1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
2ZRBA 3WY9A 4AYWA 2ZAMA 4XD7D 1X3SA 2G0NA 4HLQB 1UAAA 3FHOA 5FTMA 5LDDC 2BOVA 1SXJC 2GHIA 2ODWA 2O8FB 3H4MA 2Z4SA 3F0TA 4Q9KA 4HUQB 1VG9B 2AX4A 1E1QA 3SYKA 4EDHA 3RS2A 4IJMA 1J8MF 2OZEA 4GZLA 2A5DA 3SEAA 3WMGA 2ZE8A 3KJHA 4V02A 1IN6A 2J9RA 2OFXA 4EFNA 4ZPXA 3HDTA 4F92B 4B35A 3DHWC 3UANA 2WSSD 2WMOB 4MUBA 5IDVA 4DLTA 3AM1A 4Q4JA 4LJ8A 1YZUA 1JNYA 3O8RA 4KLZA 1PV4A 4WA7A 1KZGB 2YOGA 3R9XA 1S8FA 5LPNA 1S96A 1TF7A 2OCBA 3TSWA 1YE8A 2H7VA 1JPNA 1UM8A 2F9LA 2EYUA 3TUJC 2XXAA 2LWIA 3R20A 4FN5A 1BOFA 1TF2A 3OIYA 4B3FX 5H68A 2KWIA 1RRPA 4TYWA 2IXGA 2VYFA 5BN3A 4F91B 2ZRFA 5HKKA 2AK2A 2QY9A 4E07A 1Z2AA 1UFQA 1QVRA 3K09C 2LKDA 4W5HA 4M53A 4NPHA 4MRNA 4EJSC 5CITA 5KDOA 2O8BB 1XCGB 1W0JD 2YNMA 1KHTA 4C30A 3IIMA 2QBYA 2V7QA 2IYXA 3IKJA 1CU1A 4KFSA 4DDUA 4EKDA 2EVWX 1YZNA 4EPXA 4WZBE 5CIQA 2IT1A 1KI2A 2ZJ8A 4KV9A 1E2GA 4IVPA 2DFKB 1KO4A 3RRZA 3A58B 1GRQA 1A5TA 3X1WA 2ECKA 1VTKA 3TH5A 1G4AE 2F6RA 1S4QA 2EFEB 3LV8A 1ZNWA 5KSOA 3IQXA 3AQ4A 1TUEA 1G3QA 1KNXA 1Z06A 3LY5A 2ZS9A 2GJAA 3KXLA 2BMJA 1DELA 1AQYA 3CPHA 2GVDC 2QTVB 5SZKB 3VAAA 4S2EA 1G6HA 3K1JA 4RZ2A 1BYUA 3PVSA 3DKVA 5J4VA 3U7HB 3B5JA 3OIVA 3FTQA 2XZPA 3NWJA 2YINC 4MA4A 4ZDWA 5CM9C 1DADA 4LJ5A 2WICA 2IUUA 5H8WA 1IAQA 3BH0A 4ZV4A 5EE0A 1XTIA 2GEUA 4RKFA 2A2ZA 2VL7A 1E6CA 1W36B 2FZLA 4TMTA 5FUWA 5H1YA 4ZI2A 2H18A 2QA5A 3EIQA 1TNDA 3ND9A 4TYQA 2VHJA 1IXZA 1WDTA 3LRPA 1IN5A 4MRVA 4EPRA 3NEYA 4YMSA 3RNLA 3AV0B 1VCOA 4RD2A 4ASUD 5EXPA 3AKYA 121PA 1T3SA 4L4UA 1JECA 1KK2A 5SZHB 5FI0B 5K8UA 4OJKA 4FINA 2ZE5A 2REOA 1G64A 1IHUA 4J0QA 2VRWA 3X1DA 1G3RA 2OBMA 1VCMA 4LYAA 2AFHE 3MJRA 1QHSA 3AVWA 1MO5A 1DS6A 2V7QD 3Q5DA 2XSZD 3NTUA 5J40A 2R62A 3CUEF 5JHGB 5L3VA 4DCSA 2XEXA 3EA0A 2VQSA 3AVQA 2YVUA 3W6OA 2VTKA 2FN4A 5IHPA 1E9AA 2VHQA 4FCTA 4NCJA 4HLUA 1GDDA 1XEWY 2WAYA 1OJLA 3KXIA 2JLUA 1JEEA 1N6IA 1NSFA 1N6LA 4FMCF 4I1SA 5G53C 4UJ5A 2WSMA 2DCUA 4D0NA 521PA 4A8JC 1SKYB 5DISB 3W90A 4OQLA 2XOKD 3I62A 3HR7A 5DN6A 2O8CA 2PT5A 4GZMA 4OQXA 2OXRA 3W6NA 5FOUA 2VP2A 1H8HA 3A37A 3GJ4A 4EQ6A 5K8LA 2BMEA 1HE8B 1YR9A 4JL5A 4PSAA 2DHRA 2J0UA 3UWKA 2J0SA 1XB2A 5AJYA 2AXPA 2I1QA 4LRWA 2ZJZA 1M8PA 1T0JB 2EFDB 2R65A 3LVQE 5A4JA 2FGKA 2QEQA 4NYJQ 3TVDA 1XMIA 4AK9A 1HH4A 3WNCA 5B57C 4ZCMA 1XMSA 4WXRA 1W46A 3FKSA 3U3OA 1JR3A 1DO0A 4TQ9A 1CLUA 2ZI6A 2QRNA 1JAHA 3L0OA 4KFUA 1KO7A 1QHHA 1QHYA 2ORVA 5P21A 4XSHA 2IYUA 3T15A 4FMBB 1ZCAA 2JIZA 4E22A 3PUVA 1R8QA 1WF3A 4TLCA 4ZI3A 4Q4LA 2XOKA 3M4YA 5HCNA 4CT5A 4DLRA 4XWKA 2QQEA 2BBTA 1NKSA 4LJYA 3PUZA 1Z0FA 3CWZA 5TY0A 5IK2A 5LB4A 5C1BA 1Q0UA 4GOXA 3L2OB 4GP6A 4LWZA 4BFXA 3P1JA 4C0SA 4NL4H 3QUSA 4A9AA 5FBVB 3TSOA 4XWAA 2J7PA 1RKBA 4RFSA 1VDZA 4G0NA 4W5WA 2NO7A 4XTRA 2VSOA 5KNCA 3BS4A 4X8MA 2ZJAA 2C8VA 3B1YA 3GEEA 3BAFA 3GJXC 4CIDA 4D25A 1GL6A 1X8LA 4KODA 3WP0A 1TEVA 2MSDB 1E9EA 3FVQA 1X1SA 3CB4A 4IOLA 4OJQA 1MO6A 3WYGA 2QBYB 1KSFX 5FBRB 1ZM7A 2OV2A 5TV2A 3MRSA 3QXSA 3KB1A 1NL3A 2FFAA 2JIZD 3I1FA 1EFCA 1KO5A 3CNLA 3BB4A 1E3MA 2WWGA 2QZ4A 4A36A 2FV8A 3CRRA 2GDJA 5FPTA 5JBQA 1KK3A 4V0KA 1JB1A 1ZYUA 3BXZA 1Z0KA 1NF3A 3I73A 5DN6D 3U4QB 3ZVLA 4EIWA 2PEZA 1VMAA 2RHMA 1KMQA 4S35A 3KDSE 2OLKA 1VIYA 2GETA 3KX2A 1ONBA 2VF8A 4OHZA 4ASUA 1F6BA 1NVVR 1XMJA 1YZGA 2IHYA 3QE0A 4M1WA 3TJZA 3TE6A 2QGZA 4ZCLA 3UMRA 1RRCA 3AB3A 4IVRA 4M8NE 5G3ZA 3BBPA 1E2MA 2G3YA 2O8DB 2QN6A 4DZZA 1N2CE 2VIIA 1RIFA 1CR0A 3FMIA 1LV7A 1ZM2A 3UMSA 3O8BA 3VHLB 5KDLA 2RH5A 4TZ0A 4CEIB 1ESMA 2JASA 1V43A 3X1YA 3U3KA 2OFOA 2QP3A 3I72A 1OYWA 2YOHA 4A0RA 4HDQB 1KKMA 1D9XA 4GP7A 2B21A 3DM5A 1VG0B 3U44B 1M7GA 1XD9A 1MH1A 4FXPA 1Q20A 1XNJA 1Q1BA 4ITRC 2CLCX 4C0KA 2P6NA 5F98A 1N6PA 2ZI3A 4MGKR 1JR3E 1S3SA 4LHWA 3SC3A 1WXQA 3D8BA 2WTUA 5TB5A 1NMXA 1KK0A 2ASEA 4ZIRB 1AS0A 4YDHB 4C0JA 4JVMA 2BVNA 4JSTA 3PXGA 2XGJA 4DCTA 4Q9IA 1SULA 4UXHA 3L43A 3KFXA 4GBMA 5BW8A 4Q1DA 2OE2A 3GJ3A 3M0EA 4Q4HA 2DY1A 3P4YA 2QPOA 2W58A 2AK3A 4FMDB 2XB4A 3A1TA 1BYIA 3OIWA 5JSZB 4G5GA 2KJQA 1T0HB 2P2LA 4I1OA 2CVHA 4DHEA 1QHXA 2VF7A 3CH5A 3PR1A 3K0FB 1ZD1A 3OAAA 1AIPA 5C2JB 2XXAB 3THXA 1YVDA 2UZ3A 1I4TD 1RC8A 4BEBA 1FMLA 1NN1A 4IDPA 4GSYA 3ADDA 3QBVA 3SJAA 3R8CA 5FBWB 1BO6A 5J4HA 1NJGA 1QDEA 4L9WA 4M22A 2BEJA 2QU8A 4LC0A 4PHTA 2NTYC 4I81A 4QBIA 5TVKA 4DLZA 2AHOA 2J87A 3WXMA 2CNWD 1R8SA 1K5GA 2RAPA 4NE2A 3ZZUA 2BEKA 3A4MA 1UF9A 1P2SA 3A1WA 4Q1AA 4CEHA 2QT1A 421PA 3THOA 2WJGA 3AVYA 4A6PA 5C4GB 1XD2A 3THWA 2C5LA 4YMTA 1XCPA 4A0FA 1AS2A 3EASA 2J5XA 5AUNB 4CYMA 1Y63A 1G8GA 4PAOA 1HYQA 1SXJA 3D3QA 4NP6A 4NCNA 1DAGA 1R5OA 3RABA 4BASA 4EQ6B 1P4SA 1VCIA 5KPJA 4XD7A 1ZVQA 2XTMA 1YZKA 4URUR 2F1IA 4QJ5A 1FFHA 4G5SA 1GKUB 4M9XA 3G82C 4NYMR 3V4RA 1U90A 4O25A 3EWSA 4MQBA 2QAGB 1GAJA 4UJ3A 4TL6A 2HEIA 1OHHA 5KSZA 2PX0A 4B47A 4KO8A 1Z6XA 3IIKA 1ZBDA 3BH6A 4KVAA 3ND8A 1YR8A 1GG2A 2XNDD 5DI9A 5FBLB 3U60B 2WJJA 3MCAA 1N6NA 1PLKA 4GI7A 2KI5A 5HE8A 3QG5A 1ZP6A 4BFZA 2D7DA 5KPDA 2QMOA 3GLHE 3ZS9A 3BGWA 3EZ9A 5FR1A 2JJ2D 4QM6A 3BB1A 1OFTA 1EFRD 1XJQA 2IK8A 2ZTSA 1SVOA 4DB4A 4JVSB 3I61A 2KBFA 2UZIR 1GTVA 1QHNA 2QM7A 1VKJA 1KYIA 4MYCA 3R9IA 2FOLA 1NY6A 1T3LA 5FTNA 4OQNA 5CYPA 1G1MA 2ZRGA 2NZ8A 1JAIA 4DSUA 4A2WA 3A4NA 4MRPA 1AZTA 3KJEA 4D81A 1SVWA 1B23P 2VHUA 4TL7A 4AC9A 4DSTA 3NXSA 2FFHA 2D3WA 3THXB 1VG1A 2WKRA 1OV4A 2B8WA 4OI4A 3RS3A 2D74A 4C9BA 3U7FB 5M04A 3VR6A 1U2RA 1LS6A 1F2TB 2AXNA 3MFYA 3ADBA 5ELXA 3A6PC 4PPQA 1I2MA 3GLGE 2JLYA 4NYMQ 2BJWA 2WWXA 2ZQ5A 3VNUA 5BYKA 1H8HD 4GOKA 3ASYA 2BKEA 3EZ7A 4R9UC 2ZYWX 1T3HA 1T5LA 4NHOA 1OXSC 4LZZA 4URXR 3PEVA 1N6KA 2WKQA 4PXAA 4ZKDA 4V0LA 4LYFA 2D2EA 3KQLA 1KDRA 2V1UA 1KI1A 3TW8B 4C3ZA 4MDEA 2ODEA 5FR2A 3DOEA 2E87A 2HF8A 1C1YA 3GFPA 3CNOA 4A1FA 4B3BA 2ZUCA 1Z28A 2CHVA 4WOPA 4HB2A 4HAUA 3MWKA 3U44A 1ZAKA 4Q4AA 2ZRJA 2BHRA 2XX3A 4Q02A 3SZRA 1FX0B 3ZH9B 4BFSA 2O8CB 3PUYA 3VR1A 3RANA 5FBQB 4YONB 4TYYA 3NBYC 1XTQA 1HA3A 2ZS7A 1BMFD 5KDDA 2JJ1D 3BRWD 3SQWA 4A0HA 3GLFE 1XMVA 4RD4A 2VP4A 3P4XA 2QNRA 5CDFE 4MYHA 5GJWC 4ZDKA 3O8CA 4JVNA 1IN4A 1SKYE 5C4MA 1VHLA 3LXXA 1P9RA 1XF9A 1CP2A 1N25A 1EFTA 3THYB 2KSQA 2OILA 4IRUB 1OF1A 2N1BA 1ZM3A 3ZVRA 1TX4B 3LQRA 2WBLC 5JRJA 4PC7A 2QSZA 4JL6A 2A3RA 4X8HA 2C9OA 2BM1A 1M1YE 3BOSA 3M1IA 5FUYA 1Q3HA 4TYNA 5FOTA 5GVRA 1AZSC 1P72A 1A4RA 2HYIC 1R0WA 1KI6A 2OEPA 5JECA 1P3JA 3FOZA 1FTNA 1S0UA 3F5FA 1T91A 4OHWA 1U94A 1G17A 3KQUA 2B8TA 4POAA 4OQMA 3LFUA 4QHYA 1W0KD 3U3MA 5JS8A 1ZD8A 3CNNA 5FOSA 4DRZA 1OW3B 1Z3IX 4UNQA 3HPRA 2Z5FA 4IFBA 4Q19A 2EYQA 3Q5EA 1II9A 4M2LA 1U99A 3RS0A 2EW1A 2ZU6A 3VHXA 1Q1EA 1SXJE 5JS7A 2GXSA 4QBFA 3VQTA 5KO2A 3IBGA 2V1XA 4N0DA 1QHIA 4IXMA 4K8OA 3VNVA 3CKLA 3OEHD 2BMFA 2GVZC 2PLRA 2NO6A 3J81k 2NIPA 4LBYA 1KDTA 4DLWA 3NVAA 1WMSA 4FW9A 4Q18A 4A8JB 1WCV1 2QT0A 2ATVA 1XDBA 2Z4RA 5DE3A 2G88A 2XAUA 5CM8B 4PSVA 2BCGY 1N6HA 4PQFA 4RSGA 2HV8A 4QHSA 1O3YA 5FPYA 3K0CC 3PJRA 3QENA 2R44A 3PG5A 1J7KA 3UKDA 1UPTA 3JZMA 2IW3A 1QRAA 2AKYA 4KU4A 2CL6X 2J3EA 1G7SA 1UBGA 3AGQA 4D80A 4LJ9A 1QZXA 2IYLD 2OUKA 1C4OA 2PBRA 3THWB 2Q3HA 4JLAA 4IDOA 4L8GA 1S2MA 3AH8A 3CIOA 4MRRA 1C9KA 1E99A 2ONJA 1P9NA 2F3TA 1TQ4A 3AP2A 4JBWA 5JJIA 1H65A 1NN5A 3GLGB 1E32A 1ZW6A 4MITA 1PUJA 2O8BA 1RYFA 1EG7A 1IY1A 3CWQA 2JJ2A 2BIFA 3IGFA 221PA 1JJVA 1G8HA 2R6GA 3TIFA 2N42A 4P33A 5DHFA 2IEYA 2G6BA 4XWOA 1XPOA 3X1ZA 1AM4D 2C99A 2JDIA 1XEWX 2HF9A 2ERXA 1PLLA 1KKLA 1M7HA 1W7AA 2ZM5A 2XTNA 1ZIOA 2IWRA 3TVTA 1XPUA 2J7KA 2GCOA 1GVNB 4HB3A 3IO3A 4U02A 4TMXA 3NDBB 4MUAA 2AWNA 2ZITA 1QBKC 1W4RA 4L16A 2VO1A 2MSEB 5E7JA 5E7MA 4EPTA 1KTVA 4FWTA 2G83A 3N70A 2YWGA 2LCFA 4JMPA 5EP4A 3UG6A 1KAOA 3SBEA 2J1LA 4RZXA 1Z0DA 4LBZA 4OK5A 4Q7JB 1Z07A 5EUMA 1IN7A 4LYJA 4IDNA 2NOAA 4DDTA 3P27A 4G3XA 3VU9A 5CDFA 1ZM4A 3LLMA 4JZKA 1KZ7B 3B2EA 4UNNA 4ACAA 5JWOA 3EX7C 3H84A 4YLGA 1SVMA 3ICQB 1KO8A 1E2FA 4JLDA 1YZQA 2ZJOA 4TTRA 3KFVA 1DEKA 2JLSA 3IO5A 1S3GA 1BKDR 2Y8EA 1P62B 3B1XA 1L4YA 4WXPA 4QKQA 8OHMA 2F9MA 2QORA 1G3UA 4Q03A 1WP9A 1X8JA 3A36A 3SBDA 3FYHA 3PFIA 2UVQA 1P2VA 2ZRMA 1XEFA 1TF5A 4TT3D 2PZEA 2QMUA 1D2EA 2GF0A 3ZZTA 3LBHA 3R9WA 2IXEA 1G19A 2HJVA 1NVVQ 2PCJA 3WHKA 4OHXA 2GEVA 2VH5R 1V5WA 1ZNXA 4NCKA 3RVBA 1W2GA 4Q48A 3P32A 1EWRA 3ZD6A 4DJTA 2CLDX 4LHXA 3ZJYA 3BFKA 2OAQ1 3VTKA 2YV5A 5AUPB 1NY5A 2G9NA 5LD2B 2LKCA 4D4JA 5HTKA 2N46A 4O3MA 1NRJB 2ZSAA 5F9HA 4B2LA 4BFYA 3I5XA 1ZU5A 1G7CA 2GTPA 1OIVA 4N3NA 5DYGA 5CJPA 4PO9A 4QJ3A 2REBA 3DL0A 3UPUA 2EWVA 3BERA 4PHHA 2QPTA 3E5HA 2W00A 5DO9A 1UEIA 2R6AA 3U5ZB 4ZDJA 1VYTA 5FL7A 4RJLA 3GLIE 4KLNA 1YQTA 2BMDA 3QJYA 5BN5A 5AR1A 4TTPA 2QENA 1Z6AA 4OKSA 721PA 4AG5A 3Q7PA 5CJ2A 3WYFA 2ATXA 3HPQA 1G8PA 1E2NA 4Z8YA 4AG6A 3GCGA 3EA5A 2FPMA 5FOWA 3UMFA 1SVSA 2E1RA 4X8OA 1XD2B 1YRAA 4DLUA 2D62A 2J0UB 2G0TA 1DPFA 1NLZA 3LNCA 4YXWA 4PZZA 1OH5A 2PJRA 1EFUA 4BLPA 3CX6A 3E1SA 3ZVNA 5B64A 4EJSB 3CR7A 2GEDA 2GNOA 3MWLA 1AK2A 2Q9AA 1ZJ6A 1AQUA 4LYHA 4PC1A 2GJSA 5JHHB 1DAHA 3ETLA 4Z51A 2XITA 3S1AB 2A5JA 2DYKA 2D4HA 1ZC4A 1CRQA 3IHWA 2XNSA 4Q7KA 3R7WB 4E03A 4W7SA 1NG1A 1IJFA 3QPWA 4HEJA 2BWJA 1YRBA 2EWWA 2ZROA 1G3MA 4BZPA 3GEHA 4M1OA 2HCJB 1G41A 4BEJA 3L8ZA 1K5DA 4JLPA 4AURA 4AKIA 1TADA 1W47A 2YC4C 2ZRAA 4TMKA 2ZE6A 4JYBA 3B78A 1NLFA 2Q0HA 2W6JD 4LSGA 5SZJA 3WP1B 5L3RA 1J90A 4Q7LA 3CX8A 1DAMA 1YJ5A 1JI0A 4BE7B 3U6BA 1G291 3U3RA 3FMPB 4M9ZA 4BPBA 1QHHB 3H1TA 4U00A 3IPXA 3AP3A 4QBGB 1GIAA 1TU4A 3GLFA 3MUFA 1Q21A 3A4LA 2XNDA 2XJ4A 4RD0A 3KJIA 1E2EA 1Z0IA 4OHVA 4B76A 2RGXA 4LK2A 1CTQA 4NU0A 5C46F 4MKIA 1I4DD 1JQLB 1HQYE 1HEIA 1J99A 3FFBA 2CHGA 2I3BA 2A7QA 5J5CA 4AY2A 2GK7A 3WRXC 2P6RA 3GLHA 4WIAA 3P20A 2ZRKA 1RFLA 3SFZA 4B6FA 4JT2A 3VU9B 1KO1A 1W4AA 1U8ZA 1MABA 2XSZA 3CPJB 4JLNA 1E4VA 4JLVA 5EP1A 1YZTA 5AK0A 2QG6A 1E0SA 1X6VA 2GILA 4D82A 3EXAA 1DARA 2WJVA 1AGPA 3SHWA 1JBKA 3AGPA 3NHBA 4H1VA 1GITA 2AD5A 3V4FA 4BFTA 4M1SA 4DIEA 4BECA 3U7GA 4QGGA 2HLDA 3U3JA 3W3ZB 2GA8A 2V54A 5HCIA 2IHBA 3AKDA 5CK5A 2QP9X 4JL8A 4IEEA 1XTSA 5IRCD 1UEJA 3HU2A 2BDTA 1LW7A 1CULC 4HUQA 5F2EA 1M74A 4LX0A 4DEYA 1GILA 3U4QA 4DLSA 5TDHA 1IQPA 1RZ3A 4B71A 2W2TA 1WBDA 3DZ8A 3QKTA 4KSCA 1PZNA 4XSGA 3TSZA 1QG2A 3W9YA 2VP6A 3FMOB 2ODNA 2YOFA 1XJ0A 4HAWA 3W5IA 4P32A 4II7A 2ZUBA 4RZ3A 4F4IA 4B3XA 1E9RA 4A15A 4C7OB 3PUXA 1MO4A 1Z29A 2F1JA 2FPLA 1ZU4A 2ZSFA 4HZIA 4RZUA 1IXRC 1P60A 3QQ5A 4IEIA 5DGXA 1CF4A 2IC5A 3GMTA 4PC6A 1D2NA 1E0AA 5J4YA 3G5UA 3T35A 1W1WA 3A1SA 5JFGA 3ZZ0A 3KZ1E 4M9SA 4TTQA 4HAVA 3SHFA 1TPZA 1XTJA 1YKSA 5E95A 1E79D 2J45A 2IF0A 2V4ZA 1R4AA 3HYRA 2QROA 1MO3A 1OH7A 3UIEA 1A7JA 1DVRA 3GJ7A 4NONA 1XXHB 3QF7A 4Z1MD 1N6RA 4AKGA 3ZQJA 3DEFA 3EARA 4MKHA 3GPLA 1HQCA 2GESA 1VPLA 1G20E 4BLQA 4R2HA 1COWD 2ZE7A 1KJZA 1M6NA 4HUTA 1KGDA 2I1VB 1W5SA 5GJVC 2BKUA 4HB0A 1QHGA 4V0NA 3AUYA 1VG8A 1KAGA 1E2KA 4GOJA 2YJTD 1LF0A 4YC7A 2V55B 3N2EA 4XIGS 4X8LA 3QXHA 2HT6A 4F4CA 3C8UA 3LBNA 3QSYA 4CEIA 4MKFA 2P0EA 4P4UA 4M1MA 5G3YA 1US8A 4HLDA 3WMEA 4RFVA 4B34A 4ESVA 5EXXA 5DIFA 3VR5A 1UKYA 1MKYA 1UBEA 2F1HA 4LBVA 2GKSA 2ZPTX 3WYAA 1FTSA 5L3SB 1KY3A 1GNPA 2IL1A 3A1UA 2PX3A 3ICEA 3QIAA 3FGNA 1W5TA 1CIPA 2WPDD 2R2AA 4US1R 1BIFA 4EPYA 3C14C 3ZQ6A 4M9QA 1G3IA 4M0LA 5AJZA 5CB6A 2WHXA 4Q1FA 3K70B 1AA9A 1A2KC 3LDAA 4A8JA 3W6PA 4C4PA 2MSCB 2QPAA 4RKEA 4BRUA 1U0JA 3B9QA 2NO1A 4TLEA 1AJEA 1HUQA 2XJ9A 4C0BA 1LNZA 1SZPA 3SN6A 3LO5A 2QE7D 4E09A 4YDSA 3VMFA 1IOZA 3SDZA 1NN0A 1CKEA 1JXMA 3SU8A 3CONA 1E9BA 4ABYA 1IM2A 3K8YA 1W44A 2ZSDA 5EZ5A 3SYLA 1NVXQ 4JJKA 1ELOA 4LJ4A 2DR3A 2RGBA 3EZFA 2CDNA 5HPYB 1DOAA 2F3RA 4TMVA 4KCGA 4BGDA 3VKGA 2NZJA 4D2IA 1OFUX 1ZUNB 2BC9A 2QI9C 2ZSEA 3BIFA 1GKYA 4B48A 4OHYA 4Q9JA 1CEEA 1OKKD 1SHZA 1N6OA 1E1RD 4JKIA 1NG9A 1PUIA 3PCRB 3RAPR 1CJKC 1T8TA 3W5JA 5K8TA 2RHDA 3I8XA 4ERNA 4GT1A 5KU1A 1J70A 3DMDA 4G01B 3OEHA 3T1VA 2IS1A 4C0LA 3AVXA 2ZI5A 3V00A 2VA8A 4KBGA 4WZAE 3KXKA 2G77B 3CF6R 2FU5C 3MG9A 1L8QA 1G7TA 1P6XA 2C95A 1SVLA 1CXZA 1E2DA 5BQ5A 1IJEA 1PJRA 2ZETA 3C5CA 1TU3A 4ILEA 4XVQA 4D0LB 3ZIAD 1R2QA 2YYZA 1FP6A 4CW7A 2P3SA 2ZIAA 4RD1A 5FOXA 1ZC3A 4TLDA 4BWYA 3OE7D 1OB5A 2KB0A 2YWFA 4B74A 1K8RA 2B6HA 4BQSA 2BCJQ 2VP0A 5JWHA 4PHFA 2O8DA 3LH5A 1IONA 4TYPA 1MR3F 3KKNA 4F93B 3CRMA 4Q9HA 4DDVA 1F2TA 3I3SR 3L0IB 5FPKA 2GAOA 3CM0A 1N0VC 3HU3A 4Q01A 5DNYB 4XVUA 1CS4C 2J7PD 4ZKEA 1VYVA 2PLFA 4QC2A 1ZCBA 3B60A 4EUNA 4LUCA 2VEDA 2IEZA 1ZD9A 4IOMA 4B32A 3FE2A 4MYTA 3IEVA 1ZNZA 2RGCA 1N5JA 4JLKA 2F1RA 5H70A 4Z1MA 4AI6A 1ZMXA 6Q21A 3NG1A 5FL7D 1Q3TA 5C18A 1Q57A 2OAP1 3U61B 1W36D 1QF9A 4AWXA 1NBME 1NVWQ 3GD7A 1OLOA 2DFTA 1FUUA 2W6IA 4GL2A 1F3OA 5HR5A 3K9NA 5FOVA 3C7KA 1VIAA 3DZDA 4A2QA 1GRNA 3IDQA 4HI0E 2VHTA 2WAXA 3SE0A 5A5GA 1NIPA 1GM5A 3T1QA 4I1VA 1GP2A 3SR0A 3ZYCA 3K09A 3LXRA 2FDCA 1TL7C 1FNMA 1GUAA 4URVR 2CCKA 5G40A 2O5VA 1BS1A 3K0EA 1H8ED 3CZQA 3EZ2A 1EXMA 3I8SA 2TMKA 1U8YA 3LQQA 1SQ5A 1HT2E 3B1ZA 4QOSA 4DT1B 5FH9A 2DFLA 2RGEA 5JCPA 3MSXA 4YQFA 2WMNB 1E9SA 2F43B 4HAXA 2MMGA 3TKLA 3T06B 1R10A 3JZAA 2AR7A 4KYUA 4F38A 2FEMA 2D7CA 2REXB 4F4JA 2WWHA 3CH4B 1KIMA 3CLVA 3RDPA 1Q22A 1WA5A 2RGAA 3I92A 1CJMA 3QBTA 3QKRA 4PHGA 1EFRA 1NBMD 4JYCA 2FFQA 4G1UC 4KHZA 2C77A 1TEXA 2Z43A 2ZREA 2FEOA 4DEXA 4OL0A 1UKVY 1E98A 2PMKA 5KYKA 3OESA 1FW6A 4HZUB 4OYHA 4CEHB 1E2LA 4D0GA 3Q9LA 3Q85A 3SFVA 2OO7A 3CPEA 5J47A 3HP1A 1DAKA 3QI2A 3VFDA 1VECA 4JBYA 1WRBA 3GP8A 1X1RA 2FNAA 3QKRB 1YHNA 1Z08A 3T5DA 4C0HA 2IA5A 3MLEA 2W0MA 1GFIA 4DSOA 1OXXK 5K8IA 4KVGA 4OK6A 3MD0A 3K0CA 2JA1A 2ZRCA 2DWPA 3AEZA 2YZ2A 4KJZA 4WZ6A 2CL0X 1E2JA 2EFHB 1XXHA 2WIAA 4B43A 1NMYA 2QAGC 2JLXA 3BFVA 1P75A 3RSLA 1S1MA 2IYYA 4O2LA 3K9LA 4JT4A 3QNUA 2Q9BA 3GJ0A 1OKKA 2WPDA 2Z6VA 2RGGA 2X19A 4MYUA 4LJAA 2AWOA 1OH8A 2GJ8A 1YZLA 3BK7A 3OF5A 2IS2A 1QG4A 2CK3D 3TLXA 1Y3AA 1CJTC 2RB4A 2WIBA 3AVUA 2GAAA 2OLJA 2V8OA 2PMDA 3KB2A 2XZOA 2X1VA 2OCAA 4RCZA 3B1WA 4LHZA 3F8TA 4Q1BA 4H1UA 2RGDA 4TQUS 5JEEA 2X77A 3L0PA 2Z0MA 5JCZA 1P2UA 3RRMA 3EC2A 1H8EA 3PEWA 1CR1A 3EPKA 2GXUA 2UKDA 3ASZA 4ZIRA 1TQ6A 3FHCB 4CVNA 1E79A 1ZM9A 2YC2C 2OCYC 3QPUA 1Q1QA 1TUIA 1I2DA 2C2HA 4EAQA 2ZYTX 4NBSA 3VR2A 1HV8A 4LOAA 2ZJ5A 1CRPA 2BM0A 2PH1A 1KJYA 1KMHA 1JXOA 3NDPA 4R71A 5ANRB 2CVFA 4QGFA 3C15C 3PITA 4TL8A 4JSYA 2ZU0C 1GSIA 1Z6YA 4DCNA 3B13B 4LPSA 1FNNA 2HYDA 4V0OA 4BLTA 1XD8A 2V6JA 2JLRA 3GJ8A 4PPNA 3B1VA 4NYIR 4TQAA 4FWIB 3AVOA 3ZGXA 1J8YF 2GJ9A 3TQFA 4QJ4A 1DG3A 4B2PA 1E0JA 4JKYA 3MMPA 4L15A 3BD9A 2JGNA 2NQ2C 3LW7A 3ONWA 3CRVA 4I4LA 3FMFA 3WNBA 4LDJA 4Q4HB 5AJWA 2NMVA 5JI2E 2GBLC 1TAGA 1LY1A 1XEXA 3BE4A 1KDPA 1GKIA 1W0JA 4NDZA 3RSOA 2WOOA 1RE0A 4QRHA 3RC3A 5JZVA 1ODFA 3W8RA 2ZI9A 2YWEA 3QKUA 4PSKA 3O47A 2DFNA 2ANCA 4DSNA 3WNDA 3GLHB 4BFUA 3N5CA 2IS6A 1OB2A 4Y0VA 2ZJBA 3T12A 3FWYA 3IBYA 3KKMA 4KYIB 4QXAA 3EPLA 3C4JA 4IKEA 4JLMA 3FHTA 2GF9A 4IW3B 4AYTA 3DKPA 3QKSB 1GZSA 1RVDA 2HXYA 1W2HA 1EGAA 4BLRA 4LY6A 4U7DA 1KDOA 1MRSA 2VLIA 2A5GA 4KSBA 4TWZA 4RFSB 5L8VA 4DDWA 4UQOA 1E1QD 1MT0A 1JR3D 4M1KA 1FMJA 3K9GA 3SNHA 1LB1B 1II8A 2A5FA 1RW4A 4B2IA 4JLJA 2JDID 1SKQA 3WBJA 1EFHA 2FX3A 1R0XA 2CE2X 1T5IA 4BRWA 3K0AA 1DAIA 3BWDD 5CLLA 1KSHA 3X2SA 1SGWA 2J41A 2FSHA 4GMXA 4U5XA 5IK2D 5JSZA 3EC1A 2O52A 2ZVPX 3AUXA 5AJVB 2GCNA 1ZUIA 3CW2A 3VKWA 1XPRA 3GJ6A 4O0MA 3ZVMA 4C0AC 1Z0AA 1MV5A 3CRW1 1WE2A 3NKVA 2MMCA 1E1RA 3I32A 2HXSA 3IPYA 3JVVA 4PR0A 2WZQA 3VX3A 4YMVA 5KSPA 4HSEA 2OCPA 3KQKA 4AKEA 3W3AA 2VHCA 3CR8A 3Q3JB 2HUPA 1Z6TA 5HKKD 1YR6A 2Q6TA 4A4DA 2DPXA 4A0GA 1G9XA 3Q8XB 3GEIA 1GOTA 2ZJYA 2GK6A 1KI3A 2PEYA 1P5ZB 1F48A 4OQFA 3UXMA 1N0WA 3CZPA 3ZIAA 3H0KA 1P73A 2WJYA 1Z2CA 1KNQA 1UDXA 2JJ1A 4L9SA 4RD3A 5EE3A 3RYTC 5JLJA 3OEEA 5E4FA 4G5RA 2FMXA 1OE0A 2ZR7A 4FIDA 4PX9A 3TRFA 3RC8A 4TL9A 5LB2A 3BFXA 4BLSA 4HAZA 3HR8A 3IUYA 4DBLC 3CF0A 3SS8A 1KJWA 2O0KA 2IUTA 4CGZA 3MWYW 1GL9B 3NHAA 2ZI7A 4DWJA 2CCJA 2O8EB 4TT3A 4TN1A 3KKQA 1DE0A 3NH9A 5UKDA 4EFMA 4KITB 1WB9A 1G4UR 1IY0A 3NBFA 2ZRDA 4JVLA 3QY0A 4NMMA 4PO8A 4B3CA 1XWIA 5AUOB 2BJVA 3DVLA 3REFA 4W9MC 1II8B 3T1TA 4O2RA 1W4CA 2IYZA 2R6FA 4QBHA 2IF2A 2HT1A 4OI1A 4ARZA 4AD8A 2IUSA 1QVAA 3LX5A 2IWHA 3FKQA 2QGNA 4MGZR 4MDFA 5BWMA 3KQNA 3QXCA 4FMDF 3KUCA 4BFVA 4YMUA 4BLOA 1PVOA 4K46A 3ZS8A 1KY2A 2QL6A 2QRZA 2HDNB 4Y0AA 3TAHA 5KNBA 2H92A 2NG1A 2VSXA 1E0KA 1Z83A 3NC0C 4NZYA 4QFMA 4M1TA 2O0HA 3N2IA 4QHTA 2FPKA 4F7WA 3KUDA 1D6JA 4QG7A 3AF1A 2QQ0A 3DPUA 1UADA 4URWR 1J2JA 2I4IA 1XBTA 3DM9B 5KTYA 3RLFA 4LHYA 1G5RA 4KFRA 4IDHA 5FUVA 1MOZA 2OG2A 1OFIA 2W2XA 5FTKA 2B7CA 1G21E 2G1KA 4G5QA 3DMNA 1L4UA 3TUIC 3BH7A 1G5PA 4ZO4A 5KUTA 4Q4AB 3W34A 3QEOA 1DO2A 2DWOA 2CXXA 2V9PA 1XJCA 1K6MA 1EESA 1XEXB 4IHQA 2WKPA 2CHQA 2R8RA 5B30A 1D2MA 2V6IA 3L8YA 5BN4A 2X8AA 4LPKA 3EPHA 1ETUA 3PUWA 3DO6A 1XZQA 2QUZA 1ZUHA 1ZRHA 3EZ6A 5F3WB 1HTWA 4TMZA 4GFDA 2FSIA 3TBKA 4WAUA 3H2YA 2GZDA 3KTAB 4PC2A 4P4SA 1OT3A 2D06A 3WMFA 3QPVA 3B9PA 4QGAA 1AS3A 1MRNA 2GRJA 2GZHA 2H1LA 4DT1A 5JJLA 2ZR0A 4XVRA 3OFND 4EFLA 2BBWA 4PC3A 3T5GA 2ANBA 3TGPA 1Z6GA 4KFTA 4P4TA 4DLVA 5GVSA 2F7SA 5E7IA 3T61A 1GL7A 3K9HA 3HWSA 4N0EA 2O0JA 1LF5A 1OXUA 1W0KA 3X1XA 2WJHA 4K81B 4GMDA 1NKTA 2VPPA 3KKPA 1D8TA 2KBEA 821PA 1ZIPA 3RRNA 2RGNC 3AP1A 1F60A 1XXHE 1Z0JA 4C7OA 5DI3B 5L3QA 1G18A 3WRYC 2BBSA 3CO5A 1FP7A 5EXTA 4BZXA 1E9CA 1VCNA 4DUGA 2OESA 1RJ9A 4KI0A 4P3YA 4DLYA 3B8HA 1AGRA 3IIJA 2P67A 2Z83A 4HAYA 1NLYA 1DTSA 1YR7A 5LD2C 2CL7X 2C03A 1WBBA 4NH0A 2FG5A 1XFAA 1R0YA 5DSZA 2FF7A 1GNRA 1NSTA 3RS5A 1RRFA 3UATA 5HE9A 1W49A 2FJUA 2E9SA 3C16C 3IQWA 4LJ7A 5HZHA 4UNRA 3EIEA 2RGNA 3EIHA 2DBYA 3MAAC 2SHKA 1XP8A 2FSFA 4L5BA 1GNQA 2FH5B 4LGMA 1W48A 4LJ6A 1F2UB 1UKZA 2H8KA 2OFWA 4B6EA 4D4MA 2OBLA 1FOEB 5L3SA 3EW9A 1KSGA 3AVVA 3MWJA 4NKRA 4LC1A 1IBRA 4DVGA 3Q7QA 4BZQA 1OYYA 1AKYA 4M4SA 4M21A 5FTLA 1RJ9B 3OHMA 1TMKA 2CK3A 3BB3A 1LTQA 4XJXA 3SI7A 2QAJA 4DUGD 5FUXA 3KJGA 3P26A 2QE7A 4RY2A 5DI3A 2JLZA 2ORWA 3AF0A 3ZLJA 3QXJA 1A1VA 2ZRIA 3SJCA 3I5YA 4Q00A 1RRGA 3TR5A 2Q21A 4MGYR 3GLGA 1R6BX 4R2IA 4V0MA 2IYSA 2EFCB 1BMFA 2WSSA 5KHOC 2ZAOA 4Q47A 4UNPA 4JJZA 1TQDA 3JVUA 4V03A 3GFTA 4Q1EA 1WQ1R 4FMCB 1OSNA 3LW8A 4DLXA 4KXFB 3PEYA 3L0SA 2OXCA 4Q21A 2GCOB 2P5TB 3LLUA 4KAXA 2J0QA 1UKEA 1EK0A 4NCHA 1P2TA 4OK3A 4P0TA 3NIBA 4WVFA 2W0SA 1SVKA 1B0UA 1GWNA 2IYVA 3I4LA 4PPGA 1HY3A 4QM7A 1G5TA 2DWQA 2GBLA 2P65A 4P4SB 3SJZA 2FGJA 4P31A 3R7WA 1KSJA 4QL3A 4TZ6A 2PL3A 1KI7A 2OM2A 5EP2A 3TR0A 2XZLA 3T1OA 1Z63A 4GPTA 4UKDA 2ZRHA 2OHFA 3OE7A 5J4KA 4PFSA 3CRQA 5EXSA 3LA6A 5D3MB 4Q5IA 3EWAA 1JALA 4HZUA 4FD2A 2AKAB 1CR2A 4JLOA 4R7ZA 1KI9A 1E9FA 3FKSD 2O8FA 4LV5B 1NI3A 4MGIR 2WWWA 1N0UA 3CBQA 4Q7MB 2QTFA 5A0FA 4HLUC 3OFNA 2EU8A 5FL3A 1XTKA 4YXWD 4Q66C 3VR3A 2JLQA 5BXQC 1A82A 1XRJA 4TSFD 3QXXA 1HURA 4RVCA 5JEDA 2K5UA 3K0SA 2JLWA 4NTZA 1DAEA 4ACBA 2CEAA 2IXFA 1PLJA 3FB4A 1E2QA 4DXAA 3VX4A 5GJBA 4HDCA 1KI8A 3L82B 2F43A 2B92A 2R6DA 4NCIA 5F9FA 1CJVC 3D31A 1P9WA 3S1AA 1L7VC 1AKEA 2XB2A 2Q3FA 4M1YA 4IOJA 3E2IA 2AD1A 1NP6A 1Q1ZA 3B85A 3H86A 2A9KA 1XCMA 3FPAA 3QVUA 5AJXA 4B33A 4CT4B 2AL7A 1HE1C 1MABB 1OIWA 1KMHB 1TQ2A 5AWFC 2WOJA 5LBIA 3R8FA 4ON9A 4JBXA 1R7RA 1T9HA 3LX8A 1XZPA 1T8UA 1ZNYA 4US2R 2YKGA 4RD6A 5GJCA 3HYTA 4DIDA 4JS0A 2IS4A 3HJNA 2QM8A 1DG1G 1DAFA 2ORIA 2HJGA 1N5KA 4IVQA 4DCUA 5IF9A 3AKEA 2P6UA 1IN8A 1FQKA 2WVJA 4XH9B 5CLQA 4CEJB 1U98A 1LFDB 3DOFA 4US0R 5EP3A 5EUQB 3GLFB 3D6TB 2ZANA 5EJEA 2FE4A 2ZUDA 1ANKA 4PZLA 3NC1C 5EE1A 4B44A 1E4YA 3PQCA 1XX6A 2QMEA 2GZAA 1AN0A 1NJFA 3RWOA 2FZ4A 3SOPA 3QOFA 3IEUA 3BORA 4GRAA 4MH0R 2V3CC 1U8AA 1XU4A 4PTLA 3IHLA 4W5JA 4Q1CA 4A6XA 2X2FA 4H9GA 3GLIA 1LS1A 1NNEA 3F3YA 2ZI4A 3SQXA 1FL9A 3QF4A 1OFHA 4B3DA 2PZGA 4IXNA 1TTTA 5D3QA 2HLDD 4EPVA 5B2ZA 3KTAA 1FQJA 4PQYA 4Q4JB 3WBKA 3U2QA 3TNFA 3UG7A 2P5SA 1U9IA 1EWQA 3C5HA 4V0ME 2VP5A 4URYR 5EE9A 3NBXX 4WW0A 5DLQC 1KOFA 1S9HA 4EJSA 2JATA 3RS7A 3U6KA 1Z22A 5CIWA 1KK1A 1RYHA 3Q72A 4JLBA 4LI0A 2WM9B 4R98A 2H16A 2IYWA 2RKOA 5E3HA 1F2UA 3AKCA 1N5LA 3TK1A 2IYTA 3E70C 3O8DA 4Z54A 1S1CA 2GWHA 1Z47A 1JQJC 3ADKA 3TUZC 2HCBA 3G0HA 3EG5A 4DKXA 5TXGA 2C9CA 3NBZC 4KBFA 2CBZA 2OT3B 2H17A 1KI6B 1FZQA 1ESNA 2NGRA 4B73A 4DB2A 4WBSA 1CJUC 3K70C 3GLIB 4D6PA 4QGHA 3MJHA 1JEDA 3LWNA 2NO9A 2JEOA 4DC9A 3GFOA 4TMWA 3ADCA 4PAMA 3UWOA 2B7BA 2W6JA 3K0AB 3EAQA 2WWFA 2WWIA 4UXIA 2ZEJA 1UBFA 2C96A 3OIUA 4IDQA 4PAQA 4OI2A 3SYNA 2CNWA 4TLAA 5B58C 3THYA 4B75A 1M2OB 2QTHA 1RPZA 2VSFA 1O87A 2PJZA 4IOKA 1COWA 1EX7A 4OI0A 1YU9A 4HATA 4N1AA 1OIXA 4NYIQ 2NPFA 5AUQA 5KSYA 1US8B 1X86B 5HZKA 5J4LA 5EE5B 1JPJA 3D7MA 5FI1B 4UNSA 1SHKA 5JJKA 1SXJD 1NBMA 3FDIA 2F55A 1T4GA 1FX0A 1T6NA 3RRYA 5IT5A 2PCLA 2VP9A 2CLSA 2A30A 3FFAA 3OAAD 5FPHA 3RS4A 4A2PA 2C04A 2ZS8A 3M6AA 4LBWA 1G8YA 1VHTA 1OH6A 1NN3A 2Q9CA 2ZRPA 4D4LA 2IBMA 3K70D 2FSGA 2WJIA 2J59A 4DCVA 2H57A 1Q12A 1S9DA 2GJKA 3GQBA 2G1JA 3K53A 2A5YB 1G8FA 1A2BA 3UK6A 4ZCIA 2ZR9A 2QAGA 1D5CA 3AVPA 5SZIA 3SJBA 3TAUA 1P7CA 1E9DA 4Q9LA 4TSFA 1X8KA 1E94E 2D2FA 4XOIA 2ZVQX 4IFEA 4YMWA 1FPMA 3PIRA 3QVVA 4NYJR 1NVUQ 1JR6A 1BH2A 1E96A 1CR4A 2JLVA 4FCWA 2ZRNA 1SXJB 5TARA 4AIIA 3QEJA 4QNRA 2JAQA 4AKHA 3OZXA 5CK4A 3AVTA 1UJ2A 3A1VA 3CF2A 2AFIE 4HDOB 2XTZA 3IILA 5G41A 2H5EA 3ECCA 5JMTA 2Q3MA 3BC1A 3ZD7A 2R6CA 1NMZA 3TW4A 1OXTA 2ZSBA 3T34A 3RHFA 1SVIA 4CDGA 4PO1A 2KE5A 3NH6A 5EZ6B 4PANA 2CJWA 5JI3E 4LHVA 1R0ZA 2GXQA 2IYRA 4C0QC 1UDWA 621PA 1N3BA 1OHHD 4QNMA 1GRRA 4C2UA 2ZRLA 3QKSA 4XTCS 3VR4A 1ZINA 5EQTA 5FFMA 4LV8B 5TMPA 2C9YA 2BBOA 2ZJ2A 3KL4A 2EFGA 1G6OA 2ONKA 4LV6A 3GJ5A 4PQRA 4A82A 4C2TA 1G16A 2FFBA 1E69A 1G7RA 4HYYA 1IXSB 2AN9A 4OBEA 1N5IA 4I1UA 2L0XA 1Z8FA 3AF3A 3TQCA 2C98A 2YWHA 2IX3A 4HB4A 3ZDQA 1U9IC 3NEJA 2C78A 1I4LD 1CBUA 1Q44A 4MKGA 2W6ID 1F5NA 2JJ8A 3A8TA 3W8NA 1Z5ZA 4D4KA 4TLBA 2IYQA 3B6EA 5FTJA 2CE7A 3PEUA 4CEJA 3TMKA 1E2IA 2YHSA 2PZFA 3KQHA 4URZR 3B82A 3C41J 3LAWA 5JWRA 2W83A 3WHLA 1EX6A 4ZDIA 2RCNA 2ERYA 3LVRE 2ZYVX 5DH9A 2RMKA 4D26A 4CRWB 2NPIA 1IY2A 4FCVA 3VKHA 3MGCA 5KOYA 5CYOA 1NIJA 2ZXUA 3B7GA 1VYUA 3AF2A 5D3MA 4HLCA 3PV0A 2X2EA 5GADl 4B3GA 1OPXA 1M7BA 2QMHA 2FA9A 5BYJA 4UXJA 1DBSA 2OBNA 2J0VA 3KKOA 3V9PA 4ESHA 1L2TA 4GDFA 2GXAA 1FUKA 2WV9A 4A92A 4BUJA 1U0LA 2CJWB 4CZ2A 5DYIA 4Z8XA 4AYXA 2BV3A 1P61B 2JCSA 3QF4B 3OEED 1E2HA 4FI3C 2EQBA 3U7EB 2J46A 1W36C 1W4BA 1M34E 1D9ZA 3LD9A 2WWYA 4G5OA 1KI4A 5JRZA 3LBIA 2ODBA 4MRSA 3CX7A 1II0A 3K0FA 2QP4A 3HU1A 4RCYA 2VBCA 3RWMB 2OSBA 4ARZB 3DDCA 4JIMA 4PPFA 5DHAA 5CB8A 4CF7A 2GCPA 4E5UA 2R9VA 1UBCA 1E2PA 1R5NA 1U81A 5KNDA 1JJ7A 3BJIC 1OXVA 4PZYA 5L3QB 1HT1E 1R5BA 4I99A 2CMKA 3AF4A 2ZYUX 5FPSA 2O8EA 3PENA 2FWRA 2CCGA 2PT7A 4GNKA 4EPWA 2A78A 3REGA 3QG1A 1XTRA 2DB3A 2QSYA 1U0HC 4LCBA 1LVGA 2NO0A 3EPJA 4BFWA 2W2VA
chains in the Genus database with same CATH superfamily
3GNQA 1SCIA 4NLLA 3WHPA 3WY9A 4HMOA 5FQNA 2ENWA 1X3SA 3EJ6A 3TXXA 3TNDA 3WIUA 1QIGA 1XELA 1ZK0A 2ZIFA 3MIIA 1IE3A 3FHOA 4PYMA 5FTMA 2Z8ZA 4B3RB 3JAWB 1SXJC 2GHIA 3IVAA 3SHOA 4MW5A 5DK4A 4YJFB 3REQB 4ZI7B 3WRXA 1VG9B 1Y5RA 1E1QA 4LQLA 5DTJA 3SJ7A 1J8MF 2CFRA 1REQA 3D1LA 3PJFA 3SEAA 5I7SA 1GUZA 1A9YA 3WMGA 2JFXA 3PXEA 3KJHA 2DUMA 1IN6A 1DX9A 1GTG1 2J9RA 2OFXA 2VTVA 4B85A 4F92B 2PQ2A 5DBOA 1IHOA 1AHPA 3EOAI 4JI6B 3RSSA 3GAFA 3H87A 3TQQA 1IHXA 4RVUA 4QELA 2PD6A 1MB0A 4KN8A 3WAKA 3RUEA 5LQKA 4BBAA 3HN2A 4KLZA 1MHTA 1KZGB 2YOGA 3N8KA 3IOYA 1YE8A 2WLTA 2EYUA 3TUJC 2ZIXB 2IYEA 2LWIA 4FN5A 3HB9A 1NNI1 2AEEA 4IWYA 4PRLA 4QLAA 3UAGA 1X92A 1UBSB 1YU6A 4ZVTA 4B3FX 4PLFA 3FB1A 5H68A 3REQA 2AVNA 1RRPA 4IIGA 4BMOB 4MV8A 3O95A 4W9RA 1M72A 1WMDA 5ELMA 2CBGA 1C7RA 4BUZA 2QY9A 3DEKA 4HJRA 2Q5LA 1A8UA 2ZQYA 1Z2AA 3AQIA 3F6PA 4E07A 3K09C 4RNCA 4W5HA 4M53A 2XRYA 4Z0TA 3EIXA 2BI4A 1MO2A 5IH3A 1VPDA 4ZT3A 5LZ4A 4C30A 2YXEA 1QK3A 3D0KA 3VH1A 3K1AA 2V7QA 1T5TA 3G0DA 1HKUA 1P1JA 5KCZA 1PUXA 4DDUA 3WGMA 3PL5A 1WUJS 2EVWX 3TM4A 3CNHA 2WYVA 2HIMA 3AONB 4R2WA 4WZBE 4HDMA 4JI3B 1JR4A 5ILOA 3G8AA 1CQIB 2QAIA 1AD2A 2WSLA 1E3LA 1H1DA 3KPWA 4IJWA 1E2GA 4IVPA 4O63O 1KO4A 4ZEOA 4MP6A 3RRZA 3STWA 2J3LA 3UUWA 5JCJD 2WIKA 3A58B 1GRQA 4YUWA 5C81A 4Q39A 1DQSA 1M2EA 3PR3A 3TZKA 2JD2A 4MI1A 3DLIA 3HVUA 3IULA 5L53A 1KNXA 2QTCA 3BK2A 3KXLA 1BXGB 1M6HA 1YIOA 5K3FB 2QW0X 4OYLA 3GRFA 4DCGA 1W88A 4YV7A 3CPHA 3KSAC 2QTVB 2X5NA 1IAVA 1I4OA 1ZJJA 4G2TA 3RTDA 5I48A 5HKOA 3R3YA 2GNPA 1V11A 4ZZ3A 2JGMA 1MNQA 3CLRC 3DKVA 2AN3A 2Y1OA 4IHJA 3TTTA 3TD2A 1GLNA 3FTQA 4CMEC 3VDMA 1NR5A 2YINC 4FBGA 4M55A 1EDBA 1NUHA 4JUDX 5CM9C 1H2AS 1MLDA 2X0FA 1GGMA 4KXMA 3B1KA 1JG2A 4LJ5A 4ZGGA 2XKBA 1G5FA 3QVGA 2C8JA 2C83A 3HN6A 1IAQA 1U1CA 1JS1X 2EKBA 4KAFA 5KTRA 5HP4A 3VJRA 4ZV4A 1TMYA 5EE0A 2D5AA 1XTIA 2VL7A 2HCFA 1W36B 4TMTA 5H1YA 1VKZA 3BEDA 3RRJA 3U4GA 2QA5A 1CE8B 1TNDA 3F4KA 3ND9A 1RJFA 3F90A 2PH5A 5AW6A 4MMYB 4RH1A 1IN5A 5A62A 4AFNA 3NEYA 4YMSA 3NHLA 3H4TA 4ZOAA 4AVYA 1RDFA 5BR4A 2FRDC 3AKYA 4E5MA 4YRPA 4NE7A 3D8RA 2ZZMA 1KYZA 1QVZA 5DOVA 5SZHB 1D1QA 4IDFA 4Y98A 1EUYA 4G4GA 1G64A 2G25A 2VRWA 2WJPA 4FLMA 3ETHA 7REQB 1K2WA 4EAAA 2E6UX 2AFHE 2FEXA 2YXDA 3OJCA 4DUZB 1WVGA 1QHSA 4L2IA 1GG5A 5LL6P 3JQ6A 4LZOA 5ER6A 3UJAA 2BGLA 5AIBA 4ZAXA 2I29A 2V7QD 2NXNA 5I45A 4JHXA 2XSZD 3NTUA 1ONSA 1RAIA 1M2GA 3T94A 2V8BA 5L3VA 2EG5A 1ABBA 2GYUA 3DB1A 3GV0A 2Y3IA 2JGLA 4NMXB 4JASB 4FCTA 4ZCSA 2FCRA 3ASUA 3ZU6A 4JENA 1C0PA 2ZIUB 5CX4A 5HIMA 5BVHB 5BUQA 4BLUA 4R1UA 5JPDA 3S44A 4D0NA 4EA8A 521PA 1IDOA 1Z4JA 4LDNA 4P3OA 4A8JC 1FYEA 3SJUA 1SKYB 2SNIE 5DWQA 5DM70 3W90A 3AEUB 4R84A 3EZGA 3B5EA 3HR7A 3TLGB 3EUWA 1C80A 4BNUA 4BN5A 4DYDA 1H42A 4GAEA 1DIOB 3EXG2 1TMOA 5DF1A 2J08A 4PZPA 4MGHA 2BTEA 4OHRA 2YJGA 3BT7A 3Q8WA 2QXYA 1Q7RA 4JL5A 1LK7A 2QIOA 5EZQA 2FN3A 4HPXB 4Y1FA 4MO9A 4NHEA 1M0EA 5DYNA 1SY7A 3PUHA 1T24A 1AGNA 2H3HA 5A4JA 2QEQA 4NYJQ 1C0EA 2FPUA 5B57C 1VJTA 1Z4KA 4WXRA 3AR4A 3RREA 3GLUA 1PZFA 4KQ6A 2M32A 5IJWA 5AVZA 1YZ3A 5DNCA 1THZA 1DO0A 3ETNA 3CLRD 3GU3A 3IJEB 4L57A 1WMAA 2QRNA 1R6VA 2YZKA 2ZI6A 4TKMA 4WFKA 2CKMA 2JPDA 3CR3C 4IHAA 4DMKA 1DOHA 2H5JA 1WDLA 1ZCAA 2HK8A 4MZDA 3BFJA 3DZGA 1Y7PA 3IEXA 4TLCA 2FZGA 3N6XA 4JYMA 3PLNA 4Q4LA 5KJEA 4C2AA 2OFPA 1EH5A 3ZE0B 4K6OA 4CT5A 3O3OB 2QQEA 3K5IA 3OFSA 4MICA 3RASA 1IPHA 2FZCA 3N5KA 1QP8A 1Z0FA 3R0ZA 1YI0A 4X3CA 4PSUA 4GXQA 2QR5A 5LB4A 2BISA 1OBHA 2PN1A 2QD4A 4GOXA 4L22A 3QLJA 3ZG6A 4EMUA 5C1BA 5J43A 2GJ4A 3HBAA 3BSWA 4LWZA 1QP0A 2GKGA 1WXWA 2JLCA 2LPMA 4C0SA 3SSNA 4D9JA 3WTCA 2IPXA 1YS4A 5SYMA 4XQGA 5KX5F 4XWAA 2JLBA 4RFSA 9LDBA 1Z2OX 1OX4B 4W5WA 4NV3A 2C61A 4MK4A 4WCFA 4XTRA 3ASVA 4GH5A 4MQEA 2VSOA 1S02A 2HA4A 2Z30A 2O7VA 4X8MA 2C8VA 5KTOA 3MAGA 4D25A 4CIDA 4C5BA 4QYIB 2MSDB 1R9NA 5G4LA 2X0JA 1UXHA 4IOLA 1MO6A 3WYGA 3NRCA 4CXMA 2QBYB 3MRSA 1JBQA 3DLCA 3KYDA 4M6WB 4RS3A 2JIZD 1I3NA 3I1FA 4GEGA 1EFCA 1KO5A 1QU2A 5FOQA 3NV9A 1WHSB 1ZOSA 2QZ4A 1CNMA 3UFXB 4WBXC 5FPTA 1JLHA 2NXEA 5EQFA 5JBQA 2WR8A 1E1MA 1ZQ9A 4V0KA 5LWQA 3M34A 3ZCVA 5TT0A 3HA3A 4EJMA 1U80A 1NF3A 1VFPA 1UH5A 2O54A 1W1UA 3G0GA 1C7JA 4QUBA 2AC7A 2I8AA 1KMQA 1HORA 1Z2DA 2RHMA 2UYQA 3UMCA 4B83A 4WKGA 1MD9A 3VZSA 1VIYA 4AMBA 1UFVA 2GETA 4BGEA 4OHZA 3ZWQA 2HLHA 1N75A 3A1NA 3I76A 3PNOA 4ALKA 1F6BA 4RV5A 4O1IA 3RYFB 5KTPA 1XMJA 1C9JA 3GRVA 3TJZA 3FTEA 3KT8A 2QGZA 5T5QA 4DTCA 3AB3A 1BDMA 1EI9A 1FLVA 1E2MA 2O8DB 3FGPA 4PQEA 3SX0A 1KS9A 4HQLA 1JQ3A 5LLSA 1U4NA 1ZM2A 4V38A 2QTAA 2A59A 3EE6A 5HMLA 4TZ0A 3U3KA 2PWZA 5CDTA 1AU9A 1ADFA 3I72A 2YOHA 2HRQA 4J07A 4Y6LA 4ZRMA 1N36B 2VRCD 3U44B 1M5UA 4NH4A 1M7GA 3AERA 1MH1A 4UOZA 3NM5A 5D6NA 2O2GA 4ZI7F 5CXQA 5MHTA 1EP3B 1Z4LA 4C0KA 5LP6F 2P6NA 5HF5A 2OO5A 1OLUB 1VIMA 3E7DA 1Z5PA 1PQUA 1ORIA 2ISSD 2ZI3A 1E3QA 3KT0A 1S3SA 4LJKA 4MGKR 2FW8A 2FUEA 4S1NA 5EWMB 3JASA 2WTUA 1NMXA 4YJ2F 2ASEA 1LQUA 4L85A 4DQXA 4ZIRB 1P44A 2Q1XA 2R8EA 2BVNA 2MSNA 1V8BA 4IGFA 3OUUA 3S70A 5GIPE 2XRMA 3E2PA 3DT8A 3H1EA 4P93A 1SULA 5BW8A 4IUYA 1J2EA 4Q1DA 4WK0B 4H7HA 3LXUX 4YHBA 3TR6A 1HDIA 5LN1A 1Z34A 3WRWA 3MA0A 4MLZA 2QPOA 1JFFB 1NFRA 3RQSA 3GUVA 3CZCA 2WWVD 1ZVMA 3KL2A 1BYIA 2NVUA 3OIWA 1KJJA 3N86A 1EAYA 1XHLA 1Z13A 4V0QA 3FF1A 4BJ6A 1ORWA 3QLEA 4G07A 1T0HB 4JJ6A 3G2OA 2ZBEA 1YS9A 4KQCA 2H7YA 4I8XA 2P2LA 4I1OA 2CVHA 3UHAA 3WICA 1W5EA 4CPDA 1DRUA 3A10A 5DZSA 2QVGA 3OAAA 1AIPA 1NJ5A 2GA9A 2WJ4A 3ENNA 3HSYA 1YVDA 1W19A 5JNWA 4YP9A 3TGWA 2GN0A 1UFRA 4RA9A 4Y8VA 1E3TA 2IIQA 4NG5A 5FBWB 3TLZA 2AG0A 3WLFA 2HO5A 4Z53A 5JR3A 3L4KA 3CURA 1KRHA 2YH2A 5JXJA 3VM6A 2H06A 3CUUA 3WK9A 4EYKA 1CVRA 1EXVA 1RLJA 2XNJA 2QLBA 4PHTA 3TLMA 2ZT6A 1EB8A 2HH9A 4P81A 4WN9B 5TVKA 3UOAB 3WLEA 3WXMA 1AQNA 3AWDA 2XCLA 3GGOA 1UPUA 4JQZA 5I8ZA 2ZBGA 1K5GA 4K6GA 1W5BA 4HEQA 4K86A 2JLAA 3ZZUA 1Z6ZA 1H66A 4B6QA 1AQJA 1EEXB 2YQ5A 1Z4NA 3JQFA 5LZ5A 3LCRA 3H18A 4CEHA 1JHZA 3WTBA 2QT1A 3VTKA 3Q88A 4TLLB 2WJGA 3I2HA 4DM7A 4A6PA 5GVRA 3PGJA 3Q10A 4I1PA 1NW8A 2C5LA 1XCPA 3G2IA 3MHTA 3KM0A 1B00A 1B0AA 1JEQB 1O6GA 1ZUD1 3G88A 3FPHA 3DLTA 3O5AA 3OZTA 4IO1A 5IC4A 3F46A 1EVQA 2GOYA 4NP6A 1DAGA 1R5OA 1XDSA 5I9BA 4BASA 2HWKA 7GPBA 2AMVA 1P4SA 3L01A 3PUJA 5A3QA 5KPJA 4ECEA 1E5DA 4HK4A 3A2MA 1DV2A 1Z75A 4CMHA 4DANA 4N39A 2EBWA 4U1RA 3C6MA 3HLTA 5KAMA 2F1IA 1NVAA 4MI3A 4QPCA 1GKUB 4BNLA 5SYNA 1VLMA 5GZ3A 4AX4A 1O8BA 1E1NA 2QRGA 3EWSA 4MQBA 5CFQA 3LBAA 3B6IA 2BTOA 2QG9A 2P4EA 3HI6A 1V8FA 4DIEA 3QTBA 1QHFA 4MWSA 4RETA 2Z6QA 1E5LA 5GQSA 3VZQA 2GS9A 3RSFA 3M4ZA 4CHTA 3DVRX 4X71A 3U60B 1WMEA 3AOEA 3E7XA 1WXIA 3LYAA 4GL4A 2EGGA 3GXOA 3WMWA 5A4MS 4CI0B 1IBCA 1ZP6A 2OZLB 4LZAA 4BFZA 2Y76A 3G89A 1FRFS 1M33A 1LRKA 2XY4A 2F3SA 3VJMA 2MIIA 3BGWA 3MUEA 1DC8A 2YXLA 3BN3A 4QM6A 1R37A 2HQRA 3BB1A 3GRUA 2I22A 3IAM6 4D3XA 1Q1NA 1YQEA 3LT0A 4DB4A 2CFIA 4D8UA 3C5EA 5C51B 5HUHA 1YBVA 1AKQA 4I1IA 1QHNA 3WO0A 2V65A 1T3LA 4TWBA 3ORSA 3CW8X 4WBNF 5B4UA 4O4LA 5CYPA 5ALFA 5KC8A 3G59A 2Y2UA 1FNBA 4FGZA 4BPRA 1DWPA 1JAIA 2Q8PA 2Q6IA 4KPGA 4A2WA 1ZK2A 2QX9A 4DSUA 1UKCA 4MA5A 4MRPA 1AZTA 4D81A 1DQRA 3TLAA 3NXSA 4JBGA 1HXHA 3LCVB 1RTTA 3SLGA 1CDOA 1N8NA 1UBTS 1VYHA 2YDXA 5BSWA 2I2BA 3VR3D 3O7WA 3JQ9A 2X76A 5M04A 4RZIA 5DSTA 3GHHA 3W2HA 5CFRA 1JW9B 3ROKA 3JQRA 4PYLA 1V9SA 3MFYA 2ES4A 2FAXA 1C9MA 5ELXA 2ACKA 3OG9A 2BZSA 3DSRA 4MB0A 2QB5A 4FEGA 4YRTA 1L4FA 5J2TF 4YAJA 1VKHA 3AM3A 4BBZA 3WNVA 2DXIA 4CM6A 3MMXA 1B14A 1H4TA 4GOKA 2VAWA 3EZ7A 1FDWA 1B74A 4R9UC 2ZYWX 2GZSA 1T3HA 4Y6RA 4ETIA 1FRQA 1Z74A 4ZI5A 1XVVA 2CXUA 4CTNA 2PZKA 3CTPA 4B1FA 1CDEA 3ROGA 4BN0A 2V1UA 3TW8B 4C3ZA 4MDEA 3BMOA 3P0IA 2ODEA 2YCLA 3BGDA 2G9ZA 4WINA 2DCMA 4PR3A 5FR2A 4FGSA 1KY4A 2E87A 1T1RA 1QIFA 4XARA 1MOPA 4A1FA 4B3BA 1A9QA 2IHZA 1KXZA 4UHCA 5DBIA 2EDAA 3L46A 4HAUA 3MWKA 3UAOA 3ABRB 3LQ1A 4MW1A 2ZRJA 5JC1A 2AZMA 4PCLA 3PUYA 3ZWOA 3ULKA 1BXKA 4MJLA 1XTQA 2WF5A 3F2VA 4DNFA 1BMFD 5EFZA 5KDDA 4HKTA 1MORA 3FYSA 1S8NA 4W9NA 4R69A 1NC1A 4IILA 4DBZA 4YR7A 3BJEA 4RD4A 2QN8A 4DJ5X 4QZVA 1GA6A 1KARA 1T9BA 1NPYA 1VM6A 2GF2A 1QGUA 2PS9A 2QNRA 1OU0A 4EHLA 2PXHA 4QT4A 3V48A 5EJIA 4ALMA 4BVKA 1DDOA 1NDUA 1IN4A 4CM8B 4EVIA 3IDSA 1EGHA 3JQPA 3QX8A 3INYA 3T1NA 5K0EA 2R8YA 3LYLA 1RADA 1CP2A 4IJ6A 3B3GA 4J3JA 4K3VA 4UARA 1PL0A 1AKVA 5TMEA 1I3OA 4ND3A 2PTGA 2FR8C 2EJTA 4IRUB 4QO8A 3T4XA 3TCNA 2N1BA 3VH3A 3WNZA 1QQ5A 1ZM3A 4EI8A 4ZT2A 3ZVRA 5I7RA 3HVKA 2M1XA 4HQ6A 4FVTA 2QSZA 1PYGA 2JK0A 4D9NA 1E6LA 3P0FA 1FS4A 1GKLA 2A3RA 1RXEA 2X9GA 4JL6A 3H1GA 3SX4A 3BOSA 3M1IA 3ZU2A 4MP3A 4CCYB 4PFJA 1MEEA 4H27A 1OU4A 1BN7A 1LKZA 1R0WA 1GUYA 1K3TA 5JECA 4IUDS 1U02A 1KE1A 4PAWA 3DCIA 4ZQGA 1I0ZA 4R2KA 4BJHB 3WB1A 4CMIA 3ANTA 2JGRA 4P0PB 4PO3X 3SOZA 1DWUA 4Z6KA 2I78A 3IP5A 1V71A 1U2SA 3RYIA 5JS8A 3T54A 1JAYA 4EHNA 3OP1A 4DRZA 2I9PA 1Z3IX 3HPRA 4LY0A 2EYQA 5HTOA 1I2CA 4REQB 3K2QA 2WNSA 1SG0A 5CVDA 4TS9A 2GBIA 5F5XA 1Q1EA 5TR9A 4DRYA 5KO2A 1ML4A 3N3AC 3IBGA 3HO1A 1ZH6A 1P5HA 2E0IA 1V1MA 2IV7A 4EECA 3RYCB 1AN9A 1LK0A 1O2DA 5J59A 4NMHA 3PHGA 4NS1A 2CT8A 1XMXA 4E5KA 4FJ1A 5ECYA 4JEHA 3J81k 2AH5A 3KZOA 4LBYA 4YJ3F 1WMSA 2A9VA 4E1BA 3JRXA 3ZGZA 4Q18A 2TECE 3UW1A 3EFEA 1XDBA 2GM9A 1NJ8A 1YQ9A 2XADA 4X65B 5DE3A 2XAUA 3PYLA 2XUHA 2HM7A 2LRHA 4UZFA 2WD8A 4PSVA 5IXYA 1N6HA 3T9BA 5CX1B 1L7QA 2HV8A 2VSQA 5FPYA 3KUKA 4RM3A 4U7FA 5CTJA 3W7BA 4YT2A 3PG5A 1BJKA 1J7KA 3H8WA 2ISQA 3UKDA 1UPTA 3HGQA 1X7DA 4CV3A 2WM8A 3IAS6 4RTNA 1WQ4A 2IQ5A 2IW3A 3UWPA 3FOWA 2G1PA 2J3IA 3MCUA 3FOEC 1ONPA 1QV6A 2J3EA 1J0AA 1TM7E 3I2IA 4D80A 4N7MA 4YQYA 5HIIA 4JELA 1BSVA 1V37A 4D9EA 2IYLD 3EXHC 2B30A 1BE1A 1E5QA 3DD5A 2HFJA 1E1KA 3HXPA 4JLAA 1IRIA 3DFZA 4L8FA 2X0RA 2P8JA 1ZD5A 4BV8A 2ZAYA 5ED0A 3UFBA 1CWUA 1EE1A 2F3TA 3W2GA 2CDCA 4Q82A 4JBWA 4CM9A 3Q6IA 4RHFA 3HLYA 2DH6A 3DFFA 1VJ1A 3G5MA 5JIBA 2FZVA 4X85A 1KIFA 1A71A 2JJ2A 2PSEA 1GPLA 221PA 2ZJFA 5ALSA 4P33A 5FADA 2IEYA 2G6BA 2X1LA 3X1ZA 2HF9A 1OZFA 4N5LA 4UU1A 4YJKA 2XUPA 3HABA 1KKLA 2I66A 2BY4A 4I3HA 4PW0A 4P3KA 2HMVA 1BKSB 1ZIOA 2PVSA 1FTYA 3TVTA 1T8SA 4PGAA 1FVXA 3QEMA 2WZCA 5B7PA 2VAXA 3O26A 4HB3A 5LP6B 4XFDA 1UJMA 1WJGA 4LFBB 4XGQA 4NEHB 3PNYA 1C9NA 1QYRA 1W581 1YIAA 2ZITA 1W4RA 2FN9A 1LVUA 1H23A 2H1CA 3AEXA 2P90A 2MSEB 1IL0A 4KQGA 4HN2A 5E7JA 4DV3B 2XVXA 4EPTA 1KTVA 1GG8A 1LW6E 3GZ4A 2O20A 4FGLA 1KH2A 2LCFA 2QTZA 3UG6A 3E9ZA 3ROZA 3H9JA 3IT1A 1L4KA 2J1LA 2VCEA 1CJCA 3L1KA 1N4AA 3G9TA 1F20A 3UK2A 2AJ8A 4IDNA 1IULA 1I6LA 1C3LA 1P31A 2NOAA 3G13A 3JAKB 3MINA 2CXHA 4BMPB 4F4UA 1NW7A 1CY1A 1NW6A 1ZM4A 4G5YA 4S0ZA 2G8NA 3TLYA 4EHBA 2JAUA 3ABSB 4EI7A 3B2EA 5I7HA 1KORA 1JQ5A 5JWOA 2H85A 2AOTB 5CD1A 4EFKA 1JH8A 4K6CA 3ZE7A 2ADOA 2ZJOA 3CVOA 2IU6A 4E14A 2FDRA 4UTXA 2JLSA 2WQZA 4JBHA 3ZEIA 3ITNA 3B1FA 1S3GA 3PXCX 3B1XA 4IZOA 1OGYA 4QKQA 3UXYA 4LNUB 3GRPA 2AZXA 5BSTA 1LUAA 2QORA 3NIWA 1G3UA 4TXNA 5DULA 5IBRA 3K8ZA 3ZV3A 1WP9A 1X8JA 4AQDA 1C7ZA 3NPMA 3A36A 4EDFA 5JBIA 3ESXA 2O23A 1ZD2P 3T9EA 3ROMA 4B7UA 3EIFA 3OJWA 1NJ2A 2PO5A 4EKNB 2RSLA 4ZJYA 3L41A 1N92A 2JH3A 3O3MB 3OHPA 2NZXA 3OZIA 4TT3D 3UAYA 2QMUA 2EKLA 1WKBA 2GF0A 2H4YA 3FDJA 3LBHA 3O8LA 1G19A 3EAGA 4J6FA 4QQKA 5DBFA 2PCJA 1UC8A 3ZX4A 4LFAB 3Q4GA 4Y18A 3FNBA 2IHTA 4JJEA 3O6VA 1NURA 5EMHA 2A57A 2OFFA 3FI0A 2WF9A 3SIRA 2O5RA 4W4TA 3AIIA 2X9QA 3AY0A 5EEHA 3R40A 3RVBA 3TQHA 5F2KA 5AW0A 2OO3A 3ICCA 2B37A 2UUOA 3P32A 3OPYB 4ND1A 1YUBA 2HI0A 3SM9A 4F1KA 2OAQ1 1A76A 1V35A 1WZNA 2YV5A 3BMXA 4BWVA 4MR7A 3VPFA 2CWDA 5CFNA 3ESQA 3TZQA 5HTKA 2PAAA 2SCUA 3D6MA 3JX9A 2ZSAA 4E4TA 4HV4A 5F9HA 4PU0A 5DHSA 2GTPA 4WZAA 4N3NA 1OIVA 5DYGA 1XKTA 3I5XA 3J7AC 1F4LA 4PO9A 3ILYA 2EWVA 3BERA 4C3UA 5KYYA 1I5EA 3E5HA 3U5ZB 4QUEA 4N0MA 2HK6A 2LBPA 3CN7A 2GUGA 4N65A 3QX3A 4ZANA 1H22A 1WUKS 1YQTA 2J3DA 2NUPA 1IEWA 3GFSA 1V3UA 4H7DA 4TTPA 5AR1A 1PFWA 3EISA 4OKSA 3TGLA 2HU8A 1DRWA 1FYDA 3IRUA 1RYBA 4AG5A 2EZ4A 4IY1A 721PA 3U16A 3LOQA 3HPQA 2AOUB 4AG6A 2VUIB 3FSGA 1L6IA 3H5IA 1X1EA 4TTTS 1RKQA 1DLIA 2Q6VA 1SVSA 2PR7A 1YRAA 2BUBA 2X6QA 3D59A 3EEIA 3MTBA 3EQ9A 2UXDB 1NLZA 1GZ5A 2VSYA 4NF2A 4PZZA 1OH5A 2PJRA 3MJTA 1WUIS 3CX6A 3H9BA 3WNBA 1GPJA 5ITZA 5B1IA 2Q5CA 3GGSA 2WE7A 3ON5A 5B64A 2R6ZA 1NMQA 3D0RA 1TT7A 3MWLA 2AUNA 2RG1A 1KMNA 3SZ3A 4LYHA 1AQUA 1YNOA 1EBBA 2YDYA 2FP4A 3AEUA 3PGLA 4JEMA 2ZPAA 1TJNA 1DAHA 3ETLA 1YQQA 5ESRA 4YIHA 1JIXA 1K8XB 3S1AB 3UJBA 4ZZ1A 5LSAA 4UHBA 2PTHA 5JH7A 5JXWA 2BWJA 2EWWA 1SUFA 3PDIB 3PHCA 4R9RA 5DGTA 4B0PA 2ZROA 3R7AA 2YS7A 1X2EA 4U2BA 1A8QA 2HKIA 2OSVA 1N8TA 1WABA 5KYWB 1G41A 3ISVA 4BNDB 3K9QO 4BEJA 1CC1S 4MPRA 1U0OC 2DETA 3PC7A 1I2BA 5F12A 3RIMA 3RHSA 3OCWA 4AKIA 1W47A 1FNDA 1RKUA 1SB9A 2IOFK 1V16A 1K88A 2ZE6A 4KJXA 2W6JD 1JMKC 3BM5A 2JKVA 3CEPB 3QLUC 4LSGA 3WP1B 5KX5A 1Q95A 5F73A 3VHRA 1J90A 1NR1A 4RF2A 2G09A 1PBTA 5HBGA 4YQEA 3U3RA 1X1TA 4M9ZA 4WEOA 3F6YA 3OEWA 1SCKA 4U00A 1PJCA 4GGOA 1FRNA 4HRXA 4QBGB 1TU4A 2H00A 2HIAA 1FF9A 2P79A 1AB5A 3RV4A 1Q21A 2NV0A 1AVTA 2AUTA 3HCAA 3W7VA 2XJ4A 4YUYA 3OZFA 1FLAA 4LK2A 2XHZA 4NU0A 2PE5A 3G49A 4MKIA 2UDPA 1HEIA 2DHCA 1J99A 2X7XA 3R5KA 2E89A 4ND2A 3I58A 4D9MA 3IPRA 2WAOA 2JAXA 2A1UB 4QUKA 3HV2A 1XQ6A 2QTNA 4S1VA 4WA8A 3ZV4A 4AKSA 4QU9A 4U6QA 5EJ7A 3PPIA 4B6FA 4OXKA 1FCJA 1JHOA 3DEAA 4BX2A 4D0LB 1GJRA 1KO1A 4Q37A 4E33A 1F9AA 2WUWE 2D1FA 4WPGA 1MABA 5E9AA 2GN4A 3DE0X 3HCBA 4FSXA 1OVGA 3WLIA 3RUAA 3U4IA 4DR4B 2QG6A 2Q2NA 3FZQA 4QUDA 2GILA 4D82A 2XGGA 3O73A 3ZV7A 3P9NA 4GVPA 3HYSA 4BCCA 3Q3HA 4UCXA 2ZB3A 3H1AA 1JBKA 2Q07A 2Q4EA 2AD5A 4II3A 2KYRA 2V7EA 3IC5A 3FLAA 3K9WA 4O2BB 2OQ2A 1STOA 4XX1A 5DPMA 2W2OA 3AV3A 3RUCA 3UXHA 2Q5OA 4Q9LA 2V54A 3GK3A 3LVFO 3DDZX 4H59A 5AQEA 4JL8A 5ALOA 1H2YA 3TNYA 5IRCD 1CUVA 2W8BA 2IQIA 1CS0A 3AHEA 1XRLA 3KE8A 2P9CA 3PXUA 1BHO1 5F2EA 4LX0A 3TQOA 4ZCQA 3WAJA 1PD1A 4PGFA 3UBMA 1Q91A 1L5RA 2HHAA 3UPDA 1OD6A 2B83A 3N8DA 3QMMA 3NDJA 2W2TA 1WBDA 4FR0A 3HDVA 4IFIA 4Q93A 4XSGA 3WGUA 1LSJA 4RWEA 3W9YA 2VP6A 3V1LA 3E3OA 3FMOB 2ODNA 1XJ0A 3W7AA 4ER7A 4RZ3A 1MXHA 2OMKA 1ZGHA 3FZNA 2GPBA 4RZUA 3RIHA 4XX0A 5G1PA 1MGOA 3MTIA 1GGVA 4E31A 1XQWA 4OP3A 1I01A 4IEIA 2QUIA 2X4DA 1L7OA 1XZIA 4EARA 3CZAA 1JHXA 2ZLBA 3OUTA 3Q9SA 4WTOA 3T35A 3HS3A 4IMIB 4OQ4A 1ATIA 3EXIB 3M5CA 4RADA 4OFWA 4BBJA 4EVSA 2NSJA 3ZZ0A 3KZ1E 4TTQA 3T6KA 1U31A 4XFJA 5DNVA 2HEGA 5I3CA 1JSLA 1N3IA 1YKSA 4FBLA 1BFKA 2PNFA 3DNMA 2JZCA 5JMPA 3HDYA 3SAJA 5K6RA 2DQYA 4ZHQF 1ITZA 2QJOA 1PNQA 3E22A 2EARA 3MQFA 2OQIA 3HYRA 5IAGA 2P9JA 3D7SA 4NONA 1G8SA 2VHZA 5A1JA 4AKGA 1QH9A 3EMBA 4GI2A 1PJSA 3ZQJA 5B7QA 3DEFA 3SXPA 3TPZA 4RQTA 1O8CA 1OJ7A 1UMCB 2QYHA 1U4SA 3NP7A 3KSDO 4MKHA 3GPLA 1HQCA 2XBLA 2XMQA 1V11B 3C3WA 5A9SA 1K86A 1WOMA 2DP4E 1W5SA 1IATA 4Q05A 1KR5A 2B3DA 3MS7A 1C3VA 1VC2A 4H2DA 1KAGA 2D0IA 1UJCA 3FGOA 4G5XA 4GOJA 1A69A 4OEHA 3BRCA 1LF0A 1Y3HA 5ARCA 2V55B 3N2EA 5HM6A 3SHVA 1QQ6A 2XYHA 3GT3A 4XIGS 4YVFA 5F51A 4EZIA 4YJFA 3FVTA 4IUBS 4M8LA 3C8UA 4G0YA 4G5FA 4O4JF 1PEYA 1VB3A 2J3MA 2ZDQA 3A31A 3C6XA 5K8CA 2PUAA 4IIHA 5G3YA 4RBNA 3L8HA 4AROA 1NHWA 2QG4A 3K5PA 4J0EA 4PRKA 4BYMA 2Y92A 3M89A 1J0CA 3PL1A 5EXXA 3ZLTA 2VK2A 3CUKA 3I9JA 3VR5A 2DR2A 4IIJA 2F1HA 2OCIA 2ZPTX 3I5AA 3WYAA 3ZZNA 4CLRA 1W85A 2VWGA 4DR7B 1YVRA 2XMBA 3ZZ1A 1Q14A 4FBMA 3FGNA 4MIYA 4US1R 4C1NA 3QX9A 4M9QA 4ZVMA 1E3IA 3OJ0A 5B5SA 3T4UA 1MC5A 2B8NA 5AJZA 2XWBF 1PGQA 4Q1FA 2VAPA 1A2KC 3EVGA 4A8JA 2QPAA 5GONB 1VL6A 1E89A 3B9QA 3O2SB 1MNAA 2Q7OE 2ZCVA 4KR7A 3R9KA 1LNZA 3Q12A 3DZJA 1E77A 2BFAA 5ARBA 1JZQA 4ARUA 1Z12A 2HA0A 3VMFA 2BFCB 4B2YA 1XDGA 3SDZA 3QZUA 2ZYGA 4O59O 2FVXA 4LDQA 3RIYA 2XE8A 1DB3A 3K8YA 1W44A 4NR0A 1HRDA 1JT9A 3HWX1 4JJKA 4U0JA 2C7VA 4QREA 2F4VB 3ZHZA 5KWIA 4HBZA 2CDNA 4EHDA 1GQRA 3JZFA 2IYAA 3PF8A 4WBNB 2W6ZA 4NOKA 4PCVA 3FNHA 1TAHA 2R8PA 2QI9C 5C4IA 2R7LA 3H65A 3P52A 3P0EA 3DEHA 4MHTA 2GFHA 2NYUA 1NFFA 1QIJA 3RGGA 2ZYDA 5BMVA 3ANMA 1DKMA 1KEZA 5JJBA 3R7LA 4R1SA 2VJMA 3N6VA 1HLGA 3CX4A 2QT9A 2VNKA 3FI9A 1NG9A 1CVIA 3PCRB 1UCFA 3RB8A 3FOZA 2QDXA 5LQAA 1AKWA 1XZLA 4ARIA 2AJDA 5AW9A 4ERNA 2PZAA 1J70A 2VNHA 1WSDA 1LLQA 5DW3A 4MYRA 5A71A 3T1VA 4BKPA 4C0LA 3AVXA 3WFJA 4D3SA 3Q7TA 4KBGA 4IMPA 2FU5C 5E38A 1GFZA 4AJ1A 1G7TA 1L7EA 1SVLA 3T95A 1FMCA 2IP1A 3CRNA 1XLTC 4WXMA 5H02A 5JG7A 1HX7A 3GGPA 3NOOA 3ORHA 4RKQA 3CCCA 2NU7B 1WTCA 3C5CA 1TU3A 1HE3A 3FJOA 3GA0A 3DYVA 3PQ3A 4ILEA 1DT3A 4QFCA 1O89A 1CD5A 1ZI9A 2XXJA 3UBTA 4RTOA 3WYDA 4BWYA 4L1KA 3PQ8A 5FOXA 4TLDA 4U7GA 3F7MA 1W1IA 1BDJA 3DV0B 4QD3A 5AW4A 3WGJA 5K2OA 5JWHA 5C5EA 2GN6A 1GTJ1 4G9EA 1N7JA 4MVJD 2PQMA 2WHEA 4TYPA 5EWLA 1TEHA 4Z4CA 4DDVA 3VZDA 3EGOA 3ZK9A 3N7UA 1XK7A 1NQXA 1NVKA 3L0IB 3PD7A 4F0JA 2GAOA 4CMKA 4C22A 3MCVA 4AF8A 4Q01A 5LMZA 2D3TA 4WOJA 3N2GA 2O2CA 1CS4C 2J7PD 3V4ZA 1EA5A 1VYVA 4WHMA 5IAOA 3VHXB 1ZCBA 2B78A 3C5WP 3LUKA 2ZWOA 7ADHA 4LUCA 4NU8X 2IEZA 3FLMA 1T2CA 1TPYA 2JIBA 2QRQA 4IOMA 1A98A 5F7ZA 2Y4NA 4D9BA 2Y0BA 4R2XA 1ZNZA 3AUKA 4JLKA 4BY9E 3PK0A 3GDWA 5H70A 3HADA 4Z1MA 1ISRA 5LKAA 3U61B 1W36D 2OAP1 1QF9A 4JI0B 4RENA 3Q3EA 2PRKA 2YCBA 3EF1A 2VZ9A 4NJMA 4CNBA 1I3KA 2AFVA 1C81A 4HNQA 1OLOA 4LRTB 4HVLA 1FUUA 1FFBA 4KOAA 2PH7A 4GL2A 2I34A 5HR5A 1YNSA 3EFHA 4EW6A 3U26A 3P9IA 4YRJA 2H29A 1GRNA 1PVDA 4HI0E 4Q1VA 3PYMA 4DQLA 1CY6A 3OIGA 2Z1MA 2L18A 1K5PA 1L5VA 3D6FA 3NAGA 3SR0A 1TYZA 2FDCA 1T2UA 1TL7C 4NEQA 5B2FA 1OXMA 2H2AA 2NZ2A 3G2NA 1T9ZA 5E4YA 1UC5B 3PCXA 1NYTA 1EXMA 4G0MA 1QQAA 1SQ5A 1IZYA 1HT2E 1LWOA 4YPFA 1C29B 1NTOA 4CMCA 4LMPA 3PGMA 4CDRA 2V4MA 4Y0NA 4E5VA 5J5VA 1ODJA 3A6DA 2OGTA 3TSCA 2C4TA 5JW6A 3JZAA 4XRRA 2JVIA 3IHKA 1WM1A 1W75A 2D7CA 5C8YA 5CFOA 8ABPA 2WWHA 3R3XA 4JOQA 4KZKA 4UM9D 4K9RA 1U2DC 1U0SY 4FCCA 1Q22A 1WA5A 1XTBA 1RI1A 3RDPA 5JQGF 1A8SA 1P19A 3EF0A 3QKRA 4MRMA 4YV1A 2QUJA 4YJ2B 5FD8A 2YVQA 3CLTC 4KHZA 3OH8A 3QPBA 1TEXA 4EA7A 1JSCA 2OCGA 4OP2A 4RSRA 3VSBA 2PIAA 2PRYA 4RYLA 2FEOA 1IG0A 1QLWA 3AILA 3HFJA 3KLNA 3PXBA 2YYSA 3OESA 4OYHA 5AKGA 3KQWA 5GAJA 1OMOA 1TU0A 2I2XB 3B2QA 4D0GA 3N39C 3M6VA 1RPTA 1WHTB 3PTZA 3Q9LA