1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
molecule tags Signaling protein
source organism Mus musculus
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
2ZJBA 2BM1A 3FPAA 3EZFA 1NLYA 2CK3A 3MWLA 1F6BA 4LRWA 3O8CA 1TQ4A 1W36D 4P4TA 2WKRA 1R5BA 121PA 5GJVC 3BJIC 2ZRMA 3DL0A 1JAHA 3GLHB 1WB9A 1LVGA 5L3QA 2ZEJA 4K46A 3CPHA 1CR4A 4QHSA 3DOFA 1ODFA 2MMCA 2R44A 4NZYA 2FWRA 4QKQA 5DLQC 3ADBA 4J0QA 4D2IA 2IYUA 3FFBA 4S2EA 3RRZA 1Q1ZA 1YZGA 2C77A 3UANA 2GF0A 1G21E 2V8OA 4KXFB 2XXAA 4NE2A 2GA8A 1CU1A 3MFYA 3VQTA 3ZVLA 4TYNA 2ASEA 1E2FA 2F9LA 5DIFA 4RCYA 4KVGA 4YONB 1CEEA 3SJZA 3NHBA 4CEHA 3DZDA 1CLUA 1NSTA 5TARA 2IHYA 5HCNA 2ZSDA 1OFTA 3CB4A 3DHWC 5H70A 1N5JA 2X8AA 2WWGA 2Z5FA 4Z8XA 4CEIB 1CR0A 3KXIA 4DLZA 4GT1A 4MYTA 4EQ6A 2VP2A 2OZEA 3FE2A 2C9CA 1E2IA 3O8BA 4DCTA 5H8WA 2AFIE 4LCBA 3GLFB 1SXJC 3LVRE 5CDFE 3TGPA 1UKYA 2CHQA 2WOOA 1XTKA 4C0KA 1TU3A 3NBZC 3KXLA 4B71A 2RGXA 2I1QA 1I4LD 3CBQA 1PLLA 4Q4HB 3ADKA 2HEIA 1G1MA 2WJYA 5CIQA 1ZD1A 2HXSA 1EK0A 3O47A 2GJKA 3KX2A 3EWAA 3CPJB 3OEHA 1OH7A 4TQ9A 2HLDD 3AVVA 3KB1A 1QHXA 2J46A 4FWIB 1KSHA 1FPMA 2IYXA 1ELOA 4MUBA 5J4KA 3GJXC 3WYFA 1RE0A 4KITB 2ONKA 4NL4H 3KKOA 3MD0A 2FNAA 3Q5DA 2XTZA 4IOLA 2ONJA 3OIWA 3TR0A 5HE9A 2PH1A 3AP1A 1OSNA 1W4AA 3N5CA 2BBTA 3RS4A 4B3CA 4NPHA 1IN7A 3QXCA 4KHZA 2GXQA 1TUIA 1KJZA 2WIBA 1BO6A 4MKGA 2A5YB 2RGCA 2QNRA 4DHEA 1AJEA 1OV4A 1M6NA 1PLJA 2AXNA 2GCOB 1BYIA 3R20A 4FMCB 2DFNA 4II7A 1FL9A 4PZLA 5K8LA 1AKYA 5DH9A 3U7EB 1GKUB 3LQQA 5J5CA 3LLMA 4BEJA 2GILA 3UMSA 1ZNYA 3QKRA 4LHZA 1HH4A 2Z43A 5CK5A 5CYOA 3HYTA 1YU9A 5JJKA 3ASYA 3UWOA 3B1ZA 5JRZA 2CNWA 3VHXA 3J81k 3KQUA 2IYVA 3FKSA 3I5XA 1LY1A 4YQFA 1TL7C 5G40A 4M4SA 3CX8A 3BORA 2GEDA 2JJ1A 4TMZA 1P2VA 3UPUA 4UNPA 1U0HC 4R2IA 3KTAB 1K5DA 4C2TA 1S96A 1NBMA 1Q21A 5CLLA 3TK1A 4EDHA 2SHKA 2B21A 4LJYA 4C30A 4BZXA 1RKBA 1W0KA 1GILA 2WMNB 4RZ2A 4CEJA 2ZRGA 3CF0A 2ZE7A 2IT1A 1HT1E 1WP9A 1H8EA 4AG6A 2TMKA 2R6CA 2ZRDA 1S3SA 1OKKA 3AVUA 2ZU6A 2J0UB 4PANA 1QF9A 1NVXQ 1Z28A 2ORVA 6Q21A 3LD9A 4DZZA 2QE7D 3GJ7A 2GEUA 4AWXA 5AK0A 3ZQJA 4CIDA 1U81A 1XF9A 3A1WA 4LX0A 1UBFA 3PUYA 4RZ3A 3D3QA 4RY2A 3T34A 2IYWA 4MYUA 3WHLA 3D7MA 4JKIA 2XNDD 1GSIA 3ND9A 3U2QA 2XZLA 2FX3A 3PQCA 1KSJA 1F3OA 2O0KA 1SXJD 3REGA 1QZXA 2O0JA 3RSLA 1M8PA 4D4JA 3HU1A 3HJNA 1WMSA 5CB6A 2OCBA 2B7BA 1T6NA 1VHTA 3UG7A 1B0UA 5JJIA 2P65A 1ZUIA 1S2MA 4LBWA 3VFDA 5JBQA 2YOHA 4DT1A 1Z2CA 1NN3A 1AIPA 1X8LA 4TQUS 3B7GA 3QG5A 4OI4A 3RYTC 1W7AA 2VHQA 4EPYA 2FF7A 1S1MA 4ACAA 3AF1A 4B3FX 5FH9A 3F0TA 5L3VA 1ZM7A 2KJQA 1D9ZA 2YWFA 1IY0A 3LXRA 2UZIR 4EPRA 2WVJA 4LGMA 1E3MA 4PC3A 1I4TD 3EWSA 2DFLA 3CX6A 3T5DA 3KKPA 3GLIE 2IW3A 3LLUA 3U3KA 3I5YA 4TZ0A 4C7OB 3QXSA 2VHJA 5GVSA 4TTQA 2Q9AA 3EA5A 4QM6A 1XEXA 2ZR9A 621PA 4CF7A 4PXAA 3VX4A 1JBKA 4Q4HA 2RCNA 4NCNA 4Q7KA 5ELXA 4MDFA 3QXXA 4HLDA 2QA5A 3IEUA 1NMZA 3MCAA 4RSGA 3SYLA 2C8VA 4JL6A 4YMTA 2QROA 2XOKD 3DM5A 4BPBA 4DC9A 3QXHA 4A2QA 2Z83A 4D0GA 4PO1A 2PT5A 3DO6A 1EESA 3ZIAA 1XJQA 3HU2A 2IYSA 1R6BX 1NLZA 2ZJZA 4NCJA 4YDHB 2JJ8A 2FMXA 3MWYW 1SZPA 3DKPA 3DKVA 2I3BA 3TVDA 4NYMQ 4GFDA 2J41A 3M1IA 1M34E 2XZPA 2PCJA 2ZSAA 2VLIA 2FV8A 4FIDA 2IWHA 4CVNA 4CEJB 1KMHA 4DVGA 4X8OA 3ZZ0A 4MRPA 3LBHA 5AUNB 2IEZA 4C0SA 5FL7A 1XD2B 2W6JA 3Q9LA 2J5XA 2G1KA 1AS0A 2C95A 2HCJB 1KZGB 1QVRA 2KI5A 3EZ7A 3TVTA 1XZQA 2YC4C 2EWWA 3B8HA 4HB3A 4Q1FA 4QBIA 2QY9A 2YV5A 1YR6A 2VIIA 3VAAA 1OHHD 1XJCA 1EFRD 521PA 1Z0JA 3X1YA 2G83A 5EP4A 4H9GA 3B1XA 2GJSA 4ZI3A 2D62A 1OJLA 4Q9JA 1XWIA 2QENA 3QF4A 3EC1A 1ZUHA 3QJYA 4RZXA 4C0AC 2PX0A 1DG1G 3CO5A 4KLNA 2IWRA 2IHBA 2CCKA 4ZDWA 2CLCX 1MH1A 1CR1A 4KCGA 3K0AB 5TB5A 2A2ZA 2QGZA 5B30A 4ZKEA 1XBTA 2REOA 4XD7A 2WSMA 1Z6AA 4QGGA 3PUXA 3OE7A 5FI1B 4B34A 1E4VA 3KTAA 5F3WB 1P75A 1TMKA 4EFNA 4QG7A 4PC6A 5JFGA 1BMFD 3TIFA 2AL7A 2C03A 2BHRA 3M4YA 4JZKA 3QPVA 3GD7A 5EXSA 3NVAA 3PEVA 1AGRA 1KYIA 1XXHB 3EARA 4JL5A 4AIIA 4YMUA 3OF5A 1Y3AA 2AR7A 2LKDA 2ZRIA 1OLOA 4DDWA 1IBRA 4WW0A 1GM5A 5KSPA 3NEJA 2CE7A 4LJ6A 2VQSA 4JYCA 4S35A 1IAQA 1JJ7A 1D6JA 2RB4A 4BZQA 2C04A 3T12A 2Z4SA 1BMFA 2OCAA 2ZE6A 5JSZA 3MAAC 5KDOA 1XCPA 3SS8A 3A1SA 4JL8A 4OHWA 1Z2AA 3CWZA 4BLTA 5KUTA 4L9WA 1HA3A 1QHGA 2OBLA 2P6NA 2QQ0A 3FHOA 4Q48A 2EU8A 4GOKA 3EPJA 4G1UC 2BMJA 3UG6A 4KBGA 3K09A 4LJ8A 4ERNA 4M9QA 1W48A 1TF5A 4IEEA 4M22A 3T06B 2WWYA 4IDOA 1NN1A 3PUZA 3ZJYA 4RJLA 1FX0A 3DEFA 3U7GA 4WOPA 4O25A 3T1TA 3IO3A 4V0OA 3WP0A 2FEMA 4IVPA 1XCMA 3TQFA 4PZYA 3QBTA 2H18A 4GMXA 4C0BA 3EX7C 2P5TB 4HZIA 3CM0A 1YRBA 4LWZA 1RVDA 3LNCA 1Z6YA 2JLQA 1KAGA 1VCNA 3HPRA 3QE0A 1GIAA 5CIWA 2OAQ1 3SBDA 1A2BA 1SGWA 4OQXA 4O2RA 1CULC 3EXAA 2ZJOA 5AJZA 3Q85A 4A2WA 3CIOA 1AS2A 5GJBA 2EQBA 4RVCA 1XCGB 4PQRA 4QGAA 2V3CC 1RPZA 4URXR 1UDWA 1XTQA 3W6OA 2IA5A 4IXNA 3LX8A 3K70D 3V9PA 2ZANA 2V7QA 5JS8A 3ADCA 3FHCB 1KDPA 2ODWA 1N5LA 5SZIA 3VR6A 3K9GA 3KUDA 2QI9C 1N6RA 2J87A 2R62A 1U8AA 1HYQA 2I1VB 2IXEA 4UXHA 4KYIB 4EAQA 3H1TA 2QEQA 1CJMA 4XSHA 2QP4A 1DPFA 4RD0A 3EPKA 3A6PC 4JJZA 1IQPA 1CRQA 2LWIA 2H16A 1TADA 2A5JA 4P4SA 1E0KA 4ZO4A 3TUZC 4C9BA 2FGJA 4B76A 2NGRA 3TJZA 5JEDA 2B92A 1LFDB 4PSKA 3RRYA 5FOSA 4DDUA 2EYUA 3AVQA 1X3SA 3BD9A 4CT5A 1DADA 4FW9A 4OK5A 2QT1A 1TF2A 3LW8A 2XZOA 3CW2A 1ZU5A 1R4AA 2R6FA 4I1VA 1P2SA 3NEYA 3KQKA 2WJHA 4MGKR 3DMDA 4TYPA 4B3GA 3THYA 1L4YA 3B60A 4WIAA 3UATA 2OCYC 2YVUA 3GLGA 1Z0IA 3THOA 1MOZA 4Q66C 1Z5ZA 3MWKA 4A1FA 3MJHA 1KK2A 1YR9A 3DVLA 3NTUA 3QKSB 3QVVA 5M04A 2Z4RA 2XB2A 4LBZA 1JALA 4ZCMA 3QQ5A 4B47A 1R0YA 4DLUA 3SN6A 3VR2A 1JQJC 2WAXA 2ZRNA 1JR3D 2ZUCA 3RS5A 4PFSA 1Q3TA 1E0SA 1WDTA 1YQTA 2GVDC 1E79D 5HR5A 1K8RA 4IOKA 4DB4A 4M53A 3TSWA 4AD8A 1Z0FA 3ND8A 1II9A 1RIFA 3BB4A 3L8YA 1TPZA 2WV9A 4HI0E 2QE7A 4IFEA 4HLCA 2J7KA 1CRPA 3SI7A 2WSSA 2XTMA 1Z06A 4L5BA 5ANRB 1Q57A 3NWJA 1P7CA 3WBJA 3ICQB 5FTMA 1G7RA 2V54A 3SC3A 2C96A 3EZ2A 3VTKA 1M1YE 1UKZA 2ZI4A 5FPTA 2XB4A 3T15A 2IYRA 2FPKA 4RD2A 3WXMA 5L3SB 1KO7A 3OZXA 2HF8A 3B1VA 4TMXA 2CLSA 3QI2A 4LK2A 4LV5B 2F3RA 1W5SA 3OAAA 1FOEB 4UXJA 4L9SA 1AZTA 3SEAA 2DCUA 3X1XA 3CF2A 1IOZA 4MRSA 2FSFA 4RD6A 4N1AA 1TQDA 2BM0A 5TV2A 1T8TA 3HPQA 2UVQA 1M7HA 4L8GA 3A36A 1CF4A 2C2HA 3ZVNA 1E9DA 1ZC3A 3KB2A 1Q1EA 3L0OA 2J1LA 4XTCS 2BDTA 4DB2A 4NHOA 1E2HA 3QIAA 3CPEA 4PQYA 3A1VA 1DAHA 4UXIA 3CH5A 4FMCF 3PVSA 2G0NA 2WKPA 3TAUA 3OHMA 1E2MA 2XX3A 1XNJA 2MSDB 3L2OB 3AKDA 4YMVA 3EC2A 4L4UA 4V0NA 4OQNA 4GZMA 1TEVA 1IM2A 3A8TA 3L0PA 2ZYVX 3I4LA 3I61A 5FBLB 2B7CA 3DDCA 3V4FA 4DIEA 2QTHA 4NBSA 3FMFA 3W3AA 1OKKD 4HAUA 2WKQA 2BKUA 4PZZA 2W2XA 2OXCA 3I62A 1H8ED 2AX4A 4DJTA 2YINC 4BFZA 1COWA 1N0UA 4LDJA 5JZVA 2QPTA 4PPQA 1EX7A 1UAAA 2XOKA 4BLQA 1HE1C 4D4MA 4TMKA 1G3QA 2G77B 2ZYTX 1IXRC 1VG8A 4HB4A 4RD4A 1F2UA 1Q12A 2XJ9A 2O0HA 4Q7LA 4DT1B 2ZE8A 1X6VA 3NHAA 3G5UA 4QBGB 1IJFA 2WOJA 2X2EA 3MSXA 4CYMA 5JCZA 1AQUA 2ZI7A 2WWXA 4FN5A 1OXXK 4LYAA 4BRWA 3IILA 1G8YA 5KU1A 1Q1BA 3ZLJA 2J9RA 4DBLC 1YZNA 2Q0HA 2QMEA 1KI6B 1ZVQA 2IC5A 2RH5A 2CE2X 4LV8B 2Q3MA 4U7DA 2VF8A 3K9NA 3VX3A 4EJSA 2ZREA 1E2QA 4AYXA 1EG7A 3N70A 1E1RA 3PR1A 5K8TA 4NTZA 1GOTA 3WYAA 1N6KA 1FNNA 2F1JA 4GRAA 2VO1A 3HYRA 4TMTA 5LB4A 1UFQA 1FP6A 2D2EA 4HLUC 1OPXA 3QPUA 5E7MA 1X8KA 4AC9A 3C5HA 3FOZA 1U99A 4JLDA 5IF9A 5CK4A 3MRSA 3K0EA 4R98A 2VPPA 1GL9B 3WP1B 4DEYA 5BW8A 1XTJA 3CR8A 1QBKC 1MKYA 1GFIA 1JB1A 1OT3A 3K09C 2GDJA 4B32A 2J0VA 3QOFA 5AJYA 3SBEA 3B5JA 1U94A 1SXJA 1KI3A 4MA4A 4NYMR 4Z51A 2X19A 4BFWA 3KJHA 1BYUA 4PPNA 5FPKA 4NCHA 2NPFA 2P5SA 3Q3JB 1NRJB 1U0JA 3GJ8A 2PX3A 5FOUA 5HE8A 5IDVA 5AUOB 4JS0A 4LV6A 3UKDA 4F4JA 4F93B 4DDTA 3BERA 3MMPA 2OO7A 5EXTA 3K0FB 5KNCA 1P9RA 1GKYA 4KODA 5EZ6B 2DWPA 3AB3A 2V9PA 4WXRA 1NY5A 1E98A 1II8B 3RHFA 1Z6XA 5FR2A 2ZRBA 4PPGA 1GVNB 4XVQA 2GVZC 4G5OA 3BWDD 2JJ2D 1WCV1 1ZAKA 1FFHA 2IUSA 4JVMA 1U8YA 1KAOA 3T1QA 4KV9A 3UMFA 3FDIA 4TTRA 2H7VA 1W44A 1ZM2A 1E9SA 2YC2C 4TL7A 4V0LA 2XJ4A 3PEUA 4BLRA 3P1JA 2OAP1 1JPJA 3QKSA 2BJVA 5CJ2A 4QHTA 2R6AA 5JECA 2CCGA 4QBFA 1E0AA 4JLVA 3PIRA 4X8HA 3CKLA 1AA9A 3E1SA 3KJIA 2O8CB 1KI4A 4MGZR 3RS2A 2ZETA 4OQLA 3DM9B 3RC8A 2BWJA 3BRWD 5L3SA 3L43A 4B2IA 1AM4D 1P9NA 2CL6X 3CNLA 3I92A 5DSZA 4GSYA 2O8CA 4M1SA 3AP3A 4PX9A 2Z0MA 1A2KC 3C41J 4JT4A 1KGDA 4HATA 4GI7A 2YWGA 3AGQA 4N3NA 2QSZA 5KSZA 2AWNA 4LJ4A 4RFVA 2O8DB 2ATXA 3GEIA 2F7SA 5KOYA 2WBLC 1CIPA 2XEXA 2ZROA 3IHWA 4JMPA 1E32A 1D2NA 1D2MA 2ZRAA 3EIQA 4D0LB 4BQSA 3U5ZB 4FWTA 4W9MC 5AWFC 2J59A 2HCBA 4U00A 4M8NE 2BEJA 1S9DA 2RHMA 5IK2A 4ON9A 5E3HA 5FI0B 2ZI9A 2QMOA 2ZQ5A 3LXXA 3ASZA 2ZI6A 2DFTA 4Q01A 2ZYUX 3SJAA 2D3WA 3CRRA 3VHLB 2V55B 3WRYC 4E5UA 2RHDA 2BOVA 2V4ZA 4BECA 5LPNA 1DARA 3EASA 2CK3D 4PHFA 3D6TB 4A82A 3IUYA 1NVVQ 2DR3A 3JVUA 1WE2A 2VP0A 3I1FA 4F4CA 2Q6TA 3AF4A 1E2EA 1SVOA 2HJVA 3LVQE 2HUPA 2OFOA 1Z0DA 5B2ZA 4A8JA 1XRJA 2JLUA 4R2HA 1JEEA 4QGHA 3WYGA 2AN9A 2ZRKA 1E9EA 4JBYA 3VR3A 4NH0A 4G5RA 4OI0A 1WRBA 3ZGXA 3SHFA 3CWQA 4BASA 4ESHA 2GF9A 3CNOA 4WXPA 3VU9A 4HYYA 4GOXA 2GBLA 3CZQA 2AHOA 4FCTA 4D4LA 1IY2A 2ZI3A 4XVRA 1G3IA 2UZ3A 1OXVA 4XWKA 2RGNA 3B6EA 2ZYWX 1N0VC 1SVWA 4KFTA 3SNHA 4ZCIA 3SOPA 4PHHA 1P2UA 2QBYB 1DE0A 1P3JA 3I32A 4BFYA 2FSGA 1RYHA 2ODEA 3HWSA 1XEXB 2JDID 1YZUA 2ZRHA 4LY6A 3KFVA 5BN5A 3IIKA 4EJSB 4NKRA 3W90A 1G16A 1DAIA 1F48A 1Q1QA 3GCGA 3NH6A 4TSFA 4DSOA 2WPDD 1N0WA 4A0FA 5KPJA 2RGNC 1ZD9A 1SKYB 1UDXA 2IXFA 1FX0B 4QNMA 4GOJA 1MABB 4JLBA 2BMFA 5CM8B 3R9WA 4P0TA 3RANA 1BIFA 5KO2A 5CYPA 2H5EA 4DXAA 2O5VA 1N5IA 1FTSA 2CXXA 2I4IA 2OSBA 1SKQA 2WZQA 4M1OA 4E07A 3BH6A 3W8RA 4P32A 1F5NA 2BMEA 1G19A 1KI2A 1KK3A 3T5GA 4FD2A 2H1LA 3NBXX 4Q9HA 4ARZB 4ZDJA 5EE9A 1N6NA 4O3MA 4E09A 2K5UA 1NG1A 3B1YA 2J7PD 1KJYA 1II0A 1XMIA 4M1WA 2FU5C 5FPHA 1TF7A 4G5SA 4YMWA 5AJWA 4M1TA 1T3HA 2BEKA 2B8TA 5HPYB 2OM2A 3IBYA 3W5IA 1W0JD 4M1KA 1FTNA 3R9XA 4DSNA 4I4LA 4PC1A 5IK2D 1X86B 3PEWA 2J0QA 4A0RA 2ZVPX 3PFIA 3FGNA 1GITA 3QNUA 3GEHA 1ZCBA 4LHWA 3OIUA 4EUNA 1YZQA 1EFTA 1E96A 4EFLA 4XJXA 4KI0A 4QFMA 4RKFA 2PLFA 1T5IA 5AJVB 1E99A 1HT2E 2WAYA 2NQ2C 2P3SA 1Z63A 2W58A 2CVFA 2NG1A 2WHXA 1G8FA 4NU0A 2D4HA 4C0LA 1J99A 2Z6VA 1W2HA 4W5WA 1G64A 1YR8A 1VCOA 2WMOB 2NZJA 4PAQA 3C15C 3A4NA 1VDZA 1XEFA 1KKLA 1NBMD 2RGBA 2GXAA 3W34A 1U0LA 1NLFA 3E5HA 2XSZA 2ZRCA 5DI3B 4EJSC 4LSGA 4D82A 1KIMA 1MR3F 1SVMA 5AR1A 5L3RA 5KYKA 2RAPA 2PT7A 3GFTA 1R2QA 5FBQB 4RZUA 1C4OA 1P73A 4OBEA 821PA 1QHIA 2ZUBA 1X1RA 1KNXA 2CNWD 3RC3A 1RRFA 1W0KD 5J4LA 3RDPA 2GK6A 4UNNA 1N2CE 1Z83A 2OT3B 3S1AB 1VTKA 2R6GA 2ZVQX 4NYIQ 1RRPA 2C99A 4P33A 2ZITA 3VR5A 4D25A 2FFAA 3RRMA 4B44A 2HYDA 1I2DA 5JEEA 3E70C 1TQ2A 3G0HA 2VSXA 1GNPA 3PJRA 3VKGA 1JQLB 4Q7JB 2WJIA 5JS7A 2N42A 2DFKB 4C7OA 4KAXA 4TN1A 4JLJA 2IF0A 2O8FA 1G6HA 3NBFA 1G20E 3RABA 3U3OA 5AJXA 1A5TA 2NO0A 1VIAA 2MSCB 3LDAA 3VR4A 1T3SA 4US1R 1T91A 2Q3FA 3B2EA 2F9MA 4URUR 1T8UA 1E9BA 3KFXA 3EPHA 3T1VA 2ZSFA 2FPMA 2F1HA 4ZPXA 1E4YA 1M7BA 2FZLA 3PV0A 1P62B 3HR8A 4YMSA 3RS3A 2GEVA 1KI1A 1ANKA 1R0WA 4B3BA 4B48A 1BOFA 4XVUA 3SFZA 2QAGA 2HLDA 4JYBA 3P4XA 2O8EB 1UM8A 2ATVA 2ANBA 2ZE5A 5GJWC 5FOVA 1G3RA 3U6KA 1U2RA 3VR1A 4B74A 4Q7MB 1RRGA 2GKSA 4TTPA 3AVOA 2GTPA 1XXHA 4TLAA 4GL2A 2PZGA 3OIYA 1JNYA 4JVLA 2KB0A 3PXGA 2CCJA 3WHKA 3AVWA 4HUQA 1KI7A 2E87A 1R10A 1UEJA 1S9HA 4BLSA 4Q4AA 2OEPA 1VIYA 2ZS9A 1YJ5A 1JJVA 3H84A 4C0HA 2ZRFA 3A1TA 2HV8A 4ABYA 4MGYR 1NNEA 3IIJA 5JI2E 5D3QA 4ZKDA 1CJVC 2OUKA 3W8NA 1QHHA 3IPYA 1HTWA 5IT5A 2A3RA 2WPDA 2JJ1D 4QC2A 2F43A 4C0QC 3AKEA 2CJWA 2QRZA 2B6HA 3E2IA 2JA1A 4URVR 4AY2A 2IYYA 4DLTA 1COWD 3QEJA 5DYGA 1HE8B 2PEYA 3M6AA 3WNDA 4PC7A 1D2EA 4GBMA 1G6OA 4Q9KA 2RGAA 1ZNXA 2XSZD 5FTJA 1CP2A 2V1UA 3IPXA 1OXTA 4HDCA 5FUWA 4HUTA 1PVOA 1F2TA 1NJGA 1GRNA 2OFXA 4NYIR 1XMSA 3LWNA 2V1XA 2D2FA 1MABA 1W4CA 1IHUA 3Q5EA 4HB2A 1PUIA 3GLHE 1A1VA 4BRUA 3P26A 4Y0VA 3SJCA 1IN8A 1KMHB 5SZHB 1TU4A 1SVIA 3U7FB 4P4SB 4URYR 1U98A 2D7CA 2JGNA 3ZS8A 3GLGB 1WF3A 1YHNA 2UKDA 3AF0A 2IS2A 3THYB 3TUIC 4AKHA 4QJ5A 2W00A 1KJWA 2OILA 1N5KA 1EX6A 1G8PA 1X8JA 3THWA 2A30A 2JLRA 4OJQA 4ASUA 3NH9A 1QHYA 5JHGB 5GJCA 2PZEA 4FMBB 1PV4A 3RRNA 1VG0B 2CBZA 2AK2A 4GP6A 1J70A 2KWIA 5FUXA 3IEVA 2X2FA 4QJ3A 4B75A 1Z0AA 1DAEA 2OCPA 4OKSA 4V03A 3I3SR 1O3YA 3OEEA 4M1YA 3R7WB 2WWIA 3BH7A 5JWRA 3LV8A 1AK2A 2QORA 3OAAD 4ACBA 2GCNA 2IX3A 4IVRA 3VNUA 1GNQA 3P32A 5E7JA 3UMRA 3FKQA 1L2TA 4DRZA 4TL6A 1OIVA 3LO5A 4DUGA 5HTKA 2QRNA 5KNDA 2QBYA 2X1VA 2W0MA 1NMXA 3EA0A 4A8JB 4JLNA 3ZD7A 3GJ6A 2W2TA 2GRJA 1K5GA 3AF2A 2OHFA 2QQEA 2QUZA 2AKAB 1Z47A 2ODNA 4B3DA 5JJLA 3CR7A 3V4RA 2CEAA 2ZS7A 3CZPA 4HAVA 2ZRPA 1ZIOA 2GJ9A 1HUQA 3BFXA 2JAQA 2W2VA 1ZM4A 3L82B 1H8HD 1HY3A 1NIPA 3BB1A 1I4DD 4LYJA 3HR7A 2V7QD 4R71A 3ZDQA 1DO2A 4KLZA 3GMTA 5DHFA 1XPOA 2QT0A 4M9XA 3RVBA 3NDPA 3C4JA 5HCIA 2CMKA 1GUAA 2DYKA 4KSBA 5C2JB 4FINA 4XH9B 3LY5A 1GTVA 1JPNA 5BYKA 1OH8A 4YLGA 1LTQA 4C2UA 5FOTA 4B33A 1JXOA 4LJ7A 4QHYA 4Q47A 1WA5A 4Y0AA 4HDOB 4A15A 4C4PA 1KI6A 1RFLA 1JXMA 2EW1A 2QP9X 1G41A 4WZAE 4MH0R 4RFSA 3U44B 2B8WA 4NCKA 2ZRJA 3AF3A 1YRAA 4URZR 2DWQA 4DLXA 4WA7A 4A2PA 2FSHA 5DN6D 4B43A 4Z8YA 2C9OA 4B6EA 3AP2A 1M7GA 1KZ7B 4NP6A 5EXPA 4BFUA 4RKEA 1T0JB 4EPTA 2F55A 4M1MA 1KI9A 3BK7A 4IHQA 3QBVA 2R8RA 3A4LA 3MLEA 2BIFA 4UKDA 4Q9IA 3SDZA 1ZC4A 3IBGA 4NYJQ 4M2LA 4UNQA 2DB3A 2F1IA 5DN6A 2HYIC 1XP8A 4JSYA 3CONA 4QOSA 2WWHA 4X8LA 4JLAA 4B2LA 2VEDA 3LW7A 5EP2A 3AKCA 4HSEA 1KY2A 4DKXA 4JJKA 3A1UA 1NP6A 3EZ9A 3K1JA 4YC7A 3SHWA 2JLVA 1R7RA 2RGDA 3JVVA 2PL3A 5BYJA 1NJFA 3QXJA 2F1RA 5JCPA 1OFUX 1R5OA 1SVLA 3TW4A 4AI6A 1MO3A 2AKYA 4L16A 4MKHA 4GDFA 1X1SA 1GRQA 3GJ3A 1O87A 2ZJAA 4TMWA 4PR0A 1IXZA 4W5HA 1JR3E 4MRVA 2GJ8A 2GHIA 3GEEA 2VHUA 2PBRA 3DPUA 5AUQA 1IN4A 3SYNA 3IHLA 1T0HB 2XAUA 5GVRA 1Z0KA 2C98A 4G5QA 4DSTA 3OFND 1K6MA 3K53A 4L15A 4MRNA 4ARZA 3R8FA 1OH6A 2G9NA 5EXXA 4C0JA 4F38A 1NMYA 2YWEA 1GNRA 4QJ4A 2EFGA 4HUQB 3T35A 3TE6A 3LH5A 3NG1A 3FFAA 3NIBA 2GZDA 1KMQA 1NY6A 1MV5A 5L3QB 2QMUA 1E2KA 1XTIA 4IOJA 1CJUC 2FA9A 4QBHA 4XOIA 1SVKA 2CL7X 4BLOA 2JLZA 3THXB 1VYVA 3PITA 2DWOA 2NO9A 2WJVA 4M21A 2MSEB 2W6ID 1Q0UA 2VP6A 1ZP6A 3KL4A 5CB8A 1XB2A 4TMVA 5EQTA 2NO1A 2NMVA 1FNMA 2FE4A 5C4GB 3SQWA 3BXZA 1KOFA 1FUUA 721PA 1KO4A 4Q21A 4V0ME 2FN4A 2F6RA 2NO6A 3SU8A 3VMFA 2IS1A 1OB5A 2RMKA 2FPLA 1G4AE 2DPXA 3GJ5A 2J45A 4ILEA 1II8A 4PO9A 3TAHA 4LBVA 2G6BA 4TYWA 2LCFA 1QHSA 2IUUA 3K70B 2ECKA 1EXMA 3ZZTA 5EJEA 3QSYA 4XIGS 1GL7A 1KDTA 1QG2A 1PUJA 2AD5A 3BGWA 3I73A 4LHXA 1EFCA 4X8MA 2N46A 5DI9A 3HU3A 5CM9C 3ZYCA 3U60B 4I1UA 2ORIA 4DIDA 2CHGA 3TUJC 1FQJA 2YNMA 1GRRA 3IIMA 4HLUA 4OJKA 1ZM9A 5H68A 421PA 1IJEA 2P2LA 2REBA 5KTYA 4CEHB 3RNLA 3H2YA 3B85A 4OK6A 1NN0A 1UADA 3LAWA 3GFPA 4OQFA 2ZAMA 2QAJA 2FEOA 4BGDA 1B23P 1CTQA 4IW3B 2FZ4A 5FPYA 1DO0A 1R0XA 1XEWX 1P61B 2IEYA 4B3XA 2RGEA 5G53C 4DLWA 4DCNA 1RRCA 1G18A 2JIZA 5FBRB 2HDNB 1ZNZA 2JLSA 3KQNA 2GNOA 5FPSA 1A82A 1R5NA 1ZW6A 4BFXA 2WICA 4BWYA 3ADDA 4O2LA 4AG5A 2NZ8A 1E1RD 3AEZA 5EE3A 3U7HB 3ZH9B 3GLHA 1IN5A 2ZSBA 2H17A 3BFVA 4P31A 3EPLA 2Q21A 1GAJA 3SJBA 4KFUA 4Q00A 2A5GA 3KUCA 4EFMA 5EUMA 4HB0A 3S1AA 1Q20A 5BN4A 4A6XA 3LRPA 4TQAA 1OYWA 4DDVA 2ZU0C 4IEIA 1E1QA 2H57A 2EFEB 4LJ5A 3LBNA 1G5RA 1U9IA 1YR7A 2VL7A 1ZBDA 3K8YA 1IN6A 1NIJA 2OV2A 4QGFA 4A0HA 2Y8EA 5JWOA 2AFHE 2D06A 3QKUA 4KVAA 5J4YA 2JEOA 1GP2A 3B1WA 3RS0A 5FL7D 1CXZA 2WWWA 1VYUA 3WMGA 1I2MA 4Q1EA 4KBFA 4TT3A 3A4MA 1VG9B 3D31A 3NXSA 8OHMA 5G3YA 3TRFA 2OG2A 2AK3A 4JLOA 2G0TA 2AWOA 5CLQA 3TSZA 1E2PA 2HT1A 1E94E 3BAFA 1C9KA 4JBWA 4CT4B 3BB3A 1S0UA 3F8TA 4LPSA 1FW6A 5DGXA 3P20A 3SFVA 4QXAA 4CRWB 1HURA 5H1YA 3KJGA 1D9XA 2AD1A 3TNFA 2PLRA 4V0KA 1NKSA 3CLVA 1CKEA 3KKMA 1XTRA 1OF1A 4LZZA 5FBWB 4AK9A 3VU9B 5LD2C 1OE0A 4JT2A 2FDCA 5E4FA 3PG5A 3CX7A 1DELA 3FKSD 4Q5IA 4BE7B 4MYCA 2BCJQ 4AKGA 4O0MA 1G4UR 3L0IB 4UNSA 5FBVB 3EIHA 3GLIA 5BXQC 2O8EA 3BC1A 4LJ9A 1PZNA 1P2TA 4LUCA 4AURA 2GAAA 1LS1A 1ZUNB 3AGPA 2IL1A 3SE0A 5BQ5A 4FCVA 3FYHA 5EUQB 4OHZA 1G7TA 3GLIB 1HEIA 1ZIPA 5D3MB 2IYQA 3HDTA 4US2R 3PEYA 1BKDR 3QY0A 4Q1CA 3T61A 2X77A 2WWFA 3EZ6A 2BV3A 3X1WA 1XPUA 3U3JA 2OLJA 1DG3A 3AQ4A 4LC1A 1E2LA 1XD8A 4W5JA 1XPRA 5G41A 3MWJA 2VA8A 3DOEA 3IQWA 3FB4A 4TT3D 4EPWA 1Q3HA 4WZBE 2BBOA 2GWHA 1F2TB 3GLFA 4JKYA 4A8JC 2ORWA 4NCIA 5FOXA 1KNQA 1A7JA 3TQCA 5AUPB 2KBEA 5J4HA 2BBSA 3TBKA 3UXMA 1TTTA 3WBKA 1JR3A 4N0DA 1J2JA 4URWR 1OFIA 1DEKA 3ZVRA 2WSSD 2NTYC 2OE2A 3REFA 2BJWA 4US0R 3K9LA 1ETUA 1E1QD 4I1OA 4CW7A 1OXUA 3QKTA 3N2EA 1SHKA 1S4QA 1R8QA 3BS4A 3OEHD 5DE3A 1EWRA 5JHHB 1OIWA 2IS4A 2YHSA 1KHTA 4HEJA 2KE5A 2QZ4A 4CZ2A 3K9HA 2W6IA 5B64A 5KHOC 3FHTA 4B73A 2OFWA 3ONWA 3VNVA 2P6RA 2BCGY 2ZAOA 3MUFA 4PC2A 2L0XA 1T5LA 1NSFA 4HAXA 1UBEA 1MO6A 5DHAA 2FFQA 2PMKA 1PLKA 1R8SA 5CITA 1F2UB 5E7IA 3V00A 3C5CA 5JMTA 3D8BA 3MG9A 5JSZB 1XD2A 2ODBA 1LV7A 4G5GA 5C18A 4IDQA 3TSOA 4XWAA 4LHVA 4OI2A 4D4KA 1P5ZB 3CUEF 5F2EA 3GFOA 3N2IA 3OIVA 2XXAB 4AYWA 3Q7QA 1AKEA 3QF4B 1TEXA 3OESA 3CRMA 2PEZA 1XU4A 2BC9A 4ZDKA 4LHYA 1XXHE 1JR6A 3GLFE 1W4BA 2A7QA 5EE1A 3ZD6A 2QGNA 2DHRA 4PQFA 1ZCAA 2JDIA 3X2SA 4G0NA 5J40A 2XGJA 1VYTA 1LS6A 3GQBA 3LBIA 1DAGA 2VHTA 5EZ5A 5K8IA 1YZKA 4PPFA 4F91B 1XJ0A 4U02A 3AVXA 4AKIA 1P60A 3I72A 4MDEA 2BKEA 2ZJ5A 4HAYA 3TLXA 1MT0A 4Q02A 2XNSA 1ONBA 3JZAA 2EYQA 4U5XA 2CVHA 1D5CA 5JRJA 5BN3A 4QNRA 4A6PA 1E9CA 1DAMA 1SQ5A 1AGPA 4JBXA 3Q72A 5J4VA 1TAGA 2P6UA 1L7VC 2ZS8A 1FMLA 4CGZA 4W7SA 3L0SA 1P4SA 5CDFA 2IK8A 4MKFA 2VH5R 5LBIA 5TXGA 5L8VA 2JLXA 1CS4C 4D6PA 2FH5B 1MRSA 1SKYE 2Q3HA 4H1VA 4IDHA 3B13B 5TMPA 3H4MA 4DSUA 2IUTA 5DNYB 1CJKC 1E2JA 4B35A 1DTSA 2QPAA 2NO7A 2N1BA 2HF9A 1M74A 1N6HA 1SXJE 2ZR7A 4RD1A 1OHHA 5DISB 5EE0A 3SR0A 5EP1A 1TNDA 1DOAA 2H8KA 3BOSA 4PSVA 2IS6A 1DVRA 4IJMA 3LFUA 5FTLA 1UPTA 3X1ZA 4BUJA 3Q7PA 4A4DA 4LYFA 5JWHA 3IO5A 3HP1A 1OW3B 2IYTA 3KXKA 4EPXA 2GCPA 1G5TA 2F3TA 4P4UA 5GADl 3M0EA 4A0GA 1ZRHA 4TYYA 2QTFA 4G01B 3KKNA 1ESNA 4RD3A 3VKHA 1EFUA 1T9HA 1RC8A 4NYJR 1TUEA 2IXGA 3BE4A 1OXSC 4HLQB 1XZPA 1ZJ6A 2YYZA 3FWYA 3KJEA 2AXPA 2FOLA 4MUAA 1IXSB 2ERXA 1UEIA 3QVUA 1QVAA 1KO1A 2RKOA 3GJ0A 1U90A 1NF3A 2KBFA 3PUWA 3QEOA 3ZIAD 1IONA 5FL3A 4QM7A 2PJZA 1M2OB 1P6XA 2C9YA 4Z54A 1XMJA 3AVYA 1UBGA 4EIWA 2ZJ2A 3OE7D 1TX4B 1NN5A 2G1JA 1Q44A 1G291 2PCLA 5FUVA 4KSCA 3FVQA 1S8FA 2IBMA 3R8CA 4D0NA 2ZUDA 5G3ZA 3KQLA 4OK3A 1E6CA 1HQCA 4IFBA 3ETLA 4IVQA 5FR1A 1WQ1R 1VCIA 4MRRA 1W36B 1SULA 3O8RA 3WY9A 1P72A 1YZTA 2QAGC 2HJGA 3WMEA 1JAIA 2VBCA 4UQOA 3F3YA 4XD7D 1RJ9A 5F9HA 3BFKA 3AUYA 5DO9A 1P9WA 3ZZUA 2REXB 3KZ1E 4V02A 3BIFA 1AN0A 1NBME 2C78A 2ZJYA 1UJ2A 4BFTA 2W6JD 4TZ6A 4DLVA 4TYQA 1XEWY 1GL6A 3GPLA 2A9KA 1GG2A 2BMDA 4K8OA 2XITA 2EVWX 3QG1A 5DYIA 1KI8A 2O8DA 4N0EA 1ZINA 4XSGA 3H86A 4IRUB 1EFRA 3A58B 1YVDA 2CDNA 2HXYA 1QHNA 4CDGA 1YZLA 3F5FA 4Q4AB 2VP9A 4JVSB 1HQYE 1ZM3A 1J7KA 1Z29A 2WIAA 5TY0A 4BFVA 4F4IA 1CR2A 1VMAA 3WNCA 2NOAA 5KSOA 1S3GA 3AV0B 2VYFA 4LOAA 1AQYA 5KNBA 5C4MA 1NVUQ 3C8UA 1H8HA 1OYYA 2ANCA 4Q9LA 4DLSA 2FFHA 3MJRA 3U44A 3UK6A 4RCZA 1VG1A 4I1SA 3U4QB 1E9FA 5KSYA 1KO5A 2R2AA 4KJZA 1OIXA 2YOFA 4ZV4A 3C14C 1DAFA 4HAWA 4H1UA 4YDSA 3KQHA 1V43A 5UKDA 4UJ5A 4F7WA 2VSFA 3AM1A 1XMVA 4KYUA 2YOGA 2J0SA 3I8XA 3W6NA 4DUGD 221PA 4GNKA 5FFMA 4MYHA 2R6DA 1U9IC 4JLKA 3QUSA 4A36A 1J8MF 1W2GA 2FGKA 2R65A 3QKRB 1F60A 5KDLA 1L8QA 1G17A 4RFSB 1Z6TA 4DCSA 1JEDA 3U6BA 4JLMA 1VCMA 4GPTA 4PAOA 2E9SA 1N6IA 2D7DA 4F92B 1R0ZA 1V5WA 5B57C 1N6OA 2FJUA 3WRXC 1NVWQ 3RWMB 2ERYA 4WBSA 2A78A 2GBLC 3RLFA 4DCUA 2ZRLA 2O8BA 3EIEA 2BBWA 4LBYA 4PHTA 2E1RA 2Q9CA 4HAZA 3B82A 5J47A 4JLPA 2P0EA 4TLCA 1AZSC 2YJTD 1NI3A 2P67A 5C1BA 2JLYA 4Q1DA 2EFHB 4Q19A 3WNBA 3C7KA 3QF7A 4XWOA 1LF5A 2XNDA 5SZKB 3W5JA 3R7WA 1W4RA 4ZDIA 3EAQA 1UF9A 4OQMA 2J0UA 2QG6A 4ZCLA 3K0SA 1E2NA 3EG5A 3ZVMA 1DS6A 4Q18A 3PENA 4FI3C 4UNRA 4LJAA 4IXMA 4HDQB 2CLDX 5A4JA 1KK1A 1Z07A 2EWVA 5HZKA 4TL9A 2QTVB 3UWKA 2O8BB 2GESA 1G3UA 2ZTSA 1KK0A 1E9AA 2EFDB 3U61B 4K81B 4M9ZA 4E03A 4DEXA 2A5FA 3KKQA 5EE5B 4PSAA 4Z1MD 5KDDA 1OB2A 1WBBA 4HZUA 2CJWB 1NL3A 1OFHA 2F43B 2FSIA 1KDRA 2W83A 3B9PA 2ZJ8A 4JSTA 3FMIA 5E95A 2G88A 5FUYA 4B6FA 5C46F 4OL0A 1KY3A 3AH8A 3I8SA 2MMGA 1FMJA 4OHVA 1E0JA 4KO8A 4FCWA 1YE8A 1KTVA 4A9AA 3DZ8A 1SVSA 3LQRA 5HKKA 1LB1B 1D8TA 3SYKA 1QG4A 3IDQA 4OHXA 4LC0A 3K0CC 2D74A 4BZPA 1T4GA 1NG9A 3K0FA 4ITRC 3RWOA 4DCVA 3B78A 1VKJA 4WZ6A 2EFCB 1GWNA 2QU8A 1W47A 2PMDA 3CH4B 3FMPB 1XX6A 3AUXA 3OEED 3PCRB 4FXPA 3GLGE 3SZRA 5A0FA 4UJ3A 4EPVA 5FOWA 1HV8A 3WMFA 4V0MA 3CRQA 1SXJB 2NIPA 3C16C 3TMKA 4ZIRB 1QRAA 2IYLD 3P4YA 4FMDF 3W6PA 5TVKA 1GDDA 1NVVR 4ASUD 2BVNA 1ESMA 1E9RA 1GKIA 4YXWA 5B58C 1J8YF 4POAA 4DLRA 1XDBA 2GCOA 3IQXA 4PTLA 4DLYA 2WM9B 1XFAA 3H0KA 5FTKA 3FMOB 4BFSA 3CNNA 1KSGA 1VPLA 4WVFA 2QM8A 2ZPTX 3GP8A 4D26A 4QL3A 3UIEA 4QRHA 3Q8XB 1ZU4A 2YWHA 1W46A 2QN6A 1G8HA 2OESA 2GETA 5CJPA 3K0CA 4B2PA 1G7CA 4PAMA 4AKEA 1DAKA 2JCSA 1KSFX 5IRCD 4YXWD 1CBUA 1FUKA 1E79A 1ZD8A 2O52A 4Q4JA 1EFHA 1VHLA 3U4QA 2VF7A 5A5GA 4NDZA 1XD9A 3THXA 4I81A 1MO4A 4BLPA 1W49A 1H65A 1XTSA 1ZNWA 3NBYC 5HKKD 2JLWA 5JLJA 3NC0C 3CRW1 3X1DA 4TLEA 3TR5A 3IGFA 1L4UA 2CHVA 2GAOA 5P21A 3TKLA 3ZQ6A 3THWB 3BBPA 4MGIR 3K70C 1YKSA 3AVPA 4GZLA 4M9SA 1S1CA 5F98A 5F9FA 1UKEA 2NPIA 3U3RA 3OFNA 1PJRA 1TQ6A 4TLBA 2JASA 2RGGA 1T3LA 1JECA 4LI0A 1OH5A 4NONA 1MO5A 1RW4A 2WJGA 3AKYA 4A92A 1J90A 4IOMA 4IDNA 5LB2A 4PHGA 2JIZD 3ICEA 1QHHB 1E2GA 2IYZA 4MITA 2WTUA 1RJ9B 2GK7A 2YKGA 2V6IA 1ZMXA 3W9YA 2VSOA 2OBMA 1Z8FA 2HT6A 3JZMA 2G3YA 4P3YA 1SHZA 4D81A 2ZM5A 1G9XA 1BH2A 3IKJA 1W36C 1G5PA 2VRWA 3RSOA 3NC1C 3MGCA 4EQ6B 2ZSEA 4LYHA 4CEIA 1N25A 1US8A 3TH5A 5TDHA 1IY1A 1KDOA 2ZI5A 4Z1MA 4HZUB 2QL6A 3LA6A 4GMDA 1EWQA 1KKMA 4FMDB 3EW9A 4AYTA 4KU4A 1W1WA 3VKWA 2QMHA 5SZJA 2XTNA 1N6PA 1FP7A 2A5DA 2V6JA 4Q03A 3BH0A 2GXUA 2ZIAA 1RYFA 1ZYUA 4E22A 5LD2B 1G8GA 1US8B 3A37A 2W0SA 3ZS9A 2FFBA 2VTKA 4M0LA 5FTNA 1NKTA 3U3MA 5HZHA 4Q1AA 1E69A 1MRNA 4JVNA 2OXRA 3R9IA 1Z3IX 3RAPR 5JI3E 1FZQA 1Z08A 2PZFA 4EKDA 5IHPA 5D3MA 3QENA 2OBNA 2VP5A 1UBCA 1WBDA 3PUVA 2J7PA 1FQKA 1N3BA 2OLKA 4D80A 2QAGB 2IF2A 2H92A 4Q1BA 4TSFD 3K0AA 1BS1A 1JI0A 2FG5A 3P27A 4IDPA 1W5TA 5LDDC 2DBYA 2GZAA 4OHYA 3DMNA 4TL8A 3W3ZB 3O8DA 4ZI2A 4XTRA 4WAUA 3CRVA 3TW8B 4LPKA 1Z22A 4ESVA 1DBSA 2JATA 5K8UA 4DWJA 4IKEA 2QPOA 2CL0X 3L8ZA 1A4RA 4NMMA 4OYHA 4PO8A 1LW7A 1U8ZA 3B9QA 1VECA 2GXSA 3ECCA 4R9UC 3SQXA 3NKVA 2VP4A 2ZR0A 2QSYA 1CJTC 5BWMA 4MQBA 3G82C 2VHCA 1UKVY 1WXQA 4OI1A 2GZHA 3AVTA 3CF6R 5DI3A 2C5LA 4ZIRA 2R9VA 2PJRA 4MKIA 1N6LA 4KFRA 5EP3A 1QDEA 1G7SA 2KSQA 4TWZA 3QPWA 4G3XA 3GJ4A 4KFSA 2LKCA 3NDBB 2YZ2A 1RZ3A 4JIMA 1C1YA 1E2DA 1AS3A 2QM7A 1EGAA 4TLDA 2ZXUA 3KDSE 4BEBA 3RS7A 1GZSA 1LF0A 1W0JA 2WJJA 4GP7A 1LNZA 1Q22A 3LX5A 2O8FB 4Q4LA 2J3EA 1Z6GA 3T1OA 4Q4JB 2GJAA 2JJ2A 2DY1A 4I99A 4C3ZA 1KO8A 5KPDA 3FTQA 1G3MA 2Q9BA 2QP3A 4R7ZA 1Y63A
chains in the Genus database with same CATH superfamily
1TUBB 4X7MA 3AIKA 2VXYA 3OQJA 5IKEA 5LWHA 2LE0A 3VVLA 3EZFA 1NLYA 2YQ4A 3MWLA 1T2AA 3G6WA 1VOTA 5H9VA 2WKRA 3INTA 3KG2A 3HDQA 3O75A 5GJVC 1URPA 3SEZA 1X0XA 4OIMA 3DL0A 4NBKA 1W6RA 4PNPA 4U1RA 4EHIA 3HR4A 3OA2A 4K46A 3DCJA 4QHSA 1JMKC 1CUBA 1ODFA 2Q4BA 4NZYA 4O4HF 5CX1B 2FWRA 4WLVA 3JCZA 1JJBA 1LU9A 2KW5A 3BG5A 5FWXA 5GP1A 3KOUA 5AXBA 1N36B 2AXEA 1L6IA 4K6FA 2WDPA 2RHGB 4G0WA 5I8ZA 1IQ0A 2DRIA 3I28A 3VTFA 3T5TA 1GU0A 3KR2A 3A2NA 2V8OA 2K7FA 3QPCA 1K92A 3ENKA 5E38A 2GA8A 1AH2A 3ZVLA 4D8YA 4TYNA 4IH1A 4HBGA 4WZZA 3K9BA 2Z8XA 4YQEA 5B6PA 5DWQA 5DIFA 4RCYA 4KVGA 4YONB 3SJZA 2FJPA 3BIJA 1EAMA 1JDBC 2Q4DA 1CZLA 3Q3CA 1AUOA 1GUZA 2BGMA 3MBKA 4JN6B 4RGBA 2YIJA 3ZOKA 1ZG3A 2QMYA 4R0MA 1X7YB 3E2PA 1IHPA 3HFGA 2EHDA 3CB4A 3DMHA 5LP6C 2JKYA 2WWGA 3OPMA 4Z8XA 3KXIA 4EMUA 2PE5A 3WTCA 4EQ6A 1LBEA 1BX3A 2C9CA 3B1FA 1LLFA 1MIOA 4WACA 3LCVB 4NPAA 1L5OA 1H3NA 1SXJC 3LVRE 5EESA 4C06A 4DV1B 4Q05A 2WOOA 2CHQA 1XTKA 1E62A 2X5NA 1AXEA 4Y9SA 1Q7GA 3V1UA 4EABA 5JCXA 1AGYA 5K20A 3DBRB 5CPFA 3TFOA 5IJ0A 3NBZC 1WVIA 4QVGA 3ORRA 3J81k 1NVKA 2I1LA 4MUFA 2WW8A 2ZIEA 1R8YA 2WY2D 4JD5A 3BRSA 4WJZA 4W7IA 3O03A 5IS2A 2WJYA 2AS0A 5KYYB 1ZD1A 5D2CA 1OTHA 2H2WA 2GJKA 3EYAA 3WNZA 4TQ9A 3GIWA 5CDHA 4QOFA 1U2QA 5JE8A 2I54A 3BCSA 4RPHA 2LIPA 5CFMA 2FSUA 1X7ZB 3OQIB 3DKRA 2NYVA 5GZ3A 1PX2A 1ELOA 1X92A 4MW6A 1IZ8A 1E5DA 1GQOA 1RE0A 2WU8A 2FLKA 5LFAA 2M98A 3DD5A 4NL4H 3AK4A 4OP2A 1OMOA 1YQEA 4IYRA 4D4GA 1NI5A 1ZK4A 3MD0A 3NOVA 4BX3A 2XB6A 2XTZA 3TR0A 5HE9A 2PH1A 2E5LB 3KWFA 1L4HA 3AP1A 1OSNA 1UMDB 3GNSA 2H29A 3Q7TA 4PIVA 2BFCB 3N5CA 3I8OA 1C4WA 4RGVA 4DA7A 1EUQA 4NPHA 2HTFA 5TVGA 2Q2VA 3VDXA 2Q6LA 3PGA1 4KXVA 3VC7A 1MG5A 2FLVA 4DRXB 3N2ZB 4E2ZA 4B80A 3PFBA 1UJNA 2RGCA 2X86A 3KZNA 1F0NA 2RKWA 3KNZA 1M6NA 4LOLA 3ST7A 1PLJA 2AXNA 2ZBRA 3R20A 4IIYA 3S6JA 4UEKA 4ARSA 4K03A 2DFNA 1UPCA 3CUUA 4YRPA 2I5PO 4JEIA 4QFCA 5DH9A 5FYDA 3N0RA 3C2QA 4TT8A 2REQA 3UMSA 3RG2A 2PFGA 5ECWA 4LHZA 4M55A 4YUVA 5SICE 4MS4A 1Y89A 3DEYX 1PJ3A 2HK6A 1SCNE 3UWOA 4BQEA 2ZDQA 3VHXA 8MHTA 3K4PA 4K9MA 1KEZA 1IJKA 1D8AA 5CXUA 5TNXA 1UJ6A 4FT2A 1EVLA 2GH1A 4CBVA 3IKLA 4I9NA 1GZ6A 3O94A 4XGIA 1H2HA 1T2NA 5LCXA 1M2KA 2QTZA 4LXUA 3FYUC 1AUPA 4G0PA 4TMZA 1MRZA 3L18A 4I4TB 4L9AA 4KXUA 3ORSA 3KTAB 5K6TA 4YT5A 5DBEX 1NBMA 2QTWB 5ES4B 1SOUA 1HDZA 3A4YA 3LBFA 4IWNA 3TK1A 3TR6A 4U39A 4C30A 3TLJA 3D6FA 3NUZA 1ATZA 1RKBA 1GILA 4FT4A 2ZRGA 3Q4GA 1MEOA 1LNQA 4TRJA 4FR0A 4AZTA 2PFSA 4DABA 1N34B 2ZYIA 2IT1A 4C78A 3PI6A 4Q82A 1VA5A 4AG6A 1V4NA 4AAYA 2PYZA 3INNA 2R6CA 5C51B 2RHLA 3ZG6A 1XJWA 4KO1S 1FFDA 1N5MA 3I2JA 4PANA 2N9UA 3KCNA 1ONNA 3SYMA 4F06A 1KU0A 3ETEA 3LGAA 3CUYA 3PXAA 5AK0A 1U81A 3A1WA 3TI7A 4QDXA 5A4IS 1UBFA 2H7XA 3EXIA 3T34A 3GF4A 4F4FA 1YQGA 3B48A 4IUDS 3D3EA 3GFRA 1C8KA 1NX6A 2YJNA 4JKIA 2XZLA 1QAQA 2ZBEA 3MYYA 1F8FA 2RK4A 4BDSA 5K0NA 4QGSA 3U9TA 2O0KA 2GCGA 1JHUA 1HT0A 3RSLA 4PBSA 3EXG2 3SC2A 1WEHA 1ESCA 5BY2A 5HZMA 4OJTA 3WQHA 1M66A 1NP7A 3HVUA 1U3FA 3ZHXA 4EHAA 3LK6A 1S2MA 2H1FA 5DMXA 2XQKA 5D7NA 5CNMA 3EDRA 2OPHA 3HCPA 3HCWA 1AIPA 4XD2A 3ROEA 2A1IA 3ISVA 3QH4A 2XV1A 3B7GA 1J97A 4HN2A 4ND6A 5LXTF 3RYTC 4CG2A 5CDGA 2HHHB 1YQQA 3KHKA 5KVAA 3DFZA 3AF1A 4ACAA 1KEWA 1ZM7A 4B5LA 3WADA 2HJSA 4RS3A 2YWFA 4KWCA 3H3FA 2WVJA 3SF8B 1SQFA 3H42B 4CM8A 1HLFA 3GLIE 4K6MA 2IW3A 1KEEA 3LLUA 3MMXA 3U3KA 3LYAA 4TZ0A 2PN1A 4WNAA 3TI9A 3QXSA 2X8JB 4I5IA 4TTQA 4LXYA 1J1ZA 4C3VA 2VDQB 4AMVA 2BGRA 2ZR9A 2WK1A 3F6RA 2G67A 4PXAA 4CF7A 3ZDCA 3MB8A 1TW3A 4RSMA 2RCNA 4NCNA 5HKOA 5ELXA 2E7ZA 1EE9A 2P40A 2WT8A 4M76B 3RC9A 3SYLA 3RU9A 2AG8A 2C8VA 4JL6A 5A0TA 3VR6D 4RX1A 2NU9A 4PVDA 1P5JA 3EVNA 2WC1A 3MINB 3RWBA 3UJ3X 4ENVA 3ZWWA 3HXMA 4PO1A 3GP3A 3IT1A 2IZOA 2UVPA 6ADHA 4U2DA 3U5TA 3P2KA 1XTTA 2HA6A 1R6BX 1H2WA 1NLZA 2XCLA 2ZJZA 3U3MA 4NCJA 4S04A 2JJ8A 1YL6A 1PR0A 2FN7A 2NACA 3G9TA 3WB9A 1SQ0A 1WOMA 2HA0A 4DBLE 2I3BA 1GUFA 4NYMQ 4CQNA 2GCEA 2QG4A 1J06A 3U26A 2DWCA 5DK6A 1BKYA 4C04A 2EEPA 2V5UA 3ZIDA 4I55B 2P91A 1WCIA 2I2AA 4UMFA 3WQSB 5L6LB 2WVGA 4C0SA 3PJEA 1YRQA 4N5MA 4C14A 3Q9LA 3CLUC 1TJ3A 3GQBB 3B8HA 3D0RA 1BW9B 2YV5A 1YR6A 1EB9A 2FR0A 3K9WA 4ZI7F 5DK4A 3GY0A 2I2FA 521PA 1Z0JA 3HKEB 3PPVA 5C34B 4S12A 2G83A 4RKWA 5CTAA 4ZI3A 2D62A 1YONA 2WUEA 2BR4A 2QENA 2Y0CA 4MR8A 5EHNA 2A33A 4CIWA 2WTEA 3NP7A 5LQRA 4Z4GA 4BE9A 5AM4A 3HDGA 4B7CA 2FRDC 2JVIA 1P0FA 8ATCA 3HK2A 1Q14A 2QTTA 2WV7A 2A2ZA 5TB5A 4FYYA 4J0GA 1D0IA 3NAMA 2GMWA 5B30A 4MPRA 1FDSA 2BFDB 1XBTA 4ZKEA 1QO0A 3U3ZA 2REOA 4QTTB 4XD7A 1ZK3A 2BT4A 4OLJA 3GWGA 1FTYA 3HEBA 4G63A 1P75A 5DHPA 4QG7A 4RMJA 1ZA2A 3T4UA 3GRUA 1S01A 3TIFA 2AL7A 2AW5A 2BHRA 3OX1A 1NI4A 3AB7A 1HR0B 1DQNA 1MORA 3NVAA 2QW8A 3HEAA 3F49S 3QFFA 1OXKB 1KYIA 3EARA 2BMVA 4XXHA 4YWJA 7REQA 2PO7A 3OF5A 4PG5A 1Y3AA 2ZRIA 1VJTA 1PX0A 4B6JA 1OASA 4DDWA 1EIZA 3GJSA 1GM5A 1AX9A 2FZWA 2CE7A 3ITEA 5KSPA 4XQGA 1THZA 5HIAA 1LLCA 1JJ7A 4DMRA 3PFCA 3VZQA 3K9FC 3WICA 3FI9A 1B6RA 4Y1RB 3WLNA 1ZJYA 4IUCS 2GD0A 4IZHA 5JS6A 1UBTS 3SS8A 3QX9A 2Y3IA 3VDNB 3O9ZA 2C2YA 1HA3A 3I6YA 3QU4A 1QHGA 1DRJA 4L9WA 3BWVA 2ETXA 4R2KA 3TLMA 3UG6A 4B6SA 1FS6A 2X6TA 1REQA 3FY4A 1A97A 1KQ3A 1W48A 1N1EA 2FEXA 3T06B 2OHXA 1SXQA 3V8VA 2P6PA 3UA4A 1M1NB 3P9PA 3MC1A 4MVYA 5IVPA 5F76A 3D8SA 2BFBA 5KC9A 4ROSA 1ZICA 3D5EA 2VDWA 4EB6A 3ACCA 4O25A 4IDGA 2YCBA 4TROA 4ESOA 1U0BB 5CVJA 1ISHA 1I3MA 2H1IA 1GQFA 4ZQFA 2FEMA 4TLMB 1ZX1A 1PEAA 4AZ3A 5I01A 1FBTA 3NKLA 4K3UA 1P5HA 3LPAA 4GMXA 4UCFA 5KWSA 3MUOA 4TM8A 4RTPA 3EX7C 2C20A 4MICA 1YRBA 4V39A 3P45A 4H15A 3L4BC 1RVDA 5HZGA 5GIPE 5JG7A 1A3CA 1JHAA 2YMPA 4XEHA 1JYSA 3AZOA 3I53A 3A0RB 2G76A 4CL2A 1KAGA 1XTUA 3IAAA 3QE0A 1MJGA 4ITUA 1M6YA 2ISSD 1XA0A 1THMA 3FIUA 3X1KA 5AVTA 3N8HA 1T13A 4RETA 1ZD3A 1K08A 5BNWA 1ZI9A 2JHFA 3IUMA 3NHYA 5LP6A 2ZJOA 3ZE0B 3S1SA 1X38A 1L8AA 2FZVA 2HRBA 3FG9A 3PCTA 5TS2A 2NUAB 2EF0A 1C0EA 2VJOA 3S70A 4O2AA 2R4UA 1P1HA 2P3QA 4D8VA 1X7HA 1UDWA 1XZNA 4N5HX 4Q9NA 3W6OA 4DCGA 4YT4A 2BFBB 3OZEA 3K70D 1U5BA 4X7PA 2ZANA 1UBOS 5JS8A 1XQ6A 1VSQA 1N2CA 4XEUA 4EH1A 1KDPA 1RAIA 1U3VA 2F17A 4AMYA 5DYWA 1BMDA 1S7CA 2WSLA 1H94A 2CJYA 3AILA 3BTSA 4G25A 3TKYA 3VR6A 3K9GA 4ZCPA 1QB7A 2D2XA 1QIGA 2V96A 2NVUB 1DFGA 2R62A 3RFCA 1DCKA 5AKZA 4BNLA 2B5WA 4MVJI 4OJYA 3H1TA 2QEQA 4QTUB 4XSHA 2H4JA 5CVCA 5HJ7A 3EPKA 4INZA 4HGQA 4LZJA 3OQHA 2VJLA 1TADA 3LGSA 1XNGA 1HRDA 1W30A 3T94A 3TUZC 1PVDA 1Z2PX 2Y93A 2JFVA 3HLKA 1Y4DE 1YOBA 3I4CA 1CUSA 3VI4B 1EXNA 2QR5A 4OMFG 2GEJA 5JEDA 3TL2A 3KEGA 2B92A 2XYRA 1LFDB 3H13A 1I7SB 2OV3A 4JJIA 2YHIA 5HFJA 4DR4B 5FOSA 3U3XA 5KCZA 1ACJA 2W4QA 4CMJA 2LVBA 3E3NA 4OK5A 2IELA 1N9GB 1TF2A 3LW8A 4JXZA 2XZOA 1V7CA 3R4CA 1ISGA 4K9DA 2UZ0A 3OOJA 5EYPB 3LQ2A 3V7NA 2AZMA 3LT2A 3C98A 3OJOA 4I1VA 4AS3A 1E3WA 5EJ7A 4KJXA 1L5KA 2WKSA 2VJAA 1DKOA 3THYA 3MMZA 1HEUA 5LU8A 3GLGA 1DMRA 2I7CA 1FF9A 3ONNA 4WOBA 1Z0IA 3R7NA 5HS6A 1Q92A 4Q66C 3MWKA 3NTUA 2H1OA 4EGAA 1TLTA 3NJ4A 3QVVA 2XB2A 3EEBA 4ZCMA 5IBRA 3VR2A 3ZD9A 4EG4A 2GCIA 3H2IA 4C5CA 3RS5A 5EY5B 5K6AA 2OXIA 3SC4A 1UPBA 4DV3B 1YQTA 3VI3B 4CMAA 3RYFB 3GT3A 5F3RA 2Y1OA 3H2BA 4YJFB 5JZMA 3RVRA 1JEOA 2QTGA 4M53A 3GRAA 3TSWA 4AD8A 2OCDA 2DVMA 3BB4A 3L8YA 4WN9A 4LGCA 2WV9A 3NZEA 4HI0E 3OIGA 3QP9A 4P9NA 3CN7A 2YVLA 3SM3A 3GMDA 5F2NA 3VVMA 2WSSA 1U0NA 4MTCA 4IDEA 3FYUA 1Q57A 1I33A 2E2WA 2VPTA 4GI3A 1QIDA 4GYJA 4HDSA 4G5FA 4UDYX 5FTMA 1G7RA 3WBJA 4P0PB 3ZJUA 3JARA 3ZHYA 4IO0A 4PRZA 3R3JA 3LK7A 3WOHA 2F3UA 5FKJA 3U62A 1OLUB 2XBLA 4D44A 1QU2A 1DIAA 5BSMA 5K0CA 3SHVA 3AEKB 3WXMA 4H6WA 5BW6B 3EFHA 4WKBA 1BE8A 2HIGA 2JK1A 4OXNA 4KRFA 3HN6A 4LK2A 3NUQA 4LV5B 2F3RA 3OAAA 2CY0A 1Y8ZA 1FOEB 4UXJA 1PJBA 1PNRA 1J2UA 2DCUA 2I55A 3CF2A 3K6SA 2J3MA 2C7PA 3L6RA 5LZ7A 4RD6A 4N1AA 5KX5F 2BM0A 4H18A 1I2AA 1U4NA 5TV2A 3TEFA 2HPVA 3ZBQA 4EYKA 2C2HA 3T52A 5F5NA 4YUYA 5FJJA 2YICA 3O1LA 1MMFB 3KB2A 3L0OA 5LWQA 4YJGA 4XTCS 4E7OA 3EZYA 3TOSA 5LZ9A 2XXBA 3E81A 4B8WA 3HZZA 3P0HA 3PC3A 3JATB 4P86A 4QT0A 4FYPA 4Y2JA 2Q50A 5AQ1A 1E2HA 1RI3A 4YY3B 1TKCA 1Y3DE 3A1VA 1JSCA 2OHVA 4L8FA 3OQVA 4UXIA 4W5OA 3KD2A 4RTMA 3BT7A 5BMVA 3TSAA 5AT1A 1WZIA 5ALWA 1E2MA 3OPNA 1Q7BA 1WHTB 2WSIA 3H2KA 3LS2A 1V11B 1WDMA 2EKQA 4ZP1A 4Z9YA 4WV3A 3GJZA 4J6FA 4ZOAA 2JFGA 1TFRA 4GZMA 3R0JA 3HZHA 5GOTA 3RVMA 4J0HA 3A8TA 3R6LA 4IIUA 4D8XA 4QELA 4HF7A 3I61A 3EQ2A 3VZBA 3ZCXA 3OEYA 1HKUA 4A5OA 3EZXA 2IOFK 4INJA 4EZBA 5HP4A 1TK9A 2B5VA 2YV2A 4LEIA 1YTUA 5JXJA 4NBSA 4LFAB 1G0NA 3BD8A 3MMSA 4MP3A 3W3AA 1M2HA 2C59A 1FQOA 3KQUA 1HO3A 4CTOA 4EKGA 1C3VA 3WLSA 3WZLA 3HKCB 1DWOA 1JKMA 1L5RA 3IPLA 4JBGA 1BDBA 4DJTA 1PGQA 1QZ3A 3AM5A 4O3FA 1ILWA 1HDIA 4WGFA 1N0UA 5JPCA 2WIFA 4PBRA 4RXUA 4DYHA 5JD5A 3RAGA 2PX2A 1EX7A 1U4SA 4KVFA 4OBXA 3RTBA 1M3SA 1BCRA 3U4HA 1R16A 5JAOA 1AK9A 1HE1C 4BLQA 1BU5A 4TMKA 1FJGB 1G3QA 2G77B 3OZUA 2ZYTX 4UHKA 4UOEA 1VG8A 3M9XA 4RD4A 2IDMA 5L40A 1G98A 3VHRA 2GARA 4XQEA 1Q12A 3STWA 2XJ9A 3NNNA 4Q7LA 1PQ4A 1WMEA 2ZE8A 3C7AA 4QBGB 1N77A 1XZJA 1XQWA 1L4EA 4N3BA 4PAGA 3MSXA 5K4GA 4QQFA 5JCZA 2ZI7A 3E84A 2WWXA 5JJ5A 4FN5A 4U2BA 2PBLA 1G8YA 1NUSA 1GN8A 5KU1A 3ZLJA 1EK1A 4G0XA 4KXMA 4MV6A 3SVTA 4NNJA 4UPVA 2JGEA 2IC5A 2RH5A 2G5TA 4U7DA 5A7GA 1U2GA 4PTZA 4GMHA 3L6OO 2V7XA 4EJSA 2O50A 3KSAC 2ZKIA 3PXDA 2H08A 3T3GA 4AYXA 1H69A 2Q2OA 2XE7A 5IYZA 1BCSA 4RJTA 5K8TA 3A6HA 1N6KA 4GECA 2F1JA 1SU8A 2A59A 3EHDA 4TMTA 1FP6A 2ZUWA 4HLUC 3MLBA 3OZTA 2VHYA 1X8KA 2H85A 1WJGA 1SXIA 4I1RA 4I5GA 3RRFA 5JBIA 4CDNA 2FR8A 1SIBE 1Z82A 4YUAA 1QYRA 4D9GA 3WK5A 4R98A 2VPPA 1GL9B 5HIIA 3K96A 3W5SA 5BW8A 2B1IA 2WTNA 3P0FA 1GFIA 5CEFA 3WWZA 2GDJA 3COWA 2P30A 2J0VA 2ZXFA 3QNWA 1SXJA 3MS4A 4MA4A 4NYMR 3ZU3A 2UXCB 2OGZA 2WSBA 1SC6A 3RIYA 1JU4A 2X3UA 4OHFA 2J85A 2YZMA 2PMCA 4JQZA 1Y5NA 4LRXA 5B3JA 5IDVA 2ECQA 4GKAA 3ANTA 5AUOB 5JOQA 5ALHA 5LOVF 3BJEA 5CDUA 3ABIA 3F46A 1S7GA 1Z38A 3BERA 2NM0A 2CUNA 1E8NA 1SPBS 2E55A 5IM5A 3U09A 2P5YA 3OCXA 4HWOA 5EZ6B 2V9CA 1LCIA 2V9PA 1LW6E 4WXRA 5EJGA 4FGWA 4BFCA 5K3OA 4IX1A 5BMOA 4R1QA 2ZRBA 3BXOA 3DWEX 1QKKA 5CNIA 3TTSA 3L7OA 5HEKA 1T6XA 2UYHA 3D6MA 1GYRA 4G5OA 2JJ2D 3RYHB 4BGVA 1XQXA 2ZIVB 4HMPA 4AKSA 4EVRA 4XPZA 2Z08A 2UZAA 3UMFA 1WOYA 2FWNA 2QN1A 1XRLA 2H7VA 2ZKLA 2YC2C 5DOZA 1KP3A 3CO0S 1SZCA 1F17A 1G8AA 1Q3KA 1FEZA 4HXFB 3TLBA 2LDBA 4F56A 2OAP1 4BWFB 3DT9A 1T5SA 4WK2B 1YS9A 3S2UA 4JJ4A 1LI7A 4UMEA 1BS2A 1CY7A 1K7SN 2MJLA 3UTDA 1VHQA 4FGUA 5EJMA 1GAEO 2JAPA 2H7YA 4JLVA 4AUMA 3RH0A 1SHUX 1JQAA 3VGJA 3CKLA 3FOAA 4N40A 2EJCA 2OV6A 3KJIA 1G21A 2CUKA 4BBZA 2EHJA 5EZQA 4YAUA 5K05A 1XGKA 2WNSA 2IITA 1BKSB 4MGZR 4TRNA 3QPAA 2Z9DA 4OQLA 3UMVA 3QVMA 3GFGA 3NEAA 4EBBA 2NX2A 3OP1A 4HYEA 4XM1A 3RC8A 3AEKA 1G5IA 3L43A 4KWIA 1AM4D 1Z5VA 2Y1CA 3FW1A 2DUWA 3R7DA 2O8CA 3DP9A 3E5MA 5CMLA 3GIDA 5K0GA 1HETA 1KGDA 3FJYA 1ISSA 1BS9A 4I8IA 3DDWA 7YASA 3HH8A 3DOCA 3MJ4A 3VR3D 1G0OA 2F7SA 1SCJA 5REQA 3KRTA 1E32A 5BN4B 3L46A 4OKIA 1UBRS 5CG2A 1D2NA 1GPMA 1D2MA 3EIQA 3Q9SA 3W8DA 3OIDA 4FWTA 3GYBA 4L74A 1FSSA 1T5TA 3IESA 4XVHA 4C2AA 4CLDA 1XZBA 3ETNA 2BEJA 2NXEA 2W8BA 5IK2A 5AVWA 4WCFB 3I6BA 5E3HA 1ZEMA 2ZI9A 3QPBA 4C20A 3CN9A 3CSSA 1OX6A 2TYSB 2HU8A 3ASZA 4JGIA 4IIFA 2I3DA 4NS1A 5JAZA 5EKDA 1LSSA 4W5RA 2WJPA 1THTA 5JCJD 4U6QA 1QP0A 5CG1A 4H16A 3PGJA 2V6GA 2DG2A 4R2JA 2F8LA 2M6RA 4D96A 4EW2A 5AESA 3LPNA 2C7BA 3B3AA 3AF4A 3C8HA 3RFUA 4EW3A 1E2EA 2Q1YA 4EB8A 1GGJA 3BDAA 1T1SA 1L3CA 5HDQA 4KDCA 4YMGA 2W11A 5EYPA 4BMPB 4RA6B 3DOHA 2JLUA 1Z15A 3KOWA 4QGHA 4R2HA 4GZ6A 4MV3A 3WYGA 5A0VA 3BHMA 1W5EA 4IQFA 5LYJB 1Y6QA 3RK0A 1M6HA 1X15A 4HOYA 3BXHA 1C4KA 1VZ2A 2R7AA 1RCFA 2E48A 4TXMA 4XFDA 1WRBA 2YJ5A 3RHTA 2RHRA 4FX5A 5BVHA 3C45A 4QUDA 3HO6A 1E7YA 3WHIA 2IBSA 1RJFA 3HM2A 3NAGA 2GF9A 4WXPA 3UW3A 3VU9A 5ALVA 2G17A 4Q3NA 3O38A 1YNSA 4E94A 1B8PA 1WZEA 3TD2A 3Q1KA 4FCTA 3H0CA 4I50F 1O58A 4O29A 1G3IA 2UZ3A 3G2KA 1HXHA 3I9JA 4TV8B 2QVGA 3B6EA 2ZYWX 4NSNA 5EZYF 1JSZA 1UT6A 2WG1A 3TS1A 2QMQA 1R6AA 3OQOA 4NAHA 1UWLA 1JA9A 2QBYB 1P3JA 1TCAA 1X7XB 3BGIA 2A1UB 4E2YA 4FLFA 1S3IA 1XEXB 4C0XA 1UMDA 2YMLA 4L8VA 2C2KA 2ZRHA 2QTNA 4MQFB 1UP4A 2EG9A 3E35A 3H2SA 3KFVA 4R8MA 1P39A 4NKRA 2JBWA 4M38A 3T3EA 3OJ0A 1XROA 3W90A 3IP1A 2AG0A 1F48A 2JJMA 2ZCUA 2ZTHA 5B3AA 4CIBA 3VPBA 2PUJA 2PKWA 3NYRA 3GLTA 4A0FA 1L7RA 3B9RA 1ZD9A 5KPJA 1SKYB 1TJPB 2L42A 4QNMA 3WB2A 4E31A 1IBMB 1LRLA 4P7GA 1X9IA 2BMFA 4BC0A 5KO2A 4J7CA 3HSKA 4DXAA 4FHZA 1JQBA 2CXXA 4F85A 2I4IA 2H07A 2WZQA 2R48A 1NGSA 4CMKA 3RV3A 1Q83A 3BH6A 1TOAA 1F5NA 3UNXA 1G19A 4XX0A 4X7RA 3T5GA 5IF3A 4ARZB 3PHIA 3D3KA 3ZHVA 3KDAA 5G0UA 3ZCSA 4O3MA 1KQGA 2G72A 3T7JA 3PNBA 2QN9A 1T5OA 4F5DA 3H8JA 2Y4OA 1ONPA 3KALA 5FYQA 2FU5C 4PLVA 2Y27A 4JSRA 4G5SA 1Q91A 4P8RA 4PSUA 5IJ0B 2O8NA 2WPNA 1AQIA 2WD7A 3P71T 5ADVA 2RJ3A 2EP8A 4KKXB 1W0JD 3C4QA 5F52A 4Q4CA 1YJXA 1Y1QA 4CV1A 4DSNA 5E3JA 4PC1A 4QDTA 1GLNA 5B2EA 1ECCA 5B7GA 5GY7A 2QZZA 3DNMA 4Y2RA 4GYKA 2J0QA 5H3HA 4FQ7A 2ZVPX 1GO2A 4NK5A 2W43A 5JH7A 4OQZA 1GITA 1B16A 3QNUA 4EA7A 4G36A 1G8JA 2XMGA 3F6PA 3GEPA 1K7CA 1DKUA 3OIUA 5HJ2A 3TTTA 4RSRA 3KPYA 1JIKA 2IH2A 1T5IA 1UFVA 5BSHA 5EPOA 3C6ZA 5IC4A 2NQ2C 2CYCA 2BEVB 2FUKA 3JYNA 2P3SA 5H4HA 2DFDA 3GLUA 3NIDB 3SJBA 3T9AA 1V2GA 2HD4A 2CVFA 2NG1A 1P8JA 1KU6A 4WNIA 5SY6A 2D4HA 4C0LA 3ZDRA 4YXFA 2AW3A 4N76A 4R05A 4W5WA 4DNOA 4PAQA 4KH1A 1PL0A 3B70A 3T4EA 3ZV4A 1NBMD 5ALOA 3PXBA 3RSQA 1D1QA 2GXAA 2XDQA 1TLFA 1X7GA 3EWIA 2ZRCA 3T3HA 2XPCA 2JLBA 2C82A 2X0EA 1KIMA 5C31A 4YRDA 5L3RA 1YA8A 3B3FA 3MSCA 4HH3C 4I7EA 1H0RA 1LI5A 4DMCA 4TZTA 5FBQB 1A76A 1IOLA 4Z7OB 1KNXA 3NVDA 5JAMA 1X2EA 3RC3A 4GPD1 1I5OA 1TO1E 1Y1KE 2XYVA 3H6KA 3RDPA 3VRHA 3GI1A 4UNNA 5KTKA 2OT3B 3AEQB 3F74A 3JQ8B 3OD1A 3B89A 4IO1A 3WNQA 4OSOA 1VTKA 3F6SA 4H7IA 3D59A 4HQLA 1KDVA 3RRMA 2BEVA 1UP6A 4B44A 4KQJA 2AC7A 2GPBA 4Y8VA 3ZN2A 1P4GA 4BMZA 3BA6A 1ST2A 2J9GA 1JQLB 4XPIB 5ICCA 2I34A 1GGFA 3PJRA 3JR7A 1EJ6A 2N42A 2DFKB 4KAXA 5IC6A 3OLYA 2Z5VA 1C29B 1RRKA 3HVKA 5E6SB 3ZEIA 5MGBA 1C1DB 4OSEA 4GXNA 3Q3GE 1DLIA 1G20E 3KR9A 3T7CA 3C85A 3U1VA 1QPBA 4O4JB 1DXYA 2AQ8A 3DB2A 4PZAA 5I8WA 1E2BA 2A5LA 3LDAA 1T1EA 1O03A 2ID7A 4LRYA 1K66A 2QTRA 2GZRA 4BB9A 3LOUA 2P2GA 3GCDA 2RI6A 3I04A 2F9MA 3R0QA 2DPGA 5AOBA 1T8UA 1D2HA 1E9BA 1T9CA 2GLTA 3EDCA 5JXIA 5C8VA 2FPMA 2PGXA 2I67A 1FFAA 1TO2E 3DYVA 3S2IA 4D3SA 2VK4A 4WFIA 1M7BA 2PGAA 1L5QA 1P62B 4XKJA 4YMSA 4D3DA 3OTOB 3P52A 3GDWA 3VPFA 1RWVA 3IPRA 4XVUA 2HLDA 1JR2A 1E7RA 2QJRA 1NAHA 1JHDA 2DLDA 4NBVA 1FK8A 5CA0B 1FXWA 2ZE5A 2ANBA 4WCFC 2ATEA 5BUZA 4FYKA 3W2FA 5FOVA 3QUCA 4LF6B 5DRTA 3FPHA 4KMRA 1SKAA 2ZZMA 4Q7MB 1QAMA 1E18A 5AMXA 1P7VA 3ONEA 1SOMA 2COKA 1NYQA 2HBZA 4WCDA 1JEYB 2V0CA 2O2IA 4HUQA 1R10A 3HB1A 1V2HE 1UODA 1ZRSA 3U7JA 4YEDA 3VU1A 3E7FA 4Q4AA 1HDEA 1QRUA 4G4JA 1FFCA 2Q27A 1YJ5A 3KJFA 1DRVA 3H84A 3TMYA 4BGEA 3EQZA 4YRSA 3DLTA 5DCUA 3WGMA 5IUNC 1B3BA 2B3TA 3H4TA 4FGZA 1KXJA 1LKZA 4GOMD 1CJVC 1OVGA 2K7ZA 3JAKA 3PC6A 5L4LA 4JR2A 2XLBA 4K1XA 1F9AA 2YMMA 4QZVA 5IT5A 5LXTA 1LJUA 4MGHA 5HKAA 2JJ1D 4FYXA 4NU8X 1O9GA 4C0QC 4OHBA 1SCUB 4OHKA 2CC2A 2QRZA 1BD4A 2XNCA 4BJ1A 2HWXA 2LDXA 3JYOA 1YQXA 2VWQA 3ZQ4A 4F1JA 1HNZB 4JI7B 1HE8B 1PT8A 4FILA 1MFPA 3WLHA 2HSWA 1WABA 2Y66A 3WGHA 1G6OA 3GLIB 2RGAA 1ZNXA 3FB1A 3N6VA 1I6LA 1LA2A 1D04A 3UHPA 1I2ZA 4BEVA 4BIMA 1XCLA 1JX6A 2GPAA 2PVSA 1WDLA 4MR9A 1OXTA 1U4OA 2GPTA 2XUQA 2O7NA 3DYIA 3HGMA 3KVOA 4HDCA 1WS6A 1Z8DA 5IBQA 3SG0A 2OFXA 1ECLA 2DQSA 1XMSA 3F67A 4NYIR 4X6LA 1KRHA 1JG2A 4OTZA 4BAUA 1MABA 2CFCA 4QU9A 2QD5A 3KM0A 3RT7A 1EVZA 4ND1A 4R1LA 4BO0A 4B40A 3SJCA 5SZHB 1KDYA 1GCIA 2AR9A 1M2NA 1SVIA 1QLJA 2JF0A 2VAXA 3FCSB 4GMKA 1ZCFA 4P4SB 1TQHA 2UKDA 2ONCA 4B3JA 3FPCA 3THYB 4NWIA 5DF1A 4NHEA 2VJMB 3TUIC 5CFLA 4C4SA 2EATA 1KJWA 2OILA 2XA2A 2RONA 1LSJA 3N7TA 1TTQB 1ZSVA 5IULC 2ZUEA 1EGQA 3M2TA 1WXWA 5TC4A 4DWWA 3THWA 3DWIA 4MUXA 2JLRA 3WLAA 4ASUA 4FDLA 1QHYA 8ABPA 1GZ4A 5KAPA 4EG1A 3PQ2A 2CBZA 2AK2A 4V1CB 3NJ8A 1UXKA 3Q7RA 3MWEA 4RHEA 3H2HA 5GGXA 3U37A 3HYNA 3ZBPA 2VCYA 1I36A 3QFRA 4O4HA 2Q28A 3LVFO 4GG1A 1CG6A 2FMHA 4GPEA 3AEUA 1O3YA 2GN0A 3B6IA 3I3SR 4KUGA 1JW9B 3N28A 4M1YA 1DQPA 3VV2A 5JWRA 4D97A 3ABZA 3ZW9A 2QORA 3MIIA 5F5XA 1MN6A 5EOVA 5E7JA 1KHHA 4ZEOA 4HT3B 3FKQA 4GXQA 4KNVA 4MMZB 3VO1A 4DRZA 4DUGA 1OWLA 5KNDA 3OLVA 1PR9A 2QRNA 3CWCA 3EA0A 1NMXA 4A8JB 2D8AA 3CMCO 3N2KA 1I7PA 3P9RA 4PZPA 5KJFA 4X6XA 3WSWA 5LQNA 1L0BA 2G5CA 1YQWA 2PKXA 3CG4A 3A3NA 4C3OB 4WBNA 2QRVA 2WM8A 2AKAB 1VPEA 2D1TA 4Z9XA 2FW9A 3QVJA 4MWOA 4IIXA 1OLXA 4ZVUA 1P31A 5ALQA 2X9GA 3CZPA 1BSVA 3EDOA 2GJ9A 3WLTA 2DKNA 4JROA 1SUFA 5TPWB 1G21B 1QGZA 2W2VA 1ZM4A 3L82B 4NK4A 2RHWA 5CB4B 1NJ5A 3D3NA 2O48X 1I4DD 2G7ZA 2R751 3OU6A 4LYJA 4NBRA 5J5AA 4KMSA 4CR7A 3HR7A 4UARA 2I80A 3SSMA 4KPUB 4C76A 2DWUA 1DO2A 1JA1A 2VSYA 5FWAA 1R6UA 3NTXA 3G49A 1JJAA 3L7YA 3E7DA 1QG6A 5HCIA 3VZCA 1QIIA 4EG6A 2DYKA 5C2JB 3LY5A 1AG9A 1JPNA 1UANA 4D0SA 3CTPA 3WE7A 3GELA 3K4QA 4YLGA 1LTQA 4H3VA 4DIUA 4YV1A 4C2UA 3M1YA 5FOTA 4ML3A 2XGSA 4GO1A 4JXJA 5AW4A 1H4SA 1K5PA 2O3UA 1QCCA 1Y4UA 2TS1A 4QHYA 4C7MA 2MR6A 1QK3A 3L01A 4WN9B 3CUVA 3KT6A 4I2NA 1RYZA 3CURA 4C5AA 3RVNA 4JT9A 2NQ8A 1L7NA 4BV2A 4DQXA 4WZAE 1A9XB 4HPWA 2B8WA 2XF8A 3TX2A 1Y5MA 1YRAA 2K2QB 4DQ0A 4HQOA 4MVCA 4JQSA 2ZIZA 3PRYA 1L5MA 3AUSA 3O1IC 3WNVA 4B6EA 4L2IB 4F4HA 4ZT3A 3EQ9A 3P19A 4YRZA 4ZHSA 2O19A 2P0AA 4BFUA 3R3YA 5DT2A 4M1MA 2KLBA 2F8TA 3BK7A 2WD9A 4INPA 1TJ4A 4N4AA 4BX9A 4IHQA 2JGFA 3QX3A 5DXJA 3O74A 2B69A 2R8RA 3A4LA 4UKDA 3IBGA 3HXPA 3QU9A 1I1HA 1TKBA 5KVQA 2AYYA 2FZEA 2G9VA 5ARDA 2HYIC 1XP8A 3F98A 3CONA 1RJGA 4QOSA 2QJTA 3Q7EA 2WWHA 2WILA 3EG9B 3I5MA 1XSEA 2VJKA 2ZBDA 4XUDA 2R1UA 2OORA 1PTKA 3FFXA 4GYWA 2RFLA 3AUFA 3PLNA 1V71A 3NTOA 4H7PA 4AJ4A 1YL7A 5A5DA 3K1JA 2EP5A 1BJRE 1RLOA 4OBBA 3SHWA 2JLVA 1R7RA 2RGDA 2PL3A 1MVOA 4PZUA 5DBGA 1VBKA 4QPNA 5BYJA 3UK0A 1PJZA 2F1RA 3DTNA 3QXJA 2RBKA 2Q8NA 3SX2A 3ITDA 4PCAA 3TG8A 1SVLA 1K97A 2BHNA 4CI9A 4MKHA 1O87A 4KYVA 4TMWA 4PR0A 4Y2YA 3PYLA 4I46A 3EHEA 2PT6A