1TQDA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
400
structure length
385
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDIKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 142
structure length 385
sequence length 400
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tqdA02
4OHWA 4NYIR 3LV8A 1WP9A 1E9SA 2AR7A 5GJVC 3GLIE 3ZLJA 2FDCA 2IYRA 2PH1A 1W4RA 4AKEA 1XBTA 1U94A 5HCNA 4MRPA 1RYFA 1QHXA 2F9MA 1XEWX 1ZCBA 1N6RA 3Q5EA 4LX0A 1VYVA 4ERNA 2PCJA 3X1ZA 2EFEB 1XRJA 4NH0A 4A0FA 2YKGA 4C7OA 2XITA 4KLZA 1NNEA 3IEUA 1OV4A 1U90A 3MMPA 3RS3A 4C9BA 3U60B 3GEIA 5TDHA 3MLEA 2GDJA 1SZPA 4Q48A 3LFUA 1Z5ZA 1JPJA 1U8ZA 3KFVA 4UNNA 1LY1A 4D81A 2F3TA 4A2PA 3OESA 2JJ1D 1LB1B 2CCJA 2ZSFA 3I32A 3MRSA 2WPDA 4B71A 4GL2A 4WBSA 3JZAA 3A1SA 3M4YA 5LBIA 3EC2A 4XWKA 1J70A 3C7KA 1J7KA 1DO2A 1Z29A 3CNLA 4LBWA 4FIDA 1E1QD 4DSTA 3DDCA 2IXEA 2IEZA 3UIEA 3LX5A 1Z3IX 2NQ2C 1BKDR 3EW9A 2ZE8A 3PUVA 4OBEA 2WKQA 3UPUA 1G41A 1S1CA 1XX6A 1WCV1 2IYSA 5FOVA 1OSNA 4TQ9A 4KSBA 2OFWA 1GIAA 2OLJA 1E9DA 2AXNA 3UG6A 1XMSA 1NBMA 1X1RA 2IXGA 3WP0A 4PZYA 1NLYA 2EW1A 2DYKA 1E9CA 4RZUA 5KSPA 4PO9A 4URUR 2W58A 4XWAA 1FPMA 4M1OA 1QHHA 4WOPA 3CBQA 3KL4A 4R9UC 2B8TA 3RRZA 1Z63A 1GITA 5DSZA 2IYZA 5BQ5A 1W2GA 3AF4A 2MMGA 2XNSA 4IDQA 4QBHA 2ZJYA 5UKDA 3HU3A 1GL9B 3AVVA 2RGGA 4LJ6A 4W9MC 4JLJA 2IYTA 3QBTA 1P2TA 3QKSB 2PT7A 2V6JA 1S96A 5D3MA 5CIQA 1CR0A 4I1VA 4IJMA 2ODWA 1T3SA 1AGPA 3QENA 3QXXA 4PQFA 5AR1A 4HDCA 3B85A 2MSEB 4Q47A 1COWA 1KSFX 4NCNA 4D6PA 5KPDA 2VH5R 3TIFA 2FSHA 3IILA 3R9WA 1NN3A 3GEHA 2GZAA 1T9HA 1ZC4A 2DCUA 2LKCA 4JLDA 1RC8A 2CDNA 1D9ZA 1ONBA 3JVVA 1II8B 4UQOA 2REBA 3B7GA 5FUVA 3CW2A 2VSOA 2G88A 2FU5C 2H92A 2QAGC 3TR0A 1TQ2A 2ZJ2A 3TVTA 3P26A 3LVQE 3A58B 2AK3A 2V6IA 3K0AB 3W3ZB 3CRVA 5G41A 1DAKA 2XAUA 2IF0A 2I3BA 1AS2A 2NGRA 4KVGA 1DO0A 4HAZA 2CXXA 3CPJB 5IDVA 1F3OA 3FMFA 3RS2A 3QY0A 3BB1A 3AKYA 1W0KA 3NTUA 4RD4A 3PUZA 4WZAE 3U7FB 1JI0A 3KXLA 3RC3A 1KK2A 3NC0C 3QKUA 4QG7A 3TBKA 3K70C 5AJVB 1OXUA 5HPYB 3MWLA 3R7WA 3SBEA 1E2DA 5CJPA 5J5CA 2J0QA 2WMNB 1YVDA 2R6FA 2UVQA 5FTNA 3ECCA 4ASUA 4LYAA 5CIWA 2CNWA 3U7EB 5IHPA 1RRGA 4PSKA 3U7HB 1MABB 3Q9LA 4QM6A 2ZSBA 4NYJR 2JIZA 1I4LD 1N0WA 1XXHA 521PA 3GPLA 4EFMA 2VF7A 3GLGE 1QHIA 2RGEA 4M4SA 3T61A 1E2HA 1T0HB 4HDQB 5DE3A 1N6IA 1PZNA 3X1XA 1G21E 2OAP1 3GLHA 3DEFA 3MJHA 4KV9A 3U3RA 2A7QA 2W2XA 4PPFA 4KITB 2KJQA 3EZ2A 3OIVA 3FE2A 3TH5A 4EPTA 2FF7A 2PT5A 4LI0A 5KU1A 3UMSA 5KPJA 2EFDB 1G7SA 1X8JA 1AN0A 4R71A 1QHNA 2FWRA 4K81B 1PUIA 1EWQA 1OE0A 1KKMA 1Z22A 2JATA 2VLIA 3BFKA 3NKVA 3I73A 2IXFA 1CJTC 3ADDA 2XSZD 3SC3A 1CJMA 2D74A 2RAPA 4NKRA 2QP9X 5FUXA 3R8CA 2B7CA 3HP1A 1TMKA 1TAGA 3RS0A 4E07A 3LBIA 1KI9A 4DXAA 5ELXA 2A3RA 4GNKA 1QBKC 1E2IA 4QC2A 4DSUA 1DG3A 3T35A 2XZPA 1VKJA 3IIJA 2JEOA 4ZCMA 2WHXA 2J5XA 4DDUA 4URWR 1Z0FA 2YC4C 3THWB 4BASA 4Q7LA 3KQUA 2ODNA 2RGCA 4MH0R 1XEFA 4L5BA 3WNCA 3K09C 5C1BA 2DFNA 1T3HA 3TNFA 1Q22A 4Q02A 1RZ3A 4U02A 5A5GA 3WHLA 1KOFA 2A5JA 2OCBA 2RGNC 4HLDA 4B6FA 4D0GA 121PA 1Q1EA 2JASA 3SOPA 3QG1A 3ADCA 1X86B 1Z6TA 2OCAA 2OUKA 4G1UC 3TMKA 2ZANA 2ZJ5A 2QI9C 3GLIB 3KTAA 1MRNA 2RGAA 3SBDA 5AWFC 4Y0VA 3V9PA 5AUNB 1BYIA 3HU1A 4MGKR 1FQKA 1S3SA 1G7RA 1E2QA 1II0A 1IXRC 5JS8A 3SJZA 2IUSA 2A78A 4JL5A 1R0WA 2V55B 2O8FA 2VL7A 1SKQA 3KJHA 3K9LA 3VKWA 3SS8A 1ZMXA 4DLTA 4QJ5A 2EQBA 1E4YA 1T3LA 2R65A 4R2HA 3SJAA 2RHDA 2ZI4A 3OEEA 4LWZA 1E1QA 2OO7A 3WHKA 4QBIA 5J47A 2ZSDA 2GRJA 4GI7A 1NVWQ 5DH9A 1NMYA 1S4QA 2QPAA 2ZRDA 3BB3A 1ESNA 4Q1BA 2WTUA 4LHVA 4Q9JA 2P6RA 2FX3A 2J87A 2IWRA 4HAYA 6Q21A 3Q3JB 4A4DA 1NBME 4BFZA 4RD3A 4OJQA 1D2NA 1NY5A 1DELA 2GCNA 4OQMA 3SEAA 4MDFA 1CIPA 3BJIC 3HU2A 3DL0A 4X8MA 1WQ1R 1KAOA 2GJ9A 4QGGA 2C99A 2FPMA 5KSOA 1YZKA 2CL6X 1ZNXA 4HSEA 3CRW1 2H7VA 3GJ4A 4HAXA 4RZXA 5FTLA 5EP3A 4F38A 3A37A 4UKDA 4EDHA 3NG1A 4LPKA 1ZUIA 4I81A 1ZVQA 3CONA 3QKSA 3NHBA 3HPQA 4NTZA 3RYTC 1OHHA 1RJ9B 4POAA 3K8YA 1GOTA 3P32A 4JLNA 4TL8A 3RS7A 3QF4B 4DCVA 2ZR7A 3FHTA 2HXYA 3C41J 2ZU6A 1Q3HA 2ERYA 4MYCA 3FFAA 5HE8A 3PQCA 2XNDD 2WM9B 2AD5A 4M21A 4QHTA 4DCNA 1P9RA 4LJYA 4YLGA 5L3RA 1AK2A 1SXJC 3OIWA 1GZSA 3BE4A 3IPXA 3BIFA 4GOJA 4JSTA 4TL9A 5FPYA 5G53C 3LH5A 1GKYA 5F98A 4QGFA 2A5FA 2QT0A 1YRAA 1R5BA 5KO2A 1A82A 1II8A 3G82C 4XWOA 5HTKA 5H68A 1PJRA 4Z51A 1ZUNB 1E9AA 4AURA 3BWDD 4A15A 3CZPA 3W5IA 1G6HA 4DLRA 5JFGA 2QE7D 3ZQ6A 1EK0A 4IDHA 4QHSA 3AKDA 1ZD1A 3CX8A 1KDTA 1KTVA 4OQXA 3PEWA 2O8EB 1KO7A 4TYQA 4RCYA 3ZS9A 5JWRA 4Q01A 1G8FA 1OFTA 2K5UA 1UBCA 1FNMA 2C2HA 4K46A 4US2R 1G8GA 1L4YA 5GVSA 1U2RA 3TW4A 421PA 1TADA 1AQUA 1F60A 1VCOA 4BEBA 5EP4A 3WMFA 3IIMA 1NIPA 1OT3A 2AX4A 4IRUB 5KTYA 2P2LA 4LHXA 4C0KA 2ECKA 2WKRA 3AVYA 2J1LA 4ZDWA 4DDVA 1VIAA 4A1FA 3N5CA 2VHUA 4QOSA 5FPKA 1R5NA 2Z5FA 1XXHE 2VF8A 2WJHA 1T5IA 4B32A 1YR6A 1CJVC 3CKLA 3AEZA 3FHCB 5EXXA 4HB2A 1G5RA 2L0XA 1JJ7A 2NG1A 2OBLA 1WE2A 4W7SA 4XVUA 5JSZA 3RAPR 2NIPA 1KSHA 4ZPXA 2WWGA 3GLHE 4GT1A 4IFBA 2IYXA 1N6HA 4Q4JB 3EPLA 3W34A 5M04A 4MKGA 2YOFA 1E99A 1LVGA 1X8LA 4IOMA 2B6HA 3K0SA 3AB3A 1CRPA 1D2EA 3A4LA 5D3QA 3VR3A 3GLGB 4W5WA 1KYIA 4TL6A 3IO5A 1OYYA 4EJSC 4D4MA 1SXJD 3REGA 1UAAA 1E1RA 2QQEA 5LDDC 1FNNA 5B2ZA 3NH6A 2IS4A 4IOJA 4QGHA 4GZMA 2ZI5A 3MSXA 1SVIA 5CK4A 4PZZA 1GRRA 2PX0A 2ZYVX 4KFTA 1NSTA 2HV8A 1H8ED 2BCGY 2EFCB 2I1VB 1KY2A 4PHTA 1DPFA 3DOEA 3QXSA 1W47A 4F91B 1OH5A 2ZUBA 2G6BA 2WSSA 1Z07A 4OQLA 2HXSA 5JJKA 3AV0B 1HQYE 3PIRA 2H1LA 2BEJA 2EFGA 4CF7A 1E0SA 2WWWA 4Q21A 3BERA 2G9NA 1HURA 5DISB 1KNXA 4QGAA 5CDFA 1OH7A 1W36C 2JJ8A 1OIVA 1V5WA 2F43B 3NBYC 4YXWA 1NLFA 5C2JB 1IY1A 4E03A 3B5JA 1EG7A 4RD6A 1R5OA 2H17A 5DI9A 4B74A 3ZZ0A 2D3WA 1WXQA 4C0QC 4J0QA 5G3YA 2FOLA 3GJ8A 3V4FA 3W6NA 1ZIPA 4DLSA 2ANBA 4C7OB 3AVWA 2NZ8A 3ZVLA 4TMZA 1NI3A 1KK0A 5TB5A 1XEWY 1KIMA 1MV5A 1E94E 3VR1A 3IQXA 2V54A 2HLDA 1CXZA 1R0XA 4OKSA 3RC8A 2F1JA 2O8DB 1DOAA 1RYHA 1NL3A 4Q66C 2ZTSA 2X1VA 3T1OA 2CE2X 1XPOA 2BM0A 2FPKA 2D2EA 3X1DA 4EJSB 4IHQA 3HR8A 1DADA 2WWFA 4QNRA 2SHKA 4XD7A 5FH9A 1II9A 2VP4A 1XB2A 1O87A 3QJYA 2FE4A 4Q5IA 4EPXA 2ODEA 3UG7A 4US1R 2CK3D 2MSDB 1CLUA 4MDEA 4AKIA 1E32A 3I5XA 1KO5A 1CS4C 1DG1G 2RMKA 2WIBA 3WRYC 4AWXA 1Z0KA 1DAGA 4TLDA 5JECA 1OH8A 1M2OB 3F5FA 1KDOA 3B9PA 4FMCF 4PPGA 4OYHA 4DDTA 5L3VA 1ELOA 5IK2D 4MKHA 4LJ8A 3NVAA 4TT3A 1IJFA 4DIEA 3QOFA 2YJTD 4FMCB 4ZO4A 5C4GB 1DVRA 1Q12A 4RD1A 4JVLA 5KNBA 4KVAA 3KZ1E 3ZIAD 3CIOA 3IGFA 3LVRE 2ZS7A 5P21A 1NVXQ 4EPWA 1XMIA 3WYAA 4B6EA 5KNDA 1FX0B 2ZRLA 2FFHA 1W36D 2GTPA 2VHJA 1G7CA 3ZDQA 2JLWA 1SGWA 2JLUA 3L2OB 3GJXC 2JJ2D 3TUJC 1RJ9A 2BMFA 2FGKA 4JLKA 3QF4A 2DHRA 2Z4SA 4ZIRB 4H9GA 3OAAD 4HEJA 4JZKA 2XGJA 721PA 2JLVA 1JR3D 4B35A 5JCPA 3GP8A 4CT4B 2OILA 2DR3A 3ND9A 4NCKA 1SVKA 2Q9AA 1HT2E 2D62A 2H57A 3FKQA 4RKEA 4JJKA 3THYB 1E79A 1ZNYA 3LDAA 4TTQA 3H0KA 3WBJA 4TN1A 1G7TA 1UKYA 1JAHA 1ZM9A 1JEDA 1NLZA 1VG0B 4F7WA 3QI2A 1TF2A 4RJLA 2O8EA 4OK6A 1GL7A 2BEKA 3IDQA 1ESMA 3PUWA 5CB6A 3JZMA 2BKUA 2ZPTX 2DWOA 2OG2A 5FPTA 5FBWB 1K5GA 5DI3A 2DFKB 4HDOB 3FOZA 2ZR0A 1KSGA 1G3MA 3SQXA 2MMCA 3AH8A 1MKYA 2ORIA 3NIBA 5HCIA 2ANCA 2ZJZA 1RRCA 2XOKD 3K0FB 4DBLC 4YDHB 5CITA 3R7WB 1D6JA 2ZVQX 1N6NA 5BXQC 4OHYA 5DIFA 3KUDA 5FL7D 1OW3B 2GILA 2O8CB 5E7JA 1N5KA 1YZQA 3LRPA 4HZIA 4JT4A 4R7ZA 1NG1A 1Q20A 3ZZTA 1R4AA 1VG1A 4P4TA 2GCPA 1Z0IA 4Q4JA 1I2MA 1TQ4A 4I1SA 1TTTA 1QHSA 1IJEA 1NVVR 2J9RA 3FHOA 4XTCS 2ONJA 2FSGA 2PJRA 3T5DA 1F5NA 3GLHB 3GLGA 1P2SA 1G20E 2OCYC 4BEJA 2TMKA 4NCIA 4F93B 1ANKA 4TZ0A 4Q9HA 2OT3B 3QBVA 1VYUA 4MQBA 4PSVA 4LJ9A 1OIXA 5FR1A 4DHEA 1KZGB 4LBZA 3LLMA 4AYTA 4TTRA 4GRAA 4C30A 3FKSD 3EG5A 1RRFA 1VG8A 5HZKA 2HEIA 2NO0A 4HAWA 3EPKA 4B2IA 4EQ6B 1FQJA 2P65A 1JQJC 2WBLC 4XSGA 4C3ZA 4L9SA 3GFOA 1E4VA 1YRBA 2ZYTX 4E22A 5C4MA 5FOSA 4GZLA 3RSLA 3BH7A 2VBCA 3O8BA 1C4OA 3DO6A 3M1IA 4LJ5A 1G19A 4V0LA 3K1JA 4HUTA 3HR7A 2YWFA 3QVVA 4PC3A 3U5ZB 3BD9A 4P4UA 3DKPA 1FTSA 1OFUX 3FGNA 1ZU5A 2OFOA 1AZSC 4OL0A 4XTRA 5J4LA 1JXMA 2A2ZA 3KB2A 2XB4A 1RW4A 1Z6YA 2BJVA 8OHMA 1T4GA 1TPZA 4D4KA 4M1MA 1DE0A 2VP5A 3D6TB 4HUQB 1KSJA 2D2FA 4HAVA 1BMFA 3W9YA 2E87A 1XEXB 2ZSAA 1FUKA 5AJWA 2QL6A 3H2YA 5DO9A 1UF9A 1H8HA 3KTAB 4D2IA 3TE6A 3CLVA 4QRHA 3K9NA 1Q1QA 5EE0A 2OXCA 5AJZA 5L3QB 1ZM3A 2O8DA 1W0JD 5KUTA 1JAIA 3FMIA 1GNRA 3WMGA 1DTSA 2WVJA 3ZQJA 2X77A 1UKVY 3W8RA 5EXSA 3I72A 2O8FB 1UKEA 3OE7D 2FEOA 3ND8A 5CLLA 4D80A 4KAXA 4EJSA 4HLUC 3DMNA 1SHZA 2IA5A 3DZDA 5B30A 2H16A 3GFTA 4B44A 3RRMA 4IVQA 1UM8A 2KSQA 5B64A 3B2EA 3KB1A 3UMRA 3B82A 2AFIE 3L8YA 3R9XA 5K8LA 1LTQA 3P20A 4C0AC 2VP6A 1YZLA 4Q9IA 1X8KA 3IQWA 1VIYA 2GKSA 3P27A 2GJAA 221PA 4KLNA 1HUQA 2VSXA 3ICEA 4B2PA 5JI3E 1XTKA 3ZS8A 2NO7A 1N0UA 4NP6A 2IYQA 3ZVRA 4PR0A 1FX0A 3VR4A 2XTMA 4JL8A 1JECA 1K8RA 2RGDA 4UXJA 3NHAA 3OIUA 5EZ5A 3X2SA 3BGWA 4B73A 4URYR 3DHWC 1WB9A 1RVDA 1OKKD 2NTYC 4V0NA 4XSHA 4HLCA 2QRZA 1XPUA 2XTZA 2ATXA 2VHCA 1IAQA 3LD9A 2QORA 3BXZA 3BK7A 4ZIRA 4JLOA 2ZJOA 2QM7A 3HPRA 4DSNA 1Z2AA 5EQTA 1RRPA 3VNVA 2ZR9A 4M0LA 5J4HA 4S2EA 1U8YA 1CP2A 4M1KA 3THXB 3KKOA 4Q18A 3TW8B 1IONA 3AGPA 1UBFA 5AUQA 4KBFA 4AG6A 3KQHA 4E5UA 3THYA 1QZXA 3CF0A 4I99A 4NCHA 2QPTA 3B1YA 4DUGD 3SNHA 3WMEA 5DNYB 2R62A 4JYBA 1F48A 3A1WA 3LX8A 1EWRA 3NBFA 3TAHA 1E2KA 2DB3A 2ZE7A 2XZLA 2Y8EA 5F2EA 3WBKA 1EFRA 2UKDA 4HZUB 1E96A 2QM8A 1ZAKA 4DT1A 3IUYA 1DEKA 2CHVA 2H8KA 1LF5A 3A36A 3A4MA 3OEHA 5FUYA 1KY3A 1C9KA 3AVPA 3M6AA 3UWKA 3HYRA 3K0CA 4Q7MB 1RKBA 3VHXA 4DEYA 2DWPA 2P67A 2WZQA 2ZRGA 1M8PA 5DYIA 2OSBA 2O0HA 1BYUA 3KKMA 3MG9A 4JBYA 4QFMA 2GAOA 3H86A 2R2AA 2VHTA 1RFLA 4LV8B 3VQTA 5JEEA 2GZDA 4YONB 2ZRFA 4Q1DA 3EWAA 1N3BA 4B76A 5EJEA 3K0FA 4AYWA 2NO9A 4LPSA 3ETLA 4M1WA 2O8CA 4IW3B 2Q3FA 3T06B 1EFTA 1RE0A 2IW3A 3SYKA 5BWMA 4JKYA 2JLZA 5E4FA 1GP2A 4EIWA 4ZKDA 4D0LB 2YOGA 3OZXA 1XDBA 4Q4AB 1HA3A 5JSZB 4M1TA 1XCMA 1U0LA 2BBOA 3KDSE 4FD2A 4RFSB 2JDIA 1XMVA 1VHLA 4UXIA 2VSFA 1YE8A 4NBSA 2ASEA 1CJUC 3EX7C 2MSCB 5DN6D 4Q7JB 4UNSA 2YHSA 3MAAC 1G291 5KYKA 3W3AA 1YR7A 1SVSA 2FFBA 1GAJA 1KK1A 5CB8A 1ZNZA 3RLFA 2BBWA 5HKKD 4UJ5A 5EZ6B 2OESA 4EQ6A 4JLPA 1XP8A 2XXAB 4O25A 5FTMA 2QAGB 1U98A 4LYFA 4XVRA 2JGNA 2X2FA 3Q5DA 1R10A 4LV6A 4UNPA 1NRJB 1KI1A 4Z1MD 5GVRA 2P6NA 5B57C 3M0EA 2B21A 3PVSA 1UEIA 2REXB 2QTVB 3BFXA 3FMOB 2C96A 4DVGA 4IEIA 1K5DA 2J59A 2HCJB 4ESHA 2N42A 3PXGA 2GF9A 3R9IA 2J41A 2DPXA 1QVAA 3U4QA 1MO3A 2CVFA 4DLUA 4LDJA 3EA0A 3FVQA 1A5TA 3K70B 1DAIA 3E1SA 1BO6A 3WP1B 3AVUA 2KI5A 3NXSA 1EESA 1KI7A 3CR8A 4KSCA 3DOFA 2DWQA 4NE2A 5KSYA 2HF8A 1N6PA 1CKEA 3VX3A 4LJAA 2AKAB 5TY0A 4HUQA 4DCTA 4MGZR 1XEXA 2R6AA 3AF1A 3AF2A 4BRUA 4RVCA 4A36A 2BC9A 1D2MA 4JIMA 4G5SA 3FPAA 1CTQA 2NZJA 3LW7A 1W5TA 2GEDA 4JLBA 4PTLA 4TSFD 3CNNA 1L8QA 1OIWA 2OAQ1 3BB4A 3Q7PA 4ZCLA 3BH6A 5L3QA 2HCBA 2VP0A 4B3FX 2JJ1A 2ZRPA 1WA5A 2Q9CA 5FOWA 5E95A 1ZRHA 3GLFA 1A2BA 2WWHA 4G3XA 3EIHA 3I4LA 2R6DA 1G17A 4PHFA 4PQRA 1GG2A 4MYHA 2PLRA 2HUPA 3O8RA 1AS0A 1DAEA 4CEJB 5ANRB 2KB0A 3CH4B 4ACAA 3MD0A 3DVLA 3KKNA 2IS2A 1P9WA 3UATA 1MO6A 5JI2E 2Z0MA 4KODA 2ZE6A 2ZSEA 3AVOA 1XTRA 4P33A 4MYUA 5FTKA 3EIQA 1FL9A 1G8HA 2ZRKA 5IRCD 1NG9A 2WJJA 5FBQB 2FFQA 2OV2A 2GHIA 4EAQA 2RKOA 4JSYA 2HYDA 3F8TA 3EPJA 1ZNWA 2CLSA 2R44A 2GK7A 5JZVA 3L0OA 3VKGA 2W6ID 1GSIA 1IN4A 1ETUA 3T15A 4TQAA 4QJ4A 1LS1A 3AF3A 4DLWA 3KQKA 4Q4HA 3O47A 3P4XA 3QNUA 4ARZA 3SZRA 1HYQA 4R98A 4RCZA 4IKEA 5FFMA 4W5JA 1KNQA 1Q3TA 3RVBA 2LWIA 4C0JA 1P2UA 1Z06A 2A30A 2G1JA 3VKHA 1U8AA 1W49A 3G5UA 1IN5A 4ON9A 3THXA 1KAGA 1N2CE 2GXUA 3CX7A 3EWSA 2YNMA 4MA4A 1Z2CA 5FBRB 3GJ6A 2QT1A 2X8AA 3IHLA 4LUCA 1KHTA 2GVZC 1P60A 1MOZA 1P2VA 4MUAA 3GJ3A 4KFRA 3SQWA 5EP1A 1UBGA 4KXFB 3EASA 1P7CA 2OM2A 1MO4A 2O0JA 3W90A 1FMJA 4M9XA 2W6JD 4AK9A 2J7KA 1G64A 3W8NA 5HZHA 1GRNA 1Q44A 4ESVA 2H5EA 2FG5A 4HZUA 5H70A 5FOUA 3OIYA 1SULA 3LA6A 1YR9A 3WYGA 5JEDA 3U44A 2JLQA 2ZUCA 2CL7X 4G5GA 3C5HA 4YDSA 5DYGA 4V02A 4CYMA 4LY6A 2WJGA 4BWYA 4BZPA 1QG4A 1TQDA 3KFXA 1HH4A 1QRAA 2D7DA 4FI3C 4E09A 5DI3B 2GVDC 5CM9C 1DBSA 1WBBA 4P0TA 3VR2A 3NBXX 2BBSA 2DFTA 1RIFA 2RB4A 3D7MA 3EZ6A 3X1YA 5BN4A 3NC1C 2G0NA 2IS1A 1R6BX 1WMSA 4OHVA 1P72A 1NJFA 3VR5A 3PITA 3W6PA 3AKEA 4EPYA 4BFTA 3RRNA 1AM4D 1CR1A 5EUQB 4A8JC 4M2LA 1OXSC 4ITRC 1AA9A 2ZITA 5KDLA 2RHMA 1SKYE 3ICQB 3TAUA 2F3RA 2EYQA 1DAMA 2N1BA 2O52A 1VYTA 4I4LA 3N2EA 1CU1A 2V4ZA 4P32A 1TF5A 5TARA 1PVOA 2JLYA 4Q4AA 4YMTA 4JT2A 2UZIR 4M9SA 4BFYA 2ZRHA 3AUYA 4GBMA 1GUAA 4WVFA 4RFSA 1N6LA 1HE8B 2JLRA 4MGIR 2PMDA 4A9AA 3WYFA 3EZ7A 1Z0JA 2IS6A 1ZBDA 2PZEA 2VHQA 5HKKA 3A1VA 1SXJB 2ZYWX 2V7QD 5BW8A 1SQ5A 3LW8A 2XSZA 2FH5B 4NPHA 2OLKA 1GNQA 4ZV4A 3RWOA 1UADA 3MWJA 1YZUA 4URVR 1CULC 1ZM2A 3VHLB 4DCUA 5SZHB 3CX6A 4DLZA 2XXAA 2IEYA 5CJ2A 2QAGA 2XX3A 2GEVA 5DHFA 4LYHA 3D8BA 4FMBB 3F0TA 3GJ0A 2VRWA 3HJNA 5K8IA 3PCRB 3DMDA 1IM2A 4AIIA 2YYZA 5FPHA 1GDDA 4US0R 2IWHA 3U6BA 2WJYA 3IKJA 3PENA 1H65A 2QRNA 4P3YA 3CPEA 1XTIA 2O0KA 1JJVA 5GADl 1Z6AA 3IHWA 3KKQA 5HR5A 2ZE5A 3E2IA 4A92A 2QMHA 2ZIAA 4M9ZA 4TYPA 2ZI6A 2YWGA 1XJ0A 4ZI3A 5L8VA 4CDGA 2FJUA 4XH9B 5AUOB 1AJEA 1F6BA 4QKQA 1VG9B 1EX6A 2D4HA 1N5LA 2ZAOA 1NN0A 2ZVPX 3VR6A 1E0AA 4KU4A 3H4MA 3L0IB 4LBVA 4P4SA 4KFSA 4OK3A 1Z83A 2WAXA 5FI0B 3D31A 3X1WA 2WICA 3T5GA 4BRWA 1DAHA 2P3SA 3K9GA 1E2MA 3BRWD 3QQ5A 5EE5B 5J4YA 4PAOA 3NBZC 3GLFE 4KHZA 2OFXA 1U0HC 5JHGB 4GSYA 3ASYA 5KSZA 2B92A 4PC1A 2WJIA 3VAAA 4DC9A 3KXKA 2FN4A 5TXGA 4UNRA 5HE9A 1U9IC 3AVQA 4B47A 1E2JA 5IF9A 3SJBA 1G6OA 4B3DA 1I2DA 5CYPA 1HTWA 3IIKA 1UKZA 5SZJA 2CHQA 2V8OA 2G77B 1A1VA 4OI1A 2LCFA 3AQ4A 4M8NE 4CEJA 2QENA 3SI7A 1QG2A 4O3MA 1IY2A 2FA9A 1N6KA 2QEQA 1FP6A 2Q3HA 5JWHA 4LRWA 3FYHA 4PC2A 3FWYA 4V0KA 3RS4A 2GXSA 2B8WA 1IHUA 4JBWA 1YR8A 2ZI3A 3TUIC 1O3YA 3K09A 1E69A 2P5SA 1IN8A 1OXVA 1J2JA 2WPDD 4WXRA 4C0HA 3GJ7A 3QEJA 3EZ9A 1W36B 1GFIA 3UKDA 1UDWA 4KCGA 1YKSA 2QGNA 2RGNA 1AIPA 3KX2A 1YZGA 4D82A 1G3UA 4V0ME 2JAQA 2QA5A 4QL3A 4D25A 1FFHA 1PLLA 4QBGB 1YQTA 4BLQA 4HAUA 2DFLA 4FCVA 4TYNA 2IYLD 2EU8A 1GKUB 3GQBA 1OXXK 3QG5A 2XZOA 2WSMA 2XNDA 1T6NA 1WBDA 2XTNA 3IEVA 4EPVA 2WOOA 3EPHA 2W0SA 2ZEJA 2QQ0A 1R2QA 3KKPA 3O8CA 2EFHB 1LFDB 1NBMD 3GMTA 4FINA 2IK8A 4X8LA 3SHWA 4BFSA 4GP7A 1P4SA 1SVLA 3QXCA 5CYOA 1XZPA 4LBYA 3TSOA 3UXMA 4DB2A 4B75A 2NO1A 2QY9A 2YWHA 2W6JA 4QXAA 2PLFA 1NMZA 2QE7A 3E5HA 4TLAA 2V9PA 3GFPA 4DB4A 1JALA 2DBYA 1AZTA 3SFZA 1V43A 4TMKA 1ZC3A 4CEHB 4JJZA 3CRRA 2ORWA 4ZDJA 3ZVNA 5LD2C 3BORA 5EUMA 3U61B 1JEEA 1YJ5A 4HB3A 2I4IA 1TEVA 4DT1B 1DAFA 4ZKEA 3E70C 4TMXA 1ZU4A 1COWD 1GNPA 1HY3A 2NPIA 2CJWA 1KJYA 1XFAA 3IBYA 4XJXA 4WA7A 2NMVA 2FSFA 3SYNA 1P5ZB 2CCKA 3T34A 3MGCA 4Q7KA 3LO5A 3SR0A 2GXQA 1G9XA 1HEIA 3WY9A 1XF9A 1CR2A 4CIDA 3HDTA 2BBTA 2JCSA 3C8UA 2NPFA 2EWVA 3BFVA 1IXZA 2GF0A 2GZHA 3JVUA 1JPNA 1G4AE 1R0ZA 2C98A 3U3JA 1GL6A 3CH5A 1D9XA 2HT1A 1MH1A 2QZ4A 1P73A 4MKFA 2ZQ5A 3RHFA 1J8MF 1G3RA 1SKYB 3PUYA 5BYKA 2KBEA 2O8BB 2IX3A 1W0KD 3TVDA 4TYWA 1G1MA 5C18A 1SXJA 2R6CA 4PSAA 1NY6A 1IOZA 4PZLA 4XIGS 3VU9A 4TYYA 4KI0A 3TK1A 4PXAA 4JL6A 3B13B 3FDIA 5AK0A 4TMTA 2OBNA 2W83A 1I4TD 4OQNA 2CEAA 4ILEA 1E2EA 3RWMB 3I5YA 4ASUD 4A2WA 4DKXA 2CNWD 4DLYA 2PEZA 1H8EA 5E7IA 1N0VC 1Y63A 4AI6A 1MO5A 1S0UA 2G0TA 2BV3A 4BUJA 4RZ2A 5DGXA 2JIZD 4DIDA 3DM9B 2GJ8A 4RY2A 2HJVA 4FXPA 3CF2A 4G5RA 4LJ7A 4TLBA 4ABYA 4FCTA 3BAFA 3NDBB 2QUZA 4EKDA 5EE3A 3T12A 1X1SA 5F9FA 4AG5A 3U4QB 4YQFA 1AKYA 1NF3A 4Z8XA 3C14C 4OHZA 4EPRA 3C16C 1X6VA 1F2UA 3CWQA 1OB5A 4A82A 3U2QA 4A6PA 1HV8A 3A8TA 2IL1A 3NEYA 4A8JA 4DEXA 4BFXA 1QDEA 3CF6R 3UANA 2BDTA 2QROA 2ZI7A 3QKTA 1N25A 4F92B 1G3IA 2ZRMA 1SVWA 1XCPA 2WKPA 2X2EA 4IVPA 1CJKC 2AKYA 1EGAA 4FMDF 1MR3F 2YOHA 3P1JA 3QKRB 1S9DA 2R8RA 4FWTA 4H1VA 1AS3A 1R8SA 4DLXA 1LS6A 2ZS9A 1T0JB 4Y0AA 1XJCA 1AKEA 1KZ7B 1ZD9A 2C9OA 4HATA 4BFWA 1SVMA 3PEYA 4NYMQ 3TRFA 5KHOC 3NWJA 4Q1CA 1M74A 2BJWA 4QBFA 4GPTA 4D4JA 4JYCA 2HDNB 1ZCAA 3HWSA 2RGXA 1B0UA 3OF5A 3U3KA 3DZ8A 3ZH9B 5JCZA 3GLFB 2C03A 4HLQB 4PHHA 2CK3A 2PZGA 1QHYA 1W1WA 2ZS8A 4JKIA 2GBLC 3B1WA 2BIFA 3L0SA 1Y3AA 3Q72A 4AKGA 3RS5A 4AY2A 4LC1A 4DCSA 2J0UB 1MRSA 5KOYA 4U7DA 3SFVA 1G8YA 1XWIA 3K53A 4N0DA 5IK2A 4PC6A 4IDOA 4P31A 4ZDKA 1N5JA 1Z47A 1J90A 3I8SA 3DM5A 3ZIAA 5EXPA 1LNZA 3EIEA 2EWWA 2IHYA 4V0OA 3MCAA 5DLQC 1EX7A 5FBLB 1YHNA 2GESA 4NYIQ 1OF1A 4KJZA 1KI4A 3UWOA 4RD2A 4JLMA 4ZCIA 3OEED 1W2HA 2JJ2A 3KUCA 4NZYA 3QXHA 1TX4B 3BOSA 3KQLA 1PUJA 1ZUHA 2ERXA 3OAAA 1JR3A 4TMVA 1GM5A 4NDZA 3EAQA 5G3ZA 4PC7A 4OJKA 4Q4HB 4BLTA 4IVRA 5G40A 5GJCA 4ARZB 1CR4A 4B33A 4N0EA 4TZ6A 3J81k 2ZRJA 1TUIA 3P4YA 5B58C 3CM0A 4A2QA 2J7PD 1KDPA 1XTQA 4QNMA 3MJRA 1UPTA 1EFHA 2AL7A 5TV2A 1G8PA 1KO4A 2OHFA 2IT1A 4YMUA 1XTJA 3B1VA 2XJ9A 1XD2B 2CE7A 2R6GA 4KBGA 3V4RA 3QPUA 4L16A 1Q57A 2KBFA 3QSYA 1NN5A 1GKIA 1U9IA 2GCOB 2QPOA 1BH2A 1ZJ6A 2ZETA 4L8GA 4WZ6A 3UMFA 2BKEA 3TKLA 2HJGA 1VCIA 2W00A 3SJCA 1E9BA 1IQPA 4CEHA 1ZP6A 2BHRA 3CB4A 1Z0AA 2CL0X 2QNRA 4F4CA 4FCWA 2AK2A 1KI2A 1KGDA 1LV7A 2F6RA 5CK5A 2AD1A 1OHHD 5J40A 2CBZA 3IBGA 3AM1A 2XEXA 1S8FA 3A4NA 2ZRIA 3LWNA 2CLCX 1F2TA 1FOEB 1T5LA 2AWOA 2PZFA 2A5GA 1OFIA 2XOKA 1W4CA 2IC5A 4LSGA 2J0SA 1R7RA 1JXOA 3GJ5A 5FL7A 2VP9A 4DWJA 3I62A 3OHMA 4MRVA 1XJQA 5JJIA 2OCPA 2ODBA 3DPUA 3RSOA 2XJ4A 2ZRNA 3KJGA 4EFNA 3AP2A 2ZRBA 1M34E 4C0BA 1P3JA 2QU8A 2A5YB 3D3QA 3S1AA 1S1MA 2P0EA 2ZXUA 3N70A 4MUBA 1SXJE 2ZM5A 1JB1A 4F4IA 3TQFA 3AKCA 2O8BA 1NP6A 1EXMA 3I61A 1D8TA 5IT5A 5JS7A 1ZW6A 3CWZA 1NIJA 3THOA 4DDWA 5EE1A 2XB2A 2WWXA 3TLXA 4JVMA 1W44A 1ZD8A 1N6OA 3TUZC 1S2MA 2F55A 1T91A 1X3SA 3CRMA 3FKSA 3DKVA 4WXPA 2R9VA 2J45A 4D0NA 2PX3A 2QMOA 2C78A 2D06A 3PJRA 1GWNA 3R8FA 4M53A 4GDFA 2BWJA 4D4LA 2Q0HA 2CLDX 3EC1A 4TMWA 1T8UA 1XD8A 1PLJA 4IDNA 4A0RA 4MKIA 3RNLA 4GOXA 5FI1B 1GILA 1L7VC 2GEUA 2IYUA 3B8HA 4YMVA 3K9HA 3LAWA 4CGZA 5BN3A 2G83A 1YZTA 2ZYUX 5C46F 3FB4A 2IUUA 4WAUA 5FL3A 2VIIA 3PG5A 5L3SB 1E2NA 3A6PC 4RD0A 5JRZA 3EXAA 4YC7A 1EFUA 2ZAMA 4BGDA 1OLOA 1UBEA 1J99A 1KK3A 4N1AA 4HB0A 1E1RD 4HB4A 4KYIB 1VMAA 5FOXA 1US8B 1W4BA 5FUWA 4C4PA 4UNQA 1NN1A 2GJKA 5JMTA 4NYJQ 1E2GA 3QKRA 3Q7QA 2FFAA 2FMXA 1R8QA 2Q3MA 1E2LA 2QP4A 2WOJA 4G01B 5EE9A 1W0JA 2OXRA 2WSSD 4P4SB 4TL7A 3VX4A 4CRWB 4G0NA 1G5TA 1QHGA 3ASZA 1AGRA 3B6EA 4M1YA 3AVTA 1KKLA 1G5PA 2X19A 2IF2A 3OE7A 1CEEA 2P6UA 1FW6A 2YINC 4GMXA 2QAJA 3K70D 4DSOA 1FTNA 2VPPA 2C9YA 3SN6A 3I92A 2GJSA 2C95A 4Z54A 4AD8A 2QTFA 4YXWD 2BCJQ 1VCNA 4C0LA 2C9CA 3PV0A 2F1HA 2Z83A 3H1TA 1E6CA 4BLRA 1OJLA 3CRQA 4BZQA 1ZINA 2J3EA 2RCNA 2J0UA 3TR5A 1ZIOA 4TTPA 2Q6TA 1BOFA 2ZRAA 3KXIA 3L82B 4A6XA 1A4RA 3LQRA 1BIFA 4M9QA 2FSIA 3B78A 2ZJBA 1XZQA 3QPWA 1CBUA 1AQYA 3BC1A 4C2TA 2HLDD 3C5CA 2IBMA 4H1UA 3NEJA 1K6MA 2KE5A 2C8VA 2OBMA 1P6XA 4KO8A 1NSFA 4LHWA 2WWIA 2F7SA 1IN7A 2FZ4A 2I1QA 4GOKA 1W46A 3L0PA 5F3WB 1E0KA 1E9FA 3RABA 4B3GA 3VNUA 2G1KA 1DS6A 1Q1BA 3QPVA 1OKKA 1QF9A 3PEUA 3U3MA 1UDXA 1I4DD 4XD7D 5E7MA 4IXNA 1NJGA 1JR3E 3GCGA 1ODFA 4DLVA 2FNAA 1MT0A 3K0EA 5SZIA 1KDRA 2F1IA 2HT6A 1ZM7A 2P5TB 1B23P 4IXMA 4IFEA 4JVSB 4PPNA 4II7A 4DJTA 1KO8A 4V0MA 2J7PA 5SZKB 4MRNA 5JRJA 1M7GA 2QP3A 1OYWA 3GD7A 2ORVA 2VYFA 3FMPB 4LYJA 1T8TA 1JBKA 2VTKA 3CUEF 4PANA 4RSGA 1VCMA 4RFVA 4TT3D 3QE0A 1XPRA 2GXAA 3TSWA 1A7JA 3TQCA 4DUGA 5BYJA 1XD2A 1JQLB 4S35A 2NOAA 2GNOA 1KI6B 3QVUA 4XVQA 1KMHB 2GCOA 4NMMA 3ADKA 2ZJAA 4HLUA 2REOA 3MWYW 4O0MA 5EP2A 1J8YF 5TMPA 4A0HA 4L4UA 2BMDA 2GBLA 4PAMA 4OK5A 5E3HA 2D7CA 4JVNA 4B48A 3RANA 1HQCA 2WAYA 2ZRCA 3WRXC 2PCLA 2V3CC 2CHGA 5H8WA 3WNBA 5AJYA 4O2RA 4U5XA 5AUPB 4PFSA 2AXPA 4WW0A 3ZVMA 2QBYB 1U0JA 4Z8YA 4NHOA 1Q21A 3CO5A 1CRQA 3AF0A 3EZFA 1TF7A 3F3YA 3ZJYA 5CLQA 4OI2A 1XD9A 2CJWB 4X8OA 1P62B 1U99A 1VTKA 2Q21A 4Q9LA 2IYYA 1GRQA 5LB2A 1W7AA 3LQQA 2QTHA 4MRRA 1E3MA 5F9HA 1E79D 2PMKA 821PA 4PO8A 4LHZA 2ZUDA 2PL3A 4TWZA 4BLSA 4O2LA 5J4KA 1WDTA 2LKDA 1XCGB 3K0AA 5H1YA 2FV8A 4QHYA 1RPZA 4KYUA 1IXSB 2CMKA 4NCJA 5FBVB 1LW7A 1C1YA 3WNDA 5A4JA 3IO3A 5JWOA 4BZXA 4LV5B 2JLXA 2QSYA 1YU9A 4UXHA 3OFND 4BE7B 4EUNA 3LXRA 3MFYA 4UJ3A 4JLVA 4GP6A 1KMQA 5DN6A 1HT1E 1EFCA 4JMPA 1ZM4A 2V1XA 4ZI2A 3PFIA 3G0HA 4TLEA 2IHBA 3C4JA 3N2IA 4Q1EA 2AN9A 4CZ2A 3LLUA 4Q9KA 2BOVA 1KO1A 1MABA 2YV5A 3NH9A 4G5OA 3VU9B 4BFUA 2Z4RA 4Q1FA 4Q4LA 4F4JA 1IBRA 1OFHA 1G4UR 2OEPA 3BS4A 4LCBA 4Z1MA 1TL7C 1P61B 5TVKA 4B3CA 4W5HA 3C15C 1Z8FA 4CEIA 3PUXA 4GFDA 4GMDA 1M7BA 4PAQA 3PR1A 1Z28A 2IYVA 4AKHA 3BBPA 4CT5A 1QVRA 2ZI9A 4R2IA 4FWIB 4CW7A 3L43A 4BQSA 3SYLA 2WJVA 3QXJA 5LB4A 5JBQA 1L4UA 3AVXA 3U7GA 1M1YE 1E2FA 1FP7A 2QMEA 5L3SA 2VEDA 4JS0A 2E9SA 2AHOA 3TSZA 4B3XA 4CVNA 3AUXA 3T1VA 3W5JA 1F2UB 1US8A 3U6KA 2ATVA 1TU3A 3LBNA 5CM8B 1PV4A 3SHFA 2QN6A 3CZQA 4NU0A 3CNOA 3EARA 4A8JB 4TSFA 3U44B 4AYXA 2JLSA 3THWA 3I1FA 2O5VA 1JR6A 4MRSA 4BLOA 2ONKA 1OB2A 2Z43A 2ZJ8A 2VO1A 1E9RA 3HYTA 4L15A 5K8UA 2F9LA 4JLAA 3B9QA 1TNDA 4Q03A 1SVOA 4IEEA 1ZYUA 3QEOA 2FEMA 3NDPA 3QIAA 4BECA 1KJWA 1G3QA 5FR2A 3LXXA 1IY0A 2GK6A 1TU4A 1S3GA 1WRBA 1SHKA 4X8HA 4TQUS 4B43A 4PPQA 3GLIA 4TLCA 1NVUQ 2ZREA 4MYTA 5JJLA 1Q0UA 4G5QA 1GVNB 1FZQA 1E0JA 1P75A 1BMFD 3L8ZA 3ZD6A 1L2TA 5FOTA 1BS1A 2H18A 4BLPA 1H8HD 2AWNA 4YMSA 1S9HA 4B3BA 1W4AA 2QSZA 4ACBA 2Q9BA 2G3YA 2QG6A 2WWYA 1PLKA 4IDPA 2DY1A 1E98A 5K8TA 5DHAA 4EFLA 3SU8A 1OXTA 2QMUA 1W5SA 4WZBE 5A0FA 4LJ4A 3V00A 2A5DA 1KI3A 1G18A 2OE2A 4QJ3A 3U3OA 4Q1AA 3FFBA 3LY5A 2PEYA 2W6IA 1CF4A 4RZ3A 2C77A 4PX9A 5GJBA 5EXTA 2GETA 2E1RA 3K0CC 3ZGXA 4C0SA 3B60A 2ZROA 1M6NA 2WV9A 3RDPA 1Z08A 4Q00A 4LC0A 4L9WA 2C5LA 1QHHB 1KI6A 5FPSA 1KMHA 5BN5A 4ZDIA 3Q85A 2IUTA 4U00A 2FPLA 1FUUA 4BFVA 4LGMA 4B34A 4YMWA 2CCGA 4NL4H 1A2KC 3QF7A 2EVWX 1XNJA 3R20A 3A1TA 4FW9A 5JHHB 1UFQA 1XTSA 5LPNA 4URZR 2RGBA 4URXR 1GTVA 5D3MB 1VPLA 3SE0A 2KWIA 3GEEA 1Z0DA 2FGJA 2QBYA 2UZ3A 1HE1C 3FTQA 4OHXA 4KFUA 1D5CA 5J4VA 4IOLA 1UJ2A 1F2TB 621PA 4NONA 4B2LA 4WIAA 2W2VA 4MGYR 4FN5A 4QM7A 4C2UA 3Q8XB 2YZ2A 3I8XA 3ZD7A 2RH5A 2WIAA 2GAAA 1VDZA 2HYIC 3LBHA 1E9EA 2HF9A 1DARA 3AP3A 2IYWA 2B7BA 1NMXA 2Z6VA 4DRZA 4HYYA 1NKSA 3O8DA 3T1QA 3VFDA 1E2PA 2OZEA 3OFNA 1EFRD 1YZNA 2C04A 3ZZUA 5AJXA 4LOAA 3S1AB 2BMJA 3OEHD 1Z6GA 3QUSA 2JA1A 2VQSA 4HI0E 3H84A 4I1UA 3KQNA 2V7QA 2J0VA 2V1UA 3UK6A 4OI4A 3BH0A 3REFA 1OPXA 1P9NA 1TEXA 1Q1ZA 1UEJA 3B1XA 3ADBA 3I3SR 2W2TA 4IOKA 1W48A 3PEVA 2W0MA 2J46A 3T1TA 4MITA 4I1OA 4AC9A 4JBXA 4PQYA 2YC2C 4XOIA 3TGPA 1XXHB 3A1UA 4M1SA 1NKTA 3IPYA 2F1RA 5FTJA 5LD2B 1OH6A 4DZZA 3WXMA 2YWEA 1LF0A 2QGZA 2VP2A 4OQFA 5JLJA 3EA5A 4OI0A 3AGQA 3ZYCA 1U81A 2JDID 1JNYA 1R0YA 4NYMR 3CR7A 4PO1A 2A9KA 4N3NA 4CEIB 4LZZA 1G16A 1KI8A 4D26A 2BMEA 4K8OA 5KDOA 5GJWC 1TUEA 2GWHA 3MUFA 4PHGA 2ZU0C 2YVUA 1FMLA 3W6OA 1Z6XA 3VTKA 1XU4A 1M7HA 1VHTA 2CVHA 3MWKA 3TJZA 3B1ZA 2PJZA 3RRYA 1WF3A 4V03A 1KJZA 3CPHA 4M22A 1N5IA 3SDZA 4Q19A 1VECA 3VMFA 2AFHE 2PBRA 2WMOB 3AP1A 2BVNA 4LK2A 2NO6A 5CDFE 5KDDA 4A0GA 3ONWA 1NVVQ 2VA8A 2BM1A 2EYUA 2N46A 4FMDB 3LNCA 5KNCA 1IN6A 1TQ6A 2F43A 4RKFA 2GA8A 4LHYA 3KJIA 4BPBA 1XMJA 3KJEA 2FZLA
chains in the Genus database with same CATH superfamily
3SD7A 1U1FA 5TMEA 4JI7B 1Z5GA 3EVDA 5D3ZA 2BKXA 2VSQA 1E9SA 1X1DA 1NP7A 5AK5A 4FU0A 3FGPA 4V39A 5GJVC 2IYRA 1POWA 4AKEA 5KZMB 2PH3A 1PCXA 3PD0A 1XEWX 2OECA 1N6RA 3Q5EA 1IBKB 1HDYA 1VYVA 1ZCZA 1X7GA 2JHCA 2PCJA 1CUJA 3IDSA 3ND7A 3X1ZA 2EFEB 4G0UA 4CIYA 4C7OA 5CDGA 2EHJA 1E6UA 2XUZA 1R9JA 2I62A 3OLZA 4TRRA 2WUGA 2VWHA 5LN1A 1U90A 2LP4Y 5IFKA 1MW8X 3K1YA 3FB1A 3U60B 2WJ6A 4CKEA 1B41A 4IDCA 4V2UA 3D4IA 4FNMA 1SZPA 1UZUA 2FZ5A 4DMFA 1X3LA 2FR8C 3IDOA 3DFMA 4D81A 3IELA 4F84A 5JR3A 3H4IA 3F6PA 3JR3A 2DH6A 3RVQA 2WPDA 1WHSB 3QLUA 2Z2JA 4HF7A 3WK6A 4C7MA 1GSHA 4MA0A 1PL8A 3PXAA 2CLFB 2WFMA 4WBSA 1HT0A 4I50B 5I4CA 2OWDA 4LRQA 3DMTC 4AECA 3QELA 2GFHA 4XWKA 1AUPA 3VNBA 2KM1A 1I2CA 1J70A 3C7KA 5NULA 1DO2A 4MW0A 4DC0A 1H4QA 4MUIA 2PGDA 2QSJA 3D0QA 3IESA 4LBWA 2W6CX 4FIDA 4C0XA 3OZSA 4DSTA 5DX8A 4AF7A 2IXEA 3OM9A 3AERB 3E58A 2A6PA 2NQ2C 2H06A 1HT3A 3C3JA 5K4HA 3PUVA 3UYKA 3KYJB 3L1UA 4WUVA 3UPUA 2ADFA 3E22A 1S1CA 5EI5A 1XX6A 4I5FA 3MJDA 1NFFA 5FOVA 3IFSA 1OSNA 1CUVA 4KSBA 3D0OA 5DTJA 2PZ8A 3UJ3X 1LPNA 2DWCA 1VIVA 3OA2A 3IUSA 4GDMA 1ABEA 1Y8AA 2P30A 5GONA 4BKQA 1E9CA 4RZUA 5KSPA 5IWAB 2RE8A 2JVKA 4URUR 1N32B 3RAGA 1NQUA 1EK6A 4M1OA 5IT4A 3GHYA 4S1WA 4YMVA 3PYXA 4O4JA 4R9UC 2B8TA 1TJ3A 1NRWA 1GITA 2ZB4A 3FFWA 4OQYA 1W2GA 3AF4A 3I4CA 5CXSA 3EBOA 2XNSA 5ALPA 4NQZA 4YJ2A 1FB5A 4H7EA 2WUDA 4QVGA 3FCSB 2RGGA 4DANA 5C5IA 5AVRA 5KU7A 1IMOA 3B5IA 4RTPA 2IYTA 2G9QA 4E7PA 2XEDA 4JH0A 2OBXA 3T3DA 3USZA 4YQEA 1MFPA 1NVKA 3ZHSA 3D1LA 2HMVA 4M83A 1CR0A 4I1VA 5CG2A 4HDKB 3B9BA 1XK7A 1T3SA 4UEWA 1YK1A 3OU2A 4BLVA 3AZOA 3H5VA 2QKYA 5AR1A 1SKUA 4A16A 1EJ6A 1W1UA 2MSEB 4Q47A 3GDOA 4P80A 1N7HA 1GRVA 2E4WA 2FWPA 2PPLA 1NVAA 3AR8A 4MS3B 4NCNA 3H7IA 2VH5R 3SC2B 4KQWA 3IILA 1CLEA 5T8KA 4C6TA 1J39A 1JIUA 3OQVA 1ZC4A 4FHEA 3MOGA 2B0JA 4JLDA 3TLYA 5CAEA 2W37A 1VPEA 3O38A 4EHKA 2YNMD 2V9ZA 2Q29A 1Z0ZA 4FYVA 4ZQFA 2VZEA 1C3LA 1O2DA 3C6YA 2REBA 4N49A 1USIA 2EKZA 4LN1A 3UOGA 1YDMA 2G88A 2H92A 4A8PA 5JQGF 1B3RA 1P1BA 2ZJ2A 4I1PA 3R41A 3TPCA 4EF4A 3SKVA 3WLTA 4RK0A 3K0AB 4HCJA 2NW6A 4CTMA 2XQFA 3DF9A 3HU5A 1VE5A 3K8OE 4KVGA 5M5BA 1DO0A 3G9TA 4HAZA 3LGSA 3MGGA 3CPJB 2M6LA 4AJJA 4Z9AA 4KQCA 4D44A 4DM3A 3AKYA 2CV1A 3NTUA 2P6PA 4BNFA 1YC5A 1DJOA 3PUZA 2R86A 5A05A 3DQZA 5A4DA 1A9ZA 2DWUA 3PF8A 4NCXA 4C3VA 3RC3A 3QKUA 2AT1A 3NC0C 1OXUA 4MO9A 3MWLA 3R7WA 1T2VA 2QJTA 5J5CA 1YVDA 3RUCA 4IPTA 5MN4A 1E7SA 1N8NA 3HV0A 1HI9A 2PSFA 4FGZA 4LYAA 5CIWA 4LGYA 3RBXA 3T1NA 3MMSA 1RRGA 4PSKA 3VR5D 3SHTA 1IHXA 2FN7A 3C8MA 3INGA 3ILVA 4P3KA 5FUBA 2XB8A 1Y8QA 3ADOA 1P9LA 4OGKA 4RXMA 4EKEA 4UAJA 1K4KA 1N0WA 2G8NA 1E3QA 2AG5A 4U7PB 4OP3A 4UAUA 521PA 1XSEA 4EFMA 1BW9B 1RP1A 4FB5A 2PAFA 1M3SA 2RI1A 1QHIA 3GLGE 3TTXA 5HR5A 2BKLA 1PZNA 2JAPA 4YPOA 1G21E 3GLHA 3MJHA 4KITB 1JDZA 1XQ1A 2KJQA 3TLGB 3OIVA 2FF7A 3L77A 3UMSA 3SYTA 2ROQA 1AN0A 1QKIA 4CLDA 4MKRA 2FWRA 3LL4A 5KINB 1A8IA 3AW8A 1CT9A 4WBNA 2JATA 1P1KA 2X0JA 2AOVA 4DYVA 3ADDA 5IW8A 2SNIE 4KDRA 2QUIA 8AT1A 2JANA 4GX0A 3TIVA 3IOCA 1ZR4A 1ODKA 1P4HA 4OA8A 3TDMA 3ANLA 4G56A 3RS0A 2QIOA 2SECE 1SKBA 3LY8A 3A1EA 3LBIA 3PJFA 4ARBA 4FFWA 3ED5A 3C6QA 4MMYB 1QBKC 2A67A 1U1DA 3EUWA 1DC4A 5ITSA 1RYBA 3ZK8A 4JJEA 1E7YA 2QZ9A 3DBOB 2G72A 1CQJB 1FJ2A 1XP5A 4QYXA 4ZCMA 3HKCA 5EXDA 4EA9A 2P5YA 3QVKA 4RM2A 4CL8A 1S7GA 1T8RA 2HJSA 1IG3A 3OJCA 1Z5VA 2ODNA 2X9GA 3DUWA 2F3SA 4I4CA 1XWWA 3UPDA 3RUFA 3IBCA 3ZV4A 2CLHB 1R64A 1DTWA 4IHJA 1RYNA 1G5QA 3G9QA 4MS1B 4B7ZA 2R8OA 3L9XA 3R0JA 4RTLA 2V5UA 5K3FB 1Q22A 5ICSA 1EK2A 3AVUA 1KQFA 1VQ1A 5B4TA 5A4IS 2A5JA 5ALOA 4EYEA 2XDQA 4JOQA 3R4CA 3MHPA 3QKWA 1G2PA 5DDIP 2E5FA 3AF6A 1U63A 4OMFG 2CLEB 1GPYA 3LDFA 5IJ0B 4DMMA 3TMKA 3LUPA 4UE3S 2VUHB 4CDMA 3VSEA 3GLIB 4G0WA 3QLEA 2WW8A 2QTAA 3V4ZA 3KTAA 2RSLA 5FBHA 2XUOA 4BNTA 2QHXA 3QNWA 2AI3A 3OG9A 3PFGA 4U9HS 4N54A 4WLEA 4C5AA 2XYVA 3GFSA 3EPRA 4MGKR 1FQKA 1S3SA 4NG5A 3UK2A 4ZCTA 4XQ0A 3N8KA 5LUAA 1P1IA 3E1GA 1L5OA 2X0IA 1Z13A 3ZVKA 1U0GA 2A3NA 2A78A 2IUSA 2GPSA 5AOAA 1TA0A 1VHDA 3HMQA 4YCMA 5BSGA 4JC4A 5IUJC 5CCBA 3COJA 4F56A 1D0IA 5FPQA 4DLTA 4QJ5A 2PZBA 1E4YA 2R65A 2UXCB 3JCZA 1XQXA 1WAMA 4BV9A 4NECA 2Z3ZA 4Y30A 2EBHX 4QBIA 2ZSDA 3NBQA 3N5KA 1AZWA 3AY7A 4GI7A 4XE5A 3LTNC 5JAZA 1NMYA 2PQMA 3DGEC 4ZYUA 4INAA 1S4QA 2ZRDA 2D4AA 3BB3A 4Q1BA 4E31A 5LP6A 3MXTA 3JQBC 4LHVA 4MJ7A 3WE7A 2J87A 3G2KA 1C4XA 2IWRA 5D5HA 5DEIA 4HAYA 4E5KA 2E21A 5B7GA 4LYEA 3I23A 3KEFA 1NBME 1T2EA 2HQ1A 2BDEA 2Z09A 2A86A 1SD5A 3PCTA 2C0CA 3BYZA 3ECAA 3V7FA 3QEBZ 1KQ3A 1OBOA 2VBFA 4LOIA 4LXQA 2BKVA 2NNWB 3BJIC 3HU2A 3OFVA 3OWHA 4L3WA 1WQ1R 2B8EA 2GJ9A 4KOAA 4B3HA 4WN3A 1B76A 1ZNXA 2YXEA 4JIGA 4S1NA 4ALNA 4R1NA 1DB3A 5DGDA 1EJ0A 5BPFA 5KYUB 3UQZA 2PD6A 1HE3A 3CKMA 5IXYA 2N75A 1QO9A 3DH0A 3FZQA 4F38A 4ATNA 2TECE 3SF0A 1WSBA 3QTBA 4DA6A 1XK6A 1ZVQA 3CONA 3QKSA 3NHBA 3HPQA 4QELA 4EVSA 1LQUA 2BI7A 1DAPA 3CVOA 3FOCA 4RJIA 3MJFA 2A5LA 3QVWA 4INOA 4NESA 5ALYA 4N7MA 1SH7A 2HXYA 1YUMA 4I4TA 4EMSA 4HXEB 4EJ6A 3FFAA 3PQCA 4NZPA 2WM9B 4X97A 2AD5A 4M21A 4AJ4A 1RQ7A 3PC8C 2AJBA 3PDCA 3QWIA 4YLGA 1ZH2A 5KMGA 3JVIA 3U7QB 4AJIA 5EPEA 3NQ41 1DJLA 2EW2A 2VHWA 4KIFA 5BY2A 1II8A 4DXHA 2XYPA 1LVUA 3G82C 3OQ6A 1UMKA 4W1PA 1PJRA 5H68A 5HTKA 4AQ7A 2ZULA 5B2FA 4AURA 1JEQB 1P1HA 4YRNA 5IULC 3OF3A 1EK0A 3EZYA 4QBTA 1HZJA 1YD7A 3AKDA 4R2JA 3S7ZA 1JBEA 4HQKA 4ENSA 2RG7A 3DFIA 4TYQA 3DDOA 4RCYA 1YQUA 3ZS9A 3LYAA 4I6GA 3W9SA 3TL6A 5T57A 4DV0B 4Q01A 9LDTA 4B45A 2GJ4A 2QX6A 4KXNA 4D9FA 1KZ4A 5LQCA 4K46A 4US2R 2HHJA 1G8GA 1UFVA 2D5CA 5GVSA 1I30A 4KQFA 1YIAA 4K40A 4QFCA 4RGQA 1CQIB 3IAAA 3RE1A 3FNEA 2I6GA 1K8ZB 4B7XA 2Q5HA 2F64A 1EUYA 2FK8A 2WM8A 3GR6A 1K8YB 1NIPA 2ZJFA 3CSSA 3IIMA 4UTPA 4WLVA 5B3LA 5KTYA 4J0HA 1G0NA 2QV7A 2J1LA 4RWEA 3D3WB 3IP1A 1YWGO 4JP8A 1V3VA 4PYKA 3N5CA 3SIWA 2F59A 4OLHA 3A6LA 1XXHE 2VF8A 5AI0A 4B32A 2Z5VA 1CJVC 3KZNA 4BNWA 4PBSA 2G82A 1Q83A 4G23A 4HB2A 3BSSA 2OBLA 3NRCA 1L4EA 1P4RA 4XVUA 2I4MA 4HL6A 2GR9A 4PNPA 1ADBA 4GT1A 3G0OA 3IKMB 3ZW7A 1MHPA 1BGWA 1K08A 1U7OA 1GU1A 4HWTA 3OEWA 5M04A 2NADA 3NJRA 2XNCA 1AUVA 1N2GA 5EC8A 4ZAZA 1E99A 1BVRA 1X8LA 4OHMA 1J0XO 4N18A 2CDAA 2GMWA 3WMXA 4V1CA 2WK1A 3H3JA 2P41A 4QU8A 4ZZIA 4C6RA 5D3QA 1C7JA 1PF7E 4FEAA 4R1UA 2HLPA 3RC9A 3EFBA 3UA3A 4O29A 3DT6A 2YJ5A 3EVCA 3TJMA 3NH6A 3GFQA 5BW6B 1RLJA 2IS4A 3WGLA 1GCOA 1Z9BA 2YUIA 3PPXA 2WY2D 3B48A 4AP9A 5A5EA 1X1CA 5CK4A 1GRRA 1DV2A 5F1YA 3WLJA 5P8WA 4YMLA 3JYPA 4OF4A 4RV9A 2BCGY 1R0SA 5BSRA 1L5YA 3DOEA 1LPSA 1W47A 3QXSA 2ZUBA 3NPAA 3SXUA 1CHDA 4OQLA 1JDBC 1BMQA 2GLUA 3KBOA 5CA1B 2BEJA 2IXTA 4O5AA 2B83A 4Y9UA 4AIRA 3I2JA 4EF5A 1E0SA 2WWWA 4BAZA 4ZO6A 3BERA 3D43A 3KVOA 1V1MA 3LFHA 4TTTS 4EIWA 1L7AA 3K96A 2J67A 4QTTB 5KTKA 1OH7A 3OLQA 4OFWA 4PCAA 1JP7A 2JJ8A 4AJEA 1V5WA 2F43B 3OQIB 1NVBA 2NZ2A 2CUNA 1WZIA 5I9SA 4WEQA 3PD7A 5E1OA 4GYWA 4Z6KA 4B81A 2EZTA 2H17A 1M5TA 3NM6B 3IJRA 2XGMA 3ROEA 4UE6A 5ESXA 2D3WA 1WXQA 1XZJA 1SU4A 4J0QA 2YW2A 4RJTA 3GVXA 2K7ZA 2FOLA 3GJ8A 3QI7A 3I3OA 3W2GA 4RMNA 4WHMA 3D6FA 4ZK6A 4MHTA 1QRRA 2QAIA 3BA6A 1KZ6A 3H9JA 3U4AA 5TB5A 4G4GA 1XEWY 2D1FA 3MTDA 3IQXA 2HLDA 4KLAA 4MJLA 4IMRA 4BGVA 2O8DB 1DOAA 5I7SA 2X15A 4Q66C 4RADA 1GZ5A 3E0QA 5FT9A 5MGBA 1B0AA 2ZAGA 3WZ2A 4F21A 3U1VA 2PMEA 2HWKA 1UODA 3KXPA 5JUWA 4IHQA 3HR8A 3WNZA 5E4TA 2WWFA 2XOXA 2CZGA 2P91A 3U80A 4BU0A 3R3YA 4AY5A 2VP4A 1S89A 1XB2A 4X66B 1J0BA 2HDOA 2VFAA 1J49A 1B15A 2IQ5A 4IJUA 5DLYA 3UG7A 4F3CA 3P2OA 5EA2A 1CLUA 4S2UA 1NNI1 4AKIA 1WMDA 4UEKA 3AFMA 3KIPA 1CS4C 2R96A 2RMKA 2W2OA 2WIBA 3HDHA 1IAVA 1Z0KA 2AFIA 4IP0A 4TLDA 5DASA 4RZIA 4PM4A 3RJ5A 4QOHA 3EUFA 4RZQA 1TGVA 4XQ9A 3USES 5ED4A 3W1VA 4DDTA 2EL7A 2GH1A 3RT9A 3WWCA 1ADYA 2XT6A 3NWEA 1USVA 2HNKA 2HWWA 2ZXEA 3BWMA 4TV9A 1IJFA 1DBWA 4DGSA 1AO0A 4FMCB 1VMEA 1Q12A 4RD1A 3SC6A 2HQBA 5F1OA 5LQUA 1GGFA 1JILA 3E9QA 3IALA 3LVRE 3CLUC 1V35A 1M72A 1M6HA 2ZS7A 4O1HA 4I4IA 5G0TA 3AESB 3KYDB 3WYAA 1ZONA 1JDSA 2CYAA 4AZSA 2FFHA 1W36D 1K0UA 1Q77A 3JQ8A 3ER8A 1YI1A 3ZDQA 4NK4A 2FPXA 3V46A 2JLWA 2BKAA 4HBGA 2R2GA 4BNDA 2XT9A 2JLUA 5EHQA 3GJXC 3E15A 3H0CA 3FOAA 4KN6A 2YFQA 3WOVA 2FGKA 3NDIA 4NSNA 3FYUB 2NUTA 1IDN1 3QF4A 3S5UA 4DVJA 2CLKB 2O07A 4JP5A 3OAAD 2C84A 4YCJA 2XGJA 5AM1A 2CJYA 3Q3CA 3CIFA 2X3UA 3FNFA 4ZGGA 5JCPA 1F4PA 2RH8A 4CT4B 1ZIDA 1V95A 3WA7A 2Q9AA 2PLNA 2IHZA 1SUSA 1CW2B 5SY4A 1B0ZA 2A4KA 2H57A 1VI6A 1XZCA 4EHBA 3GARA 1NBIA 5EG5A 1W4ZA 2UVPB 3ZV3A 1GO2A 5CGQB 5E1BA 2QRVA 5D84A 1G7TA 1IHPA 1J56A 2QGFA 1JAHA 1W5AA 1ZM9A 1YBFA 1GNLA 2O2XA 3MTJA 5T3UA 1JEDA 1YJ8A 4U2GA 3M2TA 2KX7A 4OI4A 1XYYA 1IEQA 4B6SA 4PNEA 5HF8A 5I7UA 2EX0A 2X5OA 4HGRA 2YS7A 1IEXA 2BEKA 3RSQA 3UCXA 2Z6QA 4FOTA 1N7GA 1I14A 3STYA 1H0HA 4C21A 5JYBA 1EXWA 4N9QA 1FS4A 3PNOA 2ZPTX 2RJ3A 4IS2A 2J9FA 2JA2A 2OG2A 3G79A 4ND1A 3AM3A 2EXXA 2W2LD 1LK5A 3PNQA 5JD6A 2HSGA 1JTEA 2QN8A 2VK8A 2ZUSA 3VHXB 2PGLA 2ZR0A 1MA3A 3A7DA 1Y6JA 3SQXA 1ECCA 3LWBA 4ZCQA 5EKUA 1MKYA 3NIBA 5HCIA 3P2YA 3A6GA 5IG2A 1RRCA 2QR3A 3R6TA 4FYPA 2XOKD 2Z95A 3DV2A 3I04A 3QVTA 1MEJA 4O3FA 1V48A 4XFDA 4YDHB 4CN8A 5CITA 3DW3X 5D87A 2ZVQX 2AV6A 1MG0A 5BXQC 3NDRA 2IHKA 2WIDA 1JXQA 1YZQA 2BZ0A 3VO2A 5ADWA 3ZTTA 1PJQA 2Q5OA 5K0EA 1Q20A 4ZYYA 1SCQA 2M2IA 4GNRA 1IYZA 1VG1A 2VNSA 2O7NA 3PJDA 5AKXA 4P4TA 4DSAA 4JDPA 4C4TA 4I1SA 1CRZA 5JS2A 2AOWA 5LM3A 1TTTA 2Y4NA 2C2BA 1ZA2A 1SNYA 4XTCS 1VPDA 1XZ8A 3WLRA 3HJTA 3AXTA 4RA9B 2PJRA 4I9GA 3T5DA 1D2CA 4M54A 1NAIA 3R7FA 5KBYA 2J3LA 3SM3A 1F5NA 4IIGA 3K1AA 5ALDA 1BC5A 4WDQA 2GEFA 3IURA 2A58A 3LT1A 3UMCA 5BMVA 1GAWA 4Q9HA 1EIWA 3QBVA 4BO1A 2AUNA 4GXTA 5LQKA 1OAKA 2BGRA 3CVJA 3MWFA 4QRDA 1JIIA 4WXHA 1KZGB 2BI8A 2RIRA 2ONCA 4QTXA 4C30A 2O9JA 3ZUPA 4MWSA 3CSUA 8GPBA 3OCUA 1VG8A 3L8EA 1VA5A 2C07A 3ZGLA 1CF9A 4N9WA 1VKRA 1DBIA 1K5PA 2HA5A 4XSGA 5JNSA 2WYOA 5E8JA 5CVTA 1W73A 4L9SA 5F3DA 3RBZA 2Y66A 3GYBA 4EO9A 2FG7C 5COBA 2WG0A 1YRBA 1QZUA 3AYXB 1XROA 1EHYA 2VDLB 1KJJA 4GZLA 4HQ0A 4P35A 5CCEA 4XQGA 1XCBA 1NVMB 1OV6A 1XLTC 3GELA 1HE5A 2CFIA 3KV1A 3LY7A 3M1IA 3NV7A 3QBDA 5AM4A 3C7AA 2X23A 3G23A 4HUTA 1KXZA 3C1OA 3QUAA 3ANSA 4PZPA 5A4KA 1Q15A 1M2KA 2Z2YA 3PE6A 1ZVMA 3CJRA 4KPGA 1OFUX 4P4UA 1NU8A 1U7DA 4MA5A 4HTFB 1A5AB 1AZSC 4OL0A 4XTRA 1PR1A 4Y18A 4H1TA 2Z8YA 4YGXB 2A2ZA 5ALXA 2VJBA 4I6JA 4HZGA 3T94A 3OBIA 1RW4A 3GFRA 4FUQA 4FHFA 3WTBA 1TPZA 1ISSA 4PHCA 3OTIA 5B7NA 3JARB 2AOUA 1KSJA 1R9MA 1UPXA 2JIQA 1GTJ1 4DMLA 1NVDA 3NVDA 1RWPA 4YT8A 2VZ9A 3TIXB 5H4GA 1T35A 2QL6A 1X38A 1I7SB 3N8HA 3CLVA 3LRXA 3PQ3A 3ZTWA 3QMVA 5AJZA 1SUBA 5GM2A 3RAJA 3ZHVA 5KUTA 1JAIA 5I51A 3E7PA 1C1XA 3RJMA 2OWEA 2WVJA 4PLZA 4H77A 4WCFA 2ZSJA 2O8FB 1NUPA 1TYCA 1IZ7A 3FUWA 3MYYA 3OE7D 4Q0MA 2HBRA 4N47A 4EJSA 3BXOA 3DMNA 5BQ3A 3IQEA 1OLUA 1PP4A 5B30A 2V74B 3DLHA 1MIHA 4D9CA 1SVNA 3GFTA 1J1ZA 5TEVA 4B44A 5LYJF 1SJ9A 3EB9A 2WWRA 2A1UA 1EUCA 3CINA 3JQ9C 3C3CA 2KSQA 4OVKA 4CR6A 1UXJA 3B2EA 1TVEA 3KB1A 3RS8A 2DBZA 3L8YA 2IGTA 2QB5A 4RA6B 4MGHA 3GJTA 3GD5A 4C22A 5K8LA 4D6XA 1TRHA 1ZHOA 4R8LA 5IARA 3LQYA 3WA6A 5HOQA 3DBRB 3UGQA 4LRTB 1N2ZA 2VPYA 1M2OA 2Y9MB 4JC8A 1F2DA 2J5QA 2GKSA 1AMNA 1VRVA 3RVOA 4CJXA 1GGMA 2Z1MA 2V3VA 3SZOA 2FEWB 1Q7GA 2VSXA 4UEQA 4P38A 3ICEA 5JI3E 4ZXPA 5EEGA 1WDWB 1FSSA 3HK2A 2GBCA 5F4ZA 2DF8A 1V6AA 2IDJA 4LXHA 3ZS8A 2TYSB 2NO7A 4Z9BA 5JZOA 2BEVA 4NP6A 1H85A 3FLBA 1IRXA 3OO1A 5CT5A 4GZ5A 5FNVB 3SVZA 1QFJA 4GSLA 5JBNA 2FZVA 3PA8A 2G76A 2JCVA 1JSLA 1VRWA 4HLCA 4KWEA 4F7DA 4UOQA 5E7QA 4ZARA 3RFCA 3OKCA 2TRSB 1E6KA 3II6X 3LD9A 1KZ9A 3BXZA 2GHRA 5ILGA 4ZIRA 1P5JA 3NP9A 1YR1A 4JQYA 4OREX 5E1MA 5EQTA 2ZR9A 2P9FA 3U13A 3O9ZA 3LGXA 1V6SA 1EDDA 4HPWA 3V1TC 2NTEA 4GRIA 4QU5A 4PNHA 4BOYA 2BMAA 5BVGA 3H1AA 1H2RS 1KEVA 4H15A 3THXB 2F8SA 1CY7A 1AKRA 1DXYA 1P17A 3L49A 5B7QA 1M2WA 4QREA 3V1UA 2O7RA 5EUCA 3FSGA 1I33A 1C7IA 1U8XX 1UBFA 2H3HA 4KBFA 1OZFA 4E5UA 6LDHA 3THYA 4DV7B 4CV1A 3SNHA 3GLFE 3VHRA 2XTJA 4C89A 5DNYB 1ZOLA 4FFMA 3GBVA 1BX1A 3TAHA 2XZLA 2Y8EA 5F2EA 3WBKA 3WGOA 1Z15A 3WRWA 1N9GA 4BVBA 5FHRA 1M2FA 2IW1A 2C7OA 5C34B 3GA0A 4PFQA 2OHHA 2QM8A 4MP6A 4A2PA 2QVGA 1ZAKA 5T6MA 4X3CA 2PKRA 3JQFC 3IAM6 1DEKA 2H8KA 1U80A 3OEHA 2DAPA 5FUYA 3L7NA 1KY3A 2Q3DA 2DR2A 1C9KA 4MI6A 5EIFA 3MZ0A 4Q7MB 1RKBA 3DUFA 1SBQA 2DWPA 3WDSA 2P67A 4F2PA 3P9KA 5T7BA 2C7BA 3NHYA 2A9RA 2O0HA 5DYIA 5F76A 2FQ1A 2PS0A 2VHTA 4XI9A 1K3FA 3UK6A 1ZMBA 5F23A 4Q1DA 3EWAA 3OZCA 4BUZA 4O63O 3ZCTA 2MU1A 1NOJA 4D56A 5IJ9B 3HB9A 3CZ9A 2NO9A 4NU8X 3ZHTA 3ETLA 4HNAB 3IVAA 2O8CA 1S01A 3QMWA 2Q3FA 2QD5A 2K6GA 2WZCA 1RE0A 3K72B 1PYDA 3OZUA 5GPBA 2WB2A 3D2AA 4H31A 4OGWA 3JATA 2HX1A 3OFKA 3OURA 3QM1A 4JKYA 4OG2A 1P5RA 1ZR2A 3NT4A 1TAUA 3D1VA 1GP2A 4M9CA 4EKIA 4D0LB 4Q4AB 1Y1RA 2IKSA 4CL3A 1HA3A 5KTNA 1J8DA 4PRZA 3NTOA 2VQ6A 1L4FA 1F5SA 5YASA 1Z7BA 4BLUA 2YJZA 3I2IA 2JDIA 1G2QA 3WWYA 4O2BA 4EUFA 2UYGA 2WVHA 3FBWA 4MHSA 5ALNA 5EN4A 1G6KA 3EX7C 2EOAA 4KVZA 5DN6D 1ES9A 4Q7JB 3ZX5A 3TMAA 2EATA 1G291 10MHA 2BT4A 4JB3A 5T5QA 1YR7A 1SVSA 1QQTA 3SXPA 3A32A 2HXGA 5HKKD 3PFBA 4FPXA 1H5UA 4HGYA 5AW7A 3R3WA 2F8MA 3I5MA 4Z1OA 4EQ6A 5KYXB 2XKAA 1ZUD1 5K8VA 3BL6A 3PXBA 4FX5A 4XIJA 3ABQB 3M5PA 2QAGB 2MTBA 1XYGA 4LYFA 2G9UA 4XVRA 2Q2OA 3LUGA 4C76A 3CLRC 3GBPA 4LV6A 5B57C 5GOZA 2PSEA 3ZW9A 4F12A 2DX7A 1UEIA 3BFXA 2QTVB 3BGVA 1QK4A 3FMOB 2IBTA 3P0JA 3ZWYA 1UJMA 4HDAA 4P86A 2K7FA 2J41A 4R1PA 2PT9A 2FX2A 3IUJA 4W6QA 1QRUA 2F3QA 2CXNA 4CN9A 4YBZA 3OJFA 3EA0A 3ZDZB 1RRKA 3ENZA 1A5TA 2V6BA 3ZN2A 3KAQA 4IJ5A 1KYQA 4RPLA 5H5JA 1M6WA 2AQIA 3NXSA 3ITNA 1EESA 4CNQA 1CZHA 2C5FA 2ONZA 3ORYA 4WFJA 2F8LA 4TS4A 1IH8A 5KSYA 1ZQ9A 1C8BA 3VX3A 1CKEA 2AKAB 4DCTA 2PV0A 1GR1A 1BXRB 1XEXA 3MPOA 1RZRA 4A36A 3ZCPA 1X7YB 3LCMA 1NW7A 5H3HA 5K3DA 4RPCA 3D59A 1CTQA 1NYTA 1RLMA 2GEDA 2ZGVA 2R68A 3D9QX 1V71A 3CNNA 4U6SA 4XR4A 3F98A 3Q7PA 4L74A 4YCAA 4ZCLA 5HDQA 3R74A 2P7IA 1IY9A 3MPUA 2JFUA 2PA0A 4X3OA 2VP0A 1HORA 2ZRPA 4J4BA 2K2WA 1JLLB 1WA5A 4JOCA 3UUFA 2VQ3A 1O6GA 4IWNA 2CWWA 1H3FA 5LU8A 1U3UA 3H9CA 2XCQA 3I0NA 2HHAA 2KMLA 1R8JA 2FEKA 5ENVA 2WWHA 1GNTA 2XRYA 1PTJA 1F0NA 2RI6A 3EIHA 1G17A 3F5SA 2Y93A 3DAOA 2O1EA 1RYMA 2PE5A 5K3SA 1NR7A 4MYHA 2FUG1 4YAEA 4HQNA 5I9IA 1ORTA 1Z0UA 1EUDB 3ILXA 1QIKA 1ECLA 2FZKA 2QDXA 3L8MA 1PR5A 1U3CA 1KDZA 3Q6MA 2BN4A 2D5BA 4K9KA 2KB0A 3CH4B 4ACAA 4J4TA 3MD0A 5SYAA 3EGDB 4NZOA 2PUTA 3Q5GA 3GUVA 1T3TA 1R6XA 4G89A 2LRHA 2A0FA 3AL2A 3UAVA 3UZUA 3KKNA 4YX9A 4PAGA 3R09A 5CFRA 4KODA 2A9PA 5C32A 1FMCA 3ZDAA 1YCDA 2ZSEA 1W25A 3N7AA 3GRKA 1WABA 3I2FA 2Q7XA 5JSUA 3QNMA 4OQPA 1G8HA 2JZCA 2XI4A 2ZRKA 1ZVJA 2ZBDA 3UBMA 1C1HA 4D45A 5IRCD 4J7AA 1WSAA 1DRWA 4U39A 5FBQB 7AT1A 2YDYA 2XF2A 4RQBA 1UOQA 1OXKB 3DPIA 1KPGA 2FFQA 1W8IA 2G8LA 1Y9ZA 2OV2A 1OROA 3FAKA 3QWHA 1TDJA 1KAMA 1XN1A 2HYDA 3PCXA 4H7IA 4Q3EA 5DTEA 3EPJA 1ZNWA 2IDKA 3TXYA 1DHTA 2ZJ4A 4DA7A 5AKIA 1GSIA 2QG4A 1OT5A 4TQAA 2PANA 3TMYA 1ESEA 2BFMA 2C5SA 3W4KA 3KQKA 4LJLA 5CLJA 3GQBB 3L7JA 4ARZA 4WZZA 5K0GA 1JA1A 2GRAA 4R98A 3RT1A 4EFDA 1DRJA 3BT7A 3TFWA 1NI4A 4W5JA 3RVBA 3K7EA 1YZ3A 2YBEA 4MRMB 3GBSA 2MYNA 1U8AA 1PYOA 4ON9A 4KBYA 3CUTA 1CIJA 1YE5A 4TS9A 5AHKA 1NDUA 1V11B 2I8CA 2P6OA 3EWSA 1RMYA 2YNMA 4HX2A 4RVGA 3W8DA 3WGGA 1NBAA 2QT1A 3VU3A 2X41A 4CQMB 1EKXA 4X0EA 4MARA 4IIJA 3OECA 2X8WA 4BVKA 4ZOLA 3QP9A 1XZEA 4HNHA 4KFRA 2QTCA 1L4MA 3KLMX 3ZY4A 1C7ZA 5BORA 3L0ZA 5DMHA 5GZ3A 1MO4A 1A95A 1Y6ZA 4YK7A 3CUKA 3CVUA 4XCXA 2O2CA 5FLEX 2HO4A 3TE7A 1U8UA 2VVTA 1GRNA 1YOVA 3BGSA 3S8MA 1Z4LA 2FG5A 3JQDA 3U49A 5AESA 5CX1A 2B37A 2D5IA 1MQSA 1PFUA 2F1OA 3O21A 5JEDA 1Z17A 5ERGB 4KK4A 2C3MA 2LDBA 3V80A 1CNEA 4TXLA 4CMKA 4MHOA 4G5GA 1YB6A 3C5HA 4FE4A 3DJFA 5DYGA 4DMKA 3E7WA 4CMIA 4CYMA 4ER7A 4MUMA 4YAFA 4D9GA 3AEXA 5CB4A 5JAPA 3ORFA 1KJNA 1X19A 1ODCA 2IP1A 3A05A 1QRAA 1GZ4A 2D7DA 1ZBQA 4E09A 5DI3B 2D5LA 1N3IA 1DBSA 2GVDC 5CM9C 5G4LA 5EMJA 1MH9A 3X1YA 1RIFA 2HC9A 5BN4A 5KKCA 2PHZA 1A97A 2Z5LA 2FPOA 1E20A 1GYPA 3H11A 4Z9YA 3SR3A 5AW8A 4Y1GA 5DCLA 5EFOA 3VR5A 3NNNA 3W6PA 4F11A 3E82A 2FHSA 1CG6A 2PH7A 1CR1A 3WGVA 4WEOA 5LMZA 4JWTA 4MULA 2AZ4A 5KDLA 3ICQB 2RHMA 1F8XA 3NYQA 1NXVA 2N1BA 2O52A 1U04A 1O8BA 4GKAA 3RR2A 3MILA 1JTVA 4I1IA 1O4WA 4K6OA 2DHEA 2OA0A 4DREA 1DT3A 3AUYA 3T7EA 1EFDN 1GUAA 1UR5A 1KBZA 3DXYA 4JSRA 4DQXA 2RHOA 1N6LA 2O06A 3C43A 5I9TA 2PUGA 1GGKA 3GXBA 5DK4A 2PL5A 1WVGA 1I1HA 2WT4A 2PMDA 2Y1LA 3I83A 3LQKA 1QOZA 3PQ5A 4KE9A 1O94D 2WV7A 5K0NA 3SY8A 5BWBA 1NUSA 1SXJB 1C2YA 1XNGA 1SQ5A 2COUA 2E5WA 2SKEA 5BW8A 1DKPA 4DR6B 3DZGA 2H7XA 3OX4A 1GNQA 2Y1DA 1M0WA 4LY9A 1UWCA 1W76A 1TA9A 1L5RA 1UADA 2HM7A 3BE6A 4GC5A 4H7PA 4HGOA 4JASB 1ZM2A 3W7BA 1Z82A 1NQAO 2B6NA 2YZGA 2GBPA 3VHLB 1ZI8A 3A9VA 3CX6A 3SSNA 4OXIA 2IEYA 4GOOD 3V4SA 4RIGA 4DIFA 2C57A 3IOBA 4NEHB 4QQNA 4MR9B 3V8QA 3WWZA 2G40A 2ZQZA 3JD2A 4FMBB 4RLFA 1U0OC 3ELUA 4NJMA 1T0BA 5ADHA 5H02A 1ZD5A 4PZAA 3PCRB 1U6IA 3HTXA 3Q3GE 2PD4A 4QOGA 1GDDA 3R24A 1B8UA 1M1NA 1ZKDA 3IKJA 3U6BA 3L1HA 3PENA 1TIBA 4OSOA 4BJ6A 4P3YA 1X0VA 1OYOA 2V45A 3DVAB 1F8FA 2B7LA 1XTIA 4IH1A 5FF9A 5BNFA 4ZT2A 2I76A 1JJVA 2C4NA 4BMXA 1KRHA 2HREA 2JL1A 3I2YX 3UTCA 3PB3A 1SY7A 3BJMA 3E2IA 1DCMA 5CPBA 4LY0A 1SUPA 2QMHA 2WYWA 3GUYA 4KKXB 3JAMA 2YWGA 5TMBA 1RBYA 4ND8A 1T9DA 3S4YA 2CXHA 4XH9B 1NZJA 4W8OA 4BJ3A 1JHXA 2VZ8A 3I9MA 4WKOA 4K86A 1VG9B 3M5DA 3F49S 5IH3A 4FM9A 3IMKA 2XF8A 1X92A 1NN0A 3EJWA 3F46A 4UMDA 4WFIA 4KU4A 4BQIA 1E0AA 4L27A 3L0IB 1KJ8A 1Z83A 2REQA 3NB0A 4GPZA 3WLNA 3X1WA 4BRWA 1OFUA 1SBCA 2GOYA 3K9GA 1GZUA 1E2MA 1A9RA 2QRKA 3BRWD 4OKIA 3QQ5A 1GCGA 3P2IA 4NULA 4F72A 3NPMA 3C6ZA 2O20A 2X0NA 3E3OA 1FSFA 3FPCA 4OXRA 1AGXA 3ASYA 4GSYA 1XUOA 2VNAA 2O2IA 4XUCA 4K3UA 2Y27A 5TXGA 4UNRA 4JA0A 1OAOA 6CHYA 1E0DA 1PFWA 5C52B 5ARCA 5I8PA 1XV5A 1G6OA 4GWGA 2E1PA 3VRHA 2HBZA 2RC5A 5TMDA 2BTQA 4XDHA 1UKZA 2GT1A 2V8OA 2ZTMA 3BXGA 3USCS 4KAJA 4RYDA 5BV8A 3GLVA 4OI1A 4CEJA 3OM1A 5LWHA 3LGAA 3SWWA 3QA3E 4JR0A 2JGAA 5HM6A 1P8AA 1ADGA 1N6KA 2QEQA 3C4QA 4M1EA 4AG3A 1CZOA 5JWHA 4RJKA 4A5SA 1MU0A 1ISJA 4PC2A 2XMSA 1E64A