3HCOA

Human ferrochelatase with cd and protoporphyrin ix bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA01
2XVZA 3GOQA 1N0IA 4KMMA 1DOZA 1QGOA 2XWQA 2HK6A 1L8XA 2H1WA 3HCRA 4KLAA 2Q3JA 2QD2A 3HCNA 2PNJA 1LBQA 2C8JA 2JH3A 2QD1A 2XVYA 2XWPA 2QD5A 4F4DA 1LD3A 1C9EA 2Q2NA 2AC4A 1AK1A 3HCOA 3LYHA 3M4ZA 1TJNA 2HRCA 2PO7A 2PO5A 4MK4A 2AC2A 2DJ5A 2H1VA 2HREA 1C1HA 2Q2OA 3HCPA 4KLRA 2QD3A 2XWSA 4KLCA 4CCSA 2QD4A 1HRKA 3W1WA 2XVXA 3AQIA
chains in the Genus database with same CATH superfamily
1NR5A 1CDZA 2J7PD 3TK1A 4CCYB 1YFZA 3D59A 3OUUA 4UBIA 3CUTA 3RF6A 5D6NA 4XYLA 5DNUA 1O6BA 3CCCA 3QEMB 5T64A 3VR4D 4GM0A 1L8AA 2LUOA 1MAAA 2BR3A 2GJAA 2PNFA 2ZP1A 3QPDA 1H9BA 2Q28A 2DQKA 3LE8A 2X7HA 1SCUA 2JA1A 1T6NA 2ATCA 1NRIA 1YCGA 2R6AA 2P90A 3OVMA 4O4JF 5H7XA 2DKOA 1WPQA 4B47A 1WABA 2BSAA 3G2MA 4PXSA 3RCBA 3V5NA 4C0JA 1EVKA 2AN1A 1MP0A 1PJ2A 1QGYA 1R4MB 3FTDA 4HEA1 4MQ5A 5J2TF 3TXXA 4RTPA 2UXDB 4M0FA 3C70A 4JP3A 1Q16A 3ELBA 5I9BA 4A23A 1GTMA 5JS2A 2VT3A 1UC4B 1DDOA 4RY8A 3ROPA 1CLEA 1Y63A 2OCYC 1T9GS 2B8NA 3W6ZA 3DEYX 3ZDZB 1P8AA 3IKVA 3PB3A 1JIVA 3F8TA 4GMHA 3A9VA 4FT4A 4TMWA 1G20E 3IKJA 5K2MA 1Q1ZA 5GY7A 1HDIA 2VVTA 3SJ7A 5IMSA 3PGJA 5IYZB 3U16A 3CVYA 4EVRA 4B7ZA 1I0LA 2VDOB 1VQ1A 2YXLA 4FNOA 2CNNA 3KKPA 4QUHA 3HYLA 4MHSA 3COJA 2EZ4A 3KE8A 2JI9A 3K31A 1B14A 1BWRA 3LPNA 3QLJA 1VCHA 3ZU2A 4YT4A 3ONWA 1N4DA 2PSSA 1EWYA 1XL0A 3H3XA 9ABPA 2VNKA 2ZTSA 4CM1A 3AP1A 2ZRFA 5EL0A 1EKXA 4TL7A 3R7SA 4DSZA 1UWLA 1S89A 3E58A 4NU6A 2RC5A 2EKQA 4Q3BA 2GVZC 2XMGA 4HT3B 1NUQA 5LYJA 5J4YA 3ZVNA 2DUJA 2P7IA 4C2UA 1Z26A 1ZIDA 2Y1XA 2N1BA 1M73E 3D3QA 3UW3A 1U7ZA 4N0MA 4DLVA 3RT9A 3ZZTA 5HP4A 5JSYA 1IOZA 2KQUA 3GP5A 1USUA 3OJLA 5AD1A 3EZLA 2BKEA 4JZKA 1CIJA 2RKOA 5ELMA 4Y2RA 4LS3A 2HRQA 3I9NA 2ZYGA 2I2XB 3UYLA 4DUGA 3LW8A 4CFZA 4L28A 2JLUA 1EEXB 2PX5A 4HADA 4LXUA 1O08A 3F3KA 1YA8A 2GESA 5D5QA 5TQJA 2PZBA 4CMCA 5THXA 2XLBA 1TF7A 2GBCA 1M6YA 1N5IA 2R2GA 3IUYA 2QTZA 4KWIA 3DNMA 5HKKD 1I1HA 2YWFA 5JVDA 4KREA 4Y1RA 3HCBA 4GX2A 1QWSA 4BNTA 1T6XA 1JG7A 4JLOA 4L8LA 4DREA 4D1YA 4I55F 5TR9A 5KTRA 1MMFB 1THGA 4K28A 1EGVB 4RACA 1JT2A 4Q9AA 3WB0A 4C43A 5IX8A 3PKJA 3CZRA 4NXNB 3R5HA 5BMOA 1JXAA 2O6LA 2I33A 3SYLA 2WD8A 4JNCA 4C4TA 2H4HA 2WWVD 1D0IA 2I8CA 1GQOA 4RK6A 2VYND 5HIAA 1ODFA 3BWEA 4WMLA 2XRFA 3CW9A 5IVDA 1ORRA 1C8KA 2J9ZB 5EZ5A 4BNIA 3NAQA 2LIVA 4CL0A 2CLIB 1Y82A 4QWWA 4MYSA 4RGVA 2PMEA 1A9OA 2Z98A 9LDTA 5A4DA 2IYSA 2VH2A 4PW0A 5ITVA 5IVPA 1BXGA 2QE7A 4GGPA 1F8GA 2PFKA 3FROA 1PYDA 5GAJA 1GKKA 3VJLA 1IUPA 1CHDA 3N5KA 3HY6A 1MH9A 2PFSA 1XTSA 4G4GA 4V39A 1WUJS 5LWQA 1CQJA 4Z0TA 5I7WA 4L15A 2LRHA 3TZBA 4TXHA 2O1WA 2VAWA 3WKAA 1KHTA 3HA2A 2OM2A 5EUCA 2H1FA 4CV1A 1S2IA 5HQ3B 4L4UA 3WAKA 4W5HA 3FWZA 2BTQA 2PY6A 1Y3AA 4BJ6A 2EJVA 1HM5A 3I6IA 5E6UA 5JCZA 2UZ0A 1U9IA 3QMWA 4QOGA 4R8MA 2ALJA 2A4MA 2OB1A 2X8JA 3VR3D 4HNHA 5JHGB 2R79A 1A2QA 2FRDA 2WT9A 721PA 1WMEA 2VPQA 3C6XA 9GPBA 2FQXA 4P22A 4AJ1A 1HL7A 3IUJA 3G59A 4RZ3A 1KGDA 3TEMA 1QGED 3LJKA 1QV7A 1R00A 2FP3A 3HN2A 4FHEA 3X2FA 2PGOA 3GNTA 1SBYA 2WNIA 2RI0A 3LUJA 4LNAA 4XARA 5DGXA 3L04A 5AOBA 4OXIA 2VOJA 2EFEB 4OP3A 5KSZA 4B7AA 2PUBA 1ADGA 3RTGA 2IA5A 2EHJA 2NZ8A 4I2VA 1ZI6A 5KVQA 3RWOA 1RWPA 3OKFA 1TEZA 3OX4A 4EF5A 5H1YA 1NP7A 3WLPA 3H5RA 2J9XB 3RREA 3KXPA 3PC3A 1QZ3A 1OU4A 4K46A 5DBFA 3PT5A 1Y8RB 5KYUB 2D0PB 1WCIB 5DGDA 4RK1A 2C4KA 1JQDA 1RJGA 3G0GA 5A0FA 3ORFA 3H87A 2ZLBA 2BRUC 4IUYA 1E2UA 4OL0A 4CNQA 3U4MA 1P5HA 1SKBA 2E4YA 3ECCA 5EY5B 1U8AA 4JI3B 2V74B 5J58A 3OA2A 4CV0A 1AURA 2B4KA 2PX0A 1Z8NA 1OWLA 1U7WA 1Z4JA 4I4TB 2H1IA 4RD1A 1P9WA 4XCQA 1TEVA 5AI6A 4FW9A 3WGUA 4E2FA 4X92A 2G4LA 2ZFUA 3OZIA 1WY5A 3SEAA 5EXSA 5JVDF 5K8CA 4B09A 1KAOA 2DWPA 1UC5B 1BMTA 2BD0A 5E0KB 1DQPA 3NDPA 5HKBA 5FBQB 1OXBB 2H2IA 2O50A 3TO5A 3T7RA 3GJ0A 4G37A 2XT6A 1C9JA 1P0IA 3EA4A 4JJGA 1GTG1 2CBZA 2G4CA 2KB0A 5EKTA 4GR9A 2F67A 3PQFA 2OGWA 3N8KA 4NFHA 4JEMA 1D2MA 1O9GA 2IKQA 4M9CA 3S70A 3THWA 1PSZA 3GJQA 3FB4A 5AM0A 1LVHA 2ZRJA 1YCDA 3CO0S 2FPSA 3LZCA 2H2AA 1R27A 1PVDA 4N1AA 3V4VB 1X1DA 4XQGA 3HM9A 2WJJA 5DLYA 2Q2WA 2NGRA 3EY4A 4LBVA 1ZN8A 4TMKA 3H99A 5CU7A 3W79A 4WEOA 1SRQA 3AL2A 4GBMA 5IXYA 1CNMA 2NZWA 3PIRA 3W6UA 4PXAA 4RCVA 1ONOA 2PSFA 2VHWA 4DKJA 1LU9A 3Q85A 4OSEA 1FX0A 3GMDA 4XGKA 3I92A 5D3QA 4AT1A 5ERGB 2WFLA 3U49A 4LBZA 2C1EA 1O58A 1K5GA 4G8CA 4CIYA 4UBMA 1G5TA 1NJ5A 2H3EA 2QX9A 3IEIA 3ZQJA 4FE7A 3HNRA 1WW2A 5LQNA 1E4VA 3I8SA 4C87A 3HA3A 4FTWA 1JDNA 1ULZA 2HA3A 5IJ0B 2A86A 3EDRA 1CRLA 2BUBA 4BO4A 5DLEA 3T3EA 2CSXA 2MOKA 1E7RA 1UM9B 4OV6B 4ZTZB 1PGNA 5GJBA 3PPXA 1XTQA 2C03A 3RVBA 1M0WA 5BV2P 1QQAA 1MT0A 5JZMA 5KU1A 4M3NA 2GKSA 1YQEA 3RODA 4PLFA 3G8DA 5K5EA 3A3YA 5IN4A 2YC4C 5KOIA 2DCMA 4MW6A 3IAM6 3ND8A 1V16B 1ZBQA 2XDQB 1FBTA 1G7CA 1IFXA 3WDSA 1TYCA 1U80A 2CUZA 3O90A 3BGOS 4IV5A 2FK8A 5TY0A 4RVNA 3GY0A 4L3VA 4ARSA 1IOWA 4EVIA 2PPLA 2H17A 5CA0B 2JI8A 1L4HA 1J22A 3UV6A 4OI2A 2OFPA 5JSZB 2P2ZA 4PHFA 3DT9A 4GQAA 1E3SA 1JHOA 1P0MA 2HUPA 3ROKA 1P4SA 4P82A 4KVAA 3A4VA 3MTDA 5LDHA 1UBJS 5KNLA 3DP9A 3VAYA 4MGKR 2OHFA 3K05A 4XTCS 1XQ1A 2QY6A 2WA2A 1VB5A 2H0QA 4KNYA 4KN9S 3JRXA 1C7IA 4XFJA 3E9EA 1NQWA 1IBRA 2OO5A 3F7TA 1CUBA 3LUPA 3EEFA 4U2KA 3L49A 2Z57A 4OL9A 4AN4A 1B15A 3KT8A 1TJPB 3ABRB 4MMZB 5K8TA 2AYYA 3COYA 3VU1A 1RJ9B 3NNSA 4IDOA 1A27A 1JKIA 1V6CA 2NZYA 3WWYA 4C20A 1ZGCA 5JNTA 4MPTA 5AKXA 3AG6A 4ILEA 4RNCA 2FDXA 3GXOA 3UWMA 4KDFA 3ESYA 5ESRA 4L0QA 1ZD2P 5CJJA 3R8XA 1U1IA 4CKYA 2VSOA 3RIXA 2G0TA 2I22A 1YIOA 4ACAA 1L7BA 1QYCA 3H1GA 4BJ1A 1QIGA 4TQUS 4B8ZA 1ODIA 2AYXA 1EXMA 5KU7A 5BSTA 4HG2A 5HCIA 2FN4A 1NNEA 2KPOA 5JRJA 4FYVA 3HBNA 3R74A 5KYGA 1W46A 2FFQA 4B35A 1OZFA 3OX2A 2EFCB 4A8PA 2SCUB 3EQ2A 3UHPA 4HNTA 4EJ2A 5D87A 4IY1A 5EUBA 1ADCA 3JSXA 1FMJA 3P9KA 4Q21A 2D1FA 3ZY2A 5JSFA 1ETHA 1X7HA 5BN5B 3EQ8A 4E2ZA 1YZQA 2C0QA 3UBMA 3EEIA 4R2KA 3Q98A 5ALGA 3D2BA 1YUMA 4F4UA 3ZOZA 5CDHA 2WWGA 5CVEA 1SXIA 2VYFA 4IM7A 2BF7A 4QRHA 5I9TA 2WT4A 4B83A 5IS2A 2WVAA 3EDQA 1R10A 1N1GA 1ZJYA 4AICA 4O8CA 2W71A 1UBUS 4XGQA 2OHJA 4X6YA 5IM4A 2IXAA 1LBEA 3L8DA 3JVUA 4LXHA 1KH1A 3I42A 2O20A 4HLDA 2WHXA 4JU8A 1NU8A 2GNAA 4ZXFA 1JEAA 1RKBA 4R83A 4QVIA 4Z3DA 4PPGA 1X7ZA 1PL8A 2IELA 4X1IA 3MJCA 3V46A 1GARA 3L6OO 1DX6A 5JH7B 1T3ZA 2ADOA 1KI4A 2QYHA 3AEKA 2YYSA 3Q12A 4EB8A 3KHKA 3PHIA 1T1SA 1NVAA 1MGOA 4RTRA 5JJKA 3M4XA 3DMTA 3G68A 2PJUA 1VYUA 1XC7A 3IJPA 2AE1A 2WSLA 4NBNA 4BUJA 3ONNA 1P6XA 3I52A 4LISA 2Z1MA 5JANA 1SZDA 1OXSC 1R6XA 4D5EA 1GADO 1DT3A 3L8EA 3N3BC 5AHKA 2JH9A 5HYVA 3SBDA 2O7QA 1NVEA 2XUPA 4QULA 5DIZA 5TPWA 5EKSA 2HCRA 1R5BA 3UJ8A 1CV2A 3ONVA 4R51A 2QAGA 3GVCA 4IOKA 2Q1WA 1VSTA 1SXHA 4E3ZA 5AM3A 1PW7A 3LC0A 4OLFA 4W7IA 1XNRB 1JSLA 1E58A 3FWKA 1WG8A 4MW2A 1M8GA 3PRKE 4KUHA 3TD2A 2FLWA 1E9FA 1G21B 3I5UA 1CLUA 1K89A 4OKIA 3FI0A 1J2JA 4URYR 2JLRA 2OBLA 3FPGA 1F14A 3CLKA 3W7VA 3KV1A 1M2WA 4J16A 2Z5LA 2ZSFA 1GRQA 1MQ8B 3DDNA 4WZBB 5AKEA 5TMEA 2OYRA 4YAFA 4EG3A 5KX5B 4NEGA 1GOTA 4MAMA 3BH6A 4F5YA 5BV7A 1T13A 1ULHA 4YP0A 5EWLA 1FNSA 2JAXA 2ORYA 5E7MA 1OH8A 1ZWLA 2AVDA 2P1ZA 1NLZA 3DAGA 1LDBA 2P3SA 1ZBDA 2D54A 1H6CA 1QHIA 1Y6FA 1LNQA 4KIUA 4S12A 1DKOA 4KFSA 1V8PA 5KJEA 4GE0A 3K0KA 4WNYA 2HYDA 3ZV4A 1GL3A 1ZCFA 4G4SO 4G85A 2Y9PB 3BSWA 1OIXA 3N6RA 3DYBA 3NU1A 1IUKA 1FFXA 1TQDA 4F04A 5KYKA 1F4VA 4LKOA 4UDXX 2R66A 3U61B 1E9CA 1XP8A 3KJGA 5HOQA 4G41A 5EPOA 1RWWA 3CLUC 4ENUA 4GOOD 5A5DA 1LK0A 3OIWA 2FEKA 3DB1A 4N5IX 4DR3B 5LB4A 1C9NA 1E7WA 1V11A 1ZUNA 3WTCA 4BGDA 2X2OA 3OQNA 4MX8A 5TQ2A 5SY9A 4IGIA 4NFSA 2HK9A 3OH8A 3KT6A 3X1DA 1C8LA 3GQBA 1B4DA 1ZI9A 2NO7A 1DAFA 1K3FA 1X70A 3AWDA 3D8SA 2NTEA 3E9CA 1QHXA 2GA9A 3LPLA 4IGEA 1HI9A 5HCNA 4CM8A 3ZE1B 2YNMD 1F4PA 1JGTA 4IEEA 4C9BA 1EXDA 2VSFA 5EJ8A 3F5SA 4Z8YA 3OPVA 3KQSA 1Q14A 3QE3A 2YW2A 2V6BA 4QJ5A 3TNYA 4J0CA 3JRWA 1NBMD 3U7IA 2O7NA 1WDWB 3ZX4A 3GJ5A 1NQ5A 2JI7A 3RT7A 4DLSA 4Q6BA 4HVLA 2DPGA 3EC1A 4HDSA 4CQMA 3ZIDA 1USWA 5FV4A 3HS3A 3AI3A 2PS1A 4B7CA 4Y6PA 4J2OA 2ID8A 5D2CA 1V71A 2XW6A 4IINA 4ZRNA 1M2OB 5C9ZA 3D6FA 5KNCD 4GKAA 5LXTA 4L9WA 4K6KA 4F6LA 1Q3TA 2D2XA 3I4CA 1ADFA 3O73A 3QFCA 3OQ1A 2ONKA 1R6TA 4ZHQF 1EINA 5TEVA 1UWCA 3RYFB 1ESCA 1BX0A 3UHAA 4CF5A 1E63A 3AYZB 3DMHA 3NKLA 3OC0A 3L0SA 1JVSA 4KMMA 3L0IB 4FOLA 5BVHA 4GPIB 2P6RA 4BY9E 4GKKB 1OT3A 2IUFA 3IJRA 3LUAA 3A6PC 4RQAA 3BMNB 1QUEA 1W19A 4M99A 1FFBA 3T5CA 3CIOA 1ZISA 2R84A 3TMKA 3BCRA 2ZITA 1H4VB 3LKZA 3CYFA 2PZKA 3NANA 4H6XA 1GGNA 4LRYA 2PA3A 4UHBA 4D3DA 2LPMA 4XEUA 1TADA 4EFNA 5FOSA 1TJ4A 3K6SA 1DGQA 3CGGA 1P4HA 2QL7A 4TQGA 3CNOA 1V41E 1QH0A 3L6EA 3NDRA 3NGMA 4UZSA 4R3UC 1FU8A 2QG9A 3PE3A 4FILA 2ZYHA 4WK0B 4BO0A 3FY4A 4RU1A 1TMOA 1CRZA 1C0IA 1QGUA 3K5HA 1VBKA 3AF5A 4JL5A 3TTVA 3BZUA 4NL4H 2DLCX 3G9XA 4W5WA 2F8MA 1ORIA 3R76A 2VHVA 4RMJA 4AS2A 4MHOA 4ZANA 4BRWA 2A9FA 2R8XA 3W9YA 3NEPX 1T34A 2YN0A 2P6PA 4Q1VA 1DC8A 2DKNA 1T8TA 3WBJA 4K6FA 4UEKA 2LBPA 4D41A 4HDNA 4XIFA 3ANNA 5F23A 1OKKD 1RBMA 1SCNE 2IGBA 2R1TB 4GMGA 3K0EA 3TW8A 3V55A 4D8WA 4EPVA 3BOSA 1OR8A 2HGSA 2Q07A 4CMGA 5C7YA 4C7JA 3SS9X 5LP1A 3GQVA 3L1HA 2A59A 5DM0A 4ZYWA 2RGDA 3PUYA 4CIVA 3B1WA 3ICPA 4AMUA 4CDGA 4Q37A 4H08A 3JWJA 1OLOA 1XQXA 4K6MA 1ZGHA 4ZKEA 5KUTA 2CFSA 3QLEA 3NIBA 4MQUA 1QG2A 1J6UA 5J4LA 3G7NA 4HLUC 3VC3A 4DCGA 2UZ4A 2PS0A 1YIDA 2F1KA 2QB5A 4X91A 3FPSA 4AECA 4FEYA 4XSVA 3B1KA 4Q3CA 4RSGA 3JYQA 3NBZC 2E5WA 4RIGA 2FFJA 3WYFA 4YMGA 3KETA 2HLNA 2PUTA 3ZDAA 4EY7A 1DWPA 1NN3A 3QJGA 3UUEA 3F6SA 1H6AA 5J2UB 1DOHA 2ZB2A 3AF4A 4KPFC 1SELA 4PCLA 1DCMA 2J5QA 3RW9A 1B7GO 1YDHA 2GERA 2GUWA 1KZ6A 1FK8A 1C5KA 3AK4A 4IFIA 1VC2A 1X7XB 2B30A 2GF2A 4EB6B 1HL3A 1A4UA 4B7UA 4YV1A 1SU6A 1CVLA 1A76A 3GGDA 4ZI7B 1L0BA 1U9JA 1CJUC 3TX6A 3VH1A 4IFEA 4EW3A 3COWA 2R96A 4LQDA 3TCXB 3ZK7A 7MHTA 4PICA 5BPFA 3B1JA 2HF2A 3URMA 4BGEA 5AW2A 1JJ7A 2W8ZA 4JUCA 1KI6B 4CLOA 5M5BA 1DCKA 4WZAA 5BSFA 4M89A 4GHWA 4KO1S 4R40A 1KQNA 3SZGA 4V03A 2WPNA 1NF8A 3OTWA 2HJ9A 2FLVA 1EQUA 3ZV3A 3B60A 1T6ZA 1E2PA 2Z30A 2WWWA 3EAGA 1E5LA 4KFRA 1RZ3A 4QG3A 3IL2A 4KFCA 4HVCA 4IUDS 1GPNA 2GD2A 3U6BA 1C1XB 3Q3CA 2HDOA 3W4JA 4L74A 3Q4GA 3NWOA 2XMBA 2Y6UA 4NCHA 2ZBUA 5FPKA 1LY1A 5KNDH 1XZPA 3WKEA 5DXAA 2B8WA 8ADHA 3GJXC 1KJYA 4GLLA 4Z4IA 1XXHB 4ZQFA 5KWEA 1PS9A 1SIWA 3WO0A 2DETA 4RIFA 1F3LA 2XD4A 3H5IA 3ZHXA 1Z18A 4UNRA 2BN4A 5L4LA 2AB0A 4G1FA 2Q6IA 4R1UA 1EE2A 1I9CA 1NV8A 1UC8A 5E8JA 1XMJA 1TTQB 1U65A 1W25A 3DBRA 4P3PA 4YGXB 3SHFA 4B76A 2HADA 1E9DA 3GK3A 1PF7E 1YDFA 1SC4A 2ROQA 3LBNA 1SCQA 2GHQA 1ULTA 4XUEA 4F9GA 4RTNA 2I7TA 1M34B 2Q5LA 2R1UA 3IX7A 4QE3A 1SPBS 4Q4AB 1QF6A 4LE1A 1ST2A 1D2NA 3V9PA 4YBRA 1MBZA 2AZTA 4G5SA 3HRKA 4RQTA 3RLIA 5JAUA 4R1NA 2GK7A 5KBYA 1T1RA 2LDXA 1LTKA 3K0HA 3SZUA 5A2GA 1C7ZA 1X7YA 2Z43A 4ITVA 5J2TB 1AKMA 1NXVA 1XRPA 4YXWA 5TVKA 3WYBA 2BONA 2Y1WA 5LZ8A 4AJJA 1YKFA 5ICMA 1WSBA 4R1TA 2XUGA 4L5AA 4DJ5X 1ZLXA 3JQGA 4X94A 1KFBB 2B5OA 4O4LF 4EHAA 1QHEA 2LNDA 1TU3A 1E79A 2DY1A 3N7UA 2VP3A 4A1FA 1EE1A 1Q6YA 3LUBA 4DARA 2H92A 2NSJA 5KKCA 1L7RA 2Q5OA 1B1AA 3PUWA 1K8RA 3IMFA 1HZZC 5MN6A 4BS9A 3TRDA 1ZC4A 3CMMA 3P2JA 2WSSA 3D4PA 3ILVA 1XZGA 5T6MA 3D02A 3OMXA 1UDWA 1FLAA 3AFHA 5TQ0B 1QBKC 2CZCA 1ZH6A 1KR2A 4D46A 1I51A 3E3AA 4N3BA 5EE3A 4YHBA 5EESA 2LR0A 4L08A 5DMHA 5FI3A 1TVEA 1WL8A 3HXMA 2VQ3A 3BE6A 2M6SA 1BGWA 3OQIA 2CXSA 3T4EA 3VBEA 3VHXB 5LQJA 1DHTA 4MV7A 1T35A 3MTJA 4JI0B 3V9AA 1H3NA 1II8A 2AOXA 1GL9B 4YHHB 3GLFA 1UBGA 3R6LA 2ZTLA 3OMWA 3KZKA 2ZSHA 4RAOA 3IHWA 1QFSA 1VE5A 1KPHA 4EB3A 4P34A 4QU9A 3L9WA 2BVNA 2XGJA 1XMOB 3AZPA 1UEXC 2WAYA 3DO5A 4Q3KA 4AJLA 4X44A 4FC7A 1EK6A 3H16A 3OQ6A 3HKDA 4KQ1A 3SYMA 2WV7A 4D6YA 5KREA 5FYQA 5E2BA 1UBCA 1E4EB 2DPHA 1XPJA 2IHZA 4BAUA 4H3VA 1PLLA 5IUJC 3GMSA 4E21A 2XNDD 4EBBA 4A0RA 4I55B 1HFEL 1OU0A 4CM7A 2W2XA 1EK5A 4D8UA 1IG3A 3K9LA 4WNIA 1GXSA 3QEBZ 1GGVA 4E46A 1P1IA 4Z4FA 3V7FA 4EFKA 1NAHA 4HY3A 1R4ZA 1VLZA 1WP9A 1LKZA 1UQRA 1YS1X 1SU7A 2ZROA 2A5DA 3BAZA 3KJQA 4H59A 2NU8A 2KWIA 4ZOEA 3DZFA 4BZXA 1TCAA 1SCUB 1Y1PA 2X4DA 5BV0A 4ZAYA 1R8YA 3PFCA 3VU0A 1C1HA 3RIMA 3CUWA 5C35A 3WRYA 4AMZA 1UT6A 1FUIA 4I9HA 4J3NA 3QLTA 4ZOQI 5JFTA 3HDVA 4W9NC 2YV1A 2IOHA 5K0JA 3H86A 1E7SA 2EP7A 4V0RA 1KYWA 1BQ4A 1XJ0A 3WWDA 4FNAA 1G20A 3TW6A 3TL6A 5G0SA 2H11A 4XD7D 3CX3A 1XZDA 4DJEC 4S0XA 2QVYX 1Q1GA 1CDDA 3ODGA 4YAJA 4ZRMA 5F1OA 3USES 3I61A 3FHOA 4ZMBA 1Z16A 5FLEX 2NV6A 1P9LA 4LSGA 3T52A 1IWPB 4UFPA 3QU4A 1YE5A 1KZ1A 5AR1A 3WX0A 1MV5A 3EZXA 2VHCA 2R7LA 5DXJA 5FO1A 4YAGA 5F4ZA 4BLRA 4FM9A 4QTXA 4AX4A 5BMVA 4YRIA 4DR2B 4GU5A 1OVGA 4XRRA 5KCMA 4BQNA 4HNGA 1QIJA 4RJ2A 3WFJA 3X1WA 2J5BA 4TV9A 4OHXA 2ZXUA 2F55A 2P8SA 3BTVA 1L1QA 2XZPA 1Z39A 2BHNA 5C4IA 1RQPA 3AV3A 1JXOA 3C1AA 4JVNA 4UQOA 1SCDA 4UBJA 4WRRA 3IIIA 5CW2A 2O8VA 3TZEA 8AT1A 4ZOLA 1VE6A 1R8JA 2CYBA 4KACA 5LYJB 3K70C 3QIVA 4TL9A 5ALYA 3ZS8A 4BX0A 4BKQA 4IMIB 4QYMA 1DUIA 5JAQA 3QXJA 3W5IA 1J99A 5IVIA 3WGVA 3PQ4A 3FYHA 5JCJD 3RFTA 3SNKA 3WGOA 3LOUA 4TRMA 5TB5A 4M0KA 5ENZA 4ZJZA 10MHA 4TTRA 4JR2A 1H22A 4DCOA 3MQ4A 3DG9A 3R0XA 1UBRS 1GVNB 5HIIA 3TLAA 3SYTA 1R8SA 1XZMA 2IXBA 4DZTA 1UANA 1E6MA 4B43A 3ZHSA 2V7UA 4PZZA 3H1TA 1FSSA 4Y9UA 4G2TA 5B53A 2BJWA 1GCOA 4MOWA 3W2IA 3B5IA 1I1QB 3KPYA 4MRAA 2DFLA 2P9FA 3HN6A 3GUUA 1U04A 3M5PA 1E0KA 1Z74A 4JOSA 3ZY5A 4EA7A 3SX4A 1NURA 1YZLA 2VNJA 1ECJA 4BQQA 5JVDB 2EHDA 1P4GA 4Y1RB 2LD4A 2Q3FA 4G0NA 3PQ8A 2X8WA 1TX4B 1QQTA 1E9RA 4OBEA 4CF6A 3E9NA 2IZ5A 5TS2A 3IA7A 2C98A 2G82A 1P2GA 2YMQA 3OZFA 3VX3A 1VI6A 3L7OA 3MPOA 4KO4S 2EWWA 2W83A 1YTLA 4PO8A 4HLNA 5AXCA 3CRW1 1BHQ1 2IS6A 4AKGA 2FN9A 1HT0A 5E3JA 2LZ0A 2V5UA 1RKUA 1DLJA 3AVXA 1B0ZA 4Y6RA 3A8TA 4XCVA 5DM60 4K7JA 1YA6A 4ID3A 1JHZA 3DW1X 2EG5A 3E7DA 4AI6A 1BXGB 5LQCA 1OXXK 3G79A 1S9HA 1PJRA 3HMQA 2Y92A 4EGSA 3QSGA 3HDHA 1VL5A 3MPUA 4LC9A 3RRBA 1ZM3A 4FN5A 1PN3A 1ZW6A 3D8RA 1C9MA 3K96A 1V26A 3H5VA 5JBIA 1MIOA 3C3CA 1CQJB 3RK4A 3DTYA 3ANYB 4NZZA 3K92A 2IXTA 4C3OB 3PDIA 3Q5EA 1R6AA 1V3UA 4KQIA 3ZH9B 3E9ZA 3UKJA 3MOIA 3EC7A 3QG5A 4MPRA 4RVSA 3AI1A 2CLKB 3HXPA 2FWPA 2JIBA 5AW9A 2BTQB 3KUKA 3SJCA 3UF0A 5AM2A 1TFRA 2J6HA 4MWOA 1JEJA 4BAZA 3HU3A 3O91A 3PHCA 5E6UB 2BBWA 1DNPA 3GRKA 3U4QA 5JAPA 5E2AA 4EG0A 1GAEO 1AG9A 1K88A 2J4CA 3KTOA 3BK1A 5BMVF 1EDOA 2X8JB 3CLTD 4F8EA 4NDZA 3OJ0A 2XMSA 3UUGA 2IYAA 2EJTA 5LU9A 3S5UA 2OECA 2OV2A 3TJMA 5JZBA 3LA6A 5B5SA 1LI5A 1XAIA 3LYAA 1FFEA 3O8BA 4Y0NA 4F4DA 1XN4A 5C80A 2JIQA 1P3Y1 2REOA 2WPDD 4L8FA 3TTTA 1LPBB 2BTOA 1ABFA 5B1DA 1IBSA 4FOPA 4BZZA 1B8UA 2AQKA 2Y66A 4U63A 3ML1A 2AHOA 1BRTA 1EJ6A 2IHYA 1DSSG 1FBNA 2DBQA 4L8YA 4BLUA 5J4HA 3F67A 4PO9A 1N3LA 2GZMA 3GX1A 2B69A 4CU2A 2AG8A 1KTIA 2KLBA 1LNSA 1EZZA 2FAXA 4P36A 2AGVA 2C78A 3OCVA 3O6VA 3LS2A 4I1OA 4KKXB 1IM2A 1JS1X 4N9WA 2R1ZA 4WKOA 2VPZA 4LDNA 5G1PA 3VYTB 1PR1A 2Z2ZA 4RVDA 2ZXEA 3VYSB 4U2EA 1N33B 2NTNA 1T8WA 3ESDA 1X9GA 4WN9A 3D7MA 3BFPA 3JATA 3T1NA 1NR7A 1T6BY 5FLXA 3II6X 4WDRA 3KDSE 4N49A 3IUBA 3N5CA 4JNKA 5DWQA 5CBPA 3STWA 1KO1A 1JJFA 1YOBA 1L4BA 2Z09A 3THYB 5AVOA 1H23A 1KJWA 4HGRA 1IQRA 5H68A 1DBPA 1ISIA 1EJBA 2EQ5A 2CW5A 2ZYTX 3EZYA 2VL7A 4IJ5A 4M0PA 4UNSA 4DTIA 1ITZA 3CINA 4ZVSA 5JMTA 5CYFA 1K06A 2BIFA 5CG1A 2FDRA 4Q47A 3T34A 1T43A 2QLMA 1DDGA 3S29A 4KBGA 1G8AA 1MPXA 1IVYA 5SYAA 2HTFA 1OHHD 1BMFD 1JV2B 1RQ2A 3BHJA 3E8XA 4MYRA 5DTEA 4ZAZA 3THWB 1G64A 2DQSA 3W9UA 2J09A 1GNSA 5A5EA 5EPUA 2XT0A 3LPMA 1W93A 3X1MA 2R2AA 4YQYA 5F1KA 3PQDA 3SMVA 4BMXA 2ZUCA 3DCNA 2NT3A 2Q3MA 3QNUA 1M2EA 2FX3A 3IXLA 4HBGA 2MMCA 2CJYA 1QQ6A 4X95A 3VYRB 5F73A 3JQFA 4I8DA 5FUXA 2H4ZA 2ZIXA 4XFDA 1II9A 3BAFA 1KYYA 4QRDA 2FK7A 4MEAA 1ZVKA 4W5QA 2XNHA 3TQOA 1FX0B 3TL3A 1RI1A 4KR6A 2WFLB 1T9HA 2BKXA 2J6IA 2UVQA 4TTJA 2QYOA 4H3HB 2VDLB 5B1SA 1N6RA 1DWUA 3DWEX 4A0SA 4POAA 2D7DA 2WRZA 1IB0A 4FFOA 1KH2A 3RWMB 1Z6YA 1MRSA 4JODA 4LYGA 1K5HA 3DEHA 3ETNA 3RVQA 5C8YA 4DG8A 4F9EA 3P52A 4MKRA 3OBBA 5UKDA 2W00A 2JHGA 1EWQA 4AY2A 4XR4A 4HEJA 4AN1A 3PA8A 5BN4A 4DV4B 3U60B 3DFIA 2DBRA 3DLAA 3K9WA 4Q3OA 2VPWA 1KF0A 2V7WA 1E1KA 2GEBA 3D9QX 4M1MA 3K2QA 2IIVA 2NV2B 2VJMA 3WK7A 2PUHA 1SN7A 1FNCA 2O9JA 3CUYA 4YH1A 1XFAA 2QTLA 4V0NA 4D56A 4UOZA 5GMOA 3B82A 4G5XA 4LF8B 3TVDA 2W6ZA 1B6SA 1YULA 2IV7A 1VXOA 3CEPB 4PV7A 1PEYA 4UVGA 4CZ2A 1EZ4A 4IIJA 4JSTA 1OW3B 1GILA 1Q7GA 4Q4JA 3RYCA 3GEHA 2JGAA 3QLVC 5ALRA 5F35A 3S2SA 2FN8A 2QW1A 1OYVA 1XQ9A 2FPGA 2W2LA 4RHUA 4HZIA 3KUDA 3VR5A 2YWHA 3GAAA 2QV0A 2GDJA 3H4TA 4LSZA 5DWVA 4Y2HA 5DEIA 2PQ0A 3FG9A 2RGXA 3W04A 2DQYA 5ICSA 1UUFA 3KR9A 5BWNA 2FUKA 3LVRE 2BEWA 5K0SA 3ABOB 5I7OA 3LXMA 1P2BA 2JD2A 3LQKA 3DEJA 4MRNA 3IEXA 4TV8F 3FGNA 5F1PA 4TTVA 2JAPA 1XRMA 2IOQA 1AS2A 4U2FA 4UM5A 4W1PA 2BFNA 2HPVA 5CB4A 3N2LA 4D79A 4U2CA 2JATA 5BRJA 3WGIA 4DDTA 2P0EA 3RVPA 1OWOA 3R9KA 1JFSA 1SQFA 2ETXA 3FGZA 3GV0A 1LTQA 4LYDA 1ZMOA 1JBEA 1W0JA 3BE5A 1XTVA 4KYTA 3RS7A 5BW8A 1XTPA 3QHPA 2HPHA 3KQQA 4JYMA 4TWRA 3CURA 2O0HA 1PYGA 2F8LA 4PGGA 2X2FA 1XJQA 2ZVDA 4UHKA 2G88A 2A1TR 2J9RA 2JHCA 3H6HA 4HNRA 4LKRA 4ZO8A 5L6LB 3EBPA 3I0ZA 1HQCA 4FFWA 1XZHA 2CV0A 1RHJA 2WILA 3OSUA 3SC2A 2C5LA 3MBKA 1NVMB 2H1RA 2EW2A 1UOPA 4RSMA 5EJ6A 4G56A 3UH0A 4B4VA 3CLRD 3NJ4A 3TL2A 2D06A 1EJ2A 1IG0A 2REQA 2DE0X 5J59A 3UA3A 2QM7A 1EK1A 3KSUA 4BQPA 4ZCTA 2XADA 4DT1A 1BDIA 3UB2A 1KXJA 2ZQ5A 1PR0A 4PE5B 3BERA 3PITA 5BSUA 5EJ7A 1EE9A 5FH9A 5I4CA 4FKZA 2JPDA 4NBLA 1M0SA 2GEKA 3NVMB 2AWOA 1C81A 3R9WA 2I62A 2IH5A 3IHLA 2WQ7A 1EUCA 1TO6A 4NTZA 4YQEA 3FLAA 2I0FA 4BNZA 5C8YF 2HMYB 5KKAA 4REOA 5CVTA 1O95C 3A37A 1W76A 5C81A 5AK4A 1VL1A 3BKXA 5ECGC 3WO1A 2VQ6A 1WJGA 1TT7A 4WA8A 3TUJC 5LP6F 1GYQA 4KUEA 4KPEC 1XEAA 1T0IA 2QU7A 4J7CA 1G5IA 1RMYA 4M21A 4E2YA 1X7ZB 4OLAA 4X1IB 2ZB3A 5JTTA 4LNUA 1H66A 4CM9D 3AEKB 3AM3A 1YD7A 4INJA 1EGQA 4CL8A 4K5QA 1SCAA 3HWRA 5BSHA 3AVPA 1QWOA 1YUNA 4WXMA 3CN9A 1N0WA 3A1EA 6REQA 1CUJA 4RPGA 2G1PA 1CUCA 3VTFA 2Q6OA 3RRYA 4HGQA 3PUVA 3R5FA 3B6MA 5K09A 1WCXA 5KQRA 3QXGA 1U2SA 4QDXA 4IIJF 2H1HA 3F73A 3ZN2A 2JFQA 1G5RA 1PL0A 3ISTA 3IT3A 4WKPA 2OT3B 3OMLA 5DNWA 5TPWB 1I4WA 5K99A 2QAGB 2XXBA 1J0XO 1M1ZA 2PUVA 2WU1A 2RG1A 1MX5A 4B73A 4XWKA 1D4ZA 4QXQA 1ISHA 4TXNA 2BWJA 3JZDA 1MO5A 2EFHB 3HYSA 3MAGA 4BKPA 2BMWA 2VHYA 4OXRA 2Q0HA 4L07A 4X41A 2O8BA 1ZN2A 2B1GA 1K98A 2B0CA 2O54A 3ZJ5A 2G77B 4H7DA 2WC1A 1S9DA 3GLIE 4OXXA 1VGRA 3GT3A 4RA6A 3PGXA 3RBZA 3OOWA 3C5EA 2D2IA 4ZARA 1E4YA 1TRKA 4L2IA 4G6ZA 3OSZA 3I6QA 5EYPA 1G0NA 1OROA 2HI0A 3WFZA 1E69A 1FDVA 2DWCA 4FFLA 5CB4F 1AQYA 2UZIR 2JEYA 1JF8A 5EWLB 4DMFA 3CVWA 1FE8A 3GBPA 4YUWA 1V0JA 4ZQGA 3AFMA 3S1SA 2A84A 4QTTB 1N5LA 5K2OA 3S68A 4BVEA 1DFGA 1E9EA 1PNOA 3DOEA 1X8XA 4HGOA 1NTRA 2PMDA 3GDFA 3UM9A 3OD1A 4MA4A 1O2DA 5IC5A 3ZV7A 3TFQA 4IQ8A 4JLWA 4PCAA 5EUQB 4F11A 3QUCA 3DHWC 2VN8A 3MB8A 4MV0A 5FBWB 1UJCA 1FFXB 3TJRA 4MGEA 3ZXIA 3BWDD 1J5XA 5CXUA 2X8LA 1M54A 1R9NA 2FE1A 2JK1A 5A7FA 3HL4A 2QD3A 1VRWA 3PPYA 4DUZB 4RXUA 1WUKS 1XMIA 1VSUA 2C5FA 5B58T 1V11B 1ZUNB 2HNBA 1IN6A 1ODJA 1U8FO 1D2AA 2MR5A 2GUGA 4BZWA 3W7BA 3P9SA 5LUAA 1QHHA 1AHNA 5TQ2B 3U1VA 3ZI0A 1ZKMA 2DULA 1YDGA 2J85A 1L4YA 3GQBB 2ZT8A 2QMQA 2QR2A 4RETA 3G82C 3MUNA 1A5BB 2FXVA 2QMEA 4LUCA 4CM8B 4PTYA 3RG8A 2G80A 1DAMA 4F4IA 3G8BA 5DBHX 4Z7QB 2PGJA 2P4UA 2FYTA 2V7QA 3IMKA 3CO5A 1A2BA 4YCLA 2A1UA 4EUKA 2BCEA 1CY8A 2ZU6A 1ZXLA 3DLIA 4K9LA 1SM4A 1LX7A 1YR8A 3FMOB 2VTDA 3IOBA 4HDSB 3QKIA 5F9FA 2FRXA 5JDIC 2B1JA 5KJ6A 4XIIA 4EO7A 2WTUA 1UZAA 2A0KA 4KK4A 4DW8A 3A05A 2OHHA 2HO5A 5LXTB 3OTHA 1GCIA 1GQRA 4N5MA 4JFRA 2EX4A 3RRNA 3WSWA 3DC2A 1PWXA 3OM0A 4B3JA 1HO3A 4GF5A 1D2GA 4NOLA 4N5HX 2R0QC 3N74A 1PLJA 2NNLD 4HXEB 3LTEA 5LQDA 5BVHB 1D6JA 1T2FA 2YVLA 1BQEA 1DAKA 3DJFA 1ZL2A 4AP9A 3DM9B 2DFKB 3PNSA 3TGWA 2QL6A 4RYDA 3ZDCA 2O2IA 3HJCA 3SKVA 1VIMA 4O2AF 4Q01A 1MNQA 4M0CA 4RS4A 3W3AD 3AKDA 3EUFA 4FDUA 4C6RA 5PGMA 2QENA 3HMKA 2CXXA 3OKCA 4WOCA 4RJKA 1XCMA 3K6SB 2VDNB 4HFNA 4GI7A 3PEVA 2P3QA 1NBEA 2BHRA 1GUDA 3WGYA 1O87A 5LBIA 3ZWMA 4CKCA 1QS0A 4Z51A 1IXRC 4NOKA 4IEFB 5DYGA 3AP3A 4U2BA 4PX9A 5IBCA 4PWYA 1NUAA 4IZIA 3E2PA 1IBMB 3MUFA 1QGUB 3G3EA 2I67A 4N3GA 1REQA 4AXBA 1TD9A 1QG6A 4ZREA 3VVMA 5C8DA 3E9QA 1ZU5A 2XCIA 4QUBA 1II0A 2BFOA 2AKYA 2GZAA 3BQ9A 4G2NA 4TSFD 4YLEA 3AB8A 4DCPA 3T5AA 2XNJA 4FOTA 5BWMA 3QI7A 2NLOA 1CNEA 1MGPA 1GZUA 3PHGA 1EVLA 4Q15A 1PWYE 1EFVA 2ZRNA 4CIWA 4Z7NB 3IAUA 4HDNB 4B6PA 5B37A 3CX6A 2QUHA 4KLCA 4YA6A 5C31A 1KAMA 3I62A 2RBGA 3TW8B 2FX2A 3QWAA 2BKLA 1LWNA 1ZUWA 3OQVA 2H3HA 4FB5A 3KZCA 1VIDA 4HQFA 1MA0A 3UYKA 1L5LA 3LC2O 2O5EA 1NQUA 2Q9AA 1F7VA 2FHPA 1S02A 4LPKA 2HC9A 1NVVR 2NQ2C 2Z3VA 1TW3A 5F2KA 3C6ZA 4OUDA 4ZVRA 4LWQA 5ALFA 2GN6A 1LZKA 1M3SA 3GGJA 3ORYA 2JGEA 4V38A 4CYMA 1QDUA 2HSGA 2GXUA 3AOGA 2ID9A 3H2SA 3BCHA 4MV5A 4IH1A 2V97A 5C1DA 2AZMA 2DU8A 5AW4A 3V00A 3IMEA 4B2YA 4IIYA 3BCUA 5EXPA 4CCSA 2HSJA 3L0ZA 1KZYC 4TTQA 4UAGA 3UOWA 4UDYX 1ZZEA 3RVLA 2QWXA 4H18A 4GPAA 3QMPA 3I2HA 5B7GA 1NE7A 4CM3A 3WQSB 2R48A 2R6JA 1ZS9A 1J56A 5AUPB 3NUZA 5A6VA 5AVWA 1M2GA 1CUUA 4J6EA 1LV7A 4JKYA 5AXDA 3GZNA 3E1GA 4IIEA 4OQDA 2EFJA 1AGYA 3FBTA 1XZCA 4HDMA 3OFNA 3ZGLA 4OJMX 4DA7A 1A8PA 1WLSA 1MG5A 2WU8A 2JJ1A 3CUSA 5MF6A 4B74A 3QOYA 2CF6A 5CA1A 1PGOA 3KYJB 3U7GA 1MB9A 3ICQB 3AYXB 3JTEA 1BMQA 3KT3A 1MQ9A 4WZAB 3WHLA 1RYZA 1OBOA 4DCUA 2I4TA 1GTVA 3OAAD 2GD1O 3O8LA 4H27A 3D1LA 3EMDA 3T3DA 4MVXA 1QIFA 3MQ2A 1YU6A 2HNAA 1OF1A 4FJ2A 2QTCA 4NMWA 4AQ7A 4FZVA 4XLTA 1VMIA 2F9MA 3BTOA 2DR0A 1KDVA 3FJ1A 3U48A 5ALEA 1WXWA 4CR8A 5K3AA 5E6RA 3BMCA 4JI4B 3LP8A 1Y7HA 1CJKC 3LGXA 1XLUA 4JY7A 3SWWA 1NUSA 2Y0CA 2QP3A 2RD2A 5HA5A 4QVKA 4TLDA 3T3MB 3PGKA 4OHMA 4BRZA 3ZDBA 2WJAA 1DX4A 5AJWA 4DAEA 3Q9SA 1ABBA 4PG5A 1T4MA 4WVLA 3BRCA 3DEFA 1DE0A 3BIOA 4MTLA 1H2WA 4ZCSA 4CQMB 3D6AA 1P2SA 3DBRB 3NIDB 1E2KA 4GSLA 1SUWA 3NOQA 1CJVC 1YJ5A 3QTBA 4ZEXA 4XVQA 4DWVA 2OORC 4ESEA 1ABEA 3FUVA 2ZS9A 3IILA 3PD7A 4DWOA 5A6SA 3T9DA 3VDXA 5A3JA 2OAQ1 2OPBA 3JQAD 1QTRA 4HN4B 4DCJA 4EF4A 2FMHA 5KWVA 3MBOA 3H2IA 3IIEA 3W78A 4KWCA 4A36A 2B7CA 1RZRD 4HZGA 1XTIA 4LDAA 3RBXA 5KQPA 2FZEA 3OPQA 2OK7A 2Y77A 1X7YB 2HCFA 4JJZA 3R9IA 3GA5A 5F51A 1C3EA 4TZ0A 1DRWA 1ICIA 2NIPA 4L57A 4EYGA 1MT3A 1RSZA 3KQOA 1YR7A 3ZY4A 4OFWA 1DKUA 4D25A 2OCGA 1K66A 3SGLA 2BGJA 4PZLA 3VO9A 2NZVG 1OFUA 2H52A 3JQGB 4KJZA 3RQIA 2Q4BA 1NXTA 3DWGA 3RHFA 1E59A 1TCUA 3CSUA 3ZWBA 1EFCA 1ZYUA 3LUDA 3W3ZB 4DR1B 3HDYA 5BSGA 2Q9BA 3ZR4B 2NUBA 2YVKA 5JT1A 1UBMS 4I2NA 3EUEA 4IZ6A 5F2OA 2EKPA 3C16C 4FHFA 3ORRA 4QTYA 1VYHA 2AZ4A 1SC1A 3IA2A 3OWHA 3KEMA 1NBAA 2IXFA 2O3SA 3ZHRA 1RM5A 4F60A 1DKPA 1V9CA 4P08A 4TMVA 1FRVA 4B2IA 3UWKA 3WY9A 1NYLA 3LWNA 1LK5A 1VMKA 1HMPA 2FUNB 1W88A 1J2EA 3GP3A 3WBKA 4ARVA 3HBMA 4EAAA 5CA1F 4WA7A 1PG0A 4BQOA 4NZOA 1SUBA 2PKXA 1DADA 1EK0A 1EGAA 2A3NA 2J67A 4MAAA 3TLXA 3OQIB 4DIMA 1COZA 1KI9A 1CHNA 2WZQA 4EW1A 1JKMA 221PA 4IS2A 3U31A 3T7TA 5HS6A 2ZSDA 4CQLA 4DPKA 1II8B 4NG5A 1OREA 2WK1A 1J0EA 3H18A 4FR0A 4D9IA 5H59A 1XVVA 3GLFB 3CIFA 1ISJA 2AR7A 3RDPA 4BP8A 2BGWA 3V8VA 1XT6A 1WUHS 1XUOA 3BWMA 3EXFA 2JLYA 1E8NA 1ZDMA 4U7PB 4XB6B 5FWDA 1QCCA 1K8XB 3GUZA 3L4BA 1YRQA 4IJQA 4B3IA 4PVDA 4NS1A 3VKWA 5BYKA 3QG1A 3HKDB 1RQXA 4B3GA 5IH3A 1NQXA 1Z0IA 3ABZA 3EWNA 5K8VA 4TXMA 4I81A 2PKQO 5B3AA 1MHTA 4CLRB 2C4NA 1NYTA 2ZYIA 3WHKA 3ZQ4A 4MW9A 5BR4A 5ERYA 1QVRA 1WQ3A 3KEOA 3AM1A 2W6JD 1JYSA 1CCWA 1GXSB 1WCYA 2ZT5A 1M67A 2NU7B 4ZO4A 2Q1XA 1IY2A 1X8JA 3BIXA 5CP8A 5AQEA 1P44A 1GA4A 2YUTA 2NU8B 1YOVA 2ILTA 3WAJA 4R9VA 4XD2A 1YR9A 1F2TA 1Q1BA 2FRVA 3GN1A 1EX7A 1QVWA 1XVLA 2XI4A 4K6OA 1D2RA 4LRUA 4Y30A 3QPAA 5DI9A 2CF5A 3DGEC 1M6NA 3LL4A 3WGMA 5L45A 2VZEA 1U0BB 5A4MS 4INAA 2BMFA 2QX6A 1E2LA 2PYIA 2DECA 2XVZA 1KIMA 5JJIA 3HA7A 2IDMA 4XVCA 4BFZA 1TAQA 1TKAA 4CWAA 2WZCA 1A71A 2I7DA 1AQ6A 3BN3A 4IILA 4C78A 1G20B 3JVVA 2GYUA 2WJIA 2QSYA 2GNOA 3NNNA 4JLBA 2FEPA 4BB5A 4EARA 1T9AA 5EWJA 5C7IO 4MJLA 4LG1A 4MKHA 3EULA 1ZI8A 1L7DA 2ZJ5A 2BEVA 1YHNA 2QTMA 4QPDA 2APJA 3BL8A 1LLCA 1IXKA 2FETA 1Q7EA 1FDIA 4R2WA 5CCXA 4MEBA 1D09A 2PUFA 4M7OA 4DNFA 2VIIA 3TZLA 1ZR4A 4CIDA 2QKYA 4P7BA 3DLTA 3PHHA 3OCZA 1GWNA 4DIDA 2ABWA 4GP6A 1FQJA 3O1IC 4QSMA 3TZ6A 5BMVB 2O3QA 3PCRB 2R8EA 4ERNA 4A2QA 1A69A 1P18A 4QT0A 2NVBA 3OY7A 3CRVA 2Q0XA 4TV9B 3AVYA 4QNRA 2EP8A 3B1ZA 1YZNA 1V7ZA 1E7QA 4TPKA 2W90A 1ZINA 3QVWA 4UFNA 4ZOLB 1YNSA 3JQBC 3UK7A 2OMEA 3BHIA 5FL7D 2G1UA 1JLMA 4Y7DA 3WLMA 4ZP1A 3OLCX 1Q0RA 1IXSB 2CVPA 1KMNA 3F5DA 4FFDA 4CCWA 5E0OA 1VLHA 3L77A 2RGRA 3PPIA 2B9VA 2AXPA 3OT5A 4PGHA 4QATA 4AZWA 5IWAB 1ORWA 4AJOA 1EUQA 1W2WB 4LDQA 4W4TA 3D0OA 3JYLA 2CNOA 3D2LA 3OQBA 3UMFA 2ZATA 4KEAA 4B4UA 4B8YA 1DX9A 4MPPA 4MTCA 1QYWA 2VT2A 4LYJA 2VTBA 3HZRA 4BFYA 2IX3A 1A77A 2P2YA 1QH9A 4YMSA 1ZM7A 2D59A 5IANA 5AVRA 8MHTA 1ZNZA 4Q3NA 1Y9JA 2AHRA 4DNXA 1Z29A 4NHOA 4TSRA 1JEQA 2AWNA 3FNEA 4BLSA 1AO0A 1HLGA 2H0RA 2CLCX 2E3JA 2PGAA 2X1HA 1TL7C 3NV9A 1XYVA 1F9AA 1JQ5A 3BBLA 3ETEA 1WO8A 2FHSA 4AU1A 2J5XA 5FBZA 3ETJA 3UWOA 1K92A 4DFDA 1PAUA 5DHAA 5CVJA 4NZYA 3BFJA 1JJIA 5FAKA 1UWVA 2C9CA 3T4UA 3WLQA 2PBRA 2CZGA 1CTQA 2XYHA 2ZBPA 5CD9A 3UFBA 3RANA 3SZ3A 3H2KA 4K87A 4U7WA 4B2LA 2VRCD 1YJ8A 1XDZA 2JHAA 3HI4A 5HF5A 4PVCA 4DILA 2E5LB 1LD3A 1UZLA 2ISCA 1J5PA 3CZ9A 5FOVA 5AUOB 3PIIA 3FPJA 4II3A 4B9EA 5F12A 4HQ0A 4JS0A 3Q3GE 3TR5A 2NOAA 1IE3A 1MIOB 2L82A 3DMRA 3IPRA 4GO1A 4DPLA 3C8MA 1XZKA 3AO0B 2Z9CA 3PDIB 4KXWA 4DBZA 4EOGA 1LLQA 1JL3A 3HEBA 4I5DA 4HRVA 1AJEA 2VSYA 4D02A 4FXPA 3HH8A 3GFBA 5BSRA 3EJWA 4EG7A 5K0NA 4TMXA 5BUQA 3SJBA 5BUZA 1YZGA 2AOWA 8ATCA 3U4QB 2JKYA 5E3HA 1BQ3A 4UATA 1L4MA 1XVUA 4CNBA 2NSYA 2AG5A 3DOIA 2PUEA 3AERA 2JEZA 2EDAA 3HZOA 5LOVA 3BJRA 4EO9A 2D5LA 2D5BA 1WETA 4FP9A 4WZ6A 2VK4A 3SYKA 4YIHA 3QELA 5AKGA 1UKVY 2H54A 3EPRA 3LQFA 2FCAA 2P41A 3NH9A 2CMKA 4RH1A 4Z8XA 5HEKA 2RHTA 1SBCA 2IZZA 1XA0A 2XA2A 4UTPA 2FDCA 1Q7RA 1T2UA 1IY9A 1WP4A 2V7GA 2ZIFA 4KC0A 4PZEA 3OF2A 4RESA 5K03A 1W5EA 2R25B 4YJ3A 1KO7A 3VYVA 1GCGA 1HNNA 2WA1A 2J3LA 4L3OA 2FKNA 4RJLA 2OA0A 3UC9A 3L4SO 3M6FA 1HGXA 2WKRA 1YDEA 4R8SA 4AJKA 1QR6A 4OHOA 5AKZA 2AXQA 1TZ2A 3O0DA 5MN4A 4B34A 2JZOA 2A9QA 1T36A 2Q99A 2VJAA 4G5OA 4HQ6A 2I71A 3AIKA 3T1YB 2XEDA 2Z3WA 3DCYA 4Y1FA 3WGTA 5CDUA 1MOZA 4S1WA 4E1AA 1SJ9A 1EFPA 4WN9B 1CBUA 2QBYA 4JELA 3JATB 3EMVA 3I9V1 4G67A 4HEA6 5CMLA 4G1EB 1PR3A 5JBQA 5K4HA 1XN1A 3MGGA 5AXBA 5HMMA 5KMGA 1NV9A 2H18A 3L1KA 4I1UA 5CBPB 3FKSD 4C21A 3WMGA 1N1DA 1YGYA 3QA9A 2RONA 3D64A 4KQ9A 1H8HA 1NFRA 2FPIA 1LBTA 2W4MA 3QBJA 4ON9A 3USZA 5C1BA 1THTA 2A9KA 3OG9A 3Q3VA 1GLVA 1M6WA 2CNWD 1KJQA 2UYGA 1CUYA 1P80A 2G7ZA 3QUQA 2WWHA 1ZRSA 3NHKA 2WIGA 2ZU0C 4RV4A 1CUAA 2H2DA 4NH4A 5FIUA 5KNBA 3OTIA 3IEKA 3NDBB 1H2EA 3IUMA 4N4AA 3LLMA 1QJ4A 1CDOA 5EE0A 5H5JA 1HX7A 5IDYA 1GL7A 1S1MA 3P9PA 5CJPA 4BXOA 1IZZA 4TKVA 1Q95A 4M83A 1XRSB 5LZ7A 2YFHA 1F0YA 2ZYUX 1C8BA 3IAEA 3L7BA 3A3KA 1KYXA 3EGWA 4HB0A 4JLKA 2WB4A 1N2GA 3PSAA 4LV5B 1Q77A 1ZXXA 3H3FA 3IQFA 4U00A 4BN4A 2ODQA 3X1ZA 5LMZA 5BQFA 3VOTA 4WD3A 3VO1A 2EOAA 2DUUA 3OT4A 6NULA 1JFVA 3B48A 1RKVA 5TQVA 1LPOA 2GN9A 5TJ9A 3CLSC 4ZEWA 2BM0A 2PH3A 2W93A 3UGKA 3NX4A 2ZTHA 4C0HA 4WJZA 2ZIXB 4ETIA 4EUNA 1UDXA 3ZGNA 4EYKA 3HB7A 3KZOA 1UBSB 4TTIA 2WIAA 2IP1A 2BSQA 2AMYA 3JQCA 4LF9B 3VHLB 4RM3A 4UM8B 3O3MB 4CR6A 4IKOA 2QLLA 3HRIA 3WK4A 2JD1A 4HXFB 4UM9B 5LMUB 1Y3CE 1G9XA 4DMMA 4BGVA 5C8YB 4B3CA 3RH0A 1H69A 1TKCA 2V6JA 3DO8A 2WKQA 4JN6B 2JCSA 1JXMA 4Y2JA 3WJ7A 2BGLA 2R4UA 2VBGA 3I6BA 4H60A 3VYUB 4A26A 3OBIA 3AR4A 3FAKA 3NEYA 3QJYA 1OI3A 4C4AA 2I9PA 1DOZA 2AN3A 2VJMB 3HHPA 3L5OA 4WE3A 5LBTA 1WF3A 2AV6A 1WOYA 3GPIA 2VQEB 2DFDA 2GFIA 3D7NA 1XMPA 2P1RA 2V55B 1JFLA 2OXRA 2JJQA 3EDYA 2RH5A 1O94A 1U4NA 3MGCA 4YJ3F 3ZE7A 4Z4QA 6ABPA 4I99A 3U40A 3C7AA 2OQ2A 2TSYB 1F7UA 4IIJB 1F2DA 3GJ6A 3I2FA 4Q4JB 1GPDG 3TSOA 4M98A 3RYCB 2H7YA 4F5ZA 3W6NA 2NM0A 1RHRA 4IFBA 5PNTA 2FPGB 5KB3A 1JQEA 1HDXA 4L0MA 1X42A 4URFA 2CCKA 1G8GA 4RGYA 5T4HA 3SI7A 1U1FA 2YV5A 3JQ7A 3UVEA 4I08A 3TNDA 3WKCA 3ZW7A 1Y1RA 5JS6A 1PV4A 2BL4A 3ZJ4A 1VCOA 1QIDA 2XRZA 3Q15C 5GZ3A 2ZSBA 1TT5A 2BJHA 5K8UA 4TVOA 3RO7A 3ZQUA 3NBKA 2CVZA 2C83A 1JPJA 2BEWB 3I9JA 4OQXA 2IYRA 2Q5EA 5TC4A 3M6VA 4QU8A 2VH1A 2OZLA 1JTVA 3HR7A 5KC9A 2GVDC 1YZKA 1A5ZA 1A3CA 4Y2PA 3VYWA 2WIDA 3TWOA 4A6XA 4GXNA 3ZGXA 1LBHA 4F0JA 5J1SB 5CB4B 1YVEI 1X0XA 2QI9C 2X1VA 2I4IA 1HYQA 5IDWA 3BK7A 4LY9A 3S3TA 4QXAA 1RLOA 4WVFA 4A2PA 4M76B 1GQFA 3FLMA 1KQFA 4OQNA 1HYHA 4J0QA 1OYYA 1PZXA 2NVOA 1XA4A 2YDXA 3AQIA 3ZX5A 4CDNA 5COAA 3OQPA 3JQ8A 4IKEA 1E2IA 1CE8A 1AIPA 2LWIA 3ND5A 2WSYB 3G2PA 1RJDA 3OUZA 3QUSA 3SC2B 5ICEA 5EKXA 2WNSA 4PBTA 2OP0A 3IKMB 3FYUC 1UINA 1EHIA 2HV8A 3OX3A 3B70A 2D4AA 3UG6A 3T3HA 5B1YA 5DGTA 3OKAA 2REQB 4O2RA 3RU2A 3QYPA 4RKEA 3DOJA 2XUJA 3GJRA 2Q4TA 4DT1B 3ENVA 1Z8HA 5IFKA 4HF7A 2J3HA 4UMVA 1HH4A 5EP2A 4RW0A 3RUHA 1GFWA 3PC2A 2BISA 2O0JA 5BW6B 2PGNA 5EP4A 2OFFA 3O3CA 2EYUA 3ZZ0A 3UV7A 1ZEMA 1EUCB 3PR2B 3PZRA 1TAUA 3KVNA 4URHA 4XVHA 1D03A 1JFFA 2QLJA 5EEGA 5H82A 3WSVA 1XZIA 2B4RO 2JVIA 3PR1A 1QHSA 1IZ9A 1QO0A 2VHXA 1MX1A 2GZSA 1KARA 2C2XA 1ECBA 2BHTA 1MJGM 1PQPA 1MAHA 1XWWA 5J9FA 2ZM6B 2DT5A 4MLPA 1CY1A 3UC5A 5I45A 1Q0UA 2G1KA 2XRMA 2WKWA 2OXCA 3FWNA 4LNUB 4MMYB 2NZXA 4TL8A 5FTNA 3E3OA 5AJYA 3BDVA 5A3RA 4NATA 3USCS 1NBME 3L4KA 6REQB 4S24A 1GNTA 3JD0A 2EEZA 3RAGA 1P31A 1BX3A 3SZOA 2RAUA 4RJJA 3T3OA 1EGMB 4EWLA 1UKZA 1M1XB 2JRLA 1L5QA 2P75A 4JJEA 3K6RA 1ZICA 4PS0A 3KQHA 1BFKA 2FPKA 1HLFA 2R8BA 1QP4A 5L4SA 2HWXA 4WJLA 5CFMA 2QZ9A 1AY0A 4FN4A 1VI5A 1QKIA 2ZZKA 5KYTA 2W8BA 3EPPA 8LDHA 2OUIA 4J0JA 2RK4A 2O8BB 4BCDA 1C29B 1N6NA 1W85B 4W5JA 4IDEA 5B7PA 1LTHR 1QUFA 1PR5A 4B3RB 2FSHA 4HJXA 1BS2A 2BT4A 4JHXA 4V0KA 4RA6B 3BILA 3TTSA 3INYA 1L4LA 4DLTA 4TYNA 3PLAE 2QRLA 1YRAA 3MOSA 2XIQA 4L2IB 5TARA 2HH9A 4OHVA 4G4JA 1GITA 3JU3A 1N8TA 5EYPB 2IS4A 4I4IA 1I94B 2YY6A 4PO1A 4QGHA 4UHHA 4ER5A 2VDJA 3OIFA 4IGFA 4YT8A 4P3OA 2QRHA 4AMGA 3AVTA 4UXJA 4I6GA 2VPYA 1IB6A 1GG8A 3LDAA 2JHFA 3IALA 1JDBB 4IXNA 3E03A 3F4KA 3LOPA 4NK4A 2FV8A 3TAUA 1PVVA 1VLQA 3LT1A 4HVTA 1DC4A 4A7PA 4WBXC 4UD2A 3W5JA 5KHLB 3S40A 2A8YA 2QDKA 1RNLA 3G5AA 4HX2A 4QFBA 4ZVOA 4AG3A 4IIHA 3U4AA 4QGFA 3OFKA 1X92A 2OENG 2P2DA 2X0DA 1N77A 1F9EA 1E3DA 4P3KA 5FULA 1Z7GA 2ZJYA 3NHWA 1NW4A 3PNMA 2OQIA 3AEXA 3ZD8A 3QTLA 4WKBA 4E15A 1V3TA 4QD3A 4YJ2A 1Z4KA 5GINE 4CLOB 2VYVD 2P40A 4MYTA 3NHMA 3UICA 2Q4RA 4JGBA 1P2VA 1Q50A 1NNI1 1QHHB 1V5WA 3NETA 4PPNA 1ZGJA 3ET4A 1YS6A 5DP2A 4I66A 1KSGA 1VFNA 4RBNA 1MKYA 1ORTA 1MRZA 1EFRA 1Z0FA 3RJMA 5JI2E 4LSWA 3RUEA 3KHSA 3S8EA 3QFFA 3PJGA 4LWPA 3TR0A 3WDMA 3BF7A 1RE1A 1T9CA 1ZSVA 4NBVA 3FMPB 2BRUA 5D01A 1RI3A 1U6IA 1ZY2A 2A1UB 3EF0A 2IDZA 4HDAA 4MYDA 4CKEA 3LRXA 1ZXBA 5THQA 4NV1A 3WP0A 4MEJA 1WPGA 2O2YA 2D6FA 1KFCB 1AGNA 1ZM2A 2NO9A 1HPLA 3AM4A 3STYA 3O75A 3U56A 2GBGA 2QEQA 2ZJZA 3R6WA 3RUPA 1T2CA 3PFBA 2JCYA 4GP7A 1TPYA 1NW8A 4TUYF 2GXAA 2VCYA 3AF1A 3KPJA 3O92A 1KNXA 3THRA 4E07A 3M6UA 5COBA 2PQ2A 2O57A 3D6HA 4NR0A 4NC9A 3SDZA 1SZPA 4UU7A 2G04A 3BL5A 1BU8A 4YJHA 2IVZA 3M3HA 1TTHA 4J1TC 2WJVA 3HJAA 3HVRA 4E4RA 2HMAA 4HLCA 4PPQA 1IN5A 1FVOA 1MZPA 2G28A 1X74A 5KAPA 1PR9A 1VPLA 2QU8A 5DBOA 4AKEA 1TZCA 5IAGA 2DR3A 2HLPA 4OP2A 4C0BA 1CB7A 1KS9A 4I9FA 4ENRA 2HU7A 4U1RA 4YRZA 2Z08A 3VPDA 2O0KA 3VR0A 4ZCIA 5IDQA 4AY5A 4MV8A 1GAXA 1I3NA 5KOHA 2NXWA 4UMFA 5JY6A 3RIGA 4KZKA 1KXZA 3NJ8A 3HO1A 1NVVQ 1T5IA 3NHSA 1CPYA 3OU7A 4XM2A 3RRZA 5B58C 2P2GA 1D1SA 2ZR8A 5DHSA 5KAMA 1EDDA 1FVHA 1H1LA 1N1MA 1QS0B 2B1IA 5DTIA 3LWBA 4WKCA 1ONSA 1PZHA 1ZAYA 1QF9A 3QU2A 3VR4H 2CEKA 4L4RA 2R8PA 1NYRA 3OF3A 1VJ0A 1U7DA 2J41A 1REQB 2XD9A 2XUHA 4QNNA 4L9AA 4AXXA 1KSJA 4J9VA 2NMVA 1V39A 4M8NE 2XYPA 3AM5A 4R9RA 1CUDA 3SDBA 4BEBA 1NBWB 2PSDA 4EELA 2BZ1A 2W6IA 1EB8A 2ASEA 4KH0A 5H0IA 2Z6VA 4ALMA 1EFVB 1M2FA 3N2YA 4UTXA 3RG2A 2R97A 4HQKA 1J21A 4QEZA 5ECWA 1CR2A 3FPLA 1JJVA 2G9NA 3VU3A 4R2IA 2OV4A 1JSRA 4J0EA 3DTTA 1DKRA 1D8AA 2PWPA 4J8PA 4LYAA 2VP4A 4C30A 3F1KA 3T5TA 3UO8B 5JZSA 2R9VA 1UPAA 3A31A 2WB2A 2AJTA 2AJCA 2E6KA 1DELA 3MS7A 2ZI9A 4YJ2F 3RK1A 3QIAA 1RFLA 2EBHX 5JFGA 1U3FA 4OUDB 1I32A 2A0YA 2JFWA 2LTAA 3UOAB 4MV9A 4YMUA 3RQSA 4AJ4A 3ODPA 3PZBA 4IGAA 3S2YA 2RGCA 4TKLA 4IAOA 1G8HA 2OD7A 3V4FA 4AWBA 3U4CA 1O0SA 5FP0A 3U3KA 5DK6A 4C05A 7REQA 2GHTA 3UPDA 2NW6A 1N2XA 4YO8A 2K7FA 2GK6A 4MXDA 3D4IA 3GROA 4B84A 3PKZA 4RZSA 1WDKA 1A5TA 1P1JA 2JBWA 3QX9A 1ZONA 1L3CA 4LOLA 4NYIQ 4R16A 4CGYA 5LVAA 1P2UA 1M7HA 3CE6A 3Q2IA 1RLMA 1PFWA 1IN8A 2ZJ4A 3RKRA 4A82A 5ELXA 3D6MA 1RJWA 4B6EA 3OQOA 4DMRA 2GCGA 1IL0A 5AKHA 1MOQA 1U5CA 2I54A 1W30A 2UUPA 1LX6A 3GZNB 1HEIA 1NW3A 4HDMB 1F2UA 1NMYA 4JT4A 2BMVA 3ACBA 2HR1A 4B7XA 2HJWA 4TMYA 5A4IS 2DHDA 1VJCA 2J4DA 4M9ZA 1ZOSA 2FQQA 3HDQA 4ND1A 4TN5A 3VNAA 2SNIE 5CA1B 2FSUA 3DCIA 1P2TA 1BVUA 3NM6B 1J8FA 1P1KA 4RKRA 1B23P 4UOQA 2GJKA 1H0RA 4R9NA 2BE7A 3TZHA 2E49A 3X1XA 1FDOA 4FYMA 3HBAA 5JPCA 4GT1A 4EPYA 1M6VA 5CB8A 1HKUA 4JJIA 5HOEA 1Q2XA 1PD1A 2XHZA 4FWTA 1NXPA 5GZ6A 3AY6A 4OI1A 5EKDA 3Q9UA 1E5QA 2VUUA 4QFMA 5E6RB 4N82A 3BMCB 3QWHA 4CTJA 5H3LA 1CZUA 2LGJA 4KQHA 1XHEA 4PIPA 3B6KA 4ZZIA 4KNWA 2VUHB 3PYMA 4Y67A 4TZTA 4BLWA 2FFBA 4J0GA 2DH5A 1TQ8A 2OCIA 3HJNA 3INGA 3P2IA 4GVLA 4XZ3A 4YECA 4ZO6A 1X13A 1KQPA 3B7WA 5D8DA 3HI6A 4GE3A 3RSZA 5AVQA 4TYQA 2PX4A 2ZIUB 4PGFA 4LF6B 4ZYYA 3L1UA 5SZKB 5EOVA 2XGMA 5HJ7A 1OB2A 4BNJA 3SP1A 3VO8A 5EMNA 4KXNA 4QLAA 3BSFA 3SVZA 2JFHA 5ED4A 1U5AA 4KDCA 3Q5DA 1X1QA 5A6SB 3WFIA 1H0KA 5JJBA 3FZQA 3GJTA 1OBFO 5CT9A 2JIMA 1RT9A 3O94A 3KPWA 2ZBVA 4E13A 4CKZA 5LPNA 1T1GA 4UTRA 3OOYA 4ASUA 1PJBA 4IX9A 4ZT5A 3TCNA 3KVOA 1U3DA 3EUAA 1EUZA 3F0TA 1L5HA 4B79A 2QRMA 2CVQA 3M1LA 1PWHA 4QBKA 5LIRA 5DNYB 2EX1A 2GPNA 3AC0A 1KVTA 3I12A 1PFYA 3R6GA 2Y71A 4IXWA 1NSTA 4NEQA 4X6XA 3K32A 2HK6A 1HETA 4KGZA 4QGSA 4X7PA 1F4LA 3GDWA 1WSDA 3IV9A 1VMEA 4EY5A 5TNXA 3NASA 3LA8A 4CG2A 1OTHA 2ZK7A 3WGKA 4A8JC 4D44A 1CZKA 4NOJA 3OZTA 4QOSA 2OBFA 1KY3A 4FYKA 1X8KA 2FMKA 3OT1A 4NG4A 1T3LA 5EG5A 3LRPA 4BZPA 2PD6A 4HAYA 2XA1A 4KP7A 3ZYCA 3J81k 3TNJA 2P9JA 4IH4A 1OYWA 1TGYA 3IDFA 4YRMA 1H3FA 3GFGA 4RK4A 4ARIA 1ML3A 1TFUA 3AFNA 4ISBA 3RRMA 3E9YA 2GILA 2WV9A 3DBIA 4LZLA 1CS4C 1Z07A 1U0HC 1W88B 4HH1A 3ZDYB 4C4RA 1BWPA 4EGJA 2BC9A 2FU5C 2CFCA 4PLGA 4LYEA 2FMTA 2ZRPA 3I4FA 3P8ZA 3FRJA 4AZTA 2XOEA 1EXNA 1QRUA 3FF4A 5B1HA 5CDGA 1RJFA 4N3AA 3TBKA 4EPTA 2XEXA 4LMAA 1NUPA 3OZAA 4G5GA 3GLKA 1TF5A 1JHYA 1VSQA 1T2EA 4PRLA 1V48A 2A94A 3DMYA 3IAHA 4H15A 1GNVA 3F5QA 4PZYA 5HFJA 3CVVA 5D3KA 3H5AA 2QTFA 4EFDA 4M60A 3OZDA 4DLYA 1HDYA 3EXFB 3CNEA 1MHPA 2XTNA 4LJRA 1Q21A 3C8HA 1C7FA 1HFKA 2XKBA 1W5BA 2VDWA 3VSAA 1HTTA 5JNRA 4RHCA 4S04A 1QE5A 2ODBA 4K2AA 2IBSA 1QHGA 2W2QA 1R16A 1EX6A 2BFFA 3LC7O 4ARCA 1CUIA 1ARZA 2QX8A 1H85A 3NB0A 4DR5B 2ZB4A 3AEUA 3H2ZA 1ND6A 4CMKA 3MOGA 5DT2A 1P3JA 4MR7A 1Q44A 4AM8A 4IDBA 3MS2A 4LX0A 3G1UA 2YZKA 3PVCA 3NR2A 3EFOA 3IB3A 4ZTUB 4J4HA 4FYXA 1OZ0A 3UAOA 1QIEA 4XRGA 1FW8A 5GJCA 3FNRA 4B5LA 1N57A 2C1ZA 3A3NA 4N0DA 1LSUA 1CVIA 4U0JA 5JD3A 3PLNA 2EWVA 3PRYA 4NESA 4PQFA 1YOVB 1UMCA 5DNEA 4MVJE 5FEMA 3DT8A 5JPIA 1X14A 3IIKA 3MT9A 3O4GA 3HJRA 2Y1FA 4DXHA 1F2TB 3BK2A 2B37A 5TX7A 3PFIA 2BM9A 5HKLA 3EWIA 5J63A 3W06A 2HCTA 4RPJA 4EI2A 4G0MA 3M7IA 4D96A 3BREA 3A6ZA 4E31A 1N6KA 1TD1A 4F6RA 4JV5B 4DV3B 2GKOA 2YJTD 4QQNA 3B9RA 3IESA 2Q3EA 3NRBA 1U6KA 3DMPA 3AKEA 4QJ4A 5KHOC 2EWMA 1PT8A 4OJYA 1RWXA 1U31A 3LU1A 4ZVKA 3WZ2A 2TMDA 2JNWA 3PJFA 4R0VA 4EYQA 5HX7A 5EWJB 1JIIA 1BEZA 3SQXA 1JR2A 1VIAA 4NFLA 2BEVB 2C4HA 1RMQA 2X5OA 4P7FA 3FOZA 3RHSA 3PXAA 4ZA2A 3JD3A 3L84A 2C2HA 4RUKA 5KVVA 3HCFA 4ROSA 4GYWA 4AMBA 1NIPA 2EQAA 3J7TA 4K9PA 4LHXA 4P4LA 3FUXA 3D3WA 4H1HA 4JYZA 1PJAA 3D7LA 4QO8A 3STXA 5JAMA 2VRBA 2XWQA 4IO1A 3GT0A 3RRJA 3WRYC 4DWWA 4R71A 4P4SA 1RYMA 1ETUA 1S3GA 3QV2A 3RABA 4B17A 2WF5A 1AUQA 2VDPB 4HAIA 4RX1A 3VR3A 1ISMA 3WMWA 4KIJA 3GJ8A 4TX1A 5LSAA 2K5UA 4W6QA 3H1EA 2ON6A 2JFYA 1OWPA 2Q7XA 3GP8A 4KX3A 2D4HA 2FJUA 3NT2A 4KO2S 3U4GA 4DY4A 2IEAA 2O06A 1J07A 3LUGA 4H1VA 4F4CA 2IF2A 4CW7A 4DAOA 4H16A 1PFGA 2VTKA 2QXUA 2O2EA 4KH1A 2Q41A 2I2AA 2PGXA 3JPWA 4K9KA 4NMLA 4M0MA 4RLFA 3N86A 1DCFA 3SFZA 3ZK9A 1HORA 1EBUA 4RTSA 9MHTA 2YZ2A 3DA8A 2C31A 4KGVA 3A9WA 2XOKD 4MUAA 4PC2A 1OJLA 2FSFA 4J94A 4B87A 1FYWA 4ATNA 3EDCA 2CUNA 4WQMA 2VI5A 1L8QA 1SXJC 2G40A 4G1UC 1CZOA 1GDTA 2CBGA 3ITNA 4JQZA 4ZAWA 2C3OA 1W36C 4B9AA 4KLZA 3O83A 4DA6A 3F6BX 2VTBB 3H2YA 3OE5A 4S0ZA 4K6CA 2V8OA 4UAJA 3TG8A 2D8MA 5E3IA 3KEFA 2GO7A 1IQPA 1USIA 2R5WA 5L95A 2W98A 5L8VA 1EU1A 1I13A 2DTEA 1PJLA 3N05A 4Y0VA 1JEQB 1R7RA 4IH9A 1DARA 4E5PA 4B3SB 4HLUA 1NXWA 2F1OA 1RI2A 2HWKA 4XIJA 4LFBB 1WEKA 3EARA 3CMCO 3MNFA 2Q0SA 4KR0A 4BN0A 4EGQA 2YICA 4V2IA 3C14C 1O6CA 2ZBQA 3VTZA 4TLLB 2UAGA 2PJZA 3NEJA 5BPHA 5E4JA 4PANA 3AJEA 4A10A 5HHTA 4YAEA 1HNXB 3ZIAA 2CBXA 1XZNA 4BUCA 2B7BA 4DJFC 3D6TB 3O3NB 3K9BA 4MRMA 1DG1G 5D84A 1BS9A 1WU7A 3C1UA 4Q24A 2CUTA 3ZGYA 2BYTA 2SICE 2DMRA 5JC8A 3P9NA 3SSOA 1POWA 2X7XA 1ACJA 2HZ7A 2NXEA 4F5WA 4NPHA 1Q0TA 4NRDA 3RSCA 1E3LA 5LA6F 1RXYA 2HBRA 2RGNA 1UXKA 5FPQA 1TA9A 1ADYA 1G8JA 5ALPA 3BEDA 3NP9A 2QPTA 3G6KA 2W22A 2TMYA 4TKUA 3MILA 4EDFA 2FOLA 1CRWG 1M76A 3LMKA 4C4OA 3O8NA 1GM5A 2IYLD 3ZV5A 2NP6A 4RMHA 2FUCA 4MRRA 1RI5A 1BA2A 4JLDA 4AJHA 4NQZA 3A0UA 3LFUA 3MSXA 1A8UA 1EBFA 3CPHA 2CJXA 5B4VA 1A7UA 5FBVB 1KP9A 3UQZA 3DL7A 3K9GA 5TJHA 4IYJA 2BCGY 1SO8A 1A8HA 1DJLA 3B53X 3KZMA 3NFRA 3RS5A 2AX3A 2F64A 4BAGA 3AERB 3MRTA 3J7AC 3CHYA 5LOVB 1LF5A 1MJNA 3ABQB 4MR9A 1OQAA 3T3PB 3UZUA 4RTLA 1NJFA 2O2HA 3QELB 4YRDA 1IDN1 1F12A 3MM4A 2EYQA 5E1MA 1AA9A 2B9EA 2E89A 1TJ3A 2PTGA 5M04A 5H02A 1IZ0A 1D1PA 1SVOA 2P4EA 2EG9A 1FTNA 3D7KA 3GWGA 4B4DA 1I6WA 3UUFA 3TRJA 5KO2A 1RM0A 4YJ3B 3OKPA 2W6QA 5JZVA 3DC7A 2O5RA 3DHEA 5LZ5A 1WZIA 1HNWB 1TIPA 1KK3A 1X1AA 3QPWA 3IIMA 4QUEA 5FUWA 4CLEA 1Z62A 4US1R 2B3TA 1SAYA 1KWKA 1T36B 4BDTA 1JZSA 4LF4B 2CHFA 3VPBA 2MDTA 4PFSA 2EIHA 5C53B 2NSDA 2AG6A 4C22A 3C97A 1EFPB 1HE1C 1LRLA 3GARA 3H8JA 2ZT6A 3R3XA 2QBYB 4XGRA 4MAFA 4NMHA 5KMGB 2QSJA 1S2NA 4LHZA 2WZBA 4A2WA 3ENWA 1QH8A 3OOEA 3IP3A 1ZJ6A 3IVRA 1C4XA 4Y9TA 2FPIB 3UJHA 2I34A 2Y99A 4JLVA 2JJ8A 3IMCA 1DIGA 4O1MA 2IU3A 3IP5A 4H6PA 4WCVA 4WCDA 2B92A 1PS8A 1FNBA 4YX9A 1FS6A 3DQZA 1N2BA 3E5MA 3UAVA 2OLEA 2RAFA 3G9TA 4KRGA 1WCWA 2PGLA 3K8OE 4FGWA 3W1VA 4MRSA 1H8ED 3T54A 1G5QA 1KVQA 1YZTA 3L7CA 3NM4A 5IAKA 4BXOB 3CPEA 4OB8A 4TKVB 1E9AA 1HZZA 1SIOA 4W63A 4EZIA 2E82A 3BC1A 4NH0A 1QTQA 3SX2A 2VAXA 3NLLA 2F8TA 4AUEA 1OH6A 2PL3A 4OHYA 1LVGA 3T4XA 3ICEA 3O2SB 1TZKA 5DBEX 4HS9A 3K0SA 4DDWA 1W1IA 2R00C 2XKJE 1QRAA 3MELA 3QKWA 3F2VA 3ICOA 1S2MA 2JCXA 4EKEA 3HO8A 5ALQA 1T25A 1XRQA 4R3NA 5SV2A 1XNJA 1NFQA 1VDMA 3C7DB 1S4MA 3DP7A 3QA3E 1B41A 3TOXA 1IATA 3ZLJA 2GOYA 3R40A 1O03A 2BFMA 3WLJA 7AT1A 1X80A 4LXXA 3DL4A 4LDPA 4TXLA 3R6DA 3F71A 3V8BA 1LFAA 2J87A 3BB3A 4GFDA 3EA0A 5IJXA 3EAFA 3EGVA 3P9ZA 2DTXA 4EP1A 2DHEA 3AW9A 5KNCH 4LC1A 4KGDA 4PQGA 1J0DA 1EVIA 4DJJA 1SVUA 1UJ6A 4JASB 4YP6A 1C7JA 2H2GA 3ZVMA 1O97D 1ZVQA 3I32A 2CXUA 5HK9A 1KY5A 2HRBA 3ITEA 3W1EA 5ETJA 1SWWA 1BYUA 1UFOA 2KHZA 3C98A 3P9RA 2AR9A 1CRQA 3B12A 4R1LA 4RXMA 2CUKA 5CFLA 1T2NA 3ZDFA 1T5LA 3AUUA 3ZHQA 1YBMA 1S96A 2NG1A 3KQUA 5DTMA 3F9CA 5ALJA 2WTBA 3VOSA 1E1CA 2WFZA 2FR8A 5DTQA 5EI5A 1RXCA 1QLHA 1RQ7A 1XD9A 2FWBA 5AVTA 1LLDA 5F3WB 3WBFA 2QVGA 1P17A 3GA0A 4KZPA 3BBPA 4LSMA 1QU2A 4ZI5A 4N54A 2C0PA 1B0AA 3H7AA 3ASVA 5KS2A 2RH9B 1HRKA 5B4UA 2QAJA 2VP9A 2ZETA 5T4BA 1ZM4A 2YOFA 2C9DA 4RZQA 1ZD5A 4F5DA 1D2EA 1ZCBA 2YRFA 3CUKA 3JQ7B 3VKFA 2QMUA 2FTKE 2GN2A 5GJWC 4C0SA 1WXEA 2F1JA 2O48X 2YQ4A 1ZGBA 3P4YA 4ENPA 3BQNB 1TT5B 2GTIA 3UAYA 1U2GC 4FHCA 1UL1X 2IFTA 3JZIA 4QLBA 1Z88A 3U4HA 3ADCA 1ECGA 2OZLB 4G0WA 1E7YA 1I10A 2BKAA 4F06A 4K81B 2W58A 3GLHA 1Z2DA 1J2RA 2PBLA 4X1YA 1OXMA 4ZQEA 1NC3A 4YMWA 1PJ8A 1XZJA 5J47A 3V4RA 1ZK4A 5I9IA 4N5LA 2BFPA 1C0EA 1Y1TA 3N2KA 2WSMA 5HIMA 2GZDA 4OX9B 1IWBB 3KTDA 2WTMA 3B3FA 4U9HS 1W52X 1MDFA 2PSJA 1GRCA 1GT6A 2VNAA 3CZMA 5AJVB 3NXSA 4OMFG 2ZTMA 3N8DA 4B0PA 5EIAA 1OLUA 3UWSA 2Q3HA 3JQPA 4CLXA 5B6JA 5AW3A 2FEOA 4V1CI 3TB6A 1T0HB 3VZQA 3R7NA 5L3SA 3OHSX 2PM8A 5LJLA 2Y93A 4B46A 1G2IA 3JQ8B 1NI5A 1RCUA 1CE8B 3OU6A 4PHCA 4C5BA 3WWPA 3V8PA 4J0FA 2FNAA 3DZHA 3CTMA 4I1RA 4LXTA 2H1LA 3BH0A 3X44A 3CF4G 2DB3A 4YUZA 2NU6A 4Z4GA 1BKYA 4NDAA 4WASA 5BYBA 1RTKA 2XKKA 4E51A 1DOAA 2QE7D 2C2MA 2XAUA 4MR8A 5CRIA 1YUBA 4RF5A 2JANA 1ORHA 3VR6A 4BNGA 4E0BA 4LDZA 1ULUA 2XTZA 3FETA 1QG0A 1ADBA 2HPAA 4GKBA 2V1XA 5JXHA 1INLA 4Y1EA 3B89A 2MSWA 1GSAA 1K0UA 3MWLA 4NAHA 4NWIA 1I24A 3RI3A 5ISMA 1JFFB 2X8AA 1R2QA 1Z5WA 2GA8A 3IMGA 5KQSA 5IFLA 2JBAA 3SEFA 2AR0A 4FDLA 5ALDA 4P86A 5BNTA 1Q11A 1H6BA 4BJ5A 4F1JA 3P20A 3IVGA 2JLWA 2EL9A 4HXYA 4D9EA 1Y34E 5KJ1A 1XCPA 4TTSA 1VG9B