1NAIA

Udp-galactose 4-epimerase from escherichia coli, oxidized
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Crystal structures of the oxidized and reduced forms of UDP-galactose 4-epimerase isolated from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1995-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1naiA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1naiA01
2WSBA 3I23A 3DTYA 3VH3A 3H2ZA 3GPDG 4FN4A 1VL0A 4PG8A 1MGOA 1MUUA 3LSYA 5ICSA 1ZVMA 3WJ7A 5KJ6A 4PZCA 1HDXA 1PJ3A 5KJFA 2Z5LA 1E1KA 4WE3A 3WSVA 1NX6A 3RCBA 4NFHA 3U0BA 2IE0A 1EFLA 3AUTA 3QVOA 4D7AA 2ZB7A 4MKXA 5F5NA 5KVCA 2HLPA 4EGFA 3MJVA 3UAGA 1LBEA 3E8XA 2X5OA 1OBFO 4CQMA 1YXMA 5GZ6A 1CWUA 2LDBA 4EDFA 2O3TA 2DTDA 4YVFA 3DZJA 3PLRA 4HBGA 1HEUA 2UDPA 5U4QA 2D3TA 2GF2A 1U3VA 3C3XA 1EQUA 1C0IA 3PFFA 3OMLA 1E3IA 4WCDA 3AFMA 3QA9A 2FY8A 1DIGA 2YJZA 2C54A 3IJPA 1ENZA 4EJ0A 5DOVA 1P33A 5HWSA 1DRVA 1MC5A 4B8ZA 1A71A 5ER9A 4R16A 3DL2A 1PJ2A 4AVYA 4BKPA 1P31A 2YYYA 4UUOA 2IEBA 1C14A 4Q3DA 5L7TA 4H7PA 4J6FA 2I3AA 4YT8A 3QW2A 1M67A 1X0VA 3AUSA 3F4LA 4K6FA 1I30A 3RVDA 4WUVA 4NBWA 1T2FA 1YL5A 4Z9YA 4WOJA 2Q2WA 2A4KA 3FNHA 1OOEA 1VL6A 2HK9A 1ONPA 2O3QA 4TRNA 3P7MA 4M86A 3NT5A 4EUHA 1DFHA 5F1OA 2IYPA 4RLSA 3PJDA 1Z75A 1IULA 1KC1A 3GC6A 5CPBA 1WZEA 1A5ZA 2X9GA 4BNWA 3Q1LA 4LMPA 1A4UA 2ZQYA 4P8RA 1DRUA 4EJ6A 1YWGO 1GADO 3H4VA 1WDMA 4QXMA 2QHXA 2CDCA 3D3WA 2HU2A 3H65A 3OETA 1UP7A 3RC7A 2AQHA 2OBNA 2ZIZA 3NEPX 3IP3A 4XB2A 3UGKA 1ZBQA 1LEHA 1LLDA 1GEGA 3ON5A 4MVJP 2DPGA 2PNFA 2VRCA 2EXXA 4FFRA 4I5EA 2DTEA 1G6KA 1DHTA 3U09A 1QXSA 3PYLA 5J23A 4YDRA 1ZCJA 4DA9A 5I9NA 4RVSA 4LCJA 1M76A 3D4OA 4IIUA 1UXKA 4IUYA 3WGQA 7MDHA 3OQBA 4N5MA 4WLEA 1Q0LA 4YA6A 1OMOA 1KY4A 4MOWA 4UUNA 5BSEA 3JD1A 2WD7A 4PFJA 4NR0A 5G0SA 5T57A 1GYQA 3DHEA 3U9LA 2E82A 3FF4A 2O50A 1U7HA 4IDDA 3D1LA 2VWHA 3MOGA 1WVGA 3H6KA 3AOGA 5HA5A 1SOWA 5DCYA 4TWRA 4GI2A 1M2WA 3K73O 1SB9A 1V0JA 2XAAA 4LVCA 4R3NA 3P2OA 3ZW8A 4E2XA 2JCXA 4J0FA 1HXHA 1YJQA 4L74A 3DZFA 1AXEA 1Z7EA 3NJ8A 1N2SA 4TRJA 2NADA 1U2GA 4DPKA 4QFDA 2CDAA 3E9NA 2YFHA 3K5PA 3BHMA 4MVJG 4D41A 1CYDA 4NU6A 5ENVA 4Q39A 5F1KA 5CEEA 4RVDA 5FFFA 3G79A 2I3GA 3UH1A 2I66A 4WASA 2ZB8A 2ZYDA 3ZNNA 8ADHA 1NASA 1NM5A 1KVRA 3OH8A 3PQDA 1KBZA 5B4VA 3OJOA 1EVJA 4RVFA 3HJAA 5DNAA 4ZD6A 4D42A 1JVBA 1NFQA 2JCVA 5JCXA 5KNLA 2GDZA 5JNLA 1U3TA 1E1LA 3INRA 1VE9A 2C7GA 3D7LA 3KBOA 1BXKA 4GMGA 4IJVA 1ZXBA 3HQ4O 2V6GA 4QFCA 4KTTE 1VC2A 1JAYA 4FW8A 1L1FA 2Y66A 4L4RA 4BB6A 3NX4A 2RAFA 4YR9A 2JHGA 2VT2A 3L9XA 4BO9A 1DDOA 1DFGA 3VPGA 3PIDA 4CMGA 1BXGA 1CQIA 1UUFA 4R1SA 3S2EA 1I24A 2PWZA 3LLVA 1XU7A 1C1XA 4JX8A 1ZO8A 3QLJA 1RKXA 1EK6A 4UVHA 2BFPA 1R0SA 1Z7BA 2VRCD 2BD0A 4B3JA 1IZ0A 2B37A 1C1XB 4FS3A 1T1SA 4OHUA 1DXYA 1F14A 3V2UA 3GEDA 4CQLB 4W6ZA 3JCZA 4XGNA 2JD0A 4ZQFA 3KYDB 3SEFA 2PKQO 4A0SA 2Z1NA 4PRKA 3AY3A 5JMPA 2WM3A 2QZ9A 1IHYA 2Q49A 3BXXA 4OOFA 4CM4A 3QQPA 4R9RA 5H82A 5COQA 2AQKA 4PLVA 4UAGA 1W6UA 3ASVA 2D8AA 4ZRNA 4YAIA 2NV6A 1DC3A 1P74A 3QVXA 4BNXA 1MXHA 1ML3A 5FYDA 3TFOA 1T26A 3NDJA 5EESA 5T8KC 4JK3A 4OM8A 2O3UA 3GGOA 4E5YA 3CINA 5BNIA 4XQ9A 3X2FA 4WLOA 3DFUA 4TRMA 4DIFA 5A5FA 1MFPA 1NXQA 3D4NA 3Q9NA 1PL6A 4KDEA 4GKVA 4AJLA 2JD1A 2VT3A 4B79A 3OJEA 2Y0DA 4YBZA 3B1JA 2BGKA 3L0DA 3IUSA 3FR7A 1A27A 4B7XA 1ZK2A 3DDNA 4MVJE 4BNJA 1LLQA 1KEWA 3U5TA 1KVSA 1MG5A 1NR1A 2DBZA 1EZ4A 4JJFA 4LVUA 4BO2A 4GMFA 4I08A 1PJSA 1E6WA 1E3WA 3RFVA 2GZ3A 2GN4A 4KP7A 4BQPA 3GNTA 3DFZA 4J9VA 4BO1A 5T8KA 2QX7A 5I7FA 2VHWA 3COSA 5T5QA 5EQDA 4RVHA 2F00A 2JJYA 1CDOA 1XDWA 1LI4A 1C0KA 2UUPA 1E3WB 2R2GA 5A9TA 4WKGA 3W4JA 1SC6A 4JQCA 1RWBA 1NQ5A 1E0DA 2GN8A 4NH4A 1R0KA 4JNKA 1LA2A 3ICCA 2RH8A 1CIVA 1DRWA 3F1LA 3HE3A 1KETA 5GZ1A 1HDOA 3VDQA 1LDEA 2P2SA 1Z73A 2D59A 4HNGA 3ZHYA 4E5PA 4YAJA 4XYEA 5BQFA 2GERA 1GPDG 1Y1PA 2YDXA 3QIVA 3B20A 1A9ZA 2VRBA 4M8SA 4ZA2A 4MIOA 2HMSA 3CEAA 5TLSA 1GEEA 3Q6IA 4HFNA 4KWIA 4LISA 5TGDA 3SLKA 3EK2A 2NVWA 1HSZA 1PZGA 3U4IA 1DFIA 3SC4A 4AICA 2E37A 1E7YA 1RPNA 1N9GA 1WPQA 5K9ZA 2GRAA 1GPJA 2JHFA 4UVIA 3S2GA 4II3A 1LSJA 2DBVO 3ZGYA 3FHLA 4CM3A 5EINA 2QW8A 4F6CA 3WOHA 5ILGA 4TZKA 4CM9A 2VOJA 1N9GB 2W2LA 1DIRA 1PX0A 1X7HA 4FDAA 4BOYA 4BO7A 1GYRA 3PGJA 3NV9A 4YEDA 1UXIA 1PL7A 3V1TC 2EKLA 3WBFA 4U0KA 2EGHA 2EJWA 2J3IA 3AY7A 4GWGA 5KTKA 1D8AA 4G5HA 1U5CA 2A94A 3IC5A 4EJMA 5JW6A 2O4UX 1EE2A 4CV0A 4GLOA 3I5MA 3AM3A 4IDCA 4ALLA 4BNGA 1Z6ZA 2C82A 1K6XA 4YT5A 4IMPA 3VPHA 3V8BA 1U4OA 5BR7A 2RIRA 3EUWA 2PH5A 4N54A 4R1TA 4YYZA 3FNFA 1ZH8A 1E3SA 1LXCA 3DOJA 4N5LA 1VKOA 4NIMA 1QKIA 5HS6A 4ZGWA 2GO1A 2EW8A 1WDKA 1B8UA 3KRTA 4W99A 4R54A 1PWXA 5IF3A 5DT9A 4QT0A 1KIFA 4FOOA 3F46A 4WPGA 1F06A 4ZQEA 1OI7A 3SBOA 2BH9A 3WMWA 1YE3A 2VZ9A 3CXRA 3QWFA 3WYEA 2O3RA 3BMCA 3ITDA 4LSWA 4IQ8A 1ULUA 3TZKA 1IOLA 2Q99A 2VCYA 3PZRA 1H93A 3GVCA 3I4CA 3JTMA 4B3IA 1KVQA 1EDOA 3BMCB 4K1LA 4MDHA 3WNQA 2WJPA 3LC2O 1Q1NA 1ADCA 2ZATA 4JROA 4OAQA 1ADGA 1ARZA 3MTGA 3DXFA 4RDIA 2HMUA 2W98A 1LC0A 4FC6A 3DBLA 4DQVA 5KVQA 3ZV3A 3CTMA 3C1OA 1R4NA 1XQ1A 4NNJA 1XKQA 1R12A 1PJQA 3NTOA 1J49A 2C7VA 2P5YA 3ZHZA 1L7DA 3DBLB 5JSFA 1AN9A 1KERA 1NVTA 1H2BA 4RZIA 3RUIA 2NNLD 2FMUA 1FMCA 1SEVA 1R4NB 3HDYA 2WMDA 1K2WA 4GWKA 3ZWNA 2Y1EA 4CM9D 1RYDA 1RM3A 4CMIA 1D1SA 5JO9A 4DTIA 1I01A 1GZ4A 5IG2A 2NU7A 5LDGA 1MC4A 5AYVA 4BIIA 1QORA 2X4GA 4E13A 5ITWA 1KS9A 4F46A 2HSDA 2X0JA 4QSMA 1J0XO 2GSDA 4FPXA 4BHTA 1HRDA 5G0TA 4GKBA 4CMIB 3SX2A 1UDAA 4BKUA 4CJXA 3AJRA 2P9EA 1HETA 5I9LA 4DLAA 2Q1TA 1LDGA 4MKRA 4DPMA 4KOAA 2BGLA 4BNKA 1X14A 5HBRA 3P5SA 1P1JA 2C29D 3WTBA 3BAZA 3TZHA 1U28A 3P19A 4GX5A 4AJKA 3PGXA 1A7AA 1QSGA 1IY8A 2YW9A 3IS3A 3RFXA 3E48A 3RBZA 4Q3EA 3TQHA 4J90A 4PVCA 4XX0A 1D3AA 1KEUA 2B36A 5U9CA 4YJGB 1DHRA 3IQDB 1R37A 3EHEA 5IDYA 3I9OA 1PL8A 2P5UA 1Z74A 2ZTVA 2EW2A 2WD8A 2F1KA 4KUGA 3PHIA 2EP7A 3AK4A 3IJRA 1I3MA 2VOEA 2VWPA 3I9NA 5L95A 5IAAA 4CMJA 1W4ZA 2GASA 4Y6PA 1T2EA 3OQ6A 3FTNA 3KYCA 5G2OA 4C7JA 4GGPA 5DBGA 1NPDA 4L0QA 2C2YA 3AW9A 5JPIA 3BYZA 5TC4A 2HMVA 2JFGA 4UUMA 3KYCB 3Q2IA 3R1IA 1S7CA 2DC1A 5L3ZA 1C0LA 1NPYA 2AG5A 4M49A 3M1AA 4HFRA 4BNUA 2X58A 4K28A 4GLLA 3ZWPA 1U1IA 2HCTA 4PG6A 3K30A 2A92A 3KUXA 3R6DA 1JVSA 1F0YA 4XQCA 1BMDA 2OHXA 1GAEO 2ZTMA 3QV1A 2LDXA 1H5QA 3VH4A 1LNQA 2C07A 3G49A 2D5CA 3ICPA 1NFRA 2BFOA 2QRJA 3O9ZA 2TMGA 4NJOA 1GQ2A 4O5OA 2AEJA 4CMAA 1XHLA 1PQWA 3ETDA 4WLVA 1UZLA 3EVTA 3UN1A 5CEJA 1Y5MA 1CQJA 3ROPA 3GGPA 4UVGA 1PGNA 4N18A 4YT4A 3TPCA 2NU8A 2FHSA 1UAGA 5CHEA 1U8XX 2PGLA 3BIOA 4E5MA 2GPTA 1XCBA 1GZ3A 1GDHA 1YL7A 4IM7A 1BXZA 2QZZA 4L75A 4JGBA 5C5IA 3M6IA 2HRBA 3LC1O 4RF2A 3HN7A 1JW9B 3PK0A 2AEMA 3NKLA 3C8MA 4YAGA 1LSOA 2EKPA 4Q3CA 1F17A 1ZIDA 4I1IA 1TB4A 2NSDA 5THQA 4MPDA 1ONOA 2I76A 5A4DA 1UP4A 2GZ2A 1G0OA 2PKRA 3HDQA 4GX2A 3C85A 4PZDA 4W7IA 2XXBA 2YZ7A 3WGOA 2QRLA 1F12A 4XGIA 5F1PA 4BV8A 3H5AA 3V5NA 4QQRA 3ZU3A 2Z95A 1EMDA 2H6EA 4HY3A 3LLSA 1Y8QA 1NP3A 3OEYA 3KLMX 2CZCA 4TKLA 3NTQA 3DOOA 1Q7GA 4I9UA 4E21A 3AM5A 3WGGA 4CLXA 1V3VA 3GN2A 2BF7A 2V6FA 4I5FA 4W4TA 4CPDA 5DP2A 1NFFA 3E1KA 2RH4A 3F5SA 1Y8QB 1PS8A 1IHXA 1K6IA 1DLIA 1XQ6A 3E6AA 4WJZA 3IL2A 2CMDA 4RF3A 5CDUA 1YKFA 2Q2QA 3DZGA 4IQ0A 5TSDA 5KJ1A 3FPCA 1HYHA 1LQTA 5GMOA 3PWKA 3TZQA 4E3ZA 3VZSA 1QMGA 1PGPA 3H5NA 2ZB4A 3A4VA 1JKJA 1ONNA 3AM4A 4E4YA 1PSDA 5DZSA 4FR5A 5TIIA 4YJDA 4PLHA 1A9YA 1O95A 4C7KA 1QV6A 1I10A 2J8ZA 3PLNA 5C37A 4E2YA 5IJZA 1N5DA 4RPLA 5CDSA 3GAFA 1GR0A 2C0CA 4DPLA 3JQAA 3DR3A 4BUCA 4N7RA 2PKQP 1V35A 2QQ5A 1UDBA 1J6UA 1PJLA 1R66A 3ROMA 4AFNA 1I2ZA 4B7UA 1NBOA 4FJ1A 3K2EA 3JQAB 1YDWA 1N8KA 3GAZA 1B14A 4W9NC 5DULA 3TWOA 2AEFA 3MJCA 3WFIA 4BKQA 4L4SA 4CUKA 3CKYA 2WWRA 3LDHA 2Y99A 4WLNA 1CRWG 3RAJA 5TRTA 2C2XA 4XJSA 4AJEA 2ZB3A 1EVYA 1O0SA 2NTVA 4HADA 1M66A 1VJ1A 4YQZA 1FDVA 5A3VA 2EIHA 3DAFA 4PIVA 1U3UA 4CR7A 2VZ0A 1QYCA 2CNBA 3HADA 4HX5A 4K26A 3ONDA 1E1NA 1R4MA 1GYPA 2E4AA 4Z3KA 1NVGA 1EQ2A 2QIOA 4Z9FA 3RKUA 4J2HA 4W82A 4W9NA 3IKTA 1YQXA 3DC2A 3CSDA 2DFVA 3UOGA 5I8WA 3PP8A 1NHWA 1IL0A 2GR9A 5AVOA 4BO5A 1O94A 3KSDO 4CQMB 1R0LA 1LLUA 3DQPA 2V65A 4DGSA 3BTUA 3ZU4A 1BDMA 1LRJA 1ZJZA 4JIGA 1XU9A 3WX0A 1PS0A 5JBIA 1I3LA 4KUHA 1YBVA 4OKNA 1PGOA 1YL6A 5T64A 4DUPA 1YRLA 4Z9XA 3SXPA 4E31A 3KHUA 2WE8A 3C7CB 2G1UA 3K2BA 3FWZA 4XJTA 4ZQHA 4QX6A 2JFHA 3HN2A 2FWMX 3KB6A 3PWSA 2Y1DA 5JE8A 1GUFA 4BVAA 4WGGA 1UJMA 1Y9EA 1RJWA 3I52A 4A10A 4UEOA 2OZPA 1ZK3A 1IPEA 3OM9A 3QVTA 4IBOA 2RHCA 4RLHA 3AI1A 4R01A 5C3MA 1PGQA 4J0EA 4B8WA 4NMHA 2ZKLA 2X5JO 4M89A 2I65A 4CM5A 1PZEA 3QWIA 5IDXA 2XXJA 2ZCUA 1TT5A 3JD2A 3UXYA 9LDTA 3GHHA 3CE6A 3ITKA 4CODB 4RZHA 4E5KA 1I8TA 5L7YA 2X7HA 4IMRA 3JQAD 2YFQA 4BL5A 5JLAA 1UXJA 3PJFA 1LC3A 1UR5A 3KETA 2EV9A 5IFLA 5DN9A 1TT5B 5KWEA 1K89A 1YJ8A 2NQ8A 2A35A 4TROA 1NR7A 4RO0A 4MP3A 5G0UA 3MJTA 3GVHA 4FGWA 1XLTA 2Y67A 3D5QA 4XYMA 3Q3CA 4U6SA 1D7OA 1LRLA 5T6BA 4XYLA 2AHRA 6LDHA 5AXAA 4DC0A 5L4NA 2YDYA 2OGUA 3INGA 3D3WB 3RBVA 3H9GA 4R68A 4JLWA 4M87A 4X54A 3JD3A 3PHLA 5EERA 4BB5A 4D3DA 1J4AA 3ZWOA 2FR0A 2GGSA 4DIBA 3WIEA 2O7QA 4DMMA 2NWQA 3JQBC 3FNEA 3L6EA 1MP0A 4QO7A 4CQMD 4S1VA 1QLJA 4N5NA 2Y68A 4BO0A 5BSFA 3K96A 4Q3AA 3DTTA 3I1JA 1YQDA 2V7PA 5ITVA 1M6WA 4CR8A 3DO5A 3S8MA 3ORFA 1UP6A 2BI7A 4FIZA 4Y6SA 5DDIP 3I9JA 2WD7B 3VTFA 4UUPA 3ZNQA 4DC1A 3KV3O 3GZ4A 1NQTA 4ND4A 1F8GA 3UICA 2B4TO 2PY6A 3JQBA 4CLDA 2FSVA 4CLHA 1QYDA 2QYTA 5A06A 4L73A 2O2SA 2G0TA 4IS3A 4CV3A 2PZMA 4FC7A 3DAPA 1LU9A 3QHAA 2JD2A 3JQ6A 4EBFA 3MEQA 3PZBA 4TMFA 4R5MA 2DFDA 4J4BA 2DLDA 1V8BA 4JJGA 5B4TA 1O89A 3JV7A 1PQUA 2PLAA 2FR8A 1GFSA 3EW7A 4CLRA 1I36A 5GZ3A 2JKVA 5EPOA 1YDEA 2B5WA 2VWQA 1U5AA 4EEXA 5CPFA 2CUKA 3VZPA 1JN0A 2VN8A 3TDKA 4A5OA 5FEUA 4ZRMA 1JU9A 1MFZA 3CIFA 1H6DA 3CZMA 1QG6A 1EUZA 3GDFA 5COBA 3CUKA 3WYCA 3NT4A 3RBXA 4WCFC 4CLRB 4D79A 4OSOA 3OIGA 1BRMA 3VHRA 1SB8A 3RJ9A 3M2TA 1IB6A 3D0OA 4YAEA 2VZ8A 3UF0A 3RC2A 1HE3A 4RQTA 1P77A 4H15A 2ILTA 5JDCC 5L9AA 3DMTC 2IZ0A 1W73A 3QY9A 4HKTA 1HDCA 3QVWA 5JS6A 1YB5A 2H1SA 2J3HA 1PIWA 2VHYA 1H2HA 1BXGB 1VRWA 4AJNA 1ID1A 4DVJA 4WCFA 2G17A 4BMSA 1P9LA 1HWYA 1UAYA 5EN4A 5JAIA 2EEZA 3NUGA 2YHIA 3IKVA 1RYEA 2FP4A 3GRPA 1E6EA 1IE3A 1U4SA 3F6YA 4AJPA 3GFGA 3WJAA 3SC6A 1VL8A 3I9KA 2PH3A 3IAHA 4D44A 5JDCA 1Y6JA 2YHIB 3RC1A 1XR3A 3DMTA 2EHDA 4JJIA 4JP2A 4OMUA 4XA8A 2BMAA 2CF5A 1TT7A 1ZSNA 1DOHA 2EKQA 3RSHA 5A9SA 3FCOA 3UCFA 3LYLA 3EZLA 4GX0A 5JAQA 5TT0A 5B4UA 2Y1FA 4HNHA 2B4RO 4CM4B 3V1YA 1E7MA 3NYWA 3DB2A 5A9SB 4Y6RA 1DPGA 4U5QA 1U7TA 5KJEA 4IGFA 4DBZA 4ND3A 4ALMA 1CETA 1H9BA 4Y8VA 1CERA 1K6JA 3AI2A 1RM5A 1S6YA 2VUTA 2Q1WA 4XQGA 1YS4A 1LQUA 2DU8A 4ZQGA 1XEAA 4QUKA 3NJ4A 2YQ4A 2D0IA 2O23A 2B4QA 4XZ3A 2HMTA 3JYPA 2D4AA 1HDRA 1X1TA 3ZU5A 1HZJA 3T7EA 3W8EA 4NQZA 4OYRA 3HFGA 2DKNA 3OP4A 4YRDA 3RUDA 3MJEA 1JDJA 5H83A 2NU9A 3WICA 5KCZA 2Y1CA 4YWJA 4YRAA 5G0WA 5K6AC 5JCJA 3KO8A 4MVJF 3OA0A 1P44A 3GHYA 3HWRA 4D46A 4A7PA 1DB3A 5DOZA 4BKOA 2WYUA 3U4CA 3O8QA 4XYGA 2OXIA 4FFLA 2BELA 1RM4A 3MCVA 3MWEB 1E5QA 1E7QA 4FGSA 3KTDA 4R5HA 4BGUA 3ZWBA 3O8QB 5A05A 4YACA 3FBTA 1ZKMA 4ALJA 3K8ZA 1PQPA 2DPHA 3WMXA 4ROSA 3HDJA 3ROQA 3WGHA 4DXHA 4ZICA 5K6AA 1ZSVA 2P68A 2X0NA 4UULA 2IZ1A 4FD3A 2IDZA 1ZK4A 4J1TA 3JSAA 2GYYA 3GDGA 3E03A 4RV9A 3RUEA 1GV0A 3VTZA 1NQAO 1GL3A 4XKJA 4DQUA 4Y67A 3Q11A 3Q2KA 1XGKA 3W1VA 2JFFA 5L53A 3BMQA 1DSSG 3HSKA 2P9CA 1KY5A 4TVOA 1B8PA 5CDYA 2PZJA 3LF1A 4J4TA 2HJRA 4RDHA 4R4JA 1WMAA 4PG4A 2NVUA 2ZK7A 4MVJH 4TRRA 3DOCA 2OOSA 4RF5A 1ISMA 4AJ2A 4QO8A 3X2EA 2DBRA 4LK3A 2WYVA 3GNSA 4MVJM 2DUUA 3OA2A 5JYDA 2Q45A 4E12A 1EEHA 3H2SA 1P0FA 2FSSA 2NVUB 1PU2A 1NNUA 2EGGA 1LRKA 1QYWA 3ZWAA 2O3SA 3ZV4A 3GFBA 1AHHA 4OH1A 2O7SA 3QWBA 4BGIA 4IZHA 3CMCO 3EDMA 4AG3A 3F5QA 2W90A 4B4WA 3HFSA 2HUNA 5ENDA 3JYQA 1A7KA 4XIYA 4Z0TA 4Z0HO 4DBVO 1X7DA 3W4KA 3TL3A 2EP5A 1QLHA 2D2IA 3DZIA 2HKIA 1DIBA 4IDBA 1LDYA 3LF2A 4IDGA 1E3JA 1LDNA 5JCJD 4R1UA 2CVQA 2PTGA 1YQGA 1XIVA 1DEHA 5A02A 1U3WA 3PJEA 3DBHA 5FI3A 1T2AA 2DBQA 2ET6A 3ZDFA 1ENOA 1DIAA 2UUOA 2FN7A 4OQYA 2G82A 3ZCXA 1MA0A 4BNTA 3WGYA 4CMKA 2DTXA 4BO6A 3GR6A 4DRYA 1HTBA 3UHAA 3RIHA 3DBHB 4U7WA 4ILKA 1BVUA 4L4XA 4CUJA 2VNAA 1ZEJA 4YPOA 2BFAA 3EGOA 3RC9A 3PDUA 3PJGA 5B37A 2CF6A 4L9RA 2E6UX 4PLCA 4ZVVA 2BHLA 1WZIA 4RPJA 4CMBA 3VOSA 4UEJA 4BNYA 3PYMA 1A4IA 2EERA 5JMWA 3NDIA 4J1NA 4BS9A 2Q1UA 4GBJA 2VUSA 1DAPA 3MJSA 3TN7A 3RUHA 2RBEA 1MV8A 3VC7A 4CL3A 2A9FA 2WDZA 1U9JA 4M1QA 2FRDA 2W2LD 3RUFA 1ZUD1 4GSKA 1EUDA 2NTJA 1K5HA 4E0BA 2QG4A 3NDRA 2ZYAA 3OHSX 4D43A 4WECA 3FSRA 1EE9A 3H9JA 1EK5A 2FR1A 1I2BA 3UFXA 1GV1A 3FI9A 3OF2A 4HV4A 4JXKA 1VI2A 1XSEA 2E48A 3OBBA 3AWDA 4URFA 5BSGA 3H9UA 1ORRA 4AJJA 3K92A 4AJ4A 3F9IA 3B6ZA 1CJCA 3FD8A 3LZ6A 1FK8A 4LRSB 4W7HA 5LDHA 2AG8A 1Q7BA 1RM0A 3D3EA 4BNMA 1E6UA 4CMCA 1VLLA 1N1EA 2NM0A 3PRJA 3VH2A 2NUAA 3DBVO 7ADHA 4WK6A 3IUPA 1UDCA 5CP8A 3GVPA 3K9QO 3QSGA 4R69A 3KYBA 2CDBA 3WGTA 1ZMOA 4B3HA 1BDBA 1ZK1A 1OZAA 2PZLA 2YV1A 4PCVA 4NBTA 3RQSA 1I3NA 3GGGA 4NFSA 4FFMA 2C5EA 2X8LA 4AJHA 3TL2A 5A5EA 3H8VA 3TOXA 2Q50A 5L45A 1W0CA 1ADFA 1K3TA 3GMDA 3GOHA 4CR6A 1BVRA 4BNVA 3TRIA 4CM7A 2VYNA 1H94A 3GH3A 3OECA 4IJKA 2IEDA 2YQ5A 3DZBA 4NI5A 2X9NA 1HDZA 1P0CA 3BHJA 4R9SA 3BMOA 3HHPA 1H0KA 3PPIA 1U2DA 4Y9DA 5IDWA 4XGKA 2X6TA 1GCOA 2WE7A 1LTHR 1SO8A 3PHJA 1NWHA 1FF9A 4CV2A 3H5RA 2JAHA 1QV7A 2FPIA 3GMSA 1E77A 1W8DA 5F5LA 3BMOB 2J5KA 2AQ8A 1ENYA 1T1RA 1SMKA 1SZJG 4GGOA 1TA4A 1Y9AA 4H16A 2I5PO 2PZKA 4YCAA 3ZZNA 1E1MA 4IY1A 1H6CA 1QYXA 3WQSB 4YXFA 4CV1A 1BW9A 4BO3A 3EC7A 4DWVA 3HNPA 4PG7A 1SNYA 2GCGA 3T4EA 4MVJI 2R6JA 3CPSA 4YAKA 1BW9B 3IIEA 1HDYA 2C20A 2OL4A 3AFNA 4QEDA 4AJ1A 4CLEA 3GVXA 1V9LA 2OBYA 3O26A 4HFMA 4BNHA 1TXGA 2PD6A 2YV2A 2YY7A 1UH5A 4CM8A 1ULSA 3RASA 5TT1A 3R3SA 4EEZA 4NFYA 5EQFA 3WG9A 2PGDA 4OGWA 1LX6A 4KQWA 4IQGA 3GN1A 3PIIA 4CM8B 5EJ2A 4WNIA 1Z45A 2GN9A 2G76A 4XWYA 2HAEA 3FRJA 1KOLA 3RKRA 3OJ0A 4FQ8A 2WTBA 2UV8A 1MLDA 2CFCA 1ZXLA 4D45A 2AE1A 3PTZA 1JA9A 3PQEA 4A03A 2Q46A 1AUPA 1KYQA 3FWNA 1UZMA 2OUIA 3ZWCA 4MIEA 1ZZEA 1PS9A 2AW5A 2X22A 3DHYA 4BNLA 2UVDA 1WWKA 4E2ZA 3PEFA 2PD4A 4RF4A 4DQXA 1U8FO 5K0ZA 3KEQA 3TZCA 3MOIA 2VYND 3GUCA 3JQEA 4UVEA 3VZQA 3JD0A 4ITUA 4LCEA 4YTEA 1ZSYA 4E32A 5KKAA 3OIDA 4B4UA 3WBBA 1T4BA 4MO2A 5G4LA 1GU7A 4ALNA 1N7HA 3FTPA 4D0RA 4C4OA 3KSZO 3HB5X 1WXDA 2IXAA 1JKFA 1P45A 2I6TA 4IJWA 4JP3A 3WGZA 4R1NA 3U49A 3BTVA 2UYYA 3W8FA 5KIAA 2WYWA 4PZEA 2VHZA 4J9UE 4XCVA 5F21A 4O6VA 2E49A 1Z82A 1JLLA 1ZNQO 4HXYA 1EBUA 4CM1A 8LDHA 3KM0A 3E5RA 2XOXA 3AU9A 2VTEA 1O5IA 4YJHA 5JC1A 3ST7A 2AXQA 3C1TA 3G1TA 2H9IA 3MJ4A 4AJIA 3QRWA 4LW8A 1PZHA 3ABIA 5JAMA 1HLDA 1NHGA 1WMBA 1X7GA 2DM6A 2GNAA 4J3FA 3RU7A 4B7CA 5IXYA 4YJHB 3V1UA 5AXBA 4E30A 4EYEA 2Y05A 4NBRA 4ZU3A 1PR9A 3ZI0A 1YBAA 6ADHA 5L40A 1HF3A 5DP1A 4FCCA 1R4MB 5C7OO 1C1DA 3AUUA 3ZW9A 2OP0A 2FPGA 5JFOA 3ZNOA 2ZCVA 2VHVA 1M75A 3L77A 4FJ0A 2P9GA 3ASUA 4IJUA 4DYVA 2NU6A 1E7SA 2PA3A 2ZTLA 2VQ3A 1C1DB 2CD9A 3GK3A 3VZRA 5A1TA 3TZ6A 3BHIA 5DF1A 1V6AA 1P1RA 2I9PA 5GY7A 5HTOA 4I9HA 4K9DA 5DCWA 1EVZA 1X13A 2EJVA 1B7GO 1T25A 4TSKA 5A3JA 3LU1A 3A1NA 1I3KA 1PJBA 1ZFNA 4E5NA 3A9WA 3H7AA 1TLTA 4EUEA 1CEQA 1PJCA 2X23A 3QE3A 1I33A 3VAZA 1YH3A 3OEWA 1BGVA 4NDNE 2DT5A 4INAA 2O3JA 3JQ7A 4ZQBA 1E3LA 1UXHA 4O59O 2B83A 3PWZA 4FFNA 3WS7A 3ZWYA 4J16A 3TOZA 4GAEA 4BNFA 4UVDA 3AU8A 5HS4A 3GF4A 3V2GA 2W4QA 5JC8A 1E5LA 1JKIA 4XD2A 3M2PA 4WEOA 4KQXA 1GTMA 2GD1O 5C7IO 1N1GA 3JQ7B 1PTJA 2PV7A 3I4FA 3IMFA 3LVFO 3DONA 3RWBA 4WOKA 5BNFA 5JY6A 2OORA 1O8CA 3ZV5A 4YB8A 4NZ9A 3VVBA 1JTVA 5U1PA 5TX7A 3S55A 4LN1A 1P3DA 1D1TA 3K6JA 1LLCA 2YV3A 4LSMA 3AI3A 1O9BA 2P91A 4FFPA 3BMNA 4I5GA 4J1SA 5I8ZA 1HZZA 3SJUA 3VDRA 5H81A 2NVBA 2HDHA 3ADOA 3SLGA 3LQFA 1WW8A 5TS3A 1QYVA 1AGNA 2FZEA 3BMNB 3ZWMA 5IN5A 3TJRA 4KTVE 3NRCA 3TFQA 1ISIA 2QRKA 3S2IA 4XEHA 4WLFA 3ANMA 1LDMA 1SEPA 5HM8A 3KXDA 4ID9A 2JCYA 4HUJA 4U8GA 2ZQZA 2NACA 3ETEA 1I0ZA 3HZZA 4NBUA 1H9AA 5AQ1A 1PZFA 4ND1A 1GUYA 1E3EA 1JAXA 2CVZA 4D3SA 3A06A 3ONEA 2ZJ0A 2X1HA 3WFJA 3ANLA 2YUTA 2X5KO 4A27A 2D1YA 2Y0EA 3C1AA 4O1MA 3U4HA 1ISGA 3FPLA 3LC7O 1YGYA 3UCEA 1DJQA 4MINA 4DIOA 2UAGA 3NGLA 4I5DA 4NU5A 1HLPA 1H6AA 4ND2A 3WQRA 1T2DA 3S1LA 1LUAA 1IZ9A 1WAMA 3HB4X 2XF8A 1UZNA 4PGFA 4QTZA 4U0JA 3CMMA 4BNIA 2R00C 4XDZA 1VSUA 2O2YA 4XIJA 4OQZA 1DO8A 1B16A 1EVIA 3WLEA 4JBHA 4D0SA 2BGMA 1FDTA 1HKUA 3ROKA 3ENNA 4FFOA 3A14A 4L8VA 4JBIA 3LT1A 3INTA 3ULKA 3I6IA 4F3YA 3FNGA 5AXCA 4DLLA 5JO0A 4E6PA 1KVUA 4IXWA 4RPGA 3WNVA 1A72A 4EI2A 3VKUA 1SBYA 3S2FA 1HT0A 4BQRA 3HUDA 1VKNA 2V6MA 4MIYA 2R00A 3WB9A 4GL4A 4EZBA 4O63O 4PLZA 2X9VA 3D64A 4EUFA 2SCUA 5I7EA 4PLTA 1F8FA 4RVUA 4KZPA 2J3JA 1NPTO 3OFSA 1OC2A 3N58A 3E18A 5ILOA 2IXBA 5G4KA 1JWAB 4CMEC 2D5AA 5TJ9A 3DBRA 5L4SA 3WXBA 4RGBA 4DL9A 4BV9A 3K31A 1QRRA 5A04A 4RL6A 4PVDA 1GY8A 3QVSA 4GQAA 2Q3EA 5G4KB 4RJTA 2ZYGA 3LK7A 1Q0HA 4WCFB 2POQX 4Z3DA 1PR3A 1IUKA 3DBRB 1VJ0A 3NGXA 3NT2A 3L9WA 4CQLA 3GT0A 3O03A 1B0AA 2WEKA 1P1IA 3OJFA 3GA0A 3W6UA 5KOIA 5IN4A 1B3BA 2DAPA 2NTNA 2X86A 4J7UA 5TQVA 1Q7CA 3KYDA 2PFGA 1DJNA 2IZZA 4KMSA 2IYOA 1KEPA 4CMEA 3DZHA 3PQFA 1LSSA 5JY1A 2HJSA 3GZNA 1DBVO 2P4HX 2JL1A 3VPFA 2OO5A 1WNTA 1YB4A 4CLOA 1HE4A 2EWMA 3FN4A 3FR8A 2C59A 3WSWA 5IDQA 1ZJYA 3PYXA 4XR4A 3RFTA 3STHA 3GZNB 3F3SA 3MZ0A 4Q3BA 3JQFC 2PD3A 1ISJA 2PGJA 3D4PA 1PGJA 3PI7A 4MKZA 2Q4EA 5MDHA 1CF2O 1Y7TA 4NJMA 1C0PA 2J6IA 4YJFA 1TEHA 4CLOB 4CM6A 3UVEA 3UKOA 3IOYA 2X0RA 1AE1A 3H9QA 3PDJA 4CL8A 3AOEC 5L51A 3N7UA 1NWCA 3JYNA 1ZMTA 4PG5A 3OIFA 4XYBA 3ZV6A 2V6BA 3JD4A 3GUYA 2TMDA 3A28A 4NJMB 4QECA 4YJFB 4BKRA 2P4QA 3ZH2A 2HO5A 4IPTA 1K0UA 1MX3A 4P4LA 4PLFA 5ES3A 1IPFA 3RJ5A 2AMFA 3GG2A 3JQFA 1PWZA 3ZWXA 5CG2A 4XRGA 1OAAA 3F4BA 4OXNA 2DQ4A 2Z1MA 5B12A 1HSOA 2EF1A 3H3FA 1HDGO 1LSUA 1IYZA 2VNSA 3AY6A 4Z0PA 3AOEA 3JQDA 3PXXA 3QWHA 1YBMA 4TKMA 3HG7A 3WR5A 4EW6A 2X0IA 1SPXA 3GLQA 1BWSA 3RROA 2BFMA 2Q1SA 4NK5A 3WWZA 1ZW1A 5L4LA 4FB5A 1NTOA 4F6LA 3EMKA 3GEMA 5ER6A 3WLFA 4H3VA 4RCVA 2OP1A 2GLXA 1N7GA 4J91A 5BT9A 1I2CA 3WDSA 4EITA 3TF5A 1GUZA 1VSVA 2RHRA 3NTRA 4PN3A 5ADHA 3KSUA 4M55A 4DYDA 3C7DB 4IDFA 3V2HA 3TNLA 4G2NA 4BNZA 4E2WA 1B26A 3JQ9C 5KVVA 3G3EA 4XR9A 2H63A 4XRRA 1HYGA 2PR2A 4CMHA 2GZ1A 5CFZA 5MGBA 2XPCA 3OJLA 4WNCA 4BO8A 3I9MA 5I9MA 3PVZA 3BMQB 2ZJ1A 5T67A 1V3UA 2B0JA 3EZYA 1LDBA 4JBGA 2J5QA 3L4SO 3BTSA 3ZN2A 2W8ZA 1GZ6A 1Q2XA 3NAQA 1ZEMA 3B1KA 3CZRA 2OFPA 3JQCA 2QYSA 3WTCA 3O4RA 5A9RA 4ZJUA 2CSUA 1EBFA 2Q2VA 3DMYA 4KDFA 3U3XA 4GX1A 3JQ9A 4J1QA 3UCXA 1WDLA 5DBIA 1YVEI 1E92A 4KUEA 5TJHA 3UUWA 4BGEA 3Q9UA 3E9QA 4Y98A 1HYEA 1I5RA 1XYGA 5KKCA 2JAPA 1MG0A 3GVIA 3WIDA 4PLPA 2BRUA 4NK4A 1GD1O 2EG9A 4OXKA 4BNNA 3G0OA 3QWAA 3L07A 2C5AA 3I3OA 1VJTA 1T24A 1B2LA 4ZN6A 2AQIA 5CDGA 3U4DA 3G17A 3KZVA 1QP8A 2OMEA 3KVOA 3ZU2A 5IZCC 3T4XA 5A03A 2HK7A 2B35A 4DMLA 4GPD1 3JQGA 3L4BC 2VTDA 3KLPX 5IZ4A 1G1AA 4E33A 4CUZA 3VKVA 3O38A 1Q0QA 4IDEA 5CEFA 3RUAA 3EY4A 5TNXA 3RI3A 3I9LA 1DIHA 5HRUA 1I32A 4PLYA 1DC4A 3JQGB 3B70A 5BNTA 3W6ZA 3ENKA 2YHUA 4JN6B 2VUUA 2GUGA 4OO3A 1M6HA 3HDHA 5EL0A 4HWKA 1KVTA 2CY0A 4ZHSA 4J43A 1QR6A 2PK3A 5IZCA 3GY0A 3F47A 1WLYA 2NQTA 2RCYA 3E82A 5KJCA 1OC4A 3JQ8A 3ANNA 3L4BA 5JAZA 4J4HA 4Q3NA 4ALIA 3QP9A 3ZHBA 3VVCA 2HMWA 3VH1A 1NAIA 3GRKA 4XDYA 3WGIA 1ENPA 1MB4A 1ZK0A 1YO6A 1DC6A 3ZWVA 4A26A 5JDIC 4FOSA 4NHEA 3JQ8B 3L6DA 1PJ4A 4OKIA 4B4VA 3TSCA 1EUCA 4ESOA 3D5TA 1JQBA 2VHXA 3WQQA 1PEDA 1EDZA 1P1HA 1H6BA 4UREA 4B4OA 1SOVA 1XA0A 1JWBB 4XB1A 4Z6KA 4HP8A 4LRTB 1D4FA 5LCXA 4TQGA 2BKAA 3ADPA 5DCUA 3PHGA 4GSLA 4G81A 1BHSA 2FOIA 1ISHA 2NLOA 4ND5A 5JDIA 2HRZA 1G0NA 1NYTA 3WWYA 1E7RA 1X15A 3N74A 4TZTA 1FDSA 1EFKA 1X0XA 1HL3A 1XWFA 4NG5A 3H9EO 4J2OA 4RVGA 4S3MA 4BO4A 4IDAA 3KOUA 1C3VA 4RPHA 4GVLA 1YB1A 3FBGA 3W8DA 4JCOA 4MP8A 1R16A 4U6QA 1X1EA 1P1KA 3DHNA 3BA1A 3L6OO 2VWGA 1B15A 2Y0CA 4R51A 4YJGA 2O4CA 1J5PA 5JXWA 5IXSA 4IZIA 2BLLA 1LJ8A 1N92A 1WP4A 2VYVA 3I83A 2DUWA 2W2KA 4I9NA 5CG1A 1YOVA 4TVBA 4L76A 4P4NA 1OFGA 4P4GA 3R3JA 4OIMA 4FSHA 1ISFA 5B1YA 1O6ZA 2W2KB 5JYEA 1YOVB 1V3TA 3BZUA 2CVOA 1R6DA 3GNQA 3ZNPA 3RD5A 1Y5RA 5I7SA 4YQYA 1R15A 3PHHA 4BMVA 3OICA 3GQVA 3DWFA 4OXYA 1DAOA 4UEKA 3SVTA 4WEQA 4NPCA 1NQOA 3EVNA 3JYLA 2Y93A 5FF9A 4P22A 1FDWA 1GQQA 3JYOA 1BSVA 3QJ5A 4OL9A 5EIOA 3UW3A 5BSHA 1UXGA 3GPIA 3LT2A 4PRLA 4NBVA 3VPSA 9LDBA 1NAHA 1YONA 4MVJA 1HE5A 1VM6A 3DZKA 3OQ1A 4IIVA 3ONFA 3DEYX 3DAGA 3ZHXA 3E9MA 4GVXA 4HFJA 4D3FA 3CH6A 3E5MA 4DLBA 4O0LA 4OJNA 2B5VA 3EYWA 5THKA 4Q9NA 2DVMA 1P1FA 4BMNA 3GDOA 1Y81A 4LGVA 5TF4A 1AHIA 3C24A 4J7XA 4ONEA 5LC1A 1KEVA 3H3JA 3LT0A 1B8VA 5ICMA 3W4IA 3BTOA 3Q0EA 4R41A 4AJOA 2H5LA 1B3RA 4ALKA 4YRBA 3G1UA 2Y1OA 2IODA 3VPXA 3R0IA 2ZTUA 5I7VA 1XG5A 1NVMB 4MP6A 1T2CA 2I67A 3OSUA 4PLGA 2J3KA 1GCUA 2Y1GA 1DC5A 5COAA 1SAYA 1FDUA 4A73A 4IGEA 3MWDB 1VPDA 2AA3A 1FXSA 2HQ1A 4PLWA 2VYVD 5DBFA 2Q4BA 4DREA 5EMHA 3GG9A 1DLJA 4GH5A 1GQYA 4IXTA 3F1KA 4YT2A 4R3WA 5AXDA 4M54A 3ETGA 3GEGA 1BTOA 3WYBA 4AL4A 5AOVA 1MXFA 1SCUA 2FZWA 2G5CA 3M1LA 5G0VA 1TI7A 3SJ7A 5FI5A 4RORA 1PJTA 5CAEA 4OOEA 5FWNA 4IS2A 3B1FA 2O48X 4RQUA 1Y8RA 3MTJA 4LMRA 3KEOA 5C7LO 3LT4A 3T7CA 4K6CA 4FJ2A 2AE2A 1HE2A 4II2A 4F45A 3PFWO 1KC3A 4A2CA 3AUAA 1Y8RB 4J7CA 3P2YA 1E7WA 1ADBA 3EAGA 4FBGA 4BGVA 4J49A 1XELA 3IP1A 1T4DA 4I8XA 5F3RA 2GN6A 1L7EA 1FJHA 2BI8A 1BG6A 3IDSA 2I99A 4G65A 5CDTA 4IINA 3I6QA 4MVJD 4OSPA 2FPPA 4XQEA 3RU9A 3RUCA 4KWHA 4RPKA 5KVSA 3ZWWA 1AXGA 2B69A 2HK8A 2IRWA 3U62A 4WLUA 4MJLA 3C7AA 5L7WA 1TVEA 4P38A 2J5RA
chains in the Genus database with same CATH superfamily
3M6WA 1BKDR 3QPAA 2JLWA 2GJ8A 3KJIA 2O07A 4HX2A 4MEBA 2H18A 4TV9B 1ECPA 4LF6B 2RCNA 1XUOA 3WGJA 3KKOA 2XKBA 3GPDG 3H2ZA 4OI1A 1VG8A 1MGOA 1NVUQ 3LSYA 4PG8A 1QIDA 3IMCA 4JJ8A 4R40A 5C5EA 1HDXA 1JH8A 1OAKA 1P4AA 1ZGZA 3NP7A 4TUYA 3SOZA 1US8A 2P7HA 1WMFA 3HI6A 1E1KA 1Y7IA 5BUSA 4M0PA 2B30A 3RCBA 4JJAA 4OMDA 1SU4A 5JAHA 3U0BA 4C0WA 4DA6A 2IE0A 2YFYA 3AUTA 3OZIA 4OHYA 4TXNA 2FG5A 4WA8A 2MMGA 4TUYB 3FFWA 2I1LA 2HLPA 1US8B 1YCDA 2FPRA 2NXWA 2O1SA 3E8XA 2FPGB 4HQFA 1DUVG 4RMHA 1IG3A 4IIDA 4Z54A 1IK6A 1VPEA 1ZG3A 1RQNA 2O3TA 4M76B 4YVFA 1GKUB 1HEUA 2QXYA 2NU6B 4G0YA 2X1LA 5A6SB 3QF4A 4UXHA 5AKZA 1LY1A 2CK3D 2DY1A 2GYWA 2QMQA 3D6HA 4QXOA 5CTJA 3SOPA 4EUKA 3REOA 2BJWA 1DIGA 2FY8A 4PTZA 4F91B 2G9UA 2ETXA 2ZW9A 2J0UA 1RHQA 1ZP6A 4EL5A 3OLCX 5JADA 3QF4B 3DG9A 2H1IA 5DNYB 1P33A 2YVAA 4HB0A 1G59A 1QIMA 2OCAA 3ETNA 3EBOA 5HWSA 1DRVA 1Z6XA 2ESRA 2ST1A 4F6RB 1SBQA 2XVAA 4MCHA 3UANA 3ZHRA 5B3AA 5ER9A 3MQ2A 1H69A 2QDKA 4BFXA 4K9PA 2H2WA 3LUFA 3DL2A 5BRNA 2H0QA 3UB2A 1WQ4A 3ICOA 2J0UB 4HPXB 4AVYA 3T7KA 4BKPA 3VKFA 4UUOA 4Q1EA 2IEBA 1M8FA 4Q3DA 2IIQA 2PL1A 5MHTA 4BU1A 1TRKA 2B34A 3I0MA 2WKPA 2ZE7A 5E4JA 3WWCA 3ZVNA 1X0VA 3FFBA 2QRNA 3AUSA 3BQMB 3F4LA 4FX5A 4KFSA 3N2GA 3UQYS 1Z0DA 4EJ2A 3KLBA 2ENUA 5B2FA 3OZDA 3FPSA 4Z9YA 4WFIA 2ERYA 4V38A 4IWNA 4WOJA 2Q2WA 2A4KA 3FNHA 1H1LA 1OOEA 2ZSIA 1ONPA 2A3NA 2D2VA 4HLUA 5CJ2A 4GBMA 5AUNB 2GK4A 2PX2A 4ZT7A 4H7EA 3N2GB 2Q5JA 3SHTA 4G9BA 3P7MA 4ZO9A 5EZQA 3BH0A 3KOYA 1EJBA 3NT5A 2DUNA 4EUHA 3NLLA 2C4WA 5AK6A 5LWHA 3MUOA 2ZWOA 1GPH1 1H1LB 4DNPA 1Z75A 1IULA 1TGYA 1ZONA 3CO5A 4G26A 4YRCA 2JGFA 4QUDA 5AO9A 4EGCB 3GT3A 4GKAA 4EYOA 5BWMA 3WQBA 1E9BA 3Q87B 5CPBA 2OB2A 4FD2A 1IWPB 5I9IA 3KJXA 4F9FA 2PSFA 1YWGO 4PNZA 3CG0A 3CUYA 4L9WA 3LP6A 3F98A 4FE4A 2QHXA 1JA0A 3N9IA 4TL7A 2FNAA 1AGRA 2CDCA 3KOWA 3H65A 1KF0A 1JSCA 2HU2A 3QVMA 4WAUA 4YV7A 1RI2A 2Q8NA 1PUIA 5DK4A 2PQ0A 3IP3A 3ESXA 4FDMA 4XB2A 3TNDA 3HVUA 1LLDA 1VECA 4LQCA 5D85A 4LZNA 4HQ6A 2PNFA 1KORA 2VRCA 4H08A 4A2WA 1QQ7A 5KWJA 1DE0A 2WILA 4KV9A 2V3VA 2I4IA 3O73A 2YWJA 3UATA 2PWAA 1I0LA 2VA8A 4Z8XA 3OLWA 5K0EA 1VLMA 4GICA 1NJFA 3TIFA 5JYBA 4GLBA 3ROXA 3FFAA 1YI1A 5TQ0A 1QIFA 3WYFA 7MDHA 1N2XA 1YQ9A 2MSEB 3OQBA 4WLEA 4LG1A 1BC5A 3P0EA 3L6UA 4OMFG 5GJCA 1ZN8A 5E6SA 1VL1A 1POWA 4MUJA 4QU0A 5G3YA 4CCYA 3JD1A 4YAUA 5K0FA 2BEVA 1MB2A 1C0EA 1A9SA 1DAHA 3TD6A 4K6HA 4YUAA 1IJKA 2WJVA 5TQ0B 2IYLD 2O50A 1K8XB 4IDDA 4D4IA 4QM7A 2PH1A 4R9UC 1Q95A 5DE3A 4HLQB 3D1LA 1JFSA 1Q44A 5E6SB 4CCYB 2BSAA 2XZPA 4ENVA 7MHTA 3H6KA 4ZDJA 5IJ9A 4OVKA 1SOWA 4WXRA 3DCIA 2RFLA 4LOIA 3WK5A 1M2WA 3B5JA 5HEKA 3WV5A 1ORVA 3FI0A 1SB9A 1V0JA 2FX3A 2XAAA 1UXOA 3P2OA 3OZXA 3QMMA 4HB2A 4K03A 2GM9A 4I50F 1HXHA 4J0FA 4QEZA 5E4FA 4BZZA 6NULA 1OGJA 2DWUA 3DWEX 2EDAA 3MA0A 4M83A 4ZAFA 4KWEA 1V7CA 3T1HB 1K6EA 2VP2A 1AKNA 1KMIY 2QU7A 2CDAA 3E9NA 3O7WA 1PWYE 2H9AA 4OHBA 1RI5A 1P7PA 1XZPA 2QRQA 3BHMA 3NBYC 3PCXA 1CYDA 4MQEA 3RUPA 2ONZA 2QAJA 3FPGA 5ALQA 3WKCA 4Q39A 5AM1A 2QD5A 2GA9A 1Q12A 5FNVF 3W5SA 5DMHA 5C35A 5CEEA 3BBLA 1CUYA 1HI9A 1WF3A 2I66A 4MQMA 5DEOA 3UH1A 5HJ7A 3K1AA 3ZNNA 2PX8A 4C4YA 3GI1A 1Q20A 1NASA 1YF3A 2PSHA 1KKMA 1KVRA 3FOCA 3OH8A 3P9IA 1CB0A 4MQEB 1L4FA 4MA4A 3T5BA 121PA 1ZD9A 1EVJA 1MO3A 3ELWA 4YYEA 4LYAA 2UVPA 4B3TB 221PA 4WX2B 4B09A 3K1AB 5JNLA 1U3TA 2BM8A 1E1LA 1VE9A 3AMVA 3D7LA 1ZICA 2QTZA 1TCVA 3WHKA 1TM3E 2VJCA 1JQ5A 1CZHA 3FDFA 1JAYA 5DU2A 1M73E 3O6VA 3C74A 5A5GA 1ABEA 1Z8NA 5FH9A 1DDOA 1L3CA 1GA1A 2PQ2A 3FETA 4CMGA 2M6KA 3A3PA 5D6NA 4ZMBA 1CIPA 2F43A 2W43A 2E18A 2QTNA 4Q1VA 2YZMA 3RG8A 3S2EA 3BL8A 3UB4A 4AY6A 1KQPA 1C1XA 1N3BA 3K9HA 4JX8A 2HB6A 2WWHA 4TKUA 3SIRA 2PRSA 2I7CA 2P69A 1F6WA 2BFPA 2VAWA 2HWWA 3BFXA 3EA5A 4UVHA 5K0SA 1DKOA 1SVSA 1R0SA 1WW3A 4QKQA 5HIIA 2F43B 3IR7A 3L0YA 5TPZA 5AIAA 5DH9A 4B3JA 4BX8A 1XVLA 4MUKA 1C1XB 3EG5A 4TV8A 3GAMA 4OHUA 1DXYA 1TO1E 1ONBA 2FWAA 3B6EA 4ME6A 5A71A 3LRTA 1JV2B 4KVGA 5M5BA 4OAOA 2JD0A 2J6HA 4G37A 3SEFA 3PQ8A 3PUKA 2Z1NA 2REBA 4O25A 4PRKA 3R7WA 3OMWA 2PN1A 3HMKA 5BN3B 2F6RA 1WTAA 4Y2GA 2FJ0A 3BXXA 1E2IA 1GGEA 1TYDE 4Y2JA 4I8IA 2BSQA 1U0LA 2BY4A 5CYOA 3VRHA 3EDQA 7ABPA 5K8UA 1IC6A 3E5NA 3D0QA 4KJZA 3BB4A 4ZRNA 3R7WB 1X3LA 1PK7A 5HJ2A 3RB8A 1TD1A 1P74A 2EX0A 2QX6A 3QVXA 4A2QA 2PAFA 1H2EA 1VP9A 1Z35A 2O7RA 2F2TA 1E5VA 4CWAA 3TFOA 1H0SA 3H5VA 1J1UA 3S5JA 1W9MA 2BDEA 3DEAA 2WHPB 4ZTZB 2F8TA 3A4NA 1XU4A 4MRVA 1CS0A 1H8ED 1MX5A 3PR1A 3QKWA 5KSYA 5FOSA 4XQ9A 4RAOA 3V8NA 4BP8A 5ARDA 1SU6A 2VT3A 3QJGA 3OJEA 4HYTA 4WNAA 2BGKA 2V74B 3L0DA 3FR7A 1A27A 1CS0B 1PQ4A 3H8JA 3OTHA 4P3XA 4WXHA 2A9RA 2WUVA 4BNJA 4MYDA 3MYRA 1KEWA 5ALHA 4RLFA 3U5TA 2BFEA 3R40A 3IEVA 1LTKA 5I4BA 4JJFA 4LVUA 2PG3A 4GMFA 2C99A 3AX6A 4PANA 3N6RA 4WNAB 2IUEA 3K05A 4OUDB 3RTCA 3VHQA 2OG2A 5HR5A 2GN4A 4GR5A 4KP7A 3RVJA 4BQPA 2IV7A 5ISMA 2Z6QA 4NXNB 2EJBA 2OT3B 1Q7EA 4M1TA 2YZGA 2PUCA 2R7LA 2F00A 1BFUA 2JJYA 3CRZA 4YI3A 5KYVA 1O87A 1UPTA 3MWEA 5BRJA 5JMTA 4WOPA 1RP1A 3AINA 4BKMA 3CVVA 2UZ1A 3QV2A 8GPBA 1PR5A 3A2MA 5KNCA 5DI3A 2PSEA 2VPIA 1FQWA 1SC6A 3ZLAA 1OASA 4JQCA 3QVKA 4R1LA 3ZYCA 1E0DA 1NNSA 2ERXA 4BB9A 4DSAA 1EP9A 2GEJA 4Y6LA 3ICCA 2OYCA 4YRZA 5HUQA 1VL2A 3TBKA 1CIVA 4EAQA 5LL6P 2WM9B 1CD5A 4I2VA 3TJMA 4MV9A 5AVSA 4V24A 4FI3F 4Z9AA 3EYAA 3R3YA 4NBSA 5GZ1A 1SBTA 5DI3B 1LDEA 3ZHYA 1UFRA 1JHRA 4A82A 1Y7PA 3QYAA 3W5IA 2ZVDA 1UC5B 3A7EA 1QTIA 1Y1PA 1JTEA 2H1RA 2CWWA 3ZDXB 1SUBA 4MIOA 5ALYA 3CEAA 3Q6IA 3SLKA 1GZSA 1L5QA 1JDBB 2QAGC 3IVMA 4BCCA 3B85A 2DFNA 3U4IA 1G9XA 2OYRA 1E7YA 2REOA 4G0OA 1U2QA 1CULC 1U65A 4DM4A 1GPJA 2EZ4A 1APBA 3JPYA 4II3A 1LSJA 2JB9A 4MVYA 3FHLA 4FSDA 2ZJAA 1KBQA 5EINA 2QW8A 5G1PA 4C1NA 1WKBA 4NU8X 4TZKA 2L2QA 4XE5A 1QX3A 4CM9A 4B2LA 1KH3A 1M34A 3O95A 4OG2A 4REOA 4N7BA 1BJRE 4S35A 4IDUA 1OYVA 4JL6A 2BEKA 3VTFA 3ZVRA 2O59A 1T8SA 3H2YA 4BN0A 4YEDA 3N3AC 1PL7A 2OLKA 3ZX4A 1C9MA 1Q0UA 2WU4A 4GYJA 3WBFA 1X3SA 3A6DA 1JH9A 1J56A 1RTKA 1J2JA 1KJQA 1M34B 1TQ2A 2R86A 3FFXA 3LPMA 1U5CA 1SVKA 2I3BA 2NTEA 4LY3A 5JW6A 2O4UX 1GUDA 3A37A 5JNSA 2WZBA 1ZI6A 2IEZA 1YB6A 3PFHA 1EE2A 4JJ6A 5K7SA 5G41A 2F67A 1V16A 3HUTA 4LSGA 1Q92A 5LMNB 4IDCA 3AKEA 3D59A 1RC0A 3L7LA 3MUFA 4CCSA 3VPHA 3PA6A 3MCAA 3SK0A 1JHUA 3CPJB 2RIRA 1NDQA 4P3KA 3OZFA 1KK1A 2PH5A 4JY7A 2CLOB 4R1TA 3EUAA 3JPWA 1K5PA 1O8BA 1XALA 3R5FA 3FNFA 4HQOA 1E3SA 2OFXA 2P7IA 4TTAA 1FRNA 1VKOA 1W4AA 4WK0B 5DW0A 1QKIA 1A8IA 2NP6A 2A14A 1Y0BA 2WYIA 3VKGA 4B43A 3R0VA 1WDKA 3KRTA 4W99A 3PXBA 2GEDA 4AZ0B 5DT9A 4GZ5A 5GJVC 4FOOA 3F46A 1NX9A 5TVGA 1F06A 3KFLA 1FSZA 1QH1B 3SBOA 4YRNA 1G5QA 1YS6A 3SYTA 1JPNA 2VZ9A 3QELA 3WYEA 4R2HA 1Q11A 2O3RA 2ZEJA 3OJXA 2QYOA 3PNPA 1RQPA 1W85A 3F74A 3IAS6 3USES 1UBFA 4E7PA 2VCYA 1P3JA 4ZDIA 4MV1A 1H93A 2V4MA 5IRCD 2QTHA 4LV6A 2X6RA 3NATA 1J99A 2W6PA 1WZ2A 2D6FA 3QELB 4B3IA 1EDOA 3PVSA 1NMEA 1AD2A 1RWPA 1XMJA 3QKSA 1W85B 4IDNA 2G25A 1OXBB 4K1LA 3MRTA 3BAFA 1JHDA 3PC6A 3PFKA 1GSOA 1DPFA 1N1DA 1L6IA 1WULS 2RC5A 2VJLA 1N2IA 2PX0A 2W6QA 4JROA 2NMVA 3HEAA 3G59A 2LCQA 2HMUA 1Y9JA 5ESXA 3M5PA 1TMYA 5GGXA 2WHEA 3QKSB 5BNZA 1M0TA 2OM6A 4HYYA 1UFVA 4WW0A 5KVQA 3AERA 2X7JA 2I6SA 4N9QA 5DVZA 3NBUA 1Y3BE 3H2HA 1UPFA 1QC5A 4MPPA 3OQHA 1PJQA 4OTZA 4BLTA 5GV8A 1L7DA 2B2NA 3HCRA 4WL0A 2DB3A 1AN9A 4NZPA 3ER9A 1UKYA 1V8PA 2A59A 1D2RA 4MDFA 3TMKA 1KE2A 5IULC 1NVTA 2ODQA 1H2BA 2BFFA 3Q1KA 2NNLD 2QN9A 4IWXA 4MUGA 1FMCA 1U28C 3NFYA 3AM1A 4JENA 1OZGA 4MB2A 2GI4A 3AUFA 4GWKA 3NW9A 3UJ8A 3IVXA 4ZO7A 4MAFA 4XFKA 4F9TA 4LXUA 1RYDA 4CMIA 1A5TA 1MN6A 4JNGA 4GL2A 2NZYA 4EELA 1JMVA 2AC4A 4DDUA 2NU7A 4ZYTA 4QXPA 2BFFB 2QJFA 1L0BA 5DTJA 5LDGA 5IBRA 4ZZIA 1QORA 4E13A 1T4CB 5HIJA 2HSDA 4KXLA 4B3DA 3IP5A 4QUHA 1Z5OA 4QSMA 2X15A 4C0SA 1J0XO 1ZJWA 4QM6A 1FRZA 3WP0A 1OTYA 4CMIB 4BKUA 1F8YA 2ONJA 4CJXA 4CN9A 2QK4A 2C31A 2Q1TA 2NU7B 3PIRA 4MKRA 3ZEIA 4M7PA 5EP1A 4UTVA 2BEUB 5HBRA 1N5LA 1USIA 3P5SA 4KN5A 3WTBA 3BAZA 3O8RA 4AJKA 3PGXA 4CU2A 2DERA 2JFUA 1IY8A 3SICE 4RWZA 1LV8A 3I64A 3X1MA 4K9QA 3TQHA 3NM5A 3WHLA 1QM5A 1S2OA 2P4EA 3DDCA 3QUQA 1D3AA 2B36A 4JGGA 4PX9A 3SX0A 5HXAA 2B99A 3IQDB 2BMVA 3ZXXA 5JOQA 3K5HA 2BGUA 1U0BB 1EGQA 1RMQA 2WJAA 2EW2A 3UV3A 4ZIRA 4RVCA 2V7XA 4KUGA 1KPGA 3WWEA 4FKZA 1R6VA 3OQVA 5C32A 3AK4A 5IKOA 5LU9A 4WK2B 1TUBA 4W63A 2ZXUA 4MZXA 4PSUA 1CR0A 4GYWA 4O8ZA 2JEYA 3UMCA 3M4XA 4ZIRB 4FYVA 2ZSEA 3CUEF 2OLEA 3HB0A 2FPMA 3UA4A 2NUTA 5LZ2A 4ZODA 2XGMA 1QZZA 1EJ2A 3GJXC 1J2YA 1PR1A 2HWYA 1QFZA 4UUMA 3WIVA 2EATA 2LKCA 1JAHA 4M98A 1R0YA 1V4NA 2NUTB 4MUYA 1AQYA 3RVRA 3U4AA 4KJXA 5TVKA 5I8PA 3N8NA 2P2YA 5CNKA 1EP1B 1NLFA 1Y7LA 2ZULA 3BZWA 4M49A 3M1AA 4C7XA 1ODLA 3ZWPA 3HMQA 4BEVA 1U1IA 2HCTA 3Q41A 4FMBB 4Y18A 4ZEXA 3CBGA 2HF7A 4C5CA 1YUBA 4M0CA 1A8HA 1W29A 1DDIA 3B5EA 3MWKA 2EU8A 1XZBA 1A82A 2ZTMA 3QV1A 5KNDH 1XTUA 2D1QA 4GI5A 4KAXA 1H5QA 1LNQA 1PRYA 2C07A 2D5CA 1C3JA 2RHGB 2XADA 3G49A 5JHGB 5JASA 2WV7A 2TMGA 1J22A 4JQYA 3TLMA 5B3KA 3CHYA 1I1HA 2J3LA 4G5GA 4WLVA 1USUA 3UN1A 1JBQA 3H83A 4PSDA 1Y5MA 8AT1A 3QXXA 3P9RA 4LQDA 4M8IA 4I1PA 2ZRPA 1PGNA 4AX4A 3HACA 2E21A 1E5DA 1L5VA 1PYOA 3BCUA 4AMVA 2CHUA 1VP3A 1R64A 2R60A 3H4IA 3H97A 1QCCA 4HEJA 2Q2NA 1MX9A 2HIHA 3L8HA 2QZZA 3KUKA 2DPXA 3OKAA 3HYNA 4L75A 1V6SA 2WMNB 5IM5A 4C4SA 4AT1A 2HRBA 2AG6A 3LC1O 3QUTA 4Y2UA 3PK0A 2AEMA 3I45A 5KZMB 4MICA 1PFGA 3IOEA 3Q7TA 1EXWA 1ZISA 2PQ6A 1W0KD 4U2BA 5FJIA 3RDPA 2HLDA 4ZXFA 2Q2OA 4GMHA 3WL5A 1ZIDA 2RB5A 4PGMA 5AHXA 5CXUA 5EJ9A 2NSDA 3IUEA 5THQA 5D86A 3NS7A 4JITA 2O05A 3GJ7A 1ONOA 3ZD9A 3V97A 2PKRA 4GX2A 2QL6A 3F96A 1AZTA 3S6JA 1FUYB 3DOEA 3U7QA 3TVYA 3IRVA 4WJLA 4D9HA 4XGIA 2IWRA 1PKXA 3ZU3A 2LW7A 3V5NA 3TPZA 4MPJA 5HQ3A 3UOAB 1I1NA 3CH4B 4DXAA 3DKRA 5LSAA 1XNHA 2EAUA 3H87A 3LLSA 2D7DA 3VDMA 1X9IA 1RAFA 2XVMA 1E2MA 1WB6A 1KJ9A 3NTQA 1Q7GA 3GZJA 3GFQA 2C4UA 3GN2A 3JWIA 2Y0BA 2VSFA 3NIBA 3K5IA 5HQ3B 2I91A 3KIPA 4RKWA 3DZ8A 2PQMA 4K9SA 4BX9A 4YRSA 2MSDB 3TLBA 1IHXA 1TQ4A 1FX0A 1XQ6A 4YCDA 3IR6A 3H1FA 3IL2A 2DY0A 2I9KA 4UMVA 5TSDA 1NBWB 1MJGA 1UKEA 3CV3A 4R2MA 3TZQA 3PWKA 5JRJA 3VZSA 1QMGA 2QN6A 1W2HA 3FCCA 2ZB4A 1S1CA 1JKJA 5CNJA 1I7QB 3BUSA 1FX0B 1HLFA 5HCNA 2WG2A 3HZOA 1KI9A 4WZ6A 5AHRA 2LPMA 3OPQA 5BP7A 4YJDA 3JSXA 2OQIA 4HEQA 4X1KA 1E60A 1QV6A 2BDTA 1VHTA 3DLBA 1Q19A 1JKJB 3HUEA 1R3DA 1PHRA 1VHQA 2C9OA 3ED5A 4CZ2A 5CDSA 1C7EA 3VNAA 4LJ6A 1COWD 5AUQA 2FPPB 1XJ0A 4X1KB 3OTQA 1KGDA 2FUG6 1E9DA 2O8NA 3OE1A 1J6UA 3KALA 2EARA 4HLNA 3D6VA 2GM3A 2ZTSA 4P5DA 2GO7A 4FJ1A 3SYKA 4BEWA 5JWOA 2IU3A 1YDWA 2WU1A 3E9CA 4DIDA 5ADVA 2AX3A 3AXTA 1FQOA 3K0EA 5D1HA 1B14A 5DULA 3L1JA 5JZ9A 3CKYA 4NX2A 1IQPA 4EWLA 4W9MC 3LUGA 3UMSA 1GL6A 2WJ3A 1P80A 3IDFA 4XJSA 5TRTA 3FYUA 4ZZ0A 3TQSA 2XMBA 1O94C 1EVYA 3E1GA 4UNQA 3K70D 4C3OB 3JALA 1OX5A 3EDOA 1VJ1A 2M1XA 3WOVA 1I7NA 3DF7A 5KYWA 2D4HA 3QFCA 3O75A 5P21A 1U3UA 3JQRA 1IN6A 1PJ8A 1QYCA 1YZTA 2C3OA 4K26A 3FYUB 4D02A 1A97A 4BP9A 1GYPA 4P3NA 2CT8A 1CIJA 4NONA 2G9RA 4P4SA 4N0PA 5HF8A 2XQKA 2QIOA 2R1TB 2P5SA 4E2FA 1FTSA 1M6YA 2PX6A 3LZDA 3VMFA 2I6QA 4Q9DA 4F7DA 4W9NA 3IKTA 4EPYA 2IY8A 1SD5A 3LCMA 3MWGA 4N8EA 5I8WA 3PP8A 1F20A 3DTVA 1IL0A 3GRZA 4NBLA 2GR9A 4BYGA 3C3PA 2WSMA 3FROA 5FUVA 3RS9A 5JZSA 1MJFA 3MT8A 3GAAA 4H2DA 1CR1A 1HORA 3KEGA 4JGIA 1YZGA 1LLUA 1NXXA 2QTAA 4ZVKA 5AKEA 4CQMB 4DGSA 3ZU4A 4F6RA 1QAMA 1BDMA 2NYUA 1LRJA 2P8JA 2XVYA 3KAJA 3KXKA 4HMOA 4JIGA 4QG3A 1OXTA 5JFGA 4QJ5A 4XVUA 1JG3A 3DTVB 3FGZA 3TCXB 1I3LA 1Y4SA 2VYQA 3TMYA 3L92A 3QSYA 3IVRA 1YL6A 1VE6A 2QW1A 2Q0QA 4RKEA 4UEWA 3SXPA 4BWYA 2WE8A 3OC0A 4B81A 3ZGNA 3C7CB 3J80A 1URPA 4HTAA 2CVHA 3FWZA 5HSGA 2V59A 1MD9A 2EG5A 1RRCA 5J4YA 3Q85A 4YJ3A 2Y1DA 3TAHA 4H18A 2HY7A 1NU8A 4WGGA 2XQVA 3IKMB 3QXCA 4E5NA 5DTMA 4LEIA 2XDWA 3NHMA 2ZPUA 4RS3A 2OZPA 1ZK3A 3LVQE 5ALFA 3F6SA 2JIOA 1TJ3A 1ZRMA 2PA0A 5KNBH 1QHEA 4YJ3B 4K6KA 4R01A 2Q07A 1G8PA 3GEEA 3EZXA 4RENA 2X5JO 4LJ4A 4EX6A 1PZEA 5AI4A 3PQ7A 4I3FA 5C1OA 3DZCA 4KQKA 4EHLA 2O5RA 2PUJA 2XXJA 4RDCA 1XRLA 4RK6A 5AM4A 4MUEA 3OIVA 1A2KC 1TT5A 2D0DA 3E3OA 3JD2A 3UXYA 5CU7A 3CE6A 3ITKA 2IPLA 1ODFA 1DKNA 2VHUA 3OFNA 3Q12A 1I8TA 1GSIA 1GAXA 1I6MA 2YFQA 1DG1G 3IQZA 5FADA 1IEQA 1MBZA 3B6JA 4ZK2A 5A1JA 1UR5A 3FAZA 3KETA 3LWBA 1ZIYA 8OHMA 5IFLA 1TT5B 1KHHA 3ID6C 4YO7A 3OTWA 4BFCA 2X41A 1JIVA 2JFXA 4TROA 2DQZA 1MRSA 5IM4A 4MP3A 4D4HA 3D0KA 2ODPA 3ZE1B 1XTPA 3GVHA 4MV4A 4RFVA 2RB4A 2ZJZA 1U6IA 3TW6A 4XYMA 2VJPA 3D5QA 3NC4A 3NP9A 4JUFA 3VBCA 3RRJA 2GFQA 4JOCA 4PEVA 5NLLA 1Y6FA 4EKYA 1PEAA 1OA0A 1XQXA 3NORA 1F2VA 5EWLA 4XYLA 1REQA 2EX4A 3OJWA 5AXAA 4EHJA 5L4NA 3L4JA 2OGUA 3INGA 1Z5ZA 4W5TA 4X54A 2FHPA 3ZJVA 4FQ7A 2KQUA 1J4AA 1P2DA 2OOKA 3KOMA 4QFBA 4BB5A 1MJNA 3MWLA 2GGSA 1Q3TA 4G89A 2Y77A 4JP8A 3IV7A 4PX5A 5EWLB 2NWQA 4RANA 5BNWA 1RI3A 3JQBC 2WB4A 3Q5DA 3FNEA 3L6EA 1NBHA 1XFAA 1P5FA 5I51A 2VSYA 2P2GA 1HTWA 3OT5A 2FVXA 1JIQA 2Y68A 2ZUCA 4OLJA 4BO0A 1BQ4A 5BSFA 2BM9A 3K96A 3WWDA 4CG0A 2QBYA 4V2IA 5CYPA 2D0PB 5CA1A 3G5MA 2QEQA 1YQDA 1M1ZA 5EIEA 1ML4A 3GDWA 2RHOA 1F2UB 3WNCA 3TJZA 4B17A 4EL0A 1VKJA 4EABA 4L51A 2Q4DA 2C2GA 3ORFA 1YMQA 3A3YA 3HP4A 4IRXA 2DT8A 4U2DA 2PMFA 4FIZA 1G8GA 4IYJA 4XWGA 4Y6SA 3L0OA 5DDIP 3RIYA 5E8RA 3KV3O 2L17A 4DC1A 3GZ4A 2YOFA 2W8BA 3KVYA 2Q7OE 4RD4A 2PY6A 1BCRA 4EB8A 1Y89A 1GDDA 1FU8A 1RBQA 2A0FA 2FSVA 4CLHA 4U7HA 2DFTA 5A06A 2O2SA 2OCYC 3GBPA 4IS3A 1C81A 1QH0A 2E89A 1XZDA 2IY9A 3KDAA 4FC7A 4K8OA 3TQOA 3WP1B 1K0FA 1MJHA 3MEQA 3PZBA 4IOJA 2CXXA 1MZVA 4M9QA 4MZDA 4E08A 2ZSBA 3KS9A 1BCRB 3SQDA 1JR3A 3MILA 1TMGE 4OHRA 4IRUB 2QD2A 2BOVA 3UG7A 3BD7A 1FRVA 3BCHA 1CQWA 3ETHA 3JV7A 3OU2A 3LHFA 3DP7A 3I2HA 5EZ6B 3TTUA 1YDEA 4EEXA 4XUDA 2GXSA 1L7OA 2OMKA 4DS3A 4JP1A 1SZCA 4A5OA 2O52A 4EFLA 5B7GA 1T3LA 3B9QA 1GM5A 1QG6A 4HDNA 5BN5A 3W5DA 3CUKA 1AG9A 2BW0A 3IVCA 3FF1A 3JWPA 1U2EA 3OIGA 1K4KA 1SRQA 3CWQA 1NJGA 1M10A 1XZ8A 1ZMRA 4AMYA 1GNSA 1YB2A 3CF4G 3MMXA 3RC2A 2G28A 5BN5B 5CXSA 1XD9A 2Q0SA 1P73A 3L18A 1MHPA 4FCWA 1P77A 3LQ2A 4QOJA 2ILTA 2JAWA 1PG5A 3BH7A 3DXYA 4XUGB 2IYQA 4OREX 3WBKA 1E58A 2IZ0A 1O4WA 1Z7GA 2ZSUA 3AHHA 3QY9A 4TLDA 3LM8A 3LOQA 4QFDA 1PFVA 3E35A 1ODJA 3SKYA 3OF5A 1KR5A 3JVIA 3L8ZA 3CUSA 3ISJA 3PQ4A 4V0MA 3KQLA 2RG1A 4JKIA 3HCWA 1BXGB 1R5JA 4Q3LA 3EGWA 1FMTA 1DJPA 1HWYA 1P9LA 1ST3A 1UAYA 4LBYA 4MWOA 1Q7TA 2EEZA 3A9CA 5J40A 2B4KA 1V96A 3RC3A 4WJKB 1BEUB 3Q5GA 4FBLA 3LL4A 1E6EA 3THXA 4UM9B 3ADDA 3CLHA 3F6YA 5HMMA 4AJPA 3UAZA 4PQRA 4LECA 5BWCA 2IZOA 3QE9Y 2PH3A 3DW1X 2GCEA 2B61A 5JDCA 3EX7C 3DMTA 3BD9A 4H4EA 5HDBB 4YUVA 4CHTA 3QENA 2PXHA 4JP2A 4XA8A 3THXB 3RSHA 3KPWA 4UCQA 5A9SA 3GLSA 4X00A 9GPBA 2LXNA 1AB5A 3N75A 4BGPA 3WQHA 3TTTA 5TT0A 1KAGA 1CBUA 5AJYA 2HQRA 2WZQA 5E2AA 1TIKA 2HCBA 2C84A 3AB8A 3RS0A 1V9SA 4N76A 3ZGZA 2O2JA 5HKLA 2WHXA 2YMQA 2NX2A 3IIIA 5TXGA 3LPDA 1BGXT 3V1YA 5A9SB 1PYDA 1JIUA 2HLNA 4KEAA 1DPGA 2FVYA 5KJEA 4IGFA 4ALMA 1CETA 2YHBA 1XWIA 5JUWA 2OGZA 3L04A 3T3MB 1S6YA 2W0SA 3GUZA 2VUTA 1RBZA 1IBRA 1YS4A 1LQUA 2DU8A 1QQ6A 1Z17A 2V03A 4OHFA 1ZCBA 1K8YB 2W11A 4QUKA 4B46A 2RGNA 4ZDKA 1V7ZA 2OXEA 2YQ4A 3L7CA 3MUNA 2D0IA 1VYHA 4HZUA 3RSFA 2O23A 4XZ3A 2BH2A 2LUOA 1KY3A 2HMTA 3JYPA 2D4AA 1X1TA 3VC2A 4KLZA 5ALXA 4NQZA 1WVIA 4EMUA 3HFGA 3RUDA 2J30A 4EHBA 1U7OA 1EDBA 1G8YA 2PXCA 4INOA 4O2BA 2YJTD 5H83A 4EPXA 3QVGA 4YWJA 4OJYA 4NYJQ 1YA8A 4FS8A 5FQNA 4X41A 3OA0A 1P44A 1QG0A 4MAAA 1OXKB 1YAHA 2PL9A 1FNDA 1DB3A 3HI4A 3NNSA 4WZBE 4IFIA 3ITNA 4M1MA 1XZHA 3ECSA 2NSHA 3QVGB 5DLEA 4MPRA 4ARSA 3R3VA 3MCVA 5FBZA 2C78A 4IEFB 3N8KA 1E5QA 1E7QA 1Q6YA 4ND8A 3BDIA 1L7BA 1W4CA 2M2IA 2BDUA 5EP2A 3FPEA 3NANA 5JALA 4BGUA 5BURA 4RQBA 4QJ3A 1BOFA 4D5GA 2DECA 1ZUHA 2P75A 3ENWA 3ROQA 3LXMA 4EFMA 1G8FA 3T7DA 3DCJA 4ND8B 2CL0X 1ETHA 2NUPB 2PYZA 2NG1A 2SNIE 4FYHA 1VJRA 2QTVB 4QOSA 4UULA 3SQLA 1E1CA 2HWUA 1F9AA 1TZBA 2ECQA 3KLNA 3QFTA 1JMYA 3IP6A 1UBCA 1XE3A 4JNCA 4MXDA 4A0GA 2UYGA 1E4YA 1L7QA 2FPKA 3AR8A 4MJ3A 1C9YA 1H1TA 1LB1B 1RLMA 1WPRA 4EK9A 2I34A 1QVVA 2PBRA 4L8GA 3RUEA 3OOWA 4FIDA 2LWIA 5EE3A 5HM6A 1P4HA 3D8NA 10MHA 4H9GA 4HDOB 1E1CB 2FEKA 4I4LA 4XKJA 1L5OA 2AFIA 4PYQA 3TKLA 3Q11A 4Z2YA 1XGKA 3CX8A 5CVTA 2A84A 4D3XA 2R0QC 4C2AA 1DSSG 3HY3A 1YRQA 3TIGA 1KY5A 1QGYA 2GQ0A 3TRJA 4M60A 4B9AA 4R4JA 2QG9A 3PRKE 1F4LA 2NVUA 2AFIB 3RVKA 3KPJA 4RF5A 1X87A 3A4IA 3ZJ4A 3GNSA 1ZRHA 1YOBA 1YE5A 3A9RA 2DUUA 3JR3A 4MVJM 4AYXA 1OLUA 1V7PC 1O58A 4O3FA 4MWSA 1GKIA 2NVUB 2V0GA 3L1HA 5GAJA 2CFOA 2ZRCA 3C70A 3X1JA 1C2YA 2DQKA 1NNUA 3AJEA 1IB0A 1LRKA 1QYWA 4LX8A 4QICA 4U4AA 4WXPA 3TVDA 3WRWA 1IHUA 1FMLA 2C2ZA 3ZV4A 5K8LA 2ZUDA 1Y48E 2QLMA 2NNWB 2VO1A 5AW5A 3I01A 4G8CA 4MWCA 1OLUB 5E9QA 2C7BA 3N07A 4AG3A 2GH1A 1W9HA 4JU9A 2PLWA 4MYRA 4QUEA 2C5FA 4BMPB 1K5GA 3LFTA 4QJIA 5K6RA 5CLFA 2CFSA 1B0ZA 4QWWA 1ZAYA 1XTZA 1H4TA 1NULA 4PX3A 3GOQA 4TYYA 2YWDA 4Z0TA 3EODA 4DCUA 5FDFA 1FTWA 1FVFA 3CCCA 5CDFE 2C77A 3GRVA 4D9KA 4IP0A 1KZHA 1SG6A 1QLHA 1U9IA 5D7BA 4Z4GA 1KXJA 2GAFA 4KYUA 1E3JA 1TLFA 4Q93A 2XRFA 5KMGB 1AN0A 3TLAA 2H3HA 4KDRA 1WSWA 2WJHA 4L95C 2M6LA 1UDRA 1R18A 4M0UA 1S8AA 4Q4DA 4KSCA 1Z36A 1ADJA 3B9RA 1NUSA 5TV2A 3ZDFA 4LK2A 2UUOA 5IEBA 2HHJA 2G82A 2OVBA 1MA0A 4KX5A 2H5IA 3TYXA 3EPLA 1RXVA 4CL2A 4PINA 3UHAA 3RIHA 4U7WA 1RQRA 3BEDA 1WZNA 4CUJA 1P7ZA 2VNAA 1ZEJA 1U8YA 2BFAA 2WK1A 3C3BA 5KX5A 4IILA 4KWCA 3AHEA 4L9RA 5GM1A 3FGPA 1WZIA 2PX5A 5CTAA 4JDPA 4E09A 3UJNA 5ESDA 3JZDA 4I3GA 5FOXA 3DR5A 4CF7A 4KPEC 4CTKA 3M1IA 1S3FA 4AP6A 3RYTC 1XNGA 1XDUA 4UHCA 5ADUS 3AEZA 2H1LA 5KX5B 2VUSA 3R5HA 3RUHA 1XJ5A 1MV8A 1MKYA 3A36A 4N3AA 5CLHA 3TXYA 3VC7A 4JEHA 2A9FA 3HFRA 1U80A 3K1TA 4NNPA 4PZUA 2FE4A 4EHFA 3DO6A 1M74A 2H08A 4RESA 1OROA 1L8QA 2W2LD 2X2PA 3PKJA 5AM3A 3HM9A 3T7IA 1OILA 1TU3A 1EUDA 1M0WA 1OFVA 1OLSA 1K5HA 3GELA 2MWMA 3K9CA 3FLBA 4BBPA 1PL0A 3OHSX 4A0RA 2PUGA 2BUAA 2QTBA 2V0CA 3PCRB 1EE9A 4ERXA 2QJTA 5IHXA 1IH8A 3OQPA 4MWGA 1M8PA 3UFXA 3WLAA 1VDZA 1EUDB 1OLSB 3OF2A 4DB4A 1K7YA 3WLRA 3PDCA 4UUQA 2Z4SA 1R4AA 1Z8HA 3AWDA 1SGWA 1QPBA 5BSGA 2B8JA 2XTMA 5C1DA 1Y80A 1ORRA 1KO8A 3NHKA 4QYMA 4AJJA 5AH0A 3SJCA 5HCIA 3QU5A 5EPEA 1R9NA 3UFXB 1S8OA 2GESA 1RKVA 2VF2A 3OIWA 4JR1A 5AK3A 1EUQA 2VNKA 5M2QA 3MHPA 2MSLA 1OW3B 1J09A 3LPAA 3TKAA 2NZUG 3D3EA 4FKBA 2RSLA 1ZM2A 3F6PA 1N1EA 3USZA 3GLIA 3V2IA 2HGZA 1CZKA 5E3JA 3BN3A 3VH2A 2I54A 1W36C 1OWMA 3MGCA 4L8FA 3LVRE 3DBVO 2FUG1 2BBSA 3K9QO 4JUCA 1ZD1A 2GD2A 3T4UA 3KYBA 1VPTA 2CDBA 4LVOA 3GJ4A 3SBXA 3COJA 3ZV7A 4B3HA 4IZ6A 1U2DC 1S2GA 3MBOA 1N2GA 3D3KA 3WRXA 3SYMA 5K8JB 3FCUB 4C03A 1A3CA 1G5IA 3F2VA 3TEFA 2ATXA 1J8QA 1CP3A 4FDTA 4E15A 4JT9A 4YUYA 5J4HA 3MLAA 2A7XA 4E6EA 3ZHSA 5B53A 2F1OA 2PPVA 5BVHA 3TOXA 3C5WP 1TZKA 3UK6A 1JJIA 1ZA2A 1W0CA 4KL8S 16PKA 4DJDC 2QLJA 3VNRA 4IIXA 2RGWA 4LE1A 1D6MA 4CM7A 1XQYA 2VYNA 1H94A 2XUAA 3G8BA 3OECA 1EXNA 1PT6A 2HF2A 4GW3A 8MHTA 2X9NA 1SKAA 3LCRA 5BVHB 3QFRA 2WSSA 3BHJA 4R9SA 4DM7A 5FXMA 4TS1A 4Y9DA 3KXPA 5IDWA 3PC2A 2X6TA 2FFRA 1GCOA 2Z5FA 1CDEA 1Z0IA 1SO8A 1K08A 2BHRA 3O92A 3WK9A 2OQ2A 3SU8A 1UIMA 4CV2A 2JAHA 4BIIA 1VB3A 1W8DA 1GO2A 2Y76A 3GLFE 4XM2A 1ENYA 1K98A 1T1RA 1SMKA 3NXKA 1ODIA 1GGKA 4PHCA 3S81A 3DCYA 2VA9A 3RVLA 4G5SA 4ZI2A 1SCIA 2ZU0C 3A4TA 1U2TA 1P5ZB 1S96A 2CJXA 1E1MA 3PT5A 4N0MA 3WQSB 1U8TA 1DWOA 1E3MA 1KMHA 3Q7RA 3VZCA 3H5TA 1F2TA 3HNPA 2WPDD 4PG7A 4DLNA 1XZNA 4BLRA 1JQJC 5F1YA 4ZU1X 2E3JA 1NVWQ 1S4MA 4IVNA 1JLKA 1UMCA 4YS6A 5EMNA 3W1WA 3NM4A 4YAKA 3AVWA 1KMHB 5DM0A 4K40A 2XUFA 3SSOA 3FTQA 2OL4A 3RSLA 4BDTA 1UFKA 2IHJA 2B9EA 3GVXA