1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
1E2EA 2I1VB 2QSZA 3CKLA 4MGKR 2HLDA 4B35A 1KI3A 2IXFA 4OI0A 2RCNA 2EWVA 3I3SR 3VX3A 4PC3A 5JJKA 1F60A 5EE3A 5CK5A 4ABYA 3MFYA 4JLJA 1MO4A 2YKGA 2IYZA 3MGCA 1ZNYA 2ZQ5A 4ARZA 1GP2A 2P6RA 4Q9IA 3O8RA 2PEYA 3GFPA 4F91B 3MAAC 2G0TA 5AJVB 2JIZA 3QVVA 3KKNA 3EC1A 2WWFA 3NH9A 2VLIA 3LRPA 1ZIOA 2W0SA 5EXSA 2Q3MA 4DBLC 4JKYA 2WSSA 5DE3A 2E87A 4LJ8A 1JXMA 4WVFA 1ZC3A 1OB5A 2ZITA 3MLEA 4N1AA 1VCNA 4LV6A 5JS8A 1NN3A 1Z83A 4LZZA 5EE0A 1KI7A 4HAVA 1G18A 4LBZA 1JBKA 4HLCA 2GEDA 4JKIA 1W44A 1JAHA 2HXSA 4W5JA 3CZPA 3GJ8A 1YE8A 3N70A 3TNFA 2JLZA 2G1KA 1LB1B 2O8DA 4YC7A 3B82A 1CTQA 4WW0A 1P9WA 2GF9A 3MWLA 2FEMA 3N2IA 1R5BA 3UMSA 1SXJA 3L8YA 4GI7A 2G77B 1OJLA 5BYJA 2YVUA 3H2YA 4ZDIA 2ONKA 4LHYA 4IFBA 5HKKD 1P2VA 2WWHA 1G17A 2AL7A 2JDIA 2ODWA 5JLJA 2ZJYA 2JLYA 1Z6AA 2A30A 2WPDA 4AIIA 4HUQB 3U7FB 1XTKA 1GDDA 2WJJA 1UKEA 1G64A 4DLTA 5J4HA 1FNNA 3TR5A 2WHXA 2GXUA 2IF2A 3DHWC 1T8TA 2QN6A 4LBVA 4NYIR 4TZ0A 3QEJA 3QF4A 4FMCB 5C46F 1TTTA 4KSBA 1E32A 1DS6A 3EPHA 2W83A 2F43B 5L3SB 1ZCAA 2B7BA 1A5TA 2B21A 5FUVA 4R98A 1JJVA 3E70C 2IA5A 3AP1A 3OIUA 4OQXA 3VHXA 2B6HA 1CR0A 4WZAE 1ZD8A 4B34A 1G7CA 4GMXA 5HR5A 4DLSA 4C7OA 1ZINA 4GOKA 1KJZA 5F3WB 3IUYA 4E03A 4FXPA 4A2QA 3CRVA 1CULC 2RGAA 4JYCA 4BFWA 4TL8A 2GXAA 1AS3A 3CRRA 2YNMA 4V0ME 2QRZA 3K9HA 4YLGA 3IBYA 5DN6D 1A2BA 1XDBA 2ZSEA 4C0SA 1ZVQA 4MRNA 3HR7A 3BB3A 2MMCA 3OE7D 3IBGA 2P0EA 4HAWA 2BOVA 3LY5A 3CF2A 3SN6A 3K0FA 1M74A 5FBRB 4TMZA 3TQCA 4P4UA 5H1YA 4RZ3A 1KGDA 3PV0A 4Q00A 4C2UA 1VHTA 2CJWB 1ZNWA 2YWGA 2C5LA 1GRRA 2K5UA 3AGQA 1DAFA 3K8YA 4A2PA 1JEEA 1P2TA 1UKZA 2FSIA 4ZKDA 2ZSAA 2FNAA 1SZPA 3SBDA 1NI3A 2ZUDA 1OXUA 1SXJC 2ATVA 2BBWA 3LH5A 2JJ1A 4ARZB 4D80A 2ZRAA 2BCGY 1KKLA 3ICEA 2FFQA 1TEXA 3ZH9B 1KSJA 3IHLA 2DFLA 4I1VA 4E09A 4JLVA 4TWZA 4YXWA 4EQ6B 3VR6A 3GPLA 1BMFD 4A4DA 1W49A 3BERA 3L0SA 4JVMA 4OYHA 4Q18A 3AUXA 1TX4B 1RW4A 4JLNA 4CIDA 1IY0A 3NHBA 2A5DA 2GEUA 1OFUX 1G8GA 5EZ6B 4NCNA 3ADBA 1OH5A 4NDZA 1UKVY 4NKRA 2ZYUX 3QKUA 2PCJA 5TDHA 5HE9A 4A0HA 5FTNA 1GWNA 5EP2A 4C7OB 3QSYA 3NC1C 4NYJR 3QKRB 3PJRA 4OHVA 4F38A 4R2IA 5JJIA 3K09A 4V0NA 5C2JB 5EE9A 2WVJA 5FPSA 1UF9A 3SYKA 2ZJ2A 1S2MA 2F1IA 3D31A 3QOFA 4B2LA 4WOPA 2E1RA 4F7WA 2YZ2A 4LX0A 2VHUA 3ZZUA 4EFMA 2AK2A 4DDUA 1PZNA 4Q4LA 4IOLA 4X8MA 3TVTA 2GZHA 3BS4A 2XAUA 2AXPA 3A1SA 3TUJC 4HZUA 3QXJA 5CIWA 3P4YA 5AWFC 4P33A 5FR1A 3Q72A 4PZZA 1YJ5A 3BAFA 5B57C 3DPUA 1AM4D 2LCFA 1MO3A 4DDVA 4NONA 3RS5A 3OIWA 3MRSA 4ZCIA 1OFIA 1T0HB 1YZLA 2IYVA 1GFIA 3BGWA 3FKQA 4K46A 3UANA 4A6PA 2N46A 3KUCA 4AKGA 1S4QA 2G1JA 2GXQA 2JGNA 1N6NA 4LJ7A 2NPFA 4C4PA 3ND8A 3LQRA 2EFGA 1E1RA 4A6XA 1OW3B 2A5JA 2WWYA 3EASA 4MRRA 1T91A 2XTNA 4IOMA 4EJSB 3EW9A 4M21A 3BWDD 3R20A 4XSHA 2AXNA 4Q7LA 3WBKA 4RZUA 2NZJA 4ASUA 3ECCA 1WBDA 4QGHA 2D2FA 3NDPA 5HCNA 1E2JA 4OK6A 2OSBA 3TW4A 3HU2A 3IPYA 1G4UR 2GRJA 2RHMA 4OQNA 1EESA 1V5WA 1YZKA 2HJVA 1U0HC 4LRWA 3DKVA 4DCNA 1XXHE 5J5CA 5CK4A 1DTSA 5GADl 4GSYA 4DCSA 2HCJB 2R6CA 2PX3A 4PFSA 5CJ2A 5JSZA 3DM5A 3QF7A 2F9MA 3DDCA 1GL6A 2CE2X 5EXPA 2IW3A 3AH8A 3T1OA 4RD1A 5SZIA 4QHYA 3W8RA 3TSWA 4DB4A 2ZI9A 2CL6X 4EJSC 4PPGA 4FIDA 1Q12A 2ZSFA 2GCPA 3ZD6A 2FWRA 3RHFA 5B64A 1DELA 3OEHA 5CLQA 2BMEA 4A0FA 1FW6A 3BH7A 1ZD9A 3DZ8A 1UBGA 4L16A 3EWAA 2F43A 3UWKA 1E9FA 3I5XA 3GJ0A 1D8TA 1O87A 3PQCA 4RKFA 4DT1A 5LDDC 3GCGA 4QM7A 2ZRJA 2D4HA 2VHJA 4H1UA 5KSYA 3AVVA 3QG1A 4PAMA 4DHEA 5IT5A 1EX7A 4KXFB 2QROA 2EYQA 3JVVA 2W2XA 3ZVRA 1QZXA 3PUYA 1WXQA 2FPLA 1MO5A 1E2MA 1EWQA 2G0NA 1AZSC 1E2PA 1NMXA 4JLBA 2BBSA 2WWGA 1OH8A 4I81A 2QAJA 1ZIPA 2RGEA 1P75A 4URZR 3UPUA 3MWJA 2XJ4A 1TMKA 1RJ9A 5GVSA 1YVDA 3QXHA 1II8A 3CIOA 4TLBA 2HCBA 3SOPA 4D25A 1N6KA 1DO2A 3SFZA 3ZZTA 3O47A 1K6MA 1U9IC 1GNPA 2V8OA 4TYQA 4PC1A 4ZDJA 3GLGE 4O25A 1AS2A 1G7TA 1SVLA 4IOKA 2Z4SA 3QXSA 5FPYA 1W0KA 5AJYA 2QRNA 4II7A 1EFRD 4G5OA 4Q7MB 5JCZA 1SVWA 3EIEA 4TSFA 2GZDA 2QTHA 4PC6A 5AR1A 2IYSA 1YR7A 1E9BA 1OLOA 4TTQA 2PMDA 2BV3A 1NBME 1SKYE 3F8TA 2D7DA 1EXMA 4S35A 4M1MA 4D4LA 3JZMA 3KX2A 4JS0A 2IK8A 4ACAA 4RD0A 1QHSA 2FU5C 5CIQA 2J0UA 1EFHA 3OF5A 1R8QA 1IN5A 3SFVA 4GL2A 4GRAA 4HZIA 3WRXC 2Z0MA 4DRZA 5FPKA 1U81A 2IWRA 2ZU0C 1ESMA 4BECA 1DAEA 2IEYA 4TYPA 2QAGB 5JZVA 3SC3A 1UAAA 4W5HA 3OAAD 4DCUA 3TUZC 1QVAA 3GJ4A 3A1WA 4ON9A 4V02A 3AF2A 1II9A 1NIJA 2ZI4A 5DSZA 3A4MA 3Q8XB 4OQMA 5E3HA 4M1TA 3ZS9A 1Z29A 3T61A 4JMPA 1DAMA 3BB1A 3K0CA 1HURA 4RCYA 3KQHA 4URYR 3MCAA 3PR1A 1TAGA 3QUSA 4MGYR 2D2EA 4J0QA 2OAP1 5EZ5A 4BEJA 5JHGB 1RYFA 2GNOA 5ELXA 3V4FA 2JLSA 5LB2A 4C3ZA 4D4JA 4B43A 5FTJA 5GJVC 4BFYA 3CPEA 1RZ3A 1Q0UA 3DZDA 1MRNA 4QJ3A 4ASUD 2BKEA 2J9RA 1WB9A 2IYQA 3DVLA 1AQYA 2GK6A 2VBCA 2WJGA 2RGNC 4C0QC 1J8MF 1E1QA 2WBLC 1E9CA 1SVMA 2W2TA 3WNDA 2OLKA 1ZU4A 4QHSA 1Z5ZA 2OBNA 2ZVPX 2YINC 2ZRPA 4UQOA 4L4UA 3ADCA 1Z6XA 4LJ9A 4M1KA 3EXAA 3K53A 3G82C 4O3MA 2H1LA 4M53A 1W2GA 3RABA 4TMTA 4CEIA 3A58B 3E1SA 2CLCX 2ZI3A 2YWHA 4PHFA 3TMKA 1YHNA 3RANA 4MKIA 1CRQA 3GD7A 3U7EB 1GNRA 1U8AA 1XZQA 4M9XA 1OH7A 1IM2A 4AY2A 4I1SA 5A0FA 4RZXA 2J0SA 4QXAA 4Z54A 5SZJA 3QE0A 2CNWA 4LHXA 1IXZA 4CZ2A 1AIPA 4TLDA 2FMXA 1E0SA 1NG1A 1E2HA 1S1MA 1Z6GA 4YMTA 2JLQA 1UEJA 2FDCA 5DYIA 1GRQA 2QPOA 3A1TA 4UJ3A 3CO5A 5E7JA 3NKVA 4TYWA 1RYHA 3BOSA 2GBLC 4URXR 2PCLA 2FSHA 3HPRA 4Q21A 2JJ2A 3BK7A 3B85A 4JT4A 4DLUA 3TE6A 4ACBA 3U2QA 2RGCA 1F5NA 2PT5A 4TLCA 5FBWB 5SZHB 2AFHE 5CITA 4A8JC 2DWPA 2OT3B 4PANA 5TVKA 3Q5DA 3WRYC 1TADA 2OBLA 2C95A 3I62A 1MRSA 2OCAA 2OFXA 4BASA 4WZ6A 3EG5A 1FP6A 1SQ5A 2GAOA 1IXSB 4D6PA 2R6FA 2EU8A 3AGPA 1EG7A 1W5TA 2WWIA 5AK0A 3K0EA 4O2LA 2FJUA 3IIKA 1CIPA 2X2FA 3BIFA 1GKYA 3JZAA 1DVRA 4LYJA 4QL3A 2O8DB 4LSGA 3GLFB 2IYLD 1N6LA 3TRFA 4Q03A 4URVR 4CEJB 1W0JD 5IK2D 1FFHA 3LO5A 1OH6A 3KKPA 2IL1A 2Z5FA 4NL4H 5KPJA 3W90A 4B2PA 1AQUA 1G21E 4DLYA 1RRPA 2GJKA 2ZRFA 1G6OA 1JAIA 3W6PA 4B3FX 1S1CA 2R2AA 4Q47A 5KU1A 2O8FB 4ZIRA 1NVVQ 1G41A 1YR6A 3RDPA 3W9YA 4TQAA 4D4MA 1ZM7A 2ODNA 4PSKA 1E6CA 2ZPTX 1ODFA 2W6JD 4RVCA 2QGNA 1NJFA 1WE2A 2V9PA 2VYFA 1KK3A 4LHWA 4POAA 4YXWD 1RVDA 4URWR 5HTKA 1Z08A 2V4ZA 3Q7QA 1GIAA 4LBYA 1KAGA 1CR4A 4MYTA 4QBGB 2O0HA 2ZYWX 1G8FA 3EC2A 1KIMA 3QQ5A 2AKAB 5BXQC 2OG2A 1Q3TA 2Q6TA 4GZMA 1G7RA 4CEHA 2ZROA 5FI0B 2WMNB 4OJKA 1S96A 3AV0B 3HR8A 3VAAA 5TMPA 4UNSA 1LW7A 3RYTC 821PA 3GLIB 3LXXA 3U44B 1GUAA 2ZRCA 4TT3D 2MMGA 1KNXA 2FFHA 1SVOA 2N1BA 3WMFA 3AF0A 4FCWA 2H17A 4DC9A 3KKQA 4MGZR 2C99A 3GMTA 1NKSA 1FQJA 1UEIA 2G9NA 5E95A 4D26A 3BE4A 1GM5A 2JA1A 1L4YA 1WF3A 2IBMA 2L0XA 3UMRA 3B1ZA 1OPXA 4BFZA 1QRAA 2PZEA 1LTQA 1P2SA 1O3YA 2Z4RA 3SU8A 5FOUA 5KNCA 1VG8A 5KUTA 1MOZA 1S9HA 4I4LA 4F4JA 3RRYA 4IRUB 1KDPA 5JEDA 3SE0A 1SVKA 421PA 1D2EA 1HTWA 3DO6A 5EP4A 1OYWA 2ZVQX 5JRJA 3PFIA 1P60A 4FW9A 2WKRA 1GOTA 2FPMA 3C16C 2BIFA 4UNNA 1MO6A 5FL7D 1QHHB 2WIAA 3FHCB 3VR4A 1IY1A 5J4VA 5KO2A 1MV5A 3UATA 4NH0A 3NH6A 121PA 1W4RA 5J4KA 2P6NA 4HLDA 5DHFA 3KFVA 3OFND 3ADDA 1HE8B 3SJBA 4AG6A 2QSYA 3RSLA 2ATXA 1GAJA 4Q9JA 3VR5A 4LCBA 1CJKC 2IYXA 2HF8A 1P61B 4OK5A 3SYNA 1G16A 1G6HA 4M4SA 4HYYA 5EUMA 4KVGA 1Q1BA 5EXXA 1KMHB 4KLZA 3FB4A 5F9FA 1Z8FA 3U5ZB 3K09C 2J59A 1E2KA 2ZI7A 1N3BA 4AK9A 4OHXA 1G20E 4ZCMA 3OEED 4FWIB 6Q21A 1D5CA 4NMMA 3QENA 4HAUA 4DLZA 5CM9C 1IN6A 1JQJC 1YR8A 1FUKA 4AYWA 3PEWA 2C03A 4P31A 1C9KA 4NYJQ 4RJLA 2ORVA 3GEEA 3Q9LA 1N25A 4TL6A 1GRNA 3SJAA 1YZQA 1QG4A 2HYDA 2Q21A 1HY3A 3H1TA 3NWJA 3KQUA 2ORWA 3MMPA 3OFNA 3UXMA 5IF9A 1YZGA 1Z0DA 1S3GA 4BZPA 1G3MA 1DOAA 2OE2A 2ZS9A 3AEZA 2CHQA 2FF7A 2ZAOA 3K0CC 2HYIC 4R7ZA 4OI2A 3C14C 1G7SA 1JJ7A 1G1MA 1XRJA 4FMCF 4EKDA 1CKEA 2OLJA 3T35A 3VHLB 4G5GA 2C98A 4DLRA 3CNLA 1DE0A 5TV2A 3P26A 3CONA 4CEIB 4EPRA 1KAOA 1U99A 3FDIA 4CEHB 4QRHA 4XWKA 4LV5B 4NCJA 5CYPA 1JPJA 4TLAA 3TLXA 1US8B 4HB3A 5FOXA 3AKCA 3ETLA 2VA8A 3H84A 5UKDA 4PAQA 3NBXX 4LPSA 5L8VA 4DSOA 3ASYA 5D3MA 4EFLA 2JATA 4P4SA 2AD5A 1RFLA 2VP6A 3D3QA 1XPOA 4Q4JB 3KDSE 1KZGB 2YOFA 3UWOA 2C9CA 2KB0A 5K8UA 1Q57A 5KYKA 2UVQA 4DUGD 1TF5A 2D62A 4WXRA 4XTRA 2JJ2D 4B44A 4PQFA 4AYTA 2WJHA 4WA7A 1HV8A 4BRUA 5LB4A 5AJWA 4JYBA 4ZKEA 1NBMA 1DAGA 3C41J 5BN5A 3B1WA 4LC1A 2PZFA 4TZ6A 1UDWA 1VYVA 2GEVA 4MKHA 1L8QA 1N5JA 1SXJE 4B33A 1TF7A 1ZRHA 3SQXA 1T5IA 2ASEA 3GJXC 2CCKA 1S9DA 3BD9A 2QE7A 3BJIC 3SZRA 2O5VA 3HPQA 2HT1A 4I99A 1EFTA 2CMKA 2PMKA 1UADA 3ZDQA 3SBEA 1QHYA 1N6RA 2QP3A 4ZV4A 1X8LA 3N5CA 1HH4A 3DOEA 5DIFA 2B92A 2CLDX 2NPIA 3O8DA 2YHSA 4OQFA 1CEEA 4C0HA 1VG1A 1R4AA 3IQXA 5BQ5A 3W3AA 4JZKA 5KPDA 4L8GA 1Z06A 3QXXA 4URUR 2OZEA 3R7WB 1NN5A 5HZKA 2VP2A 2QM8A 3W8NA 2KBFA 4AWXA 3CZQA 1P5ZB 1KZ7B 5B30A 4M0LA 1LV7A 1XB2A 2IXEA 4Q1BA 1G3QA 3THOA 3VKWA 3T12A 2AN9A 2FG5A 4Q48A 1XP8A 4RZ2A 1CJUC 4NCKA 4X8HA 2A2ZA 5J40A 3NBZC 2GF0A 1ZNZA 2CVHA 3KJHA 4C0JA 2A9KA 2MSDB 3P32A 4Q4HA 4XOIA 2QPAA 3TAUA 3ASZA 3U6BA 3NEJA 2UZ3A 1GKUB 2RH5A 1CJTC 2ZI6A 3LV8A 5G53C 1Z47A 1ZJ6A 3LFUA 4JLAA 4B48A 3FE2A 4RD4A 4GP6A 1BS1A 1Z2CA 1N5LA 1NY5A 1E9DA 2A5GA 2ZR9A 3D8BA 5DHAA 1W36B 2QG6A 2CK3A 4D0GA 2TMKA 3AM1A 4DVGA 1R8SA 2P67A 3RC8A 1XTRA 3K1JA 2D3WA 2QQ0A 1QHIA 2GJ9A 3F5FA 2VL7A 4HB2A 2QGZA 3LLMA 4MA4A 1M34E 2GTPA 3OIVA 2DBYA 3PUWA 1F2TB 1AZTA 1OHHD 2GJ8A 4E07A 3AUYA 4B6EA 1SKQA 2XB2A 3KJGA 4XWOA 3I8XA 1NSTA 3ZVMA 1XMJA 3GJ7A 3WHLA 1TQ4A 2IYRA 2NG1A 3A37A 4Q9HA 4QBHA 2V7QA 1HYQA 1US8A 2WJVA 2XB4A 4JLDA 4O0MA 5E7IA 3K70D 2DYKA 3AP2A 2A7QA 2Z6VA 5KNDA 4RFSA 3WXMA 1OKKA 2IX3A 2CNWD 3KXKA 2HT6A 2DY1A 2FEOA 4HDOB 1PLLA 4CVNA 4UKDA 4CEJA 1BMFA 2C04A 2WPDD 3TSOA 4QM6A 1RRFA 1ZC4A 2JIZD 2ZETA 1H65A 2ZE6A 1DADA 4HLUA 2WKQA 3EPJA 1BYUA 2QY9A 3A8TA 5F9HA 4NBSA 3V00A 5HE8A 1AJEA 1IN4A 2PT7A 1ZU5A 1I4DD 2DFKB 2JDID 3HJNA 2XZOA 1OF1A 2V55B 1NVWQ 3TH5A 2BMJA 2WJIA 2ZRHA 2FZLA 3U7GA 2G83A 4XVUA 2OUKA 3MUFA 1B23P 3KTAA 3B2EA 5DISB 1HT2E 2AR7A 2BHRA 4GBMA 5IRCD 2OXRA 1IBRA 2WKPA 2I3BA 1KHTA 1QHGA 3CRQA 2QQEA 5JECA 1U9IA 1ZD1A 1A7JA 1TQ6A 2ZR7A 5CJPA 5JEEA 3CNNA 4HAYA 4HLQB 2VEDA 1E79D 1UM8A 1P73A 2C78A 4DSNA 4DCTA 4P0TA 2VRWA 4CT4B 2PH1A 3CF6R 2YJTD 1VIAA 2UZIR 3QBTA 3VFDA 2J0QA 2QAGC 2IXGA 2KE5A 5FUXA 4RFVA 1Z07A 2QMHA 1J8YF 3EZ6A 2QENA 4IEIA 4R9UC 3QY0A 5C4GB 2QBYB 4I1UA 4KFRA 1MT0A 1U8YA 1NKTA 1FX0A 2IS4A 4BFUA 3LVRE 3OE7A 2F1RA 1D2MA 4PZLA 1WQ1R 1E3MA 2XXAA 1A2KC 3KL4A 2CVFA 1QDEA 4P32A 4TN1A 1ELOA 1OYYA 1E1RD 1Q44A 3TBKA 4KYIB 2R9VA 4AKIA 1VTKA 2R62A 4IVPA 3U3MA 2Z43A 3BB4A 4BGDA 1X6VA 4QBFA 1GTVA 2X2EA 1LS1A 2FH5B 3IEUA 2RB4A 3B9QA 3CX8A 3GFOA 1FOEB 521PA 2EFCB 2PL3A 4N0DA 4WXPA 3UK6A 4DT1B 2IC5A 1FPMA 2EW1A 3TW8B 2RGXA 1FMLA 3QKSA 2FE4A 4JSYA 1OFHA 2MSEB 4KI0A 2J87A 1KK0A 2OFOA 2AX4A 4IFEA 3NTUA 1OXVA 2VSXA 4EPYA 2WICA 4PPNA 3AB3A 1UBFA 2ODEA 2QP4A 3PXGA 3ZYCA 2W0MA 3J81k 2H18A 5IDVA 1IOZA 5A5GA 5EP3A 2R6AA 3LA6A 1XCPA 3M6AA 5FTKA 3R9IA 2GXSA 2XZLA 1KI6B 1OIWA 1OT3A 3IIMA 4LHVA 2ZJOA 4Z1MA 2JAQA 3GJ6A 1GL9B 1V43A 3TKLA 2R8RA 2AK3A 4M2LA 4RD6A 1FMJA 1XXHB 3WYFA 4PO8A 3GLHE 2XGJA 1E2NA 3MG9A 1F2UB 1HE1C 4QC2A 2HV8A 1NSFA 1T0JB 3QPVA 4BUJA 1NJGA 4B3BA 3BC1A 1JPNA 4B75A 4EPTA 1SKYB 5FUYA 3S1AA 1E9AA 2NGRA 1J7KA 1GZSA 3ZVLA 4TTPA 5FFMA 1EFCA 5G41A 3TR0A 3VKGA 1A82A 4A15A 1XTSA 4AYXA 4NPHA 2BMDA 3VR2A 5EXTA 4QFMA 4Q1CA 2VP9A 3X1DA 4NZYA 1T3LA 4IJMA 1ZUIA 4B3CA 3QVUA 1I4TD 4BLRA 2ZSBA 1FUUA 4M9QA 2FOLA 1DEKA 2J7KA 4CW7A 3SHWA 1L7VC 3KUDA 4Q66C 2JCSA 1OV4A 4JLMA 1Y3AA 2O8FA 4GMDA 2XNDA 1IN7A 1U0JA 3HYRA 2Q3HA 2F1JA 2BKUA 2HEIA 2PBRA 3QPUA 1VYTA 3UMFA 1HQYE 3GLIE 3EWSA 3O8CA 1XFAA 2CK3D 3I8SA 4P3YA 1F2UA 2EYUA 2XNSA 3GLHB 2IT1A 4BLTA 5LD2B 2A3RA 3VU9B 2P3SA 3SYLA 2N42A 3THYB 4IXMA 1IY2A 3AQ4A 3HU3A 5BYKA 1H8ED 3ONWA 4M8NE 3U61B 4JJKA 3KQLA 1IJEA 2DHRA 1JR3A 4IDQA 3TK1A 3WHKA 4BLSA 1W1WA 1R5NA 4M1YA 2HUPA 3CUEF 4NE2A 2QAGA 4KYUA 2P6UA 4QGFA 5K8LA 2CHGA 1FTNA 2ZE5A 3QKRA 1NLYA 4AKHA 1N5KA 4ESVA 1C1YA 1G5RA 2VTKA 2QZ4A 3PENA 4KITB 4BRWA 5G3ZA 1KSHA 4N0EA 4PQRA 4TMVA 3RS0A 2ZM5A 3FWYA 1VMAA 5KSZA 1E4YA 2J7PA 1ONBA 1RIFA 3NVAA 3DMDA 1QBKC 1XEWX 3WMEA 3PUXA 4FD2A 3UG6A 1E2QA 4OK3A 3KJEA 4PC2A 1XPRA 3GLFE 3L43A 4NYIQ 4EFNA 5IHPA 3DM9B 3CPJB 1R0XA 1XEXB 3LBNA 1UFQA 3N2EA 3REFA 3HWSA 1BYIA 1OHHA 3FHTA 3QEOA 2GHIA 1QHNA 2C9YA 4LYFA 3RS3A 1JR3D 5TB5A 1P72A 2NO0A 3RS2A 4MRPA 2QBYA 2C77A 4BLQA 1KI2A 1JXOA 2DWQA 3B5JA 5M04A 4OHWA 4LBWA 1YU9A 4C0LA 4A0RA 3H4MA 2HJGA 3L0PA 3EARA 3K0SA 3FOZA 2FZ4A 1R5OA 4HEJA 1KMQA 5G40A 5AJXA 5BWMA 1DPFA 2O8BA 1F3OA 1SVSA 2I4IA 3C5HA 4YMWA 1YQTA 1XX6A 1ZP6A 4IDOA 1PUIA 3B6EA 2O8EB 1DAIA 5DH9A 1RRCA 5HKKA 5DO9A 2NTYC 2ANBA 2RGGA 4KBFA 1KI9A 4JLKA 2W2VA 4IXNA 4MH0R 4TL7A 3ZIAA 4XH9B 1LF5A 3LQQA 5P21A 3DKPA 1Z0AA 2V1UA 1GSIA 2GETA 3LW7A 5C1BA 3VNVA 2J0VA 1NVVR 1XJ0A 4KFTA 2G3YA 3V9PA 4UNQA 1GITA 2DFNA 3EX7C 1CJMA 1L2TA 4D81A 4IHQA 3SI7A 3SS8A 1T8UA 1P7CA 3LDAA 1E2LA 5C4MA 2AD1A 1VYUA 1T4GA 3WY9A 3DOFA 4RY2A 2P2LA 1FZQA 2B8WA 4DEYA 3A1UA 4LOAA 1CU1A 2H92A 2GCOA 3FGNA 3GQBA 3MD0A 1NG9A 4ZDWA 4YDSA 1JECA 4QJ5A 5DI3A 2GCNA 1W7AA 1XCMA 2P5SA 5TXGA 1SGWA 4B71A 4KODA 2OV2A 2ZRIA 4JBXA 1F48A 2V6IA 3M4YA 4Z1MD 1E94E 4PPFA 4UJ5A 3I61A 1EX6A 4D2IA 2CE7A 4A8JB 1WP9A 4OL0A 4M1SA 1G291 4LC0A 4ERNA 3NC0C 4DIEA 2P65A 1COWA 3A36A 4KFSA 1KJYA 4GZLA 2OXCA 3RNLA 2OFWA 2SHKA 5FOSA 3WBJA 5KHOC 3A6PC 1KNQA 1P9RA 4TLEA 2VSOA 1TUIA 2Q9BA 3ND9A 3GJ5A 5BW8A 4BFVA 2BJWA 4TMWA 3SEAA 1S0UA 1W36C 4D82A 3CLVA 1X86B 1G3RA 2VF8A 3TQFA 2H5EA 3I5YA 3BFVA 3EA5A 1ESNA 3CX6A 2W6IA 1OB2A 3VNUA 2QI9C 1W4AA 221PA 2QMUA 3I4LA 1BKDR 3LX5A 1KO1A 2NO1A 4MQBA 4IKEA 3F3YA 2EWWA 4DDTA 3AF1A 1TQ2A 2F6RA 4A9AA 1U98A 2IYWA 1JQLB 3VX4A 2OEPA 3I92A 2FSFA 3FFAA 4NCIA 3ZS8A 2A78A 2GZAA 4JBWA 1G4AE 2VIIA 3WNBA 1G3UA 1KJWA 1J70A 4B2IA 1UPTA 4UNRA 4Q9KA 3KJIA 1SULA 4CYMA 1MR3F 1OIVA 4TL9A 2ZRNA 1JI0A 2YWFA 1AGRA 2F3RA 1G5PA 2ZJ8A 1KYIA 4AI6A 2REBA 4HZUB 2VF7A 2C9OA 5B58C 4XTCS 2JLRA 2YV5A 2QA5A 3IILA 1AN0A 3I1FA 4Q02A 2FFBA 1W4BA 1CRPA 3KXIA 3GLIA 3QNUA 2QMOA 3FMOB 2ODBA 3ZVNA 5EJEA 4KLNA 2J7PD 4D0NA 2AWNA 1W47A 2ZR0A 3DEFA 4JVLA 4HB0A 4LV8B 3LAWA 3A1VA 5L3RA 1CXZA 2WSMA 3EIQA 3R9WA 3AP3A 1X8JA 1HQCA 1U2RA 4HB4A 1GL7A 1DG1G 3AVQA 3BORA 3W34A 1A4RA 2A5FA 4OKSA 2IF0A 5DGXA 3RSOA 2RMKA 4A82A 5A4JA 1M7GA 4RKEA 1N5IA 4RFSB 1MH1A 4PO9A 4NHOA 2OAQ1 3ZZ0A 4LI0A 2VPPA 2ZAMA 2RGBA 3CPHA 1RE0A 3IHWA 3SHFA 4Y0AA 1Z3IX 1PLKA 2BCJQ 4DSTA 4QNRA 2AKYA 1R0YA 4RCZA 2VP0A 2W58A 4MYUA 4OI4A 4V0OA 1ZMXA 1HT1E 1ZM2A 2P5TB 4V0KA 2XSZA 1LFDB 2F7SA 2EFEB 4US0R 4E5UA 3O8BA 1Z0FA 5IK2A 4UXHA 3LXRA 2F9LA 3PUVA 4RD3A 1PLJA 2R6GA 1MABB 3DL0A 1F2TA 4KVAA 4Q1DA 1W0KD 1NF3A 2DR3A 3AVYA 1R7RA 5E4FA 3WP1B 2ZUCA 2WWXA 4QOSA 3W3ZB 3HDTA 1NVUQ 2GA8A 1T3HA 3FKSD 4N3NA 5FR2A 5LBIA 3NBFA 1KOFA 1QF9A 4AURA 1NMYA 2XZPA 3H86A 4NTZA 4B32A 4M22A 1NY6A 2ZE8A 4FWTA 3DMNA 4TQUS 1XD2A 3MWYW 1Q1QA 1N6OA 1E2DA 1KI8A 3AF4A 2BMFA 2BEJA 3OHMA 1ZBDA 2J45A 4L15A 3U4QA 1N6HA 2GKSA 2HLDD 2IS6A 1XEWY 5FOWA 4WZBE 1NBMD 3C7KA 3MWKA 1E0AA 1TL7C 3THWB 3MJHA 1WCV1 4LWZA 1XEFA 4C0AC 4DLWA 1KO8A 4B74A 2J1LA 1K5DA 2PX0A 1TPZA 3X1ZA 3BXZA 1FTSA 2A5YB 5JBQA 3C15C 3UIEA 5JJLA 4Z8XA 2WM9B 1DG3A 1ZUHA 3B9PA 4MGIR 1KO7A 4PXAA 4A2WA 1G8PA 2WMOB 5JCPA 4AG5A 4MYCA 4U5XA 1XD2B 4KO8A 1CS4C 1ETUA 1E96A 3M0EA 2H8KA 4DLXA 3CH5A 2ZS8A 2W6ID 1MKYA 3FHOA 5TARA 4PPQA 5DN6A 4OQLA 1IONA 4JL8A 4DCVA 1KDTA 3E2IA 4FCTA 4FCVA 4L9WA 4EAQA 2ANCA 1R6BX 4L5BA 4Q4HB 2DWOA 1FQKA 2BC9A 5FL3A 3SQWA 1DARA 1E1QD 1RJ9B 1ZM9A 1Z6TA 4LHZA 5JWRA 2E9SA 1N0WA 1J99A 1P6XA 4XD7A 4W7SA 1BH2A 2Q3FA 2IEZA 3B13B 4TT3A 3IIJA 1JR6A 1N2CE 4S2EA 5HPYB 3R9XA 2ZTSA 5CYOA 5FBVB 1D9XA 1I2MA 2Z83A 1ZUNB 2GJSA 2LKDA 1VPLA 3GFTA 4MRVA 2NOAA 3WMGA 4DUGA 4HI0E 2X77A 1WDTA 3AF3A 3RS4A 2I1QA 1AA9A 5KDLA 3CF0A 3FMPB 2OESA 2QTVB 4PHTA 4K8OA 2R44A 4GDFA 3K9NA 1XD9A 4LUCA 2CL7X 4JBYA 4JIMA 1XJCA 2D06A 4ITRC 2GESA 3IO5A 4BLPA 2NMVA 1ANKA 3HP1A 3I72A 4C0KA 4UXIA 1OXTA 2GBLA 2RHDA 3A4NA 4GT1A 1AS0A 4UXJA 1KI6A 4GOXA 4A92A 3P27A 1LVGA 1NVXQ 1R2QA 2J0UB 4LJYA 4V0LA 1AKYA 5KDDA 4V03A 3RS7A 4B76A 3FMIA 4A36A 1E4VA 4WBSA 2VQSA 2LKCA 3GP8A 1L4UA 4HAXA 1VDZA 4U02A 1BOFA 1HA3A 4C9BA 4RD2A 1I2DA 2CLSA 3BH6A 3U60B 1E98A 1N6PA 1E2FA 5FTLA 4JL5A 1UDXA 5EP1A 5GJCA 5B2ZA 5D3MB 4HDCA 4HDQB 5K8IA 3TAHA 3U3RA 5FBQB 3KZ1E 4M1OA 3A4LA 2F1HA 4Q4AB 2FGKA 2OHFA 3KQNA 4AKEA 1AKEA 2O52A 1PUJA 2FX3A 3D7MA 1KI4A 3QXCA 1N0UA 1XMVA 4WAUA 4XWAA 1SHKA 4PSAA 3WYGA 4ZIRB 4X8OA 3V4RA 2WTUA 1IXRC 2EVWX 3LW8A 1SHZA 2ZYTX 1YZNA 4GNKA 4PHHA 1SXJB 1VHLA 2H57A 3L0IB 3L8ZA 4GP7A 2ECKA 3K70B 4EPWA 5BN3A 5KSPA 5AUOB 3LLUA 2XITA 5HCIA 3TUIC 5JWOA 3Q5EA 4YMVA 1K5GA 3AVUA 4P4TA 2REOA 2BJVA 3EPKA 3PG5A 2CEAA 1LF0A 3IDQA 2VP4A 5KTYA 2ZRKA 2WAXA 1KDOA 3REGA 4NYMQ 3SJCA 1DAHA 3THXA 5TY0A 4IEEA 1QVRA 4M9ZA 1NMZA 2CXXA 2FFAA 2QE7D 1G3IA 1M1YE 3LNCA 4Q4AA 1N6IA 3VR1A 4TYYA 4Q1AA 3K0AB 5CB8A 2GVZC 4CT5A 1EFUA 2IUTA 2IYUA 3KQKA 1IQPA 2GK7A 4IVQA 1VKJA 2ZREA 5LD2C 2NZ8A 1M6NA 2VO1A 3ZQ6A 2RKOA 4Y0VA 5DYGA 1RPZA 1Q21A 1X3SA 1WA5A 3CWZA 4UNPA 1RRGA 3VMFA 4XVRA 3VTKA 1AGPA 3R8CA 1Z2AA 3T5DA 4G3XA 1KY3A 5HZHA 4PSVA 4ZO4A 5F2EA 4Q9LA 1C4OA 1U94A 3FKSA 1Q1EA 5FOVA 721PA 1Q1ZA 3S1AB 2BBTA 4V0MA 3WP0A 1TUEA 2EQBA 5L3QA 1BIFA 1XF9A 4CRWB 2JLUA 1T9HA 3SDZA 4BPBA 1XD8A 2ZS7A 4F93B 4F4IA 1KSFX 3P1JA 4ZDKA 3U4QB 2BBOA 3OIYA 5CB6A 2FA9A 4W5WA 4QHTA 3RRMA 4Z51A 4DIDA 5H68A 3RLFA 1XPUA 3W5IA 1UBEA 3AKYA 3SNHA 1T5LA 3FVQA 4JL6A 3K70C 2KI5A 4I1OA 4G1UC 3X1XA 4BWYA 2PEZA 1K8RA 1KTVA 4O2RA 5AJZA 3E5HA 4MITA 3RVBA 4IOJA 3BFXA 1F6BA 3KXLA 1W36D 1D9ZA 1GNQA 1ZYUA 1U8ZA 3KB1A 1NRJB 5D3QA 5C18A 4D0LB 1GKIA 1KO4A 1VCMA 1KI1A 2MSCB 2PLFA 4G01B 4HATA 4QBIA 4XJXA 5FTMA 4FI3C 3G0HA 1XMSA 3UG7A 3VKHA 4A8JA 5K8TA 2CJWA 1LNZA 3U7HB 2V7QD 4LYHA 1KY2A 5EE1A 3GEIA 1IHUA 2KSQA 2W6JA 3EIHA 3TJZA 2OILA 3IKJA 4QNMA 1P2UA 2D7CA 3PITA 5DI3B 5EQTA 1TF2A 4IVRA 3EZ9A 4NU0A 2JLXA 3RAPR 4Q1EA 3PIRA 1G19A 4M9SA 3R8FA 2YWEA 2C96A 3IGFA 4YONB 2DPXA 2GJAA 2JLWA 1M8PA 3U44A 1LY1A 2G88A 3OAAA 2Y8EA 1VIYA 2QM7A 5FOTA 1WBBA 4D4KA 3PEUA 4C0BA 3GLGB 2B8TA 1LS6A 3R7WA 1KDRA 1YZUA 2DB3A 1TEVA 5F98A 2ZSDA 1WMSA 1NL3A 4W9MC 3U6KA 4QGAA 4JSTA 4G5RA 2GVDC 1Q20A 2XX3A 1XEXA 1YR9A 1X1RA 2QMEA 4KU4A 2C8VA 1GILA 5L3SA 3KB2A 4IDPA 4DDWA 3SR0A 2QUZA 2ORIA 1H8HA 4KFUA 3RC3A 3CW2A 3C4JA 2DFTA 3KTAB 5H70A 1S3SA 3L82B 4KCGA 2ZRGA 2ZU6A 2D74A 3KKMA 3ZGXA 3KKOA 3W5JA 4PC7A 5AUQA 1SVIA 4ESHA 1G9XA 3T1VA 4QKQA 1W48A 4KHZA 2O8BB 2J5XA 2WAYA 4KAXA 1PV4A 4BQSA 1Z0KA 3RWOA 4BZQA 2UKDA 2VH5R 4R2HA 2ONJA 4EPXA 3B1VA 2ZRBA 4LJ4A 1I4LD 2IHBA 3GLFA 1R10A 1T3SA 2CCGA 4FINA 2YC2C 2YOHA 4AD8A 3Q85A 3VQTA 5KSOA 4Q4JA 1G8YA 3VU9A 4A0GA 2QNRA 3BFKA 2HDNB 4BFTA 3AVPA 1QHXA 1ZM3A 5FUWA 3BBPA 1X8KA 2XNDD 3M1IA 2IUUA 2NQ2C 3QKTA 4NCHA 2WJYA 2JLVA 2NO6A 1QHHA 1Y63A 2XEXA 2YOGA 1AK2A 3IPXA 3L2OB 4LGMA 3FPAA 2QTFA 3U3KA 3QG5A 1IJFA 1ZCBA 3GLHA 1TU3A 2OBMA 5FPTA 1E79A 1CR2A 2O0JA 3L0OA 4IW3B 3AVXA 4FMBB 4DKXA 5JWHA 4F92B 3PEYA 5CM8B 2O8CA 2IS2A 4TYNA 3W6OA 1NNEA 3Q7PA 5JS7A 2BM0A 2YC4C 2ZJZA 4HSEA 1NLZA 1P3JA 5JHHB 4US2R 4HAZA 5AUNB 5DNYB 2HF9A 1JR3E 4NYMR 3RRNA 4QJ4A 4EUNA 2ZRLA 4B47A 1NN0A 2W00A 5JSZB 4MKFA 3SJZA 2PLRA 1XZPA 2V1XA 1JNYA 1NP6A 2XOKD 4B6FA 3EA0A 1XTJA 5KNBA 4Q19A 4XIGS 2KBEA 1A1VA 1S8FA 3JVUA 3K9LA 3GEHA 4MRSA 3X1WA 5FPHA 2X8AA 3VR3A 2HXYA 1R0WA 3T1QA 2F3TA 2X19A 3LBHA 5L3VA 3T34A 3I73A 5SZKB 4JVSB 2IUSA 3WYAA 5DI9A 2VP5A 3QF4B 3EZ2A 2OCYC 1PVOA 1TQDA 1Z0IA 4PZYA 1EGAA 4G0NA 3FFBA 4M1WA 2KJQA 2GILA 4ZI3A 1UKYA 1QG2A 3EZFA 3T1TA 1KMHA 1DBSA 4EIWA 8OHMA 1RC8A 1YRBA 1GG2A 1YKSA 4U7DA 1XU4A 2GAAA 1E0JA 1W5SA 621PA 1OIXA 3ZD7A 3LWNA 1XJQA 1VG9B 2QL6A 4LJ5A 2EFDB 2RAPA 2WOOA 1JALA 1P4SA 2IS1A 2CCJA 3K0AA 1W46A 2ZEJA 1EFRA 2JJ8A 1OE0A 3PUZA 5GJBA 5BN4A 5J47A 2O8CB 2NIPA 4TSFD 2O8EA 3PEVA 4BEBA 4HLUC 4XD7D 4CGZA 4DB2A 1R0ZA 1CBUA 1VECA 4E22A 2J3EA 1W4CA 5H8WA 1XCGB 4MUBA 2CHVA 2JEOA 4JLOA 2REXB 4LY6A 1II8B 4MKGA 3Q3JB 2CL0X 3CX7A 2WSSD 1JEDA 3FMFA 1FX0B 4ZI2A 2WOJA 2ZXUA 3PCRB 5E7MA 3KFXA 1E9RA 4BFSA 5KDOA 1Z28A 1OSNA 2ZYVX 3ZLJA 2IHYA 1KK1A 2EFHB 4WIAA 3MSXA 2BVNA 2QP9X 2XTZA 1U90A 2ZE7A 3CH4B 4KBGA 4FMDF 1GVNB 4JVNA 2FPKA 3CR7A 3QIAA 5GJWC 3AKDA 3G5UA 1KK2A 4TTRA 1Q3HA 2WWWA 2AHOA 2PJRA 4X8LA 1ZW6A 5JRZA 1E69A 3IEVA 3ZQJA 2V3CC 4U00A 4OI1A 2OCPA 3LBIA 4JLPA 4B3GA 2WV9A 4DEXA 3AVWA 2H16A 2PJZA 1TNDA 5FL7A 5L3QB 3X1YA 1CLUA 2ZRMA 3B60A 3QPWA 4BLOA 5CDFA 2WIBA 4DSUA 4OBEA 3K9GA 4KSCA 5J4YA 1HUQA 2PZGA 1RKBA 4K81B 1XMIA 2ZJ5A 2ZRDA 3B78A 1CJVC 2Q9CA 1ZM4A 3H0KA 4DWJA 4F4CA 3CNOA 4HUQA 5DLQC 3THXB 4GFDA 5FH9A 1CR1A 4XSGA 5AUPB 1SXJD 1OXXK 4C30A 1XBTA 2XXAB 4ZCLA 2IWHA 3CR8A 4JJZA 3X2SA 1PJRA 4PR0A 2ZUBA 3QBVA 3LX8A 3QKSB 4Q5IA 2ZJBA 3NIBA 1H8EA 2J46A 3THYA 2V54A 1II0A 1B0UA 1XTIA 3F0TA 1MABA 1N0VC 2CBZA 1P62B 3U3JA 1Z63A 2FV8A 4RSGA 3NG1A 4FMDB 4MUAA 2OO7A 4KJZA 3WNCA 3CB4A 3CRW1 3FYHA 2DCUA 1E0KA 1KSGA 3AKEA 1XWIA 5GVRA 2NO9A 1Z6YA 3BH0A 3BRWD 4YQFA 1E9SA 2ERXA 4PX9A 4LK2A 4DZZA 4IDNA 2YYZA 2QT1A 2OM2A 1G8HA 3ADKA 4H1VA 3TSZA 2BM1A 2JASA 2AWOA 5EUQB 3AVOA 3TGPA 2RGDA 4TMXA 2BWJA 4A1FA 4R71A 3CWQA 3OEEA 3EPLA 4FN5A 4KV9A 4PO1A 1X1SA 1FP7A 2XSZD 3B8HA 2RGNA 2GDJA 2BEKA 1EWRA 1H8HD 2ZI5A 4ILEA 1P9NA 3P4XA 3NXSA 3AVTA 1W0JA 1OKKD 2XTMA 2FGJA 4TQ9A 1YRAA 4PQYA 2Q0HA 1XNJA 4JT2A 4YMSA 1D2NA 2GWHA 5CLLA 1M2OB 3QI2A 1ZNXA 4OHYA 5JFGA 3C5CA 1EK0A 2JJ1D 4Q1FA 2ZANA 2QORA 1W2HA 5J4LA 4GPTA 3T15A 2VHQA 4LYAA 5JMTA 3U3OA 5ANRB 1TU4A 1YZTA 1NIPA 4MDEA 3ICQB 1E2IA 2FSGA 2OCBA 3B1YA 2IYYA 4H9GA 1E9EA 4Q7JB 4CDGA 4DXAA 3RRZA 1KO5A 3IO3A 4NP6A 3I32A 4G5SA 4QGGA 1KKMA 4B73A 3TVDA 4EJSA 4BE7B 1Q22A 3GJ3A 3FTQA 2CDNA 3GLGA 4MYHA 1U0LA 4US1R 2ERYA 5JI3E 2XOKA 3HU1A 4LPKA 2V6JA 2O0KA 3LD9A 5LPNA 1E2GA 1E99A 2X1VA 3UKDA 3NHAA 1Z22A 1IAQA 1VCOA 2WZQA 4YMUA 4L9SA 1NN1A 3EAQA 2G6BA 4Q7KA 1IN8A 4ZPXA 4DJTA 2LWIA 1CP2A 2VSFA 3CRMA 3ZIAD 4BFXA 2AFIE 1NLFA 2BDTA 2NO7A 1J2JA 1DO0A 3C8UA 4MDFA 1BO6A 1Z0JA 2QU8A 2ZJAA 1ZAKA 3OESA 4DLVA 2XJ9A 4GOJA 2ZIAA 1FNMA 4BZXA 2IYTA 4Z8YA 4B3XA 3D6TB 3NEYA 4Q01A 4OJQA 1M7BA 3RWMB 4G5QA 2VHCA 4PTLA 4EPVA 1FL9A 1VCIA 4LJAA 1WRBA 4QG7A 3CM0A 3B1XA 3MJRA 4XVQA 3B7GA 2VHTA 5FBLB 3OEHD 2Q9AA 3OZXA 4CF7A 2F55A 3W6NA 3CBQA 1M7HA 3TIFA 3HYTA 1COWD 2QEQA 4YDHB 4AC9A 3K0FB 5FI1B 1J90A 2KWIA 2QT0A 1HEIA 3P20A 3ZJYA 1XTQA 4OHZA 4P4SB 1DAKA 5CDFE 4B3DA 1VG0B 5JI2E 5EE5B 4PHGA 2FN4A 1T6NA 5G3YA 3EZ7A 1D6JA 2QPTA 3THWA 1OXSC 3T06B 4LJ6A 1JB1A 4IDHA 3T5GA 2GCOB 2C2HA 2H7VA 4PAOA 3NDBB 1OFTA 2B7CA 4LDJA 3IQWA 1CF4A 4C2TA 2R65A 3NBYC 2J41A 2R6DA 3QJYA 1UBCA 1G5TA 4TMKA 4HUTA 4EDHA 4EQ6A 3LVQE 3PVSA 1XXHA 1UJ2A 5KOYA
chains in the Genus database with same CATH superfamily
1E2EA 2I1VB 2IPLA 2QSZA 4L4XA 4K9MA 3V8QA 1RJEA 3BEOA 3FCOA 1UODA 3IVGA 2HHHB 2IITA 2Q5LA 3I3SR 2ADFA 4PC3A 1KAEA 2LNDA 3OT5A 1H3NA 2QUJA 2XCIA 3Q3EA 1JHOA 1PW7A 2OZVA 1A9SA 3LUDA 1PZFA 2NXEA 2VUIB 2XQJA 2YX1A 1JV2B 2X3YA 2ZQ5A 4QTZA 1GP2A 4Q3CA 5CH3A 2Q3BA 2V7GA 4MIYA 4F91B 2JIZA 4U2EA 1E6EA 4MIEA 2VUUA 2G5TA 1ZMBA 4MI1A 4AW9A 3EY9A 3I6ZA 1TJ5A 4UEOA 1JZQA 1Y3FE 4LK3A 2A14A 2Z3WA 2B36A 4QPNA 3OUTA 3RUHA 3WJ1A 2WU0A 4QUGA 5DE3A 1YAHA 1J8QA 2JI6A 5JQWA 3HNOA 3KE8A 1JDUA 4ND8B 1WW2A 2Y05A 4YUZA 5BN1A 2ZITA 3SXJA 2VKQA 4E1VA 1MA3A 5BQFA 1VCNA 5JS8A 1T3TA 1OAKA 4Q9DA 4QVIA 1X14A 2X1MA 1F4VA 2G5PA 4LZZA 2C4NA 1G18A 5CEFA 3JQ6A 3QE2A 2AJLI 4HLCA 3AEXA 2GEDA 2HXSA 4ZQIA 1UP4A 2VDLB 5DLEA 1E1CA 1DV1A 3HCOA 4EA7A 2JLZA 2O8DA 3WGYA 3DXFA 2I65A 1SIBE 4WW0A 1P9WA 4W8HA 1E4EA 2B1GA 4XM2A 1N7HA 4Q34A 1PIWA 4RNCA 3FDFA 3VVCA 4E2XA 1FFWA 3T5MA 2AL7A 4MVYA 3U4DA 4K8RB 3VGPA 4B80A 2JLYA 4XJTA 3U7FB 1HX7A 3ZDEA 4HEA6 5TGZA 2CSXA 1XTKA 2Q2NA 4Y6QA 4ZVOA 1JKJA 3FSEA 1RYNA 5E1OA 1E6KA 5FV7A 3ISTA 4F5WA 2IY8A 3NHKA 4JQZA 2GD6A 2IF2A 4M8KA 1JKXA 4MWOA 4I4CA 2VJQA 4GGOA 2QN6A 2GUGA 1UJNA 2GA9A 4NYIR 4H7FA 2RJNA 4QLAA 5E9AA 3C3CA 4OP3A 2AF4C 3DOHA 1P1CA 2W83A 3GJZA 5FAKA 2F43B 2Z1MA 1ZCAA 3OU2A 1WULS 1A5TA 4WY2A 5L6LB 2ZB2A 1RQNA 1WUHS 3B20A 2OK7A 2WHPB 4F3CA 4R98A 1GSAA 3LC2O 3M1YA 4RF4A 4JEHA 6REQA 1A77A 2MDTA 2YV3A 1D04A 1GKLA 3C4VA 1MX1A 4IIXA 1HEYA 2AI3A 1L5FA 1V9CA 4B34A 1Y6GA 2XMSA 3MYRA 1G7CA 3C87A 3U40A 3D6NB 3JARB 2WYUA 3TOXA 4E08A 1IMJA 1JXQA 4WK4B 2O2CA 4R9VA 2D6FA 3VH3A 4DC1A 3A25A 2RG7A 2Z2JA 3H2IA 3V4VB 1DWQA 5A1JA 1HRKA 4GOKA 2DQ4A 2J09A 3IUYA 1T24A 4PS0A 1QIEA 1W6RA 3O38A 5AW7A 1MX3A 2QJOA 5JYDA 3IQIX 4TL8A 5T8KA 2HA6A 3JASA 1AS3A 3AVUA 4YP5A 3D5EA 1RZRA 5DK6A 2UVPB 4GM1A 4RIHA 3TRHA 2P1RA 1PDOA 1USUA 3MXTA 1T35A 3O2JA 5L53A 1Y37A 1KR5A 1BX1A 1O4VA 1QDUA 2PXXA 3BMNA 4C0SA 1XXLA 4K7JA 2HZBA 3FFTA 5COAA 1Y8RB 4P4GA 3BB3A 2JFHA 5FBZA 3T5BA 3TQOA 2Q1WA 5U9CA 2B5OA 1ZZEA 3CEMA 3DYIA 4HYTA 2VK2A 3LZ6A 5DHUA 3DMGA 3SAJA 4E5NA 3M4NA 5LQKA 3UO8B 4JC4A 5LN1A 3A11A 4P4UA 1STOA 1TJNA 4Y1RA 5H59A 3WLHA 3IEXA 3UFXA 2FWNA 1VHTA 5ALVA 1M6WA 4A26A 5JFTA 4KXMA 1B74A 3CXUA 3O4IA 4KN6A 2XCTB 2D5LA 5GMOA 4LHEA 1UKZA 1ZESA 2HNKA 3S5JA 1C3OA 4PYMA 4ZKDA 1APBA 2C3OA 1SZPA 3H11A 1SXJC 2ATVA 4JBGA 5JBIA 2VI5A 3LH5A 3ZI7A 1U9JA 1EFLA 4YAUA 2DUNA 2ZJFA 4O33A 13PKA 2BCGY 1KKLA 3D6JA 1TEXA 2WKWA 2X5NA 3P71T 3E9YA 3FD8A 4J0IA 4RTJA 4M55A 3TTWA 1KSJA 3AFHA 3BVPA 3IHLA 4XVHA 1SUAA 2DFLA 3LP5A 4I1VA 4J2HA 1J42A 1KARA 1EXVA 3FLAA 1D09A 2YDYA 1E4OA 5EHIA 4OGLA 3QYFA 3RCBA 1BMFD 4A4DA 3BERA 4OYHA 4JVMA 2OCGA 4YMIA 4Q18A 3STWA 4DA9A 1YBVA 1YFJA 2XUHA 1NVAA 3A9SA 4WZAA 1RW4A 5EIHA 4MHOA 1X39A 2JHCA 4GI5A 1VL0A 4CIDA 3NHBA 4P5EA 1QO0A 3F1KA 4IX9A 1PT9A 1ZG3A 4Z4FA 2GEUA 1OFUX 2BEWB 3L1HA 3CJTA 4NKRA 5HBRA 4GE0A 3TNJA 4K1LA 4LOHA 4MIOA 5FTNA 3JQPA 5TQ2B 4YHHB 2XMRA 1DFIA 2VS1A 4H08A 4IWNA 3UM9A 1HDZA 3DNPA 3NC1C 4BPRA 4NJEB 5JJIA 2FYTA 3R6TA 1NUSA 3SEQA 5EE9A 2WVJA 4J7XA 1UF9A 5BN5A 3RVOA 2DULA 4IRXA 4RA6A 3AMVA 5JD3A 2F1IA 3QOFA 3D31A 1T1EA 5B55A 4WOPA 2DWCA 2NV6A 2HBRA 3ZZUA 4Z53A 1PZNA 1WG8A 4IOLA 4LF5B 3C6YA 1R4MA 2XAUA 1SK9A 4JK3A 4HEQA 3T7JA 3TUJC 3MTQA 3P4YA 5CIWA 3WI7A 5KYUA 6ABPA 1H4QA 4P33A 3G9XA 4PZZA 4TRMA 5CFLA 4ER7A 3MT8A 4E31A 4K9LA 2R84A 2HD4A 3OZRA 2CLEB 3W4KA 1MO3A 1ZXBA 3JALA 4LMPA 4AWAA 4DDVA 5JCOC 5K4GA 3MRSA 3AR5A 1T0HB 2IYVA 4HDMA 1QVZA 1E3EA 1GFIA 2CUNA 3BEDA 4FYMA 1JFRA 3H83A 3ZWMA 2DX7A 4A6PA 1VL2A 2N46A 3KUCA 5KTOA 3PQ6A 2OFFA 3V3KA 2G1JA 1F1JA 2JGNA 1MB9A 1VKZA 3OPVA 1I3LA 4OFXA 1WOYA 2CLOB 2A5JA 4R2LA 3BTUA 2PX2A 3EASA 5LOVA 4MRRA 1FFXA 1PGNA 1U1GA 1Y34E 1Y82A 2XTNA 4ZHQA 4E94A 4EJSB 3DDUA 3EW9A 4DMLA 3R20A 4XSHA 3UJAA 4FE4A 3ZW7A 3HWX1 2UXDB 4JQYA 4RZUA 4ASUA 4N54A 3OWXA 5EKXA 4JYMA 2WF9A 4KXQA 1PR1A 3L7LA 2IU4A 2OV3A 1SXIA 4M8LA 4CU2A 3GK3A 3PNLA 2OSBA 2GN6A 5KMGB 1BQ3A 1E6WA 1X7YA 2X1HA 2WUFA 3FWNA 5DGTA 3GL9A 4DQVA 5IXSA 3PE4A 2GRJA 2RHMA 2DT5A 1QKIA 5HTOA 3ZV5A 3ITEA 2DOKA 4R7TA 1U0HC 4BNTA 1M6VA 4UHBA 1XXHE 2AN3A 3GRRA 3OJOA 1K7YA 1MVOA 4AF8A 2W11A 3GBPA 3TQRA 5GADl 5ALJA 2YFHA 3HWRA 4IMJB 1DJOA 5IAAA 1E1DA 4PFSA 5CJ2A 1TLTA 1SIWA 3HA5A 3L79A 4E2ZA 3DDCA 3A31A 5EXPA 2HC9A 3C8ZA 5FBRB 1M76A 3C7DB 2ZGVA 3T1OA 1A7KA 4G9EA 4IH1A 5CW1A 3TOVA 4DB4A 2ZI9A 2CL6X 4EJSC 3AO0B 4HFMA 4ROTA 3RW9A 4M7PA 2ZSFA 4MCHA 3CUWA 2A0FA 4IY1A 5EZYB 1TDJA 4W1RA 5B64A 3NBAA 3HO8A 4JV5B 1DELA 2EJCA 3N2YA 3IR5A 4A0FA 2BMEA 4G36A 2OHOA 1LK0A 1I8TA 2A33A 1QKJA 2B1IA 2FWPA 3BX1A 3EWAA 3PC4A 3UJ6A 5KMGA 1VLVA 2FZCA 4OOEA 3GJ0A 3HB1A 1EHYA 4RKFA 4YS6A 4ZPJA 5TPWB 3TIIA 2NO4A 4QM7A 2ZRJA 1WNTA 2D4HA 2ID9A 2VHJA 2AVDA 2YCLA 4DXHA 1Z13A 3OY2A 4DJEC 1AHPA 5KTMA 1WXQA 2VTBA 4K0KB 2ZT5A 1QLHA 1NC3A 1A8UA 1AZSC 1TJ4A 1ZITA 3ZDYB 4JXJA 4K26A 1UBHS 3L0YA 3WL4A 2I62A 2AEJA 2YWRA 3GAMA 3TLGB 4AJEA 4M99A 1V41E 4CEIA 1W581 1TMKA 3WKDA 3DBIA 4KXNA 3SHOA 2A88A 1QR6A 2H63A 3M3PA 5LFAA 5FT9A 1MEOA 2HCBA 5EZSA 1DO2A 4MP3A 3SFZA 2FWMX 1N2CA 1U9IC 1KQ3A 2B5WA 3INTA 3KKZA 3KZMA 1WTCA 3QITA 1C9EA 5FLYA 5TQJA 3CC8A 3K73O 3P2JA 4LHSA 1G7TA 1U2SA 4IIHA 4MWTA 2JLBA 4OHCA 3SZUA 5FPYA 3H2ZA 4BNVA 4NE7A 1KKUA 5LNK1 3Q12A 3JATB 1SVWA 3QFSA 3EIEA 3HBJA 5IC6A 5THXA 2GZDA 2Q8NA 3DOJA 4RJ2A 1IQRA 2BFEA 5JIBA 3RC2A 1CZRA 2KYRA 4JBHA 3GELA 5ALZA 3G7SA 2BV3A 1SKYE 4JLSA 3H5AA 4Z7JA 1JHMA 1T6XA 1N2ZA 1XYGA 4Y1EA 3A2KA 5EHGA 3KJQA 1XTUA 3NAQA 3HJRA 2V58A 1X7ZA 4KDRA 1G63A 2IK8A 4N0MA 4WWHA 1V4VA 4HQLA 2WU4A 2D1QA 1M6HA 1M9NA 1EFHA 3CCBA 3OF5A 2B4QA 2PUEA 3SFVA 1XTPA 5EHZA 4J7UA 2IWRA 3C2QA 3DBRA 3ELUA 2C7BA 5EL0A 3GLSA 4TYPA 3P9CA 4W82A 3S2ZA 4JA2A 4XM0A 4IX1A 2PPVA 4W5HA 2FDXA 5E0OA 3FSRA 1FDUA 5D6NA 3IBSA 4LA4A 3VZRA 2V59A 1II9A 5DSZA 3A4MA 2G25A 5E3HA 2FZKA 4JMPA 2F9FA 3HFGA 1HURA 4G8DA 4AUEA 4EBBA 3A6JA 1BD4A 1R0BA 1Y48E 2EWMA 4GZ3A 4OXXA 3T7AA 1BAPA 3GAFA 4RBNA 3VOTA 2D2EA 1U8EA 3DYVA 1E5TA 4PR3A 5EZ5A 3FTDA 4C76A 1T2FA 2YTZA 1YFLA 4ZICA 2ISSD 3ISVA 1L7OA 2GNOA 3DEYX 4TWAA 4FBMA 4I0WB 3ZH2A 1QRSA 1MB0A 4LOLA 4C3ZA 1SIOA 3KSRA 3LM8A 5GJVC 3H2JA 4B43A 3CPEA 4BFYA 1RZ3A 5M2QA 1DRVA 4OP2A 4YUVA 2IUYA 3DZDA 4ZAZA 5INTA 2J9RA 4FX2A 2IYQA 1WB6A 3ASVA 2O07A 1AB5A 2XVMA 3HJAA 4X1KA 8LDHA 1ZXXA 1WHTA 2GK6A 4Q3KA 4GPBA 4C01A 1H9BA 3ESYA 1R3UA 1V3UA 1P0MA 2VCYA 3B53X 1QO0D 5HHTA 1JQKA 3EZXA 3UMYA 2DUUA 1J8MF 1D7AA 1E1QA 2GDZA 1L7PA 2WBLC 2IOYA 4CM6A 1WWKA 1SWVA 2W2TA 4TVKA 1I2BA 3WNDA 5AVYA 3S70A 5H9WA 5HG0A 3DL4A 2OBNA 1ZGHA 3IB3A 1ECGA 3H1AA 4QQRA 4YPFA 4C7OA 3WLAA 5EKSA 2G4LA 1Z6XA 4V1CB 5HIAA 5J3JA 1E3JA 1MIHA 2WAMA 4PE5B 4DNPA 3D6FA 5IDWA 1L4NA 1XR3A 4O3MA 2H1LA 3PUJA 1HI9A 4KVFA 4YRDA 2PLWA 3GJTA 4GUDA 3JZDA 4TMTA 4ZAGA 5BPHA 1SOVA 3OQPA 2XW6A 3T7DA 1KR2A 4RGQA 4OUDB 4K6GA 4EYQA 4C6HA 1U3DA 1PR5A 4L0DA 2Z1NA 4DJ5X 3ZK7A 3PDCA 1PYGA 3R7FA 3UT0A 1CUIA 3WTBA 1VKHA 1FRZA 4RZXA 3I0MA 1GQOA 3T38A 1QOQB 3O8QA 4ZYVA 3QE0A 4E51A 4HNUA 1YRHA 1JU9A 2O2SA 2FMXA 2YYAA 1E0SA 3MWEB 3U26A 3ACBA 4D7AA 1PDWA 3D3WA 1Z6GA 3PDIA 5ITZB 2FDCA 5DYIA 1GRQA 2QPOA 2FMUA 1D6MA 3CO5A 4RVHA 4UJ3A 5KJ6A 1YOVA 4M0MA 3V7UA 2Q7OE 3T3MB 2FSHA 3HPRA 1GLNA 3CLTC 2XKBA 1ENOA 4Q21A 5KCZA 2H4JA 1Q84A 4JT4A 4DLUA 4ACBA 3Q8WA 3AONB 3SDBA 2PWAA 2W5UA 5TVKA 2ZUFA 1FFBA 1Z4IA 3FBGA 3G0GA 2J9YB 2VJBA 4MDYA 3DHYA 3RTGA 3FNBA 1MRSA 3I0ZA 3WB2A 5JZBA 1NRWA 2VBIA 3F3SA 1SQ5A 3L49A 5JMWA 4TOIA 3A6LA 3O9ZA 1WXHA 1X80A 4EB6B 3BXOA 5JVDB 4RNDB 2WWIA 2EKBA 3HP4A 2ZBFA 4O2LA 3N74A 4XQ0A 1A8HA 1CIPA 4MAFA 1GKYA 3JZAA 3KR0A 4LSGA 2JFZA 2EHDA 1N6LA 1CS0B 1U65A 4I6JA 5KNBD 3WMXA 4CEJB 3WL6A 1W0JD 1ZPDA 2BFEB 4Z49A 1RE1A 3Q2IA 1FFHA 1PW5A 5CDUA 1UT5A 2VR1A 4KP7A 3IIIA 1ZGCA 4G4JA 2IL1A 3C8MA 1PHPA 3DZHA 3HRHA 4GI3A 4LZAA 1SC9A 5F2KA 5G1NA 5TGDA 3SQLA 4NL4H 1BFDA 5A5VA 5KPJA 1M5UA 1OASA 4B2PA 1AQUA 1D2HA 1G21E 3QBDA 4FGLA 5GGYA 3AEQA 1XMOB 2JGAA 2JCBA 1JAIA 2REQB 2R2AA 5CFPA 1I3OA 2B9VA 3TI7A 5L4NA 4EG8A 2O8FB 3K2EA 3PUIA 4QU8A 5GV8A 3W9YA 4TQAA 4PU0A 2OYCA 3T3NA 4YRBA 4P4LA 4PSKA 3PDHA 5ILOA 1ODFA 3B48A 4RVCA 2Q0QA 5TS3A 1NW7A 3UAOA 4C1NA 3HUTA 4POAA 4URWR 5HTKA 2D0DA 2QM0A 3ETDA 4OB6A 4OIMA 3MTJA 1XEAA 1E77A 5EPOA 2POQX 1UQUA 3UFXB 4MYTA 1FZTA 1JVNA 3ZCUA 1KIMA 4ND1A 4YT8A 3FAKA 3A9CA 2XT6A 1KEEA 2XMZA 1P7ZA 1D6NA 5J63A 1N8NA 1G7RA 1YK0A 3ANLA 3O90A 4AMUA 1HFKA 5FI0B 4W5RA 2Z2XA 3TOSA 2QR3A 5JPCA 3HR8A 5KWEA 3PNBA 8MHTA 1GUAA 5JVDF 4LGYA 1KNXA 2HSEA 5CU7A 1LJUA 4ZOBA 1B6TA 1EP1B 1WSBA 1KQOA 1AK1A 4KR2A 2IH5A 3S0JA 4O0LA 3RF6A 4RA6B 1HORA 3F9RA 2C99A 5C31A 4KXUA 1EZ1A 1RR6A 3EVNA 3IPCA 1GGHA 2JF0A 1UUFA 4YLYA 4LDZA 3JTEA 1MQAA 3KT3A 3HZOA 4CLXA 5C37A 4D26A 2RHBA 4M9CA 2VN8A 4BNYA 4Z9AA 1GM5A 3VPAA 1UH5A 5A4MS 3EXIA 4KRYA 5ALFA 2EG9A 2Z95A 1H2YA 4KB5A 4YCAA 2XCRB 4BFZA 3W4IA 4Y2JA 3OT1B 2HRZA 3AFOA 4COKA 2PTHA 1I01A 2QUBA 1S5PA 2Z4RA 5FI5A 3G2HA 1NR1A 2Q6LA 4HWRA 1AO0A 3RUAA 1WPXA 3I2JA 5DM4A 4F4JA 3NOOA 3RRYA 4IG4A 3B6ZA 4D6XA 4IRUB 2CVZA 4E7OA 5JH7B 1SVNA 5I9LA 4F3YA 3OOJA 1UZAA 5LZ4A 5G0TA 5HCIA 3FFWA 4AO8A 5D5PA 5CAEA 3UW1A 4GD3Q 3PFIA 1P60A 3PQDA 4GI2A 1NOIA 2FPMA 2RKBA 3HKBA 4ER0A 2IW1A 1E6UA 5I51A 4QREA 3FHCB 2WI8A 4CL3A 4F06A 4GZ6A 5J4VA 1MV5A 3UATA 3W2GA 3AUAA 3TD9A 1XRMA 1XZFA 2VF2A 2WSYB 3EF3A 2LCQA 1UP6A 1SBQA 1OWPA 3KEOA 2IZ6A 2WIDA 4EB0A 5BNZA 4CM4A 4QDOA 3KFVA 4MWDA 5AYVA 2HO4A 4O2BF 4PIPA 1RJDA 4AICA 3UV7A 4E6EA 2WB2A 2XT0A 3S29A 3H05A 2QSYA 4AG6A 1ZW1A 5L45A 4MW5A 1SQSA 1Y6QA 2XOXA 3DKKA 4XEUA 4I5FA 1FTQA 2VJMB 1F20A 2BFNA 3VR5A 4DHWA 3D02A 1P61B 3PPWA 3GDFA 4HT3B 1ODLA 1R9JA 3ESAA 1Q1BA 1G38A 1NW8A 5C8ZA 1V7PC 1KMHB 5HJEA 5F9FA 4I5EA 4C0XA 2J59A 1KJNA 5F77A 1CIVA 3S55A 5D7NA 4E3ZA 3DHNA 1JDBC 1I51A 1EA5A 4OHXA 1Z35A 2C0CA 3PC8C 4JC5A 4K9DA 5JLJA 3QENA 3W2FA 2PJDA 1YQUA 3HDVA 5CM9C 3UAXA 5TF0A 4YV2A 3AESA 1FUKA 2JI7A 4WNAA 3E3MA 4QQKA 4RJTA 3MHPA 3STTA 3U4MA 3GEEA 5JRDS 1GRNA 5FF9A 1YZQA 1QG4A 3BMOB 2B8JA 4E6PA 3OJLA 4KO4S 3K71B 5LXTF 3KQUA 4G1CA 1GNVA 5AK3A 3I2HA 2AC4A 1M2HA 1ZSVA 3AEZA 1RQPA 2CHQA 1I9CA 4Z86A 3WYEA 4WBNA 4OI2A 1G1MA 4OMUA 1O2DA 3LSTA 4QU0A 1Y4ZA 1N92A 2OGZA 3DTVD 3HCDA 1MAVA 5DB4A 5K3SA 3VHLB 4V1CA 3NALA 3CN7A 1DE0A 2BFMA 2INGX 4PF1A 1H2HA 3CEPB 4R31A 2Z56A 3KDAA 3M81A 5TJ9A 2V0NA 4F5DA 2OVFA 1DAPA 2Y4OA 1MF7A 2O7SA 3EXEB 5CA1F 1U99A 1RYDA 1ZGGA 2D5BA 3FDIA 1GLVA 4LWPA 3IT3A 4QRHA 3A1CA 3DLPX 4RLHA 4XWKA 5LQRA 4WKPA 1SQFA 3BGOS 3ZCTA 4R9RA 1DSSG 3M5CA 3IOYA 3KPWA 3H84A 5B37A 4RLQA 4PAQA 2H1CA 5L8VA 4DR5B 2QL5A 1GL3A 1RFLA 3F2IA 3F5QA 4B85A 2QR5A 3SJ7A 4FC7A 1U6KA 4ZODA 3ACCA 1XPOA 2JIOA 1CVLA 3KDSE 1BVHA 5K4HA 3K4HA 3OMWA 2XE8A 2YOFA 1W29A 2C9CA 3S2IA 4BO9A 3FNRA 4EVRA 2MTBA 2UVQA 5KYKA 5BW6B 5IX8A 3AUTA 4MR7A 3RGGA 3WB0A 3ISJA 4B4KA 1MW8X 1SUSA 2ZWOA 3JD0A 4CV1A 3D4PA 3WWYA 4R84A 4AYTA 3ZWDA 4WA7A 3R5JA 4KMSA 1HV8A 5KAMA 5LB4A 5AJWA 3RC9A 3SOZA 4BBPA 4EF4A 1GG9A 1QDLB 4FBGA 1NAIA 1NBMA 2C2ZA 1JFFA 2O6LA 3B1WA 1HYEA 3NHRA 4NICA 1UC9A 4XUGB 2DVMA 2HHJA 2XVXA 4KNWA 3I37X 5F12A 3SC6A 4MKXA 3MNFA 2CMGA 1ZRHA 3QQPA 4PZUA 1T5IA 1DV2A 3GJXC 2BP7A 5JADA 4RS3A 3ZW9A 3CMMA 3BD9A 3UXHA 2OL4A 3BCRA 2O5VA 3A9RA 4AY2A 1EFTA 1D0IA 2PMKA 5CX1B 3REQB 3U49A 3ZDQA 3SBEA 1QHYA 1YOVB 1X8LA 4R16A 5MGBA 1RPNA 2P27A 4L0MA 1NYQA 2G82A 2L17A 1ISRA 6AT1A 1UBMS 3DE5X 3E27A 5GONA 2FPIA 1U8XX 1AKNA 4FGSA 3I9MA 1Y7HA 4JZKA 3NORA 4L02A 4L8GA 1QTRA 1Z06A 3FNIA 4J0HA 5DJ5A 3QXXA 2FUCA 1NQTA 1Q2XA 1WMBA 2OZEA 3KQTA 4L6AA 5TSDA 4DPKA 5F23A 3F49S 1VL8A 2JLAA 2C58A 2KBFA 4QRDA 4F2HA 3FPGA 1V9SA 4HDSB 4AWXA 2YWXA 4MW0A 3SIXA 4M0LA 5SICE 2M6LA 3HRKA 3EZNA 5EZQA 3FLEA 3SX4A 1I33A 3TW8A 1I4EB 4X8HA 4UREA 6YASA 4RZ2A 4NCKA 2XBMA 4DR6B 1JFLA 1X1QA 3NBZC 1XJWA 1UMBB 1ZNZA 1MDFA 2YFKA 3L01A 4P3OA 4C0JA 3P32A 4AF6A 2EX0A 3MJEA 1HE5A 1WDWB 4ZTZB 2B8NA 1BRMA 2EZUA 4QNNA 1OC4A 3NEJA 3U6BA 3SC2A 1QWSA 1KZ4A 1ZICA 1NTRA 1JLLB 3B3JA 4BATA 1WP4A 2HMAA 5I4KA 3H99A 3LFUA 4B48A 1QCCA 3HUEA 2FRVA 1J0BA 2YMLA 1IBCA 3L04A 4YPOA 4HRAA 4GP6A 1XZDA 1W36B 4RTPA 2AFVA 2ZR9A 3ROGA 4XWYA 2QG6A 3WFZA 1OU0A 2CXNA 1TVCA 4ZO7A 1GUZA 2JHPA 2Y1OA 4DVGA 4ED9A 3RC8A 1GTL1 2BFCA 4WERA 4IGEA 3FUVA 4KR7A 3F5FA 1CY7A 4FFNA 2EJBA 3ITKA 4GW3A 4L75A 5E1BA 4ZV7A 1M34E 5BN3B 5L40A 1L1EA 2IRWA 2Q0XA 4GAEA 3T3GA 3ZXIA 1NW4A 5KQRA 4NBWA 2JGJA 1ULTA 2C0PA 2Y6VA 4HQ0A 4NABA 4B6EA 4CTJA 2XB2A 4ENUA 1PT6A 1BNCA 1JWAB 2B1QA 1NSTA 3ZVMA 2F8SA 3ZK9A 1XMJA 3GJ7A 3OPYI 3WHLA 4KTVE 3PHGA 5JPIA 1X9HA 4UM9B 3U4IA 3NHPA 3TL3A 4ZU3A 1US8A 2WJVA 4JLDA 4O0MA 4FZRA 4IQ0A 3AP2A 3G0DA 4RFSA 1OI3A 1W5BA 1M2VA 1RHJA 1Q17A 2CNWD 2QMZA 2DY1A 2FEOA 2R00A 3HGQA 5I01A 2ZJ1A 2OO5A 1NJ5A 2H1FA 3H9EO 3WGHA 3LHIA 4MS4A 3WQRA 2WPDD 4MZXA 1RRFA 2JIZD 2TMDA 5PGMA 1H2XA 3NDJA 4IP0A 1RLTA 2IELA 1N1GA 4AMBA 2WKQA 2JZOA 1AUPA 2NUAA 3QE3A 5IC5A 2QY9A 5A71A 4CIAA 3EPJA 3VU1A 3D8HA 1TFRA 2FPUA 4XWGA 2IX9A 4W63A 2X0KA 5CURA 2X14A 2GPTA 4BAZA 4D3FA 1IN4A 2PT7A 1ZU5A 5ALEA 1N9ZA 4KPGA 4N7JA 2VT7A 2J67A 4M86A 1JPVA 1U9YA 2VDMB 1NRXA 4LYGA 2OPBA 2WJIA 4KQ9A 4H1TA 2FZLA 5MFZA 3U7GA 1ZH6A 2ZJ4A 2OUKA 4BNDB 4L85A 2F3QA 1J0AA 3SS7X 3DGFC 1MAWA 4RHXA 4AUKA 8AT1A 4TYWA 1B23P 2A86A 5K4AA 2AR7A 2BHRA 4GBMA 2HPZA 4RSMA 3LUCA 3COPA 3TD2A 4DCCA 2NU9A 2OXRA 2WKPA 3W79A 3CRQA 4HNHA 2QQEA 4RVDA 4XM1A 2ZR7A 5EJ7A 3CNNA 3EQ2A 2ZYSA 4HLQB 4KE7A 2VPYA 2PHZA 4MB6A 1E79D 4NZ9A 1J2YA 1O5OA 3WGVA 4ETNA 1SJ9A 3KLOA 5HILA 1J20A 5GAJA 2UZIR 4LTMA 2J9FB 2FW0A 1FMFA 2GPJA 2IXGA 4PYRA 2P9YA 3I2IA 3MCUA 2V9ZA 3UC9A 3BIJA 1M3SA 2QENA 5CDGA 2A8YA 1I3KA 3C6KA 3LGXA 2PSEA 4R9UC 3WSTA 3LCVB 3AJDA 2DWUA 3PHHA 4EYEA 3IP1A 1U8YA 1DXHA 2O06A 4JASB 3ZXXA 1CETA 2IS4A 5BVHA 3H5NA 3OE7A 2F1RA 1VGVA 3OZVA 3WS7A 4PZLA 2JHFA 4KFCA 1JQAA 4KQJA 3KL4A 3LBFA 2K2WA 1QDEA 3S2GA 3WRXA 1KA9H 1ELOA 1OYYA 2YW2A 3DAHA 3TBKA 4YY3B 4IZ6A 4KO3S 1VTKA 5U4QA 3L18A 1ZGJA 2ETVA 3KAJA 1I6MA 2RC6A 4MOWA 3BB4A 2NTNA 3HFSA 4YWHA 5H5JA 4YDQA 4E4RA 1TYBE 3QPBA 5T6BA 5K05A 1T4DA 3KK0A 4FVTA 1GDHA 2FH5B 5CBPB 5K01A 1I7DA 1Y98A 3B9QA 5DXAA 2QLTA 1PZMA 2BAGA 2PL3A 2QHXA 5G2OA 3QMVA 1P5FA 2Y1KA 3IP3A 2HCTA 1G6KA 1DRKA 2HRDA 3TNLA 4JI4B 4EL0A 4HGZA 5FTWA 3F73A 3WB1A 3LSYA 2NVUB 2MSEB 2A4MA 2FOXA 4KI0A 4QATA 3WIUA 2AX4A 2XT9A 1I5RA 2JEYA 1LCIA 2YZMA 1OXVA 3NTUA 3V4SA 4AULA 5JJCA 5IAGA 2PKWA 3AB3A 1R0KA 2FX2A 3G3EA 3GLRA 1UJMA 2FPGA 4FHCA 5I6DA 4ZCQA 2W0MA 3J81k 5EOVA 1IOZA 1HO3A 5EP3A 4CQLB 3RTEA 4A3SA 2Q8QA 4UTRA 1G1AA 2YQ5A 3CZ5A 3M7IA 4BU0A 3RS9A 5FLEX 2AEFA 3GN1A 4Z0PA 4AX8A 4P3NA 2C5SA 4JBNA 1PWXA 3KQQA 3CURA 4LHVA 3NC4A 2BFAA 4RPGA 1RM5A 2JAQA 3E9EA 1GL9B 3ELBA 4YBRA 3MINB 4M2LA 1VGQA 2A9VA 2EBUA 2VWGA 2A94A 1MPTA 3FBWA 3NB0A 4DCMA 4PO8A 1YB4A 5KX5B 5ELLA 2QRPA 3DJYA 4QC2A 3G9TA 2HV8A 2LCIA 3OOWA 1IRIA 3K2BA 1N77A 1JTVA 4CUKA 5HOEA 4B75A 3F4LA 3IH5A 5FUYA 3H1GA 3S2SA 5JO9A 2VXYA 3N8KA 1POWA 1G2OA 1F0YA 4A5SA 5LQMA 3PQ2A 1HE2A 2OHJA 3HJFA 3TR0A 3VKGA 1A82A 3GV0A 1A9TA 5EXTA 2P9JA 2VP9A 3EDYA 4LW8A 4NZYA 1NJSA 1JRLA 3MLBA 2PY6A 2WUGA 5EERA 1ZUIA 4BU1A 4BLRA 8ADHA 3OJFA 1NW9B 4M9QA 5I5EA 2XDQA 4OXQA 4DYHA 1ZI6A 2ERCA 3KR9A 1K4MA 4PLFA 3DXXA 3HB4X 4JLMA 4E15A 2XNDA 2J5BA 1AH2A 5IBRA 1U0JA 3L6OO 4ABTA 3N0XA 4BTLA 3H8SA 4HWKA 5IBQA 1JJAA 2PBRA 3IODA 1WLSA 4XE5A 8ABPA 3A6DA 3CCCA 1KYQA 3FH0A 3KWJA 3UTDA 3AJEA 3O8CA 2IZ5A 1XFAA 2XGGA 2C4UA 3I8SA 5BQOA 2O19A 1QGYA 3KYIB 2V6MA 3PDJA 2HWWA 1FTYA 3F5MA 4H7EA 1YB1A 4KLAA 5LD2B 3IUSA 1DJPA 2CJYA 2GRAA 3SYLA 2N42A 3FZYA 3VI3B 4JOCA 7REQB 3CVYA 1H4VB 2QW8A 2HDWA 1H8ED 2R4QA 3FY4A 4D42A 4M8NE 3LHFA 1QLWA 2IOFK 1NDQA 1RBMA 4JJKA 1IJEA 3HBMA 4WCVA 3F96A 3RVMA 1NUHA 2ADMA 1JLSA 2IGTA 4J6FA 4BNDA 4YRJA 3O3NB 4FE7A 1TT7A 3ZHOA 4RZSA 3COJA 1K5HA 1R5NA 5IVDA 5T4BA 2XTJA 4XB6B 4YRIA 4D99A 4P92A 4UUBA 1NR7A 2P3OA 4AKHA 5DNCA 2VTDA 3E18A 3DHEA 3LL4A 1YBMA 3PKJA 1DMSA 1YOBA 4HRYA 1L9KA 1C1YA 5IDYA 1DKRA 3FZGA 5HFNA 2QZ4A 5CGQB 1WXIA 3F1LA 5KAPA 2GN1A 5G3ZA 3WOVA 1T4MA 5GV7A 4TMVA 3RS0A 4CLOA 1VMAA 5M34A 1RMTA 4G85A 16PKA 1RHQA 1RIFA 3PRJA 3ZZNA 3PUXA 1ZSNA 1E3DA 3KC2A 1IE3A 2WSIA 1Y1SA 3PGJA 1RI5A 4LJKA 5T6MA 2YN2A 3K31A 5HKOA 4H15A 3WZ2A 1M2OA 4QOJA 1MXFA 4FDUA 4X95A 3A0RB 1IHPA 4GYYA 5JNUA 3DM9B 3CPJB 1JFSA 2CNBA 1U0OC 1WKCA 3QVWA 1JT2A 1NQAO 1DWUA 3LBNA 5FFNA 1UFQA 2FKAA 2Q8PA 5AKYA 3F2VA 3RAGA 2V65A 1M73E 3KYJB 1QG0A 2GHIA 2EP7A 3H2BA 4P81A 4R81A 4CKWB 3SVLA 2OCDA 2R6ZA 1JR3D 4D44A 4JGGA 2ZYHA 1A8PA 4MRPA 4NZZA 2QBYA 3JYOA 1T9ZA 3LLCA 2VSQA 3B5JA 4LBWA 1GAWA 1YU9A 3H7AA 4OXYA 1W1UA 4LI3X 4I4TB 4PWZA 4YAEA 4A0RA 4DMFA 4OQ4A 4KNVA 3O8OA 3DWGA 2HWYA 3AV3A 3V7NA 3JQBA 2PS9A 1E4EB 1SZDA 2FZ4A 1ZH8A 2BDUA 1NBEA 1ECJA 2HZ7A 5K0SA 1AMNA 1W34A 4M3NA 4OAOA 5ADVA 1L5QA 2H85A 1H93A 1RWBA 3LPLA 2VPWA 3H1PA 3RQSA 5LYJF 1K7XB 2Y0EA 1GGNA 3INGA 5BWMA 1F3OA 5IZCC 2BKAA 4HFJA 4E5KA 1YQTA 1ZP6A 3HJTA 4FR2A 4IBOA 4EVSA 5JZMA 2GZ3A 1CRLA 4G23A 3U9TA 1MGPA 5C80A 1RCFA 2YIJA 3FGPA 5HKKA 3K9WA 1R6VA 4NPAA 4PYOA 4JLKA 2J3LA 3R7DA 5HS4A 3H9CA 2B61A 1L9XA 4LY9A 2AQHA 3JY6A 4WN9A 1SA0A 1V4NA 1J24A 2NN3C 5DVZA 5EA2A 3RARA 1Y8QB 1Z0AA 1FU7A 1GSIA 1Y89A 1O57A 2B2CA 3QNWA 4ZCTA 1WXXA 5C1BA 3WGMA 2J0VA 5KWIA 1C9MA 1YJXA 4KFTA 1U3TA 3BZBA 3C3AA 3I5MA 4V3BA 4UNQA 2B4AA 1GITA 5BRAA 1BE6A 5BUSA 5G1PA 3DL7A 3NWEA 5IZCA 3SS8A 1CQIB 1P7CA 3BRCA 5FWXB 1YE5A 2J33A 1HYGA 4QPZA 1JPUA 2GBIA 1M72A 1T4GA 1DL5A 3UXEA 5B4TA 2V8BA 2VQEB 1FZQA 4DLAA 2DPLA 1ZJZA 1GGJA 1P1KA 1QIJA 2XIQA 3MQFA 4KX3A 3RYFA 5DP2A 5JSHA 4J0DA 2VDWA 3GQBA 3FGNA 4KMRA 5A06A 5ITSA 1NG9A 5A02A 5F7ZA 2I78A 3E82A 1NOKA 4QJ5A 3U4HA 1MNQA 3D5TA 1UPUA 4OPMA 3WGJA 4HDSA 2H4WA 1HDIA 5TXGA 3WLKX 1GZ4A 4RHTA 1Z7WA 4XR9A 2OV2A 1LBQA 3DD5A 3FF4A 1E3LA 3W5AA 4FNGA 3NTQA 1W59A 4KQXA 5JAZA 5MFPA 3WLSA 1EX6A 4CIBA 3I61A 2F2TA 5HKLA 2CE7A 2YYSA 1KYWA 5IPFA 4EB8A 2E5WA 2B2NA 3G1UA 1JDTA 3GP5A 3CN9A 1XA0A 4HUJA 4MVJF 4PM4A 2C00A 2O23A 3N39C 1UZNA 3A36A 3AJ8A 1Z3CA 4H4DA 2OXCA 4GXQA 2OFWA