3MOIA 4ZQBA 2R6ZA 4F92B 3WDKA 4L28A 1S9HA 3K9GA 1RZUA 4HWGA 5JPIA 3U3MA 1QGOA 1YRAA 5KKAA 2PR2A 1HDGO 1Q57A 1AJEA 4P2BA 2Z4SA 4DCMA 3NKFA 2VBCA 5D87A 3TD9A 1LNSA 5G3YA 1NG1A 3OT5A 2CZCA 4OLFA 2OHXA 3GARA 2PYZA 3IDAA 1MPXA 1PYOA 1VJTA 1TT5B 1PK7A 1XA3A 1K2WA 3OBBA 3E7XA 4H1TA 5BWNA 2HQ1A 3FOBA 1GGVA 4QX6A 1U6KA 1QC5B 3DWFA 4JU9A 4NABA 1EK6A 2XEDA 3UKDA 1CW2B 2HWWA 4RENA 1QOZA 4HTFB 5GM2A 1PDVA 4AMBA 4AY3A 3HQ4O 4LHYA 2B21A 4DLWA 4CIWA 6NULA 3CA8A 5CXXA 4P81A 3NYRA 1QIIA 3DVAA 3U1VA 4PRKA 2DFVA 1YCGA 2FUG1 3N6VA 3T6KA 1IEVA 2VPZA 3OP1A 2C9DA 4X1KA 3RIMA 3SX2A 3VRHA 4DIFA 3E61A 3K31A 1SCIA 16PKA 3MLEA 2GBCA 4HWOA 5CJPA 3HUFA 5A62A 2XZOA 2Z43A 1KXJA 1OAKA 1B2LA 1E94E 2EKQA 2ZJFA 1F4PA 2LDXA 3AXTA 3M3HA 2EX1A 4QICA 2WICA 3V6LA 2ACKA 1YZVA 2GRAA 2SICE 3HA2A 4ODIA 4JI4B 2GEDA 3LBHA 4WLEA 2O8VA 4KYVA 3V1LA 2DU8A 4O5OA 3FKQA 4C0QC 1K8QA 2Y1WA 4TKMA 1FYWA 3AC0A 4WOPA 1R6VA 1EGQA 1THTA 2X40A 5JAUA 5ITZA 4EECA 3T9FA 4MVXA 3CRMA 3IUPA 4OK3A 4S0XA 1DCTA 4A8TA 4P53A 3UAZA 2H5JA 3OU7A 1X13A 3N3AC 3VU8A 4H7HA 1NJFA 5LMZA 1ESEA 3IFSA 3R0VA 2C78A 1BMDA 4Z7QB 1RYDA 4II7A 4CR8A 1U8ZA 1JQKA 5CB4F 3KQUA 3ABOB 2WKSA 4KDEA 1N9GB 1XCPA 3H9BA 2GH1A 4FGWA 1FYFA 5CBPB 5I9TA 2P62A 4TVOA 1RIFA 2YHAA 3IO3A 1NULA 2A9PA 1R0SA 3L79A 4L74A 2B83A 3RFUA 2SNIE 2HPHA 1JG1A 2DULA 4QHYA 1UZLA 2EKLA 3NYQA 1WZ2A 2CL0X 1J00A 1CF2O 5J23A 3COPA 3CU5A 3E5NA 2AC2A 1LPBB 3JY6A 5LXTB 1OUMA 1U7UA 4OJMX 1S5PA 1LEHA 4PGMA 1OU4A 1TUGA 2PY6A 4A0QA 4NESA 1DWOA 4M4SA 3T35A 4D45A 3NOVA 5JEDA 2AOTA 5FEUA 3NHWA 3VZPA 2XODA 5BYBA 1W36B 3NUGA 1THZA 1KH3A 3TL2A 1K68A 1V96A 2F1OA 1N1EA 2JIPA 2X9QA 2FEMA 1DEHA 3K20A 3QFTA 1AS2A 3D7RA 4RDHA 1UT6A 4C89A 1S8FA 121PA 1XQ1A 4NZ9A 2X2FA 3F1LA 2Y1OA 2C59A 3PIDA 1XZFA 1VSQA 3I72A 1H0SA 1BGXT 4R2MA 5TF0A 2NMVA 3MWFA 2DUNA 4TKVB 4ARAA 3VBCA 1RYMA 4K28A 2EZTA 3MJEA 2QUBA 4U0JA 5H16A 2C2WA 3FRJA 1WMAA 2PZ8A 3KU1A 1U28A 3UTDA 4ZI7B 4B73A 1XR3A 4BJ5A 4BAUA 1SC3A 4RNDB 4XEUA 2X42A 3NV7A 4W9RA 1O94A 2YYSA 3KR0A 3KKQA 1IJBA 4WKPA 1TKCA 3RBZA 3SC2A 5KVSA 4X62B 3TIIA 1J4AA 4IHAA 4RF5A 1AHNA 1IBRA 1L5SA 2IFTA 3DTVB 4QHTA 2QGZA 2VJKA 4FSDA 1ZIDA 1NURA 1CQJA 2C7OA 2BGLA 2OYRA 1PJAA 2OOSA 1ISIA 1DKMA 1NC3A 1O94C 1P2UA 4IQGA 3LRPA 2ZAOA 4QUGA 4QZVA 1SQ6A 2HGZA 3K6SA 4MA0A 1EDOA 3TGPA 2MTBA 2VPIA 2DPXA 1ZIXA 4WZBA 4B7AA 1A50B 3A1EA 3QV1A 1I4EB 1WIWA 4IGFA 3ZVLA 3B85A 1GG9A 2VK1A 2PUHA 3DMTA 2W6NA 2J41A 5JSKA 4AWXA 4ZCLA 2JZOA 3NYWA 4I8DA 4CLRA 3LG2A 2V1UA 1C3OA 4DZRA 4IJWA 4OQPA 2NQTA 1UIMA 5JH7F 1NE7A 2JATA 1V5GA 1WSBA 2XNSA 2Q45A 5EJ2A 4D26A 2Y1LA 4RVNA 5DNWA 2X76A 3SX4A 5KTNA 4CLOA 4LMRA 1G7SA 3W5BA 1SA0B 5JAMA 1V39A 2PIAA 4D9HA 1A4XA 1A5BB 1OQAA 1R6UA 2KQUA 3ACDA 4CUKA 1T1SA 4IJ5A 4JAVC 1VLLA 1JDUA 3GEEA 3RS3A 1MB9A 2PQMA 2R48A 3VPFA 4C22A 1CP3A 2DQ4A 2I4TA 1BU5A 2MINA 3B3AA 1ID8A 1DJLA 1KBZA 5IC4A 4GPIB 3K8QA 2C1ZA 3L0YA 4EL0A 3HB4X 3R3SA 3PGMA 2E6KA 1QPGA 1JBQA 2CMKA 3GR6A 3JCZA 3C6YA 2VUTA 2OZPA 3LK6A 3OCVA 1GAWA 2QAJA 2G06A 3WK9A 3AB8A 3L01A 2PLAA 1GGNA 4GIBA 4H7KA 3DKVA 4KYIB 4EY3A 2RGXA 1NJGA 3ND6A 4AX4A 4RVGA 4MICA 4N40A 3F46A 3MGKA 1JH8A 3ONVA 5FNVB 4A10A 2BT4A 4R7GA 2F3TA 2GEJA 2XOKA 2W90A 1QYCA 4NATA 5LOVA 2JKYA 1N1GA 2RJNA 2RE8A 1XROA 4E33A 5C35A 1QZUA 4V0LA 3QVKA 2JLCA 1NX6A 2IT1A 2V5VA 5GZ3A 3F0TA 1UL1X 2IKSA 4MYCA 3BF7A 1F3LA 4FEYA 2AI3A 4NARA 2W6ID 5T3YA 4C5CA 5JR3A 4JP3A 1KSHA 1JXAA 2H5IA 2HMWA 2R9VA 3IODA 4QTUB 10MHA 3K70B 3QJGA 5C0OE 3TQTA 2XAUA 3B2EA 4INOA 3G2OA 3HJCA 2EF0A 3DDWA 4JWKA 1OBOA 1GWNA 3MRSA 3ZJ5A 4U2GA 2WPNA 1ZM7A 4DSOA 1P4GA 4IDAA 1IZ8A 3LNCA 1JL3A 3QMWA 4PX3A 5IN4A 3O1LA 1E3JA 3OIYA 4BBAA 5KNDA 4DBVO 4F7DA 4Q3LA 4Y6GB 3VR6A 4OHKA 1GRQA 2I6QA 2X58A 2Y68A 5JJLA 1MG5A 2G1UA 2YNMA 4C0KA 3T52A 2LCQA 3VZQA 2HKIA 1RYFA 3HKDB 5EXTA 1ODJA 1R37A 1SPXA 1JR4A 1ZC3A 2BGIA 2O2EA 2OO3A 4O2AB 4UZFA 1N6IA 4HNRA 1RRPA 4LI0A 1AD2A 2V55B 5BSGA 4BCCA 5BSUA 3C4QA 821PA 4CQMD 4PX2A 3B1JA 2FWBA 3LXXA 1HA3A 4GM4A 4N1AA 1T15A 1KK1A 4EP1A 1VL0A 1FUKA 4F9GA 4YAIA 2O5CA 3WGGA 1B8VA 2POQX 4JJGA 521PA 5JFGA 4S12A 1YVUA 4KITB 4KQKA 2NSYA 2B92A 4O2AF 1TVCA 3RI3A 2Q9AA 2NP7A 1N2JA 3AVYA 1AQLA 1NHGA 1GPBA 1ZMTA 1CE8A 3G49A 1QOPB 4UNPA 2XNDD 4YY3B 3OPYB 4MVJD 4JDUA 4QAJA 4XGNA 4RQTA 1A2KC 5DGHA 5CFOA 1P91A 1YQTA 2I2DA 4MRAA 3KWJA 5KAPA 2RK3A 3A0UA 5FPSA 1Z0IA 4M38A 4F91B 1T5TA 3F7NA 1HDRA 3G13A 3QWBA 4NHEA 1C3EA 4HGZA 5M5BA 3GRFA 1DG9A 3FCUB 3WXMA 1BDIA 4LJ8A 2BM9A 3AL2A 4UFPA 3GVPA 4ZIRA 3TKYA 3V2UA 1FP4A 5C8YB 1LZKA 1D6MA 5AI5A 4FEAA 4BPRA 2A6PA 5DE3A 4Q47A 1K7EB 4WZAA 1R0BA 3ZG6A 5BMVA 5K09A 1IUNA 1KDPA 2Z3WA 3FZGA 2WTAA 3UCFA 2DR3A 1BFUA 4L0CA 2R4QA 4JVMA 3KKNA 1IRIA 1X38A 2QP3A 3V4ZA 2PH5A 3N2ZB 4HDRB 8GPBA 5C4IA 4LJLA 3CKMA 2XRZA 1ZIOA 4Y6QA 3TUIC 5FNVF 1FYEA 3FM9A 3K0AA 3TJRA 2RMKA 3ELUA 4RD4A 1LDNA 1KERA 3M6WA 1GQOA 2Z6VA 3QPDA 2QWXA 4X85A 4KXXA 5BR1A 3R5TA 1BOFA 3O8BA 1BVRA 1FIUA 4D0LB 4F5YA 1E6CA 1X86B 5EIWA 1Y63A 4I81A 1GN8A 4OH1A 3UVEA 1J42A 1RJWA 3LBAA 4J0FA 3KYDB 3NT2A 2QMUA 1ZA2A 2VF4X 4OQLA 2PQ6A 1DUSA 3O8QA 1YS9A 1DAPA 3DF9A 5JUWA 1SVLA 1RJEA 2DPMA 4IIVA 5DM70 1UBNA 1L1QA 5HE9A 1WXFA 3LOPA 3L49A 4CLRB 4WSOA 4X7RA 1BGWA 1M8KA 1VPLA 3JYQA 1GNRA 3PITA 4JR1A 1E3WB 4XDZA 4MUIA 4IINA 4FKZA 1DXHA 2AOVA 1WDTA 3HGMA 3JZIA 4PLPA 5JTTA 3AM1A 2QUJA 4MSUA 1WP4A 1P7ZA 1P1HA 2PS1A 2BBOA 3NANA 3TOCA 4Z53A 2IKQA 3H2SA 1KO5A 1V1JA 4Q7KA 4D9KA 2QU7A 1OFHA 4QGSA 4C29A 1FCJA 1M7BA 4D4HA 3IEUA 5A05A 2IX9A 2ZBPA 3NPMA 3IA7A 1D8TA 2FG6C 2PWZA 1ST2A 1OSNA 2WB4A 1IHOA 3W7VA 4BLPA 3IMKA 3HDJA 2ZYHA 2GM9A 4OQQA 3DE2X 4P38A 4BFYA 5C32A 2W9XA 1NP6A 1BMFA 3QKSB 4RIIA 4AL4A 3VYTB 2BGKA 4IYJA 3NHJA 1E92A 2BDEA 1Z8FA 3PNKA 2QYOA 3FFBA 5BW5A 3EVNA 2ZRFA 5KVVA 2QAIA 4JB0A 4W7HA 4ZZ1A 3ZOZA 3UA3A 4C3OB 1OFUX 5KJCA 4DR3B 3K16A 4BRZA 4MDFA 3SICE 1QJ4A 1K0FA 2CF6A 1N2HA 2ATXA 3HJNA 4PZUA 5IBPA 1SUCA 4DA0A 5J2UA 3ZCSA 4C7BA 5MGBA 1DPFA 3AUFA 3ONWA 4Z4QA 2XSZD 1TYZA 2ZCVA 4CF3A 5BV2P 2WWHA 2XBMA 3NQ41 3ICWA 4HP8A 1ACMA 4P7JA 1XTKA 1XJ5A 1ZVMA 2PN1A 4GKKB 4JELA 2PUTA 2QMHA 5B3JA 2MCFA 2ZZKA 3EFEA 3GVXA 3V4PB 5KQRA 2PBFA 4HSGA 1BEZA 1L1RA 2Z0MA 4Q19A 5F1PA 3HGQA 4UNNA 4DL9A 1O96A 1XZMA 2GBLA 1N2CE 2P9TA 2Q6TA 3JQ9A 3AEQA 4M8KA 4LY9A 4S35A 4U2FA 5EIFA 2FSVC 5L8VA 2C9CA 1T9CA 3OOYA 3WK4A 3D1VA 5JECA 2WG1A 2QN8A 4S1TA 4A3SA 3OZ7A 1PJ2A 4IEIA 2RHMA 4S0ZA 4WZ6A 4RGBA 4IIHA 4MW7A 3GVCA 4DVGA 5ECWA 3DMFA 2CE7A 1P1FA 1G3RA 3EQ2A 3FSEA 3HI4A 1FJ2A 1MEEA 4MW5A 4BKOA 1I6MA 5K0NA 3MWYW 1KFJB 1EWKA 4RIFA 2FPWA 4DM3A 3ZDRA 2D5LA 2JIDA 4GVLA 4H9GA 3TNJA 4P33A 2WFLB 1SHZA 3IOYA 2OAEA 1HL7A 1KH2A 3LPDA 3PG5A 1A98A 1GSOA 1MHPA 3K94A 3OEEA 4PICA 4PSDA 5DHSA 3VZSA 5A4DA 3CZMA 1I0IA 1QVZA 1HWYA 4HQ6A 1DDIA 1N2OA 2R8ZA 3A14A 1EDDA 3D3JA 3P9YA 5CB4B 3EFHA 4DIDA 1MJNA 1XYVA 3FRIA 2F1IA 5AM0A 5KWIA 1FLVA 4I6GA 2BI8A 3SBEA 2BVNA 3B3JA 3JARB 4K26A 3DCNA 3DS8A 3JWIA 4IQFA 3ZD7A 4Y2PA 1F2TB 2MSEB 3HWRA 1OLSA 2R96A 3BXPA 3F6RA 3DBRA 3PFNA 4GL4A 5AQEA 3GT0A 2O2ZA 2GM4A 3E23A 4TVSA 2R6GA 2GVZC 3WIBA 5ICCA 5FXMA 3SNHA 4X1KB 1P5RA 3A4LA 1YCFA 2FPKA 2I7DA 3RJZA 1AA6A 4OAOA 3EASA 3DZJA 2GAAA 2NPOA 4JQZA 5YASA 2I3DA 1DT3A 4GLFA 4I4TA 2EW8A 1W30A 1IN7A 2I2CA 5AOCA 2X4IA 4LJ4A 2JLSA 3L93A 3RHZA 1W4AA 1VPWA 1P2GA 1Z2AA 2HLNA 4BLUA 1TJYA 4ZDWA 3IEXA 5JY1A 1R0YA 1TU4A 1PUXA 3DE0X 4M88A 4MJLA 4RH0A 4XR4A 4JEHA 1LQTA 4QEZA 3RS8A 3SZMA 1TT5A 4Y9RA 4S2EA 1VL2A 1U7OA 4X1YA 4GFDA 2YHSA 3OZFA 4DLKA 1D2GA 5GAJA 2WZBA 5E1DA 2PX6A 4M1YA 3SFVA 4L72A 1VI6A 2AC7A 3ESZA 3IVRA 3STVA 1P19A 2AFRA 1M6WA 2INGX 3EAFA 4Y6SA 3TRHA 5H9WA 4WAUA 5JNLA 1L7EA 2PFKA 1MT0A 4GPAA 5JAQA 3TB6A 4CCAA 1DO2A 1L3IA 5FOWA 4V1CI 5J2TA 4W9MC 1GPDG 4BX3A 2B37A 1P62B 2K5UA 2WU8A 3MWKA 3H2ZA 3L46A 1T5HX 5CK5A 3DCIA 4F96A 9LDTA 5IYZF 3G0IA 2FWIA 3U4IA 2FSFA 4R1LA 3EF3A 1QAMA 4WE3A 2IEIA 4G81A 4AROA 2R7LA 5FTMA 3SX0A 2GVNA 4WK0B 4C01A 3KB1A 4HLUC 1VRWA 2BGTA 4KDFA 2QE6A 4TWAA 1JR3E 4E6PA 4R2JA 2J4CA 4YUXA 4FJ1A 3NHFA 2Q49A 3I04A 4CM3A 1Z8NA 2O0LA 3BE4A 3BK2A 3CBQA 3SE7A 3G2PA 1BDHA 1RAGA 2ZAYA 4ZWNA 5EP2A 4TXHA 2YVKA 4NBUA 1YBVA 5DLDA 3PFBA 1X7WB 1ZZGA 2AQKA 5L51A 5LCXA 3QENA 1U2TA 1I5EA 4ARBA 2F3QA 3A0RB 1QP0A 1EGAA 2YFHA 1NBHA 3AZPA 1U3VA 1WJGA 4U9IS 1YS2X 4MUMA 2PK3A 3HDYA 3FVRA 6GPBA 3M4XA 3L0DA 1C1DB 5FWNA 3H9UA 3SLGA 4PBTA 4MWCA 1E1RD 2KW5A 3P2JA 3NNSA 4OYYA 1YNOA 3ZS8A 5I9BA 3QYPA 3V7FA 1ORWA 1SVUA 4PPYA 3I9OA 3HR4A 4LC1A 2WMNB 2JFGA 4K0RA 3NAGA 5CNMA 3N8IA 4E6EA 5LLSA 4AB1A 3VPGA 4TMKA 4ID9A 1CDDA 1ODFA 1XRQA 1Y5LA 3QPVA 4W1PA 5F7ZA 3W04A 3ZWAA 4BMDA 3M1YA 4YX9A 1Y8QB 5JZOA 3CT6A 3WYGA 3VDRA 3NUQA 1SMKA 1Z3CA 5F9HA 1R15A 1CRWG 3LCUA 4I1VA 5JOQA 3OZIA 4J1QA 5B36A 2O7NA 1VCHA 3DBOB 3ZWBA 3NC1C 1VLVA 2EG5A 3L3BA 1VHWA 1M1XB 2BR4A 3DNMA 4TMWA 1M1ZA 3H1BA 4NV1A 1KJNA 3SS7X 2I71A 2X0JA 3GLGB 2VJYA 1FBTA 3NTOA 3OZBA 1JYEA 2FK8A 2WHPB 2JJ8A 1XU4A 3VM6A 3HXMA 1O0CA 1C3VA 1X1CA 2ERYA 4GOMD 1KI8A 1V37A 4LWPA 1AM4D 1T6ZA 3K4HA 2JGEA 4GYYA 4KQFA 4TLEA 4ROTA 2BTEA 1D2EA 4S1PA 1Z2PX 1JHDA 2W6JA 4W5HA 1U1DA 2JCXA 4NWIA 5FP0A 3IQHX 4Q12A 1SY7A 2O3JA 4P84A 2XDYA 1WU8A 5IFLA 3VX4A 2BM8A 1Z5PA 4P31A 1NUPA 4DSZA 2GD1O 1ZU5A 3UJHA 5IYZB 4S05A 2XUIA 5AVWA 4CM4B 2F3PA 2MT9A 4YCJA 2LKCA 3LXUX 3BE5A 3BJMA 3B1XA 1U7HA 3KT0A 3NASA 4OP2A 4PZZA 4REMA 5FULA 1YRYE 1GSIA 3S4YA 5LZ9A 2EC5A 4OGFA 4WESB 3V8EA 5IJ9A 1NXQA 3KJEA 2OCAA 1CVLA 1ZD8A 1CETA 3TLGB 3ECAA 4AX8A 5JS8A 1C1XA 2EGHA 4R1QA 5TEWA 1I94B 2VAPA 5KPJA 3KR1A 4FLMA 3EGWA 2XDQB 2ZR8A 1EGMB 5TRTA 1F06A 4CXMA 1HSZA 1D2CA 2ZU6A 1NUSA 1OV4A 3PICA 2A5JA 4L8WB 1CR2A 1CUBA 3UC9A 1FSPA 5CT8A 3CEAA 1T0PA 2GTIA 3IAHA 4KTTE 4G0QA 2A5LA 2IXFA 2RAFA 3ELYA 4TTIA 5DCWA 3VKUA 2R6HA 3VOTA 1AHIA 3H1TA 1UWKA 4Y7DA 4UM7A 2RONA 1HX7A 3R5XA 3PDIB 4JI6B 4ZHQA 4MYHA 4CMBA 2DRIA 2ID4A 3CE6A 3MJTA 1OGJA 1WP9A 3A1VA 3BKXA 4RZHA 4U5XA 4XFKA 1RXWA 4X6UA 3Q2KA 5JAHA 4DV7B 4J90A 5AJXA 3KAQA 4Z7NB 1BCRB 2AV6A 1QO0D 1P4HA 4MGEA 1JV2B 4A2CA 3W0LB 4S2UA 4U39A 4Z8YA 5CIQA 5I51A 1ATZA 3CEHA 2LRHA 1XYGA 1CY4A 1PLJA 1UAAA 1LXCA 3EXIA 3L40A 3VKVA 4TXJA 1K9VF 1TKRA 3OFVA 4RY0A 3RT1A 4ZYTA 4E1VA 1TIKA 4OL9A 3Q7IA 3KTAB 1Q3TA 4XGQA 3DLCA 2ZAIA 3PC2A 2P3OA 2VZLA 2H2DA 5B1YA 3ROFA 2VYVA 1ST3A 1LK5A 3ROZA 1LD3A 4Q3NA 4HAWA 2ODTX 1OXXK 1ZL0A 2BZ0A 2NUAA 2P0AA 3C6MA 3GL9A 4OUDB 3LI2A 4H4CA 4UOEA 2JFFA 2WE7A 3JXEA 1KYXA 3MINB 4R7TA 2GYWA 1Y48E 2WSMA 2XBUA 5KOJA 4JROA 4EBFA 4JGGA 5KSOA 1SD1A 2HLPA 4GNKA 1DZ3A 4R2KA 4Q39A 1RABA 4LF5B 4XASA 1V7PC 4IMJB 3BXEA 3UMYA 2JH9A 1H4TA 3QEJA 4XWKA 3B7GA 1MAWA 1DIBA 2GQ0A 2RKWA 3IUMA 1QIGA 1DQPA 4WDRA 2ZWVA 2R79A 3RG8A 3N8GA 3L2OB 5DTMA 2QEQA 3TLEA 2BC9A 1ZVJA 2V8OA 1V5FA 2C0PA 3FF1A 3FY4A 5AHRA 3S0JA 1MOQA 2FPIB 4G5GA 4H3SA 2W42A 4CL2A 3B5IA 5J5CA 3RRXA 4BN5A 2M9MA 4WLOA 4RVOA 1XTVA 1OX4A 4J1TA 1BFKA 2J4DA 2QK4A 4V0MA 3DHNA 4NDNE 1QLWA 2H16A 2OBFA 3R0XA 3PEWA 2VH1A 1GG8A 4KQHA 2O8FA 3QXSA 2O3QA 5MHTA 4WA8A 5I3CA 4XQCA 2AMLA 4LKOA 2NU8B 2WY2D 3GP8A 3N39C 2IEBA 2GZMA 4ER3A 2QX9A 2YFQA 5JALA 3B9BA 5KU1A 2QE7D 4MINA 3IAXA 3NVKI 3GWGA 3UG7A 1OXSC 3UPTA 1IPEA 1GADO 1X87A 3C5CA 1I1NA 2WYOA 4M54A 2ZSKA 1FUEA 1GY8A 1UBTS 3ETLA 4UHDA 4JC5A 1A1VA 4ZIRB 1JHAA 3TFOA 1BDJA 1DUVG 3L7MA 1XZDA 4AZ0B 2OD9A 1OYVA 2QZJA 2ODEA 4RK1A 1PJSA 3CNHA 3Q3GE 1TCAA 2PDAA 4C7KA 4CKBA 1UJ4A 1KZYC 1Z6YA 4L5JA 5ED0A 1DCFA 3GUYA 2YRXA 3OFJA 4O59O 1PBTA 2XQGA 4R0VA 4CM8B 1U5BB 3G02A 3CLRC 3PA8A 3WRXC 1A96A 1NUTA 4GX2A 1Y4SA 1ZZEA 3PUKA 1G19A 3E05A 2A1UB 4BNVA 5AW2A 3GLIA 1XXHE 4TKUA 5A0VA 1P61B 4A1OA 1QGED 1OTXA 2RHTA 1G60A 2IOFK 2VH2A 3FPHA 1XQYA 2PSEA 5CA0F 4YT4A 4G01B 5DASA 5EPOA 5LN1A 3REOA 1BYUA 4C2AA 2IY7A 3BD9A 2HAEA 5AOBA 3SFTA 5ALTA 3KCNA 1LS1A 2GFIA 1IULA 3EGDA 2XAAA 1FMLA 4W99A 1TNDA 4WCFB 3RODA 2QIPA 3HWSA 1PHPA 1J0CA 2DBRA 4DY4A 4EAQA 5L6MB 2CVOA 4OPMA 2DERA 1CIVA 3C3KA 1S2GA 4TKLA 2YWGA 1JIIA 1UINA 3R09A 3C5WP 4A0HA 1UZMA 2C8JA 4JWTA 2A8YA 3KQTA 4NE7A 4OHUA 1MJFA 5D51S 4FOTA 1TMKA 2FZGA 5EKXA 3LDGA 4DADA 4G0WA 1L1FA 4CCSA 4TTJA 4JMLA 1WUTA 1A71A 3R7WA 3UWSA 4RPJA 3KV1A 2P8JA 1OFTA