1NAIA

Udp-galactose 4-epimerase from escherichia coli, oxidized
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
molecule tags Isomerase
source organism Escherichia coli
publication title Crystal structures of the oxidized and reduced forms of UDP-galactose 4-epimerase isolated from Escherichia coli.
pubmed doi rcsb
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1995-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1naiA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1naiA01
1N7HA 1U7TA 2O3JA 3ZN2A 1VL8A 2YFHA 2PKQP 4UUPA 2UYYA 5K6AC 4GMGA 4XEHA 4W9NA 2R2GA 3M2PA 5DT9A 3TZHA 2BI7A 3ZCXA 2X22A 3PJDA 1KOLA 4GLLA 8LDHA 3VHRA 1UAYA 1LSUA 1P1KA 4ITUA 3GUCA 4J1TA 3U5TA 3FWZA 4GLOA 4JX8A 2GN6A 4DBZA 4FQ8A 1LUAA 1ZNQO 4PRLA 3KOUA 4BKUA 4TKLA 1JW9B 4GPD1 2NTJA 3BTVA 3GFGA 4BO7A 2B4RO 2PD4A 4UVDA 1VJ1A 1BSVA 5J23A 2CD9A 2FPIA 2CF5A 3RD5A 2Y1EA 4ID9A 1PQUA 3PZBA 1XLTA 4DRYA 3AU8A 3LT1A 3CUKA 1MLDA 3DAPA 4IJKA 2ET6A 1UZLA 4R9SA 3JSAA 1F17A 3I4FA 1XU9A 4LVCA 4UREA 3PJFA 4FBGA 5DDIP 2BD0A 3H3JA 1R0LA 2YV2A 2NQTA 3QWHA 2WYVA 3UCEA 3WFIA 5JAIA 3P2OA 1PJ4A 3QWFA 2YDYA 1JVSA 2V6FA 1H0KA 1FDWA 1E3WB 2GZ2A 2W2KB 4KUHA 4IQGA 2D5AA 2WD7B 4FSHA 4GX1A 3DZKA 4MVJM 4D42A 4NPCA 3U4IA 2AW5A 3CINA 5IDWA 4LRSB 3DZIA 2EIHA 3AM3A 3L77A 1U2DA 3BTOA 2D5CA 1JA9A 1N2SA 4AJEA 2XXJA 3T7CA 1M6WA 5G4KA 4WLUA 1WP4A 3UHAA 2PZJA 3GG9A 1L1FA 1ZSVA 1Q7BA 1JLLA 3WGOA 2O2SA 4DGSA 3ABIA 3W4KA 4JJIA 4AJKA 2B36A 3O8QA 3ZH2A 3Q0EA 1AHIA 1ZK2A 5LCXA 3JQ7B 1DAOA 3JQAB 4CM9D 3DWFA 1U2GA 3R6DA 4J3FA 3GRPA 4YJFB 2E4AA 3M2TA 4J4HA 4UEJA 1C1XA 3DAFA 3OIFA 4U6QA 1ZZEA 3VH3A 2WYWA 1UP6A 4NIMA 1ZK3A 4DBVO 3WIEA 4CR8A 4PLCA 5JO9A 3C1OA 3K2EA 4CMJA 4LCEA 4S3MA 3QVSA 1YBAA 3ORFA 4M1QA 4E3ZA 3PP8A 4MJLA 5THKA 3ZZNA 5AXDA 2C07A 4CR6A 1PGJA 4CMIA 4DMLA 3E82A 5JNLA 2Y1GA 4UUMA 4QT0A 1X15A 1VRWA 4FC6A 1Y8QA 2HCTA 3U4DA 2VWQA 3O8QB 3TN7A 1ZSYA 4RVSA 3DC2A 3IDSA 2AE2A 2OZPA 5L7WA 3ZWCA 4EEZA 1F12A 3LC7O 5TSDA 3UCFA 3WJ7A 3PJEA 3KUXA 4I08A 4P4LA 3ZWNA 1R6DA 5TNXA 4E2WA 2V6MA 3PQEA 4DIBA 1JAYA 2LDXA 3OJ0A 1EMDA 3GVPA 1YB5A 4PGFA 1K6XA 5I7EA 1X7DA 1FDTA 3P5SA 1M76A 4GSLA 2Y1FA 4TMFA 3OBBA 1NAHA 1C0PA 2WJPA 3ZWXA 2VWPA 2EGHA 1NX6A 4NFSA 1NPDA 4L9RA 1NFFA 2QYSA 3KLPX 5JCJA 5G4LA 2JD1A 1Z7EA 2OOSA 2EKPA 4F45A 1HE3A 1NR7A 1ZH8A 4WLVA 4TVOA 1KERA 3SEFA 5GZ1A 4TVBA 1YQXA 3EVTA 4LSMA 3HDHA 1DC3A 2P9CA 3BHJA 1BXGA 3GVIA 1O94A 4MP6A 2P5YA 3H4VA 2EP5A 3TDKA 3UN1A 1BG6A 1IUKA 3QA9A 2Y1CA 4CL3A 3DR3A 2BGLA 4YQZA 1X7HA 4D3FA 4L74A 3BHMA 4QQRA 3ZWAA 5B4VA 2J8ZA 5ITWA 3AOGA 5CPBA 3H9QA 4R51A 4Y6SA 4AJJA 1E5LA 4Q3NA 2XF8A 4ESOA 2B35A 1ISGA 1HLPA 3MJ4A 2C0CA 4YAKA 1LDMA 3JQAA 4PLFA 2A94A 3HADA 2HUNA 2DAPA 3WGQA 3WG9A 4CLHA 4DIFA 4ZGWA 3BMOA 3HN2A 5BSHA 4R69A 3WSWA 1V6AA 5GZ6A 1B16A 1I3LA 2I9PA 4RPKA 3JD4A 4NBWA 2WD8A 1JU9A 2JHGA 3QJ5A 2DLDA 3EMKA 4YRDA 1T1RA 3GZ4A 1RKXA 4ZQHA 4BGEA 3AY6A 3ANLA 3EUWA 3ZV5A 4MKXA 4XQCA 4BL5A 4I9HA 1J49A 3RFVA 5H81A 3S2IA 1GUZA 5KJ1A 4H15A 1ZBQA 3D5QA 4L4XA 4XGKA 2HMWA 1ADCA 1H94A 4RZIA 2HRBA 2RHCA 3DBRB 3DBHA 4I9NA 3GGOA 1N92A 2PY6A 4XR4A 3OECA 1LXCA 5A04A 3L0DA 1VI2A 2EXXA 1H6CA 3WNQA 4BNMA 4CM8B 4KMSA 1A71A 3D4PA 4U7WA 2VZ0A 3WGGA 3E9NA 4NJMB 4DYDA 4KTTE 1TA4A 3JYOA 2DTXA 3B1JA 1PZEA 4J43A 2VYND 1X0XA 3NEPX 2EEZA 4Q3CA 1QORA 2EHDA 3KEOA 2VT3A 3JQAD 4K28A 1V3UA 1I30A 4XD2A 5EINA 2HSDA 2I67A 4ZQBA 5JYEA 1E3IA 4GSKA 4XB1A 2OUIA 1DRVA 5B12A 4TROA 1Z82A 1H93A 4PFJA 3BZUA 4MVJE 4RPGA 5ENVA 1LJ8A 4LGVA 3OJLA 1LLCA 1C1DA 3EYWA 3ASUA 1NQAO 3AUTA 3CKYA 1C0KA 2P4HX 2VOJA 4CJXA 3DMTA 4N7RA 4XB2A 3RJ5A 1GCOA 1D7OA 4KQXA 3FPLA 4D44A 1EVYA 3MJEA 7MDHA 1E3LA 1W4ZA 3IUSA 3KZVA 4BGVA 3F3SA 2QZ9A 2BELA 2UV8A 3PWZA 1F14A 4MVJD 5LC1A 2FY8A 5JCJD 1T2FA 4LCJA 4DC1A 3GEGA 4Z0TA 3QVTA 3ZV3A 3LSYA 4WJZA 1E3WA 3V1YA 1VLLA 3GLQA 4R1TA 4Q3DA 1BHSA 4YRAA 3MZ0A 1WZEA 2BGKA 1LDBA 2O48X 4IGFA 4BNTA 5TIIA 1M67A 2I3GA 1NBOA 1X14A 3OIGA 5EN4A 4A2CA 1NYTA 3R0IA 4RO0A 3RUCA 3OHSX 3G0OA 1SNYA 1TEHA 4ALLA 2W2LA 2OBYA 4BNKA 3EW7A 4RCVA 2ZB7A 1EEHA 4EITA 1T4DA 2VUSA 1V9LA 1DC6A 1YJ8A 3UXYA 3TFQA 3DZFA 2BF7A 5LDHA 1ZXLA 1Y5MA 1UXGA 4MIOA 1PU2A 1ORRA 1I10A 1QMGA 4DMMA 2C5AA 3TNLA 4XYGA 2AG8A 1E0DA 2PZLA 3AOEA 3FI9A 3KYBA 1B15A 3QHAA 3JQCA 4Z9YA 4PLGA 3VPXA 4E5YA 3RBXA 4J0EA 4ZRNA 3FRJA 2Q4EA 2X5JO 3KEQA 4YB8A 4NR0A 1D1TA 1SC6A 2GCGA 2JHFA 4CM4B 5JDIA 2X9GA 4XGIA 1X0VA 3QWAA 4WPGA 3EVNA 2HO5A 4IDGA 2C7GA 1ISMA 1Q0LA 3DBHB 4CM9A 2EERA 4BVAA 2DPHA 4GKBA 3FWNA 4OL9A 1H6DA 1Q7CA 3C1TA 4OYRA 4OHUA 2AQ8A 4U0KA 3U49A 4II2A 1O6ZA 4D3DA 1M2WA 3F5QA 2ZTLA 4B7UA 1W0CA 5JPIA 4CV2A 2IODA 1M75A 4INAA 2V6GA 3NTOA 2YHUA 1U3TA 1YWGO 5TQVA 4JCOA 4NK4A 4J7CA 3RBVA 5I9NA 2C59A 1GZ3A 5G0VA 1DHRA 1G1AA 1QYXA 1K3TA 3U9LA 3ZWPA 5CDYA 4IJVA 4FS3A 4O6VA 2DBQA 2BH9A 5FWNA 2ZATA 3VOSA 3I9OA 4YJGB 1NM5A 2VQ3A 1B8PA 3L4SO 2HKIA 3LT2A 4KWHA 1JDJA 2AEJA 4M55A 1NFQA 4ALNA 1I2CA 1A9YA 1DFIA 4AJPA 5AQ1A 4UVEA 3VVCA 1S6YA 3HDYA 4JBHA 3PDJA 4D46A 4BGUA 5C37A 5DCWA 1O9BA 1R66A 4J90A 3LT0A 1M66A 4HFNA 3U4CA 1XCBA 3NT2A 3JQEA 3L6DA 2QZZA 3C1AA 1K2WA 4EBFA 1GUYA 4E4YA 1YKFA 3D0OA 2P9GA 2DBZA 5T5QA 3WLEA 1VL6A 3F1KA 4TRNA 5A9SB 5KOIA 3JQDA 4BOYA 1EVZA 3K9QO 4EJ6A 4TZKA 4L8VA 3HNPA 3MJCA 4DYVA 1XSEA 2Y05A 2ZYGA 3K5PA 1JQBA 1LRLA 4CV1A 2IYOA 3DDNA 2H1SA 4OXKA 4YJGA 3RI3A 5JO0A 4YTEA 3DBRA 1RM3A 4PG5A 2G5CA 5CPFA 1HDRA 1LLQA 4D45A 3ETEA 2JL1A 3CH6A 1RM0A 1XG5A 4WUVA 3JQFC 2D4AA 5IXYA 1U5CA 1UUFA 3I1JA 4HFJA 5CEFA 3BIOA 1WW8A 1Y9AA 4Q3BA 1Q0QA 4KUGA 1ZUD1 5DNAA 4CMHA 5LDGA 4FFNA 2P5UA 3VZRA 1ULUA 3O26A 1J5PA 3EY4A 1UDCA 2ZB4A 3N7UA 3PQDA 1QYCA 2XXBA 4FFOA 1ZW1A 2QIOA 1X7GA 4NHEA 1VJ0A 1QP8A 1ISIA 1PJ2A 4WLEA 1P45A 2DQ4A 5DBFA 4MVJG 4PN3A 3KM0A 2DKNA 3VC7A 4CM5A 3ICPA 5DOVA 1FDVA 2Q1UA 4O1MA 1J6UA 3QIVA 1NPTO 2VWGA 4J1NA 3G79A 1GAEO 3SLGA 2NTNA 2RHRA 4ALMA 4HKTA 1GDHA 4WLOA 3CE6A 2PZKA 2B83A 3AUSA 3DO5A 4FC7A 2ZTVA 1N7GA 1DOHA 5JXWA 4LMPA 3E1KA 5FEUA 1R4MA 1HSZA 1PL8A 1B3RA 1EVJA 1MA0A 3RAJA 5GZ3A 3EHEA 4B4WA 3E03A 3MJTA 2AA3A 2NSDA 3R3JA 4NJOA 5I8WA 2EJWA 2QHXA 4C7KA 3NDRA 4A0SA 4BV8A 5DZSA 1RM4A 1HYGA 2A92A 3G17A 1ZFNA 3F6YA 4KQWA 4QECA 1GEEA 1B8UA 1DIGA 4CLOA 2Q1SA 1J4AA 2ZJ1A 3KLMX 3OIDA 4CQLB 4AJHA 3I83A 1ONOA 2YY7A 2IXBA 4D7AA 2H6EA 1R16A 1E1KA 3LVFO 4QTZA 5A5EA 2AXQA 3AY3A 2CZCA 2WSBA 3OETA 4IJUA 3GDOA 2YQ4A 4D0SA 4HUJA 4IZHA 4LW8A 3K73O 2C5EA 3RU9A 4K6FA 4YJDA 4AJLA 3SVTA 1P1IA 5EMHA 3ZI0A 5JMPA 5AXBA 1I2BA 1RYDA 4A5OA 2NU7A 1ZK1A 2WWRA 2A4KA 1CQIA 2GRAA 3AWDA 4UAGA 4RPHA 4BQRA 1H5QA 1YOVB 4ZQFA 4IMRA 3LC1O 1W73A 5KVQA 1U3VA 3OEWA 3DTTA 4C4OA 1NQTA 2W98A 1U5AA 2B5VA 1KEUA 3DMTC 5T6BA 2OBNA 3ZWYA 4CMIB 3ON5A 2QYTA 3F46A 4XGNA 4PLVA 4IQ0A 3K31A 1MX3A 1E7RA 2Q3EA 2VNAA 4TRJA 2YQ5A 4BIIA 2PZMA 3O4RA 3DHYA 1YB4A 3JYNA 4N5NA 4NI5A 4PVDA 4WLNA 3BMQB 5EQDA 1LLUA 2ZQYA 3Q3CA 2PGLA 1QSGA 1SPXA 3MJVA 3RC9A 2F1KA 4FJ1A 2QRJA 1OOEA 4M89A 1FDSA 3QLJA 4YCAA 4OKNA 2X4GA 2DPGA 2HMTA 1DHTA 1R12A 4BGIA 1FK8A 1PJTA 1IPEA 1GQYA 2X8LA 3NTRA 1B0AA 1PWXA 4OH1A 4D3SA 3VZQA 2NM0A 2OP1A 4R01A 4B79A 2XPCA 3Q11A 5U1PA 3C3XA 2BFMA 3AFNA 4FD3A 4J0FA 3BMNB 3HUDA 1SB9A 3HDQA 4CM3A 4CLRA 4PZDA 3G1UA 5T8KA 1D4FA 2J3KA 3OA2A 1H6AA 3GPDG 5JDCC 1A9ZA 1P77A 4BO1A 1PWZA 5JS6A 2UVDA 3BYZA 2YDXA 3HG7A 4O63O 1T2CA 3E9MA 2OMEA 3UVEA 3RFXA 2X58A 3JD2A 1T2DA 1NHGA 3R3SA 4BNWA 4PLTA 3KSDO 4IDFA 4LISA 1DIHA 4DA9A 4M86A 2CUKA 1UH5A 3I6QA 3GZNB 3Q2IA 4AJ1A 3MWEB 1LDGA 2FR8A 3WQQA 1PR9A 1JKIA 4XYMA 2HQ1A 4M54A 1DLIA 4E31A 4YBZA 4ILKA 4KZPA 2IYPA 7ADHA 3C7AA 4PLHA 3VZSA 5A9TA 5CAEA 3I4CA 1PJBA 1DXYA 2ZTUA 3D64A 2GERA 1DLJA 1VKNA 1YQGA 2YUTA 4FGSA 1ZCJA 1WMAA 1ML3A 3HE3A 1KIFA 3B70A 1WMBA 4B3JA 5FYDA 4DLLA 3B6ZA 4XWYA 5DBIA 3CTMA 1ONNA 4W82A 4ZQGA 1IHYA 2EG9A 2FR0A 3VH4A 5JCXA 2RBEA 2VNSA 4ND5A 4J4TA 3C24A 3E48A 3SC4A 1PGQA 3VH2A 5I9MA 3GVCA 5L3ZA 4LRTB 1HRDA 1LA2A 1BRMA 1K6IA 4YAGA 4F46A 3FNFA 2NLOA 3ZNQA 1HDCA 2Q50A 1BMDA 4HWKA 2Y1DA 1AGNA 4BNFA 4E5MA 3ITDA 3D4NA 4GBJA 3ROQA 3K2BA 5FI5A 2IEDA 3H5RA 3KYDB 3PI7A 3UCXA 2YHIA 4CQMA 5KVSA 4IINA 3U62A 4WEQA 1U1IA 5JC1A 3DFUA 4HNGA 4XDYA 4FDAA 1KETA 4Y67A 4B3HA 3C85A 1KY5A 3CZMA 2ZB3A 1SBYA 1N1GA 3GDGA 2VHVA 4AFNA 4DXHA 4Q3AA 2B0JA 3ITKA 2Y67A 5JDCA 3DBLA 5EPOA 1WLYA 5T57A 3GH3A 1AE1A 1I36A 1WAMA 3BMNA 3TJRA 1UXHA 4R5MA 4CLRB 5CG2A 2PD3A 4DC0A 2B37A 2BLLA 3TL2A 1XWFA 3GMDA 3LDHA 1V3TA 1Y7TA 2JKVA 2ZYAA 4TKMA 4XJSA 1TI7A 4FR5A 5AYVA 1HE2A 2UUPA 1ZK0A 4FFLA 3T7EA 3GC6A 1R4MB 1SAYA 1HWYA 4P38A 2B5WA 3FN4A 2V65A 4OSOA 1CYDA 4GVXA 1WPQA 2BFAA 1XQ1A 2YYYA 4J1QA 4NNJA 5TF4A 3RKUA 2JCXA 4XCVA 4AJIA 1EK5A 5A9SA 4ZVVA 3ZNNA 1YL5A 3ZHXA 2P4QA 5DCUA 4R9RA 5JAQA 5KKAA 3L6EA 2RIRA 4AJOA 2GNAA 4BO9A 5B1YA 2Z5LA 1YVEI 4DPLA 2P9EA 4WCFC 3AM5A 2Y0EA 2CVOA 4HY3A 1TT5B 2D59A 2EP7A 4MINA 5K9ZA 3GZNA 4I5GA 2B4QA 4NBRA 2NUAA 1PS8A 2POQX 2UAGA 4XKJA 2Q49A 5C7OO 1XQ6A 4BNIA 5ICSA 4DQXA 1NTOA 3PHLA 4E5PA 4IUYA 4OQYA 5AXCA 4DIOA 1L7DA 1YQDA 2VHYA 4OOFA 5IAAA 3UUWA 3GUYA 4ZRMA 1MG0A 3TWOA 1NHWA 1YO6A 4CM6A 2IZZA 1BW9B 1ZO8A 4RZHA 2C20A 2B4TO 2VYVA 4YT5A 4EYEA 1HE5A 1U3UA 1SMKA 3DOCA 4S1VA 1EE9A 3JQGA 1SZJG 2YZ7A 1ZEJA 3V2UA 4LN1A 3VH1A 3O9ZA 1JWAB 2O3RA 3JYQA 1FMCA 1HYHA 2ZQZA 3HB4X 2EKQA 2FN7A 3M6IA 4A10A 2YW9A 4D79A 2X0IA 1UDAA 3VPSA 3RUIA 1H6BA 3KYCA 3ONDA 4P8RA 4RQTA 5EL0A 3KHUA 3DHNA 1UZNA 2RH4A 1PZGA 5T67A 5HRUA 4R1UA 3FR8A 4GH5A 2FMUA 2CDAA 2Q4BA 1IYZA 4QSMA 3RSHA 1NQOA 2HK7A 4EUFA 3PYXA 4IDBA 4FN4A 2CDCA 1R4NA 3WMWA 1GTMA 5KIAA 4DLBA 3PDUA 3W4IA 2NU9A 4RVGA 4ZU3A 3PXXA 3LK7A 1HT0A 2GYYA 3H2ZA 3NYWA 1B2LA 5TT0A 2NACA 1CDOA 2P2SA 2GUGA 3FTPA 4PLPA 4IXTA 4MKRA 4QEDA 3S2EA 1EBFA 1VSVA 2Z1NA 4A03A 4BHTA 3GEDA 4WCFA 3VVBA 4AVYA 3K30A 1LSOA 5ILOA 3RUFA 1EFKA 4CUJA 4TRRA 1H2BA 5ILGA 1O0SA 4CPDA 2W4QA 4E2YA 2R6JA 3X2EA 2Y93A 4K1LA 2DTEA 3NKLA 3OJFA 5G4KB 2AHRA 5JY1A 3QVXA 2OFPA 3D4OA 4I5EA 1JKJA 1GR0A 3GY0A 3JQ9C 1P9LA 2OXIA 3W6ZA 4CLDA 1GZ4A 2FWMX 1R0SA 3WBFA 3WYCA 3AU9A 4NBTA 5I7SA 4U6SA 3LZ6A 1HDYA 4JJFA 1YL6A 2CSUA 2Q2VA 4CUZA 5KNLA 4TQGA 3WLFA 1KY4A 4CMAA 2GZ1A 1LSSA 2YV3A 1ADFA 3DB2A 3PRJA 4URFA 1D3AA 2VZ9A 4G2NA 3VTFA 3OA0A 1PR3A 2PKRA 1U7HA 3A4VA 1Q0HA 1R4NB 4NU5A 3WX0A 1MFPA 4RDIA 4IGEA 5CEEA 2F00A 5BSFA 4GX0A 4KTVE 3GK3A 1E5QA 4M8SA 4CV0A 3PTZA 2UDPA 4IDDA 3FNEA 3U4HA 4RF5A 4DVJA 5JY6A 1UDBA 3I6IA 3RUAA 1ISFA 1MB4A 3M1LA 3OQ6A 4NJMA 4BMNA 1KEWA 4Z0HO 1HKUA 1N5DA 3HWRA 3WQRA 3E18A 2J3IA 3DFZA 3ANNA 4JBGA 3WOHA 1XYGA 1ZJYA 3ZGYA 3E6AA 5COBA 4Z9XA 2FR1A 3WWZA 2ZCUA 3N74A 1NNUA 1I32A 1P3DA 3GHYA 4L73A 5L4LA 4RVHA 1C14A 3UKOA 1BW9A 1V8BA 1NVMB 2FPGA 3ROPA 3ZHBA 5TJ9A 1I8TA 1QV7A 5A9RA 1ISJA 2HDHA 4RGBA 4RF4A 1R37A 2X5OA 3B20A 5CP8A 1P33A 1ZXBA 3ZNOA 4KWIA 1KBZA 4CLEA 1GADO 2O3SA 1SCUA 5ER9A 3S1LA 3AI3A 1HDZA 1GV0A 4DREA 4ZA2A 3D3EA 1XA0A 3SXPA 1I3NA 1O95A 4IM7A 3RU7A 1XIVA 2JFGA 4QFDA 3BTSA 1MGOA 2HJSA 2VTDA 4IPTA 1WZIA 1DFHA 1GFSA 1LU9A 4JBIA 1BGVA 4I8XA 4BKOA 1CRWG 4NK5A 2W8ZA 1ISHA 4ZJUA 5AXAA 1B8VA 3BMOB 1NASA 2AQKA 3GVHA 2NTVA 2G0TA 1EQUA 3NDJA 2NU8A 4ZQEA 3KRTA 3ZU3A 1I3KA 2OORA 3GF4A 1TVEA 4JXKA 1LQUA 4FFPA 3WICA 2H63A 1VC2A 5B4TA 2DUWA 3WTCA 2JFFA 1KYQA 2RAFA 3IKVA 4GGOA 3PEFA 5DOZA 4P4NA 3SX2A 1DO8A 1EDOA 1I5RA 4JP2A 3G49A 1QXSA 4E5NA 3QVWA 4L75A 4MVJP 2IXAA 2EF1A 5TRTA 3AOEC 4W9NC 3NDIA 1W8DA 1FJHA 2EWMA 6ADHA 2O4CA 3NT5A 2PH5A 2Y66A 4IDEA 4D41A 2NV6A 1DRWA 4J2OA 1XGKA 2JCYA 2YFQA 3ULKA 3RBZA 4E5KA 3JQ7A 2HRZA 5G2OA 4IQ8A 4PG8A 1YB1A 2CF6A 5L4NA 1I2ZA 4FJ2A 4JP3A 4BNXA 3I23A 1S7CA 5T64A 2D1YA 4UEOA 2V6BA 2TMDA 5BNTA 3Q2KA 3IIEA 1A4UA 2PR2A 5JAZA 3E5MA 1MXHA 3DZJA 3ZU4A 4OAQA 5CDGA 3RC7A 1DIBA 1RWBA 1DC5A 4JN6B 1UXJA 3E8XA 2WMDA 3WSVA 3ETDA 4PVCA 3B1FA 3LT4A 4W7IA 1GYQA 1B26A 3VPHA 4B3IA 2GLXA 4C7JA 4CM4A 2FSSA 1H2HA 2X86A 5JC8A 1JVBA 1E6UA 3H8VA 2WD7A 4G65A 3H7AA 4XYLA 3KSUA 3ZV6A 4BNUA 2C2YA 4MVJA 3OFSA 3BHIA 3P2YA 4IMPA 1P1RA 3M1AA 4CR7A 1ENOA 4BO2A 4KUEA 4R3NA 3BTUA 4XJTA 2EV9A 3MTGA 3FD8A 3PWKA 4CMCA 3MWDB 1YXMA 2G17A 5AOVA 3NAQA 4YR9A 4FGWA 3DOJA 4JLWA 2FPPA 4MO2A 1JN0A 4MDHA 3B1KA 1GPDG 4XRRA 2NVWA 1R15A 5HS6A 4N18A 1QLJA 3OJEA 4EW6A 3KETA 3RUEA 1QG6A 4BQPA 2WYUA 3ZV4A 3OF2A 2O3UA 4EEXA 5JFOA 3TPCA 3GG2A 1IY8A 3MEQA 2C82A 3D3WB 2ZTMA 2EW8A 5CDSA 3A14A 2D8AA 2X0JA 2V7PA 4YDRA 3ZWVA 4CM8A 4D43A 4FOSA 1Y8RA 3I9KA 5COAA 3UGKA 3QSGA 3D7LA 1DSSG 3ONEA 1E92A 4ROSA 3IS3A 2QX7A 1T24A 2GD1O 1I01A 4E30A 3PHGA 3ZWOA 3JQFA 4IY1A 1T26A 5F1KA 3UFXA 4L76A 1AHHA 1ID1A 1YE3A 4PLYA 1T2EA 4J2HA 5KJEA 1VL0A 3DHEA 3GGPA 3TL3A 1QRRA 4Y6PA 1I0ZA 1ULSA 3EC7A 3PFFA 1EDZA 1QV6A 4WNIA 5B4UA 3GAFA 3F5SA 1UZMA 1LC0A 3E9QA 2I5PO 4B4UA 5CDTA 1VKOA 2Z1MA 2VZ8A 3AY7A 5I9LA 1QR6A 2Q1WA 3QY9A 1HZZA 1ZMOA 1LDYA 4MVJI 4IS2A 3RJ9A 5IZ4A 5JMWA 3RC2A 4YT8A 1HSOA 1IHXA 4QO8A 1ENYA 5B37A 3H5NA 3I9NA 1Y8RB 3IMFA 2IDZA 4CV3A 1NPYA 3SLKA 5DCYA 4BNJA 1PEDA 5I7VA 1O8CA 1PSDA 5COQA 2E6UX 1YDEA 3DXFA 5C3MA 4E33A 5DBGA 1GU7A 3ST7A 4GGPA 1XDWA 4Y98A 5A3VA 4ND4A 1PJSA 4J49A 1Q1NA 4MPDA 2C7VA 1WVGA 2D2IA 3JQ9A 1NVGA 4BMSA 1A7KA 4QFCA 3NGXA 4Q3EA 4FW8A 5IDXA 1ZVMA 3BMQA 4ALKA 1DPGA 1U9JA 5JSFA 3WB9A 3ETGA 3PVZA 5L53A 2X0NA 4O0LA 1UXIA 3PFWO 3FPCA 4EGFA 1LX6A 3CMCO 1PJ3A 4DLAA 3DZGA 1WXDA 2QRLA 5ICMA 3IC5A 4X54A 1J0XO 4W4TA 1GUFA 4E21A 3WXBA 4FB5A 1LRJA 3FCOA 5IG2A 1PTJA 4GX2A 1SB8A 1HLDA 1OC4A 3IUPA 2P68A 2PK3A 4BKPA 3U09A 4IJWA 1WDMA 2H9IA 3JQ6A 4O59O 3HN7A 2O23A 3PQFA 4N54A 4WE3A 4RDHA 4BNZA 5F21A 4J7UA 3LLSA 2NVBA 1VJTA 3KO8A 4YAJA 5A05A 3S2GA 2IRWA 5C5IA 5U9CA 1KVQA 1I24A 2VYNA 3NX4A 3FF4A 1PL7A 2HK8A 3HQ4O 3C7DB 3GHHA 2WE8A 1HDGO 3TZQA 1F8GA 3DTYA 3WYEA 3JQBC 3EZLA 2PWZA 4PRKA 1A4IA 1PZFA 3NV9A 3QQPA 4MVJF 2NADA 1X13A 5IDQA 3K6JA 1WWKA 4H3VA 4B4OA 4CQLA 2GASA 5KJCA 4AJ4A 1ZIDA 2CMDA 2WE7A 3FHLA 3LQFA 1PL6A 4OQZA 3O38A 2OO5A 1CJCA 2AEMA 2R00C 3ANMA 2J3HA 4GX5A 3TQHA 1K5HA 4JROA 3OMLA 1PIWA 2EKLA 1AXGA 3ICCA 3HDJA 3PHIA 4IDCA 1IB6A 4Q9NA 4CM7A 5IFLA 5L51A 5KKCA 2DUUA 4F6LA 2DTDA 2I99A 4UULA 3VAZA 1EUCA 1V3VA 3JCZA 1ZMTA 3HFGA 3L9WA 3WGYA 3KYCB 5IN5A 3WFJA 3NT4A 3WGTA 2IZ1A 4Y8VA 1LTHR 3CZRA 4EJ0A 2HAEA 2BHLA 3UOGA 5JYDA 4E2XA 4HADA 3C8MA 1K89A 5JBIA 3EAGA 5G0SA 5T8KC 3L4BC 1OFGA 1YOVA 5TGDA 2Q99A 1HDXA 3PLRA 3UF0A 3IQDB 5F1PA 5BSEA 1BDBA 4XQGA 2X7HA 4YAIA 2FP4A 3ADPA 3DQPA 4M87A 2JFHA 1ZSNA 3FNHA 4BNLA 2W2KA 5EESA 3GMSA 5A4DA 3AI1A 3TF5A 3BXXA 4DPMA 4NBUA 3AW9A 4I9UA 1NAIA 3GQVA 4N5LA 1PGOA 2I66A 4YAEA 5ER6A 4HX5A 3AFMA 2ILTA 4BKQA 5KCZA 4GQAA 1HYEA 2A9FA 3DAGA 4PLWA 1TLTA 5BT9A 3W8DA 4AG3A 3HB5X 3UH1A 1AXEA 4MKZA 1EQ2A 4R54A 1UXKA 1Z73A 4LMRA 1E3EA 1N1EA 3PGJA 3GNSA 1A7AA 3GAZA 3A9WA 4QUKA 2CVQA 3H5AA 4JK3A 3RROA 4J6FA 1GV1A 1MUUA 1Y6JA 1BDMA 2OHXA 4QXMA 2PFGA 5F3RA 3WDSA 3JYLA 4OMUA 2WTBA 2QW8A 1PGPA 1JTVA 1PX0A 3SBOA 1YS4A 4XR9A 4G5HA 3UW3A 1LEHA 2DBVO 3VZPA 1B3BA 5GMOA 2PKQO 3P19A 3R1IA 5I7FA 2VHXA 4HXYA 3GNTA 3F4BA 2A35A 3QP9A 4GVLA 3K96A 1BWSA 4H16A 3IKTA 1E7WA 4LVUA 1U3WA 4RLSA 1Z75A 4K26A 4KDFA 4L4RA 5TT1A 4EUEA 1QYVA 4CMGA 2O3QA 3INTA 3WGIA 2AMFA 5JAMA 4XDZA 5TJHA 1E1MA 3GT0A 2BMAA 4YXFA 3GN2A 3DMYA 4OSPA 5H82A 5KVVA 1GQ2A 3FSRA 3RC1A 3FR7A 3KSZO 4IS3A 4U0JA 5IF3A 4TWRA 4Z3DA 2QQ5A 3RASA 1U8FO 5L7YA 3JTMA 1B7GO 1JAXA 3IOYA 3EDMA 1HZJA 1DRUA 3AK4A 3L4BA 2NQ8A 2X9NA 3L07A 2J5RA 2WEKA 4RF3A 4WCFB 3G1TA 3A28A 2CFCA 1RJWA 5F1OA 1F06A 2P91A 2WDZA 1EUDA 3H65A 4OO3A 1M6HA 4PG6A 3PK0A 5KTKA 1PS0A 1B14A 5BR7A 1NWCA 4R1SA 1BVUA 4R1NA 2E37A 4Z3KA 3CSDA 1TT5A 4GI2A 1LLDA 3DBVO 2DVMA 3OQ1A 4KOAA 4MP8A 3ONFA 1CQJA 1KC3A 2E82A 3PWSA 4NFHA 4UUOA 3DZHA 3OP4A 3RWBA 2O50A 1DAPA 3FBGA 2Q46A 2TMGA 4CMEC 4RORA 3EZYA 4JGBA 2DFVA 1D1SA 2J5QA 5ENDA 4NU6A 3RUDA 4MIYA 1EZ4A 1ZJZA 3HZZA 4MOWA 1OI7A 3WGHA 4GL4A 3TSCA 4B4VA 2ZKLA 1U28A 4ZN6A 1YGYA 4EJMA 2VT2A 5L7TA 3PHJA 3GVXA 4UVHA 5JLAA 1IOLA 2QG4A 4OXYA 4ALIA 1P1JA 4OIMA 1PS9A 1NR1A 1E7YA 3STHA 4BUCA 1GYPA 1OMOA 5A03A 1GPJA 2Y99A 1TXGA 1QYDA 1IZ9A 1QKIA 4GAEA 3AI2A 2BRUA 3NJ4A 2G76A 3QE3A 4IBOA 3V1TC 5ITVA 1I33A 1KVTA 2NVUB 5EERA 4XIJA 1G6KA 4JQCA 3OH8A 5A1TA 3H9EO 2YHIB 2VHZA 2UUOA 3I5MA 1RPNA 4DPKA 1DIAA 2VUUA 3DEYX 3JV7A 3LLVA 1LNQA 4J16A 4B8WA 4EI2A 4DWVA 2Y0CA 1SOWA 5DN9A 3T4EA 3OJOA 3EGOA 1NVTA 4RLHA 4A7PA 2CVZA 3ZHZA 3Q6IA 3PHHA 6LDHA 1KVRA 4NZ9A 1IZ0A 1LI4A 4AJ2A 1CEQA 2QRKA 2J3JA 3U0BA 4JJGA 3RQSA 4YPOA 4J91A 1EVIA 1MG5A 2ZB8A 4ZHSA 1KVSA 3C7CB 1AUPA 4FPXA 4WOJA 5DP1A 1DFGA 2VRCD 1HF3A 3KB6A 5F5LA 4GMFA 5IN4A 2Y1OA 3INRA 4J7XA 3JQBA 4YQYA 2X0RA 1P1FA 5DF1A 3U3XA 1W6UA 3ZW9A 1KS9A 2YJZA 4J1SA 3QVOA 4BNVA 3JYPA 5L95A 1UAGA 3NUGA 4OGWA 5FF9A 4M49A 4BNNA 5IDYA 1EBUA 1Z74A 2VTEA 1PJLA 1ZEMA 2RCYA 4HNHA 3RUHA 1Z45A 1FDUA 3AJRA 1Y1PA 3QRWA 2W90A 4TZTA 1OC2A 3GNQA 1YH3A 3WTBA 1YBMA 4LSWA 4RL6A 1Q2XA 2W2LD 1XELA 1MFZA 1UP7A 1T4BA 3IJPA 4TRMA 3OEYA 4AJNA 5TX7A 4YT2A 1SEPA 2IE0A 2VWHA 1P44A 4E13A 1Y9EA 3ZU2A 3RCBA 1E3SA 4H7PA 1Y5RA 2O7SA 3IL2A 3AUAA 3QWBA 3JD1A 5IXSA 4K6CA 5HTOA 5IZCC 5I8ZA 4CQMD 2XAAA 4PG4A 3KYDA 4CQMB 3MOGA 5BNIA 3WWYA 2GDZA 5BNFA 2R00A 4RVFA 3PIIA 3LF1A 1E7MA 3WQSB 3BA1A 4RVDA 4UEKA 4A27A 4GWGA 1SO8A 4MVJH 4B7XA 4NBVA 4PLZA 4O5OA 5CHEA 4B8ZA 1UP4A 1NXQA 4DQVA 1NP3A 1NFRA 2PTGA 2JAPA 4BO6A 4E0BA 1YONA 4I5DA 1OZAA 1GY8A 1D8AA 4RVUA 3V8BA 5DP2A 2ZIZA 5H83A 1PJCA 4BO8A 1RM5A 2I6TA 3V2HA 4AICA 1KEPA 1HTBA 1IULA 3ZU5A 3ZWWA 3H9GA 3G3EA 3ZW8A 1V35A 3I52A 3IAHA 4R4JA 4XA8A 3HSKA 1XU7A 1F0YA 4WCDA 4Y6RA 3ROKA 2CNBA 4Y9DA 3V5NA 2J5KA 5HA5A 2IEBA 1SEVA 1Y8QB 2VN8A 3L6OO 3QW2A 3FTNA 3Q1LA 1PGNA 1T2AA 1SOVA 2CY0A 1VSUA 2X5KO 2FZEA 2BKAA 3V2GA 4PZCA 4TSKA 1MV8A 3RKRA 1DIRA 1AN9A 2OP0A 3I9MA 2BFOA 4YEDA 5DULA 4GKVA 2HMSA 1NQ5A 2H5LA 4FFRA 2O7QA 1PQPA 5BSGA 3N58A 1YL7A 4XYEA 4N5MA 3KTDA 1ADGA 3INGA 3JQGB 4BO5A 1YRLA 1FXSA 1BXZA 3ASVA 4ONEA 3WR5A 2AEFA 2BGMA 1YDWA 1LDEA 3KVOA 3DOOA 3DBLB 1IL0A 4F3YA 4EUHA 1KC1A 1PQWA 1EK6A 2BFPA 4BO4A 4F6CA 2ZK7A 1R0KA 2BI8A 1BVRA 2Q1TA 4ND3A 4XQ9A 5KJ6A 4WNCA 3Q9NA 3ADOA 1F8FA 1HXHA 2EJVA 3PLNA 4JNKA 2D0IA 2ZJ0A 3H9JA 3VKUA 3VPGA 4HBGA 8ADHA 3WYBA 4BB5A 1LRKA 1E77A 2I76A 1OAAA 4BNYA 3ZWBA 4WASA 2OGUA 3I3OA 4HP8A 3TZCA 3F1LA 4HFRA 1I3MA 4A73A 3COSA 1DC4A 3D3WA 2XOXA 2DT5A 3RFTA 1LBEA 4CODB 5A02A 2FHSA 2VUTA 1ENZA 4P22A 3PZRA 1X1EA 5TC4A 3IP1A 3OM9A 3FBTA 1JWBB 3JQ8A 1VE9A 3MCVA 3W1VA 3W4JA 4ALJA 2EGGA 2D3TA 5CEJA 3VDRA 1EE2A 1MC4A 3E5RA 3O03A 5G0UA 1LDNA 2GO1A 4OJNA 5EIOA 1H9BA 3H9UA 2SCUA 1QYWA 2NU6A 3IP3A 3PYLA 4PG7A 3JD0A 1GYRA 1IPFA 2VRCA 4YJFA 1ADBA 1CIVA 2DFDA 2E49A 3HHPA 4BKRA 2X6TA 3TOXA 4RJTA 2CDBA 2DC1A 2X9VA 3A1NA 4II3A 4R68A 4E6PA 3UAGA 2GZ3A 5KWEA 1PZHA 1A72A 4I1IA 4PCVA 1E6WA 4XZ3A 1KEVA 4XYBA 3WGZA 1OBFO 3CEAA 5JDIC 4UVGA 4CMEA 3GN1A 3GA0A 1XKQA 1HL3A 5A5FA 4W99A 3GEMA 4BO3A 5K6AA 2C54A 3A06A 1IE3A 4HV4A 1U4SA 3WIDA 3MJSA 2PH3A 1E1NA 3K8ZA 4R41A 5G0WA 3AM4A 1G0NA 2WM3A 1N8KA 2DM6A 1NWHA 5C7LO 5HWSA 4OM8A 1BTOA 2ZYDA 4I5FA 4BO0A 3KXDA 2Z95A 1HE4A 3S2FA 1ZKMA 4CMKA 1DDOA 5KVCA 4U5QA 5AVOA 4QX6A 1P31A 3GFBA 4BV9A 3W8EA 4BNHA 5A06A 2DBRA 5G0TA 1EFLA 3PPIA 1GEGA 3EK2A 4IDAA 5L9AA 1DB3A 1WNTA 4WEOA 4GWKA 4YACA 2X23A 3SC6A 2HU2A 1VM6A 2PD6A 3GRKA 3Q9UA 5HM8A 1Z7BA 3I9JA 3S55A 1MP0A 2GR9A 3HFSA 1XEAA 1YBVA 3GPIA 5GY7A 3VPFA 5CFZA 5EJ2A 2JD0A 2PLAA 3RIHA 4CLOB 1LSJA 3GDFA 1C0IA 1A5ZA 2J6IA 3GOHA 1HETA 4EDFA 1DBVO 4RPJA 2GSDA 3PYMA 1JKFA 1C1XB 4FOOA 4WECA 4E32A 5MGBA 1DJNA 4FIZA 3HJAA 1KVUA 3LYLA 2VYVD 4FCCA 4NQZA 1Z6ZA 4BNGA 9LDTA 2FOIA 5C7IO 4Z0PA 2LDBA 4YYZA 5TS3A 1P74A 1Y81A 4WK6A 2GN8A 3WJAA 2JD2A 4NMHA 2Q2WA 2RH8A 1HEUA 1DJQA 4NFYA 2I65A 3ENNA 1O5IA 4NG5A 1X1TA 4ND1A 4OOEA 5JE8A 3H3FA 3X2FA 4WLFA 2Y68A 1XR3A 2G1UA 4AL4A 2YV1A 1HDOA 1Q7GA 5KJFA 4WOKA 2VRBA 2IZ0A 3CMMA 3PJGA 4G81A 3WBBA 1U4OA 2PA3A 4DQUA 1WDKA 2AQIA 3NGLA 2Y0DA 1VPDA 1MC5A 1EUZA 3OQBA 1QLHA 1U8XX 2HMUA 2O2YA 2VHWA 3I9LA 1GD1O 5ES3A 5U4QA 2HLPA 4YJHA 4J9UE 3TZ6A 4UVIA 1O89A 1DEHA 2FSVA 3QWIA 3F4LA 4YWJA 3GR6A 1GZ6A 2NVUA 1RYEA 1N9GB 2O3TA 4IXWA 4R5HA 4K9DA 1T1SA 1GQQA 5TLSA 4BS9A 2GF2A 4R16A 4IIVA 4Q39A 2GPTA 1V0JA 1PJQA 3NRCA 3ZWMA 5CDUA 1CERA 2C2XA 3P7MA 3JD3A 2Q45A 1C1DB 3IJRA 4MP3A 4CL8A 3BMCA 4EZBA 4IZIA 1XHLA 4XX0A 3DZBA 2FZWA 4R3WA 5IZCA 2NNLD 4ZD6A 3WMXA 4YRBA 4LK3A 1P1HA 2GN4A 4RQUA 4D0RA 5A3JA 2EW2A 1E1LA 4PIVA 3PIDA 4L0QA 4DTIA 4WKGA 2PNFA 2GN9A 3H2SA 4ZICA 1E7SA 4UUNA 3NTQA 3BMCB 3LC2O 5ADHA 3ENKA 5FI3A 3KV3O 3S8MA 1E6EA 3UICA 2AG5A 5CG1A 2AQHA 2HJRA 3DL2A 1GL3A 4CLXA 4W6ZA 3AUUA 4CUKA 3OICA 1P0FA 4A26A 4ND2A 1LC3A 4KP7A 1LQTA 5K0ZA 3W6UA 4BMVA 4WGGA 3D5TA 3VTZA 3NJ8A 5BQFA 4KDEA 4CM1A 1CETA 1T25A 4W7HA 4DL9A 5L4SA 3F47A 1K6JA 4YJHB 1ONPA 1UR5A 1MXFA 5THQA 1ENPA 3VDQA 3MTJA 2G82A 1A27A 1H9AA 5F5NA 4P4GA 3CIFA 5MDHA 3CPSA 4XQEA 3OSUA 5IJZA 1E3JA 5EQFA 2PV7A 3DONA 1BXKA 3GGGA 3CXRA 3W8FA 4HFMA 3WNVA 3TFOA 2E48A 4RV9A 5JW6A 1K0UA 2JCVA 4OKIA 1L7EA 3ZDFA 5FFFA 2PGDA 4E2ZA 1WDLA 3TRIA 4QO7A 4NH4A 2X1HA 4E12A 3PGXA 2C29D 2O4UX 2HK9A 5L40A 4OXNA 3QV1A 1C3VA 4YA6A 3SJUA 4RPLA 3MOIA 3BAZA 1CF2O 3SJ7A 2Q2QA 4L4SA 4NDNE 3RVDA 4FFMA 4MIEA 2NWQA 2JAHA 2DU8A 1CWUA 4B7CA 4XRGA 3H6KA 2B69A 4RF2A 3ZNPA 3LU1A 3T4XA 4BB6A 2VOEA 2HMVA 2GGSA 5L45A 2ZCVA 3KBOA 9LDBA 1P0CA 3D1LA 3F9IA 3FNGA 1YJQA 4PZEA 3ROMA 3TZKA 2AE1A 2FRDA 1ZK4A 2I3AA 1C0LA 4FJ0A 4YVFA 3V1UA 1BXGB 3VKVA 4YT4A 3LF2A 1ARZA 3JQ8B 3K92A 1TT7A 3ZHYA 2JJYA 3TOZA 1UJMA 3WS7A 4Z9FA 4J4BA 1TB4A 2VCYA 4JIGA 2OL4A 4DUPA 4IIUA 4Z6KA 2PGJA 4CMBA 1FF9A 5HS4A 5HBRA 4XIYA 1E7QA 1N9GA 1GCUA 4J9VA 3L9XA 4U8GA 1G0OA
chains in the Genus database with same CATH superfamily
5EZ6B 2QTLA 4KMRA 2XBUA 1WSWA 2O3JA 1X42A 2ZZMA 2NP7A 2YFHA 2OV8A 1A0OA 2QUAA 2UYYA 2VJAA 5IBRA 4IFEA 4W9NA 2R2GA 2IYAA 5DT9A 5EJMA 1U04A 2NOAA 1EAYA 2BI7A 3ZCXA 3GEHA 4GC5A 3ONNA 3AEYA 4X00A 1S7GA 2ZT6A 4BQQA 5BT8A 5I5EA 2AK3A 1P1KA 3TAXA 5HDQA 2RGWA 2D3WA 3GUCA 3MTBA 3OKAA 3U5TA 3ABRB 3FWZA 4GLOA 4HDCA 3UKDA 2GBLA 5J1SB 3IUQA 4MPTA 1I0LA 5C3UA 1ZKDA 2CNKA 2V58A 5DGXA 2PMKA 3M82A 3BIJA 4TKLA 2NTJA 5E8RA 3KEFA 4PAQA 3S2UA 5IEJA 4KAAA 1QRAA 1VJ1A 1BSVA 2B92A 3ISJA 2DFLA 2CD9A 5J23A 3HCEA 3Q8WA 4LJ4A 3AYZB 4ID9A 2OG1A 4B6PA 2OYRA 4F84A 1G42A 2UYHA 4KXFB 4OQDA 4OD0A 4MYUA 3PZBA 5ALKA 1XLTA 4UMVA 5TXGA 1H2RS 3JRXA 4YUXA 4IJKA 4RLQA 3VR0A 1G64A 4R9SA 4EY8A 2REBA 4UREA 4EG3A 5F23A 3H3JA 4HQLA 4BDTA 2Z1DA 1KJ9A 2YV2A 2HFKA 2HJGA 4TV8B 2XF2A 3J80A 1U1EA 2DFKB 4X95A 1E58A 3QWFA 4HDNB 3SIPA 1A9TA 1JVSA 4Y6LA 4CL0A 2NO0A 1H0KA 4IUDS 1H66A 2W93A 4X90A 5KHAA 4M1WA 3SZLA 2GZ2A 1LGYA 1N75A 4CFZA 3SHTA 1JSRA 4ASUD 1T8YA 1SVOA 1TO2E 2TMYA 4J0KA 4JLOA 1OZ0A 4KGXA 6ABPA 3NHMA 4EFMA 2AW5A 2IW3A 3F6CA 5KSYA 3T15A 3LRPA 1LQ2A 3TSAA 5IDWA 3B7GA 3KXKA 1OXUA 1FUUA 3AM3A 4UM5A 5JJBA 1P7WA 3BTOA 5DNYB 2VYQA 2HA4A 2C1ZA 2IUUA 3RVJA 3R5TA 2GZRA 2WICA 5AM2A 1M6WA 5B30A 4HDOB 4TMZA 3T0GA 3A1EA 3IT0A 1K08A 3OPYB 3HACA 2G04A 2PZJA 2QMUA 4RS4A 3U3OA 3WGOA 2ZW9A 3KAJA 4OB7A 2O2SA 4PO9A 4DGSA 5KPJA 4UTOA 1OB2A 4JJIA 3BD7A 2EWVA 3MS2A 2BL4A 4X93A 2B36A 3O8QA 3UOAB 3Q0EA 2W6ZA 1MZPA 1AK2A 1DAOA 3WKCA 3ZDAA 5JADA 4S12A 4YO8A 2C97A 1MORA 5M29A 1Y6RA 5AJZA 1YB6A 3O4GA 4R1PA 1BH6A 3ZIDA 2R8PA 4YJFB 1ZGHA 3I9FA 3M2TA 3UMYA 1WD7A 2SCUB 4U2EA 2VAPA 2GNPA 3TW8B 4LC9A 1MTZA 1Y63A 3VH3A 1M1ZA 2QTVA 4B75A 3LHIA 3LY7A 4BMYA 4PLCA 1T2UA 3A10A 2A78A 4JGIA 4MV7A 4IDHA 2CXUA 3ILHA 1A8UA 2GBLC 4UJ3A 3A26A 5HCUA 3PP8A 1QO0D 4HGQA 3UAVA 3B85A 2C2MA 2CC2A 3Q0TA 4GOXA 4Q12A 4CR6A 5E1MA 1NW8A 3ZGNA 1MTOA 3OSZA 3B9RA 1UM8A 2RGUA 4R8KA 5D00A 4DMLA 3D7MA 2Y1GA 1KYYA 2XMPA 3KJGA 3AFIA 1YR1A 1ESEA 5IAEA 4ZI7B 1JI0A 1YQEA 2AJLI 5KWSA 1PJAA 2YQZA 1QU2A 1GQOA 3KE9A 3U4DA 3M7IA 5DPMA 3O8QB 2BVNA 4YRCA 1H8HD 2E85A 2RIPA 3AVPA 4FUTA 1RLOA 2I0FA 3LPNA 5L7WA 3ZWCA 1RHRA 4L16A 1Z4NA 3CBQA 1T2VA 4JU9A 3CT4A 3DV0A 2BR3A 4W8HA 4ACAA 3PJEA 3KUXA 5DLEA 3ZWNA 3U5ZB 5TNXA 2FMHA 4HQ0A 2V6MA 2BFEB 1SHZA 4DIBA 1JAYA 1RWNA 2G63A 3A2NA 3OJ0A 4I6JA 4OHVA 5J5AA 2OSVA 4K5QA 4I1SA 1X7DA 1M76A 4KQ2A 4LK2A 1HEYA 3Q85A 4K9MA 1FYEA 5TMDA 4CQJA 3EA5A 1NAHA 2WJPA 2EGHA 1W0JA 3QXXA 5A4MS 1XZJA 2DERA 3DW3X 1NPDA 2C5GA 3G8CA 2PKYX 1MH1A 1F6DA 2XEDA 1K63A 3TI7A 3W6OA 5JCJA 5CB8A 2GHIA 2J1LA 1RAFA 5G4LA 4BVLA 1G3RA 3LUCA 4OB8A 4PBSA 4JI1B 3GYBA 3B48A 1AZSC 4F45A 1NR7A 1QDUA 1DQRA 4FE4A 2V4ZA 4R8RA 1YIAA 3SR0A 2DR3A 5GZ1A 4YCMA 2ZM5A 1DWPA 2GEBA 1ODLA 2B3DA 3DE3X 1YQXA 2CNWD 1C9YA 2J5BA 5CU7A 2YICA 2IYEA 2P9CA 3ABQB 5D3MA 1GITA 5FOVA 1DBRA 1XDSA 3TIIA 3VVLA 1QHNA 3E8MA 3VO1A 2JAXA 4DM3A 4EWLA 2I7VA 2B8JA 5EXDA 1XEXA 5LQNA 4KPYA 4TLEA 3QA9A 1O03A 1WRBA 2O1WA 4BFCA 1GCGA 1W0KD 2BGLA 1DXOA 1JMKC 1A96A 1CZUA 1L1EA 1X7HA 4UHEA 4Y2JA 2IQ5A 3BHMA 2Y1WA 7GPBA 3DB1A 3AOGA 3Q7QA 4ABTA 3QJGA 1O87A 3WLKX 4AJJA 1CBUA 1Y5LA 3NM6B 1DG3A 4ESOA 3ZQ6A 1TAUA 2X4IA 1TMOA 1RYFA 4N7JA 1JQLB 3RHTA 2A94A 5I4IA 1N3IA 2DAPA 2G06A 3KT8A 2A1TR 4UU1A 4CLHA 4DIFA 2HX1A 4WNAB 5C4IA 2VH2A 4BCDA 4ZGWA 4BE4A 1TTTA 3EVAA 1TO6A 4CEHA 5L8VA 2JI6A 3QMMA 1A9SA 3V7NA 2AR0A 3Q7TA 1Z12A 1U9CA 5MFPA 2XWQA 1JZSA 4LQ4A 2JDIA 1NYQA 4FCVA 4M1OA 4RHTA 1B16A 4ZOLF 1OFUA 4M0CA 2XUFA 4M8KA 3TG2A 4MSUA 4HNAA 5BQXA 2MIIA 4XLZA 3JD4A 3M3HA 2WD8A 4NBWA 3QJ5A 2JHGA 4JVNA 2WUEA 1NT4A 2FRDC 4OK3A 2PG3A 2B6HA 2GH1A 4YRDA 1T1RA 3GZ4A 2XHEA 4LOAA 3ZDDA 1RKXA 4ZQHA 5IYZB 4QRDA 3SI7A 2Q9CA 1YCDA 2B9EA 3QVVA 4I9HA 3O1IC 5HJ7A 3G6WA 1QGZA 1C4XA 1GUZA 5KJ1A 5DSTA 3KD3A 1J9ZA 2RAUA 4QU0A 4BEJA 3I2GA 1EBBA 2A58A 5EP3A 5AVXA 1ATIA 3QKWA 4XGKA 4OQPA 3K70C 1WZ2A 1ADCA 1DC7A 3HKBB 4KZKA 4RZIA 1UEXC 3H75A 2ZP1A 2X0DA 1ORIA 5FL7A 2RHCA 3ND7A 1ZAKA 3DBHA 4RMIA 5B6PA 5EWJB 3GGOA 1N92A 2PY6A 2P2NA 3OECA 4XR4A 3I04M 2HY7A 3L0DA 1QZUA 4O02B 2KBEA 2R68A 4BY9E 2FFJA 3BG5A 5IM4A 5FEMA 1A71A 3RH0A 3D4PA 4LYAA 4D1YA 1S2GA 2EBUA 3CGWA 1TIPA 3FPBA 4U7WA 5IARA 2RGDA 3D7RA 3GT4A 3WGGA 3QLUA 2P2LA 4KTTE 3GLTA 1OIVA 3M34A 4UHJA 1PZEA 3SYTA 3HCFA 4OI0A 2R87A 3TX6A 5H02A 3CZAA 4UTNA 2G9ZA 1FFEA 1QORA 1XFDA 2JJ1D 4HHEA 5IJ0B 5JU6A 2VT3A 4WERA 4WZ6A 5E7MA 4EGQA 2AXNA 2I2BA 2XW6A 2AOXA 1AZWA 1KYXA 2I67A 2PPVA 3FPSA 1FSFA 1NNEA 3SPXA 4Z49A 4XB1A 2OUIA 2J4DA 2PWYA 3EXIB 2G77B 3LKBA 3EDQA 1H93A 4JBXA 3BZUA 4MVJE 4PFJA 1EK1A 4BFYA 1LBHA 4RPGA 4S0ZA 2PXCA 1CIJA 3QYJA 2OT3B 4LV6A 5KX5A 3QK7A 3OJLA 1NQAO 2ZVDA 3CKYA 5C1PA 1IJKA 1HFEL 2XUPA 3LKZA 4UCFA 3D7SA 1IXZA 2XCUA 1XCGB 3DMTA 2QG9A 2WJIA 4GHWA 4N7RA 5F7ZA 1GCOA 3FE2A 1CLEA 3SD7A 3VR1A 1D7OA 2QMYA 4D44A 2QYHA 3SZMA 1EVYA 3SZRA 2GB4A 4FDUA 1J97A 1J9EA 1E3LA 1W4ZA 4DR1B 3OLZA 5I7HA 1JDTA 3LL7A 2X7XA 1GA4A 3F3SA 4C7XA 2BELA 2C7PA 2DUNA 1F14A 5LC1A 1FFHA 1O6FA 1VIYA 1ZYUA 5JCJD 5A2GA 1T2FA 2PFKA 3GI1A 1YDHA 1TM4E 2ZIFA 3GEGA 3M6MD 3HCWA 2QD2A 4II7A 1Z4LA 4TYYA 1ZWKA 2PBFA 2VKTA 4K9NA 3V1YA 1DE0A 3Q7RA 4UBKA 5H59A 1K4YA 4I81A 2ZR0A 4IGFA 1I3CA 2F6RA 3DG9A 1Z17A 5TIIA 3R3XA 1B6GA 2PUHA 1A69A 3KR9A 3OIGA 1U1DA 5LP6F 2B94A 1TF7A 5J2TB 4RO0A 4YP7A 5K3DA 4OXIA 3R7AA 1TEHA 1CUZA 2BFWA 4RCVA 2AHOA 2ZB7A 1KSHA 1YGPA 1E2DA 4H77A 2VUSA 2JFUA 4Q9AA 1DC6A 1CD5A 4JYPA 4NS4A 1YJ8A 4O4HF 1AD2A 2ZIXB 4ZQCB 3CISA 4HPJB 2ZS7A 4N1AA 5LDHA 3E35A 5KYTA 4MUAA 5IKOA 1PVOA 1C9JA 3UGJA 2P7IA 1PU2A 2IGBA 2OV6A 3B6MA 2WV7A 3QTTA 3V1LA 4DMMA 1RWKA 4BRZA 4XYGA 1XTSA 2QVBA 4PC3A 4G9GA 2G72A 1E0DA 3FI9A 1R00A 2JVJA 5J5CA 2R751 4URXR 2PZFA 3JQCA 3EZXA 3PQCA 4PFSA 4TQUS 1YRYE 2GOYA 2P3QA 3RFCA 4MMXB 2IUFA 2P40A 2FPUA 2X5JO 2UZ3A 1A8QA 2I8AA 5EZYB 4C7VA 2OM6A 2J4CA 3VGJA 4GICA 1DUIA 4F96A 1H9CA 1JR6A 3NBUA 5DH9A 2QN1A 1Z7GA 3BIFA 3TTTA 1Z4KA 2HO5A 1K7CA 1PK8A 2O6LA 4IDGA 4O2BA 2Q7DA 5HKKA 2A9RA 3DBHB 4WOPA 5E1OA 4BVAA 3P9NA 2B34A 4GKBA 3P52A 1FFXB 3FWNA 3OMXA 4R1LA 1SELA 2ONZA 3F6PA 2AQ8A 3BXOA 2A2ZA 4RIFA 3F5QA 5EGNA 3GD5A 1C3OB 3WL5A 5KTTA 5JPIA 2HB6A 4PINA 1M75A 3MHPA 2V6GA 2H2WA 3DCYA 2A5FA 1YWGO 2QN6A 2WJ4A 4N5DA 4U5XA 2I91A 1VB3A 1DHRA 4BCBA 2W2QA 3DMDA 3FYUA 3MTQA 3U9LA 4X1KB 1E8DA 1IBKB 4IJVA 2BUAA 2DHQA 3FWKA 1Z62A 2VAWA 4LRYA 5LYJA 2GRJA 4F2WA 2BH9A 5GAJA 2PGIA 5FWNA 2VK4A 3KQUA 5DV9A 3WLPA 4YJGB 3O73A 4WDQA 3N0WA 1M0TA 4HAUA 4HUQA 2PMBA 1OAKA 1EFHA 2Q27A 5ENZA 2VT7A 4KWHA 3P9IA 2J09A 1YA4A 5E6RB 1J7JA 1V11A 4K9LA 3IBTA 2J59A 3G5MA 1U2ZA 3LY5A 3M4ZA 3VSEA 4JI0B 5AR1A 5SYNA 2GA8A 5F3WB 2PE5A 2GK6A 3PDJA 3PFHA 1PFQA 3Q2OA 3W9YA 1JEEA 4BGUA 4D46A 3NWEA 4X45A 3QSYA 1A7JA 1R66A 1TKAA 1OIXA 3BXFA 1G5IA 1D04A 3EVFA 5EIBC 3MFYA 4HFNA 1XCBA 2GPNA 3JQEA 1EUCB 4NU0A 4X66B 2RFLA 1K2WA 4EBFA 2VJDA 1TTHA 1C9EA 1KZ4A 3DNFA 3ODGA 4DT1B 1UPTA 1CY6A 3P9XA 3F1KA 5JXJA 4QASA 1AN0A 4WK2B 2Q3CA 5JCOC 3JQDA 1M0EA 4OK6A 4KVZA 1WBDA 5KQMA 5JNWA 1AS0A 4M1SA 5ESXA 1KARA 3MJCA 1H2YA 1Z8NA 4OFWA 1JQBA 5HMMA 3KG2A 3Q1KA 4B6QA 13PKA 1U6JA 2HHCA 1XDDA 3NHLA 4YRJA 2J9ZB 3KS9A 4YJGA 5DI9A 3X1DA 3DBRA 5GV8A 3HWX1 3HCAA 3OM8A 3W77A 2PRSA 3EEYA 5JNTA 2EZUA 4P3PA 4EMUA 4CEJA 1ECLA 2B6NA 2W5UA 2XYHA 1JE0A 1RM0A 5DU2A 1B41A 1SC4A 1QCZA 1R6BX 4GEGA 4DHWA 4DQDA 2VTVA 1BN6A 3JWHA 4ETWA 2JKYA 1Q17A 4DDKA 2YIVX 2VDUE 2I4OA 4G84A 4G63A 2P0AA 1T3SA 3BIOA 1WW8A 4MB2A 2EJBA 2QL5A 1H0RA 1Q0QA 3GXOA 4MMYB 1T34A 4EAAA 1HMPA 3VZRA 4DY6A 3T3DA 5DNCA 1L4MA 1ULUA 1NQUA 1XOIA 2QLTA 3O26A 2PGAA 2Y2VA 1U7OA 1UDCA 1FYVA 2ZB4A 3PQDA 3HBJA 3QHQA 4FFOA 5K6TA 2QIOA 1X7GA 3LV8A 2IV2X 2H48A 4TWJA 4FKMA 1P45A 5DBFA 1U1FA 4MVJG 4YH1A 4PN3A 2DKNA 4BGPA 1OAOC 5DHRA 3VYSB 2H17A 4L1KA 4V1CA 1P2TA 4INOA 1GR1A 3EFBA 4G41A 5AKHA 3EEIA 4BJHB 2CFIA 1A50B 1X9GA 5DOVA 1FDVA 4O1MA 4CTMA 5C81A 1L4UA 1W7AA 1CFJA 1U9YA 1E4YA 2Q5HA 1G9TA 3VRHA 3D6VA 1ZNWA 3H16A 2YWJA 3P9ZA 1M7HA 2PKEA 1JSXA 2Z83A 2BFNA 3HCNA 3PENA 4HWOA 4EJFA 2ZTVA 4LRQA 5FOTA 1BHQ1 3M4NA 4PHCA 5C2JB 4LMPA 1RCUA 4CVNA 3R3VA 1ID8A 2AZTA 5FEUA 2RHBA 1P2DA 4F6RB 3K9BA 1JPUA 4ZIRA 2PMWB 3CN9A 1AY0A 5LMZA 1B3RA 1EVJA 1O2DA 3RAJA 2QU8A 2JLXA 3AL3A 2HRQA 1UK9A 1VMAA 2OILA 2XDWA 4NJOA 5DNDA 2GXQA 2EKZA 2EJWA 2O0MA 1XVAA 5FWAA 2A1UB 3C16C 5CVTA 2A92A 1SHTX 3G17A 3KNZA 4RTNA 2QR2A 2G80A 3KFLA 1GEEA 1B8UA 3EOZA 4QECA 2VK8A 1D6SA 4OYHA 1HFKA 2P7HA 2Q1SA 1RRVA 2R4TA 1J4AA 3IDOA 5IT0A 3H97A 3K94A 4MTLA 4CQLB 5J2UA 4WL0A 4AJHA 1QAQA 1ONOA 1O0BA 2A9PA 3FJ1A 4U8HA 4D7AA 2EVWX 2GO7A 2WV9A 4QU8A 3UYKA 1R16A 2Q5JA 2RGGA 4PRZA 4X0EA 2O59A 4URZR 2VIIA 4JJZA 1PFYA 5TQJA 3BRQA 1UBJS 3OETA 3FPAA 4HXEB 5A3SA 4MPJA 3ZQJA 5H4GA 1OXVA 4FT2A 3QBJA 3SEZA 5FPSA 2YQ4A 4YMVA 2WNHA 2YJ3A 4D0SA 3QEBZ 2E21A 1QAMA 2CVPA 3OJXA 3ZIUA 2JVIA 4RZXA 3THWB 4YJDA 2CHQA 4ZPJA 5HYVA 2WT9A 3ZI0A 2PUVA 4YGXB 5AXBA 4XTRA 2NU7A 2PRKA 2PXAA 5C1BA 3R0XA 3IDQA 5GM1A 3K8OE 3QVGA 5HFAA 4IMRA 4PZPA 2A9KA 3I5YA 2G5TA 5B2FA 3CEJA 2PUCA 3LC1O 5KVQA 1GSHA 4ZAGA 3OEWA 3DTTA 4N6NA 5DHSA 2QR3A 1FP7A 2P6OA 4HEA6 1N0IA 1U7XA 2W6PA 1KFBB 4LFAB 3PEEA 2XV1A 2R97A 3SR3A 4Z51A 3ZWYA 3ON5A 1EA7A 3DHVA 1MX3A 5IW8A 2O19A 4F04A 4KR6A 4AUNA 5FXMA 1ODJA 4Y1GA 1DV2A 1GT6A 4TRJA 2IHYA 3K20A 1LBQA 2P79A 3DHYA 2CV0A 4TWAA 4NI5A 3TTSA 5ITZB 5EEHA 2FZGA 4WLNA 5EQDA 2HA6A 3GJ0A 1LLUA 3G2JA 3LI2A 3LC0A 1QUEA 1XMJA 2R7KA 3Q3CA 5NLLA 5IM4F 3L05A 3AVXA 4ZYZA 2MMGA 1AO0A 1UBTS 4YCAA 1PL0A 2ZBRA 4OKNA 1ORTA 4ON9A 1JHZA 2HMTA 1DHTA 5DYWA 3R7DA 1Y8ZA 2YHBA 3GZJA 5JT1A 1PJTA 4PX3A 1BCSB 1GQYA 4K0RA 5CNKA 1B0AA 3I37X 4EF6A 4D3SA 3WGJA 3A31A 4M0MA 4KE7A 4R31A 3U17A 4DADA 2A30A 3L1UA 1FRNA 4BU0A 2FJ0A 4B79A 2XPCA 3O8BA 4U2KA 5U1PA 4BX9A 5JUWA 2IPNA 3AINA 3W90A 3VNQA 1R18A 5IC5A 3KBBA 3RYFA 2HXYA 1ZUHA 4ZYYA 4AJ9A 4AZWA 2HN9A 2H18A 2QVGA 1H6AA 3GPDG 1QZZA 2PUTA 2AXPA 4K3UA 4LJ5A 4CF6A 4I4CA 4GI3A 1F0PA 4BO1A 3U40A 4B80A 2C2HA 2YDXA 1WZNA 2JC3A 3AEUB 3RRZA 5A6VA 3U6BA 1KNXA 3CNLA 3E9MA 5DVZA 1AKWA 1V41E 4MYSA 1A82A 3G8BA 1P1BA 3FDIA 4Q6WA 3KSDO 1FLAA 1QPBA 2H07A 4EPWA 1NF9A 4W9MC 3FGOA 3ODPA 2Q29A 5KSWB 4BLOA 2AMYA 1X1QA 3GXBA 3RJZA 1UH5A 3BFPA 2CT8A 5C80A 1A9QA 2FR8A 3WQQA 1GQFA 3CPHA 4EKGA 5IDVA 4Q01A 1D8TA 3SSOA 1MDBA 3C3DA 1XUOA 3SF8B 3LGXA 3MGCA 3EGCA 4ILKA 3H2JA 2XMQA 1VZ2A 2X0KA 4ZAFA 2YFKA 4MYRA 1BWQA 1EA5A 2Y27A 3O3CA 3N0XA 3WDKA 3FTEA 3D64A 2IZ6A 2GERA 5LD2C 1JIKA 3L0YA 2OG2A 4H0FA 4M9XA 1Z0JA 3FDJA 4RL4A 3RIGA 1FA9A 1INLA 1WMAA 4X71A 3MCTA 3DDUA 2PH7A 1WMBA 3B6ZA 4MCJA 4BFXA 5C8YA 4NENA 5AI5A 2NYAA 3CTMA 2Q3HA 2VDMB 3BF7A 4ZQGA 2RARA 2V6JA 3VH4A 4D9EA 2OZEA 5GOTA 3GLGB 3E81A 4J4TA 2HA2A 1DG1G 2CUZA 2QZ4A 5I9MA 2WTEA 3DKPA 4J03A 3HVRA 1GPH1 1BRMA 4G4JA 1XTRA 4PPNA 1K6IA 3NIBA 1A5SB 3G7SA 4F46A 5KU1A 2HHJA 3DL4A 1TUEA 3W79A 5DT2A 1TAQA 2QPLA 1UT5A 1E2IA 2VZEA 5I01A 1WW2A 2B99A 3L7DA 4HWKA 4JJEA 2DSTA 3L0CA 4JLJA 3FY4A 1AGNA 2UVPB 3I0ZA 5AKZA 5ECDA 5HFNA 4BNFA 4Z5XA 2NU8B 1KPGA 4Y2XA 2V7QD 1V16B 3N2GB 3K2BA 5FI5A 3URKA 1CU1A 2IEDA 2P3SA 1I4WA 3BSYA 2BTEA 1ZBDA 4DCNA 4TYWA 3MLAA 5KVSA 1BS1A 2YWEA 4LJRA 1U1IA 3A25A 4DCOA 1JB9A 3HZRA 1Y1KE 1KETA 1HUQA 4B3HA 3C85A 1KY5A 2HIMA 4HYEA 1CUVA 2ZB3A 4O4JF 1SBYA 2UUAB 4EB3A 4QATA 2NTEA 1X1SA 4L28A 4X41A 1NJGA 1EIZA 2R62A 3FMIA 5T57A 1WAMA 3DMHA 3C4JA 2PD3A 1G2QA 1L3IA 3I2IA 2BLLA 2XECA 1VB5A 3KT6A 2TRSB 4FX5A 1TUIA 3GMDA 2YJNA 1G6OA 3LDHA 4WW0A 3LPAA 4D43A 4CUJA 1PKEA 4PFKA 2LCIA 1HQCA 2R6DA 3KXPA 2BEWB 4KPUA 4I50A 4EY7A 4MHTA 4L9SA 5JZSA 5D1NA 5FCDA 4LECA 4MLCA 3OOJA 2XQVA 1HWYA 2N42A 4KAXA 1E4VA 5FJIA 5F9HA 1FRFS 1T3ZA 4P38A 1IBLB 3ZHCA 3FN4A 2LIVA 4KIWA 5ELLA 3SM9A 2HMAA 3FCEA 3LYUA 2H65A 3FMOB 3AHDA 3COWA 3DV9A 4A3SA 4R0MA 2V3CC 2YYYA 1AZTA 3LRTA 2WU8A 1SULA 1X1CA 4J6EA 4B84A 4AJIA 3TGPA 4M98A 2HLDD 1V37A 4OHPA 4JJ6A 5BSWA 2R44A 1JIVA 1GO2A 3KQSA 3OLXA 1C80A 5DCUA 1P80A 5KKAA 1Z5PA 4BO9A 4WESB 1FJ2A 4PW0A 2H1RA 3S5JA 1E64A 2OQ2A 1VG8A 2AJDA 5HQ3B 1Q19A 1J9GA 1T5TA 2O5RA 1B1CA 2M1ZA 4UDYX 4QM6A 4WCFC 2A57A 2QK4A 3MCZA 3N07A 1G7CA 3AM5A 2CVOA 4AF7A 1WCXA 1QE5A 2GCNA 4PS0A 3TVYA 1E9VA 1T3GA 2IZ7A 1JDBC 4I5GA 3PUIA 2JFVA 2FMFA 1R5OA 3DM9B 4QEZA 1V11B 1Q16A 4Q9DA 3RAFC 2NUAA 1EZZA 4C2UA 1JI3A 2UAGA 2X15A 3QVGB 3R5JA 3DFMA 1RC1A 5LKRA 3F6RA 4D9JA 3W78A 3HKCA 1CUGA 3HU1A 4DQXA 5ICSA 4TYQA 4OBEA 4R2HA 4KPEC 1RPZA 4IUYA 1SY7A 1RHJA 4D4GA 4FT4A 5ERXA 2AYYA 3Q41A 3V1NA 1L8OA 2Z6AA 3SYRA 1V2GA 4G8JA 4GT1A 5DBHX 1EFDN 1L5HB 1IHOA 1MG0A 2HF7A 2QNBA 3D59A 3GT7A 3GUYA 4M53A 4O2BF 5PGMA 1NHWA 1YO6A 4P58A 3WKEA 4D02A 3PE3A 4IDQA 5KYXB 1BW9B 4JLSA 2ZJ5A 3A2MA 3NWBA 2D06A 3LJKA 4EG6A 4GC9A 3ZKWA 4EI7A 4F71A 2XDYA 5JS7A 1SM4A 3PKJA 5BR8B 1U3UA 1SU8A 2YC2C 3L8MA 4S1VA 1AMOA 2R1ZA 4N3GA 2XZLA 3KWJA 3AF4A 1N6RA 2QTGA 1PRYA 1TC1A 2EFGA 5D3QA 1QH1A 1NBMA 4PIMA 2BHNA 3VH1A 2CZQA 1LI7A 2O3RA 1FMCA 1XJWA 1E61A 2DECA 2ZQZA 2ZR9A 3CZ4A 2EKQA 3WWPA 5KTRA 1BQ3A 4B76A 4V02A 2CWWA 2HDOA 2VQ6A 3BK7A 3HVJA 1VQ1A 1H6BA 4H3KB 4HNQA 2B98A 2ZI9A 3TINA 3WGVA 3HY6A 3AR7A 3FM9A 1T5HX 2I7CA 5EL0A 3DHNA 3T1QA 2ACEA 3IX7A 2RH4A 3FR8A 1CY4A 1TKCA 2AN9A 3EGIA 3RVKA 2CDAA 4C87A 1IYZA 1CZRA 1E79A 1NQOA 4PGMA 2IY7A 2WZQA 3PYXA 4NAHA 4UBLA 3A4IA 5D3KA 1SBCA 4F2DA 5MN4A 2CDCA 5K2OA 2ZZNA 2JPDA 2YR0A 4H27A 5KIAA 2M98A 4WA7A 4V1CB 4KFCA 1CF4A 3PDUA 1WW3A 1M10A 4TYMA 3FB4A 3W4IA 5AW2A 2NU9A 2BTQA 4ZU3A 4G24A 4U1RA 1E66A 3N2ZB 1Q6ZA 3PXXA 4QPJC 4ZZ2A 5TT0A 4KNYA 1W30A 5E7IA 2AZDA 1CDOA 5F78A 2P2SA 3TJZA 2OSBA 1A95A 1SKUA 3GROA 4QEDA 3K9GA 4MKRA 3S2EA 3C3PA 3DLAA 1NUHA 2Z1NA 3FTDA 3VPDA 4A03A 1EDBA 3PXAA 1ZVJA 4KEAA 1VHJA 5L3SB 2UYGA 3NALA 4TRRA 3HN6A 4LV8B 2BAGA 4EMBA 2X4DA 1SKYE 4NMWA 1RE1A 3S7ZA 1U0GA 2C2OA 2X2PA 5JH7B 1Q3HA 2CJYA 1M8PA 4K1LA 1QZTA 3AHJA 1RPAA 2VH1A 1OE0A 1TJ4A 2JBAA 3EYAA 1SXJE 2LV8A 5JI3E 1QGED 3S81A 4HC4A 1YV9A 3PUHA 4DV5B 1HFWA 4AF6A 1EH5A 1AA9A 2NVOA 4Q1AA 1KYWA 3IR5A 4OHMA 3RS9A 4PHFA 2QX6A 1N78A 4IIDA 2OXIA 1NI3A 3UJPA 4C0LA 1SN7A 4P7GA 3X0DA 4B2PA 5JZBA 3DBOB 4CKYA 3AH8A 1QANA 3L6BA 4NBTA 3WYCA 4KN5A 1Z2PX 3IO3A 3B3QA 3NCHA 3E9RA 3ZVMA 1HDYA 1X1AA 1YL6A 2CSUA 5TB5A 2ATCA 5KNLA 3WLFA 4CDRA 4CMAA 4LF7B 3DB2A 2V1XA 2VJQA 5IAJA 5CD1A 4E1VA 1U7HA 2AW3A 3U7IA 3ER8A 1YA6A 1KAHA 2IXDA 2O2GA 4UNIA 4G56A 4ZHQB 5CEEA 4OMFG 2PR7A 1M7GA 1W85B 1G7TA 3KKKA 4JQOA 4LI0A 4KTVE 1K75A 3GK3A 3C3CA 1Z0AA 5DTIA 3PTZA 1NQXA 1OPRA 2UDPA 1KZ7B 1N2OA 3Q10A 5HM6A 1W4LA 1N2BA 1UDBA 3I6IA 1SG6A 1M2HA 2X8AA 4HUQB 5IJWA 4PNEA 1M2FA 3NBXX 3L1VA 2JHCA 5AHKA 1J06A 1HKUA 1E32A 1MEOA 2QWXA 3GEPA 4IOJA 2P2YA 3WQRA 2WKQA 1A98A 2XCQA 3WLMA 3Q7SA 1WCIB 4AY3A 4M46A 1Z8HA 5KYVA 2JRCA 3GFTA 3VKWA 1XYGA 4TLCA 4DARA 3E6AA 3V34A 4ZDIA 1QU3A 4P32A 4L5IA 3UJAA 2QA5A 1NNUA 3RT7A 1I32A 1P3DA 1S3GA 3UB2A 2BJWA 3NYRA 5L4LA 1C14A 3UKOA 1BW9A 4KV9A 3TOCA 3K9CA 3ROPA 1SQGA 1C3EA 3HO6A 4RCZA 3V80A 3AQ4A 1YI0A 3SMQA 1AQLA 1S4MA 5I4CA 4RF4A 1EHCA 3VOBA 1V47A 1LK0A 3ZNOA 1CEXA 3LO8A 1WXIA 1SUWA 1AHPA 2O3SA 4LF5B 5DGHA 4CDGA 1Y9DA 5L3QA 3ZD7A 3GL9A 4M0LA 1HDZA 3RAPR 3KZXA 3T9EA 5LQRA 4IM7A 2NX2A 1C9MA 1Z5UA 2Y6VA 5KAMA 2JFGA 1EP3B 2QY9A 3G89A 4M99A 3IOEA 1J90A 5E9AA 2GJ4A 5F4ZA 4CE6A 4JLMA 1ZIYA 2HJSA 4OV6B 5AW4A 1WZIA 1AMNA 3L7OA 1BMQA 4NZMA 1DFHA 4Y1RA 1GFSA 3WRXA 4NK5A 2W8ZA 1WBJB 5HF9A 3IHKA 2W2XA 5HQ3A 9ATCA 5I48A 2WJJA 4CIVA 3GVHA 5M3BA 5EKSA 3MRTA 1HNZB 3TI9A 1TQHA 1Q1QA 2WG1A 3KZKA 1Z34A 4FE7A 3FX2A 4X97A 1NG1A 1IWOA 1I3KA 1RXCA 4NCXA 4PC7A 2OORA 1ZGCA 4YRRA 2XMZA 4HEQA 3C5WP 4J7AA 3LVQE 1GU1A 2ZYHA 3NO4A 2JGAA 3F97A 1UBLS 2H63A 3OLYA 1P7CA 2P65A 5LUAA 3L7IA 3WO0A 4WHMA 4QYIA 3WTCA 4LSGA 5C5EA 5CFQA 1EFRD 1QC5B 4D0LB 4C4TA 2VZLA 1KZ9A 1YJAA 3LM8A 4JP2A 1SA0B 5IJXA 2FLKA 1NUUA 1ECBA 4MQFA 4G26A 1GNRA 4L75A 2WHQA 3AOEC 3P9QA 3AVOA 4ME6A 4YJ3F 1XZNA 4X1YB 1SIBE 2QN7A 4P53A 3HV0A 1M34B 1P4GA 2XGGA 4IDEA 4D41A 1Q91A 1M1NA 2DSNA 3DE1X 4IV0A 4R6WA 2J6HA 4J2OA 4W5NA 2LW7A 5DNVA 2JCYA 2YFQA 3ULKA 4ENVA 2HJVA 1NXTA 3H2BA 4LMAA 4AWBA 4KQ1A 3CLUC 1ES9A 4JOQA 4QHTA 2CHEA 3UJ3X 2OMKA 2O7VA 2QV7A 2XADA 4TYPA 3ZCTA 5BN4A 4B09A 1KL7A 3G2LA 2G9QA 3FFWA 1W0JD 3HDGA 3R0VA 4Z7QB 4UEOA 2CMKA 1OX4B 3G5AA 2C5BA 3LTNC 3WB1A 4Q1DA 5FFMA 2F8SA 1ZZGA 3IIEA 2BEUB 4V0QA 4DCPA 2OD7A 3FFTA 1LWNA 3DZJA 3ZU4A 4OAQA 1AKRA 1ZJ6A 2REQB 4BIMA 3FVVA 4DM4A 5CDGA 3G9UA 3P9RA 5E9JA 3V6MA 3A36A 4YRZA 3QKRA 1ZQ1A 3E8XA 3WSVA 3W2TA 1MHTA 3EGDA 4PVCA 3ZGZA 3AFOA 3DEIA 1N77A 2ODWA 3OQIA 1DKUA 2WMOB 3GQBB 1QQ7A 2HCJB 2GLXA 2VF2A 3FZNA 5CM9C 2HA3A 4JDUA 5DBOA 1H2HA 3WV4A 2PZBA 3C6KA 5JC8A 5IC6A 4ZU1X 5C53B 3SR4A 1RHQA 4G65A 1UMDA 3H7AA 3KSUA 3RADC 4BNUA 2GZDA 1ECJA 2C2YA 4EARA 3AETB 4IMPA 4CR7A 4EO4A 5FKJA 3M1AA 1GRNA 4KUEA 2CXRA 2R79A 4R3NA 4C2BA 3CO0S 1VFNA 4CI9A 4H4EA 3TR5A 5KSOA 4XJTA 1G38A 2BTQB 5EKDA 1KJNA 5JD5A 3MTGA 1TECE 3FD8A 3PWKA 1QGUA 3WK5A 3E15A 3D54D 2G17A 4HAVA 4DOMA 1ZAYA 2ID7A 5AKJA 5JRJA 1Z5NA 5E0KB 2ZDHA 4FGWA 2FPPA 4MO2A 3CH5A 5DK4A 2GVNA 1B93A 1N6HA 4XPIA 2C57A 2VBIA 2K7ZA 3HO1A 1GPDG 1MX9A 4PGGA 2CFRA 2DFTA 4IYJA 4XRRA 2NVWA 2OBMA 4OHBA 3QX3A 2IPAB 4DXDA 2K5UA 3V8VA 1YAJA 5DM2A 1MA3A 3C3KA 4ZVPA 4K3VA 3OU2A 1I7SB 1BX0A 3L7JA 4R05A 3CEHA 4L78A 3CF4G 2X7JA 4TKUB 1IQUA 5KWIA 2QV0A 2ECKA 3TPCA 5JFOA 4ECAA 5DHUA 1YJBA 4I4NA 4RA6B 4AUMA 2WAMA 2XHZA 2HPAA 1GPLA 4EPVA 1EYZA 3R9IA 5CDSA 2BGNA 3E1GA 4UE2A 4RH3A 3ZWVA 1T9KA 4BTEA 4JYCA 5COAA 3I9KA 4Q66C 3UGKA 1YQ9A 1CNFA 1RQ7A 3COVA 1RAEA 3NORA 1M6VB 2OR3A 4D9CA 3KZCA 1SC9A 3OD1A 1E92A 2WHEA 4D56A 4X24A 1DTEA 3OF3A 3JATA 4KLNA 3O47A 4MWCA 4QJ4A 5DISB 1BQ4A 3K6SA 2RKOA 2FR8C 2BR4A 1I2DA 3CUSA 3M4YA 4IY1A 5EP4A 1T26A 1MQ8B 1P4JA 1EGQA 2P9ZA 2AOTB 4PLYA 1T2EA 3DHEA 4W8GA 1QRRA 1EZ1A 1E0AA 5TR9A 1D2AA 3PC4A 2Q6OA 4GOLD 3CLUD 3KQWA 2BUBA 2D7CA 4B6GA 1LC0A 5IVDA 3P9SA 2ZRLA 1U0NA 2FP3A 1N0VC 2L19A 4ZEXA 1WJGA 3FPEA 4B4UA 2II6A 5BV0A 1O4VA 2XVZA 3AHEA 3N2NA 1G8YA 1QR6A 1O5TA 2XX3A 1QPZA 1HZZA 2FSFA 1LDYA 2X9QA 3STUA 4OSEA 1UK8A 3N2KB 2YTZA 1Q0SA 4YT8A 1HSOA 1R9JA 3RYFB 5CLFA 1MW8X 3C98A 1ENYA 2GN2A 1S8FA 4QZVA 1M1UA 5K3FB 4CV3A 3MINB 2JIMA 4BNJA 1WMFA 3T61A 1O58A 1NUQA 3V4SA 2NGRA 1NT2A 2DHDA 5CFRA 2F3PA 3VU9A 1TCAA 3PVSA 4E33A 3HYRA 3N5CA 1GU7A 3ST7A 4GGPA 3ZOKA 3FPGA 1O97C 4J49A 1Q1NA 1UBSB 4PAGA 1NJ8A 3AILA 3I05A 5AJWA 4B7AA 5CB6A 4DR7B 4RAQA 5JRZA 2IL1A 4IP0A 1EJ6A 3BCUA 1YKGA 4Q3EA 2WYOA 2ANCA 1ZVMA 2AC4A 4GZ6A 4JEUA 1Y33E 4UMEA 4ALKA 1DJLA 3WB9A 1UMDB 3Q8LA 1MN6A 3GLKA 3PVZA 3I45A 5L53A 1CE8B 1PTKA 1VE1A 1X7XA 4LYHA 3PFWO 3FPCA 3G85A 4B35A 4X7MA 3DVQX 4F3RA 1LX6A 5CJJA 1RP1A 3RTGA 4ARBA 1PJ3A 2GSWA 5JECA 3FUUA 5ICMA 4R9NA 3IC5A 1EUDB 5AJHA 3DULA 4DUGA 2XDQB 1GUFA 5LXTB 4B43A 2XCLA 1E1YA 3G9ZA 3DGFC 4RIIA 2VK2A 2PBZA 3KOMA 5DM1A 1TLLA 2WU3A 3DR5A 5IZCC 1XPUA 3OI7A 3VU3A 1EFVA 2WDPA 3B60A 3EIHA 4DW8A 4QNMA 3JVDA 3K9HA 4AUEA 4OP1A 4OLJA 2O23A 1EWTA 1R27A 3N2YA 4LOKA 1J42A 4MWSA 3KJXA 2NVBA 2XUZA 3IYLW 3ROTA 1FUIA 2IRWA 2X5NA 5D5QA 2C3YA 3QF4A 2Q28A 3BJMA 3R3YA 4LPSA 4HNAB 2J9XB 4M83A 1KVQA 1I24A 5JZMA 5U9CA 3VR5A 4XIFA 1PL7A 1GZ7A 3HQ4O 1EG7A 1H8ED 1U3DA 1U6KA 1YR2A 2QD5A 3LX8A 4LGMA 4BVEA 3T95A 4KRYA 3MAJA 1SC1A 2M9MA 4K2HA 4OUKX 3TNFA 1F8GA 3DTYA 1R7RA 2YOGA 2PWZA 3DEJA 1Z3IX 2L0XA 3EZLA 4NU8X 1PZFA 5EUCA 3RG8A 2FKAA 2HWXA 3GJRA 3V4OA 5AUOB 3S68A 3CLVA 4OFBA 1W2HA 3L6CA 3L6UA 3QPAA 1NW9B 4LZOA 2A6PA 5EHQA 3EC1A 1RC8A 3C3WA 5IWAB 1PL6A 2Z04A 1JEQB 3PFBA 4CKZA 2CLMB 2QRUA