4IMJB

Novel modifications on c-terminal domain of rna polymerase ii can fine-tune the phosphatase activity of ssu72
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
192
structure length
190
Chain Sequence
PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Symplekin
publication title Novel Modifications on C-terminal Domain of RNA Polymerase II Can Fine-tune the Phosphatase Activity of Ssu72.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 71
structure length 190
sequence length 192
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4imjB01
1USKA 3BBLA 1OXKB 4EVQA 5ABPA 4Z9BA 2FQWA 1BAPA 1DBPA 2KYRA 4MS1A 5EWLB 4EGSA 3KLNA 1XHEA 4OG2A 4W5OA 3HVRA 2WMYA 4RY0A 4RU1A 3C3KA 4IRXA 2A9OA 3BRSA 2FXIA 1NY5A 3OMWA 1LK0A 5IX8A 5T3YA 4EY3A 5T7BA 3K4HA 3GYBA 4F06A 1NXTA 2L17A 1DC8A 4P1ZA 3UUGA 2FEWB 1WETA 4XXHA 1HEYA 4Z4EA 5FWYA 3T8YA 1JYFA 1D1PA 1UDRA 2N9UA 4RKQA 5TQJA 3Q9SA 3DLBA 4KREA 3KSMA 5TE9A 2PUGA 3G1WA 3HSYA 3EAFA 2FQXA 2CD7A 1JLKA 1ZHHA 3EQZA 3OM0A 2E4YA 4LE0A 4KQ9A 4RXTA 4JA2A 2IPAB 4ETNA 3NHMA 4RWEA 3JPYA 1AB5A 1D4ZA 1USIA 3H5TA 2ID9A 3CFYA 4OTZA 1DCFA 1P2FA 1Z13A 1QP0A 2PL1A 5TPWA 4W5TA 2AYZA 3O75A 1Z26A 4F8JA 3QLVA 3LTEA 4YR7A 1MB3A 3N8IA 5FBHA 1SXHA 2FKAA 3CKMA 3Q7RA 5JS2A 3RVKA 3OM1A 4KNYA 3DGFC 1SXGA 1U2QA 1BDHA 1NATA 3JS5A 3EULA 1RXEA 1MAVA 2JVJA 3HZHA 3H75A 3QLUC 3TX6A 1JF8A 2QV0A 3LKBA 5IUJC 3RVJA 3LMKA 3NBMA 1YMUA 2PLNA 3QX8A 4N0PA 1P6QA 1SRRA 3S99A 2PUDA 5FWXB 2VYCA 4MGEA 5KQGA 4D6XA 1VKRA 3T6KA 4XLTA 1ABFA 4IILA 1MIHA 3GT7A 3LUCA 5E3JA 1USGA 5DCLA 4KVFA 2P4UA 1FFSA 5JNUA 3KHTA 4YRZA 2OENG 2WB4A 2LIVA 4GNRA 4KPYA 1Y1LA 1DCKA 4RK4A 4N47A 4MRMA 1RXIA 3CZ5A 4H60A 4EYGA 4Q7EA 3C3MA 3C3WA 2TMYA 5HM6A 4XFKA 1YMVA 4MR7B 4MYRA 1IIBA 4NCAA 1U0SY 3KYIB 1A2OA 3Q15C 1QQBA 3M9WA 1KGSA 2LBPA 1I3CA 4S05A 2NUBA 3NHZA 4LRQA 4WXMA 3TO5A 1QPZA 3N0WA 4IGAA 4OLAA 1M2FA 4MR8A 2A9PA 4MPTA 4YP9A 1U04A 3RVQA 4IMJB 5IC5A 3IP7A 4RK6A 2DRIA 5PNTA 4NCBA 2QU7A 3QK7A 4WUTA 1T34A 1URPA 2GI4A 3BILA 5TPZA 5FBKA 2MSLA 3OLZA 1Z12A 4RK0A 4EYKA 4PICA 1A0OA 1QO0D 4W5RA 2PUFA 4Z4FA 4G0ZA 3H5OA 4RXUA 5JNWA 3O2SB 4MLDA 3VNAA 6CHYA 2E4VA 3O2JA 5TQ0B 1QO0A 4MR7A 2JCGA 5IUNC 1SXIA 3HK2A 1C4WA 1P6UA 4Z4IA 4LZLA 1DG9A 5GOTA 4MS1B 1TLFA 4O1HA 3TMYA 4JP1A 2H0AA 3EJWA 1DBQA 1DP4A 4N03A 4PYRA 4N76A 4N41A 1J56A 1MVOA 3KYJB 3N53A 4TMYA 2QXYA 4RXMA 3CTPA 4RSMA 1YS6A 4MQFB 2E4ZA 3OLYA 2NT4A 2F8TA 3QELA 2QVCA 3T95A 1DCMA 5FWYB 1Z17A 3A0RB 4MS4B 3MYYA 4WXEA 5C5EA 1DRKA 2LP4Y 4G97A 4KK3A 1YK0A 3E61A 1JFTA 1BDJA 3TD9A 1YS7A 4LDAA 1GCGA 3BREA 1JFSA 2ZWMA 3LUHA 4WZZA 3HS3A 1JH9A 4EVSA 4G0XA 1EWKA 4RK5A 4HYEA 3OQMA 1ABEA 1M2EA 2QZJA 3SG0A 2PUCA 4LE2A 3L6UA 4YGXB 1APBA 1TMYA 2QR3A 1W25A 3MF4A 4FB4A 5ED4A 2R48A 1CYEA 5TPWB 1ISRA 3N6VA 3I09A 3RVNA 1TM2A 3HV2A 4QYWA 3KS9A 1DZ3A 2JRLA 3R0JA 4MQFA 4YS6A 3ILYA 3I42A 1JHZA 3QX9A 4MS4A 2O20A 1SD5A 3IP9A 3GV0A 3GBVA 3EQ2A 2PKXA 1D2AA 1W9HA 2B4AA 4KK4A 2FSPA 5DKFA 5JNRA 2QW1A 4JB2A 3OLXA 1TJYA 4DN6A 3T38A 4ZMSA 5BRAA 3H1EA 2GX6A 5CHYA 3FFWA 3O21A 2I6FA 1DC7A 4YO7A 1QQAA 5IBQA 3F6CA 1L5ZA 3I45A 4RS3A 3KCNA 4QYMA 3RQIA 2LPMA 4YCSA 3QLUA 3Q41A 2MSWA 2VUIB 1D5WA 4Q6BA 4GPAA 1ZH2A 3UK0A 3DZDA 5IEJA 4NQRA 3D02A 4MRMB 4RY8A 1JDNA 1ZITA 1BVHA 3F6PA 3OQOA 1M5UA 1PEAA 1NTRA 4RKRA 2WJAA 3RVPA 4DADA 5IULC 4EYOA 2L18A 2F8SA 4D6YA 3EGCA 4JASB 3SAJA 8ABPA 1YK1A 3H6HA 4MR8B 5EWMA 3GWGA 5BR1A 4ETIA 4ZPJA 5C5CA 1DRJA 2FN9A 1LBHA 1E2BA 1FFWA 5KQLA 4O1IA 2R4QA 2MSKA 1LJUA 2P9HA 3HUTA 2FW0A 4O5AA 1PHRA 5TQ2A 2FLWA 1LJLA 2WWVD 4F11A 1BA2A 4MLCA 4RV5A 2R25B 2VUHB 2GKGA 2M1ZA 2L2QA 5F64A 2FTKE 2FMFA 4NICA 5HQJA 3OLWA 5HKOA 3HEBA 4KRFA 4MR9A 4QPJC 3ROTA 4EVRA 1NXOA 1MB0A 4G0PA 5TPZD 2NT3A 1B00A 1EWTA 1E6LA 2CHFA 5CNMA 3E3MA 2PJUA 2PAFA 3B2NA 2AYXA 4KZKA 4JAVC 2PL9A 3QELB 3FFTA 5IEBA 1CHNA 4UHJA 5JS1A 3QEMA 4YLEA 5KI6A 3QLTA 2PMCA 2E4UA 5CNKA 4Z99A 1AB6A 1JWLA 1YTUA 1GUDA 4G0QA 1QKKA 2ID7A 4G0OA 3HM9A 3FGZA 2IYNA 4Z0NA 4W5QA 2JBAB 1NXSA 3VNBA 5JNVA 1ZY2A 1U8TA 2WRZA 3RVSA 4MQEA 3BRQA 4RK1A 3RVRA 1XWWA 5KC9A 2MYUA 1JFVA 2GBPA 1C0EA 1QMPA 3HXMA 5GQSA 1EWVA 2FEPA 1XHFA 3LUFA 5DGCA 3N0XA 3H1GA 3ROFA 4TN5A 1Z18A 2YHAA 1PEYA 2XDYA 4DQDA 3H5IA 1ZAYA 3F73A 4Q6WA 4P98A 4RDCA 1KRWA 1ZGZA 5CNIA 2LUOA 2V0NA 3HO1A 1VRVA 2VK2A 4HNSA 3JVDA 2HJ9A 2IPMA 2ZAYA 4G0YA 1DJMA 5DTEA 3H6GA 3O2QB 2JBAA 3FDFA 2E4XA 4XARA 3RVLA 1PUXA 5B3JC 3GBPA 1LBIA 3IPAA 4B09A 4LDZA 4MAAA 3HDGA 3LUJA 4ML3A 3URMA 3OLVA 4RZSA 3GA5A 3CLKA 4E7OA 5KQMA 2PUAA 1YIOA 3EDCA 4LX8A 3TB6A 1TVMA 3JVIA 2L19A 4G0MA 5EWJB 1VPWA 3L49A 3IP5A 3Q7TA 3SY8A 2J48A 2MYTA 1Z15A 4XASA 2B1JA 4L4UA 4NV3A 1L5YA 4QICA 2FN8A 3OO1A 1FFGA 1F4VA 3MMNA 2PE5A 3CRNA 3SM9A 2WY2D 4TLLB 2WJWA 3LUDA 5KC8A 3CG4A 3C6QA 5BQ3A 4Z4HA 3CNBA 3P9YA 1A04A 3O1IC 5KQPA 5D2CA 2FEKA 3DLHA 1ZESA 5EWMB 2IPLA 2CHEA 2HQOA 3FMVA 2OQRA 4IF4A 3O1HB 1K68A 1KRXA 2NZVG 3CU5A 4ZMRA 3CZCA 1ZH4A 3LKVA 1E6MA 3CG0A 5EWJA 4E7PA 4ZJPA 2HSGA 2JVKA 3FFXA 4FE7A 1H9CA 5BRJA 4PZ0A 3CS3A 3LOPA 5TQ2B 2RGYA 4EUKA 3KLOA 1QNLA 1QP4A 3NNDA 1F51E 5EWLA 3A0UA 3KKEA 3A3KA 3JTEA 3N75A 4RK7A 1RPJA 2FMIA 3KTOA 3LUAA 4MR9B 2H3HA 2IOYA 3ILHA 2E4WA 2PUBA 7ABPA 3KJXA 2JVIA 1RNLA 4ETMA 3LUGA 4Z4CA 2RJNA 4JB0A 1Z16A 2HQBA 3OO0A 4F3TA 3UKJA 2M98A 2RJOA 3CHYA 3QLVC 1FQWA 4L85A 2W42A 2QVGA 4KMRA 3IPCA 1EHCA 3W9SA 2RDMA 2JK1A 3QEMB 3C97A 4FE4A 1K66A 3O1JC 3D8UA 3F7NA 1PNTA 5CNJA 3IDOA 4KQCA 3SQNA 3QEKA 4OATA 4WT7A 6ABPA 3RH0A 1RZRD 1D1QA 3NNNA 3EODA 3RVMA 4Z4GA 2R47A 4TLMB 2IKSA 4HNRA 3MQ4A 4UHKA 1RZRA 1P8AA 4YWHA 1ZVVA 4MQEB 2BGGA 5HSGA 1DBWA 1NXPA 1NXVA 1JDPA 3N0RA 1Z2EA 4M88A 1EAYA 4D74A 3H1FA 1PNRA 4F12A 3O74A 3MIZA 3Q7SA 3HUUA 3DBIA 1GCAA 3OQNA 1GUBA 1ZDMA 5FWXA 4G86A 2FMHA 2IDMA 1EFAA 1JBEA 2CWDA 2HPHA 3H5WA 4Y9TA 3JY6A 3LUKA 2A9QA 3M9XA 3G85A 3JPWA 1GLGA 2FQYA 4CBVA 2QSJA 4HNQA 3MA0A 1M5TA 2HQRA 1ZN2A 4MS3B 4N0QA 5JNSA 3RVOA 1NXWA 4H3KB 3OMXA 2A9RA 2FLKA 1E6KA 2Q5CA 4IMIB 2FMKA 5JNTA 1CEYA 2IPNA 3H5VA 3KG2A 5KWSA 1JL3A 2YHBA 3IP6A 4RY9A 4S04A 3M6MD 5B3JA 2GWRA 3A10A 3GL9A 4PEVA 4YV7A 2FVYA 2NZUG 4ZYLA 1Z2DA 3HCWA 4PE5B 3MM4A 1JYEA 1QP7A 5DLEA 4OBBA 1FSPA 4Z9AA 4KFCA 2PUEA 3GRCA 1ZGGA 3K9CA 3I5AA 4JOQA 3HJFA 4WWHA 1YVUA 1JX6A 3LFTA 3SNKA 1ISSA 1Z25A 1R8JA 2MYNA 3H5LA 3NNSA 1S8NA 1BDIA 5IUKC 1OXBB 4MS3A 2JB9A 2MYPA 4XAQA 4W5NA 1NXXA 4KV7A 3DGEC 1U2PA 2X7XA 5I4CA 1KMIY 4LE1A 3HDVA 4H3HB 5TQ0A 9ABPA 4EYQA 1VLZA 4OLBA
chains in the Genus database with same CATH superfamily
2YFKA 3HKCA 4V02A 4BZXA 3QKIA 4UBOA 4MS1A 1DXQA 1QFJA 1THMA 1IN4A 3RHZA 2BM0A 1YJBA 1L5KA 4PLPA 3AF6A 3QUCA 3LRXA 2EFYA 1M2OB 2BUBA 3BMQB 4JOBA 3BTVA 4LNAA 2Z3WA 4X1KA 3WBKA 2CL6X 1RCTE 1E61A 1B8OA 1J9ZA 2P68A 1NF8A 3AY3A 2L17A 4MWCA 3CH7A 3OTWA 5HF5A 2I4RA 3PGLA 5BURA 1XRJA 4TL7A 4MWTA 1TM4E 5I7UA 3OZWA 3MWFA 1L5SA 1O2DA 4NSNA 4QTTB 4BRWA 3Q9SA 4TMVA 1KPIA 5TE9A 5EOVA 1CEQA 3IBYA 3EQZA 2RARA 3SIRA 3KZCA 3FBGA 1TA4A 3AJ8A 2ZBEA 3ESQA 3B5IA 2ERCA 3DD5A 4KKVA 5GY7A 1P4AA 1TJ5A 2C4NA 2HDHA 4DQVA 3QV2A 2VYVA 3K6SB 3NYQA 4TLCA 4A0GA 4MQLA 1EBFA 1JILA 2HIGA 3ZS8A 3EGDB 4OTZA 4CG0A 3NHYA 1J20A 2HDNB 3M4XA 3NS7A 2O1WA 4D4JA 5IPFA 4W5TA 2ORYA 1SC6A 1Z26A 1KEVA 4JMPA 5DSXA 3FHTA 3U09A 1R64A 4IDHA 4OQZA 4NZYA 4PRZA 1JMYA 3V2GA 2PG3A 3LP8A 4QHTA 3CRZA 3QNWA 4C5CA 1W4AA 4R41A 2DSNA 2QQGA 3T4UA 1X19A 5E6UA 3A1VA 1Q1NA 2B37A 3H65A 5CVVA 3TX6A 5DP1A 1DQNA 4HVLA 3TD2A 3BIOA 4GSKA 5K8CA 1C1XA 4JENA 1W5AA 4X63A 3JQ7B 2O52A 3WHPA 3M0EA 1JDJA 1WXDA 4M86A 1GZ3A 2PV7A 3H1PA 3B1ZA 4NYJQ 4QKQA 1L0BA 4XLTA 4KFSA 1SELA 4LRWA 1BO6A 2GBGA 2Y1OA 2AJ8A 3FMFA 3LXUX 5EXSA 4LGCA 1USGA 4Y0AA 3COSA 4BATA 3U44B 4FUQA 5FA8A 5JRDS 4CEHA 1MAWA 2WLTA 3HDTA 1PI3A 4JLPA 4KPYA 3A3PA 2W6JD 1SO8A 4HLCA 5I7EA 4TRJA 1VCNA 3FOBA 5GPBA 5KJ6A 4EYGA 4A0QA 4U02A 2DR0A 4KWIA 4HFJA 2ZIUB 1PT5A 2SBTA 4PSVA 1DLJA 3CN9A 4E1VA 1YB7A 3AP3A 4M54A 1UXJA 2HMUA 3MCTA 2B2NA 2Q62A 3OKPA 2GCNA 2Z3VA 2Z5GA 2JF0A 4NQZA 4F3RA 3LQYA 4TSFA 4YEDA 1ZXLA 4Q00A 4LRXA 4TRMA 4CF3A 2ESRA 4I6JA 4H7KA 3QPCA 4X62B 2D7JA 2OCXA 3OJCA 1WSWA 4HZUB 1T9ZA 3LL7A 4IMJB 4ZVNA 2YXEA 4Z51A 5L7TA 1E0AA 4KXYA 5CVUA 1CIJA 2NADA 3L4EA 3ND6A 4KIGA 2AN4A 4TYQA 1KP9A 1YZUA 4U00A 2B36A 3OLZA 2RAVA 2OCBA 3ORQA 1ISFA 2WFLB 3R0XA 4CL2A 3E48A 3O2SB 4YV1A 1Q7CA 1XZBA 1KR2A 2HRRA 3WGIA 3SP1A 1ID1A 2BKXA 1H9AA 2XKKA 3FWPA 1XGKA 4H16A 1LTHR 4KPGA 4AY4A 1X1DA 5J43A 1ZRMA 1CZRA 2XGSA 3DZBA 2PKRA 1GR0A 3LRPA 3UB4A 1TLFA 2QJFA 5A62A 4LOJA 2DZDA 4QUAA 2J9XB 3D0RA 4JODA 4GKKB 3MMXA 1VCIA 4DZTA 2DUMA 1HL7A 2XODA 5EXTA 5A4KA 4BJ6A 3PDIA 3PQ7A 4AY6A 1E7SA 1JKMA 4KR3A 2ZYHA 1AO0A 4XJXA 3H17A 3HB4X 2P1DA 3DW3X 3LBNA 3GEHA 1A5SB 2ZB3A 2G70A 1GUZA 1VZ3A 3ZHVA 1T6ZA 8LDHA 1Z17A 1L4LA 2C2MA 4L57A 4H31A 2NSHA 1DEKA 5AIAA 1KY2A 4CL8A 3A7EA 3A70A 1XUOA 5BNZA 1TCAA 1DEOA 2VSNA 3ENNA 1JZSA 2REQB 1S8OA 4FGZA 4ZVSA 3JALB 1TAGA 3AI2A 3A3NA 4IQ8A 2R6HA 3KVOA 4JU8A 2M1XA 2ISCA 3ZVLA 2DUWA 1UEIA 4KR7A 4C88A 5AW3A 3PGVA 4EL0A 4YQFA 4Q9IA 3IMCA 4DLZA 5I45A 3LNCA 2FWNA 3V32A 4A92A 1EHIA 2WJPA 3IEUA 2BFCA 1I14A 4KW7A 4BQPA 1VGQA 3VZPA 2WSYB 3B60A 3IBSA 1ESDA 3E22A 2HA5A 3PL1A 4TTVA 5CVEA 5FDFA 3IVCA 3KXDA 2G72A 3F3KA 4WCVA 1HV8A 1B93A 4ANFA 1D9ZA 1AXEA 4L51A 1SD5A 4EBBA 1QLHA 3FCYA 3JQQA 1KL7A 2OCYC 3CXUA 4P38A 3SFTA 4B3HA 3PV0A 4CJXA 3PUYA 1ULHA 1W9HA 1DKPA 3IPYA 1N0HA 1XTUA 1S4QA 4BQOA 4F5EA 4N5IX 5B4UA 2HV9A 1Q3HA 4J0QA 5LU9A 5HGXA 3L18A 3T38A 2XKAA 4ZMSA 3DC2A 4NS4A 3G2NA 1GLNA 2C54A 2CMGA 3OTIA 3OIWA 3Q11A 3WFJA 2WVAA 2R4TA 4KE8A 1E98A 2C2OA 2OAP1 2R3SA 4M0KA 3I92A 4YI3A 1T2DA 1B0UA 1H65A 4HSGA 5KNCA 1F20A 3HO6A 4P35A 3ACCA 3BK2A 1K5GA 5IEJA 1V3UA 2P3SA 1JP7A 4TL9A 2DJ5A 1MZVA 1G9XA 2I2AA 2C5GA 4N6GA 4PLCA 4XIGS 1MAUA 3EK2A 3IQEA 4JIGA 4XM1A 5JMWA 1KQFA 4E07A 4B5LA 1SHTX 2JLSA 4ALKA 1C0LA 2AZ4A 4WKCA 5F23A 2Q0HA 3JV7A 1TC2A 4HLUA 5FRDA 4MHTA 2WOOA 3BDAA 2P5UA 1Z0ZA 1Y5MA 1FUUA 4YCLA 3GN1A 4JASB 2OQVA 8ABPA 1WQ3A 2EW1A 1Y5IA 3FDZB 2I91A 2YV5A 1MGOA 2QS9A 3H0KA 4QOHA 4X1IA 3EWSA 5F7ZA 4BGDA 4QJ4A 2UXBB 3RTGA 2ISSD 1XTJA 4CUKA 4RS4A 5TLSA 3W0LB 3IEPA 2ZW9A 4FIZA 2EZUA 3CPJB 4WJZA 1JEQB 4C5AA 3B78A 2R4QA 2XI4A 3FPHA 3D54D 2ONKA 3PI7A 3ENWA 4PXYA 3HR7A 4QFCA 5LQNA 4INJA 2ENWA 1ZD8A 1VFNA 2OFOA 3RYHA 4RV5A 4REQA 5T5QA 3SHVA 4RHUA 1BCRA 3K05A 4PLYA 4J3FA 4DRZA 5LDHA 1JTFA 1M2GA 3EEOA 4KWCA 5HZGA 1FJXA 4LSZA 1IOVA 4AYXA 2XDQA 1KARA 4OAQA 5SICE 4UE2A 4JN6B 4GFDA 4KRFA 1QRDA 3VPBA 2PR2A 5JAUA 4RV9A 3PNMA 4QSHA 2OD7A 1YCHA 3ZOZA 2P9BA 3CVXA 4JLWA 2OGZA 3NM4A 4NFYA 1X1EA 4Z9YA 2VF4X 1C9KA 1YJCA 4FDUA 1XCBA 3QPUA 3GH1A 4E3WA 1G55A 4JAVC 3GJ0A 3QELB 5T6BA 2EJBA 1ARZA 1W75A 3NWEA 3SK0A 1O08A 5FOQA 5AM3A 1ZN7A 1TAHA 3NPMA 4II2A 2E4UA 2Q4EA 4O0MA 4X6YA 3T12A 2HNKA 2BFBB 3B1WA 1NVWQ 3J7TA 1XA0A 4LC1A 4YRFA 3T94A 3B12A 3M7IA 2YICA 2FETA 5BSUA 2VJBA 1LS6A 1T10A 3UAWA 3BEOA 4PR0A 5T6MA 1ZJZA 1T5BA 1ZM2A 2AIRA 4BNGA 2BHNA 3BCHA 4UATA 3WLOA 1NI3A 5ITZA 4DDTA 5ADUS 5L4SA 3ZWAA 2Z6VA 3B7PA 3BORA 4F1KA 5CTJA 3TNDA 2NYUA 4XUGB 4CKZA 1R15A 1VIDA 2R8ZA 3IE0A 3RIEA 5HUJA 3ZCQA 3ETGA 3L7JA 4MYCA 3VH4A 4QUIA 4XPIA 5DNYB 1OU4A 2RHCA 1Y7IA 4OFZA 1PTJA 2GTIA 3U62A 5L40A 1CF4A 1S0UA 1I2CA 1TCUA 1DIRA 2ZSUA 3PU6A 4DQDA 5F9FA 3IEMA 1YCFA 2ZUWA 2VPQA 3O8OA 1N5MA 4BY9E 4R0MA 3P2YA 2F43A 2W2XA 3DPUA 3J7AC 1UR5A 5E38A 4YUVA 1YQDA 4EB6B 4MV5A 1GQ2A 1MJHA 3HWSA 1MO3A 1WSDA 1R74A 1EVKA 3WSTA 4K1LA 2C5FA 1Z35A 3KJIA 5IBRA 4HDAA 5D86A 4ADSG 1I3LA 4RFSB 3ZDBA 4JJKA 4HWOA 1CZHA 1LBIA 4FKBA 2GJAA 1BDMA 1IN5A 3CUEF 2X9NA 5DX8A 1E3SA 1YFJA 1C8LA 1UKCA 1NQXA 4RZSA 3TSWA 4E5DA 2WQ7A 1YIOA 1O54A 4L16A 4WINA 5DYNA 2PAAA 2RHWA 3N3AC 4G0MA 5KWEA 1XQ9A 2K7ZA 3TAUA 4BVGA 3Q7TA 3H9QA 4PYOA 1I7DA 4V0MA 1JEJA 4P86A 4QJ3A 3HB0A 4NV3A 4Q4AB 2ATIA 1X7ZB 2RAUA 3STWA 2BGIA 1O0SA 3RUAA 4D3DA 2BEVA 4O6VA 1ZCAA 1CHDA 4UMDA 2HF2A 4RSHA 3K9QO 5EGSA 5JCJA 2I0FA 2W43A 2GAAA 1RABA 4TGLA 4H1WA 1A04A 5CK5A 4MYDA 3L0CA 4MVJF 1JIQA 1B7GO 2PL3A 3A31A 5KQPA 1KKMA 3ZTTA 3FPLA 5AOAA 4JLUA 2IDZA 1UMBA 3KQYA 4BFVA 4FB5A 2RE8A 1XNQB 1JIUA 1I3OA 5J4LA 4OGGA 1AN0A 2JC3A 3HVUA 1T4GA 4UREA 5H3CA 2BPOA 2H54A 4HUQA 1D4FA 1HYGA 4MVJP 2A0WA 1KOJA 2EZ8A 3W5SA 5I9BA 1EWRA 1LWNA 3FJYA 1C8VB 1DUSA 4KXMA 4LGYA 1E77A 4D9IA 1G6OA 4DRXB 4D02A 3BJIC 2Q5HA 2Z5LA 4YMGA 3QW2A 2R751 3OU2A 1LVUA 4GOND 1UT6A 3VVBA 3MTQA 3TOZA 1ORDA 2KSQA 3OSUA 3A7DA 4HL6A 4RMHA 4XUCA 4RGYA 1K63A 2HOQA 4F92B 1Z4PX 3LFHA 1LPAB 4HDSB 3T3OA 1MR3F 3LU1A 1WXGA 4JITA 3Q1LA 4HYTA 1HM5A 3P1JA 1U0RA 5C37A 1EUDA 2RJOA 3OZDA 3JRXA 3RT9A 4LKOA 3WS7A 3IHTA 2OV4A 3PUVA 2QVGA 3RS5A 1JSXA 2WV9A 3WGLA 3QXJA 4CV0A 2GFIA 2X8JB 3PFCA 1WZ2A 5ALRA 1N3LA 4YP0A 1QHNA 3RUFA 1KMCA 4ZAVA 2C8JA 3E9ZA 4LGMA 3CX8A 4MUHA 1SQFA 1Y3HA 1M7HA 2XXJA 3RH0A 4DJEC 3CONA 3NNNA 1PUIA 1IUNA 3TQFA 2VXOA 3ZWBA 1EINA 1CDEA 2E0IA 2OP1A 2I4IA 1P73A 2QRKA 4PS1A 5EJ7A 5J9FA 5DULA 1O8CA 5DOZA 1W4CA 3K4QA 4UBKA 2YRWA 1T2CA 1ZSNA 3ZG6A 1G20A 1E7YA 2FPLA 2B3DA 5L3RA 5ICMA 2Y4OA 4AZ0A 4XQCA 3AYZB 4EPWA 3NBZC 1OC4A 4WXHA 3RNOA 2V59A 4DUGD 1UC9A 2OO3A 4D3YA 5JDCA 3UMVA 4BO8A 1KMMA 3I4FA 1G8YA 1W48A 1X2EA 3QF7A 2KX7A 2JW5A 1RAHA 4HHEA 3WNQA 1FB5A 3ZPXA 4UC0A 4B3JA 4MITA 4BO1A 3OJWA 5IT4A 1MA3A 4MKGA 3TOVA 1CK4A 4K6KA 2UZ1B 4ND7A 3DP9A 3USES 3ZQUA 1QTRA 3SHTA 4WY2A 2IIQA 3I9V1 3SMQA 1Z47A 1NYQA 4NYIQ 3USCS 3B6KA 3AERA 3IR6A 4W7SA 4HQOA 4UTZA 2PD4A 1O5IA 3I8SA 2WYUA 1UINA 5FO1A 3ZXIA 1SVLA 1K6MA 1NXWA 1SOAA 3MGAA 1R9NA 3EXHB 3TUJC 3RAGA 2QRVA 1DTWA 4Y1FA 1UZLA 4QFBA 3WC4A 5ENZA 1W6UA 3ZU6A 1VRWA 1RTTA 2R7AA 2IPNA 3S8MA 4P4GA 1RHUA 3VZCA 5CDHA 4B4WA 1KFCB 3EX7C 2O2SA 1R66A 2ODWA 4G37A 4QATA 3AVVA 2WD9A 2VRCA 1CNMA 1FE8A 1RWNA 3HCWA 4RA9B 4UAVA 4ZYLA 2VAXA 3WX0A 4C5BA 4ZEVA 5LNK6 5L3QA 4J1QA 2XQFA 4J90A 5DHRA 4LQ4A 1RQ7A 3GZ4A 3KYDA 4IS3A 5KYUB 1RWQA 2VEDA 2GAOA 2FPXA 3P2IA 3ICQB 4M9CA 4F2GA 2R2AA 3S27A 3T5BA 3V2IA 4LDPA 4F38A 3NKLA 1NE7A 1VI2A 1OZGA 1P61B 2F3TA 4NDZA 3UMBA 3KYCA 1T3SA 3WP1B 2YC2C 1KOLA 3DGEC 1XXLA 2XA9A 3K0HA 3QENA 4KNVA 4RO0A 4BNNA 3H99A 3DW1X 2NUTA 3HLYA 5CA0F 2FPGB 4G1CA 1P91A 5CVCA 1RWVA 5REQA 2WAYA 4YDRA 1PJ2A 3U48A 1XJQA 4BO7A 4PYKA 1YXMA 5C18A 1UJ5A 2IXAA 2V6FA 2UKDA 4KQIA 2JJ1D 4MWSA 5B1YA 1HE8B 2Z9DA 4NESA 1U4OA 2BMEA 2JATA 4OK5A 3WK7A 3C4VA 3CE6A 1BS1A 3FWKA 5IX8A 4ZYVA 4OM7A 2B0CA 3OIYA 5EIAA 3EEFA 2OFPA 2BGJA 2PTHA 3K9FC 4KDFA 3THYA 1P0QA 5AM2A 1EVYA 1WULS 4S2UA 4ARBA 2IY9A 4RQTA 3HGMA 3HACA 3RGWS 3VPSA 4Q4HA 1NC3A 4M6WA 2GEUA 2IXBA 2WHRA 3OTOB 1FL9A 2A57A 1C5KA 2IEYA 3RFXA 2CD7A 3KQTA 4KX5A 2E4YA 3FLAA 2HHCA 2JHAA 4G65A 4KTVE 4FYWA 1UWLA 1BHSA 4DIKA 2JLWA 4KTTE 2E87A 2IEBA 3Q5EA 1Z0UA 3GLTA 5K0JA 4QOFA 2IXTA 5F4BA 2ZRCA 3ME5A 1BQEA 1VG1A 2VDPB 2CJYA 4CQMD 5I51A 4QU0A 4U6SA 2YWFA 3D8BA 2RBGA 2WKSA 1W76A 2HO5A 4Z9XA 4DC1A 3QU5A 5I5EA 3T34A 1NYRA 3LHSA 3JS5A 5GGYA 1RXEA 2ZWPA 2PN1A 5EJ6A 2XUQA 3H75A 3AZPA 5JY1A 5AESA 1TAUA 1T3GA 3EEBA 3W6OA 5KTOA 4QDUA 3BIFA 1ESMA 3CF2A 3MHPA 4P3PA 2HV8A 4TTTS 3VTZA 3S99A 4FNMA 1PLKA 4QNNA 1I4EB 1FYVA 1JG6A 1EP1B 1ML4A 1N5JA 4MWDA 4ZO8A 2VYCA 3DLTA 3RFTA 3IAFA 3X1DA 2D7CA 2NQ8A 4A0SA 4DNOA 1XQ1A 3L7NA 1XEWY 3DYIA 5AOCA 5FPYA 4ZI7A 5FNVA 3LZCA 5EC8A 4LNUB 3QEBZ 1W94A 3AFOA 1KU0A 3PHLA 2DP4E 4IDCA 4KVFA 1OJLA 4TV8B 3WIEA 2NYAA 1HDIA 2PS0A 1ZYUA 1KE1A 3S1SA 4CM9D 2VL7A 5BSGA 1IDN1 5KMGA 2IS2A 3VX3A 4M37A 5FI5A 2OP0A 1KSJA 3ANSA 1SUCA 2B25A 4C78A 3KJZA 1K8QA 3ETCA 4Q19A 1OXUA 3G82C 3FSRA 3BGVA 3CA8A 1W85B 4L7VA 1RT9A 1KEWA 1Y1QA 4I3GA 4L72A 3VU9B 2VJYA 3MRSA 5DTIA 1FMTA 2PD6A 2AKYA 2PWZA 3E3NA 3FFAA 2FI1A 4IIFA 4AI6A 5CD9A 1L1EA 1GTL1 2NUBA 3ST7A 8MHTA 5FPPA 1W1IA 1UM9B 4TWZA 4AZWA 2WWGA 3T5TA 2O8BA 3HI4A 2A67A 4UM5A 2IWHA 2QU7A 5FPHA 2O4UX 4U6NA 1HG0A 4DIUA 1NZFA 1SKMA 1BH2A 2WNIA 2C4TA 3RVDA 4EYKA 2PSDA 1BOOA 3QBEA 2PUFA 1W2HA 4G0ZA 1H2RS 5TY0A 5JNWA 1NFRA 1VE9A 1LVHA 2R87A 4Q0MA 2LV8A 1B6TA 2CLKB 4QARA 1LPBB 1PRYA 1RLMA 1SXIA 2XGOA 3AILA 3H2GA 2O7SA 5ES4B 5HIKA 5M34A 3S1AA 5BWCA 4E51A 1N2EA 4Q1BA 3H2HA 5GOTA 4FGLA 3VUFA 5AQ1A 4DOMA 1GKLA 1H23A 1P5ZB 1JQEA 3TMYA 2ILVA 2D5BA 2AJBA 3TLAA 4CWAA 1HA3A 1FVFA 2XNDA 2HEGA 3QBTA 4RA6B 3WZ2A 4YJHB 3T1OA 1MOZA 4OLFA 4I5EA 3E4CA 3BQMB 3GRKA 1MVOA 3I64A 5BWBA 1G4AE 3FUUA 3ICCA 4L0QA 4B4UA 3RJZA 3L77A 3OLYA 2NT4A 5JANA 4A15A 4R1NA 2GZ3A 2AFIE 2G04A 2P5YA 3SR0A 4XVCA 2VBIA 1NLYA 2OM6A 2DLNA 1RAFA 3FYCA 2WF7A 2LP4Y 3D81A 4NABA 4WGGA 2XKJE 4EFLA 3ELDA 3G9XA 3BL6A 2E9SA 3EFOB 4LDAA 5AJWA 2CVQA 2A7QA 3HE3A 3Q9NA 4JLKA 5EUCA 3BMNB 1MV8A 1YS2X 3QJYA 1NV8A 3EJ6A 1GGFA 2WE7A 1BCSB 5C52B 4TXMA 2ZROA 2NO1A 3PFNA 3ZIAD 4BU0A 2PMEA 5K8IA 1OAOA 2B5VA 1SXJD 3UWKA 1MJNA 1DU4A 3HG7A 2A5YB 1MUUA 1NG1A 4N9QA 3SSAA 4MQFA 1EJ0A 4NJEA 3LNTA 4DBZA 1Z39A 4EF6A 4YRDA 4CYMA 1LW6E 1VDMA 1QB7A 2Q8PA 3FPCA 5CMLA 3TD6A 5JO9A 3ZYZA 5KNLA 1Q1AA 2BDUA 2X4GA 3U3KA 1H1LB 3UGQA 3TIIA 3FMPB 1FX0B 1JFLA 3SMVA 3V9AA 3FHOA 2Y93A 3UA3A 4L9WA 5KB3A 2PGLA 2WTXA 1TJYA 5BRAA 1V5WA 3AF5A 1G21B 3KUCA 4ARUA 4FFPA 4ZU3A 3ICOA 5FBVB 1V3VA 2APJA 1Q7TA 2QVZX 2V45A 4JYBA 4P2GA 4QFMA 1KJ8A 1T6YA 2FCAA 3PE3A 5ALPA 1KDVA 4CM6A 4D8TA 1AKEA 1FRZA 3BERA 3HO8A 4V0NA 4H7HA 4X1YB 1SM4A 3FUXA 3TW0A 4QYMA 3WGZA 4POOA 1HT2E 4BWYA 3Q41A 5FR2A 4A2WA 5ALLA 1LKZA 4AJNA 3EIEA 4WN9A 4B7CA 5CU7A 3ZKAA 1GD1O 5ECGC 4MRMB 2ECFA 3W90A 3LW7A 1K7YA 4WADA 4FZJA 5HOEA 2V97A 1MTZA 4DNFA 1ZITA 2XUHA 4FS3A 2ZRMA 1AMNA 3NYIA 3IMKA 4XD2A 5IULC 1TX4B 1BMFA 2CFOA 1O9HA 2PT7A 2VHVA 5K4HA 4RSGA 2AFIB 2XIJA 2JHPA 4FONA 3UQYS 3H1TA 4O4LB 2QNBA 2IY8A 3KJHA 3H8WA 1ONNA 3GGOA 4UOEA 2I7VA 1IRXA 4YRIA 1U6IA 2WSIA 1Y37A 3V7NA 3W06A 4BNWA 5I3CA 1RMYA 2GAIA 2VK8A 2FN9A 2W4MA 2Y9PB 4MKIA 3E9CA 1EZ1A 3N8GA 4YH1A 5A4JA 3ECAA 1F4LA 1KAOA 3AKYA 2V55B 4I9NA 1J70A 1DELA 4FFLA 4L6CA 1JDVA 2QT0A 2ODEA 3ABZA 4PC2A 2EW2A 4QGAA 4DQXA 1K4KA 3ISJA 5E4FA 2WWVD 4HK4A 4CUJA 3BB1A 4NENA 1DS6A 3RC8A 5IZ4A 3VA7A 2H08A 4BNDB 5A06A 3QMWA 1GZVA 1PP4A 3OKCA 1OFGA 2I5PO 2IH2A 1VJGA 3P0JA 1QB8A 4RJ2A 3SM3A 2QTGA 4KQJA 2BZGA 3L0BA 4KRGA 4WNAA 3UJAA 2I66A 2CNOA 2QTBA 1AV7A 3BWXA 1XXHE 2O06A 1WTAA 1HYHA 3HRHA 4S24A 4B1FA 1W59A 4DIMA 1X3LA 4RORA 1R0XA 2NT3A 3G5AA 3HFJA 3VR6H 4FC7A 5CNMA 3WK6A 4EJMA 2P3QA 5LXTA 4NY1A 4G1VA 3U31A 3OPYA 3RRXA 2GPWA 1E9FA 2J5QA 3NIGB 4QD3A 2G88A 3SYTA 4BVBA 2HRDA 4V1CI 2ZBDA 3FFTA 4EO7A 4UHJA 4L1KA 1SBZA 3EC7A 4I7EA 2G82A 5YASA 3FYHA 1HYEA 3DFFA 4ALLA 2H51A 5CB6A 3MWEB 4W5HA 1CQPA 1EU1A 2YXLA 3B9RA 2CCJA 2H1SA 3AWIA 3RJ5A 1GN9A 1ZIYA 1PTKA 1IHDA 4TMTA 4K9MA 3COVA 3NR2A 3E0QA 3FGZA 4AK9A 3TQSA 3NBYC 1OYVA 2AX4A 2FR8C 3KT8A 4IFTA 4LMPA 4UZFA 1KYXA 4H4CA 4ZKEA 4J1NA 4TMZA 2R1TB 1NVMB 1WOMA 3BRQA 3RUHA 4R2JA 5HF8A 3WMRA 4ATNA 4ZP1A 1K8YB 4H0CA 1T1GA 2YZNA 4TTQA 4GLFA 4CM4A 1ESNA 2GSWA 3GQBB 1C9NA 3LUFA 1WIWA 1XCOA 2JLVA 2JLZA 3GP5A 3CUUA 3SJUA 3I83A 4WCFC 2QRNA 4DCJA 1XP8A 3WK9A 5A1JA 2WJHA 3KPVA 5CNIA 1JLHA 7REQA 3PYXA 1FSFA 4AL4A 4I66A 4A7PA 5IXYA 4GKBA 1BS9A 2WM2A 3VVCA 4D2IA 1Y3FE 3DOOA 5IH7A 4Q18A 4M0DA 4JHXA 3WGNA 1E5LA 5I8PA 2PLFA 3U2QA 1DBSA 1ZKMA 4OGWA 2E4XA 1H6DA 2WD7B 1PUXA 1WVGA 3KQPA 1IL0A 3D2BA 2XF2A 4FDVA 4O29A 1XTVA 4WDRA 2B69A 2E7ZA 4LQCA 4L8VA 5CXUA 2WFZA 2QR5A 4G0NA 4L02A 1EB9A 1QCYA 4I1YA 4MQ5A 1SVSA 2K2QB 3EISA 2C5BA 4G9GA 4WOPA 5ALFA 5HMLA 2IWRA 2PFKA 3AR4A 4FMDB 3UJ7A 3HZOA 2R85A 2RHMA 3VDXA 1L3IA 3JVIA 4RTJA 1PL7A 4WD3A 5L53A 4KO3S 1FK8A 1TEXA 4BX2A 4KYUA 2WZQA 3IBTA 1NBME 3CJTA 5IKMA 2I3BA 4MCHA 4AT1A 2YY5A 2OD2A 2FN8A 2ZRKA 4JUBA 5AXAA 2HPAA 3DUFB 3I61A 1EFDN 3ZE6A 1TM7E 2BD0A 3GUCA 2GJ4A 3C3CA 3OAAA 4TUYB 2QTWB 4OHXA 2P0EA 1T2AA 3CJRA 3P9YA 2JFXA 2DF8A 4L3WA 4BNYA 4Z86A 2YRXA 4EG3A 3DLHA 1FTQA 4WKOA 2DE0X 2SCUA 2XLCA 1TKRA 4ENWA 1Y5LA 3W6NA 2VQSA 1SHJA 4CKBB 1CUJA 2FUNB 3AJ9A 4MA0A 1T2EA 1ZAKA 3CZCA 4XDHA 1KDZA 4EA9A 2G5TA 2AC4A 2OQIA 2HSGA 2R8EA 3WKDA 3GLFE 4ZHQA 1QGDA 2DH5A 2H7VA 4J4BA 4QQNA 2CBXA 4DV1B 4ZCMA 3KLOA 1VMIA 2XUZA 1U9YA 3FTPA 4CR8A 5ALOA 3U7QB 5IJWA 2QZ9A 1N6NA 4EEZA 3RBVA 4URVR 3NHFA 1JR4A 4WKGA 4C2UA 3LSYA 4RAOA 3RG2A 4OYYA 3IEIA 3IUYA 5WRFA 2AFVA 4RKWA 4ROTA 5AKYA 1LF5A 2J9FA 7AT1A 3BL5A 2RJNA 3A1WA 3LPNA 4NCXA 1EFTA 2WK1A 4I50A 3K09A 4DPLA 3GDWA 4YTEA 1NMQA 4PSAA 3VTFA 5CG2A 4NMLA 1SZPA 4BIMA 1ZGCA 1L5RA 2ZE6A 2L0XA 3GW8A 4WFKA 4JSYA 5I7HA 3AKCA 1FDTA 1RRPA 4LDJA 1IN6A 3LT2A 3T7JA 2DFLA 4P4LA 1P1RA 4EM6A 3JD3A 4XFDA 4EG0A 3K0CC 1DBVO 4UDYX 1GEEA 4KR9A 3PP8A 1LWOA 2JLBA 1SXJE 3NHRA 4R68A 5TJ9A 4UCWA 5DM60 3RVMA 1RZRD 1UFOA 2W8ZA 2ZR0A 3EOZA 5ENVA 4RACA 3W3AH 1KERA 4HEJA 1EFHA 4LYYA 1YJAA 1G59A 1HH4A 4F2WA 5IG2A 1XR3A 1DBWA 1W2WB 3K1AB 3BMCB 1JDPA 1YDFA 1GYRA 3P45A 2QUBA 4K9SA 4UHEA 1AQ6A 2OXIA 1CRQA 4FNGA 4UASA 3GD5A 3JWIA 5T4HA 2XGMA 1WBDA 3C43A 3IX7A 4KAFA 1P2SA 1FRVA 2JI9A 2P3LA 3ANNA 3H9CA 1AC5A 1HGXA 1LB1B 2GB4A 2XOEA 2ZDQA 1LDEA 2GA9A 2COUA 3IKVA 4I1IA 3UK1A 1V96A 3TRJA 3WQQA 3MD9A 2XCQA 1XOIA 1M74A 2L42A 3DDUA 4U3JB 4V0SA 4CMAA 3DLPX 1SD1A 2H00A 4ZQIA 4IICA 4TZTA 5KJCA 2CWDA 1EFRD 3H5WA 3HBNA 4TKVA 1V8FA 1YULA 5BYBA 2ORWA 3X1YA 3AR3A 1ZL2A 3GFRA 1UJ2A 3P9RA 2H2DA 3RVOA 2W2PA 5JHGB 4Y7DA 2BR3A 1AV6A 3I0MA 1DWQA 3OEYA 5LR6A 4IIUA 1KZ1A 1XMJA 5T4BA 4F4IA 2HA2A 3C7DB 4DV0B 2XJ9A 5EY5B 3E7WA 2C9CA 1QC5A 1Z3CA 3NHSA 4OYHA 4PN3A 4KMMA 1YCDA 2DH6A 1DX9A 2PX8A 1L4HA 2O57A 1KZGB 4JVLA 4Y9SA 2FSUA 3HRKA 1DWOA 2F62A 3HJRA 5ARBA 2XE8A 3T1TA 1ZOSA 1RVDA 1QP7A 3F6BX 5C7IO 1Q6ZA 2W5UA 4YASA 3DDHA 3PR1A 3ANYB 5KYWA 5K7SA 3FPKA 3N28A 4NFHA 5TT1A 4D80A 1A9ZA 4M7OA 5B7NA 3RUPA 5ALGA 3TI9A 4B0PA 1MRSA 1U0BB 1PIWA 1V48A 4KMOA 3WWEA 1DHRA 3DE6X 3F0TA 4RANA 4WX2B 4YIKA 1H5QA 1P33A 1CDDA 1N3IA 2J3DA 3RAPR 5I4CA 2J41A 1LBTA 1JT2A 1MC4A 2Q8NA 4Q1DA 3CLVA 4BKOA 3TLGB 3CT4A 1KQNA 2VHCA 2RSLA 3W7AA 1UL1X 3S2FA 2BGLA 3O8CA 3BHJA 3OZCA 1AQIA 2XRYA 4BZWA 5HJ7A 4ICIA 1EUCB 1O94A 3HBJA 4M2LA 1KP2A 1XJ0A 2OB1A 3KQHA 2YWCA 2IH5A 1MX5A 3ESXA 3OCXA 4OG2A 2QPOA 1W5FA 4UDXX 2WWRA 4IDOA 2ECQA 5DYIA 1ONSA 3R7BA 2C96A 1K7XB 1WLSA 3OQJA 2RHTA 3K7EA 4FHEA 5B5SA 1ZUNB 1TYBE 1COZA 2LD4A 1QQ7A 4JI5B 2C3MA 2I4NA 2JAUA 3GDFA 3RV4A 1M6HA 1GNPA 4XXHA 1CJSA 3SXUB 1ZC4A 2G71A 4OYLA 4C0XA 4CNBA 5ARDA 3ODGA 1SVMA 4I36A 4DZZA 1EE1A 3B3QA 4LOIA 2PZEA 4D25A 4ZTBA 1YQUA 1P45A 4OJKA 3GEGA 3AFHA 4W8GA 5I6DA 1KO8A 5BR4A 3LCJA 3L06A 1ANKA 1J4AA 1QSGA 2YINC 3HDYA 3VO2A 3CZRA 4ENSA 3I04A 3OC6A 4TS9A 5F35A 4MQMA 3A9RA 5CAEB 4UCFA 2ZR8A 2PZAA 4L95C 3C8HA 3GA7A 4PAMA 4QJIA 3MGGA 3CFYA 5C0OE 4QTYA 1RW4A 3QYFA 4I0WB 4KV9A 5IKPA 3DE3X 2Q1SA 1P3DA 3DT9A 3D4BA 2ZR9A 3CEPB 3QJ5A 4F8JA 5FPKA 4P5EA 3BXXA 4IGKA 4WAUA 3HZZA 5DI3B 1O4VA 2J5XA 2WKRA 4YAOA 2I6QA 1OI3A 3A4MA 2JI7A 5DN9A 3RKRA 4FHFA 5FLKA 1AMOA 1ST2A 3NDRA 3Q7PA 1EG2A 2WTUA 5A5DA 4IHJB 4GP6A 1MX1A 1PLJA 1M34A 2EGHA 3SS9X 4FOSA 4L5AA 5ULLA 4AO7A 5LQKA 1Z0DA 3BSYA 3QVXA 1QOZA 2Z98A 2R66A 1RD4A 2ZJ7A 3E2MA 1SQSA 1ZA2A 4HCJA 2WMOB 3TF5A 1SG9A 2QRGA 4D6XA 3Q7IA 1M8PA 3ZWDA 4M1EA 3UJPA 3G59A 2PX4A 3I2KA 4HXEB 4WZAA 3WGOA 5DCLA 4MVJE 1GN8A 5JAOA 1SKAA 4M53A 3FOEC 4KHPB 4H7EA 2I4LA 2OO5C 4RIHA 2CKDA 1EK2A 4EF4A 2H4JA 4GNRA 5FR1A 4TYWA 3U3XA 1ZRHA 4YDQA 4KDRA 2JAHA 2ZUEA 1LU9A 4DT1A 1TUBA 4NCIA 1HT3A 1HY3A 3CLTD 3LSTA 4WASA 3S2EA 3GEMA 3C3WA 2QDXA 3HDJA 3S5JA 1DQYA 1YMVA 2IOQA 1XK6A 3KXLA 3FROA 4UHBA 2OCKA 1G3UA 1ZQ1A 3TXXA 5DNVA 3IELA 4FU0A 4Q3EA 3KYIB 1PYDA 4PSCA 3ZHOA 1KGSA 1L3CA 1PNQA 1V2GA 1FS6A 2VDQB 3B70A 3TTYA 4S05A 1JG7A 5K4GA 1DC5A 4HB3A 1BHQ1 2BEWB 2WUDA 4YP9A 2A9PA 3KSBC 2Y27A 4UU7A 3L02A 3VH1A 1QGYA 5IANA 1XVLA 1XLTC 3Q8MA 3ZLUA 1GTG1 4XCQA 3PFWO 2AXQA 3LE8A 3GR6A 3VPDA 4ZO4A 3RRZA 3NHKA 4US0R 1TI7A 1GG2A 2YVQA 4WCFA 1QO0D 3A04A 3MPOA 4KWTA 1B42A 4RC9A 4ZAYA 3AQIA 3NG1A 3TZKA 4Q01A 5K45A 2FW8A 4UUQA 2G1PA 1F4PA 1WDWB 1YR8A 5DF1A 4LVUA 5LKAA 3D3QA 3B9BA 4OBXA 3HKEB 1JHPA 1M10A 2A6PA 3DEKA 1E2QA 5E7QA 2PIDA 4F4DA 3NIFB 4W63A 2ES4A 4TS3A 2P2NA 4XDZA 4Z1OA 1H3FA 1PDVA 5CITA 2JGIA 3K8OE 1DG9A 4KUHA 2DQYA 3NGXA 3AR9A 4R9RA 2HU2A 2OCAA 1OYOA 3D5QA 1RACA 4FVTA 4KXLA 2IOFK 1CB0A 4HAIA 4B44A 2R6DA 2A1UB 4HGYA 3EXG2 1I1OA 1ULAA 2XMGA 4E6EA 1V3TA 1A5AB 1V47A 3IOCA 2B5WA 1F7UA 2XNHA 2ATVA 1WS6A 3EXIA 4DR1B 1XAJA 4A6XA 1LBSA 1JDBC 3IOEA 1B4DA 3DAPA 4KACA 4KN5A 1PJ3A 2GWHA 1ZHOA 4U2DA 4B3CA 1DCMA 1NKSA 2QN2A 4MS4B 3UMFA 4OQQA 3WGVA 4PQRA 1XEAA 1AU9A 5DYGA 1FP4B 3TD9A 3HWX1 1JXMA 2OQ2A 4HAZA 2I9PA 2H2GA 2K5UA 2ZTUA 4LW8A 1Y34E 4IFBA 1YRAA 4F4UA 5C8XA 2YVLA 1M6NA 1N75A 1RFLA 4JGGA 5H8WA 3PQ4A 2QX7A 5BW8A 1A9TA 2DWQA 3LY5A 4ZCPA 1VFPA 2V7PA 1MHTA 3BM5A 1XZFA 2IBSA 2WF9A 2PUCA 4IKPA 1K0UA 1B8UA 2IQIA 3MF4A 2C98A 3S2UA 3FYTA 4HVTA 3VKUA 1SEVA 3I09A 2XPCA 4RPLA 1MU0A 5LMNB 3QV1A 1FPMA 5CDUA 2C3OA 3ZCPA 2VQ6A 4D56A 3MTJA 1OI2A 3RBZA 2CLDX 2CT8A 1OH5A 3RSGA 2Y1WA 3GV0A 2FPKA 1OBCA 2D1YA 2C31A 2V5UA 3BF7A 1E3DA 3TL2A 3BDIA 3SGLA 4AJ9A 3DTVB 4MPPA 3PHHA 2FSPA 2VYVD 4LCEA 4EQ6A 2M2IA 1KTIA 1D4OA 1EFPA 1T8YA 2IYXA 3AESB 3AHIA 4AWAA 1OB5A 4IDGA 2QAGB 4LNHA 3R3SA 2GNAA 1RCFA 2VNHA 3I9JA 3O4FA 4XJTA 4MQUA 5AKJA 5JNRA 1R0BA 2CN1A 1KS9A 3A6ZA 4ALJA 1EGMB 1C3EA 4MUNA 4OA8A 4EEKA 1L7DA 1D5WA 1SUFA 2VUIB 2JFFA 1UBKS 5SZJA 5CLGA 2XT0A 3UK0A 4AKTA 3PTAA 5JY6A 4B3FX 3FYSA 3DOFA 1T8PA 3K0CA 2RIPA 4A26A 4ZTUB 4EA8A 3U7JA 3IAS1 2QMYA 1X7HA 1CNEA 2DQZA 4C1NA 1K06A 1JYSA 4RKRA 1BXRA 4KO4S 4CLOA 1OZ0A 5JSQA 1PJ4A 3OOJA 4B6OA 3C3JA 2WF5A 3GNTA 4GNKA 5I8WA 3S29A 4DHWA 5DK6A 3WAJA 1Y7HA 3FHCB 2DYKA 2YWGA 4RTPA 2GNPA 1K92A 1XZPA 2J3HA 1KMQA 2AA3A 2PBFA 3G68A 4OH7A 5K8JB 3QVVA 4JS0A 3X2FA 3SLGA 1LBHA 4D4MA 1ZJ6A 1IG0A 3W9BA 5DZSA 1DAMA 3DBHB 3RSZA 1M7GA 4HUJA 3AOEC 5HR5A 5AUNB 4ZI7F 1OT5A 2NU6B 4NV0A 4FW8A 5FNVF 5JXIA 4CM5A 1OLXA 4HV4A 4HWRA 5ILGA 5F1YA 3BS4A 1W6RA 2WABA 1V9LA 4TSFD 3RR2A 3K70C 4RPCA 1JLRA 1P7PA 4U2GA 1IPFA 3DAGA 3SHWA 4PSKA 1Y80A 1C3JA 1F2TA 2E49A 1GKIA 1C50A 3ROTA 2IOHA 5KVCA 1NXOA 1A9QA 4RD4A 1TA9A 3EGXB 4MCAA 3NDBB 3WLLA 3P4XA 1MD9A 1EWTA 2ZYWX 4AY3A 4GD3Q 1OILA 2OKGA 3QKSB 3M4NA 4R8LA 3VHXA 1WY5A 1ZN8A 3PFBA 3N2EA 3R7AA 3EPKA 2N47A 4QOSA 4HX2A 2NQTA 1VI5A 4OB7A 1FZQA 5KX5A 4XUEA 4F93B 3H1BA 2FPIA 4NBSA 4FFNA 4UAJA 1LNZA 4JKYA 3OEWA 2RJ3A 4WDQA 4XX1A 5L3ZA 3ZBPA 4ZZIA 2FMTA 3G9QA 4FR2A 3VYSB 1GUDA 3I3OA 2XUJA 2ZTMA 1QHFA 1AKTA 3QU4A 1M75A 1QX3A 3FGNA 3R5HA 3IIKA 3ZKWB 1HG1A 3H42B 4JT4A 3UO8B 5TMEA 1UXKA 3WIBA 5CA0B 4CQNA 5GJVC 1E64A 2R8PA 4RK1A 2H1FA 4WEQA 2IV7A 1IQPA 5E7JA 2X0RA 1Q44A 3QFTA 3O3CA 5KSPA 1YJXA 2JHFA 4PYQA 3TLYA 1FFXB 2ZJZA 2QXTA 5GQSA 1D3AA 2FEPA 3FTCA 1Y7PA 2W6OA 3PQCA 1O0BA 1AK9A 1O57A 5JBIA 2IYUA 3EWIA 4GL2A 2DKNA 2FJPA 2IA5A 5LUAA 3U0VA 1ENZA 1VKOA 2Y1LA 4KGVA 4LJ7A 1T36A 2GBCA 1E18A 1NBHA 4CODB 4ND3A 2DULA 5LZ5A 2HSJA 1VRVA 2UUPA 1BMDA 1N5DA 3PEUA 4N3NA 4Q9DA 3V7UA 1YA8A 5AUPB 1YZYA 1ILEA 1DX6A 3KKKA 1GNLA 4ZD6A 3PWTA 5K09A 3SS7X 5KAPA 4BJHB 4CMCA 4ALNA 1ELOA 1EGHA 3FGOA 3HB1A 3PQ3A 5DV9A 3SR4A 3WDKA 4F96A 4JROA 5KAMA 2VIIA 3FDJA 4OXQA 3SJZA 4RFVA 4JZKA 3PEFA 3PA8A 3AI7A 2BJHA 4LC0A 1XZKA 3ENKA 3B7GA 4EFNA 2MT9A 3G2IA 1OF1A 1RQLA 2WJ4A 2L19A 2QF7A 5K0GA 5BV2P 2WTNA 4E2WA 3UAGA 1Z15A 1XEWX 4HNAA 3U7GA 3WV4A 1GTVA 4DMUB 4OI2A 1QIHA 1QGED 2GN8A 4AWXA 1RRCA 1S3SA 4DCPA 3L84A 2PE5A 4PG4A 1XYGA 1HE2A 5KC8A 2O7NA 3LUDA 1D8AA 4IIXA 1GA6A 1WNFA 1PZFA 4ZXPA 2A30A 1Y9ZA 2MR5A 1NVFA 1NMZA 1ICIA 3IC5A 1ESCA 3JX9A 4RM2A 5KNCD 2W2VA 3ZTWA 2IPLA 3PR3A 1KEEB 2EDAA 1C0PA 1JBQA 2I1WA 2QRPA 3K6KA 1REQB 2BSAA 4UHFA 3D7NA 4F91B 3JU3A 4NPCA 2N46A 4XRGA 3N8DA 1EGAA 1CR0A 2VAVA 1OI7A 1YAHA 3GAMA 4JJEA 5DHAA 4GLOA 5DW3A 4DLRA 5JAIA 5CDFE 4Q1CA 1CE8B 2P5TB 4XRRA 5KYNA 2JAXA 1R6XA 1QVWA 1L3BA 1J42A 1DLIA 1JWBB 1Z0KA 1CQZA 1VM6A 4DLSA 1P5HA 4LHSA 1OGJA 4LJ4A 4QVGA 1N2OA 1GA1A 4CEIA 2CYBA 3U7EB 4J0EA 3LUPA 1ZIDA 1F8FA 2BBWA 3A3KA 2OO5A 3F5DA 3PGJA 2HA6A 3PQDA 4BO6A 2IUFA 3AC0A 5IAJA 5ICCA 2P0YA 1R37A 2G9UA 5LQDA 3N3BC 3QP9A 2CGEA 3EY4A 3GRRA 4GM4A 3SI7A 5A6SA 3PEWA 1P1JA 4YGYA 5F7JA 1N0UA 1YR7A 2EEZA 4YACA 4BO3A 4YUAA 3KLBA 4IO1A 4M0UA 1FQWA 2DKOA 2EKZA 2YWBA 1N8KA 4G01B 2O2EA 1UBMS 3IPCA 4OUDB 1TQ4A 3R8XA 4M21A 4FE4A 3TOCA 4X41A 3F47A 1OREA 2I2FA 3PIIA 4N5DA 3EZXA 4UJ3A 4DA8A 5CLQA 1NI5A 3R6WA 1TCCA 4A8JC 4YJ3B 1EP2B 2BBSA 3IQXA 5COAA 5D85A 5IZCC 1K2WA 4LMBA 3GF4A 5CLJA 5JWOA 5IT9A 2CBZA 5DJ5A 3SX0A 4Z4GA 3AVUA 5K51A 3MQ4A 3T7EA 3PC4A 2AZMA 1A2BA 1K6EA 3BSFA 1E9DA 2BOVA 2IF0A 2GK3A 2K2WA 2IUUA 3GDHA 3S6JA 4HQ6A 3TDNA 3MGCA 4BMCA 3A32A 5C34B 3T3NA 1JZTA 2VT3A 4A6EA 3F4KA 3OBBA 3ROXA 4REOA 2V4ZA 1PK8A 4K05A 2P6NA 3C15C 2PSSA 2ODTX 2O07A 2D00A 1P0IA 3DE4X 3AXSA 4QXPA 4B4KA 3PDCA 1LBQA 3AVOA 1K5DA 4RH0A 3HUEA 4IXDA 5LXTF 2Z5VA 3ANMA 2Q2QA 2FMHA 1D07A 5D3QA 4M7RA 4OMCA 3ER9A 1XMOB 1MO6A 2AC2A 1HNZB 1C4KA 1FLAA 1U02A 2F3SA 2JGDA 3TFQA 4I8DA 1TQ8A 4TL6A 2NU9A 3WE7A 4FYIA 1SCBA 1W0JA 1T3HA 3G85A 3GJ7A 3LYAA 2A84A 3PA6A 3P9KA 3PRKE 3JQ6A 2BKVA 1L7EA 1TOAA 2O0LA 3UA4A 2H2HA 2BKLA 4HNUA 1O89A 2OB2A 1ODLA 1NMYA 1U80A 1V16A 2P79A 3DBLB 3KT3A 3HFGA 4G4GA 4GOMD 5CGZA 2YJNA 3MS4A 1OY1A 1N2SA 3NANA 1PEKE 2I8AA 4EMSA 1E2JA 2FMKA 2RGEA 4MW7A 2BYTA 2GEJA 1YTLA 2HWWA 1J1UA 5A9TA 4Y1GA 3VMFA 1AT1A 3CLUD 3IP6A 4OV6B 1UQTA 3ASUA 4C0JA 3NIDB 1X92A 4A4DA 2WYOA 2C42A 2V0CA 1JEYA 2FZ5A 3V4OA 2ZDHA 2JIPA 3I39X 4REMA 5C4IA 4JSRA 3DLAA 3UOAB 2OXRA 4Y6PA 4X1KB 1JLSA 3HYSA 4XYEA 3NTVA 3SNKA 1RZUA 1YR6A 4FR5A 1QFXA 1AA6A 3QKWA 1S8NA 3E6AA 1RJGA 3L8CA 1YQGA 3WGMA 3X1MA 3VJRA 2UUBB 2PGIA 3VKGA 5CJPA 2JB9A 1F06A 3G89A 3TL6A 3BWDD 3DQZA 3V1UA 4XB2A 2YWDA 2ZKIA 3KE8A 3MWGA 3U4IA 3KD3A 4I4LA 4JQCA 2OMEA 3CZ4A 3VKWA 3VZRA 3RNLA 4JYMA 4JUAA 1UOQA 4XQ0A 5AVWA 5JCJD 1KAMA 3UWOA 4ARZB 1USKA 4DA7A 1EPUA 4JJZA 4U2FA 3ET4A 4EELA 3H9BA 3IQHX 3K5PA 5KHAA 3T35A 4ZYWA 5C51B 2ZGVA 2AW3A 2W6NA 3N07A 3ISVA 4W7IA 5DO9A 5BR7A 1ATZA 1CRWG 4QVKA 4FEAA 1DPFA 2Y66A 2FXVA 2X9VA 4QASA 3VR5A 2DQSA 2FWIA 1W5EA 2P4QA 1NY5A 4XIJA 4XWTA 5HILA 5HMMA 1QF7A 1X2BA 3AY6A 3V33A 3Q3JB 1SZDA 2AOXA 1CQIB 2YHIB 1GRCA 3I2YX 4QDXA 2ZT5A 1P1BA 3ZE7A 4E5PA 1WV0A 3DBVO 3H2SA 1UBRS 4HS9A 5JXHA 1LSSA 1WA5A 1WETA 1WL8A 4OH1A 3E35A 1UDRA 2OOKA 3MS7A 3FAKA 2H9YA 3TYXA 2VXYA 3W04A 4UQOA 4YAEA 4E4YA 3DLCA 2JDIA 4V1CB 4DTIA 1YQEA 5BT8A 2O3SA 1JLKA 3QBDA 3TRIA 2JAQA 1C30A 2Z8ZA 5IC6A 2NU8B 1BSVA 2ZI7A 1LK7A 2EERA 1OHHA 1EVZA 3C39A 3DHWC 3V4PB 2AMJA 1S9HA 2YDYA 1Z83A 4RHEA 1M7BA 2PKWA 1BEEA 4ZHQF 2XEXA 4GMHA 1FW8A 1LRJA 1T1IA 3WR5A 3WLMA 1ZK4A 4RZQA 5EGNA 2C2KA 4UZEA 5DU2A 2I4TA 3SCZA 2ZS8A 1ORVA 3AOEA 3PUZA 2OGSA 4UMFA 3QNUA 4CMBA 1J5EB 4QM6A 4LYGA 2FKAA 2RGDA 5JS2A 2RH4A 4FTWA 5JJ5A 1XRNA 3DGFC 1SXGA 3ROQA 1WW2A 3T7SA 1TADA 1OT3A 4KJZA 3BD6A 1AUVA 3QQ5A 4YPVA 3SSMA 3QYAA 4YP6A 2DPXA 3ZBTA 1XVIA 5JEEA 1P4JA 4M9UA 5JJBA 2V03A 1HZJA 3DR3A 1N2GA 1W5BA 3VO1A 2GARA 2NZ2A 4JBWA 1U90A 4I50F 3TGWA 3M1IA 4MGEA 5D1NA 3O47A 5AI5A 4IHAA 1NP3A 2E6UX 1RQ2A 2YY6A 4JC8A 5FJIA 2ID8A 2ONJA 2Q07A 5CXSA 2RHDA 2I65A 4E2YA 2PDAA 1SNYA 2PZ8A 4Q1FA 5P21A 3W2IA 1AKUA 4F9EA 1H4QA 4HDRA 3UCXA 1Y3BE 1U7ZA 1MEJA 3L5OA 4KXWA 5EERA 4RK4A 4NULA 4N47A 1EWYA 3Q98A 1ISJA 2JA1A 4R5MA 5L4LA 4N6OA 2VT2A 3DAOA 4XFKA 5FWDA 4QBIA 1G3IA 4LCBA 1QFZA 3JQAD 4XVQA 2GPTA 5FWXB 1U0SY 4JELA 3H9GA 1CP3A 2CZCA 2WBLC 1NVTA 5AW6A 3MZ0A 3ZCRA 1QRTA 1SOWA 3UCFA 1CUBA 3B8EA 4MV7A 5FWAA 1VKHA 2D4HA 3BMOA 3TO5A 1BJRE 1BWSA 3DOHA 4MR8A 1LSUA 2IITA 4X3PA 3RVQA 1EFLA 2HIMA 4Q15A 5DBFA 5E4TA 1XWIA 4RK6A 4G26A 4CMEC 1A2QA 1GZUA 3IHWA 4WUTA 5JD6A 2JIZA 3QA9A 4KJXA 3BJRA 3WBFA 1WXEA 3AJDA 4WLNA 3V00A 1YE3A 1TC1A 1E6EA 1KS2A 2UDPA 4HAOA 3LECA 3W4IA 1KO7A 1BHO1 2XF8A 3RTEA 5FTLA 4US2R 1B0PA 4X7MA 1FYDA 4BMDA 2NU7A 1KKUA 3EC2A 3HUDA 3IB3A 1AGRA 4MLDA 1B15A 4V03A 3E03A 1N0WA 5BOVA 3X0DA 5HP4A 4FKMA 3LJKA 2G0NA 2PGNA 1YKSA 2PXXA 2FUCA 2VRCD 3EQ6A 4OXKA 4PC6A 1N9GB 4LZLA 3ONDA 3JD2A 2WVHA 1LI7A 1U9JA 3LWNA 3U5ZB 2C7PA 3HYRA 3OM8A 1W2GA 3FSJX 1B1CA 1R4MA 1G8GA 2WVJA 2QRHA 3A58B 1R0RE 2JFQA 3KM0A 5AVSA 2Z9BA 1D6SA 4LBYA 5K0TA 3N53A 5IAKA 2BFCB 3CTPA 1P4RA 3DEFA 1QMGA 1U0LA 1AUPA 2BR5A 3DMPA 4BQNA 4UMEA 1O1YA 1EKXA 2ZT8A 2XOXA 3DOUA 2OYSA 4BE7B 1H0SA 3KQVA 4QOJA 2GK4A 5AH0A 1YK0A 5DGDA 1PWXA 3R76A 2BKAA 4W5JA 5ALQA 5I7OA 1OWMA 2AXNA 2D8AA 2HFKA 1RAAA 5FYQA 3RS4A 6AT1A 1NVVQ 3G2HA 3N0VA 4GZ3A 1C81A 3PNKA 4JNCA 2QZJA 3ZGOA 1XLWA 5FV7A 3PITA 3NHPA 3HA3A 3FCOA 4NDAA 2ZQYA 5DT9A 3TS1A 3VI3B 5KNDH 1TO1E 1FXWA 2I3GA 1KK3A 3C3PA 1FP7A 3D3EA 2PMKA 1II8B 1XEXB 3CX6A 4H4EA 1CZUA 3WLRA 3K1JA 2HU7A 4J4HA 2R62A 1GGMA 1OZAA 3U7RA 3EXFA 1FFYA 2I6TA 4DLYA 1WW3A 2IHBA 4XYBA 3GRUA 2CLSA 3HPQA 2JCSA 2IU3A 3I2JA 3LWDA 3A6PC 4I4CA 5A9SA 3T3IA 5ISMA 1IATA 4AFNA 4E4RA 2FSGA 3H8VA 3IL2A 5LDGA 3DVLA 2PVPA 4YONB 2GDZA 2C7BA 2VWHA 2AOUA 1ZK2A 2BCEA 2ZSJA 4MYHA 2Q41A 3PTZA 3H1EA 1DAOA 1S9DA 4NXNB 2F1IA 4MIOA 4O5OA 2J3LA 3A6LA 3MFQA 1DC7A 1WMFA 4DG5A 1KC1A 1H85A 4M0PA 1H05A 3MT9A 4RZXA 4KWEA 2RGAA 1R8XA 4YUXA 1G7RA 1WP4A 5IYZB 3BWBA 3NOXA 4JWTA 5FBWB 4C4XA 1R0ZA 3T9BA 3KDPA 4XVRA 4TKMA 1XPUA 4TL8A 4U39A 4A8JA 1G1AA 5AM5A 3GDOA 3LVQE 5IZCA 3GPDG 1XALA 3IIMA 3OQOA 3LLVA 2D1SA 2G63A 3SYLA 2GBLC 2LCQA 1HMYA 2HAEA 4PF1A 1JR3A 2X3UA 3AUSA 1FCJA 2EZTA 1PT9A 1YGPA 2YZKA 3BWCA 1L5HA 3AT1A 4QEKA 2VPYA 4V0ME 4P8RA 4WKPA 3GWGA 1QK5A 4L08A 4DCOA 1NMXA 2ZXFA 4ZPJA 2VDUE 2DPLA 5FOUA 2JLAA 1HETA 2CHQA 1E2BA 1V1RA 4JJ6A 1WMAA 3RU9A 1VLVA 3IAAA 1VQ1A 4R3UC 3KU4A 2MSKA 1BXKA 5DMHA 2VPXA 2XBLA 4DLNA 3JQGA 5E8RA 1IDOA 2QTNA 1M2VA 2IYVA 3MBKA 4GPD1 2W2KA 4OLHA 4EO9A 4Z2YA 2UXDB 5F78A 5D51S 4B43A 1V0JA 3G6WA 3DVRX 3OFVA 1G5TA 3VV2A 1O5TA 2B7LA 2FTKE 4E6PA 2FWAA 5CBPA 3OCYA 3N05A 1GRQA 2AEJA 3TSOA 4QPJC 3WIDA 2MJLA 4S1VA 2A4KA 5EXPA 4JC5A 4D3FA 1N8NA 4DA0A 1P5FA 3ZDEA 1KEZA 2EXXA 2GERA 1OIXA 1N5LA 4NU6A 4HAVA 4TMXA 3E3MA 4UU8A 5JLAA 3O3NB 1KJIA 3R9XB 3GO4A 1NBWB 2CXPA 2F2TA 2ILTA 3L1VA 4Q7LA 4CLRA 5CYFA 2D2FA 2PL9A 1SU8A 3V2UA 4KMSA 1GAWA 2VR1A 3S4YA 4K6MA 3U4QA 1G2PA 3ON5A 1AB6A 4H35A 1TYZA 4R5HA 5IBPA 1NRJB 1YA4A 2ID7A 3EOBI 4JEMA 4GP9A 5MN4A 1F17A 3OT1B 3OEHA 3Q72A 1SHLA 4HNHA 1WTCA 1XEFA 2DHCA 4OHYA 1B8NA 1XWFA 2P2GA 2WSLA 1F9EA 4LUCA 3UJHA 4Z0PA 2CE7A 3WGYA 4EFMA 1YDHA 2PCJA 1TYCA 3DM9B 5DBOA 3PKJA 4U7PB 5H16A 3CY6A 5TEWA 2IEDA 1NM5C 4QHYA 1CFZA 5T67A 2XSZD 2FX2A 2AQIA 3TPFA 1U0GA 2TS1A 1GGNA 3PX3A 1JALA 4TN5A 4D9CA 2HRBA 2G40A 3NFYA 2NXCA 2Y0BA 4Q6WA 1TKCA 5L3VA 2VBGA 2YR0A 2V0NA 2RGWA 4B2YA 2BEVB 2B7CA 4MGYR 1D5CA 2IHYA 4DY4A 2XECA 4EHFA 4I55A 2GNOA 1G20E 1SH7A 1OC2A 5K8VA 4M60A 2A94A 2YWRA 1Z06A 3JWEA 3NB0A 4Q3AA 4V24A 4B3XA 3PRHA 1J24A 2BMWA 3EUWA 4QUHA 1SBQA 4R2KA 4DXDA 3PCTA 2C4KA 4UVGA 4HGRA 1NQWA 4DR4B 2XE7A 3NRBA 5HTKA 2Q9UA 2BGKA 3C8MA 3GMSA 4ZZ2A 1MPTA 3URMA 6PFKA 2B8NA 4JHLA 2PA0A 4LX8A 2FP4A 3DZ8A 3WWZA 1ZJ4A 4IIEA 4LWOA 1EK6A 2HU8A 1QV9A 3K9GA 2B94A 3SE7A 3TEJA 3TTVA 3AJRA 5D6NA 4TLDA 3LQQA 5CT5A 4D3ZA 1SC4A 3G0IA 3JYNA 4XASA 3FOWA 1K6IA 3QU9A 5AHRA 4DPKA 2QYTA 1G5HA 3MMNA 1F4VA 3L7IA 4FEYA 3DE2X 3ZYCA 4CDRA 3R3YA 4EUHA 4OQDA 1KE2A 4YXWA 1N0IA 1SKYE 3C6XA 3VH3A 5C8VA 2V9PA 1KZ7B 3W8RA 1G8JA 4MQ6A 5A0FA 5LD2C 2FF7A 3KUDA 3X1WA 3ADCA 2FEKA 1XRMA 1N6LA 2G6BA 3FCXA 3OLQA 3NAGA 1FLVA 2Z4RA 4IVPA 4MQ4A 5KYYB 2HQOA 3K2QA 3FTNA 2OQRA 3B1YA 3F9RA 4F85A 5D3MA 4IWYA 1IHUA 1H2EA 4L75A 1NAIA 3JASA 3L0SA 3RHTA 5IAEA 3I9LA 1KOFA 5IW8A 1W36B 1A2KC 1YJQA 1YVRA 3PWSA 4ZJPA 1RCUA 3WKCA 1WDMA 2AFHA 4UMVA 1BMFD 1DKLA 4IWXA 1LA2A 1R6BX 2ONZA 2VTVA 3MTAA 4GLBA 4E3ZA 4ZJZA 3GRAA 1G63A 3OE4A 3PNVA 4OIMA 1TK9A 2V3VA 3V2HA 4BFCA 3OUZA 4IJKA 1MRZA 4ZOLA 1EXWA 3KKEA 5AIBA 4KODA 2KLBA 1PL0A 2Q2WA 4TWBA 1X87A 4DCNA 1M2OA 1OV4A 2NLOA 3EGWA 4PNEA 1T13A 4K88A 4BFUA 2JS7A 4TYMA 2AVDA 1U0FA 4I8IA 5LBUA 3UWMA 3WRWA 3Q2OA 1SK8A 3IBGA 3UBMA 4DFDA 3W79A 3ZHBA 1UPTA 3KQMA 4RESA 4F3TA 4KIFA 4J4TA 2C9MA 2F1RA 5K20A 4PX2A 3PC7A 3VV3A 3WB2A 1W30A 5EVJA 1B8VA 2HU5A 1CZLA 1KJQA 3E1KA 5ERGB 5EMNA 3W1VA 4RPKA 3GHHA 3DTNA 3KEOA 4ZT5A 5I9TA 4DCUA 1QZZA 4FHCA 4BPRA 4WMLA 1UANA 3HN2A 5M7EA 3F6YA 5DGHA 1PZEA 1OWLA 3F3MA 4CKYA 4GL4A 2G07A 3K6SA 3IUQA 4TLMB 4IZ6A 3VR4H 4BMVA 4I46A 1YWGO 4Y2HA 1YI0A 5LPNA 1TUEA 4IO0A 3U61B 5EKXA 3ZZ0A 2BM8A 3MJRA 3E15A 3AERB 1LSOA 1YZ3A 3QH4A 5KUTA 2C94A 3T99A 1G0NA 2CUTA 1KXJA 3HGQA 4WY8A 3PCXA 5EP3A 4BVAA 1SKYB 4MRRA 1T8TA 2OBFA 2B4RO 1VPDA 3STTA 3U1TA 1GAJA 1R0WA 1LPOA 3ZDFA 3PGMA 4TZ6A 5H1YA 1E1RD 1YI8A 2J31A 1CVIA 4M98A 2OL4A 3D8SA 4TTAA 4X9XA 2YASA 3LPMA 3DFKA 5JYCA 1ZDMA 1H0HA 3BD9A 3JQ7A 1NNSA 1GZ4A 3OQPA 4Q34A 1AF7A 4H3SA 1TTHA 3NVAA 4G86A 5CYOA 4DMMA 4L8GA 2PX5A 2E18A 3GD7A 3K0FB 4HGPA 5A02A 1P3JA 5KX5F 2HPHA 4B81A 5L3QB 4OFXA 3LDAA 5BO5A 1XFDA 2ATCA 2DJIA 3G3EA 4A9AA 4QGBA 3KYDB 3OI7A 4RTNA 3LIPA 3U44A 3G5MA 1L5LA 4LXYA 3D2AA 2FUKA 1U3VA 1IJFA 3H2IA 4P3XA 3KSZO 1D8TA 2A9RA 2YNMD 4FINA 3UY4A 4HUTA 3KOXA 1PWHA 3EZLA 3G0DA 2H07A 1GPNA 3BJMA 2BVNA 3H04A 5B6PA 1CEYA 4LZPA 3C85A 3IALA 3IQZA 5KWSA 3KTDA 1OLOA 5D3KA 1PFGA 2IYEA 2A1TS 1E5XA 1P6XA 3GJSA 2NZUG 1DDGA 2G4VA 4OXIA 4PG7A 4CT5A 3KJNA 4WXRA 1OX4B 1OYWA 3AWDA 2BP7B 4QUGA 3RADC 1U3UA 1IEVA 2D54A 2WE8A 3VTKA 4B9AA 1G64A 4HZUA 3W4JA 5FUQA 1WD7A 4EW2A 1B16A 1EJ6A 2E5WA 3F8TA 4E33A 4L2IA 1XU7A 3NU1A 2Q7OE 3T5GA 3SHFA 5KCMA 3CMMA 4M1ZA 2WFLA 4OHFA 5G0WA 1K8ZB 3LY8A 3DZCA 3HVJA 4DA4A 4ZN6A 3F3YA 5BWLA 4HB4A 5K3CA 4M6WB 4GRIA 3DLIA 3ONEA 1KZ9A 3R5JA 1PG5A 1KYIA 9ABPA 4LZAA 4RCYA 1VLZA 2JPDA 2JFUA 3OAAD 3E9QA 1EWQA 4OF4A 1I5RA 2OV6A 1I51A 1ECBA 1Z07A 1U6KA 3AK4A 4F2DA 1A88A 1XDGA 3W2FA 3G5UA 4RY0A 5BPHA 3A1NA 3HVRA 1XD8A 1G7SA 4L50A 3EDYA 3FF1A 5K3SA 4RWZA 2FZLA 5AJUA 3SJ7A 1XTQA 3MG9A 2X3FA 3ORHA 3GNLA 2FJUA 4TKLA 3T1VA 5JUWA 2XMPA 5KTSA 3KR1A 3I6MA 5F76A 3UUGA 1Z6YA 2ZSFA 3PS9A 3WWYA 4FJ0A 1NJ5A 2LR0A 5AKGA 1JYFA 4BQRA 5ALUA 3HA7A 4TSRA 2GBLA 3MCUA 2WICA 1EVJA 4U9HS 3ROKA 2IGTA 1F3OA 3ZWWA 2W93A 2HXGA 1YRBA 4FFBB 2RK3A 5IXJA 1W9MA 1D2CA 1O97C 1N6RA 1SBYA 1G8MA 1TDJA 2HRZA 1C1YA 1P62B 3K9LA 3QHPA 3A6EA 3KJEA 4QG3A 1E2NA 2OXTA 1WWKA 1LDMA 3O95A 1V6AA 4LXXA 1QP0A 3ABIA 4J94A 1NR1A 4K87A 3L6EA 4PS0A 1MG0A 3CLRC 2CNNA 3Q40A 2QL5A 1VPEA 3BRCA 5D1HA 3REQB 1WLYA 3M89A 1MB3A 4DBLC 1RR6A 1ZXXA 1SXHA 1A7UA 4C0BA 1Q20A 1N5OX 1Z0FA 4DGQA 4IJUA 1YQQA 1G0OA 4BVLA 4EPYA 5FLXA 4OGFA 1JSRA 3DMNA 2QV0A 5E3IA 1IXSB 5IMSA 4IIBA 3GVIA 3ZE2B 3TPCA 5KQSA 1NNI1 1UDWA 4YJ2A 3Q3GE 2PUDA 1XD9A 3OX1A 4QRIA 5DXAA 2A1IA 2E21A 3UT5A 2WUEA 4D1YA 4EUFA 2CL5A 2F1OA 5DYWA 2JGAA 3L9WA 4D6PA 2O8BB 3KZVA 4N49A 1I8TA 2PA3A 2YOFA 1YQ9A 2P4UA 2XYQA 3RS3A 3F90A 1FFSA 3TXYA 3MRTA 4B73A 4BX8A 1I2AA 2HXSA 1RKXA 3ETJA 1GUAA 3G7NA 3DZHA 2LIVA 1RMQA 1HE1C 1W35A 3ABSB 5BSMA 4N0EA 4BMSA 1A5TA 5A3SA 2YJ6A 3FYUC 4IXNA 2XGJA 1P9LA 3JRNA 2XRMA 3UMGA 5CFMA 4IV5A 3WQRA 2QXUA 2VCEA 2JH9A 4UDOA 4YX9A 5KVSA 1YZNA 4RTMA 3RV3A 3KB6A 4YCJA 4JI8B 4KITB 2P6OA 1K7SN 2YUTA 1NF2A 2HSEA 5DTQA 4KQGA 2RB5A 4NCAA 3Q7QA 1ZI8A 4J3JA 5T64A 3WL7A 1ORWA 2DHDA 4Y6QA 5IMBA 1J8QA 4TXJA 2YIMA 3LOUA 3P4UA 4G4JA 3V8RA 3A2KA 2DVMA 4JR1A 5AR1A 4BLVA 4M55A 4R6WA 2XUGA 3FDZA 4UD6A 3JZAA 1VL8A 1XTSA 2PRJA 3C87A 1T34A 1P81A 2ANBA 3CRMA 3LGSA 2B4TO 1GKYA 1M0WA 4Q03A 4QT4A 1U2TA 4DIDA 3ZJUA 1YOVA 2CJWB 2I22A 1U98A 3H4IA 4FI3C 4NNPA 4WLVA 1JEQA 4N8DA 4B7ZA 3U19A 1HLFA 1E7MA 4Z3KA 3WB9A 5EE0A 1ZMBA 5JD4A 2WIDA 5AKIA 2PIAA 4IYJA 2WJIA 4MR7A 3U4CA 2R7NA 1BTOA 2CC2A 3K30A 1Z56C 5ALXA 2IS4A 1OBVA 3EIWA 4Y2QA 2H2AA 1KZ6A 2AGVA 3AW9A 1SG0A 4XWKA 4N7JA 2AVNA 4LHZA 4MQBA 4UNSA 1ZR4A 4HRYA 3MGKA 5FPTA 1IRIA 2WWXA 2F1HA 2ZJ4A 3VPFA 3FNGA 1CUWA 3IGFA 2JAWA 1NG9A 1J56A 2Z1NA 3KZOA 2ZCUA 4I1UA 3RVJA 3REOA 2JBHA 2O2IA 2C92A 4RLSA 4BLPA 3NWBA 4GMFA 5A3RA 5LYYA 4DWJA 2BL4A 4PFKA 4MQFB 3FKJA 3KZNA 1MTOA 2WG1A 2OGWA 4QYSA 3QELA 1P7CA 2QVCA 4ZVTA 4E94A 2FWMX 5F5LA 4KXFB 2OZPA 1JU4A 1XMVA 1BX0A 1FMCA 2GRJA 2HF8A 2GILA 2JJQA 2PSFA 3ANTA 2BFBA 4IDBA 2IV3A 3ZE1B 5BNTA 1O94D 2GESA 4YRTA 5BQXA 2PQMA 3OY2A 1ABBA 1YS7A 3V4FA 1XRRA 5EUBA 2J5BA 4ZVMA 5EL0A 4CTJA 5THQA 4ZK2A 1JSZA 4RSRA 5HKBA 3RSOA 1GKKA 2KS6A 4I4NA 3S7ZA 1I2MA 2G1AA 4ARSA 1OTXA 4Y18A 1OXTA 1QZ3A 3SBXA 1NLUA 1V2HE 1ABEA 1M2EA 3L4JA 5F73A 4NIMA 1XZGA 4R4JA 5LIRA 4IH4A 3WXMA 1ZG3A 4NAVA 2XR1A 2EZ4A 3E18A 3UJBA 1AGPA 1IBRA 1TT7A 2IXDA 2RGGA 5KOJB 1SUIA 2JRLA 3O5AA 1E2EA 2XBUA 4OQ4A 3BFPA 5M2QA 3IP9A 1TJNA 4FDAA 1T9KA 1T35A 4FFSA 1KI8A 3V34A 3U5TA 3LT4A 5AK3A 3P96A 2V6MA 2EBFX 2C5EA 2V7BA 4J7XA 4KK4A 3A25A 2E2WA 1IQRA 1E58A 1O58A 2W2NA 1EDOA 1JR2A 1GUFA 3ZS9A 1NRXA 1WXFA 5AP9A 2NSYA 4XVHA 2OCIA 1WVMA 3NHBA 4JBHA 1T0PA 2CEAA 1W52X 4RFSA 2KE5A 2WTEA 3QVGB 1T5SA 3ZHUA 1L5ZA 3WGHA 1Y9AA 3AETB 4WK4B 2QBYB 4IUCS 1N57A 1PZXA 3DZDA 5UKDA 3LLMA 1ISMA 4NYMQ 2V7XA 3PT5A 3F4LA 4AY5A 2FUEA 1JDNA 4Q4AA 1V9CA 3MJHA 4LTMA 5ALWA 2C7QA 4OHWA 1M5UA 3DJYA 5LU8A 5CX1B 1CUCA 1LGYA 2HF7A 2L18A 3T7AA 1G4UR 5ED0A 2VZ8A 3FOAA 3MCWA 5GONA 4CUZA 2HA4A 3IT1A 4CT0A 4RIEA 4WNAB 1MO4A 2GPAA 3SR3A 1BGWA 1XKLA 2H3EA 2PO5A 2ANCA 2YYYA 2I71A 2CSXA 2HCBA 4D92A 1HFEL 4C6SA 1E2PA 2M6SA 3GLIB 1FFBA 3E3LA 4L3VA 4HWSA 4JQYA 2GK6A 3ELWA 1SKUA 3PJFA 2Z3ZA 1SU7A 4ZO9A 5TF4A 1RM4A 1FDUA 1CG6A 1NU6A 5CFOA 3OHSX 4UTXA 1LJUA 4K6HA 4XGIA 1M8FA 2G67A 4FIDA 3JQBC 3S2GA 1COWA 1BA2A