4QGAA

S.aureus tmk in complex with potent inhibitor compound 19, 2-(3-chlorophenoxy)-3-fluoro-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgaA00
4TLCA 2A78A 4C0BA 5CIQA 4Y0AA 2QMOA 3SEAA 1GVNB 2GK6A 1EFHA 4KU4A 1RC8A 1W4CA 4GP6A 3BK7A 3DKPA 2CBZA 2FFQA 4JYCA 4DSOA 3TRFA 1D9XA 2FPMA 2IX3A 1XZPA 1JQLB 2EYQA 2G83A 1E69A 2ZUBA 3D7MA 5KOYA 2PMDA 3M6AA 1G7CA 2ZRPA 1I4DD 2ZE5A 1ONBA 4A8JA 4Q4HA 4URWR 1W1WA 1BO6A 1E2JA 2AN9A 1Z2CA 2HEIA 4M21A 4LWZA 4IOJA 5K8TA 4JT2A 3U44A 1E94E 3SQXA 1NLYA 4TMWA 1G8GA 4TLBA 1SHKA 1X8KA 4A4DA 3EZ2A 1ZBDA 1G41A 4V0LA 1OXUA 2GXUA 1ZM3A 1XD9A 3RDPA 4BZQA 1IJFA 1J7KA 4MKHA 3FFBA 4LJ7A 5FOVA 3RS0A 3RWMB 1J2JA 2NMVA 4TN1A 4KV9A 4QC2A 2ORIA 4RCZA 4A2PA 2XNDA 1K5GA 1EFRA 1KNXA 2PEYA 3BFXA 4XVUA 1UEJA 3DZ8A 5HZKA 4DIEA 4Q4JB 3K09C 4O25A 4ZDKA 1IM2A 1VCMA 1GKIA 1QHGA 4KYIB 2GXSA 4QXAA 5CIWA 2GETA 2R8RA 2WTUA 1G16A 2CL0X 3R8FA 1S9DA 5EP2A 1XXHA 3RRYA 4YMVA 5E4FA 2QPAA 3VR3A 2QUZA 4FIDA 4AD8A 3AEZA 1N6RA 4LX0A 2W00A 1NI3A 4KLNA 4D6PA 2G9NA 1JR3E 4A2WA 5FOTA 1Z0JA 1KI3A 1J8MF 2O8FA 2D06A 2KJQA 2AFIE 4AY2A 3K0FA 3IO3A 221PA 1XEWX 2C9OA 4CT4B 3TSOA 4NMMA 3AF2A 3QKRA 3OEEA 1TPZA 2BCGY 4LJ8A 1YE8A 1X6VA 2FJUA 4HAUA 1S2MA 1Z0AA 1S3SA 4LYFA 1Z08A 4W5WA 4B3DA 4DSNA 4QJ3A 5CDFA 5EE0A 1G64A 1IONA 4F91B 3TQFA 3FMOB 1VMAA 5J4VA 1RRPA 3BB1A 5D3MB 2NO7A 3DOEA 3CWQA 3SOPA 1AZSC 1XNJA 3GFOA 1CLUA 4CYMA 3ADBA 1OIVA 1YZLA 4PC2A 4DHEA 4M1MA 2IXGA 2XNSA 1E96A 1FX0A 4OK3A 1WCV1 1GIAA 5KDLA 3B1WA 4DUGD 3IPYA 3PEYA 3TW4A 1WDTA 1F2TB 2PX0A 3K0AA 2O0HA 3L43A 1W2HA 3MSXA 5KPJA 2YWFA 2ZRIA 4B33A 5B58C 1UBCA 1DO2A 1JQJC 3ZVMA 5FPTA 1US8A 1T8UA 3L8YA 2GA8A 1M7BA 1P7CA 4I1VA 5LD2B 4NYMQ 4HDCA 4HEJA 3X1ZA 2XXAA 2BKUA 3Q72A 3TSZA 3QXJA 4URUR 1TF7A 4IVRA 1S4QA 4R2IA 1CULC 2QZ4A 4ESVA 3OF5A 2TMKA 4UQOA 2JLXA 2VEDA 3G82C 4Q9JA 2ZU6A 3N2IA 1COWD 4G5QA 2I1VB 5CYPA 2IWHA 3TK1A 2Z4RA 5JWHA 1Z8FA 2CCGA 1AZTA 1G18A 4A2QA 1GP2A 2ONJA 3THYA 4IHQA 4BLPA 3ICEA 4BE7B 2IL1A 2J7PD 5B57C 5DN6A 4KYUA 5JWOA 2ZIAA 5J47A 2FFBA 1UF9A 2A5FA 2PLFA 2UZ3A 4P4SB 4D80A 1Z83A 2P3SA 4WA7A 2CNWA 1NF3A 3W3ZB 1U81A 2JJ2D 5DI3A 1G8YA 4A0GA 1E9SA 4YDSA 4JVNA 5HR5A 4LOAA 2G1JA 3UG7A 1E6CA 3QE0A 2B8WA 2O0KA 1QDEA 1G9XA 4RCYA 2IYZA 1W2GA 4TMKA 2GAOA 2WJYA 4TTPA 1R5NA 3D31A 2GCOB 4Q1AA 1B0UA 4LJ5A 4EAQA 4IEIA 4OI2A 1CRQA 2QP3A 1K5DA 3SJAA 2DFKB 4EPXA 2DPXA 1VG1A 3GJ4A 4Q1FA 4G5RA 4A0HA 2ODBA 3TAUA 2CHQA 5KSZA 1E9EA 4OHWA 5JSZA 1OF1A 2G0NA 3BXZA 1KK3A 1KI9A 1KJYA 2C77A 2JGNA 2D2FA 3CRMA 4LC1A 2IUUA 2FPLA 5FBWB 4QL3A 2QMUA 3GJ0A 4JBYA 4P3YA 2ZUDA 3A4MA 3TGPA 2QL6A 4HUQB 5AR1A 3UG6A 3A58B 1EWQA 3U6BA 4JVLA 4DBLC 4TYNA 4CF7A 4OK5A 2VP5A 1E9AA 2R65A 1T0HB 1TQ2A 3A8TA 1GNRA 2ATXA 1S8FA 3B1VA 2FG5A 1MABB 2F43B 3ZS9A 1DAHA 4Q9KA 2VHUA 4HB3A 2YINC 4Q4LA 4XTRA 1UPTA 2WWGA 3CIOA 1E2IA 4ZCMA 1G3IA 2AD1A 3IO5A 2B7BA 3KUDA 4HB0A 4DLVA 1YZQA 5G3ZA 5BYJA 4TLEA 2BWJA 1R8QA 5FR2A 4B34A 3DOFA 2JCSA 2RGNA 3WBKA 4F93B 4C2TA 4B35A 1T8TA 1CXZA 1RJ9A 3P4XA 4A9AA 3K9LA 1HE8B 4NYIR 3BH6A 1CTQA 4BZPA 2IEYA 1IXSB 1M7GA 5FTKA 3DL0A 4NHOA 4D81A 4LHVA 4TMTA 4QKQA 3EASA 3FHCB 4KFTA 2XITA 1KI6A 2NZ8A 3W6OA 4KBFA 4TMVA 5JLJA 1KDPA 2WAYA 3SNHA 1SXJC 2H1LA 4NCKA 3LLUA 1GG2A 2IW3A 4Q19A 5DHFA 2IYWA 4KODA 4JLBA 4NH0A 3GJ7A 1H8EA 2WWFA 4ARZA 1XX6A 1OT3A 3DHWC 3MG9A 4ZPXA 2JLWA 4AIIA 1DADA 4FMBB 1II9A 1N6IA 3KJHA 2W0MA 1G3QA 1KO7A 3OHMA 5FOUA 2VP2A 2CCJA 2ZUCA 5HCNA 1TQDA 4B32A 2RGAA 2ZTSA 2BOVA 1XD8A 3R7WA 1JJ7A 4ERNA 2ZYVX 5KUTA 1P4SA 1UBGA 2V7QA 4PTLA 1KZ7B 1ZM9A 3GJ6A 5FUYA 3SDZA 1HYQA 1TU3A 3CW2A 3T34A 1WRBA 1N6NA 5LBIA 2ZJBA 3LVQE 1GNQA 1CU1A 5GJVC 3F8TA 1ZM4A 2NO0A 1S0UA 1LW7A 3NDBB 3EPLA 4O0MA 2VP6A 4DIDA 4DSTA 2QI9C 3DEFA 3ETLA 2YKGA 4LCBA 1IN6A 1YU9A 1E0JA 2QPTA 2V9PA 4OKSA 4PHGA 1DEKA 1DPFA 3P4YA 1ZW6A 3QOFA 3AVPA 1YR7A 6Q21A 2WSSD 3CF6R 2AWOA 2OG2A 2W2TA 1G7RA 1G7TA 1TMKA 3UIEA 5H68A 1OB5A 2O5VA 3KTAA 2A3RA 4LHXA 1D2NA 1N6KA 1NKTA 1YR8A 3E2IA 5JEEA 3O8BA 1AGRA 3QJYA 2VF7A 4ZKEA 1HY3A 1WF3A 4N3NA 3VR6A 4F7WA 3VR1A 2GF9A 4TSFD 4M22A 1ZU4A 5H8WA 4EJSA 4YMUA 1FUKA 1T5LA 1Z28A 4TL6A 4TZ6A 2V55B 1W7AA 4Z1MD 3HYRA 2F55A 3AH8A 3JVVA 2BV3A 3ND8A 3RS4A 3W5JA 2ZR7A 4PSKA 2JLUA 1GFIA 2QE7A 4GMXA 5BWMA 5CITA 2RB4A 3RANA 2J3EA 2QP9X 3KQNA 3IHWA 1W48A 1KO5A 1Z29A 4LJYA 2Z6VA 4AURA 5LDDC 2VHCA 4BEJA 4TQUS 4WIAA 1I2MA 4XWAA 3ZS8A 1HUQA 4LPKA 2J7KA 3CNNA 1RYFA 4TYQA 3A4LA 2O8BB 1TX4B 1M6NA 2O8DB 3WRYC 3BH0A 1R2QA 3NHAA 1UBEA 5HE8A 3B9PA 3ZVNA 1Q0UA 3BWDD 4QGFA 2DR3A 4Q21A 3QXXA 5G3YA 3W34A 3PEVA 3BBPA 2ZS7A 4J0QA 3TVDA 2WPDA 1T91A 2ZROA 2JIZD 1XEXA 3EWSA 5CK4A 5G53C 2ZJZA 1SKQA 4II7A 2WAXA 2PLRA 4PR0A 2OCYC 2ZE8A 3HDTA 1GILA 4M1WA 3LBHA 2H18A 2GWHA 4PFSA 1JALA 1G8PA 4YQFA 4IEEA 3MWLA 1X8JA 1ZCBA 2YNMA 2RHMA 2IYXA 1E32A 5CJ2A 3GP8A 1Q3HA 4OI1A 4PO8A 3AGQA 1H65A 1NN1A 4MRNA 3N2EA 3Q5EA 3SHFA 3S1AA 5HCIA 2XSZA 3ZD7A 4QOSA 1Z0DA 1YZGA 1VG0B 1DARA 1J8YF 4NBSA 1BMFA 4XD7D 1ZJ6A 3RLFA 4M1TA 3I4LA 3NBYC 4MGZR 2CCKA 3UMSA 5L3SB 1U8YA 2HJVA 4IXNA 4WAUA 3DO6A 3I72A 2BDTA 5JFGA 3CZPA 2VP4A 2W2VA 4MITA 2QMHA 2UVQA 4X8LA 3RABA 3LRPA 1XP8A 1ETUA 2MMGA 2WWWA 5EZ6B 4Q4AA 4XVRA 1II8B 1X8LA 1YR9A 3LBNA 4V02A 5CLQA 3QKSA 4GPTA 3CBQA 1Z22A 2YOGA 3F0TA 2J46A 3IIJA 4IKEA 3X1DA 4TLAA 3HWSA 4ZI2A 2DWOA 3U7HB 1D5CA 4AKIA 3EXAA 5JHGB 3QVVA 3U4QA 1OKKA 1SHZA 3BB4A 2BMJA 4Q7JB 1L7VC 1RVDA 2QAGB 1M8PA 1KDOA 1ZIPA 4OHVA 1Q57A 4C9BA 4NCJA 4Q5IA 1R7RA 2IYVA 2W83A 5DNYB 1SVOA 1XU4A 4NP6A 3ASZA 4IDPA 1QF9A 2FGKA 3X1XA 1WQ1R 5TV2A 2I3BA 4PXAA 4ITRC 3LWNA 3K0EA 3RNLA 1E2KA 2ERYA 4RFSA 3PUVA 3TUJC 3WP0A 2ZSEA 3QPVA 2GJKA 1U98A 2C9CA 1NVVR 4JKYA 1FNNA 3AKDA 4NKRA 5GVSA 1WMSA 2ZI5A 4CEHA 2JLYA 1RKBA 2ATVA 3WNBA 3H84A 3PUZA 4I4LA 4HZIA 2EWWA 4URZR 1N6PA 1U0LA 3DMNA 1C4OA 2H5EA 2HXYA 3L0IB 3V4FA 3KZ1E 2ODNA 4NTZA 3T15A 2PJRA 1LS1A 3U7EB 2FX3A 1W4RA 2IF2A 3UANA 2BM0A 2Z83A 3PITA 1H8HA 5A0FA 3OEHD 1OV4A 2D4HA 4QBIA 2IS2A 3IBYA 3QKUA 1K6MA 4A36A 2GEVA 4HLUC 4DZZA 1IN7A 1GUAA 4TLDA 4ZIRB 1W46A 4QGHA 1E2MA 1IY1A 3OIUA 4L8GA 1E2GA 3WYGA 3QF7A 3AUXA 4L16A 2P2LA 5B30A 1MO4A 4GSYA 3KKPA 1LV7A 1OIXA 4KFRA 1XPRA 1XJCA 1TUIA 4W5JA 2QT1A 5FOSA 4LDJA 4R2HA 3BIFA 3AP1A 2NOAA 2YC2C 4DKXA 3K8YA 1ZRHA 2QENA 1BKDR 2OO7A 4I81A 2GJSA 3K70B 1CBUA 5DO9A 2YWGA 3EC1A 2NGRA 4FD2A 2VSXA 3QF4A 1E2DA 1II0A 1HV8A 1R0ZA 3X1WA 4FCVA 3LD9A 2WIAA 1ESMA 3L0OA 4DWJA 3I3SR 2WWHA 3JZAA 4RD3A 4R7ZA 1AKYA 5UKDA 1XD2B 3J81k 1DE0A 1Q44A 1SXJD 4FMCF 1PZNA 1KSJA 4MRSA 5LD2C 3PR1A 3OIVA 4DCUA 1NLZA 4DB2A 4NPHA 4PZYA 1AGPA 2QQEA 3AVWA 4PZLA 2ZYUX 4HZUB 3TAHA 1KMHB 3ZD6A 5F9FA 1JEEA 5FTMA 2GTPA 4IVQA 3CRW1 1ZC4A 2G88A 4R98A 2BM1A 1EFTA 3KJGA 4P4UA 2QM8A 4V03A 3GLIB 3GLFE 5IHPA 3EPJA 1IOZA 2ZANA 2YV5A 4V0KA 1QHSA 3EA0A 3Q9LA 1QHHB 1Z06A 1P61B 3A1SA 2F1JA 4UNQA 1U8AA 1NBMD 4V0MA 1JI0A 4JLMA 5FBLB 4M0LA 4OL0A 1GDDA 2ORVA 2R6AA 4K46A 4LHWA 1R4AA 1NKSA 4ACBA 4E03A 2Q21A 4B44A 2DFNA 3C16C 2XB2A 2ZSFA 3THOA 2GZDA 2ZRGA 3UATA 4A6PA 1T9HA 2JEOA 2JLVA 4CDGA 4LGMA 4YMSA 3FKQA 3DM5A 2BMEA 3E5HA 1W0KD 2P65A 3F5FA 4C0HA 3SHWA 3K70D 1Z5ZA 5BYKA 2ZAMA 4LV8B 3KDSE 2MSCB 2BEKA 2RGCA 2DCUA 2VHJA 2XTMA 2YOFA 4B73A 2O8CB 4Q02A 1CR0A 1E9CA 1KDRA 1GRRA 1KK0A 1E9RA 1Z0FA 4OQNA 4HDQB 4U5XA 1YRAA 4YC7A 3OESA 2WWYA 3VKGA 3D6TB 5KHOC 3RRNA 4E09A 4EPVA 1Q3TA 1N0UA 1LFDB 1XZQA 5H1YA 3K9NA 1KI1A 5EXSA 3RVBA 2BJWA 2CE2X 5FUVA 2EFDB 2IYYA 1EFUA 1KAGA 3CONA 2GF0A 1G3UA 2Z4SA 3HR8A 2PMKA 4LBVA 1KIMA 1T3SA 2ZEJA 3QG5A 4JLJA 4M4SA 2PCLA 2FZLA 4TZ0A 2YVUA 1JECA 2ZJOA 4KO8A 4CEIB 1QG4A 2BCJQ 2CJWB 4HAYA 1QHIA 5FTNA 3AVTA 4D4MA 5BXQC 3A37A 4MYCA 1AM4D 2C95A 4W5HA 3VU9B 4DT1B 1DO0A 4B3FX 1JPNA 3C41J 4Q7LA 1X3SA 2G6BA 4IFEA 2FSIA 3LAWA 4Q1DA 2JATA 4RKFA 4WXPA 5EXXA 4DUGA 2XTNA 4DCSA 4NCIA 1RPZA 1JAHA 3SQWA 3ADKA 1EX7A 1HE1C 1U90A 2ZRJA 4P33A 2JLQA 5FFMA 3ECCA 4PPQA 4KSCA 2UZIR 1CR4A 2KB0A 4CT5A 5J40A 4D2IA 5AJYA 3N5CA 1SVWA 4IFBA 2VH5R 3PUWA 4MA4A 4OI4A 2IS1A 3TKLA 1CEEA 4YXWD 3SBDA 3GLFB 2WOJA 3U2QA 1WBBA 1GKUB 2ZYWX 4EQ6B 2RGXA 4JKIA 4XWKA 2E1RA 4HLUA 2PT5A 1KOFA 1UDWA 2XOKD 1COWA 1XJ0A 3B6EA 3RRZA 3CX7A 3LW8A 3TVTA 1E2PA 1BYUA 5TXGA 4D4KA 3LQQA 5HE9A 3G5UA 1HT1E 1C9KA 4JLAA 2W58A 1XXHE 2JA1A 2PX3A 4QJ5A 3SZRA 1T6NA 5JEDA 4L15A 2F3RA 2LCFA 2O52A 1Z6GA 3IIMA 3CZQA 3FWYA 3Q8XB 4WZBE 1FL9A 4NZYA 2OHFA 3X2SA 2QPOA 2YYZA 4GDFA 5J4KA 1BH2A 1Q1BA 4I99A 4QBHA 5JHHB 2JLZA 4D25A 5DIFA 2GILA 2IBMA 2W2XA 4D0NA 4LBZA 4LZZA 5EUQB 1Z3IX 2HV8A 2QNRA 4JLDA 2OEPA 4PQRA 2IS6A 5CDFE 1CR1A 5JJLA 5EJEA 4B3CA 1RRCA 4YONB 1KK2A 3PVSA 4KHZA 4B3GA 4TTRA 1CJTC 1TL7C 2B21A 1E99A 3IILA 4YDHB 1NIJA 4OYHA 1R6BX 4IDHA 4MUBA 2HYDA 5BN3A 4RFVA 1AN0A 1GWNA 4GOKA 1OXVA 1BYIA 5HTKA 1V5WA 2J87A 3EZ7A 3ZGXA 4A8JB 3GLGA 3EZFA 4Q4HB 1G6HA 2O8EB 5B64A 4JLOA 3LX8A 1AQUA 4EDHA 2QA5A 4OBEA 3CKLA 2W6JD 3U44B 3FDIA 3IDQA 1KJWA 4CGZA 1ANKA 4I1OA 2GVDC 2RCNA 1KO8A 3OFNA 1X1RA 4Q47A 3HPRA 1C1YA 2G3YA 5FH9A 1E1QA 2F6RA 1YZNA 2IYRA 3T1VA 5JRJA 2ZRHA 4P4SA 2XZOA 2JDID 3V00A 4CIDA 1ZAKA 2B7CA 1QVRA 2PBRA 2ZR0A 1LTQA 1Z07A 3CRVA 4FMDF 3QI2A 5KNBA 4BUJA 3KQUA 4G5SA 2X77A 4LV5B 3M4YA 2C5LA 1W4AA 4KXFB 4W7SA 2B8TA 1KTVA 2ZS8A 3THWA 1XTQA 1HH4A 1QBKC 3PENA 2GCNA 4Q9IA 4M1YA 2GCOA 1IN5A 2Q3MA 2D62A 2BC9A 4PAMA 4Q9HA 5D3QA 1IY0A 1VG8A 2F1IA 2JJ1D 3V9PA 1ZM2A 3AKCA 5SZIA 3VR4A 3ZZUA 1GITA 1KKLA 2B92A 4HSEA 4JSTA 2WICA 1E1RD 2BVNA 2OT3B 2WIBA 4MQBA 1F2UA 1OFHA 2ZVQX 3Q5DA 4OK6A 1N6LA 2I4IA 1YZKA 3VR5A 1E2QA 3IBGA 2ZRDA 3ZZ0A 3QKRB 4DC9A 1UAAA 2F9LA 1UJ2A 1G291 4F92B 2HF8A 4HB4A 1XEWY 4FMDB 1JXMA 1N0WA 4DRZA 1CJKC 4BFYA 1VHLA 2PL3A 3QNUA 3RS5A 1NMYA 1SULA 4D4LA 1M2OB 4LJAA 4MYTA 2WWXA 4PC6A 2BBOA 2C2HA 3REFA 4B75A 1G5RA 1G1MA 3LO5A 3WMGA 3ADDA 2RKOA 3EA5A 1NP6A 1FX0B 1G19A 2XEXA 1MABA 3RS2A 4LBYA 1FOEB 1ZNXA 2LKDA 2X8AA 4XSGA 2NO6A 2RGGA 4MUAA 3WHKA 3QBTA 4TL7A 2QQ0A 1US8B 3A36A 5TARA 4KSBA 1NMXA 1NVVQ 1P2TA 1SVSA 3AVQA 2ZU0C 4BASA 5CM8B 3A1VA 3PXGA 2F1HA 1GL9B 3MAAC 5FI1B 4NDZA 4A6XA 1UDXA 1OFIA 3VFDA 3MWJA 1ZNWA 2ZXUA 2QM7A 8OHMA 1SGWA 1OH7A 2EU8A 1DAKA 1ZD1A 3H86A 4TQAA 5AJVB 3I61A 2QSZA 2GHIA 1G3RA 3P32A 3W6NA 5EE9A 4ZCIA 1J90A 1PLJA 4HAZA 4AG6A 2CLDX 2WKRA 2WSSA 1G4AE 3KL4A 2Q0HA 1MV5A 4GBMA 5C2JB 5EXTA 1DG3A 2REXB 3MUFA 3THYB 3CR7A 5KU1A 2ZE7A 3HJNA 4NCHA 1NG1A 4AYWA 1NLFA 3QSYA 3TJZA 3K09A 1MH1A 4N0EA 1T5IA 1T0JB 2EFGA 2QAGC 2H92A 2RGBA 2ZRBA 2NPFA 4ESHA 1NVWQ 3LQRA 5EXPA 5B2ZA 1E98A 1Q1QA 4TT3D 1JR3D 2GZHA 2A2ZA 2ZR9A 4UXHA 3T5GA 4B2IA 4Z1MA 2IUTA 2ZVPX 3CF2A 3L0PA 2KI5A 4D82A 1Z6YA 5CJPA 1EESA 4G01B 3BFVA 2QSYA 5JBQA 4IOKA 4QBFA 3CPHA 3IKJA 3TE6A 4NL4H 1IQPA 5EE5B 1Z0IA 1FP7A 3VNVA 5IRCD 4BPBA 2MMCA 3O8DA 4B48A 2WKPA 4JBXA 5AUQA 5JCZA 1TQ4A 3BAFA 3LXXA 3PUXA 1P62B 2FWRA 2ERXA 5DSZA 1VG9B 1JJVA 1A2BA 2QEQA 3T06B 2HF9A 2J0SA 5FPHA 2PZGA 4KITB 1UKZA 5AJXA 1N2CE 3ZQ6A 1N5KA 1E9DA 2FEOA 5IDVA 5C4MA 3GJXC 3QVUA 3X1YA 1XPOA 2IXFA 3KQHA 5KNCA 4BLSA 4JJKA 3T61A 2V4ZA 3P1JA 1E79D 3QXHA 1GAJA 5G40A 2NPIA 2Q3FA 1G6OA 2GBLC 4DCVA 5E3HA 421PA 1YHNA 3ZQJA 3H4MA 3VAAA 5L3VA 1IXRC 3VKHA 1RRGA 4DLTA 3D8BA 1P9RA 1T3LA 3AF3A 3CPEA 3I92A 4WVFA 1KY2A 5TVKA 1ODFA 4FINA 2FSGA 4TYPA 1G8FA 3TUZC 4GFDA 2GJ8A 4XD7A 2R44A 5DH9A 3U3RA 2EFHB 2QBYB 3KX2A 4UXIA 2NO9A 3GEHA 3I8SA 5FTJA 2DHRA 3Q7QA 3C5CA 4JLKA 4DLRA 1N5IA 2AD5A 3Q3JB 3ZJYA 1EX6A 1NVXQ 4RD0A 3SI7A 3IUYA 3H2YA 3K70C 5F9HA 2FA9A 2ZS9A 1P73A 1VCNA 3PV0A 4E22A 2FZ4A 1SQ5A 2OE2A 2IT1A 4LI0A 2H16A 1X1SA 3GPLA 3C14C 3NTUA 1U99A 1TNDA 3ZIAD 2ZJAA 3EAQA 4A82A 1U9IC 4BZXA 1FNMA 3BFKA 1KGDA 1AIPA 1DELA 1RFLA 4LSGA 5KDOA 3ZYCA 1AS3A 1JXOA 1VYVA 4PHHA 5KTYA 3PIRA 2X19A 3BERA 5BQ5A 3LXRA 3B1XA 1Q1ZA 4C30A 2OFWA 1HTWA 4PO1A 3KQLA 1CF4A 3A1WA 3LA6A 3NBZC 1EFCA 1VKJA 2XJ4A 2HT1A 2AXNA 4HAXA 4LHZA 2E87A 1ZNYA 2VTKA 4BECA 1KI2A 1T3HA 3TUIC 4DVGA 2FPKA 5FI0B 2EYUA 2J1LA 2VSOA 3NH6A 4U7DA 5KSPA 2REBA 2RMKA 5DI9A 4B6EA 3RWOA 1QG2A 4AC9A 2QN6A 1SVMA 4TTQA 2R2AA 1NNEA 1P72A 5E7JA 2ZQ5A 2BJVA 5EUMA 4EPTA 3BB3A 4LYJA 1NG9A 3BE4A 3GD7A 2A9KA 2J0QA 5IK2D 1AKEA 3CWZA 3OEHA 3ZZTA 4C7OA 2FEMA 4XTCS 5JWRA 3TH5A 4RZ3A 2RGDA 1VHTA 2VQSA 2JJ8A 3GLHA 1S3GA 4JL6A 2P67A 1OH5A 1N6HA 2R62A 1TQ6A 2XZPA 4S35A 5FOWA 1NSTA 621PA 1E9FA 4PC3A 1Z63A 3C7KA 4RZ2A 2C98A 1R10A 5BN4A 1WBDA 1NY6A 1XF9A 3LW7A 1JNYA 2GEUA 2HLDD 1FW6A 4QGGA 2C78A 2YC4C 4B71A 2WVJA 4FI3C 1DTSA 1NN5A 1ZINA 2ZITA 1EK0A 2WV9A 4P32A 4W9MC 4BLQA 5J4LA 2HCBA 3UWOA 4EJSB 2OCAA 1NJFA 2FNAA 1VDZA 3NC1C 4ILEA 1CRPA 1BOFA 4B3BA 2NIPA 2YWEA 3RSOA 3T12A 1NN0A 2J59A 3QKTA 3I73A 3K0CC 5ANRB 1AJEA 4JBWA 4LK2A 2V7QD 5HKKD 4O2LA 5KYKA 3FPAA 2A5JA 2OXRA 2F3TA 2WOOA 2ZJ2A 1XTJA 4UNPA 4L9WA 3BGWA 2CK3D 5F98A 1ESNA 3HPQA 1N3BA 1SXJA 4EUNA 1ZMXA 3BD9A 3UPUA 1KAOA 4B76A 3VR2A 2BBSA 2ZM5A 3QQ5A 1A2KC 3EZ6A 2GZAA 3FHOA 4IRUB 1HT2E 3CR8A 1OXTA 3B9QA 3LLMA 4DLUA 3UMRA 2HDNB 4PSVA 2VYFA 4Q66C 2K5UA 5EZ5A 3RHFA 2H57A 2P5SA 3MWYW 2W6ID 1W47A 3GCGA 2J41A 3B8HA 5FUXA 4M9XA 3D3QA 4GMDA 5JECA 2ZYTX 2G0TA 2GRJA 4RZUA 5JRZA 1D6JA 4EPRA 3TNFA 1S1CA 4EPWA 1G21E 1WP9A 5K8UA 3NIBA 3CB4A 1NBMA 3AKEA 2AXPA 4DDWA 4WZ6A 2QG6A 3GFTA 1YJ5A 4ZDWA 3NH9A 5CYOA 4EKDA 4LY6A 1JEDA 1KSFX 4G5GA 4QGAA 2FF7A 4L5BA 3UMFA 1ZM7A 2IA5A 2GJ9A 1XTSA 2C9YA 3S1AB 2PZFA 4M1OA 2ONKA 2DYKA 3KKNA 2EWVA 3GQBA 3MJHA 4RY2A 3MMPA 2ZAOA 1W0KA 1D2EA 3B5JA 1XBTA 1TF2A 1FTSA 5LB4A 1A82A 3EG5A 3FKSD 2IXEA 2WJIA 2BBWA 5AJWA 1FPMA 4D0LB 4QHTA 3KFXA 3BRWD 1VCIA 1AK2A 3UWKA 2WMOB 4FN5A 3CM0A 4Z54A 1W36B 2PCJA 2ZSAA 4KVGA 1DAFA 4PPFA 3B60A 5IT5A 3AB3A 4WW0A 4B74A 5JS8A 1ZUNB 3U4QB 1HEIA 1KMHA 5P21A 4AKGA 1OYYA 3N70A 3CRRA 1KMQA 4C2UA 1PJRA 2ODWA 4A8JC 3BOSA 4GZLA 1GTVA 3GLIA 3OAAD 4MGKR 1XEFA 5FL7D 1QHHA 1OHHD 1SVIA 1W0JD 2HCJB 1OPXA 4CZ2A 2FGJA 1LNZA 4Z51A 4ZDJA 3KJEA 4X8OA 4DLZA 1ZVQA 2ZI3A 4RFSB 5M04A 1F5NA 1PLLA 2Q3HA 3W9YA 2QGNA 1NY5A 1OFTA 3VTKA 5JCPA 4BQSA 1NIPA 2VO1A 3VX3A 3GJ8A 1DAIA 1YZUA 2GNOA 5GVRA 2OAQ1 1RE0A 4JS0A 4Y0VA 4ZV4A 2I1QA 5FR1A 1E4YA 4V0ME 1M7HA 2QAJA 4E07A 2D7DA 4DEXA 2DWQA 3NC0C 4YXWA 4EPYA 1HA3A 4GP7A 3SYKA 1XCPA 2HYIC 1S9HA 4R71A 1KI7A 4D0GA 4O3MA 1CIPA 1O3YA 3AP2A 3THXB 1ZD8A 1X86B 3CH4B 4CEJA 3CPJB 1BS1A 2VHTA 2XOKA 5SZJA 3QXSA 4TMXA 1W36D 1FP6A 3OIYA 3SYLA 4AKEA 2RGEA 3RSLA 2OFOA 1PV4A 2QTHA 4XH9B 1LF0A 3B78A 3ZDQA 4LV6A 1U0HC 1GRNA 2KBEA 3B7GA 4OQFA 1FFHA 1M74A 4DDTA 1PVOA 2G1KA 3LDAA 3O8CA 4CEIA 3H1TA 2QU8A 3IEVA 1IXZA 3QENA 4GOJA 4NCNA 5L3QB 2WBLC 3E70C 1F6BA 1KI8A 1XMVA 3ZVRA 3A1UA 4BGDA 4FMCB 1FTNA 2DWPA 3HP1A 4DT1A 3K53A 2FH5B 1A1VA 2J9RA 1UKYA 3TBKA 3MWKA 4UNNA 4MKGA 5FOXA 1I2DA 4MKIA 1KO1A 2C99A 1VIAA 3DDCA 4QM7A 3CH5A 1J70A 4UNSA 3QF4B 1P75A 1FZQA 1YVDA 5E7IA 2J0UB 3WHLA 1W4BA 4MH0R 3FB4A 1FMJA 1YR6A 4LJ6A 2CHGA 1ZNZA 2D2EA 2VLIA 3TR5A 3GLFA 4MDEA 4GI7A 2P0EA 1L4YA 2OESA 3OZXA 1KY3A 1KO4A 4TYYA 1TUEA 2IYLD 4Q01A 5TDHA 3U3OA 3K1JA 4NE2A 2QTVB 4AG5A 5JJIA 3SS8A 3CO5A 1KYIA 4JMPA 2V1UA 1G7SA 4BRUA 2FV8A 4XOIA 2F9MA 4EFNA 4Q7MB 4JLVA 4IW3B 2W6JA 4AI6A 4HYYA 2RAPA 4IDQA 3QG1A 3FOZA 1I4TD 2RHDA 4PAOA 2BEJA 3K0SA 1NL3A 1RIFA 3QPUA 2J5XA 2MSEB 4QFMA 3MD0A 3UXMA 4DLXA 3WXMA 3RYTC 2ZRFA 3PG5A 2AR7A 4LPSA 2HJGA 4BLTA 1L4UA 2JDIA 4Q4JA 2QROA 4PANA 4WXRA 2WJHA 4YMTA 5AWFC 3U5ZB 3REGA 1DBSA 4PO9A 4US0R 2G77B 1DAGA 2PZEA 3QEOA 4TWZA 1R0XA 3BH7A 3I1FA 4KFUA 3SJCA 3RS7A 2VHQA 1OXXK 2WMNB 4OJKA 2AFHE 4PQYA 2BMDA 4GT1A 4LYAA 4OHXA 2OBLA 4LC0A 2VRWA 3KFVA 2X1VA 2CLCX 2QRNA 4ASUD 3BJIC 4UKDA 2JJ1A 3VMFA 4PPNA 1E1RA 2OZEA 3VQTA 3U7FB 4MGIR 2CLSA 2BHRA 2AKYA 4QG7A 5LPNA 5CLLA 2HT6A 1ZU5A 3CNOA 2J7PA 3EIEA 1E4VA 1ZC3A 3OE7D 3NBFA 3P20A 3EIHA 1ZYUA 4E5UA 2O8EA 4BFZA 1W5TA 1D9ZA 2OBNA 5D3MA 5FBRB 4L4UA 5EP3A 2A5DA 2KWIA 3EW9A 3IPXA 1DS6A 3EX7C 1GNPA 2KBFA 3FMPB 4BLOA 2DBYA 1WA5A 2ZRMA 1M34E 2JJ2A 3KKMA 2B6HA 4NYJQ 4DDVA 4G3XA 3QXCA 3L82B 3MCAA 2GDJA 3I5YA 3AVOA 3IQXA 3GLGE 2GESA 1F2TA 5JI3E 3R9WA 5EP1A 3AUYA 3KXIA 4OHYA 2CMKA 5GJWC 2VF8A 4JJZA 4WOPA 4R9UC 2J0VA 4P0TA 3VX4A 2GXAA 2NG1A 1CS4C 5FPKA 1UADA 1E2NA 2V8OA 3NVAA 2AHOA 4HLDA 2EW1A 1P2UA 5CK5A 4O2RA 1R0WA 2KE5A 2HUPA 1IBRA 3M1IA 4A15A 1CP2A 1MRSA 2UKDA 3P26A 3TLXA 3I8XA 3TW8B 2RGNC 4GL2A 2FFHA 3ADCA 4IOMA 1OJLA 1E2LA 3AQ4A 2QMEA 3PJRA 5DYGA 3SN6A 2GAAA 2C03A 3CX6A 1JAIA 3T1OA 1T4GA 4YLGA 3W6PA 2IYUA 5C18A 2CL7X 5KSOA 4AK9A 2KSQA 2OLKA 1KZGB 4FCWA 4DLWA 1QHNA 4ZCLA 4RD4A 5J4HA 2BMFA 2J45A 1R8SA 1UFQA 2ZETA 1OIWA 4MKFA 4JSYA 4B2PA 1HQCA 1NSFA 2ODEA 2ZRAA 2A5GA 4TT3A 5KO2A 1JR3A 3HR7A 1EXMA 1MR3F 5C4GB 3SJZA 3FVQA 1U0JA 3AF4A 3ASYA 2YWHA 3JZMA 3ZH9B 4F4JA 1VTKA 3IHLA 4AWXA 2QORA 3GEEA 3KQKA 4JL5A 1XXHB 4JLPA 1U94A 4Q9LA 4XIGS 1JPJA 1KJZA 4UJ3A 2VBCA 3LV8A 1BIFA 4EFMA 1QVAA 2OUKA 2O8FB 1HURA 3AVUA 3K0FB 4FWIB 1P2SA 4M1KA 4PX9A 5EE3A 2FN4A 1RW4A 3EPKA 2AWNA 4DJTA 2IF0A 3RAPR 1KK1A 5AUOB 2XX3A 2CDNA 1N5JA 4Q1EA 1WB9A 3QPWA 3LH5A 3WNDA 4BFSA 4HUQA 4U02A 3GLGB 4A0FA 1SZPA 3Q7PA 1Z6AA 1LB1B 2HXSA 3SU8A 2OFXA 4FXPA 1G3MA 5JI2E 1E79A 3W5IA 3FMIA 3PQCA 3T5DA 1Z6XA 1NMZA 1W49A 5F3WB 2F43A 2VIIA 1UBFA 5E95A 5DGXA 3NXSA 4LYHA 1AQYA 3K0AB 4P31A 2GVZC 3U3MA 5K8LA 2XNDD 4UNRA 3M0EA 3AF1A 4OI0A 1EFRD 3CLVA 4PHFA 2CL6X 2CHVA 1KKMA 2ORWA 3AGPA 1E2EA 4ZDIA 1MRNA 4AKHA 2WJVA 3B13B 3T1TA 1LVGA 5JS7A 4EJSC 2XXAB 2YHSA 2QY9A 3K9GA 4OQMA 4G5OA 2CVHA 3NEJA 5J4YA 1GM5A 1E2FA 4D26A 4B47A 2IHYA 3AP3A 3THWB 1Z0KA 2NZJA 3AF0A 5FPYA 3B85A 2R6GA 2IS4A 4IVPA 4MRPA 5JJKA 3MLEA 1EWRA 4DLYA 2OCBA 3MFYA 1Y63A 4G0NA 4FW9A 1KHTA 5DHAA 1F2UB 3WY9A 2BKEA 4MRRA 3OEED 4US1R 3WMEA 3CNLA 5DISB 3ZIAA 3SR0A 2ZI6A 2PH1A 1E0KA 4POAA 2VPPA 4X8HA 3FYHA 1SVKA 4TSFA 5FBQB 3QIAA 1S1MA 3AVYA 3AVVA 1W44A 2ANCA 4HAVA 4N0DA 5DI3B 3R8CA 1Y3AA 3O47A 2IHBA 5CB8A 2ZRCA 3DM9B 2XJ9A 1QZXA 3OFND 4B6FA 4DXAA 1I4LD 1DOAA 1E1QD 4KI0A 1N0VC 5FUWA 1TADA 1OH6A 4G1UC 1LF5A 1AS0A 2PT7A 2O0JA 3EC2A 3QEJA 3A6PC 2REOA 4OQLA 1MO3A 4WZAE 3I5XA 5DYIA 2QBYA 4Q18A 2ZJ8A 2C8VA 4IXMA 3FHTA 1E9BA 4N1AA 4UJ5A 5AUNB 5JSZB 2V1XA 3KJIA 2OXCA 3WNCA 1F48A 1OH8A 2D3WA 1FMLA 4GZMA 1KNQA 2RH5A 4A1FA 2AKAB 2ZSBA 1P9WA 2WJJA 3RRMA 3VHXA 4H1VA 3R20A 4URVR 3FE2A 4Z8YA 5IK2A 3PFIA 2JIZA 3DPUA 1XJQA 4HDOB 4V0OA 1VIYA 1VPLA 4C0KA 1CJUC 2N42A 2EVWX 2VP9A 2WKQA 3SC3A 4FWTA 4XJXA 3PCRB 1W36C 5L8VA 2X2FA 5DN6D 4PC7A 5GJBA 2WWIA 3AM1A 2Q9AA 4P4TA 4RJLA 2V54A 1TEVA 5CM9C 2HLDA 3HU3A 3WYAA 1ELOA 2BBTA 4JZKA 5K8IA 3DKVA 1XRJA 2CNWD 5AUPB 4DLSA 3NWJA 4I1SA 3BC1A 4C3ZA 2YZ2A 4CRWB 1ZIOA 5A5GA 2OM2A 4F38A 4QNMA 3LY5A 4M2LA 4K81B 1LY1A 4GNKA 3PUYA 4ON9A 5AJZA 1XMJA 1RJ9B 2AK2A 5KNDA 5FBVB 3C15C 2N1BA 4PZZA 2Y8EA 2OV2A 5HKKA 3C8UA 2R6DA 3T35A 3NKVA 1XB2A 2Z43A 2H8KA 2O8BA 2Q6TA 2IEZA 5H70A 4NYJR 2O8DA 5C1BA 4TMZA 4WBSA 3EZ9A 2CK3A 3BORA 3FFAA 1KI6B 2WSMA 5EE1A 4XWOA 2H7VA 1QHXA 2IWRA 4M1SA 1JBKA 1DG1G 1ZD9A 2FSHA 4HB2A 3LFUA 4KAXA 5GJCA 5SZKB 2ANBA 2GK7A 4C0LA 4UXJA 2XZLA 3IEUA 1M1YE 1Z2AA 3SBEA 3EIQA 3SFVA 1CR2A 1Z47A 2WJGA 3A1TA 3ND9A 5F2EA 4BFXA 3O8RA 4ARZB 4PAQA 1E0SA 1P2VA 2W6IA 4K8OA 4QRHA 1TF5A 4S2EA 2D7CA 3TR0A 1IAQA 3BS4A 2E9SA 4EFLA 1TEXA 3Q85A 4LJ9A 4QHSA 3LX5A 2JLSA 2XTZA 2GKSA 4MYHA 4CVNA 4US2R 1CKEA 3R7WB 2OILA 3KXLA 5SZHB 2IYSA 1L8QA 1G5PA 2R6CA 3GLHE 4LRWA 3WBJA 1IY2A 4NONA 3AV0B 4ZKDA 2A5YB 1OB2A 3PEUA 1OFUX 5HPYB 4LHYA 1NVUQ 3WP1B 4KJZA 5L3SA 2ASEA 3RC3A 3UKDA 4AYTA 2IC5A 3AKYA 1OE0A 3GJ5A 1U2RA 3FMFA 5AK0A 1R0YA 2X2EA 1E0AA 3LVRE 2ECKA 4OJQA 1GL7A 4M9ZA 4URXR 4F4IA 2QRZA 1VYTA 1P6XA 3U7GA 1II8A 4EIWA 3FKSA 4TL9A 3U6KA 821PA 4MYUA 3UK6A 5E7MA 1IJEA 2R6FA 2SHKA 4JLNA 3I62A 1PUIA 1XWIA 1YKSA 1TTTA 2P6RA 4DCTA 2R9VA 4CW7A 1N6OA 1HQYE 1SKYE 4IDOA 4MDFA 1PLKA 4LUCA 1VCOA 2YOHA 4Q03A 1OW3B 4QHYA 4ZO4A 3ONWA 1MKYA 1UKEA 4IOLA 4PHTA 3CF0A 3EWAA 5ELXA 2QAGA 3KTAB 4RD1A 1IN8A 4ABYA 3CX8A 5C46F 1H8ED 1IHUA 4FCTA 1FQKA 1G5TA 3U60B 2V3CC 4RVCA 2AK3A 2GXQA 3QY0A 3R9IA 3OAAA 1SXJE 2C04A 3A4NA 4JIMA 2Q9CA 5FL7A 3VNUA 1OHHA 1W0JA 3C4JA 5TMPA 3RC8A 2Q9BA 4C4PA 4NYMR 1XDBA 4YMWA 2EFCB 3HYTA 1XCGB 1XTKA 2ZPTX 1IN4A 1Q21A 3SFZA 3TMKA 4DSUA 2QT0A 3MRSA 5LB2A 2P6NA 2A30A 3WRXC 2ZSDA 4KBGA 1F60A 3NHBA 5TB5A 1NBME 4PPGA 1Q20A 4TYWA 1E2HA 3EARA 4XSHA 2DFTA 2H17A 3L8ZA 3KXKA 2DFLA 1W5SA 2OCPA 2C96A 2ZJ5A 4A92A 3H0KA 2EFEB 4M8NE 5FL3A 2W0SA 3SYNA 2NTYC 3NDPA 3HU1A 1UM8A 4NU0A 3V4RA 2IYTA 3U61B 1CJMA 3CUEF 5TY0A 1XEXB 4C7OB 4PSAA 2ZRLA 4ZIRA 1FUUA 2P5TB 2GBLA 2ZJYA 1G8HA 3GLHB 4BWYA 1N25A 3IGFA 1EG7A 4RSGA 2JASA 3EPHA 5EQTA 2QGZA 1N5LA 1UKVY 2N46A 4Q48A 1LS6A 4Q1CA 2WM9B 1KDTA 3P27A 3C5HA 2FFAA 4M53A 2FOLA 4BRWA 3U3KA 1Q12A 1B23P 5GADl 4F4CA 521PA 3WMFA 2OSBA 3R9XA 1DAMA 3B1YA 3G0HA 3W3AA 3MJRA 2Z0MA 2QE7D 4H9GA 4HLQB 5DE3A 2FDCA 121PA 2QTFA 1SKYB 1RZ3A 2L0XA 2OBMA 3GLIE 2CE7A 3AVXA 3HU2A 2ZI9A 4Q4AB 4QNRA 4Q00A 1YZTA 4TQ9A 3U3JA 5BN5A 2YJTD 1G17A 3QKSB 2OAP1 1D8TA 5KDDA 1O87A 1OXSC 1XD2A 1U8ZA 1Q1EA 3NBXX 4C0AC 5IF9A 4KFSA 2AX4A 3DMDA 2GJAA 1GZSA 1AS2A 2VL7A 4BFUA 1U9IA 1SXJB 1GSIA 4U00A 4HZUA 2FMXA 5G41A 5KSYA 2OLJA 3QBVA 4XVQA 3NEYA 2NO1A 2F1RA 3THXA 2ZI4A 1VECA 3VHLB 4BFWA 1MO6A 2WPDD 1MT0A 4URYR 1NN3A 3QUSA 3VKWA 2Z5FA 4RKEA 2A7QA 1OYWA 1ZP6A 2XAUA 1OLOA 3K9HA 4M9QA 4HAWA 2ZRKA 5EP4A 3GFPA 3GEIA 2NQ2C 3SJBA 4A0RA 3WYFA 1G20E 1UEIA 3FGNA 4L9SA 4TL8A 1K8RA 1Q22A 2VP0A 4JVSB 4D4JA 4HATA 4BFTA 1MO5A 4MRVA 1R5BA 3ICQB 2XSZD 5L3QA 3IIKA 1TU4A 4CEHB 1XTIA 2F7SA 2GEDA 1RRFA 1V43A 1BMFD 3W8NA 1ZCAA 5HZHA 5JZVA 4GOXA 3DZDA 4I1UA 1JB1A 4JYBA 4DB4A 4RD2A 1P3JA 2IYQA 4RD6A 3I32A 4QBGB 2O8CA 1XMIA 3IQWA 3LBIA 1J99A 3SE0A 1XPUA 2DB3A 4C0QC 4IJMA 5L3RA 4B3XA 5A4JA 3TSWA 1ZUIA 2FSFA 2IUSA 3B2EA 4ACAA 1WXQA 1MOZA 2J0UA 5JMTA 4ASUA 2EQBA 1EGAA 3TQCA 4DDUA 4JVMA 3LNCA 5FPSA 4BLRA 3FTQA 1S96A 2P6UA 1NRJB 2ZREA 4HI0E 1DVRA 2VSFA 5J5CA 1F3OA 1GKYA 1OKKD 1P9NA 3DVLA 3L2OB 1P60A 1FQJA 1CJVC 3OE7A 5DLQC 2ZE6A 2CJWA 3W8RA 3MGCA 2JLRA 4Z8XA 1G4UR 1OSNA 4X8MA 1VYUA 3CRQA 3E1SA 3TIFA 3VU9A 5CB6A 1KSHA 2ZI7A 3KUCA 1XTRA 4PC1A 2BIFA 1A5TA 4B2LA 3K0CA 4AYXA 1SVLA 1DAEA 1ZUHA 4HUTA 5KPDA 4Q7KA 2WZQA 3W90A 1L2TA 4PQFA 5FTLA 2WHXA 3ZLJA 3KKQA 2CEAA 4C0SA 2JAQA 4JL8A 1TAGA 4LJ4A 3GMTA 1R5OA 4KCGA 2CXXA 2GCPA 3OIWA 1KSGA 4MGYR 2ZRNA 3L0SA 2FE4A 3NG1A 1GL6A 4V0NA 3F3YA 2FU5C 4KLZA 1JR6A 4BEBA 4DCNA 1P5ZB 4B43A 2PEZA 5BW8A 1WE2A 3RS3A 2XB4A 4LBWA 3KKOA 4EQ6A 1GOTA 1QHYA 2CVFA 2IK8A 2VA8A 3T1QA 1H8HD 1GRQA 1YQTA 4JT4A 2QP4A 721PA 1RYHA 1YRBA 2LKCA 4CEJB 1XFAA 2V6IA 4Q1BA 4RZXA 2XGJA 2D74A 3ZVLA 1D2MA 1NJGA 4KVAA 4H1UA 3B82A 4HLCA 4QM6A 4C0JA 4DEYA 1PUJA 4GRAA 1A7JA 4NYIQ 2DY1A 1KI4A 3GJ3A 3PEWA 4OQXA 2LWIA 1QRAA 4OHZA 4QJ4A 3JVUA 3KB1A 2PJZA 4IDNA 1XMSA 3B1ZA 1XCMA 1A4RA 3KB2A 2V6JA 1E3MA 4ZI3A 4BFVA 1AA9A 1Z6TA 2AL7A 4M9SA 2MSDB
chains in the Genus database with same CATH superfamily
2IDZA 1L5QA 4TLCA 2CF5A 3SXUB 5AM2A 4D43A 1ZQ9A 2EEPA 4C6TA 3HXKA 5FLEX 1WNTA 2NUPA 3M82A 4OKNA 4Z6KA 4GP6A 1VM6A 5CG2A 4D4IA 3EVFA 1ZBQA 4GAEA 2I3AA 5CCBA 3COYA 4RY8A 4JYCA 1ZOSA 3WGLA 4J29A 1C0KA 3AI1A 2IX3A 2RH4A 4R8MA 1MB0A 1CUVA 1H6DA 3OPYA 3TX2A 5TGDA 2ZUBA 5DPMA 3ZDCA 1C7FA 3N8NA 1UKBA 2PMDA 4C1BA 1BZYA 4WBNF 3HDYA 2XV1A 4YDRA 1ZJJA 2CHUA 2IXTA 4URWR 1W1WA 4R1SA 3TW8A 1BO6A 2AN9A 2HEIA 3MGGA 3DA8A 3QPDA 1XA0A 4M21A 4O2BF 1JYFA 4LWZA 3RROA 4UCXA 4IOJA 4KE9A 4UZEA 3WQHA 3RRJA 1OWMA 4TMWA 5LXTB 1G8GA 3MB8A 4BB6A 1X8KA 5KIAA 1ZBDA 5TQ0A 5C31A 1N57A 1OXUA 3KVOA 3L0DA 1DEXA 4UC0A 1PJTA 3I9MA 3AF5A 4YA6A 3RDPA 4KQ9A 3PGJA 3JPWA 3C3CA 2PGDA 3H4IA 5H3CA 1JBQA 1GUFA 2XE4A 3FZYA 3RWMB 2X8BA 1IZ7A 3GGPA 4A16A 1VKNA 4QC2A 4RCZA 4AECA 1DT5A 2VK8A 3ECSA 3KBOA 1A9OA 1EFRA 4DW8A 3UFXB 3OI7A 4KSYA 1I1HA 2PS9A 3MC1A 4KYIB 1NQVA 4EKNB 4TXNA 4QXAA 4MR7B 4P3OA 2GETA 4F2PA 1Z5NA 4D0SA 3M6FA 4GYJA 4ODIA 2LDXA 3A4VA 3Q9NA 4UBJA 2OZLB 1E7SA 1G16A 1OASA 5FI5A 2PUGA 4JLWA 3WDLA 1S9DA 5EP2A 4NLLA 4J1NA 5KX5F 1YMUA 4S1TA 3GROA 5AHXA 1GTMA 1DQYA 2W00A 4Q05A 1NHWA 3H97A 2G9NA 5F2NA 2AI2A 4A2WA 3PD7A 3QI7A 5BW5A 2D06A 2AFIE 4ITVA 3P9CA 1XEWX 2C9OA 4FHGA 3FB1A 2OOKA 1B1AA 2XUHA 4NQRA 2VT2A 3UV6A 1M34A 4F04A 2F64A 1UT8A 1NKVA 1PR4A 3TAXA 2CV0A 1TPZA 2X4GA 3ZW8A 4ER3A 1BEEA 2XCLA 4LJ8A 4EGCB 3FZQA 4LMBA 4ND8A 3D3KA 4OHMA 1IDOA 3D4BA 3NR2A 4U1RA 4F5YA 4B3DA 2AFHB 2JI6A 4HDRB 3FPEA 4C4XA 4MIEA 3G1TA 3TQFA 2LGJA 2Q3BA 3EG9B 2H2FA 1RRPA 2Z6AA 3NRBA 2F8TA 2JKYA 3BQNB 3G2MA 2BEWA 3N6VA 4X3OA 2R8OA 4HF7A 4R1OA 3VDMA 3O8OB 1WB6A 3EEOA 1MOQA 4C4OA 1PG5A 3WLFA 1RM5A 3FLMA 4JGBA 1OIVA 3O82A 4FOSA 2B83A 1X74A 3P94A 3H11A 3ILHA 4GMGA 1F4LA 4JC8A 1MD9A 3B7WA 1DJPA 1GIAA 3D4PA 3TNDA 3OCCA 3IPYA 4UU0A 2BSQA 1W25A 4CI0B 1SZJG 1F2TB 3BX1A 1P0MA 4OJMX 3K0AA 3UYKA 1T5OA 1RWXA 3Q41A 4D6XA 1F12A 4U7FA 2COEA 3R74A 3FPLA 2RE8A 1DL5A 4R40A 4B33A 3AEQA 3ZVMA 4YB8A 3HB1A 4HTFB 1V3QE 2OBFA 5L8VA 4NPCA 5LD2B 3V1NA 4HDCA 5ES3A 5FYDA 4DXDA 2XXAA 1VSBA 4L50A 3OX3A 3TSZA 3UK2A 4GMKA 3RI3A 3IR7A 3QXJA 3VO1A 4URUR 4DV1B 4B6JA 3PWZA 2VEDA 2H8GA 4XKJA 5CMLA 5LP6B 3E9RA 2F62A 3N2IA 4O0LA 4AFNA 1COWD 2MDTA 1VE5A 2OHGA 1KPHA 3FSGA 3PNMA 2B8EA 2BHSA 2P0YA 2IWHA 1V1JA 2CXTA 3GT7A 1PTJC 3TRDA 1AZTA 1P4GA 1DX9A 2W6MA 5EERA 3T5TA 4X91A 2WU3A 3LKZA 2ONJA 4K9DA 5HUHA 1YULA 6ABPA 2HR1A 1WHSA 2JLCA 3FTDA 4BLPA 4HS9A 4MZDA 2J7PD 2Q50A 4L0QA 4NEHB 3GAAA 4RHFA 2JGIA 4J1TA 2JVJA 4JVOA 3H5OA 5J47A 4G56A 1W88A 3BRSA 3O4VA 2JBHA 4G1BA 4LAFA 2MYUA 4DV2B 3K9FC 3RTGA 2P3SA 1RZRA 1JLRA 1XQYA 2JJ2D 5DI3A 3ICPA 5I7WA 4YDSA 4JVNA 3TD2A 1LI5A 4LOJA 5JMOA 3R5XA 2PVPA 4LOAA 2G1JA 3T4UA 2NXCA 1YSCA 3QE0A 4W9NC 5IDYA 4ZXPA 1ZOOA 5EN4A 5CA1F 4LJKA 5K6AA 1IWBB 1LKZA 1NF9A 2BHTA 4HWSA 3ZWOA 3DAHA 1WJGA 2WVHA 3PXDA 4TMKA 5JNLA 1T4CB 3UJ8A 4UE2A 4QLBA 2DECA 4HUJA 1Y4AE 2IKSA 3LT1A 3PDHA 3COJA 1B0UA 3PL1A 1FFYA 1H2FA 4LF8B 1CRQA 1YS7A 2QP3A 2VDOB 4RF4A 4QPZA 2DFKB 1TVEA 3RFTA 3L07A 3OQ6A 4GOMD 4YJ3F 1E89A 1SU6A 4E11A 4ZHQF 4GM1A 1MNQA 2ODBA 4MR9B 3TAUA 4OHWA 4YV7A 5JATA 1KYVA 3EVGA 3I2YX 3F90A 4Z0HO 1KJYA 2IUUA 2JGNA 1H2HA 5KOIA 3NBAA 3ONEA 1C5KA 3PQDA 3AMVA 4JBYA 1GUBA 2R8BA 2H85A 4P3YA 4WNIA 4HGQA 3GU3A 1VC2A 3A4MA 2QL6A 2HV9A 2BEVB 2L2QA 3AZQA 3G3EA 4HUQB 3A58B 5C5DA 1UC9A 3ZXUB 3QVOA 5EKDA 1HWYA 3EZLA 3IXLA 5A4AA 3NGLA 2WJ4A 3IEKA 4WLFA 2ZQYA 4DBLC 1U3GA 4GX2A 5DW0A 3V2GA 4B45A 2VP5A 1E9AA 2R65A 1T0HB 1WD5A 2ATXA 3BN3A 4AJLA 1P4JA 1S8FA 3EMVA 3QU9A 1FNBA 4W82A 4GICA 1ONPA 2EBHX 1SCNE 2PRZA 2CN1A 4H60A 5CX1B 3KDPA 4Q4LA 5KNBD 2IKQA 1C81A 3QY9A 1PT6A 4ZCMA 2AD1A 3LS2A 2WWTA 3CN9A 1WB4A 1CR6A 2YRFA 1PL7A 1ML4A 1QWOA 2X3UA 4TLEA 5LC1A 5IJ0A 1Q6ZA 1R8QA 5CTAA 2QY6A 5C5IA 1DEHA 1L5LA 3KM0A 4YJFB 4FOTA 4G0PA 3QOWA 3CGWA 3GA7A 1VMEA 3VHQA 4B35A 5EMKA 3P4XA 3EXHB 4CMGA 3MB5A 3A1EA 1HE8B 4NYIR 1QTNA 3BH6A 1CTQA 4ZOLB 3ZN2A 6CHYA 4CIAA 2FR1A 5FTKA 3GFQA 4RVSA 1D8AA 4GH5A 5AK4A 2YDXA 1ZEJA 5EWLA 1M76A 2XNKA 2R60A 2VAWA 2XITA 3JWGA 3ETEA 4G84A 3ZHBA 2P4SA 2NZ8A 3BXEA 1SEPA 4ZO6A 4CTNA 8LDHA 2J3MA 4TMVA 4FP9A 1KDPA 1XNGA 4MQ6A 1BCSA 2BTQA 3AESB 2CKDA 4HH0A 4M0MA 2H1LA 3O74A 3ZGOA 4EYQA 2HX1A 2IYWA 3Q0IA 3EA4A 1K7YA 1VL5A 5DGCA 3R7SA 1V5IA 1WPGA 2DY0A 1AB6A 2VCYA 3DHWC 3HO8A 1GA4A 3MG9A 2D1FA 2FUG1 3MPUA 3OM8A 4AIIA 1N6IA 4OHUA 1U7ZA 1C0LA 3T9AA 1KO7A 3OHMA 5MN4A 4IJ5A 1RI3A 4WECA 3RAEC 4BBPA 1WM1A 1NQUA 1W85B 1P2FA 2H3EA 3G8BA 3QFTA 5HCNA 5JALA 4O4LF 2JIPA 1UQTA 1E3WB 3IAXA 2ZYVX 4YO7A 5KNDH 2WM3A 2JBWA 1WULS 2O5RA 4JA0A 2Z2KA 4PTLA 1KZ7B 3HE3A 1ZO8A 3SG0A 1DO8A 1HMPA 2VPTA 2WJZB 1WMDA 2XADA 3ASUA 4Y2GA 1HYQA 3I28A 4YRFA 5FIUA 1WY7A 3M6IA 1N32B 4LRYA 2ZJBA 3LVQE 4UD2A 4U2KA 1NU6A 3IJ5A 3FPGA 3NWEA 4UCFA 1S0UA 3D59A 1LW7A 2C5AA 2GBFA 2H2AA 1IHYA 2EDCA 3LPNA 2C58A 2VP6A 3INTA 2G07A 4O0MA 4TTVA 3H5VA 4DIDA 3ETLA 2YKGA 4KDRA 2Q1UA 1R3DA 1LLQA 2DBQA 3A6KA 3GPDG 4N8EA 3VHXB 2V9PA 1HPLA 1RYNA 2RCYA 3ACCA 3GMIA 4P5PA 4QUBA 4CI9A 5EJFA 3QOFA 4WNAA 1HKUA 4MR8A 3TD6A 2NYUA 2BD0A 2AOTA 2BZ1A 2QRJA 3LL7A 4MOWA 4BMOB 3WWZA 1SVNA 1EFPA 1XZDA 1XZGA 3ITEA 4R16A 1OB5A 5KWIA 1DAOA 3T5MA 4ED9A 1N6KA 3C7DB 2I22A 1YR8A 4DSAA 1MO2A 1PUXA 3VA7A 1AGRA 3QJYA 2FG6C 1TJPB 3VR6H 2Q1SA 1WF3A 3K96A 2NZXA 5U9CA 3L02A 3NBUA 3A9VA 3TQIA 4J3JA 5G0WA 4TSFD 4LSMA 1M6VA 5IZCA 1K4YA 3T99A 4JUIA 1Y5IA 1T5LA 1ZEMA 3VAZA 1Z28A 4TL6A 2VDPB 3D64A 4ZU3A 2PU5A 5H82A 4DOMA 4Z1MD 4X1OA 5KYTA 1WXFA 2FMHA 1W7AA 2BV3A 3CZMA 4JDUA 3RS4A 2YQ4A 3LIPA 4QUDA 4IGKA 3SMVA 3RJTA 2QE7A 1BX3A 2D5LA 5BWMA 1KEZA 3TXAA 4WKGA 4BQOA 4OLJA 1UOPA 1WOYA 1MC5A 1V9CA 2XAAA 3IMKA 1J8DA 1XYGA 3KPVA 2PBFA 4RA6A 3IHWA 4D5EA 1KO5A 1LK0A 2JCBA 2Q2OA 4IHJA 4CMBA 4EP1A 3FKJA 1Y9JA 2G40A 3P0IA 3WMRA 2OY0A 4RANA 1DC3A 4AU1A 4RVHA 1HUQA 2UXCB 2J7KA 1HNNA 1RYFA 2GPTA 3A4LA 2ZUVA 3CNNA 3RH0A 4ND7A 1TX4B 4F96A 5BRAA 5FEUA 3BH0A 2C54A 5K0ZA 5HE8A 1PNRA 1T0UA 3ZVNA 2AC7A 3IESA 5KVQA 3BWDD 2O1WA 2GN9A 3DD5A 4RL6A 1JJBA 1F8YA 3KTOA 4Q21A 2O2ZA 5G3YA 4F8YA 1VFPA 1ND5A 2ZS7A 2X8JB 3QK7A 2VZ0A 4MRAA 2PFKA 5C7LO 4II7A 1T5DX 1NW9B 2WAXA 1X80B 2XVYA 3A25A 3GFSA 4BMZA 4BMYA 3FTEA 3PA8A 2CFCA 4E12A 1XDUA 2ZUFA 1GQ2A 4E5NA 4ND2A 4MQMA 1SQFA 1OZAA 2GWHA 3AU9A 4YQFA 1K3TA 3BCUA 5BXYA 4Y1FA 4R7TA 1TCBA 3LDFA 2ZVDA 4PO8A 5BVGA 1RZVA 1H65A 1NN1A 5KQLA 4R2JA 3HDQA 4GSLA 3UB3A 4BKMA 2IDKA 4QOSA 3MS7A 1M2VA 1JEJA 1VG0B 1YZGA 2HRCA 4MHSA 4XD7D 1L5OA 3RLFA 4O4IF 5JAZA 2IU4A 3I4LA 3NBYC 3V46A 2BFMA 4IIJB 5LQAA 1NV8A 1ZI8A 4QU8A 3UMSA 1DZIA 2F1OA 4P7GA 1M73E 3O94A 4KQJA 5EHIA 3VJRA 2E3JA 5CXXA 3MTEA 2ORYA 2PMWB 2W2VA 4MITA 4FFVA 2QMHA 2P9EA 4F97A 4KO4S 4RA9A 4UEQA 1WWKA 3JU3A 4ZPXA 2WWWA 3MBKA 5ED0A 4XVRA 1LZKA 1II8B 2ZWAA 1VE6A 4I9GA 3LBNA 3X44A 3Q8KA 3ZZMA 1XRRA 4GPTA 4ZYZA 1N7GA 3LWZA 4HX9A 5DXAA 1T1RA 2PBZA 1M1NB 2E82A 3O3MB 1Z22A 4PSCA 2O8NA 5ENVA 3TRJA 2H2IA 2I7VA 3D5TA 4K6KA 3L04A 4WD3A 3R0JA 3U7HB 5BW6B 5EMLA 3QVVA 5JHGB 3JQ9C 5L95A 3CLSD 2A8YA 3V4PB 4EY4A 3K94A 3Q3VA 1QO0D 4Q7JB 5JMWA 5K99A 1L7VC 5LA6F 3BMQB 3IP5A 3Q1KA 4A0SA 1MCZA 1KQFA 2H5LA 2G09A 2DQ4A 4QU0A 3AUJB 4HNVA 4OYYA 1H6BA 2G82A 4XCXA 2I3BA 5G4KA 4IZ6A 2CZQA 4HDKB 4OXXA 4RFSA 4RQAA 3K2EA 4PNZA 5G4LA 3TUJC 3WP0A 4GX5A 3DL4A 5DYTA 2GJKA 1U98A 2C9CA 1NVVR 1FNNA 3AKDA 3I0ZA 4H08A 4QATA 4CF4A 1RKBA 1OU4A 3WOVA 3H84A 1V35A 3PIIA 1GCGA 1GG9A 2LIVA 3M3HA 4RXMA 1DCTA 1L7XA 2EWWA 4AZSA 4P5EA 4Y9SA 2XUZA 1MBZA 4UOZA 3UN1A 1U0LA 3DMNA 1UBRS 2H5EA 4LYEA 1R4MB 4XGRA 4BNJA 1FDTA 2VG8A 4FFLA 1PFWA 3KZ1E 4XIYA 3ZHCA 2PJRA 1M10A 1SIBE 2ZZMA 1EP1B 1IM5A 4XQGA 1UZNA 1P5JA 2BM0A 2Z83A 2JFPA 2YN0A 3D6FA 3I42A 4WV3A 3SYTA 2LW7A 4H77A 3OEHD 3QMMA 4JJGA 4PX3A 3H2KA 4DCGA 1I94B 4QBIA 1U7OA 5G0SA 2A4MA 2NAFA 1JDBB 4U7WA 1I3MA 1TJ4A 4BV9A 1DIHA 1GUAA 2GD6A 3HGQA 4UUNA 3EMKA 3LCVB 5AW8A 4QGHA 3BFJA 3M9WA 2AC4A 2W8ZA 4M60A 1ZHFA 4KDEA 2CXNA 1AKVA 3D3WB 3DOCA 3FFTA 4JYPA 4MNTA 4HDSA 2QNIA 4QD3A 4YR7A 4GSYA 1RBMA 1LV7A 3KKPA 1FS4A 4IYJA 4MV0A 4WTOA 5E4TA 4DCJA 4YCNA 2W6ZA 3K05A 4KFRA 2J85A 3ABRB 4KXYA 1RZUA 2FOIA 5FOSA 2QT1A 9MHTA 4R2HA 5TEVA 1I5EA 4IQ0A 5DM2A 1L4MA 3K31A 3T3NA 2GF2A 3AP1A 4DAEA 2YC2C 5AVZA 1FRZA 4KO3S 4DKXA 5KYXB 5AP9A 5FUMA 2LDBA 3MQ2A 1ZRHA 4FU0A 4DLPA 2Q3LA 1N34B 1ZWKA 2OO7A 4I81A 4PLCA 4JD5A 1RLOA 5EUCA 3VH2A 2HJSA 3OCYA 4G36A 3UK0A 1GCIA 2VPYA 2H11A 2C0PA 2ZJ3A 3UK7A 3MJVA 4YPVA 4O59O 4OP3A 1E2DA 3NKFA 1HV8A 2J8ZA 1UPXA 2BEUB 1PBNA 4DM4A 1TJ5A 3BEOA 1ESMA 1OLSA 2FEWB 1Y42X 3OPYI 1VCHA 2GHTA 4LRQA 4DBZA 1W8IA 3V2IA 3JZAA 4XB1A 1AKYA 3BL8A 5LU8A 1DE0A 3M3DA 1SXJD 1KSJA 4ZI7B 1XQXA 3PR1A 3OIVA 3VR2D 1KPGA 4DCUA 4RIGA 3OLWA 3DMGA 2JGEA 1N2BA 1AGPA 1ZDMA 2QQEA 1K3UB 4JOCA 2NN3C 3MWGA 1I1OA 4WK0B 2HMWA 3CRZA 1LI4A 5F9FA 1ZSVA 5FTMA 1X2EA 13PKA 5L9AA 5AVOA 3CRW1 2L82A 4QU9A 3T7AA 2G88A 4R98A 1A69A 1EFTA 4IKOA 2QM8A 4P4UA 1L3IA 3GLIB 1WSAA 3AR5A 3S8MA 3DWFA 1J2TA 3RQSA 2YV5A 3EHEA 3LA8A 1QHSA 4O63O 1Z06A 4LYDA 5B12A 1NVGA 1PT5A 2WINI 3V80A 1HYBA 4UNQA 3WWCA 4EG0A 1NBMD 1BTOA 4H3HB 4WKCA 2JBAB 4JLMA 4K9KA 5FBLB 4M0LA 3RODA 3R2JA 4OL0A 1FSPA 2RK4A 2ORVA 2R6AA 4TWAA 1JI3A 4P4GA 1NKSA 1PQWA 5CEEA 4JP5A 2Q21A 4E03A 4P0PB 3M81A 1CQIB 5AI9A 3AEKB 3C16C 2IIPA 2WD7A 1Q0QA 2ZSFA 3HABA 2GZDA 1QAQA 5ECGC 3UATA 3VZSA 4AZTA 4YRNA 2P9JA 1IEWA 4K0RA 4CDGA 4Q3NA 2WJWA 3E5HA 1WKBA 2QUAA 3CV3A 3K70D 2FQXA 5NLLA 5HZMA 4P9NA 5MGNA 2PR2A 2FQWA 3PFFA 3L7KA 4LZLA 2RGCA 3B3AA 2VHJA 2XTMA 3UF0A 3JSXA 2DH5A 2P27A 4WKBA 2Q5QA 2ZXFA 1N8NA 2FE1A 2XE7A 3WA6A 2JFVA 1TUBB 3FWKA 4YC7A 4J7XA 4B9EA 5T67A 3WNQA 1Z35A 3VKGA 3W5VA 1GTZA 3LZDA 5JXWA 1SCBA 5EZYB 1VMIA 1LFDB 4U0KA 2ZULA 3K9NA 5EXSA 2VKQA 3V4FA 1FLVA 5FUVA 4EZIA 4MV4A 4HADA 3H2BA 1AGXA 4XLTA 3TNLA 2CVZA 4MO9A 4XIJA 3IP1A 4M4SA 1XKXA 2DUNA 2CYBA 4JLJA 3A10A 5IMSA 3QMPA 3RSCA 2YVUA 5BOSA 1JECA 3UAGA 3N0XA 1Z16A 3AM5A 2BCJQ 1GAQA 3AVTA 3TN7A 3RE1A 3WB0A 1D0VA 3P0JA 2V6BA 3QVKA 2JGKA 2VUIB 3LY8A 3WNZA 4W5HA 2HD4A 4BTLA 5HRUA 4B7CA 3SY8A 3VJKA 3NONA 2AXEA 4RKFA 3LAWA 2JATA 5CBKA 2DLDA 3DT9A 1JAHA 4ZTBA 2WWVD 1AXEA 2XRYA 2YCLA 3ED5A 1JHYA 3TZKA 5BUCA 4NMLA 2G4LA 4LW8A 3DNPA 3BXGA 4LNHA 3VKUA 4KSCA 5ALJA 1WAMA 5C8ZA 1MAWA 5J2UB 4BHTA 1A88A 3H4VA 3I5MA 5LJIA 3RAFC 1SXPA 1TEHA 4IFBA 2AJBA 2VH5R 1XN1A 3WSVA 3R40A 4K1XA 3SF8B 5EMJA 2P8JA 2R6R1 3GLFB 1JVBA 3BWXA 3U2QA 2I6UA 1WBBA 4FDAA 3Q5GA 3LTEA 3D2BA 3ZIUA 3EE6A 1VXOA 4JKIA 1CF2O 3ESBA 2PSEA 5ARDA 5F7JA 4HLUA 4RH0A 3UXYA 4ZOQI 2PT5A 1X1BA 2E18A 1KOFA 2XUQA 3GNSA 3HCOA 1COWA 4YMLA 2WB2A 3VZRA 4MAMA 3LW8A 1CEXA 4IIDA 1SIWA 2CFRA 3V4OA 1N9ZA 2VRCD 2FPPA 3K1ZA 3MJDA 3OM1A 4UDYX 5HE9A 1M6HA 1WZUA 4IWNA 4Z4QA 2AIRA 3ER6A 4XXHA 3E8MA 4HYTA 1UXGA 4K9QA 4X1KB 5JNTA 3ZY6A 1YFKA 2F3QA 3QVSA 4U2DA 3SR4A 2LCFA 1QDUA 4WZBE 1H5UA 1L5SA 2D4AA 3FWYA 4FYPA 2YS7A 4W8HA 4AO6A 3QYAA 3X2SA 2GUWA 2WTNA 1BH2A 1JHRA 4QBHA 2BH2A 1K8XB 1PR0A 1NDQA 4ND3A 1YRQA 4Y30A 1TW3A 1KXZA 2FLWA 2DT8A 4L3OA 4LZZA 3IKTA 2VLBA 5EUQB 3D7NA 3DE4X 1QH9A 5FP0A 1UANA 1SWWA 4JLDA 2OEPA 4MIKA 5L53A 1B3RA 4BB0A 4Z86A 5BW4A 1I9GA 1WZCA 3CEHA 3M3PA 1YIAA 5J59A 1L5WA 4YONB 1KK2A 5IYZB 3R6GA 1P9OA 1PWXA 3EFOB 1TL7C 2B21A 2OFFA 5AVSA 1NIJA 2BSAA 1P5RA 1MQAA 4MP6A 5JC8A 2HYDA 2QLJA 5HQ3B 4AY4A 1KQGA 1IN1A 1L7BA 3Q2IA 4C6HA 4F2HA 3ETNA 4GOKA 4YRGA 2FEXA 3PDCA 1A9YA 2V4MA 4NARA 1RXSA 2GZMA 1B2LA 3EZ7A 3ZGXA 1XZEA 1AY0A 3DE3X 1HTBA 4A8JB 5E2AA 3CLUC 4N7MA 5I4BA 3GLGA 1GCOA 1G6HA 1U2DA 3W4IA 5B64A 2AI3A 3CLTC 3OJCA 1UK7A 1F3LA 3TLZA 2ZWPA 3AHHA 2CLMB 3CNHA 3C43A 4ZVRA 2UUBB 3LUBA 1AF4A 3U44B 3ELBA 2AQKA 5K3DA 4YVFA 4IJUA 1WIWA 4CLRB 1ANKA 1Y0BA 1SK9A 3LZCA 4I1OA 3NJRA 2GVDC 3R41A 3ZTYA 2XCIA 1KC3A 4DM3A 1AV6A 1ONSA 3PPYA 3UIEA 2DJ5A 1X1RA 2TMDA 2ZUSA 5KJ1A 2PUAA 1YRHA 2WHRA 4ARAA 3R8XA 4O4HF 5FH9A 2XOEA 2F6RA 4EABA 1YZNA 5CGQB 2IZ1A 2WUWE 4X63A 1EVYA 1NJ5A 4FB4A 3V00A 1GTL1 3QVMA 4CIDA 1XPJA 2B7CA 3NBKA 5BSUA 4D1YA 1ZH8A 1H1DA 2Z3VA 4FMDF 3U9SA 3O8NA 6LDHA 5KNBA 2ZYAA 4E15A 4JT9A 2PG3A 4BUJA 4L4SA 1JH8A 4XQ0A 1CEQA 1IQ0A 4G5SA 1MB2A 1UOEA 2BFCA 2X77A 1N8TA 4LV5B 3B1KA 1RYBA 1QKJA 1V1RB 2WEKA 2XMQA 2ZS8A 1SY7A 2CMFA 3FNHA 1L5HA 3TIXB 3WO1A 1KGSA 3VHRA 5JAIA 3THWA 1Y1LA 4CMEC 2P6OA 1NTOA 1ST3A 3T95A 1MJ5A 4Y6SA 4HJRA 4R9VA 2I8AA 1BJTA 2GCOA 2Q3MA 1DBPA 4OCZA 5BORA 5A3RA 4MRMB 4WLUA 3VJMA 3OT1A 1Y8CA 2F1IA 3OG9A 2DCMA 4FYWA 1UMCB 1OXBB 1E0DA 2B92A 3GLSA 2OT3B 2JFBA 5BT9A 4YV2A 4MQBA 1OFHA 1NATA 4OK6A 6YASA 1MC8A 1NF2A 3AB7A 2QDKA 3VR5H 3FNIA 1GU7A 3CX4A 3PKIA 4PZ9A 1H0KA 1A5SB 1KFEB 2RHRA 1E6MA 4IZOA 3ZZ0A 5CA0B 3IMGA 4NFHA 1GTG1 3RT7A 4P4NA 2V45A 2Y0EA 4GWKA 4AN4A 1TZJA 5JXJA 1I9CA 2HF8A 1U7DA 4LDNA 2XDQB 1XEWY 1TEZA 4RMNA 2X5KO 1CF9A 1TGVA 1U3DA 3HMQA 3IA2A 1GQOA 3QNUA 4JGGA 1NMYA 1OI4A 1SULA 4WXHA 2Q1XA 4MYTA 1W4LA 4P2BA 1CUCA 2AVDA 2VJPA 2GPNA 3CG0A 3OPNA 3JD2A 3WGTA 1OJ7A 4LF4B 2YXNA 4YT4A 5B55A 4M87A 1A97A 3HHPA 1Y1TA 1X1EA 1QSGA 4J94A 3I2JA 1FX0B 3OZTA 3RS2A 1EBBA 2ZAIA 5EIOA 1ZZGA 3AG6A 2FW1A 1P19A 2OFPA 3HJGA 5DM0A 4EARA 2RGGA 4MUAA 3TPCA 1ORIA 3OLQA 3LPAA 5EXEA 1XJ5A 1US8B 1JFRA 4RCVA 3HYSA 5ARCA 3TBFA 1HX7A 2X7HA 3NDBB 3LUCA 2PK3A 3DLCA 3KDAA 1YIDA 3S2IA 1P2TA 1WBJB 4I50B 4PGHA 3RADC 3DE2X 1X7GA 2A4KA 2A0WA 3G0OA 3I9JA 3PXGA 2F1HA 2ZYHA 1GL9B 3JS5A 2OXTA 3T3GA 2CHEA 3NOXA 1P6QA 2D0OB 2JNWA 2WZDA 4IHKA 5D8DA 1UDXA 4YP6A 4J4BA 5DF1A 1NFFA 2HRBA 3ZE9A 5CA1B 1DAKA 3I9V1 4TQAA 4EZEA 3I61A 2QSZA 2GHIA 4ENUA 1ZX1A 3MMNA 5FNVB 4ZCIA 1J90A 4YUVA 1ESDA 3OJXA 2FWNA 2OHXA 2WKRA 3I2GA 4NULA 2O1XA 3HJBA 4LISA 4RV5A 5C2JB 4RLFA 3C3AA 4DR4B 1DG3A 2B4KA 3N39C 2REXB 2G67A 1EKXA 3MUFA 3NNDA 3ZCVA 5JCJD 5KU1A 3SQOA 5JNSA 3AY3A 1MH1A 4R31A 4UFOA 3O8QB 3TQRA 2ZRBA 3WAKA 4IRXA 4EH1A 2B5VA 3H04A 1NVWQ 4TXLA 5EXPA 2BR4A 1R4NA 3GOQA 3W8DA 4K40A 3MAGA 1I0LA 3QMWA 5TMBA 3H1FA 1Q1QA 3DE5X 1J97A 4UXHA 3EOAI 3QEMA 2H07A 1Z2OX 4GS5A 4IHAA 4Z1MA 3IMFA 1GO2A 4MVJP 1QP4A 3KT0A 1LGYA 3GGGA 2HMTA 1QF6A 2UAGA 3ZDEA 1Z6YA 2FQQA 1YV9A 1E3SA 5CJPA 1PQYA 1EESA 1QR6A 2AF4C 4DG9A 3K4HA 4OG2A 1POXA 5TSDA 3CUWA 1RHUA 4CM9D 4REMA 3TE6A 2HGZA 1F6WA 1ADFA 1NE7A 2WIDA 3FDZB 5B2FA 1H4SA 5KTKA 2WTBA 1S2OA 1CDZA 5IRCD 3V4SA 2JEYA 2JGDA 2DPHA 4UVDA 5AUQA 3WQSB 2FAXA 3CLRD 4B09A 4EM6A 4OLBA 1YR2A 4OQZA 4QXRA 5FXMA 2ZSKA 2QEQA 1QVWA 4BCBA 2HF9A 3DBHB 4KITB 3O8LA 1DKLA 1X7WB 2G1AA 3GARA 3KP1A 3PWSA 4PIPA 3ZQ6A 4X7PA 3A3NA 3P2MA 3NW9A 1E9DA 3GH3A 4PICA 4YCCA 2CNLA 2VAMA 3QU5A 3X1YA 3G1UA 4TWIA 5EQFA 5AVWA 1FYVA 3E58A 5DLPA 5C8YF 3QXGA 3H19A 4D45A 5ALSA 4M7OA 3VYUB 1MJFA 4JUAA 4O4LA 3KQWA 4PZEA 4ZJUA 4QOIA 1ODKA 2GBLC 1PKXA 5E3HA 1C3VA 1QKKA 3FJOA 1U11A 4BMDA 5L3VA 1BKSB 3HO1A 1CUBA 1YDGA 3DTVD 4M54A 2WYWA 5FCDA 1ILEA 1P9RA 2AG0A 2EGHA 1KY2A 4A6DA 1ODFA 4FINA 4ZV7A 2WF5A 3HCPA 3OE1A 4XD7A 4DLNA 4EHNA 1OMOA 1SKMA 2R44A 4WEOA 1DI0A 1A0OA 4TV9B 3A9CA 1S5PA 4PEVA 4D42A 5B4VA 3BCHA 3E8XA 2QBYB 2QD4A 2G25A 4JLKA 4EL5A 2BN4A 4CM4A 1NVXQ 3TLGB 2WG2A 3SI7A 3HNOA 3AM4A 2R1UA 3P9PA 5AKYA 3SZOA 3WO0A 3ROQA 3SSOA 2GPBA 1M5RA 1IPHA 2EQAA 5IKXA 4LI0A 3A9RA 1IJKA 3E1KA 4JR1A 3OY7A 1T1SA 4MCIA 4FE3A 3DV0B 1QORA 1JDJA 3NNSA 3CH7A 4D8TA 2C7PA 1FDUA 3V8BA 1Q92A 1H6CA 1NQ5A 4RYLA 3BIOA 1THGA 4W1RA 3WL8A 1ABFA 1J22A 2ZJAA 1S2LA 1QO0A 4FGJA 2G5PA 1X7HA 1OCEA 1FNMA 2Z3WA 3FBGA 3FUTA 3JATB 3RTEA 3RYIA 4BNDA 1TZMA 4MUMA 3RVPA 5FD8A 4Q9AA 3RUDA 4BUZA 3THRA 2HHLA 1TM7E 4X1YA 3N2KB 4L1KA 4DLBA 1VYHA 4X92A 4ENWA 5KTYA 3BERA 2G1PA 3GRAA 4L7QA 5EWJB 3LC2O 4S0XA 4UU8A 1A8PA 3IYLW 5LWQA 4C30A 2OFWA 3FD8A 1HTWA 1VPEA 1OD6A 4D9BA 2EF1A 3I8OA 5DBHX 5HJ7A 3A1WA 4BYMA 4UE3S 5J1TB 2RHOA 3JQ8A 5DNCA 1TVKA 4G97A 4TV8F 3MILA 3AWDA 1CY7A 4DLLA 3OCXA 1RAEA 1ZNYA 2VTKA 2M6RA 3G5TA 3VU3A 3H5RA 1NXQA 1THMA 3AR2A 3F3KA 1L8OA 5FI0B 4U7DA 2HXGA 3I83A 5IW8A 2PWAA 4JEIA 1HT3A 2IHJA 1KERA 2FVXA 5DX1A 2X5JO 1Q0LA 1QG2A 2ECQA 1EK6A 2QN6A 5CFRA 2ZJ0A 5A05A 4XDGA 1I30A 4D92A 5JBNA 4PF1A 4MS4A 4N3AA 4XRGA 4JYMA 2BJVA 1O6FA 4LYJA 1J9ZA 4HFRA 3CWZA 3IV6A 3OEHA 3MINA 5FBZA 3ZZTA 5CD9A 4C7OA 3OE4A 2O50A 1VHTA 3K0HA 4QRIA 4KACA 1PQPA 3VU1A 3ZGNA 1S3GA 2P67A 2D13A 4D9GA 2R62A 1RXIA 1P0FA 3ZU2A 1TQ6A 4S35A 4AJ1A 4MV3A 2C9MA 3FUCA 4HXYA 4F6CA 4MKZA 1SCAA 4MLZA 1EFVB 4OUKX 5MFZA 1JVNA 3SICE 4LDAA 5BUZA 4LKOA 3LW7A 1FW6A 4QGGA 3OM0A 5DK6A 2DKNA 5EY5B 2YC4C 4DMKA 4N3GA 3OWXA 4O4IA 3LZ6A 3V1UA 4PQGA 1W75A 1N0IA 2WV9A 3UJNA 3NWPA 2HCBA 4MYDA 5HG0A 4B6QA 4BX0A 2OCAA 4EJSB 5J4LA 1NJFA 1YI0A 3KSMA 1IPEA 1BOFA 4RV4A 1GFSA 2G08A 4WK2B 4BO7A 2R68A 4YHHB 3LYUA 5DX8A 4RU1A 4INPA 2IEDA 2Y0DA 3FNFA 2NT4A 1YJXA 3K0CC 3CGGA 4K2HA 4ZEOA 4RHEA 4ZN6A 5A03A 5IEJA 2V7QD 3VRHA 5BSEA 1AJEA 1V8BA 5HKKD 3RV4A 5IHXA 3E4DA 3ZWQA 3EVAA 2F3TA 2WOOA 2ZJ2A 3OKAA 1XTJA 4UNPA 4DY6A 3DULA 3VMMA 3ZWVA 2AZTA 2BY4A 1IWOA 1A2OA 5F98A 4BNHA 3BCSA 1XVIA 3HPQA 3PP8A 1SXJA 5IVIA 2Y1FA 1KAOA 3VR2A 1GQFA 1VLMA 1A2KC 1TCVA 3A3KA 2HKIA 3I52A 1Z74A 1OXTA 3D3NA 4NNPA 5LOVB 3BMCA 1QYRA 3KYJB 4PSVA 2IEIA 4MARA 4Q66C 2DG2A 5EZ5A 3L4SO 3LE8A 3DFUA 2BI4A 2CLEB 3CURA 4W1QA 4MUEA 4W63A 3M7IA 4ALNA 4ZT7A 4R4JA 2Q6VA 2E2WA 3HFGA 4YRJA 1JEOA 2G9ZA 4Y2VA 1GSAA 2CL5A 2OGZA 4G09A 4YJDA 3D3QA 1YFLA 3T0IA 4RZUA 1JIKA 4EPRA 3VTFA 1TLTA 1A27A 1G21E 4N40A 2HN9A 1LDNA 5DN6D 3B5EA 3NIBA 4JJ7A 1NBMA 3USCS 3B20A 3ZWPA 1K6IA 2AXPA 4N9WA 1E6LA 4WZ6A 5BMVB 2UVPA 5LSAA 1YJ5A 4LDRA 5CYOA 3D7LA 5LYJA 3L7DA 1JEDA 2B5WA 4LY6A 1PK9A 2NU9B 4QGAA 4BPRA 4M36A 4TVSA 1W35A 1U2SA 3CNEA 4TS1A 2ZIXB 5EJIA 3S1AB 2EQ5A 2PZFA 1E3TA 1ENYA 1UQRA 2VUUA 3PUHA 2EWVA 1O95C 4E3ZA 5ARBA 4IGAA 1OGJA 3RSSA 1D2EA 1X3LA 2JARA 1UJBA 3D5EA 3WFIA 3HFRA 5HIIA 1Y7LA 1V8DA 2AXQA 1P7ZA 2O3QA 1A82A 3DTYA 4QTTB 3U80A 2P11A 5EHQA 5TQVA 3VUEA 2QX7A 1ZVMA 5AJWA 2BE7A 1FPMA 5CNIA 2OXEA 4J6FA 5BSGA 4U2GA 5LN1A 2C2XA 4ZAVA 4NAHA 3RIMA 1MIOA 1VJDA 3RVLA 2VJMA 5K01A 2G76A 4DM7A 3ZI4A 1Y7IA 2VQEB 3R1IA 4I4TA 3BKWA 3ZE2B 4K2AA 1JMKC 4BEVA 4Z54A 4DV0B 4KR9A 4WRRA 2VN8A 3TO5A 4XW2A 5I9LA 3B60A