3HCOA

Human ferrochelatase with cd and protoporphyrin ix bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA01
1QGOA 1TJNA 1C9EA 2C8JA 2AC2A 2Q3JA 4CCSA 3AQIA 3W1WA 2XVYA 2HRCA 3HCOA 1LD3A 2Q2OA 4KLAA 3M4ZA 4MK4A 2XVZA 1C1HA 2PNJA 3LYHA 2XWPA 1N0IA 2XVXA 2AC4A 4KMMA 2XWQA 2PO5A 1AK1A 2QD1A 3GOQA 4KLRA 2QD3A 2HREA 2H1VA 3HCRA 1LBQA 1L8XA 1HRKA 2QD4A 2Q2NA 4F4DA 3HCPA 2DJ5A 2H1WA 2XWSA 2HK6A 2PO7A 2JH3A 3HCNA 1DOZA 2QD5A 4KLCA 2QD2A
chains in the Genus database with same CATH superfamily
1XELA 5CNKA 3NATA 1RRKA 3QPWA 3L1IA 2IL1A 2P8JA 3H5VA 5JI3E 1OF1A 3I6YA 3O95A 4RF2A 3VJRA 2P1DA 1YFKA 1EAYA 1VI6A 2DY0A 3LT2A 3PUKA 4K9SA 5CIQA 1W35A 2B7CA 2DB3A 1L5HB 5DTIA 3QVGB 4BQQA 1T8PA 3W2TA 1WAMA 3MTQA 3QELA 3SHVA 4EB3A 4XJTA 3DA8A 1LKZA 1NU6A 3QE0A 3V3TA 3J80A 1LX7A 1WCWA 7AT1A 3QU4A 4IVQA 2YN2A 2GXAA 2I2BA 3HR8A 1YS2X 3TK1A 4IVRA 5BOSA 4IXDA 2B36A 1ZSYA 4YAIA 2IA5A 3A6DA 3BGIA 3F97A 2OFWA 3LECA 3RRYA 1JYFA 4AKSA 4M38A 2DMRA 3DDZX 1X19A 5IK2A 1LA2A 2HMWA 2CZCA 2OT3B 3QF4B 4GWLA 2R65A 1RZVA 3BWCA 4J9VA 1ML4A 2BFEB 1ENYA 4PYNA 1RRPA 1FDRA 4ZVTA 3SE0A 2H5IA 4CM9A 2ZEJA 3DPIA 3I6MA 5IT4A 1TEHA 3MLBA 1Z68A 3E4DA 3KCNA 1C3OA 3S2FA 4UNPA 3QMPA 4LPSA 4FSXA 1TZJA 3BB1A 1RYDA 4MUMA 4D4HA 3DHVA 3U6KA 2D2VA 3WVNA 5KYUA 3AL2A 3AM4A 1Z6ZA 3LDHA 4L1KA 4A8JC 3D6FA 4E30A 3JPYA 3B6KA 5IKXA 621PA 2VJPA 1BA2A 1XNGA 4IWNA 2WWHA 3C7TA 1XXHB 2QMQA 3GZ4A 1MH9A 3O90A 5ALZA 3TB6A 3TGWA 1Z39A 4FR2A 1N8KA 2Y0BA 1QCZA 2V97A 4YRAA 4CN9A 4KMRA 2NYVA 2XCTB 3WYBA 4BNIA 5K2MA 1XNQB 1M6VA 4B6RA 4QPCA 5IF3A 4TYQA 3EGVA 5ECGC 1ZYUA 4IMPA 5B3KA 2R85A 4MV1A 4ZQEA 2ARKA 2IE8A 3Q11A 3S55A 4DRXB 2OKCA 2P27A 4I0WB 2ZT6A 2QLNA 3SU8A 3ESZA 2BH2A 3THSA 1CWUA 5J2UF 3Q6MA 2UVPB 1UEIA 1OCEA 4M4SA 1FZTA 2OB1A 1GJRA 2JFPA 3W5SA 2ZSEA 3KKKA 4RFSB 3Q3EA 3N1UA 1L5OA 1N7HA 4R41A 1KE1A 2EZTA 2WD8A 1WUIS 5DN6A 4GH5A 3CVJA 1YFJA 1JVSA 2X77A 3GX1A 2QMUA 3KQNA 3URKA 1SCQA 1GVHA 3A4IA 4UQOA 3JRNA 1WB4A 3SC4A 3T9AA 3ZE9A 3MTJA 3RWOA 3BMQB 3WZMA 3GRPA 1RKXA 1TKRA 4JEIA 3MM4A 4RLHA 1HY3A 4G3XA 2XUFA 4AYTA 1N2HA 1PVDA 2GPWA 2QUJA 5TX7A 3ZK8A 2E6KA 1S96A 1KZGB 2ZYGA 4XFDA 1G8AA 3VC1A 3DDSA 1JPNA 3U3ZA 4NJMA 3TQTA 3VTKA 2PZJA 3L7OA 4PNZA 1QH8A 3UT6A 2DR3A 1NWHA 1IEVA 2GEKA 5E2IA 1X6VA 2V7GA 4QL3A 2F2TA 5I8ZA 4BWFB 3T7CA 3LG2A 5LDDC 4JL5A 1X7ZA 4R6WA 3IV7A 4HDNB 5AH0A 4ZQFA 1V0JA 4R1SA 2JCYA 3B6MA 3HJFA 1QZZA 1AKEA 1LJLA 2AYYA 2Z09A 4PQEA 3BERA 5DM4A 4D8VA 3IH5A 4CKBB 3FW1A 2AEMA 5IABA 3SBEA 3EBPA 3WNVA 4F60A 4LJ7A 3ZHBA 4RM3A 5TR9A 5IAJA 1N6RA 1XTJA 1E6LA 1QIGA 1Z18A 3E05A 4G01B 1UKVY 5L40A 3K6RA 1PFVA 2Z3VA 3BWVA 2O5VA 3LK6A 1UOPA 1F0YA 1KEEB 4HD8A 4MTLA 5FPPA 5F1YA 3TTVA 1SBYA 1JP7A 3QLJA 4YH1A 3AEKA 5A3VA 3UCEA 5JY6A 3NS7A 4XR9A 4WH0A 5IKOA 1W5BA 1SEPA 3LQQA 4L4YA 2AJBA 1GAWA 2D5BA 3KHKA 3Q98A 4LISA 3N53A 5EKUA 1VMDA 4L57A 1D1PA 1H3FA 4FDAA 4PGGA 4Q1CA 4ECAA 1B16A 3GW8A 5JVDF 5IT5A 1E1MA 2OENG 3CPHA 4KXLA 4KR0A 2ABWA 4DNXA 1HH4A 5KIAA 2PUAA 3K96A 2ODEA 3HBLA 3H1EA 3W5BA 4JI4B 3W3AA 4WEQA 4EVIA 3R3YA 5K3EA 1VJ1A 1ZM7A 1XQ9A 4FKMA 2O19A 3K4HA 1EFVA 1VGVA 3BJMA 5LJLA 1SEVA 3G7NA 3KZVA 4DKXA 1O08A 2WT8A 3BB3A 4GBGA 1N9GB 4X1OA 1N5IA 4N82A 2ZRGA 2O0MA 2D59A 2ETVA 4ZV4A 3TKYA 2GN9A 1E3WA 1K68A 2J4CA 4IOKA 1S2DA 4IOJA 2CV0A 2AB0A 1ORVA 4NV0A 1U5AA 3B82A 1X1RA 1JB1A 4NOMA 1T4MA 5AVKA 5K6AA 1PDWA 1AQ6A 2BFPA 2QZSA 1RCTE 1WU7A 1RMQA 2NPFA 1PNRA 1EFTA 1NUPA 3N2IA 3HDYA 1KE2A 3PEVA 4B33A 2C94A 1ZJ4A 3DBHB 4JXKA 3M5WA 4DL9A 4FNMA 2FDXA 3IVMA 5BWCA 4BO4A 2IIQA 4IIYA 3VV3A 3ZZTA 4B7ZA 4EYKA 4XWOA 3RWMB 3TR0A 4CMCA 4Y7DA 1XCPA 1T2FA 3ASYA 4BN5A 1E2BA 3ZTYA 4IDEA 4DYVA 2R0QC 2Z5FA 3BT7A 3G1UA 1ABFA 4R98A 5LU8A 2I3ZA 3PEUA 5GV7A 4DABA 3STWA 2OXFA 1VJGA 2H07A 1RAEA 1GDHA 3BWMA 3H7IA 3K0AB 1JTFA 4D9NA 5FJJA 1B8PA 3SYNA 4U2KA 5FR2A 1ONPA 2FDRA 4B3TB 2CFTA 1OWPA 3FKSA 5TQ2A 8LDHA 1C1DB 4ZKEA 3OP1A 3N2KB 2VYCA 3L6UA 4ZC8A 2ZSAA 3D8SA 3R6GA 2FSFA 4OSPA 2MSEB 4PFJA 2ZIWB 5HDBB 1SU8A 2FFRA 5DV9A 3RT1A 4BKOA 4ZICA 1Y3CE 1I8TA 2AN4A 5JR3A 1RKUA 1ZN8A 4FEGA 3WB1A 5J58A 1YGYA 2L2QA 3R3SA 1YS4A 2CZGA 3CCFA 2QPLA 2Y1LA 3U61B 2Q27A 4ER7A 2LWIA 2PH7A 3TBHA 1IB6A 1NU8A 4E0BA 5J4HA 1R8JA 2HUPA 3VDMA 3ZQKA 4DDVA 5JPIA 2B34A 1ID8A 2ENWA 2HA2A 1WG8A 4FMDF 1Z7BA 4C4TA 5ALDA 1XEXB 1IEWA 2PZMA 3LXMA 3BH7A 5JDIC 3RFUA 1KY3A 1XHFA 2ZVJA 4JLNA 3SJBA 1RWKA 1Z4OA 3G8YA 2G1UA 3TLGB 5H82A 3VU8A 4CUZA 4BAGA 1ICEA 2QZ9A 3IOBA 1YVEI 5TXGA 4I9GA 2GLTA 1L8LA 1V95A 3HCEA 1L9XA 3SJCA 5LZ7A 1UBSB 4MK4A 3PQ4A 4GUAA 3W1EA 3WBFA 3G8DA 5D8DA 3S40A 4FYWA 4N8SA 3CVYA 3KXPA 4MW2A 1YR2A 3AF2A 3R3JA 5KWSA 3TRDA 2Q0SA 4C04A 3V9AA 3WJ7A 4CMEC 1YJ8A 2Q0HA 4TSFA 5IHPA 1A8UA 1OFHA 3NHBA 2XTJA 5T41A 3ZV7A 2A33A 2J4DA 1K6EA 1N8NA 3EWSA 5HQ3A 4KBFA 3BTOA 3PNPA 5FBRB 4ZVQA 3T9DA 2RJ3A 3UWOA 5DU2A 3PFNA 4AY4A 5C8ZA 5ELMA 4REOA 3PIRA 3BSYA 2DBVO 3ZU3A 5JXHA 1NQWA 1X1DA 4HQ6A 4BATA 1UBCA 3LUGA 4U6SA 1CHNA 4D9CA 3MIIA 3ZHTA 2PZGA 5E6RA 1Z75A 4FBGA 2C1XA 1N4AA 3CO0S 3MPOA 1SCBA 4KDFA 1KVSA 3DMHA 4M3NA 3AHHA 3JAWA 3W90A 4DN6A 4KO8A 4ESOA 2QLBA 2CXQA 2XKBA 3GDFA 4PSDA 1KYWA 2CVHA 1ATZA 2ZDGA 3G23A 3GRAA 1T15A 4L5BA 5DHSA 1IUNA 5JFOA 4GKAA 1ZITA 2AN9A 2ZYUX 3UFBA 3LPDA 1TAQA 1LF5A 2IYRA 4EOGA 4IBOA 3LFHA 4WFIA 4XWGA 4MPJA 3UJ7A 2K6GA 1YR8A 2YHIB 1S2GA 1RD4A 1TZCA 1Q91A 3TECE 5JAMA 1HFKA 4L22A 2QSJA 2YS6A 3ZCVA 3KHTA 1H1TA 3K9NA 1FSGA 4PAOA 3TQHA 4NFLA 5H68A 3VSBA 1CDDA 1JKMA 1SBIA 4BYMA 1UBEA 2VT2A 5SY6A 1P4AA 3IA7A 1N36B 2IHBA 3IIKA 1YBAA 3LCUA 4EHFA 2AHRA 3S0JA 4ZEWA 3B53X 4A27A 1GKKA 4YUWA 2RGWA 1BXKA 4XPIA 1WQ4A 3FLBA 4RELA 1N6OA 5DKFA 3JYOA 1BFDA 2VAVA 3EEQA 4G0YA 1WXFA 4G8DA 2AKYA 2EBUA 2RKWA 1RRFA 4PXSA 5FOUA 4BYGA 5KCZA 4YI5A 2KBEA 5SYAA 4FEEA 4HJXA 5TQJA 1DXHA 1JEAA 1E9RA 2GPTA 3G3EA 4LXGA 4H08A 3AF6A 2D1QA 4IXTA 4FFBB 4YDSA 3AF4A 2FUG6 2OV8A 4XWAA 2OESA 1HE2A 1A7JA 4L50A 5G4KA 1KZ7B 5H70A 2JD0A 3R0QA 3K6SB 4YHHB 2IKSA 5D87A 2JIDA 1U28C 4R1MA 5FWNA 1RBQA 4AY6A 1FRNA 3PDUA 1ADGA 1H0RA 1VJRA 2BZ0A 3MBOA 3OFKA 3NP9A 3BMCB 2Q6TA 2PFKA 1OI2A 5G0WA 3IKVA 5THQA 2AYZA 4X0EA 1OYOA 2JVJA 5BUCA 5CLGA 2JIPA 1FNDA 1V2GA 1VYVA 4NBSA 1AGNA 1NQTA 5HIMA 2RGAA 2V9ZA 3BUSA 4H4EA 4BLUA 4G5HA 4WZBB 2FX3A 3I32A 2YS7A 1QZTA 5SZHB 2GTIA 4RY9A 2MYTA 4PW0A 3FPHA 2R97A 1JU9A 1I13A 1BN7A 1B0PA 4IG9A 4OYYA 3HCBA 5B36A 1D1QA 5CCDA 3FPLA 1KSJA 1TZKA 3DL4A 4DIFA 2H52A 1AS3A 1NBMD 2ZRBA 4OO3A 4OHVA 5JCJA 4PGMA 4CF4A 2XLBA 4JJ8A 4XI9A 1J2JA 1PZMA 1TGVA 1WSDA 1Y1SA 2ZRPA 3O47A 3MCWA 2ECKA 2IGBA 5CB4A 2XUGA 3GP3A 4H3KB 3CW9A 2LV8A 3ZHSA 1L4FA 2ZIZA 3WGQA 3TQQA 1WE2A 3AI3A 5COAA 2O7QA 4N48A 1C7JA 2MU1A 1W0CA 5JCZA 4EYQA 3I4LA 1LUAA 1P1JA 4G9GA 4LPKA 1W5FA 5J5CA 3DM5A 4OB8A 2H1RA 1SBTA 2WZQA 1E3SA 4LK2A 1KHTA 1MB2A 1E3JA 2COUA 2FQYA 2GXQA 4QFBA 1SQSA 4COOA 1BCRB 4K5QA 3ROKA 3RPEA 1MC5A 1UINA 1V7QA 4ALNA 4ZFNA 1A5SB 4EJMA 2RGCA 1N1DA 2FPSA 1O96A 3GLIA 1DXQA 2CHEA 3NTOA 2I1WA 4IWXA 1SCUA 5BUQA 5JH7B 5JT1A 2PGJA 5COQA 1PR6A 3LY8A 3BTSA 2F67A 3LAWA 3PUHA 4LQDA 1C1YA 2JIZD 4DDMA 2VWGA 4B3DA 3AUFA 3AYZB 1EPUA 3BXZA 4M36A 4XVHA 3OOHA 3UOWA 3G85A 1TUBB 1FP4B 4K7JA 5REQA 1E1CB 3FCYA 3PB3A 4ZVOA 3RI3A 2Z1MA 3DAFA 2CL5A 2IXAA 1ZVQA 2VPXA 4ACBA 5ALTA 3TUZC 1V1JA 3LL4A 4PZUA 4ZV9A 1T8YA 2F3UA 2ZB2A 4PSUA 2JAOA 1COZA 3DTVD 1A9YA 2R6DA 3HDJA 1UJ4A 2IUTA 3O4FA 5AJUA 1EWRA 1UBMS 2ZJOA 3EGCA 3NPAA 1EGMB 1UJ6A 1ORHA 3K1YA 4TMXA 4RS3A 2FFQA 2PGXA 5EZQA 3CPSA 1NP3A 1MZVA 2GN2A 5A7FA 5LVAA 3J7AC 3WB9A 3GFBA 4F45A 4FW8A 2FWBA 4ZARA 4JBHA 1X1CA 1PL7A 2WFLB 3N0TA 1QFZA 4PZAA 1E89A 1P77A 1AO0A 4NPHA 4OX9Y 3BD6A 1G5HA 3L0PA 5ICMA 2I6QA 4P3NA 3B1FA 4L3OA 4ZYUA 4LOAA 4FWTA 4QUGA 2G1JA 3L6DA 1FYXA 1KAGA 2O3SA 4GYYA 4LNAA 5HJ2A 4ZEOA 1PJZA 4O4HF 3ETGA 4HYQA 4X6UA 1Z0ZA 1JWBB 5AHXA 3V1NA 4HXYA 2XQJA 3B9QA 4F6CA 4JVMA 2JIOA 1DKNA 2Q1UA 3B3JA 2CEKA 3BMOA 1Q83A 1DUSA 3A4MA 4Q7KA 2E1PA 4YJHB 4HWGA 4D4LA 4LQLA 5IXSA 1OKKD 1W4ZA 3RIGA 3EXHB 3HRHA 1L5FA 3RTCA 2AD1A 1HM5A 2ZOSA 5TF4A 2OZPA 1R0SA 1KS9A 1UP4A 5FA8A 3VU3A 3RAJA 5KINB 1Y7LA 3GZNB 1RM4A 1WEKA 1X92A 4EG1A 5EWJB 2XODA 4Z7QB 1P9WA 3OU2A 2L18A 1GUAA 5B7PA 1UMCA 3EXIB 3L4SO 2XUHA 2O3QA 1QRUA 1X14A 2Y2UA 4RA6B 4HWRA 2QL6A 2VDKB 1A77A 3OD5A 4DA9A 4GD3Q 1UDRA 2CUKA 3JASB 4GRIA 4QHTA 4R68A 4BKUA 5IANA 2B61A 1U5BA 4IUDS 2BWJA 3AI2A 1AQNA 3CKYA 4UOQA 4ZMRA 4WLFA 2P6UA 5T4FA 1V71A 1WUJS 2BONA 4UM7A 3TQIA 3UGTA 3OE7D 1W52X 1WMDA 2PUGA 1FPMA 4MVJP 2UAGA 3PDJA 1K5PA 4AD8A 1I80A 4BXOA 4O4LB 4W82A 4M1ZA 3NT2A 4ZANA 3C4JA 3E6AA 1JHXA 4R4JA 3TZLA 3W77A 2EZUA 3DD5A 1A9QA 3G7UA 3PJDA 4IEFB 3RC1A 2K7FA 5K8UA 1WKBA 1NWCA 4V2UA 5LYYA 4RNDB 3HVRA 1U7XA 4EEXA 3THWB 2GEDA 1AY0A 1IE3A 2XE8A 1MD9A 3R7LA 4BEVA 1PKEA 4JBGA 4NOLA 3UYKA 5LIRA 1XEFA 1E5LA 1Z4MA 1HZZC 5CXXA 2BDUA 2C83A 2JGJA 3TQSA 2VZ0A 1UJ2A 2ZTMA 5ICGA 1NNEA 4JT9A 3WGNA 3QWIA 4ZCPA 4RORA 4FKZA 1FBTA 1R74A 5HKLA 2IX9A 2OV2A 1IZ9A 3EVAA 2HRQA 2W6IA 1G19A 3BZUA 4L8LA 1F5NA 5JRDS 1YNOA 3NCTA 1NPTO 1TM4E 4J2OA 4MWTA 3BQNB 4IJWA 4NAVA 3BQ9A 4WK6A 2D2FA 4YLEA 1D4ZA 4M1QA 1FP2A 3CNHA 1ZJZA 5B2EA 4DV0B 3GLIE 4OX9B 1WW3A 1KA9H 2Q99A 3H0EA 4H0CA 4PGHA 2WYVA 1CLEA 1R16A 3WGKA 3WQBA 3ZXSA 1OD6A 2EFYA 1KETA 2G67A 1QNLA 4G0PA 5A0VA 3FPFA 4EFNA 2P4EA 3MWLA 4TTQA 2BH9A 3M1LA 4HRXA 2IVZA 4K86A 3FNHA 1F6WA 2DP4E 3OZRA 1G41A 5L3QB 1UK6A 2BFDB 4QNNA 4F1WA 3CWQA 3I9KA 4CTKA 4YCMA 1H05A 1ZXXA 1S4MA 1KO1A 4FWIB 4HRYA 2LZ0A 1ECJA 5CDUA 4XWKA 1FDIA 1HC7A 1QLJA 3D8HA 2IITA 4EUFA 1ZRSA 3I53A 4DHEA 4PYOA 5JARA 3PXCX 2Y8EA 1GNLA 2MWMA 2X8AA 4DLZA 3D6AA 3ND7A 5AI0A 1P2VA 3FLEA 2GTHA 3E9QA 2QRVB 4BMNA 3K71B 2Z6AA 3U1BA 1IIBA 5C8VA 2FPKA 2G07A 3GLQA 2D1FA 3PA6A 3KHSA 1FQOA 2YZ7A 1X42A 2G4VA 2YRXA 3K5IA 4DA4A 4QC2A 4A91A 1FEZA 2VWQA 3A3KA 4HMPA 2AOXA 3HEMA 2IHYA 1UZLA 2PL3A 4IHJF 4C6SA 3JU3A 1T8SA 2C9CA 3OVMA 1VPWA 2RBEA 1OW3B 3KT6A 4DB2A 1EBUA 1MT3A 1TO1E 1AQJA 2H4ZA 5LD2C 1MO3A 1XXHE 2PS1A 4ZWNA 1UPAA 3G9UA 4QEKA 4V1CB 1CBUA 4N3NA 5I4IA 1BX0A 1P1FA 5KVQA 1SKYB 1XZEA 3FFBA 1M1XB 4MUBA 1Y5MA 1PNTA 1Y4SA 1ESNA 2FGKA 2GS9A 3O1JC 5L3ZA 1O4WA 1VFPA 2FR8A 2PTHA 3LX6A 1ZG3A 4D9FA 4ES6A 3T1VA 1O89A 3QKRA 2RGXA 3B7GA 3GB9A 1UEJA 1UZNA 4GLBA 3ZKAA 1B26A 1XCJA 1Z2AA 4DGQA 1V41E 2XT6A 3DE0X 4XJVA 4EO4A 1NW9B 5BNZA 5JWRA 3KELA 1Z0AA 3F5DA 4K87A 4TMKA 3FI9A 5D85A 2ECFA 5EQJB 5EHNA 3LY9A 3ABRB 3EZYA 3AILA 1M6HA 1U8UA 2PK3A 4N12A 2YVLA 3SYKA 1CF4A 4ZCIA 2LE0A 3DFUA 3TUIC 4GE3A 5F2EA 3R3WA 1PTKA 3RSCA 4BNYA 3DBRA 4L07A 5AIAA 3FMGA 2ACVA 4QEDA 1P18A 3L01A 3VZDA 4R54A 1W8DA 4J16A 1NXTA 1QQ6A 4HAYA 2LCQA 4MYHA 3T41A 1A8PA 5DM70 3M83A 2O2EA 4OP1A 2GVDC 3O5AA 1RTTA 3G02A 4IIBA 4KV9A 1P6UA 2Z2YA 4ND6A 2J8ZA 3OIWA 1JDTA 1ODJA 3KSMA 2DHDA 3G2LA 3WXMA 4C4OA 3EY4A 1YQGA 4J7AA 5IS2A 3PTAA 4M8NE 3BF7A 1YE5A 3QVOA 3OIGA 3PT5A 4ARZB 3C43A 4W5OA 3FPAA 1JDBB 3KU4A 5FOTA 5D1NA 1TC2A 4M9RA 2AQKA 1HFWA 4FINA 1ZAKA 3VPBA 3ZE8A 1DJPA 4B45A 1Z6XA 3QXXA 1Z17A 3PQ8A 4RVNA 4OI1A 1UKCA 1JWLA 2NSDA 1E4YA 2QRQA 3E3OA 5DBHX 4FDVA 1DRWA 2J30A 2W6QA 5A6SA 4PYKA 3VR6A 4NC9A 4N3AA 3HO1A 3AOEA 4UM9D 1FOEB 3DCNA 5KYNA 4CMGA 1NBOA 4IRUB 1PG2A 5G4LA 2XSZD 5TPZD 1PX0A 2HMVA 2V7QA 3Q85A 1BH2A 4P4LA 3MEQA 1XTTA 1UAAA 1SIBE 3L7MA 2HA7A 2PZFA 4AF6A 2C2GA 2YX1A 1LFDB 3L49A 5JZMA 3T7TA 1K1EA 3UC5A 3NHWA 1V37A 5EWMB 3DHNA 4A16A 2O20A 2VXOA 3PYMA 5FWAA 3S8EA 3C87A 3CTPA 4I6GA 1J9ZA 4YRJA 2PMFA 5HKBA 4KC0A 2HCJB 4AKIA 2XYGA 5KAMA 3AV3A 5JU6A 4G5RA 1GZ7A 5B5SA 2O57A 3SS9X 2H2AA 2NU9B 4QULA 1W75A 2PJDA 4Q9HA 5ETJA 4JITA 2X5KO 5KSPA 1L6IA 2H08A 3U1VA 5ALXA 2HRDA 1BFUA 3TNYA 4DCNA 1VRWA 4RVUA 4TRRA 3IAAA 1WPRA 2B69A 3QQPA 2OZKA 4WKNA 5DBFA 3E48A 2MHCA 3E5MA 3BEOA 3RFCA 5EVJA 4WVLA 3RE1A 1QHNA 2R11A 5GADl 2UUAB 4JFAA 4JJFA 3HBFA 1B3BA 1Y5NA 1S6YA 3TCNA 3E9RA 1CZUA 1Y8AA 1MX1A 2RMKA 1PFGA 3ZS8A 2WT9A 4U7FA 3TJZA 3SVLA 1MJNA 2VJOA 5EP2A 1PJTA 1U2DC 4HMQA 2ZRFA 4EHLA 2ZE6A 2DC1A 4L8WB 4ZZ3A 3HJTA 1O95A 1NVXQ 2F7SA 3AGPA 1NUHA 4AMBA 5ISMA 1T2UA 4B31A 2CUNA 2VDRB 4A36A 1RI2A 1BDHA 3QEBZ 2AOTA 3FTPA 3L4EA 1PFUA 4FHGA 4IG4A 3UB2A 3L93A 1G2QA 1CS0B 3CF4A 2ESRA 1EFRD 3M9LA 1UMBA 1YZNA 4LNUB 5M04A 5AO9A 2PKQO 3FVQA 5AKKA 2Q8QA 4BMDA 4JB0A 3W3AH 1U9IC 4RTQA 2QUBA 2YW2A 5D00A 2W6NA 3PGJA 5B2FA 2IV7A 4KODA 4YAGA 1RDFA 3DOOA 1V4VA 2FWJA 4BFYA 4NMXB 2GZMA 4EY7A 1QNFA 4YMIA 1E2EA 1EDOA 1KVTA 1IY8A 1JEQA 1QE5A 1VJDA 3GMSA 4O0MA 5AK5A 2O52A 3C1AA 1JFLA 2YBDA 1FUUA 1TCVA 4CFZA 4QQKA 1IC6A 1G5PA 2G83A 3KVOA 3Q6IA 1FUKA 5ALLA 3KFLA 1DKQA 1KJNA 2IDMA 4G56A 1OXVA 4JIMA 2I29A 4PNHA 1HXHA 4RD0A 5J9FA 3T5BA 4ER6A 5K3OA 1Z0IA 2CNKA 3TRHA 5GIOE 5AUOB 3F7TA 4L6CA 1QAMA 1ZGHA 2OFXA 3PE4A 4B47A 4EBFA 5AFSA 2X86A 2DT8A 4HH3C 2I03A 4BNXA 4MDFA 4WJLA 1JKIA 2EFCB 3LQYA 4JB2A 2C7BA 2EGHA 3L0ZA 2WVHA 3NAQA 1H0KA 1JWAB 1J21A 3TLAA 4R8KA 4B09A 3G0HA 4NYIQ 2WWTA 4TWZA 3AIMA 1GQOA 4HFMA 4PZYA 1L1RA 3UQYS 3WLAA 1DAMA 1U2RA 3KTOA 3KJHA 4JUAA 4EPXA 2I2AA 4CXMA 4WUTA 1DP4A 2XOEA 3ADPA 3C6ZA 4QRIA 3HWX1 2PJRA 4B6SA 1UBLS 2XKAA 8ATCA 5KDOA 2IYYA 2C78A 5K2OA 1G21A 1ZNZA 1P2UA 2GJAA 1I3LA 3BQMB 4IF6A 4JELA 1LRJA 3DZCA 3STUA 5FWXB 3EZLA 2NZXA 4DJFC 1Z6GA 2ZJ1A 3AJ9A 3IV9A 5J63A 1I7LA 5I3ZA 4AUNA 2BRUC 2WM8A 2IU4A 3NC1C 4IUBS 4NH0A 5FCDA 3WWDA 4D9IA 4Q7LA 3EFEA 3OJXA 2OK7A 5H83A 5KTTA 2ZTUA 3FUWA 3HS3A 3FWZA 3OU6A 4KRYA 4B73A 4CCWA 4IZ6A 1Y4ZA 4IDCA 1VJ0A 2BL4A 1AZTA 3VDNB 2LD4A 5BQXA 5IK2D 2H0AA 3Q8MA 2A3RA 4BY9E 3NIWA 3ZWOA 4JQCA 3X43A 1DAHA 2PUTA 1X74A 3KJEA 3KOZA 1NKSA 3UAYA 3EPHA 2JIQA 4CM9D 1G55A 5BVHB 3C3AA 3VH2A 4CIDA 1BX1A 3PFCA 3IVAA 2Y3IA 3HCRA 5D84A 2ZXEA 2JGAA 4BDSA 1V2HE 4LUCA 5I7RA 3U31A 1OTXA 1Q0QA 2J9FB 2ZSIA 3SSOA 2XF8A 1XMSA 4QDZA 4F56A 2IODA 3L4BA 2WSSA 1WTCA 4PG8A 4G0WA 4NEGA 4HDCA 4NULA 4A1FA 1E1LA 3KQKA 3SXPA 4IGIA 3LK7A 1OT5A 3N75A 5JQGA 2Z2ZA 1B00A 1KARA 1ULSA 2PY6A 4XASA 3T5GA 4LZWA 3URMA 3DKVA 4L9AA 4HDQB 2J08A 1L7QA 4FFWA 3N0WA 1V5FA 4TSRA 3DWFA 1RPTA 2XDWA 1X8KA 3I58A 1C14A 1G4AE 2PFSA 3V7NA 4DLYA 4DRZA 3I4CA 2C04A 1EXNA 1O1YA 4W1PA 4D9GA 5T57A 5DPMA 2H31A 2HWXA 1B42A 3H9QA 2A5JA 2QTAA 1P9NA 1J8QA 3NHPA 3DXFA 4E5VA 1H4SA 3CS3A 3H1AA 1U0EA 3C6YA 4IV0A 2DE0X 3Q12A 2QLLA 4KGZA 3K92A 2J5XA 5ERXA 5KQSA 4NENA 5DN6D 2P9JA 4L8VA 3RC7A 1RFLA 2A30A 4D7AA 4B35A 2BF4A 2PX8A 4KAAA 2IVFA 2A8YA 2ZSHA 3DYIA 4D98A 4FI3C 4BFTA 5KYWA 1V8BA 5AJHA 4LTMA 5CA1A 1J39A 1QYXA 2NO5A 1FLDA 5T6BA 1U3UA 3VSEA 4EB6A 1CZLA 4F5EA 1WY5A 2BE7A 2HV9A 3BXOA 3U3MA 1EFPA 3INRA 4QECA 4XIJA 2NUPA 2J0EA 1M6NA 3KT0A 4CI0B 2HJ9A 1T0BA 2EBWA 1MDBA 4HQRA 4HTFB 4UFOA 2G80A 3L7YA 4MZDA 1VIYA 1ZEJA 3V46A 2HHCA 1ECFA 4G36A 1JLKA 4M9XA 2WKSA 3PEYA 2PD3A 4F8YA 1UQTA 1R9NA 3FFTA 3H17A 1G63A 2A9FA 4D4MA 4DYDA 4R0MA 3PR1A 3RVLA 3LOPA 1T8RA 5DYIA 4CKXA 5CHEA 3SZGA 1OH5A 1IK4A 5C4MA 4P3KA 2BGJA 2C5SA 2XGSA 3WIEA 5KU1A 4WXMA 2NTYC 2YQ4A 3OZAA 5I9BA 5K0TA 1M74A 2QQEA 4X9XA 3WDMA 3SYTA 1XWIA 4XOIA 2VPIA 3MLAA 3WB0A 5E3HA 1TK2A 3EWNA 2AKEA 2OL4A 1YS6A 1FMJA 1R2QA 2SNIE 3QELB 1RYNA 2ZROA 3FA2A 4MW1A 1Q3HA 2Q4BA 1C7FA 3UZUA 1SOWA 5CVVA 1NM5A 1AJEA 4YIHA 2Y1WA 4CR6A 2X3YA 5LXTB 1WVIA 3EOZA 3PGVA 2QM3A 1FLAA 4RWZA 4PYRA 2GEVA 4W1RA 4HV4A 1LLDA 3OHSX 1IWBB 5GOZA 3N8IA 3QBTA 3VZCA 1ZOIA 1PJ8A 1VG9B 2P2ZA 3ETCA 4BEBA 3HUFA 5DNEA 2I54A 2XQIA 3W3AD 3T5PA 3E1SA 5EVCA 4RYLA 4HUTA 1RSZA 4RKFA 2GA9A 1N5OX 4U7WA 3T7EA 2F64A 2HNAA 4ZOEA 4ZAGA 5CD9A 3R4CA 3Q8WA 1CQIB 1QDEA 4RF4A 4UUOA 3BF8A 1A9XA 4DF3A 3USES 2AT1A 2AMFA 2WYOA 4ZCMA 1G9TA 1U65A 4G0UA 4HDKA 2D5CA 3S1LA 4BU0A 3CRMA 2EXXA 1N6IA 3NEJA 4R1TA 4YS6A 3TMYA 3PTLA 1L4GA 1FVHA 3AK4A 4BFSA 1UM9B 3RVPA 3HTXA 1JAXA 1R9MA 2UYYA 3DOIA 4OQQA 2PIDA 3MJTA 4C21A 1L5SA 2X0DA 1I1HA 4EP1A 5ANRB 1YU6A 1C4WA 4EG4A 3E8SA 3FVWA 4HAIA 2VTVA 2Z5VA 3WA7A 3T0GA 3V4OA 2QMYA 2C8KA 3C6BA 2D1YA 3C7CB 3DT6A 1Z88A 4P7BA 1Q77A 1HQDA 2ES4A 3AFNA 4RV4A 5TEVA 5AUNB 5B4TA 3KQHA 4EUHA 1I2DA 1BDJA 5F2OA 4GQAA 4U1RA 1XVTA 4KXVA 2VNHA 2R68A 2DJ5A 4B32A 2XGOA 4LHYA 2A0YA 5GONB 4E5NA 4OHYA 3FKSD 2BKVA 3ONEA 4UULA 3A6GA 4NBKA 3KZNA 4TOIA 1T9ZA 5BN1A 4PTZA 3ZD9A 2G06A 4DVJA 2GRUA 5IHXA 4P7KA 3RJZA 4M83A 3W8NA 1TA4A 4H7FA 2HPZA 3AJRA 4QDTA 2PS0A 5JBQA 5IBCA 4RTJA 1KSGA 2I3AA 3NHJA 1GA1A 5DNDA 6NULA 4Q4HB 4ZOCA 3G49A 1TAGA 1ZXBA 1XE3A 3K0FB 4GYJA 4LCBA 4HR7A 4QQRA 4DM3A 3PS9A 3MCVA 4V38A 1JE1A 1KKLA 2G5PA 5AUQA 3CZPA 3WLKX 5BW4A 2V9CA 3DVLA 3L8MA 1DQNA 1LS1A 3TZCA 1QPZA 4ZD6A 3C70A 4E4RA 4XQ0A 4BFWA 4MRMB 5D7NA 2X42A 4MQBA 1FXWF 5IDWA 2QJWA 1PYOA 2FOXA 2P3SA 4L0CA 3EQ7A 1YQQA 3JALB 3M6XA 5CRIA 3DV0B 3UHOA 5HYVA 3CRQA 1TX4B 1AB6A 2GFIA 2VRCA 1GQQA 4IMRA 4BQRA 1W85B 1GUYA 2NTJA 3S7TA 2IF0A 3DQPA 4N5IX 3S28A 1OR8A 1V4BA 1XDDA 2C5AA 4N40A 3IKLA 3A3OA 5AP9A 5JWHA 1CUJA 1XRPA 2J3QA 3JQ7A 4BC1A 4DMRA 4FU0A 1AKTA 3WGLA 1ZL0A 5TSDA 3D1LA 2C2ZA 3BK1A 5E3JA 2J3LA 3A9TA 5JXIA 3U37A 1E3TA 5B4UA 2ZM5A 1NBWB 2PSDA 1DDOA 5C7YA 1RC0A 1BMFA 1D04A 4TSFD 1PBTA 3VBCA 5KWJA 4JVLA 1JXMA 2PX3A 5F7JA 1NV8A 1PKXA 3ZWCA 2F1HA 4MR8A 2YBEA 3LBNA 2O48X 3QPVA 3R4VA 2Q3EA 2YKGA 4M98A 2AFIE 3ADKA 3VAZA 3VA7A 1PZHA 3CUUA 3VDXA 4CIWA 4N65A 3V4FA 1HL3A 1VSVA 2FSVC 2LUOA 2ISCA 3LW7A 3PWZA 3JVVA 1XEWX 3HDTA 4MAAA 1PWEA 1VHQA 1X70A 2AI2A 2RJOA 3FZQA 3TGLA 2XA9A 5CH3A 1R15A 4N5MA 3ANLA 3DL2A 3OZSA 4OF4A 4RAOA 5AHRA 4DLRA 3BGSA 5F5NA 1C3LA 4H6WA 1AQUA 2ZRKA 1IZZA 1GTRA 3HEBA 3TTYA 1DTSA 5BWLA 4X45A 4HPWA 1XU9A 1JEEA 3CXUA 4PVDA 4S2EA 1XN1A 3LH5A 2ZUSA 1L5QA 3KZMA 4UBJA 4DHWA 3OIUA 2WTMA 4N7RA 2B92A 5K0FA 3I2YX 2HA6A 2O3JA 3CLRC 1G5QA 3U40A 3SR3A 1F8FA 4N49A 3RC8A 1D1TA 2XI4A 3L7AA 1ZD5A 3KQQA 3H16A 1UDBA 2XB4A 1OTHA 2ZWOA 3GVPA 2YH2A 1GCAA 2CE2X 5B3JC 5JH7F 5BURA 1U0SY 3QXGA 2ASEA 1KSFX 5LMNB 2UYGA 2WWRA 1JQJC 3KTAB 3QKUA 3BKXA 3SSAA 4RACA 1OXSC 1HLFA 1L4YA 1ZA1A 3NXKA 4QU8A 2IZ5A 2X9LA 4HLQB 2G82A 2IXFA 1P9RA 3ZI4A 3ICQB 2JGNA 3B5IA 1VLMA 4KP7A 3I9NA 4WBNA 3IELA 5J4VA 4MJLA 4V0RA 4U2DA 3W4KA 3IURA 4TZTA 3MWDA 1TCAA 4Y6SA 1NJSA 4MQ4A 5IJWA 4N4AA 4CV3A 4OAOA 1W49A 4DGSA 3FJOA 4OJKA 3Q41A 1HRDA 1AGRA 1YULA 1Z74A 3EXFB 4LDQA 5ALVA 4U3JA 3RYTC 5EI5A 1ITZA 4C20A 1SKYE 1VKHA 3SPXA 2B35A 3FRJA 2JI7A 4IDHA 2AUMA 1AMUA 4REMA 2GBGA 5IVDA 3W4JA 5BXYA 5CBPB 4DBZA 1L3IA 4X91A 2CLOB 4UXJA 2DHQA 1PZEA 2FMIA 1YDWA 3JATA 3DB2A 2G88A 4OL0A 1H2RS 2F55A 5JCJD 4MPRA 4MWEA 1S3FA 4UZSA 2QD2A 4NQZA 4RADA 5J4LA 2VF5X 2W4IA 4C4RA 3E7FA 3FY4A 5AVRA 1FFSA 3DR3A 3G8CA 4OUKX 4Q34A 1CE8B 2ZYAA 3T9CA 5A2GA 1KDVA 4IQ4A 2W2XA 2Y1XA 1RE1A 1ZI9A 3RYCA 5DNUA 1K75A 1CERA 2W2OA 4L7VA 4MQLA 1R4ZA 4Y9SA 5FLXA 2P6PA 4TUYB 3G2MA 1QGUA 4Y2TA 1GSOA 1K63A 4JOSA 4C7MA 1AZWA 1OB5A 4BCBA 3L1JA 2QTCA 5CB6A 3DDOA 4ZC1A 2JNWA 2PSSA 4UAJA 3ZJUA 1EDDA 2HWYA 1CP2A 3N2GB 4WA8A 1G5RA 5JTUA 1NJ1A 1VGRA 5DCWA 4WCFA 1CRPA 2BI4A 4IICA 1OGIA 3VU9A 1EHYA 5IX8A 1C8VB 4KHPB 3LUAA 2CJWB 1VB3A 2V4ZA 3HYLA 1BTOA 1MPTA 4GT1A 1NYTA 3ZC3A 4IWYA 1XCGB 4FX5A 2GDZA 1EP1B 1L7AA 1C30B 1CY8A 3N7AA 4LV8B 2HAEA 3KKLA 1NUUA 1R50A 3IJEB 3O75A 4LSGA 4RK7A 3JAWB 4UTNA 4TXJA 2REXB 4OLFA 2X23A 2NU6A 5EUMA 1CETA 1LBSA 1XPUA 2I4RA 2XYHA 4O4LF 1GR0A 3W1VA 5D6OA 4HSEA 3DOCA 1IXSB 2FR1A 1YWGO 1OXXK 2NTNA 4F4FA 2V0CA 1J2UA 2YFYA 3GAMA 1PT5A 2G1AA 3OQHA 5AI6A 3ZDYB 1EXMA 5J47A 3QMWA 1T3GA 1FDOA 3QK7A 3I2HA 4LWOA 4NX2A 5B57C 1SBNE 5TF0A 2HT1A 2OSVA 1X7GA 1K08A 1WU8A 1ZUHA 5CH5A 2VI5A 4HB2A 1FFEA 1SXJA 5T6MA 3U4MA 2XDQB 4QSHA 3UMBA 1G5TA 1HURA 4AJKA 3U5TA 4RPHA 2O07A 1INLA 4BGDA 2YVAA 1VL0A 2OFPA 3FDZA 1OC2A 4XPIB 2QW1A 3HM2A 5FOQA 3DULA 3U7FB 1NMQA 1A8HA 2VK2A 2M98A 2XAAA 3ROPA 3A28A 2XLCA 3Q9SA 1BEUB 3ZJYA 1AA6A 3VR6H 3TCKA 4DRYA 4HDSB 2QUZA 1VIMA 4FOTA 5JSUA 1D6JA 3HM9A 2XOKA 4NECA 1ISIA 3EMBA 3Q9LA 4QU5A 5J1TB 4FILA 4JP8A 4R1NA 4RQBA 1LY1A 2CCJA 2W6CX 1KBOA 5F4ZA 4PSKA 4GI3A 3W2HA 5HRCA 1IJBA 1H85A 2XZOA 3PHGA 4D41A 3KPYA 2A7QA 4MV5A 2IHJA 3KOMA 3U39A 2WZBA 4F4UA 1X9GA 3W34A 1F7UA 4HN9A 3U49A 1H2XA 1OB2A 2BJVA 4FJ1A 5AW5A 4DMCA 4F1KA 4RV5A 3MJFA 5U4XA 3I2GA 3O8LA 1EWKA 1LRLA 2QZZA 4M0CA 2BDTA 1OZGA 2L82A 2PUDA 2Q1YA 4LZAA 3N86A 4UU0A 4EELA 3LPMA 1W36B 4WZAB 5EXDA 2VRBA 4GOLD 2FWNA 4D6YA 4OXYA 4F2GA 3NHRA 5LFAA 2P62A 1I01A 1GR1A 1K6IA 1R66A 2PH5A 2Z1NA 3LUCA 3MWGA 4LG1A 1TM1E 4X85A 3LE8A 3U7RA 4F2WA 5C3MA 3RIEA 4URVR 3DQZA 5GVSA 4KN6A 1KZYC 5CVJA 5ERGB 1C1HA 2P4HX 2I67A 2WV7A 5M34A 2VZLA 4WNCA 4N6NA 4RE6A 3OF5A 3OQ1A 4JBWA 3GBVA 3G82C 2PM8A 4GXQA 3EF3A 3FOFC 4E08A 2XOXA 1U8CB 3M5CA 1C0PA 4DMHA 2PPLA 1NN5A 3HGTA 1ZD3A 1TQ4A 4ENRA 5GINE 3RBAA 4PX2A 5BW5A 3V7FA 5FOVA 2I9KA 1ZXLA 5CMLA 2NSLA 5LP6B 1R5JA 1GL7A 4B48A 3SZRA 1SCNE 3HFJA 3NBFA 2I4IA 3QSGA 5EXEA 3WIVA 2X8WA 3RGWS 4GBJA 3CNBA 4F7DA 1J1UA 1GDDA 2WKWA 3KTDA 3LVBA 4Z1MA 2ADFA 1HYGA 1RQ2A 3E58A 4PS1A 3UJ9A 2W6ID 5I45A 5JMTA 3G2KA 5AHKA 3FBGA 1VZ3A 3ORSA 4AKHA 1Z7GA 1IPFA 4RH3A 4ZQHA 4OUDB 3EEFA 3MXOA 2BFBA 4ZOQI 5HX7A 4DBVO 5LSAA 3MMSA 3KT3A 2GN4A 3EJ6A 3OCWA 3Q72A 4MW5A 3GZTB 3KR1A 4C14A 4AQ7A 1XTUA 1QLWA 2QHXA 2CFOA 3FCXA 3RIXA 4G0XA 3WGVA 3UWMA 3M6LA 2Q3BA 2YJZA 5JS6A 3E0XA 5KPDA 1YE8A 1KQPA 3ZXYA 1RABA 2FN9A 4IXWA 1NNLA 3QNMA 2FTKE 4HH4A 1F3OA 1I7NA 2D7JA 3NHMA 1O0CA 1Z5WA 3M4JA 4G1UC 3QX8A 1GVNB 1CRWG 3GV0A 1VPTA 4F2DA 2H16A 3AIOA 1U2ZA 2A94A 2IRWA 3ESDA 3AOGA 3ZWMA 3C8HA 2GNAA 3I9MA 3MB8A 4YRKA 3S8YA 1IZ0A 1YDMA 2XIJA 1SXJE 1ZY2A 3IAM6 2FR0A 3WMFA 2ZIVB 5JNTA 3I61A 1SUDA 1O54A 2Q6OA 4F93B 4ND8B 3FCSB 4B3JA 2D2IA 2EERA 1RTKA 1MHPA 4DG5A 2PXAA 3K9CA 1CUVA 1SURA 1Z38A 3C3EA 3QVVA 4A0FA 5G02A 2BCEA 1ZDMA 3PRHA 4ZVMA 4RPJA 4KLAA 2X8LA 1E7YA 1KGSA 3EY9A 3B8EA 4EHDA 1F8XA 2O2SA 3HZOA 4AWXA 2Q1SA 3LUBA 9GPBA 2CXTA 4J7XA 3L4KA 4RSHA 2Z4TA 4YRRA 4MQ6A 1DT5A 4PO9A 4RHYA 3FPGA 3NDJA 2AZXA 1RYEA 4NONA 2HF9A 3OEWA 3T4PA 4D4KA 4JENA 1CYDA 1WXHA 4MRAA 2E55A 3DVSX 5BWMA 3JWHA 3QLVC 1XN4A 3JWIA 5IJZA 3ELBA 2PT9A 3JQDA 4NIMA 2KLHA 4Q15A 2P4UA 1SUCA 2QM7A 4OHMA 4EF5A 4PM4A 4P4SA 1RAIA 1S2NA 4G1FA 1DMSA 1VP3A 4QBHA 3RTGA 4BKRA 9ATCA 5JALA 1GTJ1 4TZ6A 3ANYB 4X20A 3WIOA 4Q93A 1P6XA 1HT0A 1WCIA 1SC3A 3J7TA 4QNRA 4ARIA 1LPSA 2QWXA 3RVSA 1M8JA 2C07A 2WAMA 4ZAYA 3DMTC 2PRIA 3PUZA 4LBYA 3WL8A 1H1LA 1MXFA 3EIXA 1AO3A 2HM7A 2QVXX 4YJGB 4KG7A 3I64A 4X6LA 4ENVA 4I5GA 5DGTA 2DH6A 1MEEA 4QYIA 2YFHA 5KX5A 3DEZA 3ZD6A 3CIOA 1LSOA 1LK0A 1VTKA 1JJAA 4BE9A 2A84A 2ONYA 2Y99A 2IX3A 2ERXA 3H1PA 4XWWA 1Z2OX 1IHYA 4Z7JA 1KAHA 1ZUNB 3HJNA 2PL9A 2JC3A 1QUEA 2IXEA 1V1RA 2MYPA 3E5RA 4OMDA 4ARBA 2IP4A 5J2TA 3FTEA 3K0CA 2PSJA 2ZJ2A 5G0SA 4EARA 2V03A 3MJEA 1L7MA 2WSMA 4MGIR 5EKSA 2E1RA 1IFXA 4LYFA 2XIQA 3A04A 4M87A 4OQYA 1W48A 3RC9A 4XJSA 3C6QA 4Z9YA 3ND9A 1I1OA 1NKVA 1HL7A 2H11A 2W0SA 3M89A 3UTCA 3PKZA 2X2PA 3ICCA 3VR6D 3DPUA 3AUAA 3GO4A 4PHHA 3IPYA 3QYFA 5GGXA 3H2GA 2ZRNA 4E4TA 1S0UA 2VTBA 3HXLA 1OWLA 2QIOA 1IQPA 4BKQA 5C2JB 2BGUA 2HDNB 1Z4LA 2V7QD 4ZIRA 1NDQA 3LUPA 2GYYA 4EJFA 2BHSA 1LF0A 2EFGA 4QKQA 1PJQA 3O74A 4J0EA 4YRNA 2HCRA 1XZAA 4FT2A 1IY0A 4CL2A 2HD4A 4DQXA 4QGBA 4ZOAA 4BAZA 1CD5A 1CJTC 1N8TA 3RLIA 3QV2A 3FYTA 2MT9A 1Z8NA 1JAHA 3GLFA 4DMGA 1RKVA 1T9CA 4W8HA 5E3IA 3SNKA 4NV3A 5BUSA 3TX6A 3SHQA 3O93A 1SU4A 4OBXA 4TN5A 5JNRA 2BR3A 5A62A 5KWVA 1U81A 3EVFA 1G6OA 1K66A 1EFDN 1TLLA 3MT0A 5ALHA 2WMYA 1C9NA 1JBKA 2Y1FA 1KO5A 2P4QA 2N42A 4TROA 3I5YA 2J09A 1GZHB 2PA0A 2W48A 2VT7A 1I4OA 3NZEA 4BUCA 1FFAA 2BJWA 3GVHA 2I4NA 3HFGA 2WWFA 3LKZA 3WWZA 4BJ6A 4BWVA 2YJGA 4I9UA 3W8RA 1COWA 1E4EA 3OF3A 2IZ1A 1Q0UA 2DEUA 1NAHA 4CCYB 2B1JA 2TRSB 5LQCA 2CL6X 5C5DA 3R24A 1DCMA 3OTQA 1U0BB 2ZQYA 3WMGA 4RVOA 2EFJA 3T06B 5EINA 1EWTA 5TQ0A 5DDIP 2A4MA 1THMA 3QOYA 4UEQA 1TJYA 2ODWA 5EUCA 3WSVA 5AW4A 3WAKA 2VF7A 1XVIA 4F3CA 4AJLA 3RIYA 4EHIA 2Z98A 1JN0A 1WDTA 1O95D 2W2TA 5J23A 2OBLA 1P45A 3AETB 3HVIA 1LSUA 2CJYA 2W22A 2GETA 3G13A 3O4IA 1U7HA 4J1NA 2WMOB 1J8DA 4RULA 2R96A 3FPKA 3L8ZA 4MPPA 4G63A 3SDZA 3H11B 3TSZA 5CD1A 3HB4X 1USGA 3CGWA 2O1EA 4HQLA 1U11A 2OXRA 3ASUA 3OIYA 1DPGA 4QASA 1DOZA 4OSOA 3H4VA 1U1GA 2B8JA 3B1ZA 2CT8A 4ZU3A 5CYOA 5FH9A 3NTUA 2JGKA 2C2YA 1QYWA 4DQ0A 5A03A 1PP4A 2A1TS 2A35A 2BP7A 1VE1A 4EENA 3FZEA 4I5FA 3TLYA 1ENPA 2Y0PA 2ZKLA 4DV7B 1ZJ6A 1QVZA 3L8YA 1FB5A 3EGXA 3SNHA 1A69A 1QYDA 4MICA 2EKZA 3GUUA 2R86A 2C3UA 2O0LA 2VJBA 2V55B 2HF2A 1GQSA 3PGLA 1RIFA 1QFMA 4X95A 4JDUA 2RAVA 2X9QA 4E5DA 5LN1A 3HB1A 3OEEA 5U1PA 3G5TA 3JAMA 3ZU6A 2PVCA 2F4NA 4JLWA 3LVFO 1LBEA 2XCRB 3V8EA 4QJIA 4FMBB 4TS4A 4B3HA 4BLRA 3CG4A 3FDJA 1O6BA 1U7OA 2IEYA 3NGLA 3O4GA 2GBFA 1D1SA 3M1AA 2I1VB 4C3UA 4YCDA 1SVOA 2UZ0A 3HI4A 2C2HA 1ECPA 3PX2A 3T8YA 2EKQA 3FWPA 4R83A 1DJNA 5IVKA 1NHGA 4HEHA 4ARCA 5A6SB 1EIWA 4IQFA 3CCCA 1BS2A 4R7ZA 3S1AA 1E58A 1UPTA 2PMDA 1UXHA 3HWRA 3E9MA 4PZ9A 5JMWA 3PXEA 2YJNA 3BE8A 2J9GA 4I1UA 3WGTA 3M6VA 5ALPA 1AZLA 2GHQA 4HF7A 1TGYA 3B7WA 1Q0TA 2PGLA 4YV1A 5BSMA 3FWHA 2ZYIA 1U9JA 4GKKB 1PJ2A 4KKXB 2G9QA 1ZIDA 2IEIA 2PKCA 5L3SA 1FJXA 4XEUA 3MJSA 5IC6A 4HPJB 3TG2A 3FPJA 4G37A 1MO6A 3HDHA 1XV5A 4QM7A 2WB4A 2ZTSA 4Q6WA 3WKDA 4RTSA 3O2NA 5AOCA 1IXYA 4JA2A 3SQXA 4FLFA 2UU9B 1QO9A 2QN6A 3B2EA 4X62B 1SHZA 3U3RA 1R0WA 4ZKDA 5ILQA 2QZPA 3N5CA 5G3ZA 3CT6A 3I83A 1ELOA 7GPBA 3NHAA 3AKZA 1DBRA 3AVPA 3JYHA 1C0LA 2JHAA 1GU1A 1SKQA 1RAAA 3BRQA 3KB1A 1CFZA 4U7DA 3GLFE 2QJFA 3OLXA 4DCMA 1MH1A 4P33A 4HNGA 3PQEA 4DCGA 3WGMA 5DCUA 4JUIA 1Q1NA 4MV6A 4Q7MB 5EJ9A 4DV6B 1WBDA 1DAEA 1J42A 1RR6A 2Q8NA 4ZVUA 1I1QB 2B37A 1KMNA 3DDNA 3EBOA 3F5QA 4CCAA 4TKZA 2RD2A 3JYQA 3LRTA 3EPJA 2Z9DA 4IOLA 2X76A 1BD3A 1S7CA 4QFCA 4IJ5A 4MVJH 3WY9A 4EL0A 2FETA 4H9GA 3WYFA 2IOFA 3HKEB 5HOEA 1GFSA 5LXTF 4D9EA 3T1YB 2WSSD 2GTPA 4INOA 2IYPA 4MI6A 3HMKA 4OAPA 1NIPA 1J8MF 4RX1A 3C6XA 1G8FA 2W71A 3ICPA 1YL7A 3TI9A 1JQAA 2NQTA 5DXAA 2H92A 4GICA 4EG7A 1JNYA 2O8CA 5GAJA 5CPBA 4I1RA 3ZVKA 3JD1A 1XDUA 2JLSA 3BC1A 3BGWA 3BRSA 3HO8A 4F04A 2QN7A 4NMLA 4B6JA 4Z53A 4E94A 4CKCA 2Q7DA 3PFKA 2VPYA 4QYMA 2IPNA 1JXQA 2DH5A 3ABSB 3ONWA 4Y9UA 3SC2A 1EUDB 5DW0A 3TKLA 1TFUA 2UVDA 3PU6A 4JLMA 4L0MA 1Q0HA 4MWOA 5SZKB 4W9NC 3FNQA 4PYQA 3ROFA 3ZWPA 4LQ4A 4OK3A 3F78A 1IHXA 3F8SA 4TV9B 4XYBA 1WMBA 2K87A 4PPYA 2PUCA 4Z3DA 4J4BA 4UNNA 4GHWA 4X1IA 4YRIA 5BVGA 2C59A 3IUEA 3QW4B 4C7XA 1PG5A 2QENA 3DFMA 3UT5A 4ZHSA 3PUVA 3ZK9A 3BJRA 2NUAB 2VPWA 3BL5A 3O2SB 3CF4G 2Q6LA 3PT9A 4GPTA 1T13A 1KYIA 6AT1A 2A0UA 3QFSA 4JT8A 2GM3A 4WZ6A 1SUIA 2VN8A 3MELA 3EZ6A 3CX4A 5DSTA 3PLNA 4AUEA 1NR5A 1YA6A 2V9PA 1JFFA 2VHTA 3ESXA 4MUIA 3M3PA 3G9XA 2C4TA 5K8CA 3GMIA 2QDXA 5GONF 3IPRA 3BS4A 2I62A 4H16A 5JHHB 2JH8A 2KM1A 4LJ9A 3WV4A 1O0SA 1TF5A 2BMVA 5DM1A 1Y3IA 3UXHA 4QODA 1THZA 2C5FA 4YAOA 5EJAA 2HW8A 3GC6A 2ZRLA 3EUWA 4UVIA 5IVHA 2E5FA 1DRUA 3AP2A 4LXYA 1C4XA 3GOQA 1CK4A 1U0GA 4PPGA 4URFA 4KPGA 3R5FA 4TLAA 1WZEA 2EW8A 4OBEA 1KZ1A 2WM3A 3O1LA 2VDVE 2RJNA 3SZOA 4OP2A 2VDMB 4U8HA 4ZO8A 1C9JA 1VE6A 3CLTD 5CW1A 4LJ4A 5FAXA 4B3BA 3GLRA 2C4MA 1G7CA 2HPVA 1UAYA 4NE9A 4QTTB 3I1FA 4B84A 2CMDA 4HFNA 3LTNC 2HTEA 3AP1A 1CUSA 4LEIA 5FXMA 5H81A 4JBIA 3VZQA 3HE3A 4GOMD 3D3EA 4TKVB 3SKVA 1GPJA 2HWUA 4PX9A 4OMFG 1R0LA 1K86A 4MS4A 1F2TB 1NSYA 2G8LA 2J87A 3PFWO 4OHOA 2HGSA 3N87A 3ZDEA 2OAQ1 1ACLA 4YQYA 3PUXA 1IOZA 1T34A 3BIXA 2AG5A 2TECE 1L4LA 4A2CA 5FUMA 3QBVA 3K05A 3NTQA 4I66A 4YAEA 3DE3X 4DY4A 5LPNA 5EIAA 1TYAE 2Y71A 4OHKA 3UO8B 2H2GA 4JXXA 5AKYA 3L0CA 3R6TA 2SKEA 4KLNA 4IUCS 3TZEA 4YY3B 5LB4A 5KO2A 1KIFA 1VHJA 2POCA 1CCWA 3GFGA 4Q3AA 1SIUA 4MKXA 3SFVA 4EQ6B 1N6LA 2M6KA 2HLNA 3C1TA 2B4TO 3L8FA 2F62A 4YYZA 1T8UA 1CUHA 3U9LA 3B6IA 3V8BA 4YCLA 2PUEA 5HHTA 1EHIA 1Y1KE 2LW7A 4R2JA 5AKJA 4AYWA 2VTDA 4HNAB 1C1XA 2WA1A 3AEUA 3AG5A 3H2YA 3O9ZA 3PNVA 4UEWA 5LOVA 2J0UB 4JXJA 2OD7A 1KI6A 1E7WA 1KEUA 1W19A 4INJA 1KKMA 3FMVA 1NRJB 2VC2B 2OILA 1K8QA 2IS2A 1GN9A 2P9ZA 1NQ5A 4POAA 4DMLA 4FDMA 1IBCA 1P7ZA 3MGBA 5EMJA 1SA0A 2G28A 3MCAA 3ZEAA 3TM5A 3E2PA 1N6KA 1QP0A 5B7QA 4M0EA 1II9A 3HA7A 4NMWA 2QX9A 4KFRA 5A4KA 2FN4A 4PLVA 3O8RA 5HIIA 4MO2A 3VPAA 3OJWA 2X0KA 3O6VA 4TQGA 1GUBA 1IN6A 2Q7OE 1M8PA 1PNVA 2R8RA 4UM8B 1A2OA 1R0XA 2YVUA 1THTA 2WFMA 4IDGA 2HMSA 3HBJA 2PMEA 1P75A 2OC4A 3H5RA 5FKJA 2OXTA 3RDPA 4M7RA 5CNIA 3BBPA 4MMZB 1QOZA 3JAKB 4X7PA 5FI1B 2JGRA 5TLSA 3ICEA 1G6KA 1IM5A 1OQAA 1A8IA 5L6LB 3B7PA 5BQOA 5K8VA 3GJQA 1XJ0A 3S2ZA 3AF0A 2CC2A 2D0PB 2NVUA 3MC1A 3FH0A 1IU9A 4MCJA 4WINA 4P22A 3C41J 4W4TA 4Z1OA 1JDSA 3A05A 4WZAE 5GWXA 1N7JA 1CUDA 5JDIA 1NVDA 5E4FA 1NMZA 5M3BA 1UXJA 4W5QA 5A4IS 1IBMB 2VRCD 1OXUA 4ZPXA 1XZMA 4JLBA 1TA9A 1TA0A 1FDTA 5EZ5A 4W7IA 1ISSA 1Z4NA 2R66A 1U9ZA 3KT8A 1M2FA 1FY2A 1WXWA 3PHHA 1HO3A 3T9BA 4B7XA 1B7GO 1NY5A 1MJFA 1IIRA 2ZBUA 4YTEA 3RH0A 3D3NA 1UUFA 3RV4A 2VL7A 3IHWA 2BBOA 2QLFA 2SHKA 3GCXA 4EKEA 4YRBA 1M2OB 2QD4A 2RAUA 3P5SA 2EIHA 2HGZA 3P0HA 4JU9A 2Q3CA 4JR0A 4L0QA 4LTDA 1G291 2YWFA 1KTVA 3HCCA 4Q12A 3PQ5A 4QQNA 4ZQBA 3UK1A 1BMFD 1DL5A 3LDUA 3F5FA 5KJ1A 3K8OE 1YKGA 2HDOA 1YZHA 1KDZA 4EAAA 1KBZA 2CHFA 4W1SA 5K8IA 4ARSA 5DCYA 1T1SA 4M7WA 1OWNA 3KALA 4C6RA 1OYWA 3L1KA 5EMHA 2EKBA 3C7DB 1HF3A 4XXHA 4N8EA 3H3JA 3RW9A 3C3JA 3KXDA 2ATVA 1EUYA 1UPFA 4O1HA 1J1ZA 1Y80A 3QU5A 3KJIA 2YMQA 2OD9A 4IL5A 4GMKA 4CDRA 1VL1A 3U7GA 4H60A 4LJLA 2HMUA 2CJPA 1QGED 1DHTA 2X0RA 3IDOA 2AF4C 1T3TA 2FHPA 2FUNB 1CVIA 2HA4A 3DZ8A 3ZZUA 5KJ6A 2OLKA 1QH9A 1YHZA 1Z3IX 2JAHA 2YW9A 4I2NA 1QS0A 4TUYF 1KAOA 4EO9A 2R5NA 3L02A 1GRRA 3BBLA 1NRWA 1ZHHA 5JD3A 2N1MA 1T1IA 3SAJA 1QE3A 1OSNA 2JCSA 4WKGA 3SEAA 2QVGA 1BDBA 1LDYA 6Q21A 4WLOA 4D43A 1F20A 1P0QA 1G3QA 2Y67A 4GI5A 4ZRDA 1T5DX 3IP5A 2X1LA 1Q57A 3OMWA 4EJSC 3U48A 2H9AA 4C0XA 1V25A 3PV0A 1U3WA 2XMSA 7REQA 3QX3A 3IQDB 4B2IA 1TL7C 4MOWA 3E9NA 4Y7CA 4BZXA 2BSQA 1SVMA 2OQVA 1FNBA 2OZEA 1I4DD 2PQ6A 4I8DA 5EXXA 2E82A 1SRQA 4RAQA 3ZDBA 1QTRA 3SSNA 4BMXA 3X1KA 1OFVA 1VDMA 2JEOA 2VH2A 2XW6A 2CCKA 3ZCQA 4WMLA 1O9HA 4XB1A 1F5SA 2IEDA 3L04A 3COSA 2PZBA 1ST3A 3I8SA 4V2IA 2EKPA 1FS6A 3ZU5A 2I71A 4ZEVA 4EWLA 1X2BA 5HJEA 3N39C 2IYTA 3RYFB 3PF8A 2B2XA 3D8RA 4FGUA 3SJUA 3OM1A 2LTAA 1K89A 3KYJB 2XXBA 1FFXA 1WMEA 1JLRA 1GNQA 3DQQA 4JJ6A 1EHCA 4MS1A 2BKXA 1U28A 3QVJA 3R3ZA 3PIIA 1BNCA 4JC5A 4XFKA 1JIUA 1Y9AA 4K6GA 5L4SA 1HNNA 1B76A 4QTYA 4MI3A 1JHMA 2RH4A 4GVLA 2PTGA 4HUQB 5E6UA 4CIYA 3LCMA 2GOYA 2PXXA 4CIXA 4Z3OA 3COWA 3OZDA 5TVKA 1F8GA 3U4QA 3PRYA 4HZGA 5AJYA 4LKRA 1G4UR 1RQLA 4FJ2A 4O4IA 5DYNA 1CNMA 2IIBA 2GHRA 1W30A 2IKQA 2WU1A 3T7RA 4DARA 4WNAA 3ZQ6A 4EDFA 3JX9A 4Z9AA 2V45A 4GS5A 4O2BA 5HUQA 3OD1A 1W46A 2FFJA 4HRVA 3KYDA 3ZDFA 4NZMA 4KJXA 3VX3A 5KYGA 1KU6A 2JHCA 1AVTA 2FMUA 4HP8A 4ZT5A 3TE7A 5AM3A 4KRFA 3FHOA 2JDID 3WLOA 3T9FA 3PTZA 3LC1O 4J1TC 4AQYB 2WABA 1M2VB 3GFRA 1UC4B 1P9OA 5HCUA 1K4MA 1SIWA 2PO5A 3W0LB 2A92A 2PCLA 3VH1A 2CVPA 2YDYA 3RUDA 2V7PA 1HDZA 3F4BA 2C4HA 3LP8A 4HAVA 4QFMA 5FUVA 3ZG6A 5BSWA 1VE7A 3N3BC 2QROA 5B1SA 4DTCA 2P78A 5KOJB 1CR6A 1B8VA 4HFRA 1E2FA 2AV6A 1WLSA 5CDHA 3ADBA 1MC1A 4GPD1 5C4GB 3UV3A 2FMFA 4UFPA 3BIJA 1ECLA 3GMDA 2PLNA 3IR5A 1I6KA 1WP4A 3G1TA 4HOYA 4U00A 5DXJA 4D8XA 3NBQA 4RTOA 3U7HB 4MW9A 3GAZA 5EKXA 3OQOA 4FE4A 3IMKA 5THKA 2P0EA 4H4DA 3MD9A 3WS7A 4D3YA 4EFKA 5G3YA 4ZK2A 1TIBA 4AJ4A 1T43A 2WG2A 2MOKA 4LHEA 4LJAA 1CUWA 1SZJG 1N5LA 2VBFA 3QVTA 4M54A 4ZI2A 3D6NB 5AW2A 4C4YA 4BRSA 4GU5A 2JFQA 4K1LA 5BSGA 3EXG1 2JLWA 4K46A 1MAVA 3D1VA 5HFAA 3WX0A 4M8KA 2Y77A 5BNIA 4N3BA 3QF7A 1G20B 5AM0A 3RS2A 5F2KA 3ZTTA 1XRLA 4LQCA 2XRYA 2YYZA 3BH6A 3DKRA 1DPFA 1PDOA 4MUJA 4BNDA 2FOLA 2GILA 3N0VA 1PEAA 1M34A 2QNRA 3NHLA 5IM5A 4OQDA 2VZ9A 4OG2A 1ZZEA 3LY7A 2ZG6A 4CL3A 4LYHA 3F7MA 4GNKA 2GGSA 3VOAA 2OSBA 1M2JA 2VCHA 1TUEA 2PS9A 2AN1A 2RGEA 3IEPA 4Q21A 3HXOA 4JGBA 2XECA 3IBYA 3Q7SA 4NJEA 5LP6F 1N78A 2OUKA 3D64A 1ORIA 1VCNA 2DBRA 2GPYA 1QIFA 1H3NA 3IEIA 4FUQA 4GNRA 4PAMA 4ARVA 4AXXA 4E11A 2QSUA 2RARA 3CX6A 3RAFC 1KI7A 1SXJD 3NV7A 4B81A 3C3YA 1WP9A 3MA0A 3MIZA 3IQXA 3PE6A 4J4HA 4KO2S 5H1YA 3RYHB 4ZCTA 1Z34A 3GEEA 2CV2A 3VDRA 1QFYA 1QRRA 2FG5A 4QDXA 5B58T 2QW8A 1L7BA 1F2VA 1NN0A 3JQEA 2J07A 3DBLA 3FJYA 4GGOA 4L4UA 5JNLA 4CU5A 4Q9IA 4C06A 5JSYA 4LC1A 3AFGA 3CUVA 1PJSA 2H4YA 5TV2A 1FNNA 1YCHA 2WOOA 3F3MA 4QJBA 1VCOA 2BSAA 2DBZA 5DWVA 1FJGB 1B93A 4YHBA 2PV7A 2XOKD 1LVGA 1T26A 2BGTA 4HWOA 2RHJA 2NO4A 3VJMA 1WPGA 3A6KA 1SU6A 1NSTA 1IN7A 4ZI7B 1PDVA 3CN9A 1PHRA 4OXRA 9LDBA 5I47A 1KAEA 2VDWB 4LJRA 3TVDA 3Q0EA 1ORWA 4X66B 4AQDA 2PWAA 3EGWA 2B1QA 4JU8A 1PGNA 4P80A 3GRRA 3ITEA 3IEKA 2UUPA 4DQVA 4JLKA 5BSEA 1QIIA 4KH1A 1TM2A 3M1YA 2PLWA 2Z58A 3G8BA 4CYMA 5DBGA 1DKPA 1E5VA 1EA5A 1E5DA 1UXIA 2BKUA 4R9RA 3CLSC 2CY0A 1MFZA 1ZIYA 3W9YA 4X24A 3LI2A 3AW9A 4C76A 5KKCA 3QUTA 3G17A 4A0QA 1ISHA 2IH5A 1KGDA 3JWEA 4G5GA 4IEIA 5B6JA 3OTOB 3PFBA 1E2QA 1NY6A 2IOFK 3MJHA 2HTFA 2E87A 4PE5B 5FT9A 1YZYA 4CVNA 2E4ZA 5HJ7A 4JKIA 4D45A 2ICAA 2IZ0A 4NYMQ 3QTTA 4YP0A 1NQVA 4QBFA 1ESDA 1GLGA 4I1OA 4U9HS 3AJAA 4DJAA 3ROZA 4KGXA 4ZYWA 3K0KA 1EE9A 4HHEA 5IDYA 3UW1A 1C3EA 4Q4JA 3H9CA 1VBKA 2OO5C 4LYGA 3FE2A 4WXPA 3E9EA 3NNDA 4U7JA 4YCAA 4DV3B 4P3PA 5IXJA 3FYUB 3F6CA 4O25A 1DNPA 4J90A 1E2GA 2QF7A 2XUDA 3HFRA 3GFPA 4LVUA 3RVMA 4WA7A 4HZUB 3KFXA 3WLNA 2QRJA 3TIFA 1QC5B 1URPA 3ZDQA 2YWRA 3LT0A 3P19A 4LA4A 4H7DA 1UXGA 4PF1A 4RVHA 4H7HA 1HZZA 2CNOA 2FWAA 2XTMA 1GNRA 3G2NA 4D44A 4E22A 3M0EA 3BJEA 3HBMA 3DO5A 4URUR 4F38A 3JXEA 3IJRA 3E7WA 1VGQA 2C5HA 3M49A 4G5YA 2D74A 2BOVA 5DF1A 1NC1A 1YC2A 4Z1MD 2D00A 2R8PA 2ZJ8A 3WGOA 3QOXA 1RMYA 2IDKA 4PN7A 5ITWA 3OY7A 4XRGA 4QU0A 3EXEA 1KMHB 2CF5A 4MJXA 4NBNA 4Y2XA 1PQUA 1TM3E 3L6EA 4URZR 1FDVA 3ZLVA 1IDOA 3S2YA 3FDFA 1QVRA 3SGLA 1O03A 4Z6KA 5KYVA 4BX3A 4QXRA 4JLVA 5IMBA 3FYDA 1L7OA 1WOYA 3TSCA 1Z4PX 4YRQA 1O7JA 4IKOA 4B44A 1R37A 1UXKA 2G4CA 2R6CA 2G70A 3NOXA 4O8CA 3VC2A 3LV8A 3VI3B 3THYA 3LBFA 4I50A 4PCVA 4V0ME 3IUQA 4PFQA 4UDOA 4MA4A 1VP9A 3EVBA 2HN9A 2OYSA 4N18A 1JJIA 3E82A 4BNHA 2EF1A 5C35A 5CFPA 2ST1A 4V03A 5JMOA 5K20A 3QVSA 3IKTA 4BWGA 4AUKA 4N0EA 5EZSA 1M33A 5TMBA 2FY8A 2OBXA 1FYVA 2F3RA 1ZNQO 1TPZA 2I34A 2JH9A 3V3KA 1X87A 1QYVA 3GN2A 2JCBA 1IVSA 3HPQA 2YN4A 4H3HB 3VPHA 4L73A 1U7TA 1AKWA 1HDYA 1JT9A 1MMFB 1V5IA 3JD4A 3P9CA 3Q40A 1C3XA 1VG0B 3QLEA 4WKBA 3ZNNA 5C5EA 5G53C 4P86A 2QBYA 1YIOA 2C5BA 2ZSDA 1K3FA 3CZAA 4M1WA 4CKEA 4IJQA 3UMYA 3NALA 4B79A 2ISQA 3KV1A 3IBGA 3I52A 1QF7A 3AESA 2D5IA 1I9CA 3KHUA 3LO8A 4M76B 3D5EA 3I01A 3CF2A 4LYAA 3DVRX 4AT1A 4OFWA 2VJMB 1G9SA 2ZRQA 5TT0A 3V4LA 3ZVNA 1GTSA 5G1PA 3LBHA 3RQIA 2BLNA 2WF8A 4YMWA 4L95C 4TKMA 1UAGA 3R6LA 4OHPA 4BX0A 1T25A 2PRJA 5AVQA 3ESBA 4ZREA 3GNQA 1Q6YA 5HMLA 3C1OA 1OVMA 1X7HA 4TXNA 1MFPA 3EFOB 4MKZA 1Q3TA 1X1EA 2R751 2OM6A 4TQ9A 4V24A 4X3PA 2BFFA 2OPHA 3VNRA 4EM6A 3D2LA 4FQ7A 4QEZA 4KYTA 4JZKA 5K0BA 2EJUA 5JQWA 3QI2A 1QANA 4K6OA 4LRWA 4YWJA 3PCXA 3V5NA 2YV2A 4BO5A 1SM4A 4R1PA 1KH3A 3UA4A 5DTQA 1EDBA 2NXJA 5FFFA 4Z4QA 4RIFA 3P9YA 3P0RA 1LBIA 1T2EA 1TTPB 3VZPA 4B83A 3RRMA 4WIAA 5A1TA 1YHNA 1XNHA 3TIXB 5A5FA 1ZIXA 2F9MA 4L5IA 4C2TA 3V8QA 5ITZA 1NHWA 3AZQA 3ZLUA 1QHFA 1U0RA 1DTWB 1Z47A 1E20A 2QRZA 2XYVA 2YJTD 4MUAA 5E1BA 3CGGA 2XT9A 3IOYA 1T2AA 4N5LA 4P5DA 1QH1A 2HQSA 2GZHA 2W58A 1XP8A 3H0CA 3ZGXA 3R1IA 1NW8A 3IR7A 4U39A 3ZNQA 4CMEA 3BDIA 1LS6A 3K1AB 3MERA 5JZBA 4UVHA 3GFQA 3HADA 4ZHQA 3U81A 4IQGA 2AN5A 3DW3X 1ISRA 5JXWA 1GFIA 1BRTA 4C08A 1T3HA 4EEKA 5HS6A 3GPDG 1EQUA 1P4SA 1UQRA 4E2FA 4F3RA 1M75A 1VHLA 5LDHA 3GQVA 1GEGA 1WO8A 1WZUA 3AHEA 4DIKA 3X44A 1KYYA 1MJGM 3AL0C 2BMAA 2J0VA 3KEMA 3PC7A 4UD2A 2LKCA 4KQEA 4JUBA 1QWOA 4ZU1X 5CBKA 6REQA 5TS2A 1E1NA 2VXYA 1LTKA 1N5MA 3GF4A 1XZBA 4BNJA 3DE2X 1IPEA 1U8TA 2ZTVA 5IZCA 3ACDA 4JQOA 4E12A 5FOXA 3FGPA 4B17A 4EATA 2NO0A 3I73A 2XBLA 2O8FA 4L4ZA 1J0BA 3WLIA 4FNGA 3GRKA 5E7MA 1EGQA 1H2YA 1V39A 4ALMA 3DUWA 3CVVA 1BKSB 1JHQA 2H1IA 3JQAA 2FUEA 4PSAA 2XRMA 4MWCA 4Q4DA 3K8YA 4LJ6A 5CAEB 3BJIC 3ZWKA 3NWJA 4MZXA 2AJDA 2BEWA 2EZ8A 1MF7A 4UFNA 1Y34E 3TB4A 1ZC3A 3MTEA 4K1XA 5FV7A 3ET4A 3UHJA 4WVFA 1XZLA 2R6FA 5IAOA 1R0YA 4O5AA 2HHLA 3RG2A 3RVNA 3E15A 4WRRA 4UAUA 4Z86A 4J1QA 1E2PA 4YAUA 5FHQA 4M22A 2B7BA 3Q7EA 4I46A 4KDRA 4DPLA 1P2DA 1COWD 1BXGB 1PJCA 3O7WA 4I08A 2E48A 1JQDA 3IT2A 3R41A 4M86A 3SQOA 3AR4A 1BZYA 2RB4A 3OJFA 5E0OA 1WF6A 3GR6A 1CUEA 1U2DA 2GESA 2BVNA 3OCXA 3F71A 3PYLA 1ZK4A 4FKBA 4J0IA 5IJAA 5FHRA 4Z4CA 1W34A 2GN6A 2J67A 2R60A 1M1NA 4PIPA 4EVSA 1BXRB 4JROA 1H2WA 1WHSB 1JHOA 5THXA 1SC1A 2JJQA 4HDAA 5EFOA 1E2JA 2V7BA 3CKLA 3ER8A 4G0OA 4Y2SA 1UJNA 2I3DA 4TKUA 2XYQA 2OMKA 3PNOA 4MI1A 4I8XA 3FDIA 1PUXA 5HRAA 1TECE 3K0SA 1D4FA 4RLSA 3Q2IA 4TVBA 5C1DA 5ICSA 2BTEA 1U9IA 3FZGA 3V4PB 3WZLA 3TYXA 2MINB 3K0EA 2E37A 4N5NA 4DSUA 2I4LA 1EGAA 3FCUB 4ZT3A 1EQ2A 1HQKA 4FOSA 5DI9A 5F3RA 2Z8ZA 2OG2A 3NANA 4EKDA 2XUKA 3IALA 1KMCA 2MSDB 1JDNA 2OC9A 3HFSA 1FP1D 3QU2A 4FR0A 2VF8A 1SHTX 3AR8A 1I4LD 1SCAA 3HQ4O 4YJFB 2IELA 2DT5A 4JJIA 4MVJI 1XL1A 3D0KA 1GPMA 3OZUA 1EE2A 1REQA 4MV3A 2F1OA 2C2KA 4YPVA 1JDUA 4R8VA 5BSHA 1G0OA 3VPDA 1E94E 3V32A 3DLIA 3OEED 2YJ6A 5TS3A 4CTOA 1CPYA 1PYGA 3A1FA 3QPBA 2GJ8A 3A9SA 2YWJA 5T64A 3AKYA 1CR2A 2PUFA 4MYTA 5IH7A 4IGFA 4YV2A 3G2PA 1BOFA 1P4JA 4HXEB 4IFEA 2BELA 4TV9F 1RS0A 2W4QA 4PYLA 1HE5A 3PR3A 5JV5A 2NQ8A 1SVSA 2HKIA 2N0SA 4TL6A 2P9BA 1WL8A 3C3XA 3E03A 1W9HA 2OZLA 3IP7A 4IM7A 4L8GA 3ESCA 4X8OA 2DPLA 5AJXA 1YL6A 1GFWA 3TI7A 3UB3A 5CFNA 1MN6A 4DR3B 3RRBA 4Y6RA 2BV3A 4QGAA 2AEEA 1R5NA 4K0RA 1PW7A 4KLZA 2VP2A 1FFDA 2ZJ5A 3G5MA 1R3DA 5HZGA 1TADA 2C99A 2AN3A 4JYBA 4QYSA 2ZYVX 3AF5A 4HL6A 2A5DA 1PWZA 4FT4A 1Z0UA 1JKXA 4K6HA 4CLOA 4CEJB 3GJTA 1P0CA 2G9UA 1N4DA 4X94A 3TQRA 4BV9A 4GXTA 3R9WA 1X7WB 2EQ5A 2DOKA 4BRZA 3GP8A 2ECQA 2JGFA 5DWQA 4QO7A 5L95A 2Z57A 3OHMA 3Q3HA 4P83A 4Q0MA 3L7DA 5B1DA 5HUHA 2C54A 4MDYA 5KWIA 1A72A 3GYBA 1GCOA 1ORDA 1YJQA 1YRHA 2GZSA 2FRDC 2O6HA 1BGVA 2Q8PA 5E0KB 3R7BA 3KZCA 3TN7A 1M73E 3EVTA 3A2NA 3NCHA 3I30X 4GFDA 5F1KA 3PLAE 2O2ZA 2VQSA 3F49S 1VYUA 4ZK6A 5IJ0A 1N0VC 3G2IA 1B14A 1KYQA 4RY8A 1MA0A 2DWUA 1LPBB 4H1VA 3KR2A 4NVRA 5DIZA 5ALRA 2X2EA 1DINA 3R5KA 4LC9A 4JNCA 1ZBDA 3A6HA 4TPKA 1GGNA 1ICIA 2ZRAA 2QP3A 1J90A 1IY2A 1Y48E 3GJ4A 4MS3B 5D86A 2VXBA 1ZN2A 4OJNA 3LWBA 3OCCA 4ND7A 4J2HA 2Z95A 3EQZA 2GI4A 1X80B 3EJWA 4JT2A 3WWEA 4GZ6A 1Q1ZA 3IEMA 1KQNA 4O3FA 1DBSA 1M2GA 2FLVA 3ODPA 4BJ3A 3QRWA 3DFKA 1R5OA 4CNBA 4UUPA 4JQYA 1GTVA 3D7NA 4L27A 1P7PA 3ZJTA 2X4IA 1WV1A 3ZVRA 5E9QA 1RMTA 4CTNA 2GKGA 1YCFA 2PZAA 5AKXA 2PHZA 5TQVA 3RR2A 4IS2A 4DLSA 1LQUA 3CPJB 4B6GA 2KS6A 2CK3A 4JQZA 1HBJA 5K3DA 2CHGA 2Y1OA 4TL7A 4MR7A 1GG5A 1XLUA 3TR6A 1P61B 2FP4A 2E4XA 3KBOA 4JLSA 1HMYA 1SBQA 5IAKA 2UXCB 2V1XA 5DE3A 3LQKA 4MV4A 1IQRA 4R9UC 2G40A 2C2XA 2I66A 5HE8A 1HT2E 1YR3A 2J9YB 2UYCA 3TLKA 2X5OA 3QVKA 1Z6QA 1JU3A 3GT4A 1G2IA 1FX0A 3C97A 4XD7A 5SY4A 4AMUA 1RZRD 2FDCA 3RSSA 1XFDA 1Z16A 1Z35A 5A5GA 2BGRA 3H9UA 4RA9A 3UHPA 3MQ2A 5T3UA 1FE8A 5C81A 4QX6A 4Q3CA 4O33A 3O4JA 5G41A 4UCWA 4FVTA 1PR9A 3Q5EA 1VOTA 5BN5A 1E69A 4QLAA 2HQ1A 3ZH9B 3AJDA 3HXTA 4KR6A 3K8ZA 3DF7A 5CP8A 4RJIA 3FKQA 5LUAA 1NF2A 2P2DA 4UHFA 2NP7A 1KJYA 1NKTA 4NH4A 5FTNA 3ITKA 4GSLA 4DPMA 1SXPA 5T5QA 4HAZA 5EY5B 4DMKA 3G59A 5EE1A 3ONFA 4Y6LA 1O95C 2GUGA 2XUPA 1J1IA 2ZAOA 1MG0A 1XEWY 1Z4QA 2ZBQA 4AJ1A 1V8PA 1FMCA 1SVIA 1RCUA 1PL0A 4GPIB 1CZHA 1O6FA 3G2OA 1E5QA 5C1IA 1U4NA 2F1JA 2VXCA 2H2HA 4LJ8A 4X1KA 1C9KA 1IZYA 3DHYA 2Q7XA 4YMGA 2GFHA 4PR0A 3REGA 1R6BX 2ZSJA 1UKYA 5EJ5A 2PBRA 4DOMA 2CLCX 4KMMA 2ZYTX 3DR5A 1KY4A 1UMDB 3CC8A 4FEAA 4WJZA 3V42A 3PXBA 2FWIA 3T99A 4C0QC 4QARA 2D62A 4UOEA 4J1SA 4MCIA 3N8HA 1TVEA 3IVCA 3WLTA 4LHWA 3DNPA 1CQZA 4Z4IA 2QG9A 4M7OA 2OGUA 4EYSA 3PDIB 2F6RA 4CMHA 2B8WA 4JEHA 2WINI 3NHZA 1DDGA 3U4CA 3KL2A 2DPYA 4WSOA 3GGCA 3ND8A 4RJTA 1NFFA 1TO2E 2NO1A 3INGA 4YT5A 4XYLA 5CA0B 4J0KA 3LUHA 5HZHA 3MJDA 2WDPA 1UDCA 1JEOA 2EOAA 3QLUC 4HQNA 1FU8A 2E4WA 4Q1EA 2C1ZA 2GN8A 4V0LA 2GBIA 3D4NA 3R3VA 1DQZA 4PC3A 1E2HA 4BO0A 3I1IA 3Q10A 5EE9A 4GC5A 1NX6A 3H9JA 3K73O 4N9QA 2X7XA 4NK5A 3K32A 3UUGA 4A8JB 1XTQA 4O8ZA 1XKQA 1G60A 2B4KA 1H2ZA 4HH1A 5KI6A 5BYAA 4BJHB 2B20A 4UTXA 2FVXA 3OZGA 4P3XA 3TOCA 1GXSA 4NU0A 3KBBA 4FGLA 5TGDA 2P9HA 2Z6VA 2IU0A 1X7XB 1ZM9A 3WZ2A 2ONZA 1LPPA 3BHIA 4OU4A 1S2MA 3ANTA 1MQAA 1XAGA 3R5JA 3ZGOA 1UJ5A 1XU4A 4PLYA 1B8OA 1KU0A 2X2OA 1KQOA 4CCSA 2FMHA 4O2RA 5IC4A 3DBOB 3AKDA 1CQXA 3GLHA 2HQOA 3H2KA 3MJRA 5CGZA 4RKYA 3TQFA 5KTYA 421PA 1ZLYA 2XXAA 2UYQA 2O06A 1NGSA 4LDRA 1GKUB 1P44A 2Y1GA 1W0JA 4Y9RA 4JIGA 1EFKA 3QWAA 5DSXA 2X5XA 1MZPA 4NE2A 4TLLB 3OWXA 4F5WA 2FPUA 4BNZA 4INPA 1PUJA 1DIOB 1ISGA 2P2GA 4CM8A 4J29A 3R3HA 4NZNA 3BIWA 3UT5B 4N1AA 1MVLA 2PQ0A 2IU6A 1Q0ZA 1X8XA 3TKAA 2BT4A 1VPLA 2JS7A 3UTDA 2YFQA 4LRQA 1H66A 5E4JA 2QXTA 5HGXA 1PLLA 1J9GA 3HGQA 3A6FA 4QTUB 3WWCA 2VR1A 4AJOA 3R9IA 2ZDHA 1N2SA 5DGIA 4N6GA 5B1YA 3GPLA 4R8MA 2N1BA 5C80A 2F48A 5K99A 1AUPA 4LY3A 1AURA 4AMGA 1DIGA 4C07A 3QTBA 1TW3A 2QT0A