3HCOA

Human ferrochelatase with cd and protoporphyrin ix bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcoA01
4KMMA 1QGOA 4KLAA 4CCSA 3M4ZA 1TJNA 2QD1A 2C8JA 1HRKA 3HCPA 3W1WA 4KLRA 2AC2A 2XWQA 2HRCA 2Q2OA 3HCNA 3HCRA 3AQIA 4MK4A 1N0IA 4KLCA 1LBQA 2QD5A 3GOQA 2XWPA 2XWSA 2JH3A 1L8XA 3LYHA 3HCOA 2HREA 2XVXA 1C9EA 2XVYA 2PNJA 2HK6A 2Q2NA 2QD3A 2PO5A 2H1WA 2PO7A 2DJ5A 2QD2A 2Q3JA 1DOZA 1AK1A 4F4DA 1C1HA 1LD3A 2H1VA 2XVZA 2QD4A 2AC4A
chains in the Genus database with same CATH superfamily
3E9YA 3INYA 5B1DA 4RPKA 4X1YB 4YREA 4DXAA 4J0KA 1XTRA 4JHXA 4B34A 1CFZA 1QVRA 3DYBA 1Q1GA 3GX1A 1NRIA 5KUTA 4UEQA 3MXOA 2Q28A 1NXPA 2SKCA 4X1OA 3KOMA 1TF2A 3PQDA 1EFCA 1T1SA 1DSSG 1UDWA 1XZAA 2FKAA 2HNBA 4PVDA 2VQSA 3PJFA 4NG5A 4F56A 3C97A 3BXPA 5B30A 3D8TA 2GN2A 3AWIA 3ANXA 2I33A 2XB8A 3SVTA 2FR8A 2VF2A 1C9EA 5KQLA 4RXTA 2IOQA 4TLDA 2P68A 3NC0C 1GFSA 3AR3A 4EI9A 3KE8A 1CQXA 4F8JA 4LOIA 4FDLA 2NU7A 2AQHA 3D0RA 5KOJB 4U39A 2ZS9A 3AB8A 4TGLA 1RW4A 1Z0SA 1K98A 1WUTA 2JGDB 2HKIA 3QLJA 1UJ6A 3I05A 1JEDA 4BOYA 3O4GA 1J25A 1ABEA 3UH0A 3I5YA 2XMZA 3K0BA 1NQXA 4JSTA 2ZYHA 1G5FA 1HE3A 4MJLA 1E4EB 4TXNA 5DM0A 3KELA 1U4NA 1CVRA 4H6PA 2P91A 3QKTA 4TVOA 4MINA 1N77A 2C4HA 3A6FA 1RP7A 4TKLA 2HM7A 2L0XA 4AN0A 3BH6A 2FZCA 4JH0A 4IR7A 4MP6A 4EMBA 4QARA 4FWTA 1ZH6A 2N1BA 4H3HB 4CKWA 2BVNA 3AILA 3K1AB 3QLVC 3CMCO 3IIIA 1E1KA 1P5JA 2YNMD 3QBTA 3G1UA 1RMYA 5AIAA 1B8PA 3NRBA 1MQ8B 3R3YA 4HGYA 2J6HA 5E0OA 4BGIA 5BV8A 5HKKD 2GHRA 3TRDA 4LSMA 5E7MA 1DAMA 1BG6A 1E7MA 3K6KA 3O03A 1RM4A 2WIAA 4NATA 2DKNA 5DTMA 2DYKA 1YU9A 2F67A 2FFRA 2K87A 2XBLA 2GAAA 4MX8A 1JB9A 4UMFA 3UK6A 3VDRA 3KQNA 1M75A 2PZBA 3A3OA 1AXEA 2VVTA 4ZT3A 3IQDB 1PS9A 2EFYA 3A9VA 1FTWA 3TIGA 4GX5A 3OFSA 3VR4A 2G3YA 3KZCA 1R8XA 1VGVA 4BLVA 2ZB2A 2IK8A 3ZLBA 3NTUA 1W7AA 4N0QA 3TF5A 2VJYA 3WNBA 1G3IA 1BRTA 3OSUA 3SF0A 1JSLA 1ONBA 2W70A 2QUHA 2Q1WA 1KEVA 4J3JA 2XMPA 2XHEA 2IV2X 1O87A 5LP6A 2NGRA 5IXJA 1SUIA 2WINI 4QPNA 4DAEA 3ETJA 2UYCA 4RSRA 1OA1A 3QXXA 5FBKA 4ZK6A 2R7KA 3FFAA 5T3UA 4M54A 2PWPA 4RGYA 1RHQA 4PHHA 2E7ZA 5PGMA 4MQLA 1UZLA 1S02A 5TJHA 4JJZA 4KP7A 5LDGA 4IH4A 2WJVA 4H1WA 1E0KA 3GRVA 3D59A 2ZVJA 1NMQA 2YVAA 3G1TA 1YAJA 4RKFA 2ZREA 4RKEA 3UXYA 1BCSA 1UKAA 1WNTA 3HG7A 3N76A 1JIIA 2ANCA 1N7IA 1KQGA 5JC1A 5EP3A 1FYXA 2DTEA 4RJLA 1VGRA 2A92A 3Q3JB 2ZJYA 4RK6A 5C9ZA 4FQ8A 1EHIA 3BMNB 9ABPA 4IQ8A 1ZJWA 2CE2X 4L15A 4NE9A 3F7NA 3SZ3A 4BNGA 1E0JA 5I7HA 4E32A 2UUPA 3JZAA 3AUTA 1K5PA 2WR8A 4KYVA 3I3SR 2ZWVA 2OKGA 1JRLA 3H9UA 4YR9A 3LPMA 1UPAA 4FFSA 4RX1A 3BWCA 2HTFA 3GLHE 2GXQA 3PF9A 3JATA 5FAKA 4J90A 3U13A 2CXPA 1E6EA 4PHFA 1V3TA 1PLKA 1L4NA 2C3UA 3L5KA 4LGMA 6PFKA 3MT7A 4NZYA 3PSHA 4OLJA 5BVHB 3DS8A 3WJAA 2E5WA 4QOGA 2ZSIA 3P5SA 4JLWA 4MNTA 2DQYA 2G4VA 4TV9B 1G7RA 1XVAA 2HQBA 3ITDA 3ZE6A 4K6CA 1IZ9A 1R9GA 4ZCPA 3O7MA 2CLKB 4UCWA 2J9GA 1Y8QA 4ZANA 1TQ4A 2RGCA 1DU4A 5HCIA 4CM4B 2IY7A 2C7PA 4LGYA 4BV3A 1P4AA 3MOSA 3UW1A 2ZJ4A 2CHEA 2HQOA 2R2AA 3IA2A 1NQOA 3KYBA 3MMPA 4TUYA 2QBYB 4OK5A 4GR4A 1VKHA 2EP8A 1XKTA 4U2CA 5A7FA 4CLEA 1EVZA 4B5KA 1E98A 3BAFA 2C4NA 3HR8A 5CVDA 2IGTA 1PRYA 2BCEA 3H1EA 3DBHB 1TI7A 2AXPA 2ZT6A 3D3EA 3HI4A 3OY2A 4WADA 4ZDWA 4QGHA 4AB1A 4WIAA 2YW9A 4IIJF 2ZYTX 3B2EA 4U00A 4DR5B 5F64A 1GARA 3D81A 5HOEA 3RUHA 3ZXYA 1QZZA 2Q1TA 1XRQA 1B8VA 3C85A 3ROXA 4NLLA 2QY9A 5FO0A 1GO2A 2G1JA 4M8IA 1RXEA 1N0HA 1GN9A 3ES9A 4RD0A 3NJ8A 2OUIA 4WZ6A 5C35A 1N1MA 3IQEA 4CLRA 4QNNA 4R9NA 4F04A 1XWFA 1KJ8A 1N7GA 1YZTA 2JHAA 1E2DA 1U7ZA 2IU3A 3AINA 4I1OA 4D82A 5F4ZA 2RK3A 2PMFA 2HSGA 1FSPA 3OJWA 4KQHA 3K1JA 3BXOA 4D0LB 2J9FB 2HA4A 5L3SB 5B3JA 3K7EA 1GPNA 1HETA 4HSGA 3JRNA 3ZZUA 1F6BA 3DC2A 2QPLA 3SDSA 1IBCA 1MRZA 1Y0BA 3LLUA 3IPYA 2OHIA 3KAJA 3TW8A 4DGQA 3AGQA 3OZTA 1ISIA 2FUG1 1XQWA 3WXBA 3FZQA 3V2IA 5JEEA 5DOVA 2DCUA 1YK0A 3KC2A 3L8GA 4KHZA 1YVUA 1ZGBA 2OC4A 5CH5A 4AIIA 3IRUA 1W36D 3ENQA 2TMDA 4OLHA 2ETVA 3PQ3A 3LXXA 4EYKA 3EVAA 3NWPA 3A4TA 2JLBA 1UQTA 1K8QA 1PR0A 1PT6A 3DJYA 3SYNA 4DG8A 3FYHA 4DXDA 1XU9A 2RHGB 3DE6X 4DXHA 2GPWA 3R44A 5D5QA 3TFWA 5FBHA 3SYLA 1QGYA 5IDWA 3VAZA 1NULA 4MYCA 5IT5A 1SCNE 4KR7A 2IPXA 1IXKA 1Z6YA 3CISA 3EMVA 4YCNA 2GPYA 2X8LA 5FXMA 5AVKA 1JI3A 2EERA 4GI1A 4K26A 3H17A 4UEWA 2ZYUX 3CNOA 1Y82A 4QT4A 1Q0TA 4OF4A 3ELWA 1JPNA 3EJWA 4GRIA 5DHRA 2GH1A 1DE0A 3O82A 4ZVRA 1B41A 1EFHA 3EIQA 3HCDA 3ONDA 4F72A 4A92A 5BOSB 3WLLA 1Q1EA 2ERXA 1GRQA 1NRXA 3BSSA 4YYZA 2XPCA 4YXWD 2VDPB 1LPBB 3OJFA 2JAWA 1ORTA 4J1SA 4FMPA 1TVMA 1PV1A 5TQJA 2PGIA 2ZQZA 2W2QA 4ZHQA 5JHHB 3PPXA 2X76A 4MV8A 3PUHA 2D5BA 4BVJA 3EAQA 2BEUA 3EWSA 4C06A 3CPSA 2Z8YM 3PQ8A 1O5IA 4PR3A 1CB7A 2PV7A 1I9GA 1NVAA 1NVUQ 3H84A 3NOXA 4XWYA 3LTEA 4ZQHA 4AMUA 4W1PA 3SEAA 5AHRA 3TI7A 4FWIB 1BDHA 1RMTA 1WSBA 5CA0A 3ZI4A 2Q5CA 2ZUTA 4ALNA 2ZRPA 1VZ2A 2JI9A 1U98A 2Z43A 2SBTA 1E3EA 1L7XA 4KYTA 521PA 3A2KA 1FFHA 2IHUA 4WTOA 2HEGA 5IYZB 3TZLA 1I5OA 4F4JA 1GAEO 1IMOA 2WV7A 3FI9A 4GMDA 4FGWA 1M2VA 4O2BB 3K0SA 1CW2B 2VP9A 4QU0A 5FOUA 3E9CA 3NDRA 3M1AA 3OC6A 1XF9A 4FI3C 5EUQB 5FULA 2Y93A 3B3JA 5GV7A 2PRJA 3UZUA 4DARA 3B2QA 2HZBA 1M6NA 1U3FA 3S2SA 3PI7A 4QQKA 3HVHA 1CCWA 3P2OA 1MT3A 5ENVA 2XZPA 7AT1A 4YQZA 3AW9A 4YP0A 1KI2A 3UCEA 4L74A 1THZA 1XD2B 1KH3A 4HJXA 4DBLE 2PUJA 3DH0A 1A8HA 1P77A 1PT9A 4AO6A 2HQ1A 1SC1A 4L8WB 1AXGA 2VT7A 3QPCA 4ZQCB 2CHUA 3O3CA 3LAWA 4FNMA 1ESZA 5TV2A 3TLZA 4E5UA 5M5BA 3U7RA 3AETB 3AHGA 3UMCA 1O8CA 1VPDA 2ZJZA 3ACDA 5LYJB 5A4AA 4WCFB 3VSEA 1GUAA 2H07A 2IUYA 3GCDA 2R7MA 3EC2A 4CL0A 1V43A 1QIIA 1YRQA 1TZCA 2QV0A 3ZCQA 3GRUA 1XAGA 3EOZA 2WOOA 1IBSA 1E9DA 2QAGC 2W2MA 3ISTA 4LY9A 4LJSA 2V4UA 4W1QA 2P1ZA 5FTMA 3RTCA 4GRAA 3EQ9A 4Q7MB 1NBOA 2QNRA 3BCUA 1A7UA 4LHYA 4RAOA 2XTNA 1D4OA 2YR0A 3GWZA 3GR6A 4Y2PA 5LWHA 2MR6A 4JXJA 3CVYA 4Q82A 4NJEB 2UDPA 3VGJA 2MTBA 3ZU6A 1QHXA 2A2ZA 1XZLA 2WWIA 3PQ6A 1LC0A 1TK2A 4RDXA 3NCTA 1G9XA 1CZOA 4PG5A 1SRRA 2OYCA 4CM9D 4XM2A 3A27A 3OEED 4FKMA 4CM7A 2J3IA 4KQJA 4R1LA 3IA7A 5EJ9A 3BCRA 1LPNA 2AQIA 2BMEA 1Z8FA 2G9RA 2I2CA 2ZT7A 3OBBA 1KDTA 4ND1A 1RQGA 1FPQA 2AW5A 3LX8A 4RH3A 1HSZA 4Y2TA 5HKKA 5DRYA 5JQWA 1RXVA 3OZDA 3OWOA 4MI1A 4B3JA 2W4MA 3C7DB 3EVDA 3P0JA 4UHHA 4W5WA 1WY7A 5SYAA 2HLPA 2M9MA 3FSEA 2NXWA 3LBYA 4BP9A 5F21A 2QUAA 1EUCB 5TGDA 2LWIA 3E8XA 3MSXA 2GEKA 2C92A 2YWCA 1H5QA 3OCJA 5C53B 1XK6A 1I6KA 2B4YA 3PYXA 5H81A 2GAOA 4Q6BA 5EIAA 4EB8A 3Q3CA 1ODSA 4LDNA 2E1RA 2AG5A 1OA0A 4QXRA 3RS8A 1N34B 4JX9A 3KEFA 3IBCA 1LDYA 5EG5A 3T34A 1SFRA 4U9IS 1BDBA 1IXYA 2PKQP 5B1SA 3UCXA 3AQIA 5FEMA 1XKXA 3IAHA 4KRYA 4FE3A 3WQQA 1QE5A 3S8YA 3WL5A 5B1HA 3U4AA 4O2RA 3ABQB 1IN4A 1XTKA 1WUKS 3DTYA 1NYTA 3EXEA 2MMCA 4I8XA 1TIPA 4H16A 2DEUA 3ETEA 3QTBA 3RYCA 1KYWA 2X40A 4JCOA 4KIUA 3TD9A 1ENOA 1G20E 2X5XA 3NTOA 1EZ4A 4P4SA 2CBGA 3PCXA 2WKPA 4CF5A 1S8NA 1NFFA 5CD9A 1D7OA 3VKHA 1OXMA 4C0SA 4M46A 1HZJA 3ZE0B 1JJ7A 2C9YA 3BA6A 4DYDA 3I73A 4NFYA 3S29A 3AF6A 1QGAA 2Q9CA 4IXMA 4FHEA 2WE7A 2ZGVA 1XEWX 3KFXA 4L7VA 3LTNC 2G7MC 4TTSA 8MHTA 10MHA 2GYYA 1M7HA 4I66A 4A1FA 2V5VA 3DCIA 4O2AA 1GZ5A 4I0WB 1DADA 1DPGA 2OMEA 2Q41A 1W36C 2FOLA 2PL1A 1NE7A 3K6SB 1ECJA 1R6VA 4ZREA 5CVJA 3UFXB 4MPDA 1DCFA 1ZAKA 4X00A 4FHGA 4MIEA 4DV5B 4UFOA 1AU9A 2I4RA 2OL4A 2QI9C 3JZIA 3OUTA 5KTPA 3E81A 4C07A 2D4AA 3LK6A 1NJGA 4PYJA 3GZNB 4JR2A 4IRMA 1W94A 2FPRA 5L53A 1WCIA 4LS3A 5IF3A 1G20A 1C1DA 1VL5A 3GLQA 3G2OA 3O75A 2I62A 3IBGA 3L02A 1A1SA 2I2DA 1J2UA 2CUNA 1MG0A 2QM0A 3BB3A 3FWZA 5DLYA 5AO9A 5AI8A 5GJVC 4LOHA 3PZRA 4PSKA 4V0RA 5DOZA 3P19A 3HRIA 3W78A 5EIXA 4B33A 4A26A 4PONA 5FHQA 2XADA 1GG9A 3L0ZA 3QYPA 1SULA 4Z9FA 4GDMA 1W8DA 2DJIA 1ZLXA 4ASUD 3LXRA 5CCDA 1AN9A 2FAXA 2ZB8A 1EG7A 3P0IA 4GP7A 4IS2A 2NYUA 3FBWA 3X1KA 3NBZC 4HMQA 1O58A 3ORFA 1QOQB 4RVGA 4YRBA 5CFRA 4ZYXA 3OZFA 2YRWA 4IVQA 2QR5A 4UVGA 2Q6VA 4LI0A 3TTWA 1H85A 2WJPA 1NFRA 2VL7A 4JN6B 2GB4A 2H2FA 2YVQA 4DMMA 5A5FA 4J1NA 3P2YA 3VI4B 1IJEA 1MGPA 1MMFB 1TZBA 1U5AA 2V3VA 2XMCA 3ICOA 4V0OA 3SOPA 5JXJA 1R0BA 3FHCB 3I2KA 5LKAA 3V8BA 2FVYA 3V55A 1J97A 1HTTA 2AMYA 1VPLA 4URVR 1J8MF 5CIWA 1FUUA 1PJBA 3GL9A 5IAOA 4TMKA 5EXPA 3D02A 1TJ5A 1BCRA 3O4IA 1G5IA 3E6AA 3DL0A 3CKLA 3E70C 4NS4A 4Q4LA 3B7WA 2QMHA 2HZ7A 3KOOA 2BFNA 2YFYA 3EZYA 5FNVB 3UHFA 1NP3A 2VCYA 4JI2B 1UDCA 3DXXA 4AZTA 2ECFA 4X8HA 5JEDA 5DX1A 3N7UA 2X9QA 2XUAA 5FRDA 3U7QA 3ZS8A 4BX0A 1DC6A 4RGBA 4MMZB 3WWEA 1NNUA 2BE7A 3UKJA 2X6RA 2NU8A 3KQYA 4Z86A 3NMUF 4H17A 1CZHA 4F06A 4I2VA 5JC8A 1ZX1A 3KSZO 1GG5A 2WP8J 2VRBA 4F84A 4QAQA 3G2IA 3E1SA 3OKCA 4DKXA 1A8QA 2RGGA 3OIWA 2BBOA 2IODA 2D3WA 3BEOA 4KR0A 5G0SA 4ZOAA 3TQQA 1U0FA 2IVFA 1BQEA 1P6QA 2GEBA 4RK1A 4YP1A 1NE2A 3RR2A 4G65A 3ZGLA 4RTLA 5B6PA 1JKMA 2GXUA 3H75A 4II2A 4UMVA 1JHRA 1M5UA 4OGFA 3U81A 1VP9A 1F5NA 4OHPA 3WQHA 4BC0A 1N78A 1E64A 3EVGA 1MLDA 4I1YA 3H8JA 1SURA 4PRYA 3V1LA 1W85B 2EFHB 4LQLA 5E3JA 2BKAA 3RRJA 3IJ5A 3N8NA 4H7KA 1THGA 3U39A 3IEPA 5G4KA 1C4XA 2QW0X 5EWJA 3USZA 5IWCA 1EEHA 4BNZA 2FN4A 4F45A 2WIGA 3E1GA 3M33A 3OMWA 4B75A 1I30A 1NVEA 4HTFB 4UNIA 4ZEXA 2N0SA 4RFSA 2PD4A 5DEOA 2I8LA 3K4HA 3G7NA 4DLTA 3UA3A 2EX1A 3WB2A 4RE5A 3P2KA 5ALQA 2QGFA 3NXSA 4Q9NA 4YXWA 1BXKA 1AF4A 2IFTA 3GLRA 3KD3A 3OQVA 3A4MA 4WUTA 2ZE6A 4R8VA 4AJJA 3P27A 1VSBA 4FFBA 1ZNYA 2RCYA 1FEZA 3NM4A 1IATA 4UOQA 3I0MA 3ZVRA 5L3QB 2P5YA 4MPPA 3IB6A 3EGDB 5FTJA 4CKCB 4GM1A 3DTTA 2Q62A 2WT9A 4P4TA 3WJ2A 4IZHA 4ZCIA 4K2AA 3IBYA 2NPOA 2A6PA 3M81A 2H6EA 5B1YA 1E2NA 2Y76A 1N92A 1WPXA 2QJFA 1FQOA 4KE9A 3K8YA 1ZD8A 1MABA 3ZZTA 3SQOA 3OMXA 4L02A 3G2NA 2F59A 3DYIA 2O19A 1M34B 2I1QA 2KYRA 2PRZA 4PC3A 4R0NA 5BQ5A 4RTMA 2V6MA 3ILSA 1ZN7A 3NXKA 4EJSB 2AFHB 3MHTA 3P0FA 4PXYA 4X1KB 2NXCA 5J5VA 1U9IC 1D6MA 1DC5A 1ZGCA 2H2WA 5BY2A 5TF4A 3FTFA 1SBHA 1GVHA 4MI9A 1IZZA 1IHDA 1O57A 1T4CB 2VP0A 3B89A 4NYJQ 4AQDA 4YPOA 1IY8A 2XUZA 3NRCA 5L7TA 5IM4F 1B8OA 1MZVA 5BSEA 4URHA 1KMMA 2GBIA 2I6FA 2XUIA 1COWD 3ELYA 4EA7A 4JJFA 3OO0A 3HSKA 1XNRB 3MUOA 1C7FA 3N05A 1ZEJA 1DAGA 1CJKC 1EFVA 1LTQA 4DLZA 3C3PA 3PFWO 3QFSA 2MSCB 5TGZA 1M5RA 4KDFA 1NP7A 5BR1A 2I03A 4LA4A 2FLKA 3R3JA 3S1AA 5JBNA 1C2YA 2PSEA 1ZFNA 5JADA 5TGTA 5CLLA 5JTUA 4WDQA 2QVXX 4HSEA 1Z4QA 3KHTA 2V7TA 4BNKA 5DRTA 3GRCA 3WL8A 3NORA 1V8PA 4JQYA 5REQB 3DZIA 2VPWA 2OQVA 4DCSA 1MG5A 4KH1A 5IDQA 1TW2A 2J09A 4FMCB 5IK2D 1RQRA 1CRLA 2OQIA 4ML3A 2VJPA 4PYOA 3OKPA 7REQA 3VV2A 3C3BA 4KXVA 1ACMA 1DEHA 1TM2A 4FK8A 2CFIA 4G63A 4MVYA 4WK0B 4XEHA 2CFTA 3OM0A 4PYKA 4Z99A 1W1UA 4ZYLA 4IHQA 5CAEB 1H2HA 4QUBA 4TLEA 2QN7A 3C8UA 3NR2A 3GDFA 1YRWA 5A6SB 5FH9A 3WKEA 5I8WA 4PXSA 3LP5A 1HT3A 3ZHXA 2VJQA 5ITZB 1J2YA 4TVBA 2AKAB 2BR4A 2DX7A 4YXFA 1TVKA 3G5UA 2BFBB 2QXTA 4OFXA 4CM9A 5PNTA 1VPWA 3OEEA 1FFBA 2WTEA 2AFRA 4M9SA 5D84A 4UNNA 1WSWA 3A58B 4RKYA 4BAUA 4DRYA 2VKTA 1Z07A 4U6NA 5I9NA 2OHJA 1TEVA 3CA8A 4OSEA 2CWWA 4QNRA 4WY2A 2OK8A 4XCQA 2QL6A 3A1CA 3Q1KA 4UTOA 1ZPDA 4EEZA 2I3ZA 1AUPA 3AFMA 2BGUA 3S2FA 3MAGA 3TECE 3CCBA 1WF3A 4MUAA 2GNPA 4FR0A 3THOA 3IVCA 2AXQA 2BJHA 4KC0A 1GCIA 1I1QB 1HXHA 1O77A 4AF7A 3JVUA 4TN5A 3SXUB 1G16A 1RMQA 1JNYA 3FDIA 2HQRA 2NN3C 3KSDO 3ZY6A 3NHYA 5SZIA 3TZCA 3B3FA 4X71A 1AZTA 1MD9A 3O4RA 1FE8A 1RXYA 2BBWA 2REBA 1VL6A 4EG1A 2Z2ZA 3SM9A 1HE8B 3PT9A 3VO8A 3HYSA 1JFTA 1ULBA 3THYB 4JT4A 2Z9BA 3KKQA 3RV3A 1DFHA 1XIVA 4GWGA 4DV2B 3NHFA 4FBMA 3RUEA 5C8YF 5F3WB 2H4HA 2QYHA 3AHCA 2DFPA 3JAKB 4I2NA 1P61B 1NR1A 2H11A 3A4VA 1W96A 1EP1B 4FB5A 3I5XA 1EFDN 5CFMA 2Q3MA 4CIBA 1GFZA 1W47A 4A6XA 3AFGA 5GMOA 1H4SA 4MKGA 1QRDA 5GTDA 2FWNA 3NHBA 1ZSNA 4BEJA 4N82A 2YCLA 1T2UA 8ATCA 5JCJD 2R47A 1JJIA 4BL5A 2EWWA 2P75A 3UAVA 4HLDA 4R3NA 2V6IA 3ZEIA 4E12A 3TFQA 1U3CA 1PHRA 2Y05A 4L8YA 3W2IA 4BYMA 1K68A 2ZRDA 2QHXA 3AEQB 3ER6A 2WYHA 1VIVA 2XUJA 3GEHA 3KPVA 1O1YA 3TSZA 4BMVA 4DZZA 1A7KA 2O8CB 3C8MA 2FKNA 1DXOA 3L7DA 3O38A 4MWOA 4X97A 3CE6A 4OGGA 1IVYA 2V7PA 3MIIA 2CJPA 3I9V1 4YT5A 2QD4A 4FD3A 1RWVA 1R4ZA 2C82A 4XVUA 5AUOB 1K3FA 1NPYA 2GJ9A 3SR3A 4KVZA 1W4BA 2CLLB 3FRJA 3UGJA 1PKEA 3R20A 3V33A 1D0SA 5CR9A 4ZCMA 1DMRA 3EH2A 1EQ2A 4UULA 1U7WA 8GPBA 3H87A 3HVJA 2GJKA 1X1SA 2G1UA 1FS6A 1WMBA 1NUHA 2AK2A 1VDZA 2WLTA 3KFLA 1ST3A 1SHLA 3M1YA 5C1BA 5A3VA 1S3SA 2C4VA 4GE0A 4GSYA 5E9WA 3BK2A 1L5RA 5KX5B 3U44A 1C7RA 1EUYA 3RFTA 2V9CA 1BFDA 1RKBA 2BUCA 5EHGA 2ZATA 3A6KA 3PDHA 1ZY2A 1TMOA 3PQ4A 2JH9A 3EISA 2GPSA 3MCAA 2DMRA 2FZKA 1L5KA 4HUTA 3DZGA 1C9JA 2B0JA 1VCHA 3PXAA 2OG2A 3O4JA 4EKGA 2HNAA 4EFKA 1I4DD 2DR2A 4ASUA 4K03A 4HQOA 1KSJA 3TS1A 3KWFA 5EE9A 4C6TB 1NY6A 3ZD8A 1FXWF 3VO9A 1LK0A 2GGSA 3NYIA 3GP3A 1BS1A 3ESBA 1E96A 1B3BA 2JLSA 2QY6A 4R1TA 4CUKA 2C1XA 2VPTA 3GXOA 3W4IA 3G0IA 1E2MA 3LK7A 4HVTA 5I9MA 3TOZA 4HZGA 2O3UA 1LK5A 2YJ3A 3OZ7A 4NV3A 5IJ9B 4IOJA 4OUKX 5HQ3B 2UV8A 1EUDA 1L6RA 3LMKA 4JBYA 4LC9A 3CT6A 4F3TA 1E3MA 1GFIA 3ADBA 3N0WA 4U7TB 1IY9A 4MPJA 4YC7A 1OD6A 4YK7A 3PXGA 3DO6A 4Y6OA 3KPJA 1N2CB 3Q5GA 4FGJA 2R62A 4RV4A 2PH3A 3WX0A 5DSXA 5JD3A 5FOSA 3O4VA 1JEEA 2JGMA 2P9GA 4HY3A 1U31A 1M2NA 3KSRA 3PPVA 4OBBA 1XMOB 4YB8A 1GGKA 5G02A 3JVVA 3NTQA 4O8CA 5DTIA 5JT1A 1ISFA 2WHXA 4Q5IA 2YOHA 2VBIA 4FQ7A 4C0LA 5TMPA 1U5BA 5ICGA 4P31A 4WZZA 1KI4A 3HU2A 4F5ZA 1M0SA 3IBTA 4EW1A 2C5HA 3TIXB 5THXA 4J9VA 3U4DA 2D3TA 3V7UA 4MS1B 2JLYA 3PLAE 1J70A 1EWTA 1UPBA 4DJTA 4UCXA 4TQUS 3DL2A 4XZ3A 4E08A 2GR9A 3UJNA 1X7WB 1NWHA 1ZZEA 4URXR 5ADWA 3QEBZ 1DV1A 1KK3A 1A5AB 2C3YA 2ZWOA 2Q3FA 4DF3A 1JBEA 4FDAA 2P7IA 1P19A 5L51A 4NCJA 1Z4MA 2O5VA 2ZR9A 3BF8A 3OKAA 4MA0A 2G28A 1GQYA 5FLYA 4HK4A 3K6JA 3E05A 4YQYA 5F98A 5EIOA 3T7IA 2JI8A 1UKEA 3N2KB 1ZD5A 1Q14A 4AVYA 1JH8A 1HLFA 2WHPA 2FSPA 1JVBA 3EK2A 4HQFA 1L7EA 2I1VB 3QVTA 4MB6A 3KXDA 1L3BA 1PJRA 4RGVA 2FFQA 4YDRA 5L6LB 3V1UA 2GLUA 1ACJA 4GEGA 1PNOA 2BHLA 3ERCA 1B2RA 5JH7F 4A8TA 2C5SA 4ETIA 1QB7A 4DSAA 3QFHA 1VCMA 3QNUA 3MCWA 3PC7A 4HAUA 3ABIA 4XW2A 4CTJA 2C4TA 3OCZA 2A1IA 2IC5A 5AFSA 1UKZA 2O05A 2Z0MA 1QHHA 1SR8A 2GO1A 4HWGA 2IBTA 4X6YA 3UKDA 2K4MA 3LS2A 1U7XA 2QT0A 3A9UA 2IUTA 2J5KA 1SC9A 3G5TA 5FQOA 4WOCA 2C2KA 5HE9A 1NFQA 3L0IB 1X2BA 2AMJA 5CX1B 3UBMA 1IB6A 4OHZA 2AX3A 1DIGA 1OCEA 1P75A 2GARA 2ZPTX 3BTSA 3W5HA 3ZWYA 5B1EA 2P2GA 1O6GA 2Z2JA 3EA5A 4XQ0A 5LOVB 1GITA 2JDIA 4U6QA 3ZDFA 2ZIVB 1L0BA 1SO8A 2TYSB 1YF3A 2I6QA 2AQKA 2NVUA 2WU3A 3KJQA 3OPYB 1WXQA 4NCXA 5F3RA 1RWNA 2OQ2A 4ME6A 1JPJA 2W93A 2VXYA 3RHTA 3V7FA 4L9SA 4YRSA 4Y2VA 1XL1A 3ZWCA 3K09C 3L05A 4JZYA 3D8BA 3ITKA 1NUPA 1WD7A 2AZ4A 3OD1A 3DEJA 3IODA 3WAKA 4ENSA 5EA2A 5FBQB 4NX2A 4PNZA 4U2KA 2C2ZA 1US8A 2V3CC 3M5CA 4BZXA 2JFYA 1O2DA 3CH7A 4N5LA 2B4KA 3GPDG 3RUPA 1R0XA 3WSWA 1Q1BA 3AVTA 1RJEA 5CNMA 5B53A 5KNCD 4U7PB 1QTIA 4DLXA 3HKEB 1CUAA 4X1IA 4B6JA 5IT4A 2WJZB 1ZISA 5JZ9A 4TMWA 1Y6QA 5JAMA 4WKOA 3MUFA 4D1YA 5DHAA 1SMKA 4K0RA 2VTBA 3NI2A 1U2SA 2OTCA 3QELA 5SY4A 1J0BA 4AKTA 2R8EA 3FYUB 1L4YA 1COWA 3RKSA 3OEYA 1HKHA 2PX2A 3OTIA 4FMBB 3UJDA 2R751 2RH9B 4E0BA 4MITA 2ZRCA 4EFMA 3EQ8A 1G0NA 4GNKA 2VUTA 4RIHA 3WK5A 1D1QA 4PX3A 1V35A 4EY5A 2W8BB 2EKQA 2KQUA 4O4HA 3MELA 3GEEA 4LWPA 1ZUIA 1Y4ZA 3IS3A 5FX2A 3C1AA 1QBGA 1UKVY 1Z0ZA 1YRAA 1EP9A 1PGJA 3IP3A 3C5VA 3MGCA 4QX6A 4CKZA 4DR1B 4AKIA 2IYEA 4GC5A 2OSBA 3DONA 4KQXA 1N4AA 3V8QA 3P45A 5DV9A 4BCDA 5GZ3A 3AR4A 4LC0A 1HGXA 3SF8A 2X15A 4Y6RA 1GSAA 3ZWQA 1DHTA 3H2ZA 4AUEA 2GZSA 2HCRA 1JVSA 4G01B 5IK2A 4Q7JB 1GNPA 2ONYA 2QRUA 4FX2A 3AZQA 4EZEA 2XX3A 2X4LA 4URFA 3FTDA 3U62A 3N8GA 2ZJ7A 4NAHA 2FMUA 5F7OA 3OOEA 4X41A 4PFJA 3NDBB 1Y3DE 4UM5A 2G7ZA 2ARKA 3JZDA 4HN4B 1R6DA 4YLYA 4PZAA 1PFYA 4NIMA 1PUXA 1Z9BA 2GN1A 4X3OA 1G38A 1A98A 1QU2A 1I14A 1WCWA 4MR8B 3DEYX 1Z7EA 2B69A 3MCUA 3GPBA 3T12A 1K8RA 3HTXA 1RR6A 1VG0B 4E94A 2QN3A 1UJ5A 2DTDA 1X1BA 2GCPA 3GEGA 3PGVA 4PYLA 5TR9A 3ZV5A 4LN1A 4PN3A 3FLEA 3DF7A 1RWXA 3IQFA 2GVNA 1PR5A 3C87A 3E23A 3FROA 4D46A 2HQSA 2EOAA 4H0CA 5G0UA 2AUNA 3IKLA 3R9XB 3UMMA 1MEOA 3FVTA 4YJ3F 3EPHA 4NENA 5EUBA 1CUZA 2VP4A 2ZVQX 3GUHA 3MEQA 4DJDC 1SCUB 1N6HA 3CS3A 3IH5A 3K09A 4K1LA 1KKUA 3FWHA 5G4LA 3WY9A 4CCYA 2BTQB 221PA 2BUBA 1L7BA 3CLRC 3DW1X 4AZWA 2IS6A 2W8ZA 3OZSA 1QYCA 3CXUA 3ZC3A 2GM4A 1E9EA 1J0AA 3TL3A 4A03A 4QPDA 1TM3E 5J2UA 3ILVA 1M6VB 1N0VC 1X7GA 3ZIUA 1G1AA 5EP2A 5ICCA 4OHMA 3V5NA 3KR9A 4MVWA 3ZOKA 4JXXA 4RM2A 1GEGA 4YMIA 3HUFA 5CNJA 4B3XA 1N25A 1DS6A 1GA4A 4LRSB 5JCJA 5KYUA 1U1DA 1CLEA 1MUUA 1IJFA 1A77A 3DMTC 4C0AC 5H4GA 2R6R1 1I2DA 2RK4A 1RIFA 1AKWA 2FWPA 2IZ1A 2JA1A 3UGKA 1IWPB 2O0JA 3NAMA 3PDCA 4CG1A 1U4SA 2BEKA 1U1EA 3E53A 2HA6A 1OWPA 2A14A 3QXSA 3UENA 1WDLA 5HFAA 3BGOS 1JIUA 4ERXA 2W6PA 3ANNA 1ZAYA 2O8BA 5JS2A 2DSNA 3VU1A 5I9LA 4GH5A 3EGVA 4O4IF 1ZIDA 1RKVA 3D0OA 1UT5A 2WSLA 2ZJBA 4YLEA 1OSNA 1JXQA 4ENPA 3Q9UA 5J58A 3Q2KA 1O03A 1IVSA 1KI6A 1ZJ5A 2QTGA 3RHSA 1NC1A 3AVYA 1RAHA 1UXOA 1O8BA 3CW8X 4KMMA 3R7NA 5CDGA 4AO7A 2YQ4A 4OUDB 2UUAB 3KOZA 4IW3B 1HDYA 3HDHA 1UM9A 3A04A 4GRDA 1DO2A 1KK2A 1V41E 2PZLA 3CZAA 3E8MA 3MGGA 3Q11A 3EXG1 4I7EA 4F6CA 1PT7A 5JBIA 2GSDA 3SJBA 1C30B 4HZUA 4V0SA 2XAAA 4ZPXA 5HUHA 1L7OA 1AK2A 3EMBA 4OXNA 2A5LA 1UEJA 1FMJA 1WPQA 2I8AA 1E62A 3EGIA 3MGAA 2GEJA 2L69A 2WWWA 4J76A 1HR0B 4G0VA 4XWWA 2N9UA 4RDHA 2CF5A 1EZZA 3SZUA 3UNXA 4LV8B 2NACA 4DMHA 1WSAA 4RJKA 3JAWA 1A3CA 4HRAA 1A5ZA 3Q7TA 5I5EA 1TM4E 1H9AA 1OFGA 4MV0A 5KKAA 2X23A 5AVUA 2QR3A 4KQMA 3E5RA 1H6BA 1ZC3A 4A0GA 5ER6A 3GMDA 5D85A 4FHDA 1VJ5A 2ACKA 3K73O 2HC9A 5DK6A 2WDZA 1XMJA 3WLMA 4DPKA 2FWJA 1DOHA 4ZTBA 1QYDA 2ZSEA 1L4EA 1JEOA 1XDWA 2XNJA 5ALKA 1RJFA 3BXFA 1GZSA 2XJ4A 1MORA 1CERA 1FU8A 4P4LA 2DOKA 2PKRA 3K5IA 1Z45A 2AQ8A 1MOZA 1YOBA 5AKEA 3RANA 1XJ5A 3R6DA 1XL0A 1YJ8A 5L3ZA 3KVNA 2WHQA 2VAWA 3QXCA 3VNQA 1V47A 3C3EA 2WG2A 5DLPA 1KGSA 1VBMA 2PWZA 4XGIA 4ZJZA 4EUHA 4RK7A 1EVLA 2A30A 3KV3O 3VPFA 1WCYA 1EH5A 4HD8A 2WFLA 3T0IA 1P6XA 3FUXA 3NG1A 1E1QA 3V46A 4IZ6A 4R2XA 4Q9LA 1T3HA 3RS2A 4F1KA 1F8GA 3ZTTA 5KS2A 3EOBI 4KJZA 1WVIA 4LG1A 3T6KA 4KO3S 3BA1A 3KUXA 3QUCA 4RZ3A 4M1KA 5LQUA 3L6CA 2WU0A 3DMTA 3PXUA 4MRMA 2FZLA 1LJ8A 4RHYA 3KLOA 5F5NA 4CKEB 4MVCA 1VB5A 4PX5A 4MW4A 1J2TA 1JAYA 3NEYA 4QUDA 3W6ZA 4BMNA 5A9RA 3SHOA 3L92A 4CEJA 2WM3A 4M1WA 2J7PD 3ESZA 3UAZA 1QR6A 2HDHA 4TKZA 4JA2A 3OY7A 2F43A 2V03A 2QXUA 3UGQA 3N8IA 3WYBA 4E5NA 2A3NA 1F0KA 4DUYB 4DT1B 3IR7A 1VMEA 2FPMA 5EJ4A 5F78A 1PQWA 1OIWA 2VTEA 4QU9A 3HVRA 1WA5A 4E4TA 2PMKA 4KLRA 5SY9A 1Q12A 4A8JC 3O0TA 4QM6A 1JN0A 4P5DA 3HGQA 4LYJA 3RK0A 1IQRA 3AP3A 5I8ZA 2B8WA 3DTVD 4FZRA 4G5GA 1O3YA 5DGIA 2FF5A 1V7CA 2OHGA 2QORA 4QWMA 4W8HA 1A2QA 1JU4A 2SKDA 4L0QA 4R0VA 3T7JA 4YRJA 4DIBA 6CHYA 4EW6A 5K2MA 1ZH4A 3SX2A 4B3TB 2XDQA 4I9NA 3IHKA 2C7GA 4J2HA 2YMPA 1NF2A 3LF1A 3MNFA 3QI7A 2QSJA 5CW2A 3UATA 3QU4A 2QRZA 4RDCA 4DNPA 1F4PA 3A37A 4PYMA 1U0OC 4DS3A 3BIWA 4W9MC 1FDSA 1KI3A 1P5ZB 1P72A 4QE3A 3V8MA 3FCSB 4IGIA 5TEWA 1UBLS 2EEPA 4OB8A 5CYGA 2JCBA 2DCMA 1QORA 1WTCA 5DMXA 1V3UA 1OASA 2AFIB 3B3AA 4H7IA 3SK0A 2UZ0A 3I28A 2QYTA 4LHZA 4Z49A 3A2LA 4G3XA 1THMA 4D0RA 5FOQA 1FFCA 3SAJA 5BN4A 1I8TA 1P91A 2EWMA 3I1YA 3F5MA 2JLZA 2BYTA 1OC4A 4CLOA 3MSCA 5IBRA 1YV9A 5JI2E 1DC8A 1L4KA 2PIAA 2ONZA 3M6IA 3PUYA 1N0WA 4C4RA 2RKBA 6NULA 2EG5A 1ZGAA 2IPLA 3C3CA 3MTAA 3FGOA 3RIGA 3VPSA 1U3DA 5KNCA 2WJ4A 3N0TA 3SD7A 3ZVKA 1HLGA 3EDCA 3MUEA 1NJ2A 3PVZA 2PSFA 3T4UA 3WOHA 5DBFA 9GPBA 4R54A 3V80A 1ZLYA 3QITA 4HNSA 4DADA 4KLNA 1Y6RA 4P38A 2C84A 2VS1A 3E3MA 2J3HA 2QLMA 3W3AH 3TG8A 4PSCA 3Q8KA 4A4DA 1E60A 4YRRA 1Y8RA 2AUMA 3ANLA 3P20A 2ZSFA 4WERA 2Q7OE 4B79A 2Q5LA 2YXEA 4R2HA 5EXTA 4D9JA 3BSFA 2Q29A 2Y66A 1RT9A 2M6LA 2EF0A 2WILA 3HWWA 2QRQA 1V3QE 3G5AA 1WHTB 3IUPA 4HDMA 5FWYA 1G8YA 4QOJA 2OCPA 4OJNA 3DMRA 2WWVD 3VH4A 1KA9H 2BFDA 4EZBA 3AF4A 3QF4B 1Y4DE 4G2TA 4XYEA 1XP5A 3GFFA 2NPFA 1H4QA 1OI4A 3AIMA 4R2LA 4XWKA 1U99A 4H3SA 1R3DA 4MVJM 4V39A 5DB4A 4X7BA 4WBNB 2JCSA 3FOAA 4UU7A 3UHJA 1EU1A 3G2QA 3K0EA 5TMDA 2PAAA 1M74A 1BE0A 1XCJA 2XMGA 3NWOA 5FHRA 2O8DB 3VZCA 2PVCA 1N3IA 2FG5A 1SKBA 3LJKA 3R7DA 1UK7A 1YH3A 2B21A 4G1UC 4N49A 3PXXA 4NG4A 2DUNA 4RK0A 4ZOLA 3ZE8A 4D81A 2E1PA 2V65A 1H3NA 3STYA 1ICIA 1R0CA 5EXDA 1GGEA 4P2BA 5EWLB 2IYTA 1XVTA 2XA1A 3DMGA 3U7IA 3VKVA 5CLIA 5CB4F 4JQZA 3BICA 5EYPB 2H2AA 3EXAA 1FNBA 3RD5A 3GUUA 1YQ9A 4G0ZA 4G0YA 3I61A 1J39A 1TQ8A 1Z4PX 3FXAA 2P9CA 5A3QA 3CR8A 4B0OA 3THXA 1H2ZA 1R74A 1ZONA 2FPWA 3Q88A 1ZRMA 1MIHA 2IDJA 4RVCA 1I6MA 4UTNA 2X2PA 5K20A 1Q1QA 2QYSA 2Y6UA 3F97A 5K3FB 3NS7A 4BYGA 2G5PA 3WB0A 5KQGA 4J29A 3WLNA 3Q0TA 1D4FA 4F2GA 1FUIA 4DSOA 2GEFA 4MZXA 5BW8A 2YY6A 1Q50A 1HOXA 2MINB 1D1PA 4FX5A 1CP2A 1CUVA 3CLTD 5B12A 5JDCC 3ZXSA 2XDWA 1NC3A 3FYDA 3VR5H 4CMJA 1VXRA 1EWKA 1F2DA 1VLQA 4V3BA 3T7DA 1BNCA 3GH1A 3HKCB 3K1TA 5FR2A 3RH0A 1DZ3A 2OGWA 2RG1A 4WXEA 5EJ5A 4OB7A 4OFBA 4WI1A 1TC1A 3NWBA 4IH1A 2NO4A 4UBLA 5FEUA 1XEXB 4V3CA 5AI9A 1T5LA 2W6ID 4ZCRA 3KOWA 2B2NA 3O8QB 3CFYA 1WUIS 4WLNA 2OXIA 2FJPA 2HPHA 2WM2A 3WYGA 3W5CA 2ZIUB 4L0DA 5K01A 1E3SA 1L9KA 2MOKA 1PHPA 5DPMA 3RC9A 4RQAA 5JCPA 3NHKA 4AMYA 3PNYA 4WN9B 3IOMA 3ROEA 4ECAA 4MRAA 1MC1A 2O1EA 4X90A 2IY8A 1JLRA 2X9NA 3R5SA 1BDMA 1U9YA 2UZ1A 5C80A 1Y3FE 3H5LA 3EE6A 1QH1B 4M1OA 3RS7A 3RF6A 2P1DA 2CJXA 2VHWA 1DUSA 5HGJA 1RYZA 3TZEA 4MWEA 3P4UA 3VVMA 1HYEA 3HABA 4IIJA 1NVTA 4K28A 4HFJA 2GN9A 3IUSA 1BFKA 4D0SA 2CMGA 3PYLA 3FGPA 1VMDA 2BGMA 3WGKA 4TZKA 5CPFA 1IH8A 2ZYVX 5K2OA 3JALB 2O7VA 2QR2A 4D4GA 1ISRA 1E92A 3MRXA 3SGLA 2WI8A 4UNRA 2YXDA 2PH5A 4HDAA 3I5UA 4IIEA 1BEEA 4BXOA 3W06A 4QVKA 5K0EA 2IEZA 1CUXA 4RTKA 5LQSA 4YRIA 1E79D 4EVRA 3R9IA 3GJZA 4IF4A 5H80A 4N03A 5GOZA 4AUNA 1NDHA 2JIDA 1E63A 3MTGA 2A78A 3QKRB 1CUDA 1QPZA 1C50A 1BS2A 2MT9A 2FEPA 2Q2VA 3GW8A 5EY5B 1VXOA 2P9FA 3QVXA 1B6RA 3G2JA 3ZWDA 5JFOA 2Q5JA 2PKXA 3QK7A 3W1VA 4KXLA 3P4XA 2WJAA 3RAJA 4JYPA 2YN0A 3N6VA 3HEMA 3LVRE 1FLAA 5AWFC 3GV0A 4R8RA 2IH2A 2H1CA 2BPOA 4AAYA 2GWHA 3NGMA 1IIRA 4M55A 1SBCA 4Q05A 1ODCA 1K8XB 1L3IA 2OQRA 4CQNA 2BFCA 2V59A 2H08A 3MD9A 5C34B 1E6WA 4TS3A 4JS0A 3DLHA 2RGXA 2WD7A 3BJEA 1R50A 1XDDA 2BGRA 4BV8A 2H18A 2UZIR 3NKVA 3TSOA 4EHLA 3NHZA 4ZQFA 5JDCA 2QJTA 1YOVB 2BCJQ 4LMBA 3UMGA 5AIBA 5LU8A 4HR7A 4H15A 1YE8A 2N46A 4MEAA 3DV0B 3K9WA 2XITA 2G6TA 1CJVC 4MUGA 4DLNA 4M6WA 3KEMA 1ZXBA 3STXA 3CX6A 1JE1A 1ID1A 1ZOLA 2HCJB 4FDMA 4RYLA 1HT1E 3AIOA 1B2LA 1RD4A 3IE1A 3DOFA 3L82B 4D8UA 5EXEA 1BMQA 2J3EA 2OCXA 3FWKA 2XKAA 2UKDA 1LRJA 1K7XB 1XA3A 3S27A 4NE7A 3KIPA 4EHAA 3IHLA 3T15A 3OTWA 2BDTA 4M8SA 3F6EX 4DIMA 3WOVA 1CS0A 3U3OA 1HRDA 2EC5A 3A1WA 2OBFA 3H4IA 1D4ZA 4RPIA 5F35A 5FL7D 4C30A 2H7CA 3HBJA 3ZE9A 4NOKA 3NX4A 4LSZA 4MQEB 1OBFO 2VQ6A 5GJWC 3WYCA 3NASA 1ZCAA 1SKUA 2BZSA 4KWHA 3BQ9A 5L4LA 4MV9A 2FQQA 2L18A 4INZA 1VKZA 3DEAA 3K9BA 4GUAA 2C4UA 4XSGA 1FFAA 4D3XA 3A26A 1IUOA 3OFJA 5ANRB 1BXRA 2J7PA 3CTMA 4WKPA 3VDQA 1WUHS 1F0NA 1FFDA 4YJ2A 4UTPA 2C8KA 1VECA 2MSDB 2XWQA 1Y1RA 4PCUA 5AJHA 1RC0A 3KLBA 2HRCA 2FR1A 2OCIA 1CTQA 4EJ0A 3UT0A 2O4UX 1LPMA 4BNHA 3KQMA 2CSUA 1T36A 2WUGA 2VK8A 3RT1A 2OT3B 4M1YA 4P53A 4OA5A 4JI6B 2ALJA 1NPTO 4AJHA 4B4VA 4FCVA 3KSBC 1AS2A 2RI6A 4JVNA 2BR3A 4P34A 5AK5A 2E4UA 4LXXA 1Z83A 3TNFA 4OATA 3NBFA 2W2PA 3AESB 4Z51A 4HAWA 2ZYWX 2JJ1A 3DTVA 3R7BA 3OZCA 1XZIA 1PNRA 1UT8A 3VTZA 3SN6A 1IHYA 3A6JA 4FSDA 5CCEA 4RVUA 4B40A 4JR1A 3A05A 3MQ4A 1YVEI 4AYWA 3I23A 4ZMRA 1EDBA 3LDGA 3GMSA 4DFDA 1V6CA 5JY1A 4COKA 3EJ6A 1FY2A 3RBAA 2BZ0A 4WHMA 4BB9A 2CD7A 2PGDA 2R68A 4ZQIA 2JIQA 3EQZA 5FPQA 1VSTA 3GLVA 2NQ8A 2PS9A 1PEYA 3SXJA 2OENG 3GOHA 1E6MA 2X1VA 2E4ZA 4QHSA 5TPWB 1GILA 4WLUA 1PJ4A 2C78A 4ZK2A 1ZEMA 2Z4TA 5ENZA 3OTOB 2R0QC 4TM8A 1IL0A 1XMSA 4DILA 3GFOA 4YCCA 4ZRNA 2C3MA 3QIAA 2QLLA 1DX9A 1KJQA 5FLXA 3UA4A 1K8YB 4EDHA 3CG0A 2G09A 2W2LD 3M6XA 5DJ5A 3EG5A 3SSNA 4CL3A 3OFKA 4DVJA 3KTOA 3RFCA 4BRWA 1J00A 1NY5A 3UK1A 5DX0A 4AECA 5LBUA 3EFOA 1FBNA 3IHWA 4K6OA 5LM3A 1OFVA 1AS0A 1HDGO 1FP4A 2QD5A 2QVZX 4ZEVA 4DE5A 4JU9A 3R77A 4F60A 1T1GA 4WOPA 4DVGA 1MA3A 1N8SA 1TO6A 2IEGA 3BC1A 3VNBA 3CB4A 2XDAA 2ZOSA 2W4QA 3GDHA 3ORQA 2HBRA 5ERXA 3U5TA 2E37A 1ZHOA 4IXTA 5CJ2A 5T4FA 3CUTA 5EERA 4FCWA 5KWEA 2W2VA 1D7AA 3JQ7A 3A8TA 1X92A 1VOTA 3MINB 2R6HA 5B2ZA 2FWBA 2EQ5A 1NQUA 4X7MA 1ZDMA 1ZUNB 3HWRA 4FC7A 2QA5A 3BFJA 1UMBA 4EJ6A 2WM9B 3MRVA 3OF5A 4N5MA 1EX6A 3WBBA 3GLIB 2M1XA 5EVCA 1HTBA 1TJ3A 4CI0B 4EEXA 5DNUA 4OXKA 3AVXA 3AKDA 4IDHA 2CVZA 1WBDA 4NJMB 3G23A 2ONKA 1CY0A 1V8BA 1DKPA 2B3TA 3LP8A 4KO2S 5CT6A 3MB8A 4JVSB 3F5FA 4HMOA 4RZXA 3HUDA 2XGSA 2WTAA 1I3LA 4W5NA 3GRAA 4M8NE 1H8HD 1L5OA 5FWAA 1A4XA 1JLLB 4W8OA 3O3OB 3A3PA 3D4PA 1WS6A 4LXUA 1PT5A 1MO3A 4YAGA 3OD5A 1QV6A 3FPBA 4GOND 4UOZA 4JYZA 3IAAA 2C0PA 1S2DA 3AEKA 4L6AA 4P86A 3GUVA 2ZJ5A 5LA6A 1UOOA 2EFEB 3ROZA 4BX3A 4IXWA 4QPCA 3RODA 5ISMA 3K35A 3BF7A 3PNMA 3QW4B 3L49A 4ND4A 1DQNA 1GA6A 1JQ3A 4QRDA 4ZI7B 5A1TA 5IUNC 4JODA 4QYIB 4LNAA 2EJUA 3PNVA 5CUQA 4FEEA 4B80A 4XIFA 1NX9A 1ZD4A 5DH9A 5AKJA 4ALMA 4KAAA 1V16A 3WLKX 3OA0A 3OOHA 1WOMA 3UJ6A 3D6JA 4WFKA 3ZDEA 1H2FA 2GPNA 3PB3A 5BMVB 2ZJ6A 3L0DA 4TXMA 1ZM4A 4LZOA 4PNEA 1FNDA 3PNOA 3P9IA 5BVGB 4A15A 4JUDX 2WB2A 2DP4E 4LHVA 5E7QA 1WZNA 4HUQA 3F9IA 4CNBA 2TMYA 1VA4A 4MCHA 4RADA 1J0DA 4FKBA 5G3ZA 1WXXA 1XCBA 1PQ4A 2B6NA 2W6IA 1TLFA 4H9GA 1SHKA 1D9XA 4HH0A 1II9A 2PKWA 1XU4A 3KQHA 1Z2NX 1GZ3A 3KUUA 2OXFA 2Y2UA 5I7OA 2A9JA 3R4VA 1VPVA 5G1NA 3X1DA 4D7AA 1XEWY 5TRTA 3WKAA 4E07A 3LQYA 4NCBA 3I32A 2EVWX 3FYTA 3OCYA 1J6UA 4MW2A 1U3VA 1NN0A 3N9IA 3WMRA 1XZCA 3BDAA 3PWKA 1PWEA 2UZ3A 1KOFA 4MTLA 1Q16A 5D7BA 1XQ6A 2WAYA 2F1JA 1YCDA 3LQ2A 3ET5A 4OAQA 4BGEA 5C3MA 1YFKA 2ZSUA 3DP7A 5ALOA 5A4MS 3CF4G 2HEIA 3CWQA 1QGUA 2BI7A 3TKLA 4ZO7A 5HILA 4GLLA 5LD2C 1QE3A 3MK31 4BMDA 3R0IA 2A0YA 4K3UA 5TXGA 5T6MA 4CU2A 5HWSA 3GRYA 4N47A 4DJAA 3FHTA 3H8SA 2Y9PB 4PG4A 5KPJA 4EW2A 1TUGA 4B6EA 4CKEA 3PGA1 4ZDIA 4IH9A 3DVAA 1JG2A 1HF3A 2J87A 1K6JA 2GHQA 3GARA 4IWYA 3S28A 4DMUB 5H1YA 3V1TC 4M0FA 4FFMA 5JV5A 4Y7CA 2NV2B 3N75A 5JNWA 2RKWA 1E79A 4WASA 3ISVA 4CHGA 4IIUA 5IVIA 2AJCA 4QEZA 4TROA 4GP9A 1OXTA 1R6UA 1Y6JA 1ML4A 2IELA 2W6CX 3HZRA 3JQAD 3FETA 3QYAA 5AJWA 2E21A 2GAFA 3R0ZA 4OQDA 4YFYA 5JXHA 4H7JA 2AHRA 2CXTA 1GQ2A 3AM5A 3HO6A 3QNWA 3RSLA 3GEBA 4FDVA 3BE6A 5KTMA 4B0PA 4Y1RA 4BO9A 5GJBA 1SOAA 1JIXA 2X7HA 1OHHD 3AG6A 3H0KA 2VYQA 4FUQA 1GGVA 2NU7B 4I50A 3KJFA 4NYMR 4UXIA 3SJAA 3AKYA 3K9FC 3QVVA 2AOTA 3VMFA 1RYFA 1NQAO 2PT5A 3KJNA 4EQZA 3RS3A 4OHKA 3RRZA 5EZ5A 3OG9A 4B32A 3FCXA 2QKYA 1YS9A 1ZKMA 1JAXA 2H92A 2NYVA 1Z13A 1YGYA 4ZGWA 2WHEA 3TPZA 3EZFA 3KYCA 4JBHA 3HP7A 5NULA 5JNTA 4OA8A 4RZIA 1B15A 1JL3A 1S9DA 4WECA 4YRCA 1LPOA 1T8UA 5DU2A 1U8CB 1E6LA 5F7JA 5IM5A 3EIOA 5EN4A 2Q2NA 1U2TA 3AZPA 3VO2A 3DR3A 5HXAA 3ASZA 3AC0A 3EFBA 4EG4A 3WRVA 4CKWB 4I9GA 2W90A 2O2JA 4I5FA 3VVBA 4XUDA 3AUFA 2II6A 4J2OA 2FDXA 1CYDA 1VHDA 4MUEA 5HJ2A 1NJ6A 1CQWA 4K2HA 2W71A 5ELMA 3RBXA 3C3YA 4X66B 2P62A 1CX9B 3A6HA 2IYYA 2Q4TA 3I53A 3QA9A 2EX0A 2Q27A 4KODA 4KVFA 5FL7A 2DF8A 5LQJA 3SHWA 4Q93A 3NHLA 3R0XA 4M9UA 5IXSA 2C5GA 2BW0A 4XOIA 1YS4A 3KT0A 1ZP6A 1XP8A 3BCSA 4PLYA 4EYEA 4TYQA 2JI7A 1T5HX 5LB2A 5JNSA 2OORC 5BURA 1UBSB 1PZXA 1GP2A 2BH2A 4XWAA 3TVYA 5A4JA 4CMCA 4IIHA 3DT8A 5FBZA 5DGTA 3CX3A 4AG5A 1S8FA 1G8MA 5K03A 4B76A 5FA5A 2NZYA 1WRBA 2I66A 1T26A 1LSSA 3TKAA 3WDKA 4GPZA 5LP6B 3JQ8A 1K6MA 3VUEA 2XA9A 4F3CA 1ELOA 3U17A 1RLIA 3GG2A 5IM4A 5B2EA 3BD7A 3MUNA 3PJDA 4S05A 1PFVA 2X5KO 2NX2A 3F7OA 4N3GA 4A8HA 1J8QA 4R1NA 1VJTA 2X9LA 2J0EA 4MLCA 4QXPA 3HXLA 2FEMA 2A5DA 1YJCA 3ZU2A 1XMIA 1BMFD 4JC4A 1EK1A 3T3IA 4ZYTA 1BROA 4ZDJA 2QIOA 2QZPA 4HGZA 2AVNA 2EJTA 4MV4A 3BD9A 5HIIA 1OZHA 5K0SA 4RSMA 2QV7A 1QZ3A 2BELA 2QN8A 3OQOA 1QG6A 2QSZA 1KJZA 4EPRA 2RGRA 2FPUA 1KY5A 4R3UC 2MSLA 4Z5XA 1VBKA 1VA5A 4LRUA 5IT9A 3O93A 4FBLA 2EQAA 3LXUX 3MFQA 2C3OA 2E87A 2JKZA 5DN9A 4BVAA 3IBFA 5KNBH 1V5GA 2XUGA 4O5OA 5CW1A 2RHDA 3OQJA 4DCOA 5JNVA 5FPPA 2O59A 2HDNB 3BTOA 4X54A 1W5EA 4FJ0A 4NCAA 2RH8A 4XB1A 4INOA 3C7TA 3D2CA 3LUCA 1ZD2P 1NUUA 1OYWA 1GPMA 2YN4A 1RRPA 3IQWA 3PL5A 5DCWA 2GCOB 1XPUA 3NQ41 2Z58A 4QPPA 5SV2A 3ZR4B 1GRRA 4IQGA 4YALA 4TT3D 2ASEA 1LEHA 1LUAA 1ZRNA 3B6MA 3GA0A 3LT1A 2G83A 1K0FA 1GPH1 2XUHA 2ZR0A 4GMFA 3W4KA 2CSXA 1V5WA 4I3GA 4KFUA 5F2NA 2PXXA 3D3NA 5F9HA 2P30A 2WHRA 1PGQA 1C7QA 1PR2A 2NSDA 3TOVA 4NAUA 1B4DA 2I91A 1XMQB 1LVHA 1X86B 2BGNA 2PT9A 4LZLA 1Y8QB 4WSOA 1C7ZA 1D6JA 2XQGA 2ZU6A 2K2QB 1M7GA 3RSFA 3CZCA 4PZ9A 1I10A 4N9QA 1F38A 1GPWB 3BMXA 3JSAA 4TUYB 5K0GA 1WZ2A 4FFPA 5F7ZA 4BNMA 3EY4A 4ZZIA 1PYDA 5DN6D 2FEKA 3I0ZA 2I29A 3ZHCA 1E99A 4QA9A 2E0IA 1Y80A 1YBVA 2WA2A 2OORA 3AB3A 1QJ4A 3HY4A 1MH1A 3JQCA 4HLNA 4KAJA 2EKLA 1EA7A 2Q6TA 2ZKIA 2Y1WA 4X1IB 3QVGB 4PLHA 3SC6A 2E48A 3L1VA 1N6KA 4B6GA 4NYIR 1SBTA 5F76A 1Y7HA 1YBAA 3TLBA 4F2WA 3IO3A 3LYHA 4AX4A 5BQPA 4EHBA 1H0RA 3G6KA 4CLRB 3HSSA 4F3YA 2IJGX 4XKJA 2AB0A 2XUQA 4MEJA 2B37A 1U8YA 3PTAA 4JEIA 5JS7A 1QOZA 3ADKA 3W79A 3FPKA 2X0FA 4KQGA 4XH9B 4BVFA 2GN0A 2ZJAA 3HO8A 2ZTMA 2R5NA 4REQA 1SHJA 3R76A 4MUKA 3ZU5A 3SIPA 5KDLA 1NVVQ 1MAVA 3L4EA 2A0WA 3NHUA 4PZEA 1FFYA 1NQ5A 5KNDH 2UYOA 2BKUA 1UDRA 2Q6KA 3F2IA 5EZYF 4OQQA 3OO1A 3ABZA 2C5LA 2J8ZA 2OZPA 4FZ3A 4YCBA 3ZDBA 1X1CA 3D3WA 4HX5A 1OV4A 4L3OA 2DUJA 3HJRA 4O3FA 5HE8A 3C6MA 4U3JA 1JG7A 3D6TB 3MT9A 5ALFA 3PE4A 2OEPA 1WZUA 2WHYA 4F21A 3S1SA 2GFIA 4C3VA 3C16C 4RTJA 1OPRA 3YASA 4LJ6A 4PRKA 1LC3A 1LI4A 1NAIA 3T7SA 3SXPA 4DTIA 3CO5A 3CUEF 4D3YA 1QIKA 5YASA 1P1KA 2ZBFA 4YJKA 3QEMA 5G40A 3K1ZA 3ESDA 2P2YA 3GGSA 2OGZA 4LTMA 2QE7D 2JHPA 5B6JA 3IELA 2YJGA 1FYEA 4P2GA 1GFWA 5IABA 2MDTA 1W76A 1WMDA 5JSHA 1N5KA 3G2HA 1T4DA 2P3SA 3QSYA 1FXWA 3H5WA 4TZTA 1PU2A 5ALGA 3STHA 1GRNA 3O8NA 4JKYA 3UOWA 2O8NA 3D7SA 3COYA 1AY0A 1CD5A 1S4QA 2H57A 1DKQA 1KP9A 3ROMA 4F5YA 3LBAA 3U31A 2WYWA 1QG0A 1CZLA 2W58A 4P4UA 5F5XA 5IJAA 1KEUA 4YMWA 1RWQA 3ZOZA 2F9LA 3W6PA 3LD9A 4CG3A 2QLBA 3HV2A 2EWVA 3FUTA 1DBIA 3O8LA 2BFFA 3I3OA 4XCXA 5BQXA 2NP6A 3HBAA 3T1YB 4HWPA 4WNCA 5CA0B 4JEMA 1JP7A 2Y4NA 4XSHA 1APBA 5AVZA 1KYVA 3UWSA 3U26A 4EB6B 1C9MA 3RQSA 5L7WA 4P7JA 3GUYA 5C1IA 3GRFA 3ZY4A 2ZRFA 3LE8A 1AD2A 2VHVA 2BKVA 1GT91 1AS3A 5H4HA 4A2CA 3RTBA 3VVLA 2FFHA 3NWJA 4K05A 3DP9A 2OWEA 4J0IA 3GIWA 4JROA 1S8AA 3RYHA 5T8KA 5MF6A 1II8A 3NEPX 4H08A 4C08A 3UAXA 1FDOA 2XBUA 1I01A 3H0EA 5CT8A 1BE8A 1ZIOA 3MWEA 4JLSA 4ZAYA 5I9IA 1X2EA 4NAVA 4ZVSA 5HF8A 4F93B 2LRHA 3JQAA 3UH1A 1I33A 3L79A 3GZJA 4JUIA 5EKUA 3W7BA 4BCBA 2C42A 1Z6TA 2QAIA 3LKBA 1C2TA 2Y0CA 1IBRA 4LHWA 4OK6A 2XNSA 4YRLA 1KI9A 1DKMA 2YL2A 4Q4HA 3BFXA 4RZSA 5I7FA 1PFQA 1U3GA 1Y1TA 3CR7A 3FNQA 5DTEA 4BIMA 4QULA 1ADFA 1B0ZA 2ZG6A 3ANYB 2GEUA 3QPVA 4Q1CA 3STUA 1H22A 2YN2A 3IP6A 5CVEA 2YXPX 1UZUA 4G85A 3SDZA 4H4CA 4EY6A 3TIVA 4RKRA 4M2LA 2BY4A 2XZTA 2D0PB 3O9VA 2JVKA 4KQWA 3VJKA 1SXPA 2FPKA 2ZJ3A 3BWEA 2QDXA 2AUTA 3BD8A 4C0WA 4Q03A 4KXYA 2IGBA 1PFKA 1Z5NA 3BREA 2W2TA 3V1NA 3CVWA 4UTVA 1HNWB 2J3JA 1SKYE 1UAYA 2GM9A 1T0BA 2XH8A 3G49A 3TJRA 3CRMA 3MWDA 1FTNA 2EIHA 1RAGA 3OX3A 4G0XA 1I2ZA 3IJRA 4H4EA 2JD0A 3DOHA 4QEDA 1FLNA 1EE1A 3FPFA 2EL7A 3SZOA 3S99A 2O5EA 3LHKA 5CLJA 2GTIA 4JA0A 3CVXA 2DE0X 3ZLTA 1XDGA 1MVOA 2A57A 3MYYA 1JIVA 1BWQA 2WIDA 5JWHA 5EJ8A 4BVEA 4N6GA 5G0VA 4YQFA 1W4ZA 4ZO8A 5JD5A 3M1LA 1XKLA 2A86A 1RNLA 3FGNA 3I6MA 3GPLA 2HOQA 1BW9A 3AF3A 4L6CA 4F3KA 1WU7A 1CNMA 5JR3A 1QMGA 4I9HA 4V1CA 4FGKA 5C4GB 5HRAA 2YASA 4J6FA 3RS9A 4UMDA 4G56A 2G08A 2P90A 4TYYA 4XIYA 3NJRA 2Q5QA 1H23A 1RCTE 1E77A 2IXTA 3ORHA 4OHXA 4A9AA 4ZA2A 3LCMA 2H1HA 4J16C 1G5RA 1ZXLA 4I99A 4UHFA 1BE1A 1H1DA 5HS4A 2JEZA 3LQKA 2IYSA 3B78A 1A2OA 1QONA 1C0EA 1HURA 1M8KA 1W59A 2CLIB 2XIQA 4PLFA 3DM5A 3U3RA 3T7CA 4BFWA 1HBJA 4W99A 2Y0PA 1T6XA 2OO3A 3IL2A 1DELA 2FW6A 2GCEA 4A23A 5DYWA 3F6BX 1BVRA 5FJIA 2PEYA 4EHKA 4F4FA 5KAPA 1OX5A 5B7GA 5KU7A 3VR0A 4Z3KA 3R74A 3EXEB 3EFEA 4RC9A 2Y1DA 4CMEC 1E3LA 1F2UA 1E58A 2D2IA 2WE8A 2C97A 3L7YA 3N5KA 5BV0A 2QT1A 5CVTA 5JNRA 3M6FA 2A9QA 4KVAA 4P4SB 1R2QA 4UHJA 4RL6A 1EXWA 1RZ3A 3LBNA 3BB1A 3MLBA 1BHQ1 1DCKA 4DANA 4QUIA 2Z2KA 3K16A 3ZGZA 3CX7A 1REQA 3DUFA 4CR6A 1YZYA 4H1UA 3SC2B 5DYTA 1O96B 3GCWA 1BKSB 2Q4BA 5D1HA 2FMXA 5ALPA 5TB5A 4DLPA 2VXCA 5AM0A 3K4QA 1B0AA 2JJYA 1LTKA 3E7WA 3EQ2A 3R1IA 4H77A 1NKTA 1YC2A 3A31A 4P35A 4XYMA 1YONA 2C5EA 2WUWE 4RJ2A 4Y2UA 1TMKA 4FNOA 4PPYA 1XVVA 3E7DA 4HPXB 3U4HA 4PANA 3I9V6 4TV9F 4BTEA 1XU7A 2GPJA 3EZ9A 2B4AA 2BFOA 2CLCX 3AFNA 5IP5A 5C2JB 4AS3A 1HM5A 4HL6A 1BVUA 3L4SO 2TRSB 3LDAA 4BQPA 2CGEA 2QRVA 2VP5A 3SKYA 2NO7A 3I1FA 4W8GA 3BMOB 5DHPA 2R2GA 1WCIB 3UB3A 2QAGB 5CEEA 3DBIA 4EG7A 4C7MA 3P4YA 1VBNA 2AZMA 2VJKA 4U7WA 3RSOA 4DAOA 4L08A 4JNCA 4HVLA 1E18A 2R8YA 2WUDA 4TT3A 1LJUA 3CSUA 4C14A 1OAOC 4LRTB 3K4PA 5GZ6A 3AY3A 3NVAA 3SQLA 2GZAA 5E6UA 1H65A 1IBMB 3DZKA 3AHIA 4M1QA 1LRKA 4I9UA 1X74A 2Q8PA 2JAQA 3GN2A 1UXGA 3KJZA 1ESCA 3K70D 4ZDKA 5AXAA 1Y5RA 1F2VA 5AKKA 3H16A 2OBBA 3P26A 4EO4A 1SC4A 2PYZA 4MI3A 3CW9A 3IDZA 1SHUX 2MSEB 3AEUA 4YJ3A 2LCQA 2X8BA 1H4TA 2CZGA 1XJWA 3DBLA 3EIHA 3ZWAA 3ABSB 2PX5A 3QOWA 4U6SA 3X1YA 4G0QA 4CMIB 5DN6A 5DX8A 3M8KA 3LW7A 3NDIA 1IN6A 1YZNA 2OR3A 2V7QD 3OIDA 1GKKA 4ACBA 3EG9A 3L41A 4I1UA 2OE2A 1GD1O 3QOYA 1GXSA 1OWNA 5IU6A 1C3LA 3RF7A 2RHHA 1A8PA 2BSXA 3UGTA 4PYQA 4CKYA 5CXQA 2HA7A 3E9EA 2AJDA 4OHCA 1LXCA 1SXJD 1TA0A 2O3TA 2FEXA 3QRWA 3QUTA 2AEJA 4L27A 1BXGB 1UBRS 2E55A 4TQ9A 4YAOA 1J2JA 1G41A 3NP7A 4JSYA 5JAQA 3RU7A 3UT5A 1TGYA 4LK3A 3G9UA 4N6NA 3CEMA 1UMDA 2E6UX 3H1FA 1YACA 5INTA 5EL0A 3A1DA 4M3NA 4XM1A 2GF0A 3RSHA 2JCVA 1XZGA 1FBTA 5CJPA 1Z35A 5CYFA 3U7QB 3WLTA 1UZNA 4BWYA 4CMEA 3L4KA 1G21E 2G0AA 2V6GA 3QQ5A 1DUVG 2P4HX 4M0KA 1PDOA 2DZDA 2XGOA 4R5HA 3RVJA 4F2PA 3GJYA 6REQA 3WLJA 3T5AA 3PR2B 2XE6A 2OBXA 4PLPA 3ETLA 4TTAA 5I9SA 2VOJA 4E30A 4ABTA 2Y0BA 4GR5A 4TRMA 2Q7DA 1TRKA 1DBVO 3IC5A 3NBUA 2PY6A 4O4IA 4XPIA 4F97A 5KOYA 1DBSA 1C1HA 1G8FA 2CDNA 2HO4A 1N2GA 2PT6A 4NU6A 4OQXA 3V9PA 3BBLA 5F9FA 2G17A 1YQUA 3QIVA 1XNQB 2AG8A 3CCCA 3WMFA 2BSQA 4RVSA 1I7DA 1SOUA 4QO7A 3NRJA 3B82A 4V0QA 4K7JA 2E2WA 2K2WA 5JW6A 1F8FA 3R0JA 3HBLA 1KERA 3PKJA 4LTDA 5EWMA 1C9KA 2I7VA 2KI5A 3JASB 1XCPA 1KYTA 1WW8A 3P71T 5ALMA 4R01A 1MOQA 1QP7A 3I2JA 3KLMX 1H6CA 3QWFA 4OP3A 5EWJB 5IBPA 3PNLA 5C7LO 2BGKA 1G21A 4LBVA 3SVLA 2FSGA 3WAGA 3V7YA 1ZBDA 4CODB 2LKDA 3D8HA 1ECGA 2K6GA 1I3CA 1KS2A 3H9EO 4Q7LA 1USGA 4RFSB 4KIFA 5DMHA 2NUBA 4ZEOA 4A27A 4O4JF 2ADFA 4PAQA 5BR8B 1DTSA 1DWUA 4I81A 1H1LA 1G2IA 2PYDA 3ZQJA 1OAOA 5AUNB 4K6GA 5IYZF 4JJ6A 4YV2A 5FADA 4OJKA 4GSKA 2EZUA 3CEAA 3T0GA 1A97A 2V7WA 4O2BF 5E4FA 1T5IA 2I2WA 4XDZA 2EDCA 3EAGA 1MJGM 1QQ5A 2PQMA 3HVIA 4A0RA 4DCGA 4ESEA 3ZVLA 2CNLA 4FFBB 3FFBA 2ZCUA 1IWOA 4E2XA 3R09A 1AT1A 2VPXA 1Y81A 3ZGNA 5IVHA 2JFBA 1OU0A 4FYMA 3KTAA 1IFXA 2JFWA 3QE2A 4BNXA 4NL4H 1Z82A 5MN4A 3I58A 1LS6A 2NIPA 3GI1A 3MTJA 4Y1GA 5JJBA 2HV9A 1KFBB 2OAP1 2YZMA 1IM5A 3SSOA 4P82A 1OLUA 3PHHA 3VZDA 1MABB 2HBQA 2EU8A 2R66A 3KM0A 3NO4A 2QTNA 2GD0A 3T9DA 2ZB3A 1K63A 1RLOA 2X1LA 4WWHA 1ZO8A 4YHBA 4ZAVA 4KFRA 4H7DA 1JDNA 3WHIA 4DA0A 4B3DA 1U0LA 5ERYA 3DQZA 3C5EA 2O0LA 3KQTA 2XNKA 2A4MA 1OUMA 2Q1UA 3ESYA 1KNXA 4MGZR 3TLAA 4LRQA 4CVNA 3KXIA 4EUFA 5LYJF 1Q2UA 1KMQA 1VMAA 3IIKA 4FFRA 2IDZA 5HKBA 1MB0A 1H69A 1V1MB 3I8XA 3RFVA 4JJKA 3KHKA 2QW8A 2J7KA 3NUGA 3JPYA 2PMWB 5ALXA 4LVUA 5DYNA 2XY4A 3THSA 4DBZA 1JIQA 3Q40A 3KUCA 3NIFB 4UHBA 1RWPA 4YGXB 1LPSA 4EI7A 2PSHA 1EBUA 3KZOA 4M21A 4S04A 3BZWA 1IUKA 1R27A 3JR3A 3PUIA 5DCLA 3S1AB 1JHAA 2B4TO 1JHMA 2R86A 1HT2E 3PFHA 5EPOA 5EMMA 2IZZA 1W5TA 2HWKA 5ES3A 3KKMA 3RTAA 1YFLA 1ADGA 2A0XA 2RMKA 1SQSA 4L22A 1MENA 4CG2A 1VYUA 3A6PC 4AMBA 1OWMA 3EEOA 1RTTA 2PGJA 4ZICA 1QVWA 4KQ9A 4MR7B 1QHSA 2H00A 4UTXA 4JOBA 2VDUE 2WEKA 4DR6B 2ZIWB 4TRRA 3JY6A 4BKPA 3KHUA 4P0TA 4F4UA 6LDHA 2VQEB 4DIEA 3BZBA 4JJ7A 3MMXA 4UE6A 2OZVA 3A6EA 4KO1S 1A9OA 3ZWBA 1A4RA 1G291 1T4GA 4BLQA 3DFKA 4BO1A 5JNUA 4EG8A 4R2WA 3NTLA 2WC1A 4K5QA 1AUOA 4ARZA 2O14A 2RJ3A 1Z15A 4S3MA 5K6RA 4LY6A 2MSKA 3HLTA 3SHFA 1Z16A 3BWBA 8ABPA 3AVVA 2FCAA 3DZFA 2P4QA 2VP3A 4XUEA 3FKSD 3FLMA 4IBOA 4TQAA 2C2XA 2I6SA 3NHRA 4AMGA 5K8VA 1IN1A 4PZ0A 2UVDA 1E1RD 3IQHX 4ALLA 2YJ5A 1NBHA 2CCGA 3F5SA 2I7CA 2ZM6B 1LS1A 3R41A 4IDDA 4IUDS 3QBDA 4ICIA 3T4EA 3VU8A 4QKQA 2IP1A 4UTRA 3K70C 5JHGB 3WHLA 2O3JA 3RTDA 2Q3EA 3HXMA 2O3SA 2AG1A 5KYYA 4P0PB 2FUKA 1KC1A 2BGGA 1MB9A 1ZIXA 2JH3A 3VYVA 2Q8QA 1E2GA 3CIFA 4ZN6A 1TTTA 4WBXC 5F73A 1OFUA 5IJ0B 3SU8A 3GEDA 4B8ZA 4CGYA 1EFRD 1T24A 1Z2AA 3GCZA 4PC7A 3CWCA 5TLSA 3DVRX 1G6HA 1WXWA 1MB4A 3VKUA 3T7KA 5FUQA 4OOEA 3SP1A 2YWBA 3EEBA 1VIMA 2EYUA 2JEOA 3E1KA 3F67A 4KRFA 1SXJC 4LFCB 3WBKA 3V00A 5ALZA 4ZC8A 2IXDA 4O2LA 6Q21A 4LJRA 4XFJA 2COKA 2QJRA 1M0WA 4LDZA 3VR3D 2POQX 3O73A 3RADC 3ER8A 3HXKA 4MVJF 2GYVA 1WLSA 3MWYW 4TYPA 3RC2A 1NBWB 3WNZA 3EUAA 1LQ2A 1NG1A 1YD7A 4WMLA 3NIDB 4GT1A 2UVQA 1TX4B 4FEAA 4NSNA 5IBQA 4AY5A 3GQBB 3ROGA 2DPYA 3KR1A 4EHJA 5KYWA 1VE5A 1ZM3A 4YRFA 1PG0A 4YRNA 1CRZA 5FTKA 2VUHB 4BB0A 1NDQA 5K0NA 3Q10A 2F4NA 1G64A 1TB4A 1X8XA 3CF2A 1ZVQA 3FVQA 3NM5A 3P9XA 1UJBA 4MTCA 1TQ6A 3LRXA 1YR2A 4FXOA 4X3PA 5A7GA 3VUFA 3GY0A 2OO7A 1G5QA 2IE0A 1N6LA 1UPXA 1U8EA 1J49A 4WA7A 1LDBA 1HEUA 1S1MA 1XNJA 3H13A 4DM7A 3X1MA 1FVFA 1W48A 1YRYE 3I8SA 4KQCA 4C6RA 4BUZA 5B2FA 4KLCA 2IH5A 2ZAOA 5B36A 4XR9A 1MN6A 4IL5A 5KSOA 1UBTS 1UBUS 4HHEA 4OXQA 5IN5A 1KQNA 3S40A 1ZG3A 7GPBA 5JO0A 5EGSA 3U44B 1GNRA 5KWSA 3AERA 7MHTA 4X7RA 1JLMA 2X5OA 3W3AD 4CNQA 3WSVA 3EPPA 4NZZA 5EI5A 2CNNA 3DFUA 3ZGVA 5ALRA 4YUAA 5EJAA 5KKNB 4Y8VA 1IPFA 3TRKA 3K2EA 2WF5A 3TOXA 3VR6D 2AZXA 2GMWA 4I4LA 3AM4A 4MUIA 3FNRA 3FPSA 4GR9A 1JHDA 1SXJE 2IUUA 4BZQA 2V96A 4WCVA 3KXPA 1FRZA 2MYTA 3OICA 3ZE1B 5ADHA 2FXIA 4YYEA 4QDUA 1AC5A 3NM6B 1ZGJA 3EXG2 5G2OA 1MVLA 1CJUC 5CEFA 2Q3CA 4JLAA 5I6DA 3TBKA 1ZMBA 2W2KB 4LYGA 1HFJA 1V96A 2VPPA 2NXNA 1L5HA 4NQRA 1S3IA 4TWZA 3BKXA 3QTLA 3UV6A 1SZCA 4QWWA 4E4YA 4LJLA 4G1FA 4LZAA 2E4VA 3KDPA 3S8MA 2BMDA 3AVWA 2AWNA 2OBLA 1QCZA 2DT8A 2V7QA 1QG2A 2Q9AA 1I6WA 2M2IA 3GUCA 3Q7SA 1IG3A 1Z0KA 1A9PA 1MHTA 1WAMA 4MW9A 4B6SA 1ODLA 1V4BA 2ESRA 4IHJF 3GRZA 4MYHA 1L7QA 3CUWA 4A6EA 1YFJA 2P6UA 721PA 3ZW9A 3RC8A 4NFSA 3E0QA 2H59A 2A9OA 1SXJA 3FM9A 3RSZA 4BJ6A 3RAEC 4BBPA 1PVOA 4QO8A 3FJYA 2NU9B 3RCBA 2HMUA 4EKIA 3ABRB 1U5BB 2FSVC 1DBQA 2XIJA 3FZYA 4PICA 3G13A 2Q4EA 4R8LA 2AF3C 2J07A 4WZBE 3ZCPA 1GEEA 5M04A 2VK2A 3A2NA 1J2RA 1CUUA 1TVCA 3HKDA 4AZSA 3P9QA 3H6KA 4N54A 3I62A 4KDCA 2XB6A 1WP9A 3D8UA 4UVDA 4I9FA 2D2EA 2JIPA 2WV9A 3EPRA 3HJGA 5B58T 1NXVA 5KQMA 3TUZC 3FKQA 4QL3A 3H6GA 2ZFUA 4RGQA 3ER9A 1DBWA 1QRAA 1H5NA 5D5PA 4NWIA 3VR5D 2B92A 3IE0A 3RVPA 4C4SA 4BLRA 2BT4A 4WK2B 4MAAA 5ICEA 2O6HA 1F6WA 4RWZA 4C4TA 4EK9A 1KZ9A 1RQNA 2DSTA 3K15A 3V3TA 2MWMA 4BMSA 2B30A 3DV9A 4B4DA 1IE3A 1QNLA 4LQ4A 4EF5A 2H85A 3N8KA 2I2FA 2WHPB 2HHJA 3C4VA 1A95A 3NB0A 2CXXA 1JU9A 1P18A 3DCNA 1JFRA 5IPFA 1LTHR 3NC4A 1JYSA 1U2EA 3LFTA 4DUPA 1N36B 4J8PA 4DV4B 3KYJB 4PC6A 2IEAA 1XMXA 3CM0A 3NYRA 1M1YB 2ZTSA 4F0JA 5LMZA 4EG0A 4DJFC 2UYHA 2GPBA 3AHJA 3BRQA 4HDRB 4RVNA 1QHHB 2RBEA 1SOWA 1JJBA 4LYFA 4P98A 4QXMA 1ML3A 5BYJA 1PQYA 2OZLB 4BJHB 3FTEA 4DSNA 5LQDA 1G5PA 1GUYA 1X9HA 1PWYE 2Z08A 5E2IA 4FC6A 2HT6A 5KVQA 1FX1A 4DN6A 3EAFA 3OUUA 3WK6A 1JYFA 3W5SA 1EVJA 5HTOA 2B8EA 4DY4A 5AVYA 3RSCA 4E1VA 2CNWD 3BWDD 2FSUA 3SG0A 4BBZA 1XRRA 2PS1A 2F3QA 4CWAA 1A2BA 1MNQA 1YKFA 3Q4GA 4M7WA 4NDZA 3ZK9A 1L8LA 5F77A 1YNSA 2X86A 1FJXA 2GZMA 1F8XA 5SZKB 1QH8A 4RFVA 4R6WA 4OM7A 2XCIA 5KSWB 4MQUA 4Q3NA 4U2BA 1SVUA 1VI5A 1F14A 5IARA 5GIOE 3FUCA 1Z6QA 1US8B 3W0LB 2JBWA 2L2QA 3NHSA 1XWWA 2R1VA 1VCNA 3DZCA 4XDHA 1S3GA 1A9YA 1UAGA 2HSEA 4JY7A 4Y9DA 4QQ8A 3IEMA 2ZPAA 2PLRA 4GKKB 4KZKA 4V24A 4HT3B 2G4LA 1P31A 1KBOA 2PBLA 4TL6A 4ZP1A 2VTBB 2FSVA 1WO8A 1F9AA 3QELB 2I71A 4O5AA 2ECQA 1DB3A 1H8ED 4NEGA 1B1AA 2H4YA 2J45A 3LUPA 3MRTA 4Q9KA 2AA3A 3EB9A 4JKOA 2ES4A 5ERGB 3I01A 4ETMA 1HLPA 3TMYA 4LWOA 4LCJA 3F9RA 1C7IA 3FB4A 4RLSA 4Y18A 1XT6A 3V4RA 4K3VA 3ET4A 4RHTA 1JI0A 3EZ6A 1NQTA 4YS6A 1PFUA 3QA3E 5ECWA 1SUSA 4MP3A 1T43A 1SCDA 5SZJA 1B1CA 4DTCA 2AI2A 1S2LA 2PU7A 1TF5A 3F90A 3FJOA 3LUGA 2N75A 4XR4A 4QDOA 4BGVA 4RMJA 1NT2A 3ZHBA 1AV6A 3LOQA 1DI0A 2YX1A 3VTFA 5K4GA 3WRYC 2DU8A 3IPLA 2HU2A 4BO4A 2Q2WA 1UANA 4XD2A 4XFDA 4DCJA 1KYYA 5HPYB 4EUNA 2XQJA 1MU0A 2UAGA 3BGDA 3FOWA 4JVMA 1WXIA 4KWTA 1J5EB 1YQWA 4B3SB 3H5VA 4UARA 5FOTA 5EKTA 4LNUA 2XMDA 3FKSA 2ZAYA 1FNSA 5DNYB 1E1RA 1MEJA 4ZO4A 1PBTA 4ONEA 1UADA 3QMVA 5DNWA 2XYVA 4ACAA 4JQCA 5HKAA 3RBVA 1NTRA 1D8TA 2QQFA 4ZYZA 5COQA 2X22A 3C6YA 3JTEA 1CDOA 1OPXA 2YFKA 5ICFA 4POOA 1BHSA 1T3GA 3BL8A 1HUQA 3PNBA 4J1TC 4R1UA 5CB0A 3QWAA 3C6BA 1J09A 5JMTA 1S7GA 4TPKA 1N7HA 2I67A 3I04A 3NETA 1RM3A 1YKSA 1KO5A 2IEDA 3D6NB 4LCBA 1ZQ9A 4J03A 2FA9A 3WL3A 2R8RA 2OCDA 4J4HA 1BRMA 1ZHHA 2QRHA 4D3ZA 1SCIA 4NENB 1EFRA 2QS9A 4E1BA 2NUAA 1JFFB 2G6BA 1KZ6A 2CUTA 2F8LA 3T99A 1NVWQ 1CUGA 4S1OA 4IIVA 4PGHA