4QGAA

S.aureus tmk in complex with potent inhibitor compound 19, 2-(3-chlorophenoxy)-3-fluoro-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgaA00
5AJYA 3M6AA 1Z08A 1R5OA 4KLNA 3AEZA 2W0MA 1PJRA 4I1SA 3KKOA 3QIAA 4OHYA 1D9XA 1W5TA 3OIYA 2ZE8A 3VHLB 4C2TA 1W4RA 1MO6A 3A8TA 2OFXA 3I4LA 4V02A 4B48A 4HB4A 4NONA 5HKKD 3TUIC 1W4CA 2A5GA 2XITA 1UBGA 4BLQA 1G20E 2P5SA 1ZIPA 3QI2A 2F55A 2Z83A 4HAUA 1KI4A 3CX7A 3ZH9B 3W6NA 4ESVA 2HT1A 2RGCA 1UBCA 2PZFA 3NDPA 4GP6A 2J7KA 2ZYWX 2AL7A 3SJCA 4MRNA 3BFKA 4YDHB 2IS2A 3GJXC 3FHOA 5FL3A 2QM8A 1ZNWA 2R6CA 2RB4A 2VP2A 3NDBB 1JPJA 1A4RA 1G5PA 2BM1A 1VHTA 3IIJA 1NVUQ 2XOKD 2C9CA 4A0HA 2R6GA 3K9HA 3LBHA 1DAHA 2QP3A 5H1YA 1AS2A 5TY0A 2G88A 1NJFA 1ZCBA 2ZROA 3MG9A 1E2IA 1SVMA 2UZ3A 3AP3A 2PZGA 1E98A 1NMZA 2VO1A 3B1YA 4EFLA 1UM8A 4LJ4A 4CVNA 2NG1A 4DJTA 3U7HB 1DAMA 2H57A 2QPOA 4MUBA 1EFTA 5JS8A 2IL1A 1RJ9A 2I3BA 3SHWA 2AR7A 3OESA 3FMFA 1A82A 2BKEA 3VU9A 1GOTA 3LH5A 5HCIA 4DIDA 1ZU4A 4PSKA 1ESNA 4FMCF 1DAGA 1YRAA 5AJZA 2R6AA 3EA5A 4L16A 2EFCB 1Z0IA 3THXB 1Q20A 1L8QA 2ZSBA 1AZTA 3BH6A 1PV4A 1SULA 4CYMA 5IRCD 4W5WA 3KB2A 2XZPA 2F1JA 3FYHA 2WAYA 3W9YA 1M8PA 4RD1A 2EFEB 2QMUA 2CXXA 1II9A 3JVUA 5JWOA 2QU8A 3PJRA 1JQJC 2P6UA 4RSGA 3I32A 3TGPA 4BEJA 5CLQA 4TL7A 4L5BA 2GJ9A 2Q9AA 4A0GA 4HDCA 1DO0A 2IXFA 1Z2CA 2MSEB 1UAAA 4JS0A 2P3SA 3THWB 3NH6A 3SFZA 2QORA 1YZQA 3PIRA 4DZZA 3UMRA 3R7WA 2IS4A 1ZCAA 4M1YA 4A2QA 4PZZA 3FGNA 4A8JC 5FTKA 1HE8B 1Z22A 1T4GA 2WJHA 3D3QA 1D2EA 4AKGA 4PC3A 3U60B 3U2QA 3EARA 3A6PC 2D2EA 1ZNXA 3KTAB 3QKRA 4B6EA 2H18A 2ZUDA 1NVVQ 1XDBA 1NMXA 2IYZA 2IW3A 4WAUA 2HYIC 2J3EA 3IEUA 4BFTA 3L0OA 4NZYA 3TK1A 3GFTA 5EXPA 2FGJA 1M1YE 4DT1A 2C99A 4QHTA 4A9AA 4WW0A 2ZVQX 3J81k 1IY2A 2QTHA 4XVUA 3B82A 4OYHA 2I4IA 1CRPA 5FBWB 1U2RA 4X8OA 5KPDA 3QF7A 1N0UA 4PHHA 3SC3A 4MGIR 4EFMA 3N2EA 4TYPA 2ODBA 3W90A 1JNYA 4BFZA 1G291 1S1MA 2BEJA 4J0QA 2OV2A 1KSJA 3QUSA 4EQ6B 4F7WA 1LB1B 1Q21A 1XD2A 1E1QA 3EWAA 3HYTA 3I8XA 1X8KA 3PITA 4Q5IA 3GEIA 1M6NA 4LBZA 1VYUA 1N5LA 1NBME 5KDLA 4B47A 4CEIA 2OBNA 4OQMA 1S2MA 1T9HA 3IIKA 4IOKA 1WBBA 2PX3A 2ONJA 1RJ9B 4ACBA 1KK2A 1OXTA 1SVLA 1P61B 3W6PA 1TF2A 5JS7A 4KFSA 2D74A 2ERXA 4GOJA 1Z6XA 4M1OA 2FE4A 4NU0A 1KO1A 2IXEA 4Q4HA 3VHXA 2G0TA 4CEJB 4GRAA 2JLVA 2ANBA 3BBPA 1ZD1A 3JZAA 3T5DA 2ZM5A 2ERYA 4WIAA 4B71A 3G5UA 5L3RA 1GKYA 3X1WA 2W83A 4LJ5A 5FPHA 4MGYR 4JKIA 3TVTA 3QJYA 3PQCA 1EFRA 2PEZA 1PLKA 1L4YA 2F1IA 1XPOA 5L3SA 1KO4A 2REBA 1U98A 2X19A 2ZSEA 3C41J 3FVQA 4IVQA 4JLAA 3NBFA 3N2IA 4UXIA 3TBKA 3LQRA 4Z8XA 5A0FA 3IQWA 2AKYA 1U9IC 4Q21A 5HE8A 2PH1A 2QRZA 2DYKA 1DEKA 1KDRA 2CHVA 2ZE6A 1GWNA 3GJ3A 2GBLA 2REXB 3RWMB 3WRYC 4Q7MB 4P4SA 4DWJA 2HDNB 2JLXA 4FMDF 1AZSC 4XH9B 1T91A 5SZKB 4B76A 3Q3JB 4Q1FA 4EUNA 2R2AA 1NI3A 4GOKA 2YOGA 4N0EA 5KNDA 1J7KA 1FQJA 5E7IA 4OI1A 5KNCA 1OH6A 3LBNA 4PC1A 2RGBA 4TT3A 3SEAA 4D81A 1SVIA 1OV4A 4OK3A 4Q4LA 4LJ9A 3IIMA 3TR0A 2G6BA 1F2UA 1E9RA 2B21A 2BKUA 2C77A 4RFSB 5GJBA 1KKLA 5EUMA 4RD2A 5GJWC 4QHSA 3P32A 1EESA 2WBLC 3HWSA 1Z6YA 1UADA 3CR7A 3GFPA 2ZS8A 2G0NA 4X8MA 5AJXA 2PZEA 2ZJOA 4ASUA 3ICEA 1NBMD 1Q1QA 4QC2A 2WWYA 2J45A 1YZKA 3KQNA 2QRNA 1KDOA 3EZ2A 2FX3A 1KNXA 2EQBA 3QVUA 4HLCA 3Q72A 2D06A 2JLYA 3W3AA 2H17A 2A3RA 1KAGA 2QG6A 4B33A 1KSFX 1Q3HA 5EXTA 4BASA 1H8HD 3AF4A 2F9MA 4GSYA 4IJMA 3KKMA 2CK3A 1A7JA 4JT4A 1WCV1 4RVCA 3AP1A 3Q9LA 3RC3A 5DO9A 4I1OA 1SKYB 4QJ4A 3SYKA 5HPYB 2OCPA 2VHQA 3B5JA 5KTYA 5EE9A 2N42A 1E2HA 4GL2A 3B1XA 3NXSA 4Q48A 4AG5A 3WNCA 1FTSA 721PA 3KFXA 3Q8XB 1SXJE 2O0KA 3ND8A 2C8VA 4FCWA 2GBLC 2PMKA 2ORIA 4I81A 1ZD8A 2P67A 4DB4A 1M74A 1G5TA 4O0MA 3BB4A 3NHAA 2ZSFA 2IWRA 2CK3D 4DDUA 5HTKA 2ODEA 5FPKA 2FFQA 2ZVPX 3MWJA 2NO7A 4PAQA 1VYVA 2Z4RA 1VMAA 4F38A 1AS3A 2XTNA 4PANA 3OEHA 4DLTA 1AM4D 3BRWD 3RRYA 2QENA 3EZFA 2BMFA 1YR7A 5DHFA 2HF8A 1Z47A 2XSZA 1GVNB 4DDWA 2HF9A 2EFHB 4D0NA 3G0HA 3KQHA 1W2HA 4TLBA 4MUAA 3RRZA 2HXSA 3RLFA 5FFMA 3RAPR 4DEXA 2OEPA 2BWJA 3C7KA 5M04A 4GNKA 1RRGA 2WSMA 4IOLA 1GNQA 1XF9A 2V7QA 3IUYA 4C3ZA 2NOAA 4Z1MD 121PA 4AI6A 4PHTA 1G41A 4P4SB 1FMJA 3W6OA 2REOA 2WICA 5JECA 3WY9A 1NP6A 2PEYA 3TR5A 1BOFA 1NN0A 2HJGA 2QGNA 1JR3E 3PEVA 4L15A 1LW7A 2GXSA 1A2KC 4TLAA 1KO8A 5JSZB 1K5DA 1KK1A 1CF4A 2QMEA 3FDIA 1R4AA 1E2KA 1E4VA 3BK7A 4NYJQ 4DEYA 2YOHA 3AP2A 1C9KA 2CVFA 2ZR7A 1G6HA 2GILA 4HLUC 3GMTA 3T1QA 3O8RA 1CULC 3KJIA 2DFLA 5G3YA 1ZUHA 1J99A 4MRVA 1DAFA 4Q1EA 1S9HA 3QKSA 3CWZA 2CVHA 3PUWA 3ZLJA 3K70B 3DZDA 1KGDA 1NL3A 1RZ3A 1YZGA 2JJ2A 4UJ3A 5IDVA 1DADA 3DM5A 3GCGA 4LV6A 2IUUA 4JJZA 4NCIA 3HR8A 2QPTA 2C98A 3MJHA 4MH0R 4U7DA 3AVXA 2HV8A 1GKIA 2OAP1 4URUR 4A8JB 3WHKA 3QXCA 2AD1A 1QHNA 4P4TA 4V0KA 3U61B 3BGWA 2QA5A 5FUYA 1DPFA 2ZS7A 2IEYA 1D2MA 4HAZA 3BD9A 2G3YA 1R5NA 2WSSD 3CM0A 4NYIR 2FJUA 2J87A 5CJ2A 1EWRA 4IXMA 1OF1A 2EVWX 4KFRA 1KMHA 5FBQB 3RANA 1ONBA 1FNMA 3A1UA 3QBTA 2ZITA 1GRRA 4PQRA 4EPYA 5FUVA 4IXNA 4WVFA 2AD5A 2KBEA 4QBFA 5CIWA 2DWQA 5B58C 1XXHB 2ZJYA 1E9EA 1CRQA 4PO1A 3GLIA 2ZRKA 1E9DA 1G8YA 1G21E 4LYHA 4IRUB 3OIVA 1AGPA 1E2QA 2JLRA 2X8AA 4CF7A 4KITB 2J0UA 4OQXA 1B0UA 2EWWA 1EWQA 3SE0A 4LV8B 1VG0B 4LJ8A 5AK0A 3OAAA 4JL6A 4KU4A 1Z0KA 4Y0VA 5GVRA 1Z2AA 2YWHA 1KSGA 4G5GA 2XGJA 5AWFC 3CRMA 1LS1A 1QHGA 1U99A 4A0FA 1FX0B 1DOAA 4JL5A 4P3YA 3SDZA 3TUJC 1CTQA 5GADl 2NIPA 3ZVMA 3S1AB 3LAWA 5G41A 1KY2A 3AF2A 4Z54A 2V9PA 3CF0A 2WWGA 1J70A 1JR3A 2F43B 3LBIA 2KSQA 4H9GA 2W6ID 3VNUA 5FOWA 2IYSA 1XX6A 4LX0A 3UG6A 4K8OA 5JCPA 2QNRA 2ZU6A 3WMGA 3K0AA 1EG7A 2VIIA 1TU4A 2PCLA 4ON9A 4MDFA 3LW7A 4PAOA 2WZQA 1ZP6A 2CLCX 1KSHA 3PUVA 5HZKA 3T1TA 3U4QB 1AA9A 1HYQA 5IK2A 2GXAA 1GL7A 5C46F 1HTWA 1LVGA 3FTQA 4BFXA 3H1TA 2Q21A 3W8RA 1GNPA 3D8BA 1NRJB 1G8GA 4NPHA 4D4LA 3HR7A 4P32A 1DO2A 1QG4A 2VP9A 3AVVA 2IHBA 1ETUA 4NDZA 4C9BA 1JEDA 2QTFA 5KSZA 3FWYA 2IK8A 4HZIA 4W5JA 1UJ2A 4B43A 2A78A 1KMQA 3KQKA 3NBXX 2ZAOA 2DBYA 1F60A 4YMSA 3EXAA 2ZE7A 4DRZA 3TAUA 1NY6A 2ZI9A 5CK4A 1M7BA 2GK6A 2ECKA 3AUYA 1AN0A 4G1UC 4IKEA 3E5HA 3V4RA 2IYYA 4HLDA 2ZJ8A 4ACAA 1V43A 2MMCA 3QE0A 4A8JA 1XMVA 1U8ZA 1KNQA 4XD7A 3B8HA 5K8LA 3ZS9A 1UKYA 1N6NA 5JRJA 4RY2A 4JBWA 3VX4A 4M9SA 2XTMA 3PUYA 1QRAA 1BYIA 8OHMA 4Q00A 4FMBB 3KX2A 1TEVA 4TL9A 2GJ8A 2CCGA 3IQXA 1ZM3A 1E2JA 1G7RA 4LGMA 5FOXA 1D5CA 1XMSA 4HDQB 3W5IA 1N5JA 1N6RA 3KDSE 1YZUA 1ZVQA 3FKSD 821PA 5DI9A 3ZD6A 2VF8A 3QG5A 3UXMA 1YJ5A 1LV7A 4B3XA 1G16A 4DKXA 2J41A 4A6PA 1CR1A 1XBTA 4Q66C 4GMXA 1ZC3A 4JZKA 2CL7X 2JLSA 3VR2A 1E9SA 3KTAA 4RD0A 2ZJ2A 2ZI5A 4UNPA 4ZIRA 3OE7A 2J0VA 3IKJA 3QKTA 4D6PA 1YR8A 5J4VA 4AKHA 4KAXA 4EJSA 1AS0A 2ZRIA 5GVSA 1CIPA 2BJVA 2JJ1A 1CKEA 4NTZA 1W7AA 3JZMA 4AY2A 3CONA 4F91B 1VIYA 4YXWD 2ZAMA 4Q4AB 4JVSB 3OEHD 4LYFA 2JCSA 3MSXA 5ELXA 4BFVA 2FPKA 1TEXA 4TQAA 5DYIA 1J2JA 3K0AB 1N6KA 4OI2A 2JIZA 2KI5A 3K0FB 2BOVA 2Z4SA 4YONB 4ARZA 2WMNB 1SVWA 2F1RA 1EK0A 2YNMA 5KSPA 3TSWA 3QVVA 2QE7A 1IOZA 4JLMA 4KYUA 4URZR 1FPMA 4XIGS 4ZPXA 1K6MA 1G1MA 5G53C 2P5TB 2CMKA 4RZ2A 1OKKA 3NKVA 3KXIA 3ADCA 4TYYA 2GESA 2QAGC 4FIDA 4LBYA 4NCKA 2WOOA 1VG8A 3V4FA 4ASUD 4DCUA 2YOFA 1Z63A 1NN5A 1XD9A 1JI0A 5EUQB 3RSOA 4DLWA 4MYUA 3T35A 3QXJA 1SVSA 5HZHA 1XB2A 1QHHB 3AKEA 2W0SA 4HB2A 2GA8A 2DFNA 3T1VA 1RKBA 4TYNA 2QSYA 1GRQA 2D62A 1N6LA 1TX4B 5DLQC 4CEJA 2G77B 3GJ7A 4PO8A 3GLGA 1OB5A 1CJUC 2GJAA 3TKLA 1DBSA 1TMKA 3FHTA 4B32A 3RNLA 3PR1A 3EZ9A 2ZS9A 4F4JA 5BN5A 2HCBA 3T1OA 1E2LA 1NIJA 5FUWA 3WBKA 4PAMA 3FMOB 4E03A 5BW8A 3KXKA 4UQOA 5KNBA 2DWOA 4Q47A 3THOA 1WMSA 4ZKDA 1CXZA 3C5CA 1U81A 3UPUA 1N6PA 4EFNA 3GLGE 5JZVA 5DN6D 2W58A 2FMXA 2VRWA 2ZJZA 4DSUA 1N3BA 2ODNA 1JECA 3LLMA 3TMKA 4YMWA 3RDPA 2VHUA 3HU2A 1M7GA 3VR4A 1GM5A 3LY5A 4Q7KA 2VHJA 3CB4A 4HLQB 3RVBA 2VP4A 3KKQA 3U3KA 4JYBA 3KQLA 1XTJA 2WKQA 4ZCIA 3L8ZA 3CH5A 3VFDA 1TUIA 1XCMA 2Z6VA 5AUPB 4LBVA 4UKDA 3TE6A 2BCJQ 4AYXA 5FTLA 1Q1EA 4ZDWA 4A2WA 1P62B 4TMVA 4TTPA 1KJWA 1GP2A 1N6OA 2B8WA 2ZU0C 3HU1A 2DFTA 2G1JA 3QENA 1P2TA 3WNDA 4B73A 1FMLA 1KDPA 4A2PA 1E79A 5DNYB 1IY0A 1DVRA 1MV5A 1YR6A 5L8VA 1MKYA 2GZHA 4QM7A 1L4UA 4R98A 1JJ7A 2V4ZA 2AKAB 4KO8A 5HR5A 3BXZA 2GCOB 3DKPA 1ZJ6A 1Q44A 2G1KA 5K8UA 3A1SA 2QPAA 4B2IA 4N0DA 5GJVC 3EPKA 3V9PA 4M1WA 3CNNA 3A4LA 3LRPA 4N1AA 3C14C 1U8AA 2F3TA 1TF7A 3GJ0A 3NIBA 1FUUA 1XCPA 3MCAA 4B44A 4R9UC 5TXGA 4TZ6A 3U6BA 2CLDX 3LD9A 4O3MA 3A4MA 5J4LA 1M34E 3BFXA 5H70A 3B9QA 2XNSA 3RS5A 4P31A 4QNMA 2RGXA 3M4YA 5DYGA 1AQUA 1ANKA 4M9QA 1Z6TA 2IS6A 2GXUA 5FPTA 4C0LA 1AKYA 2QMOA 4TMTA 4V0NA 2OT3B 2O0JA 4Q9LA 1XD2B 2ZRBA 3K9LA 1Z0AA 3WHLA 3KJGA 5EXXA 2A5DA 3DVLA 3RABA 2WAXA 1TAGA 3B13B 2UZIR 4EDHA 1MT0A 3SHFA 3ZGXA 4DSNA 5SZIA 2JJ8A 2GDJA 1G18A 4LSGA 4WBSA 1JXOA 1KZGB 4JLDA 3TQCA 3ICQB 3KUCA 3SZRA 2Q3HA 1HA3A 2OSBA 3EPLA 2CJWB 3GLIE 1T3LA 5CYPA 1TQ6A 4BFWA 2J59A 1L2TA 4HAVA 4QJ3A 5J47A 1UF9A 1NLZA 1U94A 4MYCA 1G3QA 2BDTA 2GJSA 3QPWA 3CIOA 4NL4H 1T0JB 2A7QA 1P2VA 3OEEA 1VCMA 1A1VA 4M8NE 5FOUA 1KTVA 1X1RA 2B6HA 1WQ1R 3I92A 1H65A 2FFBA 3EWSA 3REGA 1JB1A 5JHGB 5FL7A 1P5ZB 1T8TA 5L3SB 3MMPA 4MYHA 1KKMA 3DHWC 4A82A 2WVJA 4NCJA 2VP5A 1N25A 3CF6R 2ZRJA 2ORWA 1AGRA 3L0PA 1ZD9A 3SN6A 3SYLA 3R8FA 1FTNA 4W7SA 3LX8A 4TL8A 2GETA 1G3IA 1OSNA 3LXRA 4LUCA 3LVRE 4D0LB 2QAGA 4XWAA 1XZQA 2PLRA 4TSFA 2ONKA 3B1VA 1II8B 4D4KA 1GNRA 2RCNA 2ZRAA 4KVGA 1COWA 1TNDA 3OZXA 3AVOA 4URYR 5TARA 3RS0A 3AGPA 1ZUNB 3RC8A 1RRCA 3AVYA 2GVDC 2BBOA 3LNCA 5JLJA 3EAQA 2IYVA 2ZYVX 1NF3A 3GLFB 4DLSA 3FMPB 2FA9A 1SXJB 2AHOA 4JL8A 4QBGB 2NMVA 1KMHB 2ZETA 3BERA 3CBQA 3M0EA 4A15A 2FDCA 4HAXA 2IUSA 2W2XA 4KYIB 1IXSB 3AF0A 3IBYA 1G8PA 3QSYA 1AKEA 3X1ZA 1MOZA 1WDTA 2BC9A 3CUEF 2VQSA 5C4MA 4X8LA 3K09C 5K8IA 4MDEA 3T34A 4KODA 1K5GA 2F9LA 1SKYE 2DCUA 2ZJBA 3NTUA 2VH5R 4E07A 2ZJAA 1SZPA 1NG9A 3B78A 5HE9A 3UIEA 2HT6A 4KHZA 4BRUA 2BMDA 1VKJA 1CJKC 4NE2A 4B74A 2P0EA 4MKGA 1XEXB 4BE7B 1FX0A 3PEYA 2AX4A 2A5JA 3K8YA 5LPNA 1YKSA 4O2RA 2GCPA 5FOTA 3S1AA 1S9DA 4EPXA 3RSLA 1U90A 3H4MA 2B92A 2R62A 1T5LA 5DISB 1G8HA 2ZIAA 1ZNZA 3QEOA 2XOKA 2QBYB 1SXJC 2QQEA 4P33A 3T5GA 2EWVA 1N0VC 4OKSA 1GSIA 5H8WA 2J5XA 2YWEA 5FBVB 4BFUA 5JMTA 4HUTA 4AIIA 4ITRC 2AXPA 3PUXA 1JEEA 2ZTSA 4II7A 3SR0A 2XXAA 1KI2A 4MYTA 2WIAA 4ESHA 1US8A 4DUGD 3I5XA 3AH8A 2FPLA 4FCTA 4CEHA 4IDQA 4LHWA 1DARA 1Z8FA 2ZYUX 2C2HA 4QGHA 1VYTA 2CHGA 1E9AA 1DE0A 4S35A 4ZDIA 1COWD 1NMYA 1IN7A 1W0JD 3H0KA 1ZMXA 1GAJA 3UKDA 3B9PA 4OJQA 1ZYUA 4QL3A 4I4LA 4FW9A 3U5ZB 1OXSC 1GFIA 3OFND 1P73A 4Q01A 4XTRA 3MUFA 1F2TA 1XJ0A 3SNHA 2JLQA 3LQQA 5FTJA 3NEYA 5C4GB 4PQFA 4C0HA 5LDDC 3F5FA 4IW3B 3AV0B 2OHFA 3U7EB 1X86B 3R9WA 5AUOB 4NKRA 3E70C 2R44A 1NKSA 3ZIAA 5EP1A 1T3SA 2ZPTX 3W5JA 1BYUA 1WRBA 1XCGB 2BBWA 2CL6X 2RAPA 2BEKA 4LYAA 3MGCA 2D7DA 1J8YF 4H1VA 3GD7A 2PLFA 2GNOA 5KDDA 1W48A 1U8YA 4KCGA 3KKNA 1D2NA 2X2EA 4ERNA 1FQKA 1OH5A 1Z07A 1HE1C 1XTSA 3DMDA 4V0OA 3VU9B 4F92B 4TL6A 3UWOA 3L0SA 1E2DA 1T8UA 3QEJA 3GLFA 3HDTA 3OIUA 1E79D 2IT1A 4JMPA 3BE4A 4M1MA 4M53A 2BMJA 1XZPA 2ZRCA 2QP9X 3OAAD 4M1SA 2Q0HA 4FMCB 5EP4A 4JLNA 4NP6A 5BQ5A 4LHXA 2ZRGA 4BLPA 5J4KA 4EPRA 1SKQA 4LV5B 4AD8A 4US0R 3H2YA 2O8DA 4B3FX 3K0CA 5E95A 1HQYE 5EE3A 5BN4A 2K5UA 1OB2A 1T3HA 2XB2A 3VR3A 2D2FA 1XNJA 2W6JA 5UKDA 2KWIA 1CR4A 1N6IA 3DDCA 4FMDB 1EFCA 1TQ2A 2A30A 3QBVA 3HU3A 1UKVY 1S96A 1R6BX 5J40A 2NQ2C 1G19A 4NYJR 4EPWA 3U44B 4G01B 1NVXQ 1E9FA 1XXHA 4PR0A 4IDPA 2HCJB 1WB9A 4IEEA 3K09A 3LLUA 4E5UA 3MRSA 1IN8A 3I8SA 2O8CA 3R7WB 3QPVA 4M2LA 2CDNA 3NWJA 2G9NA 4PPGA 3VKHA 521PA 2ZXUA 4Q4AA 2BV3A 3ONWA 3LWNA 2GAOA 4RKFA 2YV5A 4FWTA 2R6DA 4KI0A 4CEHB 1EFHA 2WWWA 2YZ2A 1VG9B 4LJ7A 1G7TA 4UJ5A 4B75A 3PEWA 4LHYA 1R8QA 5E4FA 3U3MA 2QL6A 4B3GA 1FOEB 1P2SA 1G3UA 1XJQA 3KJHA 1NNEA 3F8TA 4V0MA 5KUTA 1OPXA 3KFVA 1XTKA 2QROA 2R65A 4LJYA 4AURA 2JGNA 2GHIA 5ANRB 4BECA 4IVRA 4QXAA 3TRFA 4PTLA 4EIWA 1BS1A 1HH4A 4B35A 1E99A 1ZW6A 4FD2A 4V0ME 1RC8A 4MKIA 1UKZA 1E96A 1VCIA 3L0IB 4JVMA 5KPJA 1TADA 3C4JA 4HZUA 1DAKA 1OLOA 3FMIA 3REFA 2ZRHA 5KU1A 1R0YA 4D80A 3VKGA 4KSCA 3QNUA 3GPLA 221PA 3MWLA 3DEFA 3KJEA 2FNAA 4F4IA 5L3QA 4PHFA 3WYFA 5TDHA 1W4AA 2AWNA 4O2LA 3R9IA 4U5XA 2ZRFA 1JPNA 4FWIB 4ZI3A 5AUNB 5B30A 5DHAA 1KI9A 4PQYA 4TZ0A 2DFKB 5AJVB 3TW4A 2IUTA 3EPJA 2V55B 5EXSA 4PFSA 3BORA 1XTIA 3A1WA 4I99A 4TMKA 1S8FA 4E22A 2IXGA 2PBRA 2VF7A 1YR9A 1P4SA 1N2CE 3CRRA 1OIXA 1XTRA 1AQYA 1Z0JA 3M1IA 4OQFA 4TTRA 5D3MB 4A4DA 3THYA 1IQPA 1FL9A 2GZDA 4LWZA 5DI3B 4FI3C 4OI0A 4LRWA 3AVWA 1NLYA 1B23P 5F9FA 4RZUA 4TQUS 2YC2C 1OE0A 5FTMA 2GEUA 6Q21A 3SI7A 3V00A 1LY1A 3EIQA 1X8JA 2CHQA 5L3VA 3BC1A 2IYXA 2W6JD 1XTQA 1KK3A 3OIWA 3BAFA 4KJZA 3N70A 1E4YA 1RE0A 3RS2A 1PUIA 3BOSA 3EASA 3U44A 5EE0A 1S1CA 1SGWA 4DLZA 4JLOA 5FPYA 2JASA 1H8HA 1P9NA 4LYJA 2CEAA 1W46A 1OIVA 3C8UA 1DS6A 2C95A 4POAA 4L4UA 2BBTA 3QG1A 2V1XA 3TLXA 3ZZUA 2KB0A 3NBYC 1RVDA 2A2ZA 2W2VA 4IOJA 1DAIA 2FG5A 3QKUA 2GAAA 2VP6A 2ZI7A 4WZBE 5C18A 4IOMA 3ZZTA 1E2PA 3T06B 1W36D 4R71A 2B8TA 3EX7C 4ZDJA 1OXVA 2O8FA 2QT0A 1W49A 4ZIRB 3CPJB 1GZSA 1E2EA 1O3YA 3U3OA 1E0JA 4Q9IA 4Q9HA 4RZXA 3FE2A 1E3MA 3HYRA 4NBSA 1ZIOA 5EP3A 1W0KA 1KK0A 1OFIA 2RHMA 4UNSA 4URWR 1OFUX 3PFIA 3CPEA 1DG3A 3NH9A 1W5SA 1JR6A 3VKWA 1RPZA 3K0FA 1Q12A 2UVQA 2FSIA 4ARZB 1GG2A 1QVRA 4CW7A 3K70C 421PA 3SFVA 4HZUB 2KE5A 1E69A 3ETLA 1HEIA 1RRPA 2OCYC 5FL7D 4XSHA 1D6JA 1X8LA 1G64A 1FP6A 4M1TA 4JSYA 4U02A 3CX6A 1Z5ZA 1Z83A 3I5YA 2VHCA 2KBFA 3BB3A 2WTUA 2OM2A 1C4OA 4C0JA 1R10A 4BZQA 3B1WA 2I1VB 2CE7A 2AK3A 3B85A 2GVZC 1KZ7B 3BB1A 4KV9A 3WP1B 2NGRA 2ZR9A 4TMXA 4B2PA 3ZD7A 3U7FB 2H8KA 1KY3A 2ATXA 2EYUA 1P60A 2ZRLA 4HATA 3QF4B 4NHOA 3X2SA 5LD2B 1QHHA 1R8SA 2VYFA 2VSFA 2WJGA 4WOPA 4DLRA 2ZSDA 2RGGA 1KAOA 4BLTA 1W2GA 4DXAA 4LHVA 3VQTA 5EZ6B 1Z3IX 2R9VA 3SJZA 4JLPA 2RGEA 4DVGA 3CRQA 3O8DA 1NVWQ 4QGFA 3ZQ6A 1T0HB 1LS6A 1W1WA 1XU4A 3LX5A 5IT5A 2FFAA 3I72A 2CL0X 3AVPA 3K9NA 3SU8A 4QBHA 2IYLD 3MLEA 4L8GA 3SBEA 4B2LA 3LDAA 2FZLA 5GJCA 3VNVA 4QJ5A 2HYDA 3DZ8A 2J1LA 2RGNA 2IWHA 4OHXA 5DN6A 2ZRMA 3VR5A 1E2NA 1U0JA 3D31A 5F2EA 3Q5EA 4AK9A 4MQBA 4PC7A 3ECCA 3PENA 1BMFA 1NSTA 4WA7A 2QAGB 4KBGA 4BRWA 1GL9B 2RGDA 4B6FA 2VBCA 1NY5A 1UEIA 1UPTA 3CRVA 3K1JA 5TV2A 1II8A 3VR6A 4Z51A 5JSZA 2ZREA 4I1UA 1D8TA 3IHLA 4WXPA 4OHVA 2QE7D 3B7GA 1VTKA 5FR1A 2IS1A 1HUQA 3FB4A 2ZEJA 4IHQA 4WXRA 1FP7A 3QKRB 2B7BA 1W36B 1ODFA 2LKDA 1GITA 2I1QA 4RJLA 5KOYA 4F4CA 2OO7A 3UK6A 1KJZA 4C0KA 1SXJA 2GK7A 2BHRA 2MSDB 3FHCB 3SJAA 2J7PD 2GJKA 2TMKA 4Y0AA 4XJXA 1OHHD 5CIQA 1TPZA 4R2HA 4MGZR 1A5TA 1GL6A 4BLOA 3TUZC 5K8TA 1XXHE 4NH0A 3QXHA 1MR3F 3P20A 2FH5B 1U9IA 4NCNA 1GRNA 2VP0A 1ZU5A 4EQ6A 1XPRA 5B57C 1SQ5A 4TLEA 1G8FA 4NCHA 1KOFA 2A5FA 4LZZA 4JLJA 4YQFA 1ZAKA 5DH9A 2C5LA 1W0JA 2QT1A 1YE8A 3IILA 4L9SA 1XWIA 2AN9A 4LOAA 4O25A 3NHBA 5CLLA 4YMTA 2QGZA 3GLIB 2VTKA 5EZ5A 3RS7A 4M9XA 2Y8EA 3WNBA 1IHUA 4C0QC 5KYKA 4KLZA 2JDIA 2QP4A 5DE3A 2IYRA 1BIFA 3AQ4A 3HJNA 1G4UR 3VAAA 2H1LA 4D25A 1RYFA 1KI6A 1UKEA 3AF3A 1I2MA 4DC9A 3O47A 1ZBDA 3KZ1E 2F1HA 4OQNA 5LB4A 2XXAB 4URVR 5KO2A 4WZ6A 3RS3A 1WP9A 2VLIA 1CJVC 4Q4HB 621PA 3A36A 3AB3A 1XEFA 2H7VA 4DCSA 1R0XA 1U0HC 1ZM4A 1D9ZA 5E7MA 4LJAA 4C7OB 2WPDD 2CBZA 3CF2A 5G3ZA 2P6RA 1LFDB 1MABA 2OUKA 4XTCS 2QUZA 2GEVA 2C78A 3HP1A 4B34A 5CJPA 1W44A 2Q3MA 2F43A 4AWXA 3K70D 3ASZA 1F2TB 3AKCA 3B2EA 4M1KA 3U6KA 2ASEA 5KHOC 2GF9A 4YDSA 4RZ3A 4C0BA 1W36C 1WBDA 2HLDA 4XOIA 4TYWA 1WE2A 1OYYA 2HUPA 2FGKA 3CKLA 3EW9A 1KO7A 4JBXA 1G7CA 3TSOA 1N6HA 5DSZA 2NO9A 4IEIA 4N3NA 2BM0A 1Z6AA 1BH2A 3A1VA 2D4HA 4Q19A 2X77A 3O8CA 1P9WA 3WMEA 2RGAA 5CM9C 4Q4JB 4YC7A 2DR3A 4D0GA 5IK2D 1Z0DA 2V6JA 2FU5C 2ZUCA 3RRNA 4W9MC 4NMMA 3SQXA 3DL0A 2OE2A 2JLWA 1Z29A 4PXAA 3VMFA 2WOJA 1UBFA 1I4TD 5LBIA 5E3HA 1XMJA 2ODWA 4YXWA 2O52A 4HB0A 4CGZA 4M22A 5A4JA 2AK2A 4DCVA 2EU8A 5F3WB 2XX3A 4TN1A 3FPAA 4AYWA 4CDGA 1HT2E 3KXLA 1NBMA 1RRFA 3TIFA 3U3JA 4DBLC 3RRMA 1Q3TA 1G3RA 4G5OA 1KHTA 3C5HA 4BLSA 4MITA 2O8EB 3OE7D 2WWHA 3GLHE 2X1VA 2YWGA 3QPUA 3EIEA 2FEOA 2OESA 3CPHA 3F0TA 1HT1E 4HUQB 4PX9A 3W34A 1RW4A 1HY3A 2OAQ1 2WWIA 3ZQJA 2XTZA 3BH7A 5C2JB 1XPUA 2CNWA 4ZCLA 2FFHA 2J46A 1Q22A 2Q6TA 4RKEA 4NYIQ 5B2ZA 3EPHA 5EE1A 5CB6A 1T6NA 2NZJA 3EC2A 1NVVR 2V8OA 2WWFA 2JJ2D 4GFDA 2QZ4A 4OHZA 4BGDA 4A36A 2GRJA 4HEJA 3T15A 3ADBA 5BXQC 4S2EA 1RIFA 2V3CC 2FZ4A 4HDOB 2PMDA 1R5BA 2JA1A 1Q0UA 2O8CB 4JLVA 4P0TA 4B3DA 3PCRB 4LCBA 1VPLA 2ZANA 4HYYA 5FBRB 4TWZA 1TQDA 2EFGA 1H8EA 1P9RA 3NC0C 3BWDD 1VECA 3CW2A 3W8NA 1S4QA 2OLJA 4Q03A 1CS4C 2RGNC 5LB2A 2OG2A 2D7CA 4DLYA 3H86A 2OCAA 2GCNA 2R8RA 1FUKA 3NBZC 1OXXK 2NTYC 3T61A 1IBRA 4C7OA 1E0SA 1P3JA 4JLBA 4JT2A 3CZQA 5JJIA 1MH1A 1MABB 4DCNA 4DB2A 4BPBA 1FZQA 1X6VA 1KI1A 3A37A 3DOFA 3GFOA 1T5IA 4QFMA 2H5EA 1IXZA 1EFUA 2WMOB 3B60A 3GJ4A 4OHWA 1FW6A 3NG1A 2NPIA 1VG1A 4LC0A 1IN4A 2Q9BA 3K0EA 1US8B 3P27A 4FXPA 4NYMQ 3TQFA 4CIDA 3KKPA 5KSYA 4BFSA 1SVKA 5BYJA 5F9HA 1P6XA 4M21A 1KI3A 1OW3B 2V7QD 2XB4A 4Q7JB 1VCNA 1E32A 1G5RA 1AIPA 4P4UA 4Q1AA 2FV8A 1LF0A 3CR8A 3LA6A 1AJEA 4LY6A 1R7RA 5L3QB 2P65A 1E9CA 4KBFA 4V03A 5DIFA 4H1UA 4DDTA 1IM2A 5BWMA 3DOEA 1JJVA 2O8BB 2JEOA 4TQ9A 4PPQA 2E9SA 2OCBA 5FI1B 3K0CC 2WJJA 3P26A 1K8RA 4A0RA 3QKSB 1ZINA 1Z28A 5CM8B 4DSTA 1Y3AA 3IPYA 2C04A 4KXFB 1M2OB 3U3RA 4GMDA 2CCKA 3THYB 4Q1BA 2VHTA 1PLJA 1TL7C 2OFWA 3GLGB 3LW8A 5CITA 1O87A 2ZI6A 4D4JA 2NO1A 4QM6A 5JHHB 1V5WA 2VPPA 4QOSA 3PV0A 4ZDKA 1HQCA 5DGXA 2XJ9A 5AUQA 5JRZA 3TH5A 2DHRA 4JLKA 1LTQA 2WPDA 3IO5A 2GTPA 1Q1BA 2ZYTX 4LI0A 2XNDA 4B3BA 4DIEA 2YC4C 2XZLA 1C1YA 1LNZA 3CLVA 4QBIA 3X1XA 1PLLA 3OEED 4TMZA 4C0SA 4MKFA 1J8MF 2E87A 2VSXA 1YHNA 1S0UA 5EQTA 2FEMA 3GJ6A 5SZJA 3THWA 2WJYA 4DSOA 2O8DB 1NSFA 2JLZA 1GKUB 1OT3A 1OXUA 2JAQA 1NKTA 3L8YA 2Q9CA 4AC9A 3K53A 4TLDA 2J0QA 2F6RA 4LJ6A 1E9BA 4ZCMA 2DWPA 4JBYA 2FPMA 4PSAA 3EG5A 3LXXA 3Q5DA 4ZKEA 2DY1A 3WP0A 1J90A 3MJRA 2W00A 4C30A 1R0ZA 3ZVLA 2BCGY 2NO0A 1UBEA 3SQWA 3ADDA 1G9XA 5JI3E 4US2R 3A58B 3WMFA 3ZZ0A 1Z06A 1GUAA 3L43A 3B6EA 2OZEA 2YWFA 4QG7A 5KSOA 2OLKA 3MFYA 3CO5A 4BFYA 3LO5A 2ZRNA 2GF0A 4GPTA 1ZRHA 5F98A 4D2IA 3GP8A 4LPKA 2YVUA 3OF5A 4IFBA 2IHYA 3P4YA 3PXGA 3CNLA 4DUGA 4BQSA 2AXNA 2ATVA 4G5SA 1UDWA 1SXJD 4KSBA 3TJZA 3QXXA 2P6NA 2J0SA 1BO6A 2MSCB 4TT3D 5CYOA 1I2DA 1Z0FA 2QTVB 2WV9A 1II0A 2N46A 3D7MA 2NZ8A 2NO6A 2WSSA 2FSHA 3UATA 2IEZA 2V54A 5E7JA 1EFRD 1ZM2A 3KQUA 5CB8A 2PX0A 1CJTC 2VA8A 2RMKA 4OK6A 2AFIE 1BMFD 5KDOA 4JYCA 3IO3A 3QF4A 2RH5A 1S3GA 1HURA 1GDDA 2IYTA 4M9ZA 4G5QA 4D4MA 1NIPA 4URXR 3AVTA 1G6OA 1QHXA 4LDJA 1XJCA 5TMPA 4A6XA 2N1BA 1YZNA 4C4PA 2F7SA 1E2FA 2LCFA 4R7ZA 2YKGA 4EPVA 4QGAA 5FI0B 3CX8A 1ESMA 5HCNA 1DELA 1KI7A 3DMNA 5JEEA 4BWYA 1KO5A 3EA0A 5CK5A 4A92A 2QSZA 3SJBA 3K9GA 3I1FA 1XRJA 4OBEA 3ZVNA 2IBMA 2FN4A 1SVOA 4GDFA 2L0XA 1KYIA 3AKYA 3OHMA 4AYTA 2Z0MA 3TVDA 1GIAA 2GZAA 2Z5FA 4OJKA 2XZOA 4D26A 4YMVA 1Y63A 2JLUA 1JR3D 4QHYA 4MRRA 3THXA 2VL7A 3L2OB 5D3MA 1VDZA 3DM9B 4V0LA 4A1FA 1I4DD 1CR0A 1E6CA 1N5IA 4Q1DA 1GTVA 1XEWX 1NLFA 5JCZA 4Q18A 1QBKC 1YZLA 1N5KA 2ZUBA 2QQ0A 4JSTA 1G3MA 1IN5A 4TSFD 4GZMA 1ZM9A 3D6TB 1JXMA 2WHXA 3ZJYA 1E2MA 2BJWA 1EXMA 2QI9C 5IF9A 3VX3A 2HLDD 1SHKA 1ZNYA 3EIHA 1IY1A 5FUXA 2FWRA 2OFOA 5C1BA 3KL4A 3Q7PA 1P7CA 2CLSA 4Z1MA 1W47A 2XJ4A 3E2IA 2XAUA 4ZV4A 4LC1A 4CT4B 2W2TA 4OQLA 3Q85A 1DG1G 3GLFE 2J7PA 3QXSA 4Q1CA 4UNQA 4U00A 4UXJA 3X1YA 2PT7A 4IDHA 5JI2E 2GWHA 5J5CA 4K81B 4DLXA 1F6BA 1CU1A 4XWKA 2XNDD 4PSVA 4LBWA 4MA4A 4IDNA 1QF9A 2O8FB 5BN3A 1IJEA 3RWOA 1G17A 4US1R 3CH4B 1IONA 3UMSA 3VTKA 1G4AE 2C9YA 1P2UA 2Q3FA 4IVPA 3ZYCA 1W4BA 4DLUA 3PG5A 1E1RD 4G3XA 3QOFA 3ND9A 4DT1B 3I73A 2MMGA 1ELOA 3TNFA 3KUDA 1XP8A 4Z8YA 3ZS8A 1L7VC 4D82A 5TB5A 3ZVRA 4K46A 3MWYW 3WRXC 3HPQA 5JEDA 3I61A 4Q9KA 3QQ5A 3ASYA 1F48A 4R2IA 1XFAA 3R20A 3FFAA 1OFTA 1XD8A 1MO4A 1UFQA 2QN6A 3IDQA 3OFNA 4KFUA 4LK2A 4RD4A 5EJEA 2IF0A 3RHFA 2JJ1D 2J9RA 1TUEA 1E94E 3FKSA 1MRNA 2ZR0A 4JIMA 2UKDA 2X2FA 4HSEA 4MKHA 2SHKA 4EKDA 3GEHA 4CEIB 2GXQA 4RD6A 1F5NA 2CNWD 1OKKD 5FOSA 3K0SA 3VR1A 3GJ5A 1TF5A 4ZI2A 1OYWA 2QBYA 2H92A 3LV8A 1Q57A 3NEJA 5FR2A 2NPFA 1FNNA 5JWHA 3LVQE 4DHEA 4IFEA 3CRW1 2H16A 2YJTD 5J4YA 4FN5A 5LD2C 2HJVA 1RFLA 3GLHB 1TU3A 4BZXA 2IX3A 4XD7D 4ABYA 3IEVA 4PC6A 4GZLA 5JJKA 3NC1C 2WWXA 3E1SA 4TTQA 1A2BA 3U7GA 2FSGA 4RD3A 2FF7A 1NN1A 1YQTA 3BS4A 3SS8A 2PT5A 4FINA 4G5RA 4BZPA 1VCOA 1QDEA 1AK2A 2OBLA 4MGKR 3WBJA 3ZDQA 1TTTA 1E1QD 1UDXA 4Q4JA 1NJGA 4RFVA 2V6IA 1CEEA 3WXMA 2QY9A 2ZRPA 1JAHA 1VHLA 1VIAA 3QY0A 3AUXA 1N0WA 5JFGA 3R9XA 5FBLB 5BYKA 2OXCA 3LFUA 5JBQA 1GILA 3PEUA 3TW8B 1QZXA 1XMIA 1Z6GA 3BFVA 4AKIA 3ZIAD 4PHGA 2FOLA 1CR2A 4GP7A 4KVAA 2CE2X 1CBUA 3CZPA 1EGAA 3AVUA 4PPFA 2ORVA 3I3SR 3UANA 3SOPA 1E2GA 1TQ4A 1ZM7A 4W5HA 2YHSA 4JVNA 1KI8A 3DO6A 1P72A 1F2UB 4RFSA 3HPRA 2WIBA 1WF3A 2GCOA 3B1ZA 3X1DA 2RHDA 3IGFA 4GOXA 2P2LA 2WJIA 3AKDA 4M0LA 2ZRDA 4TLCA 5EP2A 2ZE5A 2JDID 2ZQ5A 1CLUA 2LKCA 1XEWY 1KIMA 1JALA 3FOZA 2BIFA 3IPXA 1NG1A 3BJIC 4MRSA 2VEDA 4HLUA 1OH7A 2G83A 4KFTA 3TAHA 2HEIA 4E09A 1OH8A 5FH9A 2QEQA 4Q02A 1DTSA 1IN6A 3UMFA 2O5VA 1YVDA 2F3RA 2J0UB 4XVQA 4XWOA 4EJSC 3IBGA 3NVAA 2OXRA 3EZ6A 3IHWA 3KB1A 4LPSA 1QG2A 2B7CA 2A5YB 1OJLA 2XSZD 3UWKA 1PZNA 4AG6A 3SBDA 3UG7A 4WZAE 2ZSAA 1WXQA 2QAJA 2VSOA 5D3QA 4C2UA 1E1RA 2AFHE 2LWIA 4RCYA 4Q9JA 2KJQA 1MO5A 1E0AA 2C03A 4RCZA 1IAQA 3C16C 3C15C 4C0AC 5A5GA 2PJRA 1X3SA 2PCJA 3N5CA 3P4XA 2XEXA 3GEEA 3TSZA 2OBMA 3BIFA 3T12A 4DCTA 4UNNA 1BKDR 1P75A 1KI6B 3BH0A 2WKRA 1KJYA 4QRHA 3WYGA 1R0WA 4XVRA 2HXYA 3O8BA 2BVNA 4PC2A 4QGGA 3FFBA 2CJWA 4CZ2A 2C96A 4DLVA 3GLHA 2E1RA 3PVSA 4HI0E 4NYMR 2BMEA 1W0KD 4CT5A 1LF5A 2GEDA 4JJKA 1QHYA 2YYZA 2WKPA 5FPSA 4HB3A 3JVVA 1ZUIA 2QMHA 1M7HA 4OL0A 1U0LA 5SZHB 3RS4A 3W3ZB 4G0NA 3U4QA 2YINC 1EX7A 4GI7A 4XSGA 5FTNA 5AJWA 1Q1ZA 4LHZA 4OK5A 4BEBA 3PUZA 1HV8A 4HAYA 2EW1A 2GKSA 4F93B 2PJZA 2A9KA 2QM7A 2AWOA 2EFDB 3GQBA 1R2QA 3EZ7A 1JBKA 1QVAA 4IDOA 3MD0A 2O8BA 4PO9A 5CDFE 1OFHA 4YLGA 1YU9A 2R6FA 5G40A 2ZI4A 1FFHA 2DPXA 4L9WA 4DDVA 5B64A 2WM9B 2W6IA 1MRSA 2CCJA 2ZI3A 2C9OA 4TMWA 4X8HA 2EYQA 4AKEA 2PL3A 3CWQA 3AM1A 1YZTA 2O0HA 1SHZA 4I1VA 4BLRA 5IHPA 3R8CA 1UEJA 5HKKA 1OIWA 5CDFA 1DAEA 2IF2A 2IYWA 3AVQA 4CRWB 4QKQA 2V1UA 3MWKA 4QNRA 3SYNA 1E0KA 3H84A 5JWRA 4PZLA 1IJFA 2ANCA 1MO3A 4YMUA 1IXRC 4BUJA 3FKQA 1S3SA 1CP2A 4Q7LA 2IYQA 3ADKA 4OI4A 5P21A 3CNOA 4UNRA 1H8ED 1NN3A 3G82C 1ZC4A 2JIZD 3A4NA 1QHSA 2IC5A 1OHHA 3AF1A 3GJ8A 5DI3A 2DB3A 2FSFA 4ILEA 1KDTA 1WA5A 2RKOA 3L82B 4ZO4A 3A1TA 3P1JA 3EC1A 4M4SA 2O8EA 4TYQA 5JJLA 1G7SA 5J4HA 3I62A 3WYAA 4HUQA 4MRPA 1PUJA 2OILA 4HAWA 3AGQA 2D3WA 4GT1A 4B3CA 2IYUA 4PPNA 1X1SA 4JVLA 2BBSA 5AR1A 2ZJ5A 4FCVA 3DKVA 3Q7QA 5TVKA 4PZYA 4EPTA 4EAQA 1XEXA 2WJVA 1YRBA 1RYHA 2JATA 3MAAC 4UXHA 2Z43A 3DPUA 5EE5B 1QHIA 3F3YA 4EJSB 1PVOA 1CJMA 1JAIA 2IA5A 1F3OA 1EX6A 4JKYA 5H68A 1I4LD 4GBMA 3RYTC 1JQLB 5FOVA
chains in the Genus database with same CATH superfamily
2PUDA 3KC2A 5AJYA 2G17A 3ZGLA 3C24A 5KS2A 3V33A 2WHQA 4HNTA 2MYUA 2NUTB 2Y6VA 4WOKA 1GFWA 3QIAA 1AQJA 5DM60 5JPCA 4B5KA 3L4EA 2O7SA 3OIYA 2ZE8A 3VHLB 1O6FA 1JI3A 3HNPA 1P45A 2YHBA 4DZTA 4AWBA 1I0ZA 2GAJA 2OFXA 2TMGA 4N5IX 1GCGA 1VE7A 3I4LA 2RGWA 1SPXA 1UFKA 4WFQA 3TUIC 3G0IA 3H6HA 4MW9A 3ZIUA 3D4NA 4BDSA 1GPKA 4BB9A 2XITA 4CR6A 3OY7A 4NZ9A 1D0IA 1SK9A 1G20E 3QI2A 4Z2YA 1ZZEA 3HI6A 1GRCA 4JT9A 2DT8A 1KI4A 1V7CA 4QD3A 3UW1A 1AUOA 3B5EA 1R5JA 2PZFA 2RGCA 3H75A 1C0PA 2ZIGA 3NDPA 4IIJA 4MI1A 4UC0A 5K1ZA 1D03A 1YS1X 3D6NB 3SJCA 4ITUA 5KYXA 1TB4A 3HN6A 4HXYA 4PGFA 3MWEA 3LDGA 3JCZA 1SY7A 4GZ6A 1CETA 1N0IA 3FHOA 3D4PA 3QUTA 2QM8A 2K87A 1N2XA 2Q5IA 2ATEA 5FL3A 3TQIA 5CVTA 3MTBA 4OEHA 3NHRA 3UGQA 3NDBB 1I7SB 2HHHB 1VHTA 1JQKA 2DLDA 3UHPA 3IIJA 4AN1A 2Z6QA 1NVUQ 1OBFO 1WULS 6NULA 2C9CA 5DGHA 5A0VA 2O6HA 3LBHA 5GVRA 3BTUA 4L0QA 3L92A 2C57A 4OQZA 4Q24A 1ZICA 1ZQ9A 3IP5A 1AS2A 5H1YA 2DKFA 4G4SP 1NJFA 1ZCBA 3MG9A 3PP8A 4PNPA 1SVMA 2CFOA 3AP3A 4DJDC 1SBCA 4G81A 4MUKA 1E98A 1NMZA 4C4AA 5JQWA 4ZRMA 3PXUA 4YP1A 1W52X 2WD8A 1S3FA 5ALEA 1DAMA 1JQBA 4FSXA 5JYBA 1EFTA 1K3UB 4LDQA 4JC5A 3N8IA 3OE4A 1GGNA 2A1TS 2OZLB 3A2KA 2EL7A 2AOUA 3HVJA 4R81A 5HF6A 3G79A 3L0YA 3A6DA 2V7TA 3HSYA 1Y9AA 2J3IA 5AJZA 2XI4A 2YV4A 4FXOA 1DDOA 3GARA 3ILYA 3WFIA 4JNCA 2WFZA 2ADOA 5ABPA 5L6MB 2R86A 3THXB 2PYDA 5FNVA 1U9YA 3BH6A 2ZSBA 1AZTA 4F8JA 1PV4A 3LYAA 3QSGA 3A1DA 1SULA 2WF9A 4NU8X 4W63A 4D79A 5IRCD 3RSHA 4IF6A 4NG5A 1M6VA 3FYHA 4BUCA 2CNOA 4K9LA 3HY3A 2GD2A 3FSRA 1Z4QA 4LVNA 3T9AA 2JFOA 4RD1A 3VR4H 1M75A 3ZWBA 2QMUA 5EWJB 2XHZA 3A9CA 1JIUA 3RSFA 3OUZA 4AO7A 5JWOA 1O5TA 2POQX 2YBEA 4ZO7A 4UTPA 1JQJC 1WB4A 3DMFA 4RSGA 4XEUA 3TGPA 4BVKA 2ZIFA 1TOAA 2GJ9A 3D6VA 2Q9AA 1PEKE 1VRVA 4P82A 3K71B 4JI4B 5A71A 2C2GA 5C7IO 3HNRA 5BUZA 4NPAA 4Q93A 2GM4A 3WQBA 1B1CA 4NV0A 1XAHA 1JR4A 1Z2CA 2C88A 2A6PA 4REOA 3UJ8A 4C05A 4CKBA 4JS0A 5LVAA 1UAAA 4X6LA 4RQAA 3HVRA 3O82A 1TKAA 3UMRA 1LPAB 1URPA 2FPUA 3CZ5A 4M1YA 3OQJA 5BPHA 1GPWB 1MENA 1JDBB 1QCYA 1K68A 5CB4B 4PZZA 1U6IA 1QIHA 3FGNA 1RS0A 2WT8A 4A8JC 1T4GA 3H8JA 3NNSA 2ISQA 3D3QA 4I2NA 5ENDA 4AKGA 1SC9A 1JHRA 4CFYA 4ALIA 3U2QA 1NRIA 1UPBA 2D2EA 1ZNXA 2O2XA 3K73O 3TTTA 1ZKDA 3OF2A 4BGEA 1Q1NA 2HBYA 2I8LA 3U09A 1C8BA 4HNVA 4PM4A 1CUUA 4TUYA 2FOIA 4E14A 2VDLB 4MP8A 5GZ1A 3CEJA 4F72A 4BFTA 3OJOA 5A06A 4BVJA 4TV9F 4DJ5X 3GFTA 5EXPA 4DT1A 3T7TA 1CK4A 1U5BB 1S2NA 3JYLA 5DTMA 3I42A 3I5UA 4FGSA 4BNZA 1WV1A 4ZT7A 3VPAA 4A9AA 3IPAA 1GFSA 4XPIA 2ZVQX 2VPZA 2GT1A 5H16A 4DA9A 5BMVF 2G72A 4IJQA 5L51A 3J81k 1Y4ZA 3LHDA 3L8FA 5FBWB 3B2NA 5LOVF 1GGHA 1V4BA 4FFBB 1C2TA 2QV0A 1GYRA 3QK7A 5E9QA 5FQNA 4OYYA 5LZ5A 4PYRA 3WWYA 4KB5A 3F90A 5HGJA 5KWEA 3RT9A 3DLHA 4J0QA 2HADA 1KSJA 2OV2A 4H6VA 3OJWA 1U7WA 5D2CA 4F7WA 2C83A 3BWEA 3D2BA 1D6SA 3HYTA 4GXNA 4Q5IA 3T41A 5EIOA 3T7DA 4HN9A 1PZGA 1AXGA 4LBZA 1SIUA 1IC6A 1UOPA 2GZRA 3C1OA 5JARA 4MB2A 2GYUA 3FFWA 4CHTA 3ZHTA 4G1BA 1NVMB 4BU1A 1T9HA 2G7MC 4R9SA 2ONJA 3K1YA 4PCLA 1G21B 3AXSA 1I30A 1RJ9B 4TPKA 1KK2A 1KZYC 1OXTA 3A27A 5ER9A 4ACBA 3PLAE 2L82A 4M7WA 1PIWA 1A0OA 4B46A 3CXRA 2RIRA 4NNJA 4HAOA 4DGSA 5DCWA 1Z2DA 1QH1A 4PRKA 3SQDA 2FR8A 2FE4A 3PZBA 4RPLA 4UMEA 5U4QA 5I4BA 4Q4HA 3VHXA 3K5HA 3MSCA 4EGQA 3BBPA 1Z2OX 4E33A 3JZAA 3T5DA 7MHTA 4IMJB 3JPWA 3JD3A 1P2DA 4CTJA 4S24A 3D7SA 3OTGA 3ZWPA 2NVWA 4I1RA 3HKCA 4LJ5A 1BDHA 3HFJA 3AFGA 4D5EA 3QJYA 4GUDA 4YAJA 1WM1A 3C98A 3OZRA 5CH3A 4HWTA 4RVNA 3FVQA 3STWA 4K7JA 3UYLA 3NBFA 4UXIA 2WNIA 3O1IC 4Z8XA 1PWEA 3GRVA 4W6QA 1GZ7A 4B31A 4ZGBA 2AKYA 5HE8A 4Q21A 1UBTS 4QWMA 3R9XB 5C8VA 4M83A 1C7ZA 3VR2D 2C8LA 5A4KA 2CWWA 4FZ3A 2CNBA 2J4FA 1J2UA 4HDSB 4ZO9A 3GN1A 1GD1O 3KYCA 4P4SA 4Q7MB 2JLXA 3ZU2A 1T91A 3VU1A 1WDLA 3Q3JB 3HLYA 4EUNA 3HV2A 1LI7A 1J0XO 2AFHB 5D1NA 1F7UA 1X1AA 3IEKA 3U13A 4C88A 4L73A 3SZLA 3JQGB 1FQJA 1BXZA 2CD9A 2WMYA 5E7IA 5GINE 2ZJ3A 3LBNA 1ECFA 2X9GA 2BE9A 4X95A 1ICEA 3BM5A 3REQB 5ITSA 1J39A 3NAGA 1L5NA 1JGTA 3ZNPA 3EXHC 3WGNA 5H9WA 1E9RA 2B21A 2BKUA 3H3XA 4G67A 4L51A 5CA0A 3H2SA 1QBGA 5EUMA 4RD2A 3BK1A 4IMPA 1LPPA 4JP1A 3ILSA 4JX8A 1UADA 3CR7A 2ZS8A 3ZU4A 3PQ8A 4LKOA 3VXKA 5AJXA 1H9AA 4ASUA 5JBNA 1P4JA 2AUMA 3VKVA 4ND8A 2FHSA 2OLEA 3P0FA 1PGNA 2WWYA 3IV9A 3VPCA 3KQNA 4OXQA 1KNXA 3GZNB 3QVUA 3EGXB 2X5OA 1QFYA 4I50F 2KQUA 1DQRA 3OMLA 3DE1X 1TO1E 2AEJA 1NM5C 2H17A 1PJZA 1DBVO 3PX7A 4B33A 5CLHA 5JD5A 4O59O 4OB6A 4AMVA 2BE7A 2F9MA 3B7PA 4WK6A 2XMQA 1CHDA 2C5FA 2BTQA 1L5LA 3V2HA 4FC6A 1WCV1 1LLUA 2R4QA 4Q37A 1GR0A 2HU5A 2VZLA 3RFCA 4YCBA 3Q9LA 3K72B 1I9GA 2H1FA 4YRBA 5LQKA 5DO9A 3SYKA 3WIOA 2OCPA 3G2PA 5BW5A 1QVZA 3B5JA 1DMRA 4BRSA 5KTYA 4D8TA 2EG5A 1E2HA 1F17A 1USKA 4GL2A 1O4WA 1PJTA 1QG6A 5CT5A 4AG5A 5D3ZA 5HIAA 3LYLA 1L4KA 1RKUA 2LCIA 1R0KA 1SXJE 2O0KA 4FYIA 721PA 2XQGA 3GGCA 3AW9A 3ND8A 4IIEA 2FN9A 1IPFA 1B6SA 2PKRA 3ESBA 3ODPA 5EIBD 4G8CA 1I1NA 1FRFS 1R6XA 1SHTX 4ZVKA 2V58A 4UCWA 1YA4A 4O4HA 2R7AA 4RMIA 2EX1A 2IWRA 3PJFA 4KXNA 5FPKA 2FPPB 1RXUA 2OXTA 1QNLA 1A04A 3KJNA 3LNTA 4OLFA 4NPCA 3OSZA 2GVNA 1IBMB 4HWSA 3FMVA 1VMAA 2G4CA 2WZDA 3ESQA 5F7OA 1AS3A 3IQZA 1D6NA 4U7PB 2HO5A 2AOWA 4PFKA 1AM4D 3BRWD 3FTDA 4DRYA 2OR3A 3D4BA 2BMFA 3KIPA 4C4TA 1FDVA 5I01A 5EP2A 1KHHA 1MVLA 1RXCA 1O2DA 4ABTA 2EFHB 3GR6A 4Q05A 4UUBA 4AP6A 1RI3A 3KQHA 2FZGA 1W5AA 1ILEA 4DA0A 3RLFA 1YQDA 5FFMA 1J9ZA 2HV9A 4BQOA 3TGLA 2I65A 2R79A 4EGSA 3G88A 1CJSA 3NIFB 4OJYA 4RS3A 2OEPA 2UYOA 3AEUA 3INYA 4KIJA 4U5QA 5ALYA 4ZCQA 1ODLA 4BCCA 1CUWA 2X58A 4G5XA 3D1LA 2WM8A 2ZIWB 2NOAA 2FPGB 5EWMB 2Q1YA 3A0RB 3CEHA 2AGVA 3SYMA 2O0MA 3CF4G 4M38A 4R8VA 4UVGA 5CFLA 3NX4A 3FKJA 3L6CA 4B4WA 4CCAA 3N8GA 4E3ZA 3G0OA 4BAUA 3CURA 3VJRA 2HJGA 1IDN1 1JR3E 3KKZA 3NTLA 1LVUA 3C0KA 4JI8B 2OWDA 3H1BA 3OQMA 1YBFA 5DRTA 3V1YA 4BO4A 2R8ZA 1R4AA 5BNWA 3CX4A 3BK7A 4URVR 1U2SA 3AP2A 4U2KA 4V39A 1F8FA 1G6HA 4MS3A 1G6KA 1RHJA 1CULC 3V8VA 2DFLA 5CA0B 2CZGA 3JVEA 1J99A 4QDXA 5G3YA 1EUYA 1J8FA 4Q3NA 3T7CA 3CWZA 1SNYA 2NZVG 2XLBA 1U7PA 2FZKA 1H42A 3HM2A 2VF5X 3NDRA 3G8BA 3RWBA 1DADA 1BNCA 3I6MA 3DM5A 1CY4A 2PWYA 3BXEA 4FT2A 3FUVA 3WSWA 2CXHA 3EGXA 3HB1A 3HR8A 3MJHA 2JGDA 4DWOA 1E1CA 2K2QB 5H7XA 2IHZA 2OAP1 4FSDA 2OD9A 3BA6A 3RIMA 2G82A 1GZVA 1UWLA 3A1CA 2QVLA 1VJCA 2O2SA 2I5PO 3BIWA 3TPCA 2XB8A 3RVSA 1Z2EA 3OT1B 4FPXA 3L9XA 3BD9A 1YCDA 5BSVA 3CM0A 5IPFA 3LZ6A 2M98A 4AS3A 5HJ5A 4IXMA 1JYEA 2WJ4A 3R40A 4CMAA 1CQIA 1SBIA 4IV0A 2HXGA 4NAVA 2OZPA 4ZZIA 3C3BA 4JB3A 4DA4A 4EUSA 3A1UA 1WX1A 4HQFA 4PQRA 5CW2A 3X0DA 4EPYA 2WA1A 1MA3A 4MW4A 4WVFA 1Y7IA 5FUVA 1Y9EA 1XXHB 3M5CA 2EP8A 5ARCA 5IFLA 1WEHA 1YVEI 4LYHA 4XJVA 1AGPA 2YJ6A 3VDXA 4DG9A 1KJ9A 2O50A 1PZFA 2GARA 2RH4A 4CF7A 3GXBA 4KITB 2WHRA 2NW6A 2QL9A 3D7LA 1KH2A 1ZN7A 2HDWA 2Q0QA 2B4YA 3GY0A 4Q9NA 4C5BA 3BWMA 1G55A 2GZ1A 2VC2B 2YMQA 1KSGA 2JGJA 5AWFC 5PGMA 1LS1A 2GN4A 1U99A 1YWGO 4ZEWA 4JL5A 1T26A 3CSDA 2E7ZA 3KK0A 4G63A 2NIPA 3ZKAA 1TM5E 2IYEA 5T6BA 1X14A 2YFHA 4M0FA 3S1AB 3LAWA 1T5TA 3SM9A 5IJ9A 2OHGA 2FFJA 1JQAA 3MERA 1VJ0A 2GRUA 4Z54A 4DLAA 2V9PA 1PS9A 1U0SY 1JR3A 2IU6A 1YB2A 2PL1A 2Q9UA 3WKAA 3H87A 3FSGD 3DEJA 5BW6B 4DNXA 5CFMA 2DQZA 1CPYA 3DGEC 1KGSA 2IYSA 3EZLA 1WCWA 1PBNA 1HE3A 1QC5A 1A9PA 1XX6A 2VA9A 3CZRA 3HE3A 4HN4B 3CZMA 4K8OA 5D1HA 3ROPA 4HRXA 3W04A 3JRXA 1WUJS 1CYEA 1O94A 1X1EA 5HCNA 3AO0B 4C14A 1Y4UA 1EEHA 1ZP6A 1YKFA 1KSHA 5EWMA 4PCAA 4HCJA 5B1SA 2I22A 1GUFA 3VR4D 4BMCA 5JAOA 3T1TA 3BUSA 4UNIA 1HYQA 5IK2A 1WTCA 2VYND 3PQ2A 4IHAA 5C46F 4BFXA 3NPAA 4HWRA 4CF3A 1CY8A 2YCLA 1GNPA 3ROGA 1EVQA 4GWGA 1UPFA 1YR1A 2BH9A 1E0DA 2H2AA 4P32A 2QIPA 2HJRA 3TDKA 3M70A 5CDGA 1V3TA 3GLSA 5KNCD 2RI0A 3AVVA 2IHBA 1ETUA 5EMJA 3INRA 4KBYA 3LK7A 4GI1A 4HZIA 2X2PA 1PR9A 3RRBA 1SXIA 3F6PA 3C74A 3MF4A 4QLOA 4P83A 3SC6A 1QONA 3KQKA 4YMSA 4GX5A 5TT0A 3C97A 3TAUA 1UK9A 3VDQA 2DVMA 3O31A 1Y8RA 2FVYA 3ORRA 1PG0A 2IQ5A 3FCEA 3FRIA 3KELA 3MT0A 1SU6A 4G1UC 4REQA 3V4RA 3N2ZB 1L7PA 2ZJ8A 3MT9A 1U2DA 1V43A 2XE6A 3F7MA 1UQUA 2ZYSA 4AMZA 1XMVA 3HADA 1KJ8A 2YNMD 4IZ6A 1A97A 2VDWB 4XD7A 3B8HA 3SICE 1GQSA 1JKFA 3TRJA 3ZS9A 3ZXXA 1UKYA 1RQGA 5HZMA 2GEBA 2WG0A 5FWAA 1P7PA 4QUIA 5D00A 4ML3A 3PUYA 5G1OA 5G0WA 1TT7A 1ENOA 1QCZA 4WZAB 3DTNA 2NV6A 1EJ2A 2IZZA 2Q6OA 4TL9A 4ZVTA 4ZI7F 3DUFA 2HPZA 1V71A 3VNAA 2B2NA 4MX8A 5DULA 2AF3C 2IE0A 4E3WA 4Y9DA 4YWHA 1N5JA 3D2AA 3FLBA 5BOSA 2O06A 4BX0A 1BVYF 2DFPA 2HUNA 2JFWA 4JITA 3W4KA 2Z6AA 3FKSD 5AK6A 4X7RA 3ZD6A 4TN5A 4ZYLA 2MHCA 2VF8A 1PZEA 3COSA 4MIYA 5EI5A 2OORC 2GEJA 3N6RA 8LDHA 4XM1A 1NMEA 5A3VA 4DKXA 5LKRA 1M2NA 1DOZA 1HEUA 1C9NA 1ZC3A 3PIDA 3E23A 3VR2A 1TYEB 3FXAA 1H6BA 3GFSA 4Q3OA 4LYEA 5F7JA 4D6PA 4E5DA 4TUYB 2VNJA 3MQ4A 3KOYA 4RXMA 4KAXA 5IYZA 1JIXA 4E31A 4NI5A 3DBRA 1POWA 3EXFA 1TMGE 1W29A 4DPMA 2ZRIA 1CEXA 1GT6A 2TSYB 5AKYA 4PAGA 5KYVA 5GVSA 1CIPA 2OPBA 2BJVA 1U5BA 1J56A 4FLFA 3CONA 3N28A 3R0QA 3N6XA 3O75A 4Q4AB 5JYCA 5TJ9A 3GGOA 1Y5IA 1Q7CA 2PZMA 1W2WB 4BBZA 1ESEA 4FQ5A 5DYIA 2PD4A 4RH3A 2BCEA 4LF9B 5F1PA 2JIZA 1V6SA 1MHPA 2JLCA 3HYNA 1VE6A 3NHUA 4X94A 2FR8C 5DMXA 4YONB 4ARZA 5B1YA 3FUUA 5ALJA 2WMNB 2F1RA 2CDCA 4WK4B 2YNMA 1OR8A 2OQIA 3G0DA 5KSPA 1XLTA 2B2XA 3TSWA 3QVVA 4JQOA 4JLMA 4E30A 2VCYA 1I13A 1PDOA 2WC1A 4RESA 4XIGS 5I7RA 1P1JA 4YRQA 3JAWA 4KN9S 2IV7A 4A8PA 3ZCTA 4DCPA 5HWSA 1GFZA 1ZRMA 2P5TB 3K30A 1E3JA 3HU5A 4FFSA 2EQAA 3KXIA 5AXDA 3REOA 4WWHA 2JZNA 3G0GA 4Z99A 3V3KA 1T2FA 1VG8A 4ASUD 3WRYA 4DS3A 3RYIB 3B6ZA 4Q3DA 4CLRB 4F8YA 2AOTB 2BP7A 3RSOA 2EGHA 4I9GA 1ZOLA 4WVLA 5LWQA 1SVSA 2Y2UA 1XB2A 2PGXA 1QHHB 3AKEA 5JROA 4CE6A 2HA3A 3EXIA 5ALWA 3TLAA 5THKA 2E4XA 5DLQC 2FSVC 4F9GA 4DARA 3BWYA 1MJHA 3F73A 3GLGA 5E1MA 3TKLA 3U56A 1X94A 3WG9A 4Q9DA 1XNHA 1YZYA 1TUBA 2V0NA 2YV1A 3WX0A 1K2WA 2K7ZA 4I55F 3QELB 4QREA 1E2LA 1C7EA 5EIEA 4PAMA 2G9UA 2QRQA 3IR7A 4E03A 2H1OA 2R48A 3HA5A 3V4SA 3KXKA 3ESDA 4K1LA 3ZN2A 2DHCA 2H1SA 2JAUA 4WA8A 1ODTC 2R1ZA 2Y71A 1QZ3A 4BAGA 1W85A 1WMSA 2HWWA 5U1PA 3EF1A 3DE4X 3UMMA 3C5CA 4HQRA 4DR2B 1N6PA 1TRKA 3IP6A 1A1SA 1KYQA 2COUA 1NBOA 1YMVA 2C2OA 2H5JA 5FO1A 2PMEA 4OMUA 1XZIA 2VRWA 3LHIA 1E6KA 1VSBA 1Y82A 1Z7WA 3M6FA 1CY7A 3GFBA 4YT5A 1NW3A 4DM7A 3RYCA 2MSLA 1UBRS 4OQPA 2ZBFA 4TOIA 3RDPA 2GKOA 2PRZA 2C58A 1QRDA 3HU2A 4DSZA 1T24A 1P4HA 1X1DA 3KKQA 4R1NA 3U3KA 4ETIA 3KQLA 1KKUA 1WPRA 2WKQA 2XCUA 3X44A 2ZUVA 1O94C 1JWLA 5IH7A 3P0RA 5DOZA 4PZPA 3VFDA 3M4ZA 2J67A 4XX0A 5B7PA 3OOHA 4OFWA 1JKXA 3RH0A 2BCJQ 4IG9A 4ZDWA 2BISA 1P62B 3AR3A 4TMVA 2ZBRA 1PT6A 2Z1MA 1J5XA 2XR1A 4FTWA 1N6OA 2CY0A 4LY9A 2VUIB 2ZU0C 3R6WA 2DFTA 3S7ZA 1TM1E 3QENA 1YXMA 4IHKA 4F4HA 4MA0A 3PR2B 4C08A 1P91A 4YRRA 5TE9A 4A2PA 3S1SA 1GLVA 4NBUA 3HO1A 5L8VA 2BKLA 2GZHA 5K4HA 5T41A 1YR3A 4MUJA 2IUYA 2GBPA 4D56A 4KO8A 3HB0A 2GCOB 1SBZA 3OLQA 4P08A 5ALMA 1RXVA 2QPAA 5KJ6A 3V9PA 3BDIA 1FFYA 3BGSA 3CNNA 3DOUA 1M2GA 4C4OA 4QUKA 4ND3A 3NHZA 4IIBA 3GH3A 3GJ0A 2YUTA 3MCAA 4TTIA 4R9UC 1BFDA 5L40A 2ES4A 4EGAA 1R0SA 3U6BA 3LD9A 4BRZA 4QOEA 3MBIA 4AX8A 4OXKA 4CQLB 3A4MA 2JGAA 1OBOA 3O21A 2R7NA 1M34E 2PWZA 3NHYA 4PG4A 3D5QA 3AMVA 3B9QA 3RS5A 2FF5A 1PYDA 2YJ5A 4K05A 1AQUA 2P3LA 1LWOA 3N1UA 4M9QA 4KYTA 4F12A 5DOVA 2JAWA 4UE6A 3C3JA 5FPTA 4U7TB 4IKPA 4N49A 5ADHA 4CODB 3LHSA 1I4WA 1XD2B 1YV9A 2HQOA 2ZKLA 2ZRBA 4FYYA 4GMFA 4Q9LA 4DLKA 1KQFA 4C3OB 3WHIA 5CEFA 4K9MA 1T3TA 3WWPA 3C3PA 2GF2A 4LNAA 1HF3A 4UU0A 4XA8A 1DC3A 1R50A 1M6WA 1JJAA 2UZIR 5B53A 5BQXA 2BGTA 4IFTA 5FTWA 2RHJA 2VRBA 1MT0A 2AZ4A 4GQIA 4TMFA 3EQZA 3U9TA 3CTPA 5K4GA 3KZXA 3JXEA 2GDJA 4WBSA 2BFPA 1KF0A 1KZGB 1LSSA 3S4YA 1O6GA 3ICQB 2OD2A 1LEHA 2AN5A 5FA5A 1HA3A 2OSBA 3L7KA 5CB4F 4EJMA 5JH7F 5IS2A 5D86A 1Y7HA 1TQ6A 3TQSA 3QUBA 1AKUA 3LIPA 10MHA 5FPPA 4QJ3A 2C3YA 3KB8A 3STTA 1MDFA 1NLZA 2HAEA 4L4SA 3QPWA 4G1MB 4MROA 5AXAA 4DMHA 2JNWA 3ABOB 1T0JB 4L57A 5MGBA 1HYHA 5KTKA 3HKCB 1D2RA 1DRVA 4LZLA 1LQ2A 4CU2A 4DPKA 2XEDA 3FPCA 5IEJA 4LF6B 2FFBA 1OFUA 4B4UA 1JB1A 5AD1A 5B6JA 1Y4DE 5KKAA 4FFLA 1ODKA 5AVTA 1WZNA 1O77A 1N0HA 2XQIA 3MMPA 4JJEA 5IASA 1MC4A 5J43A 4R8MA 4A82A 2WJ3A 4N6NA 4ND2A 3VYVA 2WVJA 2P35A 4NCJA 5IJ0A 2FMFA 1NPDA 3CF6R 2QHXA 2ORWA 1VBFA 2X9LA 4QUHA 4Y3UA 1P1BA 3SGLA 5HVNA 1FJXA 3VV2A 3SYLA 3TXYA 1NF8A 3R5SA 3R8FA 4JNKA 3ZDFA 1JNXX 1CZOA 3DWGA 2QRKA 1FNBA 3M49A 3WB0A 4D0LB 1V95A 2QAGA 5IHXA 5JAIA 2A8YA 1RWWA 1ZO8A 2MIIA 3G8AA 2ONKA 3JQGA 4TSFA 4BVHA 1II8B 3VYWA 2QRHA 1E58A 3HCNA 5DYYA 3HSKA 4D4KA 3QE9Y 3DV2A 2YVQA 1WY7A 2RHWA 3I9JA 2X5KO 4MK4A 2HRDA 2NQ8A 1COWA 1TNDA 1ZVKA 4URYR 4LW8A 3HKDA 3VH3A 5JD4A 3TMYA 4BO2A 4Y7DA 1NQVA 4BWFB 1RRCA 2OCDA 4OMCA 2FY8A 1TMOA 5JUWA 4HQ6A 3UUGA 2NSLA 1UUFA 1P0IA 3KQQA 3K4HA 4JL8A 2RG7A 2HCTA 3H65A 2H5IA 3PNBA 2NMVA 2WEKA 3BERA 3JZDA 2PLWA 4A15A 4JK3A 3HWX1 3FPGA 4WSOA 2HSZA 2R00C 3AF0A 1LJUA 3NM5A 1MVOA 2AMLA 4ZODA 3QSYA 1AKEA 1ZFNA 3BL6A 4CKWA 2XCQA 4V1CB 3CUEF 4D0SA 1T2VA 2VQSA 3D2CA 4MR7B 4X8LA 5AKGA 4RHXA 4B7XA 4MDEA 2HKIA 1E3DA 4A16A 5IBCA 1NQXA 2DCUA 1CE8B 5IDYA 2YIJA 4XD2A 1SZPA 1V11A 5F3RA 3MT8A 2BMDA 1PR3A 1CJKC 4LNUB 4B74A 1CS0A 1WU8A 1GNVA 1D6MA 2A9VA 2NM0A 2O48X 2VK2A 4BE7B 2BI4A 1FFAA 2XVZA 4B85A 5KTMA 5LPNA 3H2ZA 3W5HA 1M72A 3S1AA 1QO7A 2VYNA 4UPDA 1NW4A 3V42A 1X7WA 4Z4HA 1Z9BA 5DISB 2R62A 3DEZA 1T5LA 2PS0A 3QEOA 2V7XA 5EIWA 3RYFB 5EN4A 4G2TA 4JQSA 4KZPA 3OQNA 1RZRA 2PA0A 3EDMA 2CJFA 4OKSA 3T5GA 2BHNA 5DT2A 3FDFA 5FBVB 4D1YA 4XGNA 1N8NA 1VPTA 4O4HB 1JAZA 4ITRC 2AXPA 1LPNA 2I2BA 1C3XA 4FMPA 4QVIA 2FPPA 5JNSA 1JPUA 3TEFA 4YRIA 3ITDA 1US8A 4ZRDA 1RWNA 2B4AA 3AH8A 4XUDA 4CM7A 4ESHA 4Z2AA 3W4JA 4IDQA 3TTUA 4R54A 3HP7A 3PQ7A 1Z4KA 1HK7A 4DCGA 2R1VB 1KIFA 3PRKE 5JT1A 3C3KA 3T1YB 2CHGA 2RKBA 2M6SA 3PDIA 3C2QA 3HZHA 1NMYA 3C7AA 4R3UC 2HHLA 1GAJA 4BYMA 3KXDA 3CGWA 4CG1A 1ZYUA 4QTUB 3COJA 2OHHA 3OPVA 3DMRA 3OFND 3A05A 4Q01A 4XTRA 4B6OA 2N1MA 4ZJYA 5B7GA 5E9AA 4PNZA 3WV4A 1KQOA 2CLMB 4RNCA 3LQQA 1ACLA 3HR4A 1I7DA 1EWKA 1C0IA 2O7RA 4C2AA 4PQFA 4BNHA 4DEVA 3PPXA 3PXBA 4LQCA 2XT0A 3F5FA 4UE2A 4Y1GA 3WZ2A 5MFZA 4U63A 2Y1WA 1A76A 4BNXA 4ESEA 2PSFA 3SR4A 1EM8B 2R84A 2HK9A 2PRYA 3QVTA 4P8RA 1VI6A 3A2MA 3LGXA 5DHUA 5EP1A 3UCXA 3WLSA 1BYUA 2CL5A 1QGYA 4CUZA 1XCLA 1MZVA 1W5BA 1J8YF 3OT4A 1GLGA 2CFCA 2PLFA 4DLPA 1W48A 1T0PA 2OCKA 4JR0A 4BBJA 4EW1A 5C5CA 4YJFA 5BO5A 4UAGA 1MFPA 1QYIA 2B25A 2IDMA 1A98A 4KOAA 3WZLA 1ZMBA 2EQ5A 2IU3A 3D7NA 3IXMA 2Y0PA 3RUIA 3ZTWA 4EEZA 1LLQA 1RPNA 4C3UA 1INLA 4L0CA 4V0OA 4KR9A 3VU9B 4F92B 3QFSA 4UZFA 3UWOA 1E3WB 3QEJA 4LECA 3KSBC 1PYGA 5J1TB 2QMQA 2Z1NA 2NT3A 3SBOA 2XVXA 2HDHA 4XUEA 1YSCA 4ZGGA 2EZTA 2VDOB 4FFNA 5B2FA 4OQDA 1OGJA 4CM6A 1E7WA 4HGNA 1ABEA 4F9EA 2WTNA 4LHXA 1M6YA 2JGDB 3VKFA 1E1CB 1B6GA 3EVGA 1I01A 3IKMB 5J4KA 1C3OA 2AEMA 2X13A 3JAKA 4HXFB 3HY4A 3FY4A 1RPJA 4M9UA 4RDIA 5E95A 1HQYE 4B3FX 2F64A 4C89A 4C76A 2RE8A 4HDAA 3U4DA 2NP7A 3NCHA 3R24A 1SKBA 5D7NA 3VR3A 1BS2A 3OM8A 4MIOA 1HNZB 1JYSA 1N6IA 1Y5NA 2BMVA 4OM7A 3LUFA 1CS0B 1N77A 2GB4A 1S96A 3E4DA 2J3MA 4RK4A 1G19A 4EPWA 4IHJB 3EZNA 2HPHA 2PSSA 4BMOB 5ERYA 1QX3A 4RV4A 4WLFA 4WV3A 1NVXQ 5LYJF 2G1PA 1OYOA 4WNAB 1KR5A 1SC3A 2HCJB 1EZZA 2QWXA 3K09A 3K4QA 1OXMA 3ANYB 1OPRA 1UDAA 4L75A 3I8SA 1PT8A 3W5VA 3W2IA 2WQZA 4M2LA 3B1JA 1GTL1 2G9NA 5J58A 3AFHA 1JZQA 3B3QA 4BQEA 521PA 2ZXUA 1O57A 2FWAA 1HNNA 2HCFA 3ONWA 3PNQA 1ETHA 3VPDA 4WNIA 2EBHX 4RKFA 4LOHA 2V3VA 5J2UA 4YEDA 1UK7A 2QUBA 2ZBDA 4UVHA 3W5BA 2YZNA 3EMKA 1F3LA 2UYHA 1YT5A 2IELA 2YZ2A 1I36A 1GTJ1 4LJ7A 2CHFA 1N2HA 4B75A 4QU8A 1R8QA 1NPYA 3R0JA 1UT6A 3DZCA 3UA3A 1EBUA 1ICIA 3R3JA 1FOEB 2V6MA 4H77A 1YDWA 2CMFA 2IODA 2Q4DA 4V0MA 1YONA 2K4MA 2GNPA 3N8HA 4PLYA 3KFVA 1O89A 1HQKA 1M8FA 5T3YA 3ZY6A 4F3YA 5HKBA 2CXNA 3QTTA 1BKYA 3WL5A 2OBBA 3TZQA 3DBHA 2J3HA 1E6LA 4ENVA 4MKIA 2PRSA 4RIEA 3LL7A 4TS4A 1VCIA 2QDXA 2PY6A 4RXTA 3W79A 2WQ7A 3AVTA 1TADA 1JSXA 1QYCA 4EGFA 1OLOA 3K9QO 3REFA 5CHEA 4U9HS 3SBXA 1AURA 1IH8A 3ZGVA 4BKRA 4K9NA 4XRGA 1IHOA 1RM5A 3I04M 1K8QA 5KYGA 2WD7A 2WZBA 2P2CA 4NCBA 3KJEA 1A9YA 3O03A 3WYFA 1ENZA 2BRUA 3IRUA 1K08A 2AWNA 3R3YA 5IUKC 5AK4A 821PA 2DBVO 5ICEA 4G0WA 1U7ZA 3G3EA 1FFXA 3G7UA 1JPNA 4ZI3A 4MVJE 3ON5A 2CWDA 2RONA 2DQSA 3A6LA 2DFKB 3GVHA 4GLJA 3L7OA 2IKQA 2PZAA 3LOUA 4KQKA 4MCHA 4MS1B 2V55B 3K9CA 4MOWA 1LBQA 1RXYA 1OWMA 3VV3A 1YTLA 3C85A 3A1WA 2EZ9A 1H9BA 1S8FA 2IXGA 4ZO8A 2Q1UA 4Q15A 3B2QA 4YQZA 1CQXA 4RTJA 4GKKB 1P4SA 3B52X 5H02A 3PFKA 4KQ6A 1XTRA 3GJTA 1XZ8A 2YXLA 4TTRA 4A4DA 4REQB 1S2OA 3ZCUA 4FE7A 4R51A 1PR5A 2Q2VA 1NLYA 2FLKA 4LRWA 3AVWA 5JISA 1B23P 2QR5A 4RZUA 2HCRA 1T5SA 3CNQS 2PE5A 1FS4A 4QQKA 5FTMA 5FI3A 4UQLA 2IYAA 3T9EA 4GNRA 2A0WA 1XLVA 1C0KA 1X74A 2ZWOA 4AY3A 2DPMA 1QFZA 4G9GA 4BLUA 1M33A 1RLOA 5C35A 4H0NA 5L3VA 1EA5A 2QE6A 1XTQA 1FNCA 2W6JD 3ONVA 2OGWA 2AZTA 3BAFA 1ULZA 3N70A 3QYPA 3IPRA 4YJHB 3WYDA 4ZJUA 3BOSA 1ADCA 3BIOA 4E5VA 4Y6SA 4ZREA 2C5GA 2WWVD 1PNTA 3M6LA 5FPYA 1FDRA 1Y37A 2DHQA 1D4OA 1P9NA 3N39C 4HWPA 1WPXA 4LYJA 1OIVA 4RC9A 2ONYA 1Y8QA 3ZHRA 5KX5A 3RTDA 2DG2A 5AM1A 3ED1A 3UC5A 1DWOA 1TLLA 4FHDA 4PLVA 1UZUA 3ZH9B 3ZXSA 4PLGA 2AVNA 3IOCA 4RSMA 3FLMA 2CNDA 3NBYC 4R1SA 1E5XA 1RVDA 4IZOA 4IOJA 3KCQA 3IHTA 1P7YA 1ZD5A 4G0UA 1RR6A 3PNMA 4IOMA 2ZJ1A 1E2PA 1GTG1 4K26A 4PYKA 3LRTA 2GHTA 4E11A 2PXCA 2WTXA 3LKBA 3A6ZA 2O8FA 1RCTE 4X71A 3DWEX 3PQ6A 1FEZA 1X1QA 3RREA 4G0VA 2GUWA 2VQ3A 6PFKA 4RPGA 3ZE8A 3TJRA 2V65A 3FE2A 4ZQIA 1SCJA 4KQ2A 2VDMB 3E22A 3OJ0A 4RHFA 2D3TA 4TM7A 2RHMA 4INOA 3VO1A 1GAEO 5DBIA 1Z5NA 3HHEA 1MEOA 1W5SA 2YR0A 3KLBA 4YV1A 3ECAA 4B3TB 1UK6A 4PGAA 3WL3A 2AC2A 3A1EA 2UVQA 1AK9A 3UCEA 3EFHA 2O3RA 4R3WA 3AIIA 4UEKA 4Y9SA 5LLSA 4JI3B 1L5FA 1CJBA 4FFWA 3E7PA 5AHOA 4XOUA 3T8YA 2WKWA 1F0KA 3ETLA 3I23A 5FL7D 2AIRA 1LX6A 2W5UA 1FP6A 3IJ5A 3S2ZA 3TGWA 1MC1A 3H5OA 2DERA 4OQYA 1QUFA 5LQSA 4JT8A 4A6EA 5L53A 1XQYA 4EJ6A 1WL8A 4NU6A 5EVJA 4ZAYA 3WFJA 5K3DA 4O02B 4BZQA 5BWNA 4H4EA 2CE7A 3KPWA 2VN8A 1VLLA 3ONEA 3TSCA 4HZGA 1OUMA 2NGRA 2X5XA 2ZR9A 3WP1B 2Y0DA 1HORA 4JFAA 1CT9A 4HATA 2ZRLA 1P60A 3R6LA 1T9GR 1QPGA 3QF4B