1NAIA

Udp-galactose 4-epimerase from escherichia coli, oxidized
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Crystal structures of the oxidized and reduced forms of UDP-galactose 4-epimerase isolated from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1995-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1naiA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1naiA01
4ND2A 3ETEA 4CM6A 3D4NA 1QMGA 2DFVA 2O7QA 2TMDA 4KTVE 5GZ6A 2VNAA 3RASA 1YXMA 1UP4A 4I9UA 4ROSA 3KYBA 4ZQHA 4IDFA 1OMOA 4IXTA 3RUIA 5KTKA 4B3IA 1BXGB 1Y6JA 1MC5A 3VZPA 4EJ0A 2GD1O 2Z1MA 3PHLA 3AUUA 3LK7A 1T1RA 3NDJA 2W4QA 3E9QA 1SB8A 2CNBA 1HDXA 2PFGA 3V2UA 4WLEA 3JQ9A 4GGPA 1OC4A 4J91A 5IDWA 3PWKA 1E1NA 5JSFA 1HE3A 2ZTVA 4BHTA 2BI7A 3PQDA 1GCOA 1E3EA 1PJCA 3H9JA 3F9IA 2EW2A 4BNIA 5EIOA 4RO0A 3FI9A 3F4LA 3AWDA 5L7TA 1ENPA 2FOIA 1I3KA 1EE9A 2JCVA 2FPPA 2GN9A 4QFDA 5IXYA 4UVHA 4PG5A 1YKFA 4CLOA 3E6AA 4JLWA 1WVGA 1YWGO 3EHEA 4B8WA 2GASA 3IQDB 3QVXA 4Q3BA 3H5AA 1ZO8A 3CH6A 4LW8A 3DMYA 4NK5A 4DGSA 4HBGA 3D7LA 5JC8A 2DU8A 4XYBA 3INRA 5T8KC 1YH3A 5JPIA 2NWQA 3DAPA 4R3NA 1ZIDA 3VTFA 1LSUA 2TMGA 1XQ1A 2GNAA 5ITVA 5TS3A 3PIIA 5DCYA 3VH2A 2Q46A 3JQFA 3P7MA 3O26A 3K8ZA 3RUDA 1KETA 4YJHA 4D41A 4AJJA 1HYEA 2B4QA 4E12A 1XG5A 4PIVA 4DPMA 2IEBA 2JHFA 4UVDA 3PHIA 1U7HA 3GF4A 5LC1A 4UVGA 1PGJA 4J90A 4XR4A 5FWNA 4OIMA 3HE3A 4CMBA 5CAEA 1NQTA 1M2WA 4CQLA 1H6DA 2O3SA 3ITKA 4TSKA 3V1UA 5JDIC 2Q50A 3PXXA 3Q9UA 4AJHA 3SC6A 3AOEC 2HO5A 1XELA 2Q3EA 1I0ZA 3LT0A 1C0IA 5KVSA 1NFRA 3N7UA 1LDEA 2CY0A 1Q1NA 3AU9A 4IBOA 1Z74A 4R01A 4BV8A 4DYVA 1BW9A 1OOEA 5CG2A 1JVSA 3GMDA 4A2CA 2FRDA 1DPGA 5AXCA 2Y93A 4I5GA 4U0JA 4Z3DA 4TVBA 2YV2A 4N7RA 2YQ4A 2NLOA 2XF8A 3FR8A 3L4SO 2G82A 2UV8A 4TKMA 4W4TA 2O2YA 3K2BA 3L07A 1OI7A 1M75A 4H7PA 1ZZEA 2DUWA 1KVQA 1NWCA 2C82A 4FPXA 3TN7A 1YBAA 2IRWA 3Q1LA 2O3UA 4MIOA 4LVCA 5TX7A 5JCJA 3PWZA 1E3WB 1LQUA 4OXYA 4E5KA 2P4HX 3RROA 2CMDA 4P38A 3ZWVA 4IMPA 3DZGA 3K31A 4S1VA 4J1QA 1UUFA 4AFNA 4YRDA 3C1TA 4ZICA 4RPJA 3RBVA 5JCJD 1KEVA 5KCZA 1ENZA 1LXCA 4KUGA 4CLOB 1ULSA 2QRKA 4E2ZA 2NVUA 1R16A 4YACA 1E1LA 4GWGA 2VTEA 4A73A 4KMSA 3KEOA 5EMHA 3QWIA 1MXHA 4XR9A 2PD6A 3WGOA 1K6JA 1K5HA 4YJDA 1B14A 4B4UA 1NM5A 4TRNA 1H9AA 3A9WA 3QSGA 5IZCA 1P45A 1GL3A 5EN4A 1JKIA 2F00A 5JNLA 4WJZA 4CLDA 4P4NA 1ZMTA 4Q3NA 1RPNA 3R3SA 4JJGA 4YJHB 4XQGA 2X5JO 3OA0A 5F1KA 3W8FA 4ALJA 5BSGA 4YBZA 1MB4A 1E7MA 2BGMA 1SB9A 2CD9A 1I2ZA 3CPSA 4I1IA 2Q1UA 5KJCA 1VKOA 4GBJA 4BNTA 3VH4A 4ITUA 3VVBA 1IPEA 3JD0A 4GVXA 3JV7A 1OAAA 1ZXBA 1ZUD1 1CJCA 3WFIA 5ICMA 3QIVA 3VVCA 1MFZA 5JDCC 2Y1OA 3GFBA 4KP7A 1CQJA 3FR7A 4M54A 3DMTC 1O5IA 2X58A 4GI2A 1D3AA 1UXJA 1DAPA 5KKCA 1PU2A 1B8PA 5EQDA 1Y7TA 3TZHA 5BQFA 3MWEB 3LT4A 4K9DA 4NBTA 4E32A 1BW9B 1AXGA 3KXDA 1JQBA 1V3VA 3D64A 4BQRA 3MEQA 1ZH8A 2JFHA 2ZJ1A 1BVUA 1YOVB 3TRIA 2H63A 1X7GA 4NBRA 3ZU5A 1X7HA 4RZIA 5HBRA 4MVJG 4EUHA 3WDSA 1X0VA 3DZHA 1A4UA 3GC6A 3HADA 1ZK3A 3NJ8A 4ALNA 1BXKA 1IZ9A 1XLTA 2E82A 3IKVA 2EW8A 3IIEA 5FI3A 2JCYA 2Y1FA 3UICA 3ZWOA 2V7PA 1P9LA 1HKUA 2R2GA 2Y67A 4QEDA 2H9IA 4RLSA 3U62A 2JD0A 1VJ0A 2ZK7A 4HXYA 5B12A 2VT2A 1J5PA 2ZCVA 4XB2A 2NVUB 3TSCA 1HLDA 3FPCA 4FFNA 4M1QA 4DRYA 3V2HA 2Q45A 1T4BA 2P9CA 4MOWA 3ROPA 3NYWA 1H6BA 1KC1A 3ASVA 4IQGA 4M49A 4R1TA 2NUAA 4IGFA 4IDAA 1GD1O 2VN8A 3ZWBA 1RM0A 5G0SA 3GHYA 2B69A 2RHCA 3U09A 4AJLA 2ZTUA 3AY6A 5JO9A 2BGLA 4OHUA 5TJ9A 4BGVA 1CIVA 3HJAA 4ND1A 2P4QA 1N8KA 4FFOA 1XU9A 1WW8A 2X5KO 5JXWA 1P0CA 2BI8A 4E5NA 4G5HA 3ZU4A 3OA2A 1DRWA 4II2A 1DFHA 2HMUA 4UEKA 5U1PA 4HADA 2W90A 3HB4X 4HUJA 7MDHA 1F17A 4B3HA 5IFLA 3GDGA 3W8EA 4KTTE 1UAGA 2I6TA 3RAJA 1PJ4A 1HE5A 4XYMA 5CHEA 4FFMA 2OP0A 3QRWA 3DAFA 3CZMA 3OMLA 3WLEA 2Y66A 3OJEA 4GWKA 3Q6IA 1T1SA 1H93A 1L7EA 2WM3A 5A9SB 3H65A 3KTDA 1TXGA 2Y1EA 4DL9A 4K26A 4WCDA 1H2HA 2YYYA 4O59O 4QO8A 4F45A 1YL7A 2AEFA 2DUUA 2NADA 4ZA2A 2X0RA 4FFRA 2YJZA 1VI2A 3WQSB 4BO6A 3SEFA 3BA1A 4Z0PA 4MDHA 3VPGA 4CLHA 7ADHA 3PVZA 1A7KA 4NG5A 1DAOA 1VL0A 5JO0A 3GAFA 2GR9A 9LDTA 3GVXA 1W8DA 1JDJA 4BO4A 4ALIA 3PJGA 4F6LA 4F3YA 3DHNA 4OQYA 4JN6B 3TZKA 3S2GA 3JQ9C 1B16A 1OZAA 4BNMA 3RUFA 1P3DA 2Q4EA 4BNVA 2Q2QA 3JQ7B 3KSUA 1VKNA 4HNGA 5JMPA 3DXFA 4LRTB 3C7CB 3TOXA 2HUNA 3TDKA 1CERA 3RUHA 4J3FA 4J49A 4M89A 4DPKA 5IG2A 3LLVA 3L77A 3DBRA 4GMGA 5H82A 3HQ4O 3DTTA 1WDKA 3ZWXA 4PFJA 3F46A 4NJOA 1R0KA 5L3ZA 5L9AA 1ZVMA 2IXAA 1AHHA 3ZW8A 1T2EA 2VOEA 4YA6A 3H4VA 1ZJYA 2BHLA 4TQGA 1C14A 3FPLA 1BSVA 3OF2A 5CEJA 3PK0A 5HWSA 4FJ0A 4AJ4A 1A9YA 1MP0A 4HX5A 5KKAA 4W7HA 2X0JA 3ZWNA 4BNWA 2EIHA 3H2ZA 1O6ZA 4AJIA 3ADPA 1UAYA 4GSLA 5KVCA 3FSRA 1I2BA 1TA4A 2B36A 2O3JA 3NTQA 1U4OA 2BFOA 4Y9DA 3DOCA 1QYDA 4R9RA 3JQFC 3I83A 4TRMA 2B4RO 4D3DA 1AHIA 4R9SA 4NMHA 3U4CA 5DCWA 4BNUA 1NFQA 4BNFA 5HTOA 4M55A 1P33A 4NIMA 3C7DB 3C1AA 4UVIA 2DLDA 4BO0A 4CLRA 4WASA 1H5QA 1JA9A 2PWZA 2RIRA 1GZ3A 3JD1A 4IINA 5BSFA 3UW3A 1H6AA 4K1LA 3KBOA 1QSGA 3FF4A 4CQMA 4J1NA 5F1PA 4JBHA 2IEDA 2AEMA 3U9LA 4R3WA 1P0FA 5TQVA 2CDBA 3RFVA 4FS3A 3TWOA 4YT5A 3GNQA 4QUKA 1P1IA 4CQMD 4PVDA 5A9RA 2C5EA 2CZCA 2WE7A 3DZKA 4EGFA 3F1LA 3S2IA 2DT5A 4A0SA 3ROKA 1HSZA 3IJPA 5DBIA 1IULA 1WNTA 4GX0A 1T24A 3EK2A 5CEEA 3TFOA 3HSKA 4FBGA 3PQEA 4EDFA 3A1NA 5C7LO 3OSUA 4MKRA 4U8GA 1Q7GA 1EBUA 4WOJA 4BO2A 4XA8A 3HDJA 4Z0TA 1S7CA 4W99A 3NEPX 3L9WA 2WYVA 2XXJA 1JKFA 4IZIA 2PKQP 4URFA 3O9ZA 3IAHA 2EXXA 4R1UA 2P5UA 4DUPA 3QVWA 2VT3A 3MJCA 3ZDFA 4NZ9A 5A03A 1E7RA 4A10A 3D3WA 3QWAA 2HMWA 1KEUA 1ZCJA 3WFJA 4YXFA 3DBRB 4BO5A 3P19A 2WDZA 3DBLA 2VZ8A 2GN4A 1UZLA 3T7EA 3HFSA 3RWBA 2D5CA 4XYEA 3I23A 4CM4B 1U2DA 3C8MA 3BTUA 1DC5A 4R5MA 3ZHBA 1K2WA 2WD8A 4TZKA 4O6VA 4O1MA 3ZNOA 5IJZA 1NAHA 3H7AA 1DB3A 1CETA 3KVOA 4ZRNA 4NPCA 3OJFA 3TZ6A 1VM6A 4B4OA 1IUKA 1LLDA 4DLLA 3OJOA 5L53A 4DREA 1XHLA 4MP3A 4EW6A 4Z9XA 3FWNA 4DWVA 5I8ZA 4GKVA 2FN7A 5IZCC 4ZJUA 1LTHR 5MGBA 1FMCA 2VHWA 3HUDA 5JFOA 3IOYA 1PL6A 3G1TA 3VKVA 3LZ6A 4B7XA 5B4VA 1NPTO 4PLPA 3AJRA 3NTRA 2NU9A 5A1TA 3K5PA 2O3RA 2FWMX 4PLZA 4U5QA 1EUCA 4IS2A 4FGSA 3BHJA 5KJ6A 4RJTA 4CLRB 3OHSX 1I36A 2SCUA 1BXGA 2V6MA 4PLVA 3EGOA 5ILGA 3NJ4A 2GYYA 2X22A 1X15A 4RZHA 5B4UA 4CQMB 1EBFA 3LC7O 3BTSA 3MCVA 2VHYA 1N7GA 3WWZA 3DONA 3GRPA 1J49A 4LMPA 2B37A 4RPHA 5DT9A 1FK8A 2X86A 3B6ZA 3I6QA 1ZNQO 2O3TA 3QA9A 3ASUA 3GZ4A 4YEDA 2ZYDA 5TGDA 1YE3A 1YB4A 3GGPA 1UXIA 4IIUA 2I76A 3DZJA 5I7FA 2C29D 5T64A 1PZHA 3KUXA 1E77A 3WSWA 1ISFA 2XOXA 3QQPA 3EMKA 1EFLA 1FJHA 4LISA 3ZH2A 4ND5A 4K6CA 2EP7A 4BOYA 3WGGA 1RWBA 4QECA 4DC1A 4MJLA 1DHRA 3K9QO 1UZNA 1WPQA 3VH3A 4FD3A 1PSDA 1PZFA 4EBFA 1U1IA 1UR5A 5JYEA 1MC4A 2VNSA 3ZV6A 3WOHA 3X2EA 3AW9A 1NPYA 5LDHA 1ZK0A 4EJ6A 2BF7A 3D3WB 4HWKA 1JU9A 2IODA 2B4TO 1T2CA 1EDOA 5KNLA 2YHIB 4RCVA 5BT9A 3WB9A 3AI1A 1U2GA 5GY7A 4CMAA 5ENDA 4CMGA 3BMNB 3RQSA 3OQ6A 2VRBA 1LLUA 3KYCA 4D79A 1NVGA 5LDGA 1DIHA 3MOGA 1NXQA 5EJ2A 5JS6A 3ON5A 3VPXA 1GPJA 4BO9A 1ISIA 4RGBA 4MPDA 3TJRA 3COSA 4DIOA 4TRRA 4DIBA 2CDAA 3OIFA 5JAIA 1MFPA 4CL3A 4Z0HO 2FY8A 5L51A 1PEDA 1QV6A 4CPDA 4BNKA 1CDOA 3JYLA 2IYOA 3MTGA 3CMMA 5AXBA 3GNTA 4ZVVA 5CFZA 3LC2O 3H6KA 5ITWA 2YV1A 4RPKA 4Q3CA 5A06A 3CIFA 4OSPA 4H15A 4YQZA 1VL8A 3D4PA 4BMNA 1EFKA 1VJ1A 1HWYA 3AK4A 5GMOA 3ZNPA 1A9ZA 1O94A 1BGVA 3F5QA 4L9RA 2I3GA 4II3A 1UXHA 1Z45A 1UH5A 3HDQA 3QHAA 2C59A 1LX6A 1GY8A 4BMSA 3VPHA 1PJLA 4PG4A 2EHDA 5DOZA 1GCUA 1B3RA 3GVHA 3OJLA 3EZLA 1UP6A 1W4ZA 3TZQA 1E3SA 3IKTA 1PS0A 1E3WA 3OEWA 1HL3A 1CYDA 4FC7A 4OMUA 2I65A 2CDCA 1G0OA 4CM8A 5CG1A 2C07A 3WBBA 5BSEA 3BMCB 4CMCA 3TOZA 1YB5A 4YPOA 2X6TA 1KEWA 2HDHA 1GAEO 4PCVA 4YWJA 4KOAA 3MJ4A 1WDMA 3DFZA 3L0DA 3SLGA 3WYEA 4CLXA 3GK3A 3DEYX 3BYZA 3PHHA 3U4HA 1J0XO 1DEHA 5A5EA 3DWFA 4YJGA 2DQ4A 2D3TA 3RD5A 1YGYA 2CFCA 1GUZA 1DBVO 3QVTA 4OSOA 4RQUA 3ST7A 1DRUA 1EUZA 2GPTA 3HDHA 3HN7A 1PIWA 1GEGA 3I3OA 4J4TA 4E5PA 3I9LA 1NVTA 2BKAA 2Y05A 3FTNA 5L7YA 1GZ4A 3VPSA 4BO8A 2VHVA 4RV9A 4XEHA 1ZEJA 3K96A 1BDBA 3EVTA 1LDMA 3CMCO 4LSMA 1NHGA 5HM8A 1IHYA 3DBVO 1Y5RA 1XCBA 3E48A 2J6IA 1K6IA 1V35A 4RVFA 3ONFA 3VHRA 2PLAA 1BG6A 4OM8A 1I3MA 3FNGA 1YQDA 3RI3A 4BKQA 2J5KA 5ES3A 3UUWA 4XDYA 5G0UA 3SXPA 2PK3A 2A92A 3RC9A 3KYCB 1VPDA 3A4VA 3AFMA 3JQ6A 1U5AA 1HDOA 3NRCA 5TT1A 4W82A 5AXAA 4BGIA 2JD2A 2YFHA 4M8SA 3UOGA 4RF3A 3INGA 4MVJF 1R66A 1JAXA 4GQAA 1FDSA 3OIGA 2IXBA 3RU9A 3U5TA 2FPIA 5DNAA 1HRDA 4GVLA 5G4LA 1QP8A 3PJFA 3Q0EA 3OQBA 2GCGA 4PLGA 4RVGA 1NP3A 1V6AA 5DP2A 3L6EA 2FPGA 3ADOA 9LDBA 1LLCA 2WEKA 2HRZA 2PZJA 3GGOA 1ZSVA 5I7SA 1AE1A 2ZJ0A 3RJ5A 1K0UA 1B0AA 1H2BA 4WLVA 3X2FA 3PQFA 3GQVA 1YOVA 2HK9A 2Y1DA 4AJ1A 5K6AA 3R1IA 4XIJA 3DQPA 1ORRA 4CJXA 2ZQZA 3PFFA 1SOWA 3GG9A 1AN9A 2FR0A 3AI3A 4Z6KA 4RLHA 4BNZA 1I8TA 2J8ZA 4FOOA 4D0SA 4JGBA 2ZKLA 2BELA 3I4FA 3PYLA 3R0IA 4XYGA 1NFFA 3VZSA 2Y1GA 5L4SA 2YDXA 3GN2A 2EWMA 5JY6A 2Q1TA 3GEDA 2ZB8A 3OH8A 5BNFA 4CM8B 2DPHA 3UCXA 3PPIA 4YJFA 4DVJA 1QLJA 1HDZA 3KRTA 3GRKA 4YAJA 1XQ6A 5L7WA 4L0QA 1ZK4A 3GZNA 1PJQA 1YL5A 4FCCA 4B7CA 2VUUA 3R6DA 3ETDA 4YJGB 3UN1A 2RH4A 3RC2A 2J5RA 4N5NA 5FF9A 1DLIA 1I30A 4EZBA 1U28A 4L4SA 2GN8A 4L4RA 4CODB 5CDYA 4CLEA 2VQ3A 1HXHA 3JYPA 3PWSA 3G17A 2AHRA 1RKXA 3NV9A 4XRGA 2QRLA 5H83A 1W73A 4IDDA 4KZPA 2YV3A 5JBIA 3CTMA 1YB1A 1GQQA 4G65A 1KIFA 1Q7BA 2FZWA 2D8AA 3PEFA 1X14A 4BNNA 2CVOA 3QE3A 4OH1A 3DHEA 4L8VA 1NQOA 1NQ5A 4DC0A 4BUCA 1ISGA 3E5MA 4IDBA 5HA5A 1K89A 1JAYA 1V8BA 2Q99A 4W7IA 3L4BA 3TL2A 2PZLA 1H94A 4EEZA 1NWHA 2X5OA 1E3JA 4CM7A 4OOFA 1PGQA 3MWDB 3PIDA 5HS4A 4R51A 3SVTA 4E31A 3GEGA 4NH4A 3I4CA 4OKIA 5I9LA 4UAGA 4HP8A 3VZRA 4A5OA 3M1AA 2I99A 3E1KA 3JQAA 5A9SA 4KUEA 3L6DA 1Z7BA 2P2SA 2VOJA 4BKOA 4J9VA 5JAZA 3H3FA 3C1OA 3NDIA 4J0EA 4BVAA 3JQAD 4S3MA 1TEHA 4E2WA 3AM4A 4GSKA 1XU7A 3KEQA 2OBNA 4WCFB 3ZW9A 3PRJA 4OAQA 3DB2A 2OHXA 5FI5A 1NTOA 1RJWA 2YUTA 4J4BA 3PJDA 4OQZA 3HZZA 2EKQA 3ITDA 3AUTA 8LDHA 1F8GA 3QP9A 1PJ2A 3EUWA 1OBFO 3S2FA 1I2CA 1C1DA 2Q2VA 2PGDA 3GG2A 3JQ7A 1MXFA 1Z82A 4XQ9A 4UEOA 2R00A 3OQ1A 2DTXA 1ID1A 2VWQA 3HFGA 3P5SA 4WKGA 4YT4A 3TPCA 3JYNA 2CVQA 2C2XA 2EJVA 3S2EA 4CM1A 1D1TA 3HDYA 5A02A 4EI2A 4YJFB 1NYTA 3FHLA 1DFIA 1XWFA 1YQXA 1MV8A 3KLPX 3PDUA 3HHPA 4WOKA 4CM3A 3ROMA 1LQTA 2VCYA 1JWAB 3GZNB 5F5LA 3KSDO 4E13A 1B8VA 2GUGA 3GDFA 2AMFA 5ER6A 4PZCA 3L6OO 4A26A 2Z95A 3DHYA 3H9UA 4YYZA 1MUUA 3ZV4A 1EK6A 3AI2A 4PG7A 4JJFA 5C5IA 3VH1A 1IB6A 4E5MA 3MZ0A 3N58A 5CEFA 2GSDA 4WEQA 2PKQO 5EQFA 1YS4A 4JROA 4QSMA 3WLFA 1NAIA 4ZQFA 1R12A 2VUTA 1SNYA 1B3BA 2JKVA 1LDBA 1H9BA 3K2EA 2AXQA 3DZBA 1N9GB 1KVSA 1NBOA 2UYYA 2BFAA 2QQ5A 4NFYA 4E3ZA 2NV6A 3DC2A 3GVIA 2ZB3A 3BHMA 3ZNNA 4MP6A 3GY0A 4I5EA 4ID9A 4K6FA 1I33A 1C0LA 2V6FA 4FQ8A 1M67A 4HFMA 4Q39A 1P1KA 4Z9FA 3TL3A 3WJAA 4EUEA 4F6CA 5EESA 4DMMA 1UDBA 1DIAA 4FFLA 4HKTA 1LBEA 1LSJA 1JKJA 2AQIA 3K73O 3MJEA 3KSZO 1LNQA 1N92A 3WIEA 2OP1A 3JQAB 4X54A 5GZ3A 1B2LA 3SC4A 2OMEA 5FYDA 1F8FA 1Q7CA 1GV0A 1QV7A 1UXGA 3C85A 1HLPA 2BRUA 3M6IA 3RBXA 5IZ4A 4XIYA 1Y9EA 3UCEA 4HV4A 5THKA 1X1TA 1EK5A 2EG9A 1EE2A 2DM6A 3RBZA 2FR8A 4LCJA 3CE6A 3BHIA 4MVJM 2WE8A 3JQCA 4IPTA 2C0CA 1CF2O 1SCUA 2D1YA 3ORFA 3QWFA 1N7HA 1CRWG 3WYBA 1B15A 2PGLA 5G0WA 4A27A 4BNLA 1I3LA 3DOOA 1C1DB 2P9GA 3QVSA 3D5QA 1MA0A 1N2SA 1R4NB 2IYPA 2UAGA 3OEYA 3ZWCA 5B4TA 3BTOA 4AJOA 1KVRA 4XB1A 4YAEA 2HMTA 4DPLA 2I5PO 1XEAA 2YFQA 4YT8A 4GL4A 5BR7A 2AQKA 2VZ0A 1HSOA 3EAGA 3UKOA 1M6HA 2HK8A 3KB6A 4J43A 5B1YA 2OFPA 5K9ZA 3AUAA 4ZGWA 2BLLA 4I9NA 4UULA 3H3JA 3BTVA 5L45A 1CWUA 5DBGA 2CF5A 1I3NA 1SOVA 3JYQA 3QLJA 4FDAA 4CM4A 1BTOA 1PZGA 4L4XA 4PGFA 6LDHA 1DJQA 3ICPA 1X13A 5BNTA 2EGGA 2WSBA 1C1XA 3EW7A 3GHHA 3IP1A 1SMKA 3ZHYA 4NU5A 4JP2A 1IYZA 1P1FA 2AQ8A 4CMEA 2OORA 3DBHA 3NGLA 1BDMA 4RF5A 4FC6A 3ROQA 2J5QA 2EEZA 5IDQA 4PVCA 3E9MA 3BZUA 3ZWMA 4E6PA 4JBIA 4FW8A 1UJMA 4KDFA 1P74A 4ESOA 8ADHA 3UFXA 1NPDA 3IL2A 1MG5A 2D2IA 1PJSA 5DF1A 4YR9A 5KJ1A 4MP8A 1ARZA 2OOSA 3GDOA 3WGYA 2JFFA 1YQGA 4Y67A 1FDTA 1O8CA 2UDPA 4MKZA 3ICCA 1YJQA 1KBZA 4FB5A 3V1TC 1ZKMA 1PQWA 4JP3A 4H3VA 4Y6PA 1PX0A 1NNUA 1ZW1A 4NK4A 3STHA 5COQA 5KVQA 2YW9A 3RKUA 2A94A 1BMDA 1ZXLA 1SO8A 1F14A 4HY3A 4YAGA 1GADO 3BMQB 2ZTMA 4CM5A 3PHGA 3NKLA 4KDEA 3WNQA 5IF3A 1GYPA 5G4KB 4C4OA 4IDEA 1GU7A 4FOSA 3PGXA 4DTIA 5JW6A 1SZJG 4GX2A 4WK6A 5JYDA 2QYSA 1JLLA 1NQAO 1BWSA 3I9JA 2AE1A 1X0XA 5K6AC 1U3WA 4E21A 3LSYA 1DDOA 2P9EA 4J7CA 1O89A 4NNJA 1PJ3A 4YAKA 1X1EA 1P31A 1BXZA 4DIFA 1RM5A 1SBYA 2DBZA 2WD7B 3MOIA 1ONPA 3LQFA 4CV0A 3ANMA 1D1SA 3GUYA 3LT1A 1WWKA 5I7VA 3VDRA 4OL9A 1I10A 4IY1A 1ZSYA 1PQPA 1NASA 3GN1A 1U5CA 1E3LA 2GDZA 3B1KA 4U6QA 4PLWA 2C7VA 3ZI0A 3V1YA 3ZGYA 2YHIA 3VPFA 2X9VA 3AM3A 5T5QA 1FXSA 1R37A 4NI5A 3RVDA 3BMNA 1PTJA 4CUJA 5BNIA 4UUNA 3F1KA 1C1XB 1VJTA 1YBVA 2OBYA 4ND4A 3ZV3A 4CMHA 2PGJA 2XXBA 1T4DA 1GYQA 2VYNA 2G0TA 3G49A 4ONEA 1Q2XA 4U0KA 1E5QA 3DBHB 4GX5A 4MIYA 4WUVA 1HZZA 5A05A 4D3FA 1F06A 2LDXA 3BIOA 4OXKA 4RVDA 2NTJA 2GO1A 3CINA 3WSVA 4YTEA 3PP8A 2HQ1A 2DBVO 3EC7A 4D45A 2VYND 4MVJP 1DRVA 1R0SA 2GF2A 4R16A 3W4IA 4CMJA 3AFNA 5DBFA 5KVVA 1BRMA 4YRAA 1W0CA 1KVTA 3GH3A 2GN6A 1LA2A 1K6XA 1MGOA 2POQX 4IS3A 1JW9B 1PS9A 3L4BC 2J3IA 5ICSA 1DLJA 1ZFNA 5EERA 1GV1A 1HZJA 3EYWA 1ENOA 3GPIA 3ZU2A 2Y68A 2E6UX 4L76A 3T7CA 3DMTA 2Q2WA 4BNYA 3PYMA 3PLRA 1Y9AA 2YDYA 1TT5B 4RPGA 2FMUA 3JQEA 4KWHA 4QQRA 1LDNA 5TC4A 4AG3A 1NR1A 2ZCUA 4Q3AA 2C20A 1R4MB 5J23A 4E33A 3KOUA 4J1TA 3WNVA 1JTVA 1AGNA 4ZU3A 4BIIA 5H81A 1B7GO 5G0VA 2HMSA 1HDYA 3I5MA 2IZ1A 2VHZA 3BMCA 4EUFA 1HETA 3OECA 4TWRA 5CP8A 2ZB7A 3P2OA 2NU6A 1B8UA 4L73A 3LVFO 3E18A 4L75A 4GLOA 5IXSA 4R1NA 3Q3CA 5TIIA 1DXYA 4LGVA 5K0ZA 1QYWA 2PNFA 2Q1SA 2X9GA 4BGEA 3KYDA 3AM5A 3W6ZA 2EGHA 3D3EA 1B26A 4RL6A 3FTPA 2A35A 4TKLA 3SJ7A 3JD3A 1SEVA 2B35A 2R00C 4MINA 4AJKA 2P5YA 6ADHA 1ZJZA 2RH8A 4QT0A 2PY6A 1V9LA 4JBGA 2PD3A 1E5LA 1PJTA 4IIVA 3ZHZA 5L95A 4IUYA 3AOGA 3ENNA 4EITA 2PH5A 5L4LA 1IY8A 4GKBA 3GVCA 4I5DA 1A27A 2AE2A 4BKPA 5U9CA 2PA3A 1PGNA 3SX2A 3VDQA 1E7SA 1GYRA 2W2LA 3OP4A 3JTMA 1YL6A 4C7JA 3H8VA 3KM0A 2NQTA 4FIZA 4IZHA 1E7WA 3ENKA 3GLQA 4CM9A 3F47A 3O8QB 4PG8A 5L4NA 2JJYA 2YHUA 4YB8A 3I52A 2W2LD 3GNSA 2CVZA 1PGPA 2DC1A 3FBTA 3JCZA 3FN4A 4U7WA 3JQGB 1QYVA 4J4HA 1VL6A 1HT0A 2AG8A 4JX8A 4BNGA 1U8FO 3GGGA 4CM9D 1EVJA 3H9QA 4ND3A 1V3TA 3CXRA 1UDAA 3CKYA 4WLNA 1HDRA 1Y8RB 5AVOA 2HSDA 2O2SA 4IGEA 1EDZA 4D46A 4UUOA 1AUPA 1LRLA 3NDRA 2DTEA 3KZVA 4RVHA 3N74A 1EEHA 1LSSA 1RM4A 4N5MA 3WICA 4RVSA 5A9TA 3Q9NA 3I9KA 3FD8A 1H0KA 2JFGA 4RDIA 2C7GA 3ONDA 5CDGA 2C2YA 3IMFA 2NTNA 1WDLA 5DCUA 2FZEA 2OO5A 2PV7A 4E30A 3FCOA 1DIGA 4FR5A 1FDWA 1F12A 1KC3A 1LUAA 5F1OA 3W1VA 2UUPA 4DA9A 4YAIA 3UXYA 3PZBA 4YRBA 5JCXA 1E6EA 2Y0EA 5AXDA 2OXIA 4J0FA 2GZ2A 3JQ8A 5IN4A 4NFHA 3JYOA 3OFSA 2W98A 3QVOA 3FNEA 4R54A 4RDHA 2Z5LA 3EDMA 2FHSA 4TMFA 4XZ3A 1P44A 2FSVA 1DJNA 4I5FA 2X9NA 2QZ9A 3WGHA 1KERA 4PZEA 3JQDA 4MVJA 3CZRA 2IE0A 1Y81A 3KYDB 1Z6ZA 2QYTA 4NBWA 2J3KA 5COBA 5TLSA 5CDTA 4D43A 2GERA 2C54A 4BO1A 3JD2A 4WECA 4YT2A 1U9JA 2EF1A 4TVOA 4BB6A 2ZATA 3E5RA 1WXDA 4MVJD 4ZQEA 3AY7A 1IPFA 5T57A 4Q9NA 1YO6A 4Q3EA 1U3TA 4B4VA 3PDJA 3LC1O 4CV1A 1FDVA 4JK3A 1KY5A 1OC2A 4MVJI 5CPBA 1YONA 2G5CA 1ISHA 4J16A 5JY1A 2V6BA 2PZKA 1I24A 1T2AA 3F3SA 4DQVA 1D4FA 1WMBA 4GLLA 2O4UX 2O3QA 4NR0A 4W6ZA 5TT0A 1T25A 3RKRA 4B4WA 4CMEC 2NTVA 1DIBA 4DLAA 3LDHA 3O38A 3GA0A 4DBZA 1CQIA 1FDUA 1V0JA 2D5AA 4WNIA 2BFMA 2HMVA 4NBVA 3E9NA 5LCXA 2AW5A 3WG9A 4CR7A 1PS8A 1M6WA 4FFPA 1AXEA 1QYXA 2O48X 4R68A 3I6IA 1GQYA 2A4KA 1U8XX 4FGWA 1G0NA 3E8XA 4ZD6A 1JN0A 3S8MA 3B1FA 1PQUA 4QO7A 4Y98A 3ETGA 4PLTA 1WAMA 1T2FA 2PR2A 4XGKA 4D7AA 4GPD1 4RPLA 5GZ1A 3OIDA 4MO2A 4Y6RA 3ZWAA 3P2YA 2NU8A 3U3XA 4WCFA 4MKXA 4XDZA 2WYUA 2W2KB 3F5SA 1LC3A 2EERA 4PG6A 4QXMA 5I9NA 4Z9YA 1XKQA 4YCAA 1HYGA 3O4RA 3TFQA 3UF0A 2BGKA 4RF2A 3D1LA 1GDHA 1LRKA 4OOEA 1K3TA 4D3SA 2AQHA 5IN5A 5DDIP 3WR5A 4IJKA 2B5VA 2VUSA 4XGNA 4XQCA 3A14A 1GZ6A 1MX3A 1Z75A 3PYXA 5TJHA 4B8ZA 2D0IA 3PI7A 1BVRA 3K6JA 1DFGA 3IUSA 1XIVA 1DIRA 3JQ8B 4NBUA 1TB4A 2I67A 5EINA 1PL8A 5ADHA 3DAGA 1L1FA 5B37A 5A3VA 1ZMOA 3WXBA 1W6UA 3RC7A 3C24A 2OZPA 2HJSA 2Q4BA 2RAFA 1XYGA 3HWRA 3RU7A 2NACA 3LU1A 1NX6A 1R15A 4MVJH 2WYWA 4DQXA 1A5ZA 4W9NA 4OO3A 5TRTA 1HEUA 3HN2A 4JNKA 4WLUA 1G1AA 2Y1CA 2HAEA 3M2TA 4MIEA 5JE8A 2JCXA 4DBVO 4B7UA 3VAZA 3RFXA 3ANLA 2ET6A 4KWIA 2VRCA 1DC4A 2QRJA 1R0LA 1YDWA 3G79A 3ZWYA 2DBRA 2OL4A 4NHEA 1IL0A 4TZTA 3WBFA 2H5LA 2X0NA 3OICA 4AJPA 5KJEA 1N9GA 4RORA 4BO3A 4BNXA 4J6FA 2VRCD 4ILKA 4WGGA 3FBGA 2DVMA 3SJUA 2XPCA 1XR3A 2NVBA 2PD4A 3MJSA 1KOLA 1QRRA 2DPGA 3QWBA 1V3UA 3LLSA 1VE9A 5KWEA 3IP3A 1E7QA 2B5WA 1PL7A 3B20A 3I9NA 4IJVA 4EEXA 1DO8A 2DFDA 1I5RA 3G1UA 3UH1A 1ADFA 2BMAA 5T67A 3VZQA 2RCYA 2OGUA 2IZ0A 1J4AA 2X23A 1OFGA 4DMLA 3Q2IA 4UEJA 1A71A 1WZEA 1GR0A 3EZYA 4Y6SA 4XWYA 3JSAA 2VWHA 1TLTA 4WE3A 1LRJA 4ALMA 4CQLB 1ML3A 2P68A 2E48A 3DTYA 4YQYA 2EV9A 4CL8A 3RC1A 2QX7A 2UUOA 3NUGA 3KLMX 3Q11A 3LT2A 3BAZA 1N1EA 1U3VA 4P4LA 2HKIA 3CEAA 3I1JA 3ZWPA 3F4BA 1R4NA 4J1SA 3PFWO 3H9EO 4UVEA 3BMOA 3VOSA 3PTZA 1IHXA 1UXKA 5JLAA 4D44A 3T4EA 1SAYA 1DOHA 2PZMA 3GFGA 3NT2A 3WYCA 1GUFA 1ONOA 1IE3A 2PTGA 5CPFA 1E1MA 3GVPA 3W4JA 4FJ2A 4KQWA 3DZFA 3DR3A 3UCFA 3D0OA 1PWXA 3EVNA 2Y0CA 3E82A 3JQBA 5C7IO 1DC3A 3DO5A 3H5NA 4P4GA 4GAEA 3ZNQA 1P1HA 1LC0A 4BKRA 4DYDA 1X7DA 1GPDG 2B0JA 5DN9A 2I9PA 4PLCA 2R6JA 1Q0QA 1E6UA 3GMSA 3DOJA 2YQ5A 4GH5A 4J2HA 4UUPA 2FSSA 4IM7A 2V65A 5COAA 5JAMA 4WNCA 3VKUA 2HCTA 4FJ1A 2W8ZA 4O63O 2E4AA 5AQ1A 1WP4A 3WQQA 4LCEA 1PWZA 4KUHA 2HLPA 4PRLA 2G76A 2Q49A 1JWBB 4ZQGA 3F6YA 2PH3A 3V2GA 4Q3DA 2ZYAA 4GGOA 3UHAA 2JAPA 4XCVA 4WLFA 3WJ7A 4TRJA 1GUYA 2Y0DA 2E49A 2X1HA 3UGKA 3GEMA 4N54A 4IXWA 1C0PA 5EL0A 2C5AA 4E0BA 4PLFA 3ULKA 5L40A 2Z1NA 3IS3A 1LSOA 4HFRA 2RHRA 3HNPA 4TROA 3GT0A 4FSHA 1UZMA 2HU2A 4GMFA 2IZZA 4BGUA 3BMQA 2GRAA 2O23A 5MDHA 4BO7A 2EP5A 3WGZA 3FWZA 4N18A 2O4CA 5BSHA 1RM3A 5G4KA 4J9UE 3T4XA 1D7OA 3WMWA 2YZ7A 1LLQA 2ZYGA 1KY4A 4F46A 3MJTA 4XGIA 2GZ3A 1CEQA 5AYVA 2B83A 4JXKA 1S6YA 5IDXA 1JVBA 1QXSA 2QZZA 3O03A 1SPXA 1F0YA 3QW2A 4XQEA 1T26A 1E92A 4N5LA 3GR6A 2O50A 1GTMA 3B70A 2AG5A 2AA3A 2ZTLA 3C7AA 4E2XA 3A06A 1O9BA 4XJSA 3L9XA 2WD7A 1U7TA 4IJWA 1U4SA 1ZBQA 2EJWA 4J7UA 3ZCXA 1I32A 3BMOB 1VRWA 3FNHA 3NGXA 4I9HA 1LI4A 1L7DA 2G1UA 3ZZNA 5F5NA 1DHTA 1DC6A 2UVDA 2X4GA 3QJ5A 4LK3A 4R4JA 2J3JA 3BXXA 2PKRA 5DOVA 2Y99A 4BB5A 3OJ0A 4PRKA 4LMRA 3U49A 4AJNA 3WS7A 1MG0A 1WMAA 1ZK2A 3KHUA 2JHGA 3U4IA 5T8KA 4PLYA 4AICA 5G0TA 1HE2A 2DKNA 3G0OA 5T6BA 5FEUA 1HTBA 2DAPA 1XDWA 1C0KA 3WGIA 1P1JA 3IUPA 3EY4A 1KS9A 4AL4A 3U0BA 3E03A 1LEHA 5I8WA 2QIOA 3ABIA 3KV3O 4JIGA 4U6SA 4LSWA 4BV9A 1KVUA 3IC5A 2WWRA 4IQ0A 5IDYA 1YJ8A 3RIHA 1U3UA 4R1SA 3LYLA 3B1JA 5DULA 1QKIA 4NJMA 1QYCA 3C3XA 1EVIA 4MVJE 3Q2KA 1EVZA 4RVUA 4YDRA 3RFTA 1YRLA 1GFSA 1RYEA 1ISMA 3LF1A 3M1LA 3NAQA 3CUKA 3AU8A 4NDNE 3WQRA 2CUKA 3QY9A 1EQUA 1T2DA 4ZHSA 3K92A 1ADBA 3WX0A 1A4IA 4IMRA 2FP4A 4O0LA 3GOHA 1E1KA 3DDNA 1MLDA 3NX4A 5JDIA 3OBBA 4G2NA 3RUCA 3U4DA 1QLHA 4CMIA 1VSUA 1ZSNA 3AOEA 1Y8QA 4DXHA 2VTDA 2BFPA 2HK7A 3ZV5A 2ZQYA 4BNHA 4BMVA 3TNLA 1RYDA 1TT5A 3I9OA 2EKPA 3RSHA 3TF5A 5I9MA 1WZIA 1EUDA 2O7SA 1R4MA 4CR8A 1R6DA 3TQHA 3INTA 4PN3A 1O0SA 3WGQA 2RBEA 4WLOA 4EJMA 2A9FA 2XAAA 5HRUA 3UVEA 2H6EA 2ILTA 2D4AA 3WWYA 1HDCA 4C7KA 5A4DA 2QG4A 4WCFC 3VTZA 1LJ8A 1GEEA 4LN1A 2NQ8A 3H5RA 5KOIA 2HRBA 3M2PA 4IDGA 3RUEA 1EVYA 2WTBA 4ZN6A 3KETA 1E6WA 2GLXA 1Y1PA 4A7PA 3NT5A 3NTOA 1WLYA 4E2YA 1VSVA 3I9MA 2EKLA 4J7XA 4UREA 5G2OA 4BS9A 1DSSG 4XJTA 4D42A 4R5HA 1YBMA 4CUZA 4CR6A 2ZIZA 4BKUA 4L74A 4NQZA 5AOVA 4CUKA 5ILOA 4A03A 4QTZA 3DZIA 5F3RA 2BD0A 3H2SA 1PR9A 5DP1A 2JL1A 3DFUA 2FR1A 1SEPA 2IDZA 3K30A 3OM9A 2F1KA 3R3JA 3RUAA 3W4KA 1E0DA 4AJEA 4NFSA 3ZWWA 4O5OA 4AVYA 3SLKA 3S1LA 1UP7A 4LRSB 4NU6A 4QFCA 1M66A 4W9NC 3O8QA 4G81A 3D4OA 5ER9A 5KIAA 1QR6A 1HYHA 4HNHA 4HFJA 4P8RA 1H6CA 5C7OO 1NVMB 1BHSA 4RQTA 3IDSA 3W6UA 5A3JA 3JQGA 5ENVA 3SBOA 4CV3A 1HE4A 4JCOA 1EQ2A 4PZDA 3WGTA 1HF3A 4NJMB 4INAA 4RF4A 5FFFA 1KEPA 2WMDA 2E37A 3A28A 1VLLA 2NVWA 1ISJA 3PJEA 4OKNA 5F21A 4E5YA 1Y8RA 2BH9A 1QG6A 4YVFA 1I01A 5C37A 1D8AA 1Z73A 3JD4A 1KYQA 2HJRA 3PZRA 1UDCA 2AEJA 2NU7A 5U4QA 2I66A 3CSDA 1Q0HA 1TI7A 3TZCA 5JDCA 2J3HA 3FRJA 4CMIB 1XGKA 1FF9A 4QX6A 1Y8QB 1ZK1A 3AY3A 3PLNA 1C3VA 4WPGA 3D5TA 2NNLD 3ZU3A 1ONNA 3RJ9A 1P77A 4PLHA 4GX1A 4K28A 4E4YA 1E3IA 5CDSA 4DQUA 4ZQBA 4OXNA 1ADGA 4DLBA 2X0IA 5A04A 4XRRA 2VZ9A 1O95A 1PJBA 2GZ1A 4D0RA 1XA0A 4BQPA 3RCBA 3V5NA 1NR7A 3W8DA 1IZ0A 3KO8A 3S55A 1YDEA 2LDBA 5TF4A 1P1RA 3GPDG 4R41A 3QWHA 1PGOA 4Z3KA 3PGJA 1N1GA 4ALKA 2X8LA 3DL2A 1ULUA 5I7EA 1ADCA 3UAGA 3ZHXA 4B79A 1EMDA 3MJVA 4LVUA 4I08A 4JQCA 1PR3A 4CV2A 4M87A 5CDUA 4CMKA 4BNJA 4OJNA 2JD1A 5TSDA 4I8XA 1Y5MA 4EYEA 4OGWA 5THQA 5C3MA 1HDGO 1LDYA 2NSDA 5JC1A 5JMWA 1TVEA 2X7HA 1QORA 3GAZA 4IJUA 3ZN2A 4HFNA 1A72A 4IDCA 2WJPA 2OUIA 1E7YA 2QHXA 1N5DA 3JQBC 3AUSA 3LF2A 3IJRA 5IAAA 2P91A 2JAHA 4H16A 4FN4A 4ALLA 4WEOA 4ZRMA 1Q0LA 1IOLA 1VC2A 1Z7EA 3G3EA 4XX0A 4OYRA 4B3JA 3V8BA 4JJIA 3PHJA 4BL5A 2VYVA 2GGSA 3FNFA 4Y8VA 2CF6A 4J2OA 5HS6A 1YVEI 3GUCA 1M76A 2H1SA 3DBLB 1EZ4A 2V6GA 5EPOA 1XSEA 5TNXA 3ANNA 3HB5X 4P22A 3NT4A 2VYVD 4R69A 2VWPA 3WTCA 3HG7A 4XKJA 1NHWA 1PZEA 2CSUA 3VC7A 2D59A 3WMXA 2DBQA 1J6UA 2I3AA 2QW8A 1SC6A 2DTDA 4XD2A 5A5FA 1LU9A 2VHXA 5DZSA 4M86A 4AJ2A 2ZB4A 3H9GA 1G6KA 4UUMA 3QV1A 2G17A 1LDGA 4IQ8A 1TT7A 4KQXA 4XYLA 5KJFA 5JAQA 2W2KA 3ONEA 2VWGA 1GQ2A 3WTBA 1ENYA 2Q1WA 3MTJA 1ZEMA 3OETA 3WIDA 2YY7A 2NM0A 1A7AA
chains in the Genus database with same CATH superfamily
3ETEA 4O2RA 2ZYVX 4QBHA 4EO7A 4KBFA 4QGHA 4A6PA 2GCEA 1Z2EA 1NSFA 2TMDA 2VNAA 4M46A 3RASA 3L8CA 3FKSD 1H4TA 3FPJA 3AF3A 3ZV7A 4ZQHA 3RUIA 1OMOA 4IXTA 4AMVA 1KU6A 5FBLB 1SXJE 2EZ9A 1D5CA 1NUHA 3MWFA 1JNYA 2TECE 4B3IA 2CXHA 2H59A 4K88A 4D82A 3DLBA 4EJ0A 1WETA 4KGZA 3LK7A 3OU6A 1M2JA 1T1RA 3SC2A 4PZUA 1E2JA 1X1SA 2FVXA 4QA9A 2QRGA 3WGVA 4FZ3A 1VA4A 4BVBA 4JOQA 2C7RA 5JJLA 2WF7A 3SU8A 1RQLA 2CVPA 3MLAA 1NVVR 1V4NA 2AV6A 1WF6A 3DA8A 4E07A 2XVZA 5D3ZA 2DH5A 3KYIB 2ZTVA 2ZYIA 4LZWA 2BMEA 2RI1A 5JSKA 4MTLA 1NN5A 3H9JA 3PQDA 4XUGB 4BNIA 3F9IA 1BO6A 2TMKA 3MAAC 5EIOA 4P4SB 3D6FA 3E53A 3OO1A 2BC9A 5C35A 2H2IA 3GXOA 2OCYC 3QKSB 1TIBA 3VYRB 1R5OA 2B1RA 4WERA 3IV6A 3LQRA 1G2QA 3M81A 4D74A 2FOIA 5E6RB 1JFFB 2JCVA 4N0DA 4XPZA 2Z30A 5FO1A 1VJRA 1D2EA 3QEMB 4CLOA 3CW9A 1QRSA 5DRTA 2IP2A 2I2CA 2WQ7A 3K0SA 2GASA 1E1CA 3IQDB 3QVXA 1T3LA 1MOZA 3CE9A 4GMKA 3U2QA 3RUPA 1Z12A 2O8DB 2GESA 3H97A 4LW8A 3DMYA 4S1WA 4NK5A 5AHWA 3VPDA 1OB2A 1VBFA 4IIEA 3AF6A 1FS4A 1BCRA 1XRPA 4XYBA 2UYHA 4H0CA 5T8KC 2YNMA 5E2IA 2NWQA 1JEYB 1OZGA 2I6XA 1ZIDA 2IYAA 2JDID 2JS7A 1GZHB 2G04A 2N46A 2WSLA 2A2ZA 2H18A 3OT1B 3WLAA 4AT1A 2HQRA 2WD9A 2XQVA 4P35A 3FCEA 2ZYUX 3N05A 1Z33A 2Z2XA 2OVFA 3ZCPA 5AWFC 4NCXA 4LXGA 1EA5A 5C1IA 3W34A 1IUNA 3O26A 4LRWA 4XSVA 1JALA 1U3GA 4L5AA 1QRUA 4IDUB 3JASB 4D41A 4AJJA 1HYEA 1QHXA 1TAHA 2FG6C 1NJ1A 5DWVA 4N7MA 4DJAA 4JJZA 2WY2D 1XD2A 4RHXA 4FONA 4YDHB 1AF7A 4ZREA 1GUAA 1P7WA 2ATVA 4UVGA 2XZTA 2JI6A 3QPBA 1KI6B 3CEPB 1REQB 3EZXA 3DF7A 3KZKA 2VJDA 1H0HA 3HE3A 3OPNA 1ZH0A 2Q5FA 5C8YA 1NQTA 2XCOA 5DX8A 1D2AA 1QZ3A 2VNKA 4HGZA 2H7VA 2A9QA 2CB9A 1S4QA 1L1EA 4JUCA 1VPTA 1NXXA 1OIXA 3HM2A 3KIPA 4KH0A 1SKAA 2Q50A 1P9RA 1G8FA 3M9LA 1H3EA 4EA7A 3ITNA 4ZVSA 2X3UA 3SC6A 3ACDA 4FKBA 2ZVPX 3ZY4A 1FW6A 1C0IA 1XCPA 1NFRA 1DQZA 3CWCA 3BDVA 1LDEA 2VZEA 4PGMA 3AU9A 4INPA 2C5GA 3TXAA 1QRDA 3OZFA 1JQLB 1RCFA 3DMPA 4R01A 1TCAA 5EE0A 4BV8A 4B82A 2ECQA 1OOEA 2X3YA 3IUEA 1JVSA 4TT3A 4UDXX 3A31A 4FSXA 3VUFA 4A2CA 1Y82A 3RSSA 1DPGA 4OA5A 5AXCA 4B6QA 5DX0A 2Y93A 4I5GA 1ODCA 4TVBA 3JVVA 3QE4A 1R8SA 5HE9A 4C9BA 1U6KA 3K0CA 1NBMA 1XNQB 2O2YA 5HG0A 1NMSA 5K0TA 5FNVF 1YAHA 5CIQA 2D0DA 3GFQA 3TLJA 4DHWA 5ALIA 4V1CA 1XNRB 1KVQA 2O52A 1Y5IA 4AW9A 1VI6A 4KO1S 5C52B 1Z18A 1N78A 4N1AA 2WKQA 2X9LA 4LQCA 1I4EB 3ZQJA 1T0JB 3GJSA 2C1EA 3KQKA 3KEGA 4H7JA 2XNCA 1YA6A 3A4MA 4K9MA 4KR2A 1LQUA 4FWTA 3RT7A 3OZRA 4MGKR 1AB5A 3MWYW 4JJEA 4E5KA 4HG2A 5L3VA 4ZXFA 3FHTA 3DZGA 3K31A 5IM4A 4J1QA 2YJ4A 4HSEA 1PR5A 4DCGA 1YIDA 4Z4GA 3RBVA 2H1IA 1U2QA 1R64A 4EL0A 1KEVA 3GWZA 4CLOB 4X61A 1CW2B 1GCIA 4DYHA 2HK6A 4P7BA 1ULSA 4EX7A 1E1CB 4CIXA 3FFAA 5DVZA 1E8NA 4KQCA 1E1LA 2XE8A 3T61A 2JH9A 3L0BA 4L9AA 4A73A 1I94B 1Z4JA 4KMSA 3DOFA 2I8CA 2JG3A 1NDQA 4WN9A 3WGOA 2JJ1D 1K6JA 2GHIA 5EWMA 2BFWA 1AS2A 1W2HA 2J9RA 1BCRB 3TINA 1B14A 1RBMA 2W48A 1X7WA 2YRXA 1YIAA 3ICVA 1ZBDA 1VP3A 5AJWA 2CHQA 5FORA 1RYZA 3U80A 3W9YA 3ECAA 3F6PA 3BS4A 4O02B 5IZCA 1P45A 4LJ6A 2C88A 1EDBA 1JKIA 1Z4NA 2A5JA 1ZHFA 3KQOA 4CLDA 2Q6LA 2O19A 1IM2A 2H0AA 3O91A 4FEGA 5CT6A 1BOOA 1RPNA 2ZXFA 3W8FA 3NBZC 1JSCA 2DG2A 2X5JO 3OA0A 4N5DA 3H2IA 4XQGA 1NQUA 4D9HA 3P2IA 1RWPA 5JYBA 2H7XA 3IH5A 1G41A 1XD2B 2BGMA 2SBTA 3PEYA 3FHJA 4L8WB 4JODA 1R88A 2CJWA 2CKMA 4Y2UA 4ANFA 4M1OA 4M0CA 2VQFB 1ESNA 1TL7C 4I1RA 2Z2KA 4GBJA 1P4SA 3VH4A 1HFWA 4ITUA 4XLTA 1WMFA 2H57A 2BAGA 4WHMA 4L2IA 1LPAB 1OAAA 1JS1X 1X1CA 2WTAA 4QL3A 1TUIA 3GJQA 4WK0B 5E1BA 4BEWA 3G2LA 1CULC 1DQRA 3EARA 1IEWA 2FWIA 4GI7A 3VVCA 3CG0A 5JDCC 5ICMA 3R9XA 2IELA 2Y1OA 4FLEA 1SIOA 1YQQA 3DMTC 2X58A 3BWDD 3V4FA 4PFKA 1D3AA 4BYGA 1UXJA 5HSGA 1DAPA 2M6SA 2CK3A 4BQOA 2C83A 3NPAA 1OAOC 1Y7TA 3IUNA 3KLNA 3LCJA 3TZHA 3MWEB 3Q7IA 5FBQB 3LUCA 1G4AE 4K9DA 2IUUA 5AW2A 3J81k 1AXGA 1WCIA 3KXDA 4KYTA 5EKTA 1JSLA 1EX1A 2D62A 5HCNA 3VO9A 1IZ8A 3D7RA 4MGEA 1YOVB 2IYEA 4O8ZA 2C61A 3GP5A 1NQVA 1JP7A 3K16A 4PHFA 4EW1A 4RZIA 1ZM2A 3Q7TA 4OB6A 3TR6A 3FYUA 3NHYA 2J33A 4AO6A 3KJNA 5J4HA 3E5NA 4OMCA 2PHZA 4K9QA 3VSAA 4FB4A 4OHBA 1SHUX 1VGRA 2LRHA 4QD3A 2PUAA 2HF8A 1YVPA 4LOKA 4JUIA 1RAGA 3EIQA 3R4VA 5CB0A 1G3UA 1UOEA 1IZ9A 1KAOA 4KQGA 3RABA 4AQDA 3EN0A 3RNOA 3VKHA 1BHO1 2DULA 4FOTA 3OCXA 3I0MA 2CMHA 1IY0A 1P81A 2NO9A 1Z29A 1MO2A 2V7PA 3PF9A 4QEDA 1T13A 3LBAA 4LMBA 4OX9B 4U7GA 3DZDA 4EY3A 1ZD2P 1ZH4A 1AQLA 4YCMA 1VJ0A 1UKVY 4C4AA 2XDYA 2O2GA 5TMBA 4UC0A 3OEHA 3TSCA 4XB2A 3CLRD 1FCJA 4KE8A 4FFNA 4DMGA 1Z8NA 2PZEA 3ZDAA 3V2HA 2P9CA 1WP9A 4UD2A 1JHOA 1XMJA 1KC1A 3LA6A 4U3JA 3JZMA 4QPCA 4WN9B 4UUAA 5EWMB 3JQRA 3AR6A 1GD1O 4DV2B 4BFVA 1O03A 1X7WB 5CM2Z 2PWBA 3UHOA 5IAAA 1IPHA 2B69A 3EVEA 3GHYA 4PO1A 2I55A 3AY6A 5FJJA 5H68A 4OHUA 2QRUA 2QY6A 3O8OA 5AUQA 5TJ9A 4BGVA 4NY1A 4DCTA 1N8KA 2G0AA 4LC1A 1QHYA 16PKA 4ZZ0A 3P4XA 3CLSD 5BSUA 3ZDDA 4ZVOA 3NC1C 4GM1A 2FSFA 2JLWA 1E6LA 3FYHA 4DJ5X 4KB5A 1MD9A 4BFSA 1FU7A 3SG0A 4G5HA 1DRWA 1SXJD 1MABA 1NXOA 3ERCA 3I04M 4HADA 3P96A 1F17A 3LQQA 3OZSA 5HEKA 3ZE9A 4Y2PA 2CMFA 3BGDA 1MQ8B 1XTVA 2G80A 2HF9A 1EP2B 2WT9A 2I6TA 1S2NA 1PJ4A 2HPVA 2K6GA 4HYQA 4KFUA 3A4NA 3V6MA 1ZDMA 3PC8C 1BS2A 4I8DA 4FFMA 3PA6A 2YN0A 2C4TA 1SURA 1NYRA 2OP0A 1MVLA 2FCRA 3CZMA 3FMVA 2Y66A 4HGYA 4I4TA 2NZ8A 3MGKA 4GWKA 2O2HA 1TVCA 5AI0A 3VM6A 1RYNA 1TE2A 2PX8A 3FKJA 3TNFA 1H93A 1L7EA 2WM3A 3EXHC 4F4JA 3C7KA 1L7NA 4UFPA 3SYTA 1XZPA 4K26A 4WCDA 3C43A 5K6TA 1JIUA 4O59O 4LY6A 4KQ1A 3ZDZB 4GP9A 4PYNA 4UZEA 4LE1A 1VKHA 2X0RA 4FFRA 1VI2A 1LBQA 4JI5B 3VR6H 3ZLTA 3BA1A 4GZ5A 4Z0PA 4E11A 3P97A 4MDHA 1G5HA 2XZOA 3VPGA 7ADHA 4B84A 1A7KA 4ZC1A 4DCJA 1CUDA 1JR3A 5JO0A 1U7DA 4GL2A 1VKJA 5HQJA 1JU4A 1KXZA 3HNOA 1J0BA 1GZVA 2C2OA 3FYUB 4ALIA 4ZZ1A 3JXEA 5K09A 2WHQA 3DHNA 3FDIA 1MVNA 5G1NA 4JN6B 3SYMA 5DV9A 5BSVA 3MLEA 1J8FA 1OZAA 3HVJA 2JHAA 1T9BA 2MSCB 4OGGA 1DS6A 5G02A 3DYVA 4C0SA 4D0NA 1U8ZA 3ELBA 2ONYA 3R7FA 3UQZA 2XMBA 2GHQA 3R6WA 1VKNA 4HNGA 1E2DA 3DDOA 2JIQA 1IN1A 1I7LA 1Z0KA 3P9YA 3BH6A 1SPBS 2HUNA 3TDKA 5A5DA 4NE2A 1EQAA 3A36A 1COWA 3DW3X 4J49A 4M8KA 4OGFA 5GV8A 4B6FA 2VF8A 3LZCA 4KJXA 4DEXA 4LHSA 2AC7A 1EJ0A 2NZVG 4GXTA 2ZIVB 4Y1RA 4UNNA 1TK3A 2ZBUA 1P91A 3L77A 4LJ4A 4NOLA 5M2QA 2O8FA 4GE3A 1H42A 2XX3A 4QELA 1X7YB 1AZSC 1K3FA 1L6RA 2D7JA 2PBLA 3Q9SA 4HVTA 4NJOA 4R05A 2IXAA 4OH7A 4M1EA 5EIXA 3AEUA 4FD2A 4BWFB 4D9KA 4YA6A 5CK4A 1LPBB 3HCBA 1DBWA 4YAOA 2XEDA 3FPLA 1KO4A 1GPBA 4KEAA 2P0EA 5BMVF 4IWNA 1QFSA 4C6SA 4O4LF 5IKMA 1ISSA 5KKAA 2Z9CA 4DV5B 3KJGA 3KQWA 2X0JA 2R44A 4QBFA 3H2ZA 1QIKA 1O6ZA 3O8OB 4W7HA 3PEWA 2Z8ZA 3ADPA 3EXG2 4WFIA 3PKIA 5DXFA 4CCAA 2Q3FA 1TA4A 2B36A 4PIMA 4DSZA 5FWXA 4GOND 2C5SA 3OMXA 4Y9DA 5DM2A 2OCXA 3DOCA 4B71A 3JQFC 3I83A 4M8NE 2IPMA 4UTVA 5AVSA 4CTKA 5FV4A 4X20B 1ML4A 4DUGA 5JQWA 4W8HA 1MABB 2B4RO 1AHIA 4WRRA 4YRSA 4R9SA 5BQPA 4FT2A 1JYSA 1CLUA 2I87A 1NFQA 5HTOA 2P2LA 3GUHA 4XGQA 1VKZA 1P33A 3G6WA 4IFBA 2IU0A 4B48A 4Q48A 8ATCA 2IPOA 4BO0A 1OFVA 2BR3A 2WIJA 1V41E 2PO5A 4IHJB 3CM0A 4TMTA 4HB3A 2PWZA 3Q3EA 2RIRA 4EZIA 5ELXA 5LNK6 5JU6A 2BPOA 1P4RA 3C48A 4P4UA 2C5LA 1H6AA 3UW3A 3NEJA 2CNKA 3KBOA 3OJWA 3FF4A 2WNHA 3UYKA 3ZS9A 4DDTA 4J1NA 5FIUA 4JJAA 5JHGB 1JFTA 5F1PA 3QW4B 1P9OA 3B52X 4I4TB 3SR4A 5EJFA 5DM4A 3REFA 3V4LA 7ABPA 2AEMA 2HIAA 3C16C 3WLRA 3RFVA 3Q7RA 2NO1A 1QMPA 3H2HA 4FT4A 3HUUA 3TWOA 4YT5A 3GNQA 4QUKA 4UCXA 2QTAA 1K6EA 3LHKA 2OGTA 1US8B 1X1QA 2C5EA 2ESRA 2H4FA 2PL3A 1EGVB 3F1LA 3S2IA 4AX4A 5GWXA 1JFLA 3EPHA 5KDDA 3E3NA 2FZVA 3O8NA 1IQRA 1ACMA 4NJEB 4MR8A 5JMTA 1GPWB 3KAPA 5DBIA 2ZJAA 3ZEAA 4XASA 5KSPA 1FE8A 1IULA 3NZEA 2Q5CA 1ZN8A 3RIMA 1JIJA 1JSRA 1WV1A 3S8EA 1T24A 1ZUHA 3P4UA 1PT7A 4FKZA 1UXOA 2UYOA 3HXLA 5K0EA 1IM8A 1W94A 1K06A 3TG8A 1E99A 4OFBA 4BO2A 2BFEA 4I19A 1SUWA 4KQKA 1S7CA 4UHEA 1DKUA 3UWMA 2YBEA 4KHPB 3WA7A 4HZUA 1W4LA 1M10A 1JHYA 3ZEIA 1XCLA 4IZIA 1QYRA 4PQFA 4DMHA 5DNUA 1XI2A 1RRGA 1Z8DA 4URFA 3IAHA 2EXXA 4IG4A 3OQNA 1BHQ1 3U44A 2FH5B 4XI9A 4ZALA 1UMDB 1BVHA 5ADVA 2FPXA 4B4DA 3CPJB 3KDSE 3MJCA 1N2GA 4H4EA 3CZ9A 4S24A 4TQAA 2PKYX 3UAZA 5A03A 1F9EA 1E7RA 5I7SA 4XVQA 1J22A 2FUKA 4B9EA 4Y1RB 2EL9A 4JQSA 5KYUA 5IYZA 1XMSA 4YXFA 2GPWA 1QGYA 1MIOA 1OI2A 3KXPA 3FBWA 3LUAA 3P19A 3DBLA 4BO5A 5K8CA 2VZ8A 2GN4A 3T7EA 4G0VA 1U2DA 2BONA 5DO9A 3AEUB 4QODA 4F4DA 1EXNA 4CIWA 1K2WA 1SUIA 1TVMA 3DKRA 1NAHA 3H7AA 1DB3A 5DEIA 4HH3C 3ZVRA 4ZRNA 1S8FA 2EBFX 1VM6A 1IUKA 4FHGA 3IAFA 1RJGA 3QBEA 3NOVA 3H2JA 1Z6GA 4EVSA 2AFHA 2WG0A 3KUUA 4DWVA 2GK6A 5I8ZA 1P2DA 4M9CA 1NXSA 2P69A 1FTSA 3TRKA 4ZJUA 3TTSA 2VHWA 5JFOA 3F98A 4JH0A 4A8PA 5FWXB 5IK2A 3IAM6 1ZD1A 3IOYA 1PL6A 5DFAA 4JI1B 1NL3A 4N5IX 3NWJA 1ZCAA 3W5HA 4KE7A 4G23A 4D6YA 5D5PA 2P9QA 2H2GA 1E3MA 1EFPA 2H11A 4CIDA 4PLZA 4RE6A 4I8IA 1Z6XA 4PWZA 1DAKA 2VPPA 1CY6A 3BHJA 5LXTF 5J58A 2BFCB 2IKQA 1VB5A 2P1RA 5DLEA 4B2YA 5CVJA 1RNLA 3U7HB 2PRZA 2K2WA 3QMWA 1RBZA 4DIMA 1YHYA 5DI9A 3NJ4A 2GYYA 1W25A 3N87A 1GCGA 3ABSB 5SYAA 1V8OA 1HNWB 4GP6A 1GU0A 1ZUNA 3BTSA 3WWZA 5BUQA 2AN3A 1YMQA 2PS3A 3GFFA 3TTWA 4B6SA 2B37A 2CDNA 4IVQA 4RKEA 4HTFA 5DKFA 2HBRA 1FK8A 2H2WA 2VA8A 3FUVA 3I6QA 4L7VA 2R4TA 4MHSA 4PGHA 4EJFA 4Z3KA 4C3UA 3ASUA 5TGDA 2ZYDA 3O4GA 1YE3A 1YB4A 4ENTA 3ZHVA 1XAIA 2BSXA 2I76A 2JIBA 2ZOSA 3DC7A 3EPKA 1G5RA 1WKCA 3DOHA 1RLIA 1QH8B 2Q8NA 3THYB 1PZHA 4J0KA 4MR8B 1G8HA 2XYGA 5B6JA 5CT4A 4JHLA 5CNKA 3WSWA 3THWA 1JLLB 1ZGBA 2GVDC 1MEOA 2P0YA 1A9PA 3K7EA 2I4MA 3IIIA 2XIQA 3DE0X 4HDCA 1P7CA 2M6RA 1R50A 5D1NA 4ITRC 5ESDA 3TQOA 4EPTA 4WNAA 1FX1A 4I3GA 4YJ2A 1M5UA 3CEMA 1UBJS 4JC4A 3T34A 3HXMA 3EZ6A 5D86A 4QECA 1CEXA 3T1VA 4KPYA 3FPFA 4KO8A 1DHRA 4DARA 3K9QO 1UZNA 3VH3A 1O3YA 4X1YA 3W5CA 1FP4B 3GCDA 1PZFA 2ZTHA 1UR5A 4H1TA 3CW2A 1F5SA 1U8AA 1MC4A 4E4TA 2VNSA 1ZH2A 2WMOB 4RA6A 1S2LA 1QCCA 3C2QA 1NPYA 1ZK0A 3CPEA 1DT3A 1KMHB 4C2UA 2ZWIA 3N2ZB 2IODA 4R0VA 2B4TO 2IHUA 3ZOKA 2VQSA 3N28A 2P2NA 4ZFNA 1MVOA 3WB9A 5BT9A 1TMYA 2O2EA 4KYIB 2NPFA 1PK9A 5ALKA 3R6LA 1CE8B 5ENDA 3NOXA 4MQFA 4TXNA 4BJ5A 1PG0A 3BMNB 3G2IA 4OQQA 3OQ6A 5GADl 3U6KA 2VRBA 5BWBA 3L84A 2DJIA 4KAFA 2AK3A 1NXVA 1DIHA 3MOGA 1NXQA 4HWOA 4P32A 4PYRA 4X6LA 3CXUA 1J2YA 3CLSC 1K7SN 4JI2B 2ZI4A 4P98A 3ND6A 3VPXA 4BO9A 4CEJB 1AKTA 3I2HA 1OT3A 2AFHB 2F1JA 4MGYR 1SXJC 4NNOA 2Y77A 1RLTA 3CJTA 4GEGA 3PUZA 1K7FB 3KL4A 1QQ5A 1XZQA 4F5EA 4IDHA 3QTTA 3TB6A 2FB9A 3G0BA 4RU1A 3GU3A 2DR0A 2F17A 3HP7A 4BNKA 2YHAA 1EFPB 1NN1A 1JQ3A 3CMMA 4ZVVA 2RH5A 3GNTA 3N86A 5CFZA 3Q7EA 3VR4D 3U1BA 4Q3CA 4LF6B 1WUTA 2QROA 3FMIA 3NALA 4FYXA 4BMNA 3L7JA 5JBNA 1HH4A 5IVPA 4JKYA 3SZRA 4DNQA 5AK0A 2BTQB 2Q9BA 3AMVA 4LXIA 1SBCA 3ZYCA 1UXHA 1ZUNB 4RD1A 5HKOA 2VYCA 3EIHA 4U9UA 2C59A 1LX6A 4UBLA 3NH9A 2ZR8A 3VR2A 4B17A 1BQ3A 2N75A 2BLNA 2EHDA 2RB5A 4PG4A 5DOZA 5JNRA 4EGQA 4YJ3A 1QPBA 3GVHA 4B35A 3TVDA 5D01A 3CZCA 4BB9A 2I2BA 1QK3A 2YFKA 4IXDA 5J2TB 1PS0A 1BMFD 4XW2A 2WM8A 1CYDA 2I65A 3SLRA 1RWKA 5CG1A 2C07A 4L8FA 3T95A 3WBBA 3K1ZA 5BSEA 3P45A 2VH2A 2X6TA 4YPOA 1EM8B 5J4LA 1ODTC 3W5UA 4HAWA 1GAEO 2JB9A 3VNRA 2ZW9A 3BN3A 3SJCA 1J0AA 1UOOA 2DFLA 2IFTA 4LDAA 3NHKA 1WDMA 3DFZA 3L0DA 3S2UA 4YJ2B 1ZLXA 2JJ2D 3PHHA 3K8QA 4F3CA 4MMZB 1Q92A 1DTWA 2HRCA 2LIPA 1YJCA 3DWFA 4YMHA 4HD8A 5KNBD 4OD0A 3A0UA 3RD5A 3TIFA 4BFZA 2WJ4A 4OSOA 5HUJA 2GVNA 2RG1A 3T0FA 3GLHA 3MBKA 2GPTA 2ZT5A 3I3OA 1PIWA 3O0DA 4FEAA 4X1YB 1W4CA 4YP6A 1VLZA 5SV2A 3TD9A 4IVPA 4BFCA 1S89A 4W5JA 4XEHA 5DM1A 3IHKA 1P9NA 1JR3E 3FSEA 4R8SA 5SZHB 3CMCO 4NP6A 2W11A 3P0IA 2DR2A 2OG1A 3DBVO 1T6NA 4OUKX 1TKCA 4JJ7A 3QF7A 2XWQA 3FOZA 5DYWA 4XWTA 3VHRA 4DRXA 1ZRHA 2CFTA 3IE2A 2PLAA 4OM8A 3IPYA 3FNGA 4MQFB 4PM4A 4Q9LA 5TVKA 3SQDA 2J5KA 3UUWA 3V55A 5FLKA 4DLWA 5JXGA 3RU3A 5DE3A 4XDYA 5A3SA 1R10A 2W22A 1XK6A 2A92A 3NUZA 5LZ4A 1VPDA 1ECJA 3NHWA 1LLFA 2Q62A 3K6RA 3LPDA 3JU3A 3ANYB 5BPHA 4BGIA 5AVXA 2X6RA 4NXMB 2JD2A 2H7YA 3PKJA 4I1UA 4RF3A 3BXGA 2H7CA 3QYAA 1H3NA 3QH4A 3U7EB 5DTIA 3FCYA 4CNBA 4POOA 2KMLA 4GQAA 4D3YA 1T2UA 3KXLA 1QM5A 1VBMA 2H4XA 4R2IA 3ZDQA 1LK0A 1PKXA 2FPIA 3LKVA 4D9BA 5EXTA 3JRXA 4WOBA 5G4LA 2OCAA 4YECA 2XDQA 2XA1A 3G9TA 4UEWA 3UK2A 1ECPA 4HWPA 3R7NA 2GKGA 2OC9A 3CNOA 4ZYTA 1SN7A 3NAZA 9LDBA 2OQ2A 2N47A 4ABYA 3ZVKA 1TGYA 4JZKA 1UKBA 4JEUA 1OJ7A 2VNIA 3RJ5A 4H60A 1TFRA 1QRTA 1ORDA 4UTOA 1GSOA 3IERA 5LD2B 3TRJA 1IDN1 2R5NA 2YWBA 3PQFA 2HK9A 4Y9UA 5ICFA 1IVNA 2QAGB 3R9KA 5K6AA 4QNNA 5D3MB 2ZQZA 3W5IA 5ALJA 3AI3A 4QLOA 5LLSA 1TJ4A 1N57A 3RB8A 4FOOA 1TEZA 2WHPA 1U63A 3SHOA 2CVFA 3H87A 4YJ3B 4HT3B 2BEVB 1OX6A 2Z9DA 1H3FA 4UNPA 1RW4A 4NHOA 3EZ2A 1W0JA 3VZSA 4J1GA 2GYUA 2YDXA 2H31A 4GP7A 3F6SA 3GN2A 3I30X 2EWMA 5JY6A 1LH0A 3HTXA 2I2WA 3DMFA 3IDQA 4HDMA 5AI9A 1RP1A 2ZB8A 1XXLA 3Q72A 2R8OA 2P3OA 3IVAA 3ORSA 2C4KA 3SJ7A 5JSZA 1GQOA 3AT1A 5JXJA 4S04A 2JJMA 4YJFA 4DR6B 1EH5A 4TV8F 3GQBA 6REQB 3H75A 3GRKA 3SJBA 5KNBH 2VK2A 2AD5A 5C8YF 3TS1A 5L7WA 2CFSA 3L8MA 4L0QA 3U61B 1W75A 3E4DA 2C94A 2I7VA 3F9RA 2OYCA 3QPAA 4RULA 5KYGA 1RFGE 2IZ5A 3DPIA 3EZNA 4DG5A 1N5IA 2HTEA 1Y7LA 1DLIA 3D8HA 4EZBA 1U28A 2A9JA 2C57A 4L4RA 4KSCA 4WCVA 4YO7A 3R8FA 2VQ3A 2ZVJA 5JVDF 3RVOA 1ZRSA 3D1VA 4QNMA 3ZJVA 1F7UA 2FF5A 1E94E 4L1KA 1X7XA 3LFHA 3NV9A 2VP6A 5E3JA 5L6MB 1P18A 3EIFA 3KKZA 4CGZA 1W73A 5LLDA 2UVPB 2YV3A 4WKNA 2A0UA 3CTMA 1YB1A 3MILA 4CN8A 2QRHA 3N0VA 1NBIA 3VNVA 4MW0A 4D8UA 1X14A 1ZIPA 2CVOA 3AILA 2RGWA 3QE3A 4OH1A 3DHEA 4L8VA 5FLEX 4JOCA 1N5LA 1ISGA 4PQYA 2QRQA 4DA8A 3AF1A 2ODWA 4YRNA 4C0HA 3DUWA 3L4BA 3PRYA 2E55A 2WU1A 3MWLA 3ET4A 3FUXA 4L5YA 1UDRA 3FGOA 3O4HA 1H94A 5DPMA 3FCXA 3L41A 3ZGOA 4EQ6A 2H1VA 2F9FA 1O4WA 3GRYA 3EVAA 2O2JA 1CB7A 4HQKA 4I66A 1KZ6A 1MT0A 1UC5B 2DUJA 2LD4A 3QUQA 4JOSA 2P8JA 3AKDA 2R6AA 3U7JA 4YUAA 2OCDA 2AOXA 1HORA 4R51A 3I62A 2FPIB 2HQBA 2EJCA 3GEGA 1E2GA 5AHOA 2AC2A 2V98A 5LQMA 5AIAA 1VMAA 3VZRA 5IM4F 1SWVA 3WL3A 1JEQB 2NXWA 4GE0A 3L6RA 4PONA 3I92A 3MTAA 3L6DA 3EWNA 3VC3A 1Z7BA 2P2SA 821PA 2BP7A 5I45A 5JAPA 3GBVA 3NLLA 1C1HA 3CNBA 4J9VA 4ZYYA 2DPXA 5JAZA 3GBPA 2JCSA 2VBIA 3NDIA 3NNSA 4J0EA 2AFHE 3MMPA 3TMAA 1OFIA 4WZAA 4FI3F 3ZK8A 2GBCA 4QYSA 2FN9A 4GSKA 1NJ2A 2FFBA 1XU7A 2PUWA 3KE9A 3PNBA 3KOWA 3LH5A 5BO5A 2AC4A 2CJPA 1RXIA 1EG7A 1L7VC 2IL1A 3HA3A 5B1SA 2BR5A 2I0FA 5BNWA 1NTOA 4UEQA 2HFKA 2JNWA 2WHPB 5ED4A 2H4WA 1L5WA 1F8GA 1XZIA 1RJDA 2ETXA 2JAXA 2VDUE 2H0RA 5T4EA 1MKYA 4ZCSA 1KRXA 3ETHA 4QOSA 3GG2A 1K92A 5FDFA 2NZ2A 2PFKA 1MXFA 2JBAA 5F64A 1FPQA 1Q11A 3HLYA 4LZJA 3WWPA 4YV0A 2AF3C 2REBA 4WKGA 1SUPA 1U0FA 5HFJA 4CF4A 1FS5A 1UK6A 3EEIA 4YRKA 2D2EA 2CVQA 3MGAA 2EJVA 1WKVA 5A02A 2BFDA 4YJFB 3FIUA 1TZKA 2QX8A 3HHPA 3A1UA 4N03A 1ZI9A 5EJ5A 1RWVA 3GLRA 2D1TA 4CM3A 4F96A 1Y7IA 3D2BA 3OZUA 3BIXA 3TQFA 4E13A 1Q16A 2GUGA 1Z56C 3GDFA 3VMMA 1EP1B 3W5JA 6NULA 4E5DA 2QGNA 4HO1X 1CY1A 4XTCS 4EM6A 3TMKA 2FWNA 1RD4A 4KXMA 2Z95A 3DHYA 1CY4A 2A57A 1OGIA 4RHCA 2H1CA 4Q4HA 3ND5A 1A8IA 4FYYA 2BE9A 4NG4A 4N3AA 3ZV4A 3E23A 1XN1A 1KDRA 4PG7A 1X7XB 4JJFA 4X1IA 3FX2A 1N2XA 1Z2NX 4DTCA 1RKVA 2AVDA 1IB6A 3T4UA 2AN4A 2IOFK 5AUOB 3N58A 2XB9A 4DMFA 5FJIA 2Y9PB 2XUKA 5EPEA 4F11A 4HNTA 3D8TA 2YV4A 3NBUA 4MAMA 3WLFA 2Z83A 4MUNA 1XZJA 2VCEA 3BWBA 1LDBA 3RPEA 5A5EA 4RY9A 3DZBA 2J09A 2LCQA 5I51A 2Q8PA 3N7TA 1N32B 2UYYA 2O5CA 4F56A 3LUPA 4LWPA 1AKYA 3GVIA 2IU3A 3ZNNA 5AW4A 3IBTA 2P6PA 2XVMA 5A4FS 4EQ6B 2VO1A 4K6FA 2HJVA 3HA5A 1GNSA 3VX4A 4R71A 1JQEA 4Q39A 5JSHA 1P1KA 4Z9FA 3VVMA 5BR8B 1WSDA 1W47A 3FZYA 1UDBA 3EVCA 4TYPA 1DIAA 4FFLA 5EESA 3ZUPA 4DN6A 3F9CA 4OREX 3VU3A 3T5GA 1C50A 3ZGNA 1RE0A 4MPJA 4X54A 4JC0A 5GZ3A 3P2KA 3HKBA 2HR1A 2YJNA 1F8FA 1Q7CA 2BP7B 3EGDA 4YMVA 1H1DA 4XIYA 1Y9EA 1FC0A 2QUBA 3DF9A 1SUDA 1AK2A 4HVLA 1EK5A 2EG9A 1Z28A 1GPKA 1YSCA 2DY0A 2PJUA 3GEPA 2WJHA 1NXWA 2EFDB 3OAAA 4HN9A 5FA6A 3FTEA 1Y6FA 4MVJM 2WE8A 4ZCMA 1GKUB 4I4CA 2AZ4A 4IPTA 1OGYA 5KSZA 1X74A 1XJ0A 2VDMB 3DLTA 4GXRA 4OJYA 3RTAA 5CX1A 4LTNA 1PFUA 2YMQA 4NZNA 5I4CA 3P0RA 3KE8A 3WYBA 2ONZA 3RIXA 2G4VA 4M0UA 4BNLA 1E5DA 4M2LA 2ISSD 1AXRA 1THZA 3LBNA 1MPTA 2HNKA 3D5QA 1MA0A 1R4NB 1W19A 5B4TA 1YBHA 1UJ4A 3BTOA 3SIWA 5JCZA 4PTLA 1KO8A 1UIRA 3L05A 1KKLA 3CX7A 4PC1A 3V33A 5JCOC 2YFQA 5AR1A 4YT8A 4NKRA 4NOMA 3FYDA 3SIRA 4D9MA 2J87A 1QGUA 3KB6A 2OFPA 2AG6A 2BFDB 5K9ZA 2VPZA 3PSAA 3W3AA 3SF0A 5IF9A 1T5IA 3H3JA 4YGYA 4R1PA 1Q91A 4FEYA 1HRKA 4MDYA 5DBGA 5DMXA 3ZQUA 2CF5A 4EJSB 2ARKA 1SOVA 1LF5A 1GOTA 2Q1YA 4EZEA 1GPNA 2IYLD 9ABPA 3ETJA 4US2R 4OLAA 3HCCA 6LDHA 4JXZA 5EJ9A 3DZCA 2O0JA 5K8VA 4DB4A 2CXSA 1MDBA 2ORIA 2EGGA 1C1XA 3KLOA 5CDFE 5E2AA 1LZKA 3ZHYA 2V7GA 4Q4HB 1IYZA 2PQ6A 2AQ8A 1QO7A 3HA7A 5CFLA 1BDMA 4RF5A 4FDTA 5CNJA 2J5QA 3IQFA 2EEZA 4PVCA 1DXQA 3LAWA 1P2SA 3R5KA 4E6PA 4EDHA 3U9TA 1AF4A 2W9XA 4ZT7A 3WWCA 3HY6A 4OP3A 3D6MA 4X1KB 3REQA 1A2KC 1OBHA 3GJYA 3BFKA 3SWWA 2FE4A 4ID3A 4C14A 3A58B 1PJSA 4OV6B 1I9CA 3UPTA 1JQJC 1I6LA 5HF5A 4ZOLB 1SQ5A 1X1AA 4PSDA 2I80A 4TM7A 1I51A 3WLNA 5KYXB 2QUKA 3PKZA 4WINA 4C0WA 4JP3A 4H3VA 3LUHA 5JATA 1D2NA 1QKKA 1PZMA 1RC1A 3FA2A 1QH9A 2IF0A 3RKUA 4WZZA 4FNMA 5FWAA 2C84A 2AX3A 3HZRA 1FUYB 2HWWA 3BMQB 2X9QA 5BWNA 5HVNA 4N8EA 4UMEA 1MZPA 2JRCA 3HKBB 1NXTA 4GPTA 3OJXA 1IU9A 2AUTA 3TIGA 1F7VA 1U6IA 2P2DA 4R8MA 4BWYA 1ZQ9A 3R4CA 4Q9KA 4F2HA 4FFWA 1JIQA 2J0EA 2WZDA 3PFCA 3IQHX 4GX2A 1WB9A 1FLDA 1BWSA 3TUZC 1KI1A 3S2YA 2AE1A 3A6KA 4GMXA 4IKOA 5CX1B 3CX3A 3SQMA 3UUGA 2BMVA 4EKYA 2H3EA 5FPYA 2NVOA 4G0OA 3LSYA 521PA 4HX2A 3K32A 4QGFA 2ADFA 2ODPA 2QL6A 2QUZA 1ID8A 4NNJA 4YAKA 1X1EA 3VR0A 1P31A 3LVQE 1NV8A 1BXZA 1HUQA 2F8TA 1RABA 1ACLA 1C8BA 2EKZA 2GB4A 3DV9A 1H8HD 1PT9A 2P78A 2WD7B 3JSXA 4V2IA 4XTRA 1GNPA 4Y2GA 3SQNA 1Z2AA 5IT9A 4D5EA 4QE3A 5J43A 1KKMA 1OH6A 2JA1A 3W0LB 1JJ7A 5B58T 4OL9A 1CIJA 1NLFA 4IY1A 3RBAA 1M34B 4KXVA 1PQPA 1SXHA 3N2KA 1OH8A 3TCNA 3OZWA 1I2MA 3C70A 4QPNA 1V37A 3ZGYA 2WPNA 1YQUA 2GZRA 5IKEA 4M38A 4P2GA 1JEDA 1FXSA 1UBEA 4CHGA 3B1VA 5A3QA 4E94A 1T3GA 2AB0A 4BMYA 3I6YA 3VZDA 3UATA 3F96A 1C1XB 1SHJA 1YBVA 5I6DA 4FGZA 1T3HA 2XXBA 4QDZA 1GYQA 1ODJA 1SU7A 3FPSA 3F8TA 4FOPA 2C9OA 4HYYA 1E69A 1TM2A 1XTKA 5BV0A 4E70A 5CB6A 4RH3A 2Q6IA 2UZ0A 3WSVA 4TYNA 2EDAA 4UTPA 4TWJA 1KZ1A 3PP8A 3EC7A 1BE0A 3TLEA 5BR1A 2VYND 1T4CB 1R0SA 2GF2A 2XYPA 3NANA 1JH8A 2GWRA 4LJLA 4QFBA 3G5TA 1K5DA 1FA9A 4KITB 2Y6UA 1F4PA 1EGQA 3EG9A 4X6UA 2C5HA 4B8YA 2WJ6A 1QHHA 1JECA 4P3NA 5EA2A 4B47A 1TU3A 5LOVB 4MZXA 2XQJA 3D0KA 3GH3A 4B31A 2GN6A 1V8ZA 1MGOA 1JG2A 4Q12A 3DO8A 2AXPA 3F71A 3ESQA 4HMOA 4UMVA 5BR4A 3M3HA 2F90A 1SC4A 2VBGA 1FP2A 4REOA 5EXEA 4E46A 4TYQA 1ZFNA 2EIXA 1H1TA 3QMMA 5A0TA 1H9CA 4ZO6A 3OIVA 3PE3A 2ZBQA 1GPUA 1HZJA 1A2QA 1IBRA 1JPVA 2GEUA 3EYWA 4FR2A 3GPIA 2Q7OE 3TOCA 4IHQA 3ZU2A 5CD9A 1J8VA 1I7QB 3CUEF 3QEAZ 5KOJA 4GR4A 4FXPA 4A8JA 3PYMA 1VE5A 3PLRA 1ZD5A 2YDYA 1TFUA 4YP0A 1C4OA 3PQCA 2DX7A 3JQEA 3CWZA 4QQRA 5FTJA 1TD1A 5H9VA 5IYZF 4TYMA 2FDCA 1NR1A 5C1BA 3AR3A 3AEZA 4Q3AA 4C6RA 2C20A 1R4MB 2QTHA 2PKWA 5ECGC 4J1TA 4AECA 2RGDA 1AGNA 1DG3A 1RC0A 1Z4MA 5H81A 4BP9A 1RMQA 3SZMA 1B7GO 1U9IC 1XAJA 2VDOB 2GJSA 1HDYA 1CV2A 2HMSA 1B4DA 4RVCA 2X14A 4EUFA 4B3GA 2OTCA 4RPIA 2FCAA 2JIPA 1EX6A 3M5CA 3QLUC 3WYFA 2MWMA 3LVFO 1KMCA 3QUSA 1PFVA 4HF7A 5H7XA 1ND6A 3EIOA 5E0OA 1V47A 1DTEA 3LUDA 3ZHQA 3OFND 4JR0A 1G7TA 3WK5A 2X9GA 4LVOA 2VRWA 3WRWA 2ETVA 3M6FA 2I6SA 2EGHA 3C45A 1DJPA 1B26A 2QUJA 4OHRA 3OZXA 5AJZA 3ZZMA 4F7DA 4MPTA 3WYGA 4MMXB 2GCPA 4MINA 3NC4A 4OYHA 4FMDF 4IAOA 4C29A 3A05A 3OUZA 5IJ0A 1K8QA 2BGNA 2I4TA 2PY6A 2XQFA 1YE5A 2I7TA 2IIVA 4QT0A 3N2KB 1CUWA 3HEMA 2CW5A 5ALNA 2JVIA 2G5GX 3B3GA 1PJTA 3UC5A