4QGAA

S.aureus tmk in complex with potent inhibitor compound 19, 2-(3-chlorophenoxy)-3-fluoro-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 84
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgaA00
1FFHA 1UAAA 2HYIC 2PH1A 1NVXQ 4B3FX 1E1QD 4Q1CA 1QVAA 3W5IA 2OZEA 4A15A 3BB3A 1MO5A 1OKKA 4BFYA 4F4CA 1FZQA 2NZJA 1UFQA 1YR6A 2HJVA 5HZKA 4M9SA 4O2LA 4YQFA 4O3MA 4LZZA 1GTVA 2WWYA 4NU0A 2HUPA 2CNWA 2GWHA 1Z2CA 2VHQA 3T1TA 2ZXUA 1US8A 1HT2E 2C2HA 4WIAA 4DCVA 4IJMA 5J4VA 4PR0A 1WBDA 2ONKA 4ZKDA 3TBKA 1ZAKA 5CM9C 5JECA 4NBSA 3CZPA 4C0KA 4PSAA 5JZVA 3MUFA 1JR3E 1OIXA 3TUIC 1OSNA 5SZIA 2RH5A 2OFOA 2PLFA 2JDIA 4X8HA 3VKGA 2ZJAA 3OESA 5BN5A 2PX3A 3H1TA 4Q7JB 4RZXA 1IN8A 1QHGA 4NYJQ 4M1OA 1G9XA 4LHZA 1R8SA 2DYKA 1WCV1 1X8LA 1W0KA 2RMKA 2WSSD 2IYVA 1Q12A 2VSOA 2Q0HA 2ORIA 2VP6A 2VP0A 1XTKA 2ZRFA 3FMPB 4M1SA 3TVDA 5KHOC 2C8VA 4C0BA 5KPDA 2ZJ8A 1GKIA 1ZNXA 4DCTA 3E1SA 4NE2A 2GJ9A 4JIMA 4PFSA 3UMRA 4G5RA 1U0HC 1CRPA 3FMOB 1NIJA 2F6RA 2PMDA 3KJEA 5F2EA 5FOWA 1N3BA 1IN5A 4EAQA 1N5JA 4HDQB 2ZI6A 2VH5R 4OHVA 4BLSA 2BJVA 4OJQA 4FI3C 2GCOB 1EFUA 3HU3A 4YXWD 1CJTC 4NCHA 3W6OA 2XJ4A 3SHFA 3WXMA 2RGNC 4BLPA 2W83A 4LDJA 1EFTA 1OW3B 3EZ7A 5CDFA 3SEAA 3SI7A 2O8DA 1F60A 3W6NA 5P21A 1ZRHA 1TQ2A 3CIOA 5FOVA 2JLZA 4PC3A 1SVWA 1KOFA 4MYUA 4OI4A 3KDSE 3P32A 5FOXA 2ZUCA 1YZKA 5ANRB 5KSZA 3LW8A 4HEJA 1YR9A 3BE4A 2EFGA 5J5CA 2JLQA 5JWHA 1ZW6A 4PTLA 1Z8FA 3R9IA 2QP3A 5BWMA 3KQUA 4HZUB 3CZQA 2HYDA 4R7ZA 1LFDB 1Q1BA 2ZJ5A 3WNBA 3B1WA 1HQCA 2HLDD 2C99A 3QKSA 4Q02A 3A37A 1IXRC 1U81A 3IUYA 3U6BA 4RCYA 3QVVA 3H0KA 4B71A 5L3VA 4NCNA 2W0SA 1SVSA 4Q7KA 3VR2A 5KSPA 4CF7A 3AF0A 5DHFA 5FR1A 3QENA 4HAZA 2WIBA 3FB4A 1G3IA 3K09A 2IL1A 1MR3F 1MRNA 4A0GA 4FIDA 2RGGA 2GF9A 4Y0AA 2EU8A 1KI3A 3VNUA 4M1WA 1EFHA 3H86A 1E9FA 4LJ8A 4WA7A 4DKXA 1T0JB 4OHXA 3GLIB 3C14C 2P3SA 5CJPA 1Z08A 4HB3A 3NHBA 5ELXA 3B9QA 4AYXA 4YMTA 1RFLA 4QNRA 4TSFA 3R20A 2X77A 1NSTA 2GXUA 3OZXA 5KUTA 2W2XA 3R7WA 3BK7A 4ESHA 5KNDA 2AHOA 4A9AA 3NDBB 4IVPA 3X1XA 4URVR 3OAAD 2PCJA 2VSFA 2LWIA 2F43A 4L5BA 4KO8A 4MUBA 3TUJC 3K0FA 3F3YA 4Q1DA 3BRWD 1KMQA 2IYSA 2C78A 2I1VB 4RFSB 1VIAA 3OIVA 4DSUA 2D62A 3EIHA 3BH6A 2RGEA 2ZRLA 4N3NA 5EE5B 1ONBA 4OQXA 2R65A 3SN6A 2GJKA 5EZ6B 4BFZA 2ZI7A 3RS4A 3LXXA 4A2PA 4JL6A 4URZR 1WMSA 1QRAA 3LVQE 4OK3A 5FL7A 3BXZA 2KWIA 4G5QA 2F9LA 3QOFA 3SYNA 1OH5A 2ZU6A 1Q22A 3ASZA 2JLSA 3MWYW 3Q85A 2B7BA 3IQXA 4KU4A 2CL6X 4FINA 3O8RA 4D2IA 2PJZA 1IJFA 5DN6A 4EQ6A 4YMSA 4V03A 1Q44A 5KYKA 1XD2B 1ANKA 2R6AA 4KLNA 2WSMA 4IHQA 3QXCA 4ON9A 1RRGA 2DPXA 4G3XA 3QNUA 4OK6A 3EPKA 1XTRA 3DVLA 4Q1EA 2OCBA 5J4HA 2DWOA 5JS7A 4W5JA 1X1SA 2ZREA 2VHCA 4LYFA 3NEJA 5DE3A 4NYMR 4Q4LA 4LX0A 3Q72A 4QJ3A 3QXSA 1X86B 3W90A 4WZAE 5UKDA 2QEQA 2AL7A 4Q4AA 3GLGB 3ZDQA 4US0R 4BFSA 2OG2A 4KCGA 1GWNA 5B64A 2HF8A 4Q18A 1P60A 4DJTA 1WRBA 3TSWA 1KMHA 2D4HA 2IF0A 1KSFX 1S3GA 2QN6A 2ZSBA 4NCKA 4NCIA 3WP0A 2IBMA 3W6PA 4B3GA 4TL9A 2D74A 5EE9A 2ZE6A 4IRUB 4LJ7A 3UIEA 1NBMD 5FBVB 1Q21A 1IXSB 2IX3A 1X1RA 4WW0A 3CWZA 3THYB 4C9BA 2DFNA 4ZIRB 4B73A 2WPDA 1U2RA 3B13B 3ETLA 4DB2A 5TARA 1KK1A 2R62A 4N0DA 1N6KA 3JZAA 1T8UA 3W34A 3O8DA 3AF3A 1TQ4A 3LW7A 3K0SA 3QEOA 1DO2A 3NBZC 4GZLA 1N6OA 4J0QA 4JKIA 3UG7A 1FUKA 1RVDA 4I1UA 2DY1A 2J0SA 2XSZA 2AWNA 2AFHE 5L3QB 1QHHB 2FSIA 2OBNA 2ZQ5A 1GVNB 3H4MA 4C7OB 5CB8A 1QF9A 2V9PA 3I8XA 3DO6A 1XMIA 1Z83A 4BLTA 4MKFA 3FDIA 1SVKA 5CIQA 3S1AB 4C2TA 5KU1A 4LPKA 4M2LA 3GD7A 2QGZA 1W44A 2A7QA 1AM4D 2H5EA 2WM9B 2IS6A 1E0KA 2WJJA 1M7HA 1OV4A 3TIFA 2IXEA 2LKCA 2W2TA 3U3KA 4C3ZA 2ZSEA 3BJIC 1EFRA 1T6NA 1DG3A 2ZI3A 2FJUA 2H92A 2Z0MA 4JLMA 1KO1A 3KXLA 4NYIQ 4A0RA 5KPJA 4IDPA 3PXGA 2ZYWX 4JBYA 4D4LA 3BAFA 2ZSAA 3RWMB 1PZNA 4IXNA 3CRW1 1E99A 2WMNB 1KO7A 5FUWA 4CGZA 1JQJC 2CLSA 3GJXC 1ZM9A 3QKUA 4JBXA 4A8JB 4ZCMA 1KJZA 4OYHA 2PT7A 4PO9A 4DCSA 2ANBA 2P67A 2V54A 3C16C 1W36D 2ZE8A 2G77B 2A30A 5L8VA 1GRQA 1JPNA 4O2RA 4OHWA 5C18A 4NYMQ 1OFTA 2OUKA 2V1XA 2B92A 4Y0VA 3TW8B 3G5UA 3NKVA 5G41A 4K81B 1CR2A 2O8FB 2ODEA 2D7DA 3GJ4A 4IFBA 4KXFB 1G8YA 2EW1A 2H18A 1XCMA 4P4SA 1S1CA 1ZIPA 3P1JA 2ZRCA 3QKTA 2O8BB 4YMWA 2NMVA 1I2MA 2A5FA 2TMKA 1DAIA 2GNOA 2QRNA 2J7PA 1Z6GA 1IY0A 1G4UR 2ZRJA 3TR5A 1GDDA 3OEED 5AR1A 1OXVA 4IOLA 3AEZA 1E3MA 1M8PA 3GJ3A 5JEDA 4HYYA 5JJKA 5FBQB 1XMSA 4F7WA 2FFHA 5C4MA 1HE1C 3AQ4A 4TMZA 3FHOA 1J2JA 2G0NA 2ZAOA 4FWIB 1CKEA 4OHYA 1RZ3A 1IY1A 2X2FA 1H8HA 3IDQA 2W0MA 5DGXA 1TQDA 2BBWA 4LY6A 2MSDB 3K70D 1A1VA 3REGA 4Q00A 3UMFA 5B57C 4HDCA 2NPIA 2X8AA 1KI4A 3MSXA 2XTNA 3SQWA 3LVRE 1YE8A 4KSBA 1OHHD 2QAGC 4Q4JA 3D31A 1E32A 1ZP6A 1L2TA 5F9HA 2SHKA 4PZZA 4F91B 4R71A 2G83A 1H8EA 3MMPA 4NH0A 5HKKA 3PR1A 1FUUA 2ZI4A 4A92A 1W49A 5EP1A 5EP2A 5FPYA 2WWWA 1VCIA 1XPUA 1R2QA 2ZJYA 3T1OA 4PAQA 5EZ5A 2GCPA 1CF4A 1W4BA 4RD0A 1NG1A 3CB4A 2QPTA 2WVJA 2JJ8A 1NKTA 3L0OA 1Z2AA 4CEHB 1N6NA 4BRWA 2ORVA 3CRMA 5DI3A 5JRJA 1QHIA 2C77A 4TT3D 1W2HA 2H1LA 3K9LA 4LBYA 1Z3IX 3VR1A 2ZROA 2G1KA 2IYWA 1JPJA 3IHWA 3E5HA 3K9GA 2ZRAA 4A4DA 4W7SA 3U7GA 3CNNA 1TTTA 3QY0A 1DAKA 4TMVA 3MJRA 4R9UC 2EVWX 2A78A 5C1BA 1N6LA 4HAVA 2OXCA 4KVAA 4MRRA 4S2EA 1FNMA 3DDCA 3CPJB 4URUR 5FPHA 3QKRA 3ZLJA 4ARZB 2QTFA 2ZE5A 4KYUA 2A5DA 2OHFA 2IYLD 3TSOA 3RS7A 4MITA 1J70A 1P73A 4V0KA 3FMIA 3TR0A 3I92A 2ZSDA 1RYHA 2HV8A 2PEYA 3CM0A 2ZR9A 4YMVA 3SU8A 2BBTA 5EXXA 1XFAA 1JR3D 5B30A 3ZYCA 1G5TA 3H84A 2P0EA 1Q1QA 3VX3A 1HURA 2VEDA 2XEXA 4P33A 4MUAA 1EFCA 2EYUA 2K5UA 3QE0A 4GT1A 1W5TA 4LI0A 4G0NA 4LV6A 3GLFB 5F3WB 4LC0A 2C9OA 1N0VC 1VHLA 3PUXA 3TQFA 5D3MB 4A1FA 4E09A 1J90A 2J9RA 4EJSA 4ABYA 1U98A 2QA5A 1S8FA 2QQEA 2XNDD 2YWEA 1OKKD 2VIIA 3R8CA 2OCAA 3BFXA 2XNSA 3WRXC 3BOSA 2V3CC 2CLCX 4BZPA 3KKOA 1G7TA 3LXRA 4ACBA 2PT5A 5FBLB 4V0LA 3FTQA 2IWRA 2OAP1 4BFWA 2OLJA 1VCNA 4D82A 1E2MA 3QXHA 1KK3A 1EWQA 1T4GA 2FG5A 2CNWD 2FF7A 1EWRA 2P5TB 4GNKA 4V0OA 1XMJA 4ASUA 2G9NA 3T1QA 5KDOA 2XTMA 3CLVA 1Z0KA 3HWSA 3WHLA 1UBEA 4N1AA 4HB4A 4EFNA 2R6GA 4D4JA 2Q21A 5TVKA 1I4LD 4DSNA 5DO9A 3LQRA 4ZKEA 4AYTA 4RD2A 1II8A 1KJWA 3UPUA 2F1RA 2G0TA 1CTQA 1L8QA 3DHWC 3PEUA 1E2PA 2JDID 5EJEA 4UNSA 3VQTA 2KE5A 4B74A 1TQ6A 1GRNA 4LYAA 5A5GA 1F5NA 5FTNA 4TZ0A 1JJVA 4BFUA 1CLUA 4G5SA 1YZTA 5BYJA 2BCJQ 1UKVY 2ZYUX 4QRHA 2MMGA 2CEAA 1W0KD 4LBWA 4Q47A 2OILA 2DWPA 4HLUC 2D2EA 4WZBE 4ACAA 2JLVA 2OM2A 2O5VA 3GFTA 4QL3A 2GZHA 3B7GA 3P4XA 1SHZA 3LLMA 4DHEA 3VR6A 4IOJA 4TL6A 5A0FA 2WICA 3A1VA 1Z29A 5JSZB 3CUEF 1P2TA 3RLFA 2IS2A 1HQYE 5DHAA 1G3UA 3P26A 3CNLA 3TSZA 4BRUA 4LK2A 2AD1A 1IN7A 4PAOA 3I5YA 1Z6YA 4Q7LA 3U44A 1F48A 2V7QA 1GL7A 3B1VA 2IYTA 4JS0A 3ZH9B 4JZKA 1DG1G 4YMUA 5LD2B 1MO4A 2IYZA 1ZBDA 4RD6A 3IEUA 2ZS9A 3ZS9A 3DOEA 2ZVPX 1F2TA 4DB4A 1WE2A 3B60A 3PG5A 1G17A 1E1RD 1XWIA 2IEZA 2YWHA 5GJBA 1D2EA 1K6MA 4V0NA 1C1YA 3FKSA 2DFLA 4B44A 2IUUA 2F1JA 5TDHA 2DHRA 5TXGA 3SS8A 4A8JC 1ETUA 1QBKC 4U00A 1PJRA 2GILA 2IT1A 2CCJA 1HY3A 4AK9A 1L4UA 3Q7PA 5CB6A 4FXPA 4I1VA 4QBHA 4EUNA 1KO8A 1VG0B 4DBLC 3EA0A 3IQWA 1MABB 4YONB 4QGAA 2BM1A 4P32A 2ZM5A 3WNCA 1KK0A 3K0AA 4P31A 3ZZTA 5LPNA 2N46A 3H2YA 1A7JA 4NYJR 4F93B 3K53A 1ZD8A 4U02A 4BFVA 3ZQJA 1OF1A 4ZDKA 2F3TA 1XJCA 1VYUA 1KIMA 3LAWA 2GRJA 1LF5A 5J40A 2ATVA 2E1RA 4RY2A 3TMKA 4MKIA 4TYWA 3EXAA 3LD9A 3QF4B 3BS4A 1U8YA 4XVQA 2GVZC 1W1WA 2FZLA 3OIYA 2RCNA 2Z5FA 3RS3A 2J87A 4B3BA 2HT6A 5JWRA 3EX7C 2IHYA 3QUSA 2XXAB 4ZPXA 1TUIA 1X3SA 4JKYA 1A2BA 1LB1B 1A82A 2I1QA 4TSFD 1TEVA 3EAQA 1E2JA 2QBYA 2EQBA 4PPFA 1E98A 2GEVA 2NTYC 1E4YA 3U4QB 3LFUA 2YC2C 4O0MA 2QY9A 4PSVA 5HR5A 2BOVA 5AUNB 2P5SA 3T34A 3HJNA 3ZVLA 3L0IB 2EFHB 4LJAA 1MKYA 2J59A 4ILEA 3FKQA 4P0TA 4LJYA 3SBEA 3HDTA 3HU1A 4XSGA 1GG2A 1ZD1A 2QPAA 3LLUA 5GJCA 4NZYA 3U6KA 3EPJA 2QM7A 4US2R 2QTVB 5FL7D 1LY1A 1DAGA 3UWKA 3FFBA 1LV7A 4Q19A 4XSHA 4NTZA 2XOKA 3LQQA 2WWXA 4GZMA 1NLYA 1LS1A 2W6ID 4P4TA 2XNDA 1XDBA 1YVDA 3I32A 1WQ1R 3K9HA 4FMBB 3UK6A 2NO1A 3A4LA 5DN6D 5IF9A 2WTUA 4JLNA 1KO4A 5TV2A 5CIWA 2H16A 3FVQA 4M0LA 4JVNA 2A5GA 3B9PA 2WAYA 3IO5A 1EXMA 2OCYC 4P4UA 1GP2A 5F9FA 3PENA 3KXIA 1VCOA 1GNQA 3O47A 4MYHA 2ZS8A 3CR8A 4JYBA 2ZI5A 3SFZA 3IGFA 2JLXA 3VX4A 3VTKA 3NEYA 4BLOA 1QDEA 3IHLA 1WBBA 1YR8A 1K5DA 1OFHA 1TAGA 2A5YB 4TL8A 3O8BA 4CEJB 2NO0A 4AD8A 3AUYA 4DT1B 4A82A 4NKRA 1RRCA 3NTUA 3WMEA 3RANA 4B3DA 1P62B 1FTNA 4G1UC 421PA 2F1HA 5BXQC 1Q3TA 3N2EA 3C5HA 4JT2A 2QNRA 2ZRMA 5J4YA 4L9WA 3RRNA 1SXJD 3CR7A 3I62A 1P2SA 2WPDD 1NNEA 5FR2A 4XJXA 4MDFA 1P9WA 1BO6A 1CJKC 2VP5A 4E07A 1NLFA 1XZQA 4PXAA 5B2ZA 2UKDA 2J7KA 1S9HA 3KJHA 4I99A 3KQHA 3RHFA 4LBZA 2GK6A 2XSZD 3GLHB 4US1R 3PEYA 2GCOA 3I72A 3JVUA 2AK3A 4C0AC 1TF5A 1XEXA 2FX3A 1KKLA 2F9MA 1KSHA 1AN0A 2XX3A 4JBWA 4AY2A 1NI3A 2VLIA 3DKPA 4RFVA 1E1RA 3L43A 4M53A 1O3YA 1R6BX 2P2LA 2AXNA 2OAQ1 4DIEA 3P4YA 3IEVA 3W8NA 3J81k 3IIMA 5BQ5A 2O8DB 3TW4A 3PEVA 3WYAA 2GCNA 1S2MA 1U0LA 1UBGA 3ADKA 3LWNA 5M04A 1VDZA 2AR7A 3D6TB 2PZGA 1LVGA 1IONA 4YDHB 3NBYC 1AGRA 1E9CA 2JJ2A 4Q66C 4JLBA 1IBRA 4KBGA 2O8CB 4AC9A 4HZUA 3DM9B 2VP4A 1EFRD 5FBRB 1V43A 4D26A 3P20A 5EXSA 1KK2A 2BMJA 2NOAA 4MH0R 3MFYA 3T06B 5FUYA 1NL3A 1E2EA 1GFIA 5CDFE 4HAUA 4L8GA 2QAGB 3GEHA 4QGHA 2QUZA 2ZPTX 1NY5A 1XXHB 4EFMA 3I3SR 2FPMA 2FPLA 2C96A 4LHWA 4Z8XA 4PPQA 2ZRKA 2HF9A 3VU9A 2OBLA 3LV8A 5DYGA 5KTYA 4MRPA 2VF7A 1XJ0A 4CT5A 1Z63A 3EC2A 2G6BA 4JVMA 5IK2A 3P27A 3VHXA 2O0KA 4E5UA 2ZU0C 2CBZA 2VSXA 3GLIA 2GXSA 3K0CC 2ANCA 2OO7A 1VG1A 4BASA 3ONWA 5LD2C 3GCGA 2QP4A 4Z54A 2QZ4A 2V6IA 2J7PD 3KQLA 1MV5A 2WJGA 5HE8A 5C2JB 3A1TA 2YZ2A 2AKYA 1ZNZA 4LJ9A 5CM8B 3VAAA 2Z4RA 3D3QA 3OFNA 2HT1A 1SVMA 4LV5B 4RZUA 2LCFA 3IO3A 1GUAA 5HCIA 3R7WB 3T12A 4BFTA 2GESA 4KV9A 1A5TA 3QEJA 2ZRBA 1ZNYA 4NONA 1XPRA 2FSGA 1SHKA 1VTKA 3L2OB 2J0UA 1ZC4A 2PLRA 2PZEA 2VL7A 4RFSA 5TMPA 2QT1A 1FMLA 1Z0FA 2RGCA 3TAUA 4DEYA 2J0VA 1VG9B 3RABA 1H8HD 2W6IA 2OBMA 1E94E 1GAJA 4KAXA 4MGKR 3N2IA 4RZ3A 4DXAA 4NYIR 3PUYA 1G4AE 2J5XA 1XEWY 3QF7A 2FEMA 4PHGA 3CWQA 3GLIE 2L0XA 1XB2A 1N5IA 1UEIA 5FTMA 3A58B 1KI8A 1YKSA 4TLCA 3VR5A 3ZVNA 2QE7A 4I81A 1RYFA 2PEZA 1ZCBA 3CX7A 4Q1BA 5CITA 3THWA 1Z5ZA 3T5DA 1OJLA 5HKKD 1H8ED 2I4IA 1Q0UA 3BFKA 4BEBA 5FOSA 4D80A 1TU4A 2IYQA 2YVUA 4Q9KA 1AZTA 4IW3B 1Z0DA 1T8TA 3OHMA 4II7A 1KNQA 4PQRA 5DH9A 2F1IA 1GILA 1Q3HA 1TMKA 1OIVA 1NVWQ 5E7IA 1HE8B 3BGWA 4A2QA 1W4AA 2GTPA 1PLKA 2CCGA 3LA6A 3QG1A 4BWYA 1U9IC 1LS6A 2KI5A 3GLGA 4GP6A 2C9YA 2DR3A 3IILA 2OESA 3DM5A 1YHNA 3FWYA 2ECKA 2JEOA 4URWR 2GXAA 2YV5A 3N5CA 4OJKA 1W4RA 4DLVA 1YZUA 3WRYC 1UDXA 4EPVA 2QI9C 3ZZ0A 3NBFA 2Q9CA 1SXJA 4A6PA 2ZRNA 3M0EA 2HCJB 2GJSA 2EFCB 4TZ6A 2QMOA 1SKYE 4LHXA 2BKUA 1E2FA 4PC2A 3QSYA 3THYA 2QAJA 2MMCA 1FX0B 2GXQA 2RGDA 4HAXA 1FW6A 4GPTA 1WP9A 3CW2A 1CBUA 1NIPA 3M4YA 2JIZA 1KZGB 4HLDA 3SBDA 1R5NA 1KI2A 3EZ2A 3WNDA 4JSYA 3ZVMA 4LYJA 2FN4A 4WXPA 3VFDA 1VECA 2BC9A 1TU3A 1D6JA 3LY5A 3AVTA 1C4OA 2P6RA 4TQ9A 3GJ0A 3L82B 3AVPA 1G64A 1Z0JA 2C9CA 5L3QA 1QHHA 3GLGE 3RC3A 4MDEA 3DPUA 3AVQA 4GMDA 4DRZA 1QHYA 2NO6A 4HLQB 4OI1A 3X1ZA 2BMEA 5FBWB 2IHBA 4L15A 3DL0A 4HDOB 2ZRHA 3NDPA 3MAAC 4DDWA 5A4JA 5JFGA 1XMVA 1U90A 1FQJA 2XAUA 3I5XA 1W0JD 4Q9JA 1SXJE 1T91A 4B76A 3G0HA 2ODNA 2G88A 2QMUA 3MD0A 5FI1B 3S1AA 1E2HA 3SDZA 1R7RA 3SJAA 1SZPA 3BBPA 3MLEA 2C95A 3BERA 1FPMA 3Q5DA 3VKHA 1XCGB 1Z0AA 1R0XA 1IXZA 1DARA 4FW9A 4UKDA 2ERYA 3RNLA 1B0UA 2X19A 1OLOA 1P61B 3CRVA 4HUQB 4QBGB 1G1MA 5DLQC 3ZZUA 4ASUD 5J4KA 1UM8A 2EFDB 3SFVA 1R8QA 2J1LA 4HB0A 1M34E 1FP7A 1EESA 1OH7A 4JLKA 1Z47A 4JYCA 1E0JA 3BIFA 4JL5A 3ZVRA 4PSKA 4A8JA 3IBGA 2AD5A 4A36A 1KAOA 1OB2A 1A4RA 2BMDA 2P6UA 2PX0A 3RS2A 3BORA 5B58C 4E03A 3IKJA 4FMDB 2JASA 5SZJA 2EFEB 1Y63A 4DDTA 1G291 4AURA 4NL4H 3FYHA 1WB9A 1AQUA 4UNQA 3W5JA 2BVNA 1G5RA 2C03A 4S35A 3W3ZB 2DCUA 3SNHA 1DE0A 4PX9A 1HEIA 4GRAA 3KKQA 2F55A 2FV8A 2IS4A 2O8BA 4HATA 1R0WA 3RDPA 3QBTA 1VG8A 2OT3B 4XTCS 1JAIA 2ZUBA 1ZYUA 2ZJ2A 4P4SB 3AM1A 3W8RA 3UXMA 1G8GA 5FTLA 2ONJA 2YOGA 3SJCA 5DSZA 2JA1A 2ODWA 3F0TA 4CEIB 3ECCA 4KFRA 1E2NA 1JEDA 1ZJ6A 4Q01A 4EPXA 1TX4B 4R98A 2V7QD 4GOXA 1KDTA 3NHAA 2J3EA 3KXKA 4IDOA 4DLWA 2GVDC 4PQYA 5JCZA 4RD3A 4UQOA 4LRWA 1E2LA 3I73A 5LBIA 1N0WA 5BN4A 2PJRA 5FI0B 1DOAA 3FKSD 4C2UA 1RJ9B 5SZHB 1TNDA 1P4SA 1T5IA 1FNNA 1T5LA 2AX4A 3A1SA 3NXSA 4HZIA 4WZ6A 4B6FA 3CKLA 4F38A 5FUXA 1FP6A 2BKEA 1JR6A 4XD7A 3AKEA 3ND8A 2YOFA 1BIFA 1G6OA 4WAUA 3B1ZA 4LCBA 5FL3A 1C9KA 1HUQA 4DIDA 2GJAA 3K09C 1RPZA 1Z6TA 4O25A 4Q4JB 4H9GA 3RWOA 3SOPA 3U5ZB 4X8OA 3TAHA 4B43A 2B7CA 1CR4A 1GRRA 1AS0A 1F6BA 1RC8A 3A1WA 1FL9A 1KNXA 3EWSA 3AV0B 2RB4A 4DUGA 2IYUA 5JBQA 2CJWB 4PANA 3BFVA 1N0UA 1XTQA 1UBCA 4CEHA 521PA 1TADA 2ZITA 4GDFA 1IJEA 1E69A 1D2NA 3PQCA 1Z6XA 4QHSA 1KTVA 2WWFA 1NMXA 2IYYA 4QJ5A 1AKYA 2DBYA 5L3SB 1G18A 3EPLA 5H8WA 4AKEA 3M1IA 3QJYA 1E9EA 3SJZA 4W5HA 2Z4SA 4URYR 2QTHA 5EE0A 3REFA 5G40A 621PA 1IAQA 1XEWX 3U3JA 4D0GA 2XZLA 1VMAA 4KFTA 1ZM4A 2GBLC 1KI6A 3RRYA 2BHRA 2FWRA 1W7AA 1PVOA 3A8TA 4JL8A 1LF0A 4UNRA 3GP8A 5AWFC 2H7VA 1KAGA 2QU8A 3T1VA 4B2LA 3AVXA 4M8NE 2VHUA 5IDVA 2Y8EA 2B8WA 1ELOA 4EDHA 2Z6VA 1N6HA 2CL7X 4R2IA 5EE1A 2FSHA 2GJ8A 3TVTA 3A4MA 1NVVQ 4OKSA 1TF7A 5AJVB 4EPTA 5K8IA 5J4LA 3X1WA 2FE4A 4D4MA 2UZIR 2XOKD 4M9ZA 4UXHA 4XH9B 1XZPA 1CXZA 2WJVA 5E7JA 3GLFA 4PAMA 3THXB 1W0JA 5D3MA 3BD9A 3BH7A 3PUZA 3ZD6A 3KFVA 4OL0A 5JI3E 2RGNA 2Z43A 2JGNA 4EJSB 1G7SA 1T9HA 3WMFA 2FGKA 3UATA 3CPHA 4MGYR 2QRZA 2H57A 3GEIA 1GM5A 5FH9A 2DB3A 1R5OA 5GJWC 4PC1A 3Q7QA 4OBEA 4LUCA 821PA 3QXJA 3A4NA 1AA9A 5CLLA 3LX5A 4C4PA 5CYPA 1KY2A 1GOTA 1G16A 3GQBA 2GAAA 3EPHA 3KTAB 2FU5C 4Q9IA 3RRZA 2FZ4A 1G3QA 3OF5A 4BZQA 3E2IA 2MSEB 4TYYA 4BUJA 2VHTA 5DIFA 5GVRA 2ZRIA 3NVAA 4R2HA 4DLXA 1W36B 2WMOB 4IEIA 2QPOA 4IDHA 3DOFA 4OK5A 4FN5A 4AG5A 2BMFA 4POAA 4NMMA 1BYUA 5HTKA 1QHXA 2O8EA 1HYQA 3ZGXA 3ZS8A 4V02A 5L3RA 1XJQA 1IN4A 2B6HA 5H68A 3GMTA 5CK4A 1U94A 1CJVC 2QMHA 2OE2A 4JMPA 2IS1A 2CXXA 4IXMA 4F4IA 4M1YA 1OE0A 3UG6A 4E22A 3SQXA 3K8YA 1KSJA 5JSZA 1P2VA 3SYKA 1K5GA 3UANA 2W00A 2DFTA 2D7CA 2ZEJA 4PHTA 3L0SA 4AIIA 2F7SA 3VKWA 2KJQA 3LBHA 4PQFA 3NH9A 4C0QC 4URXR 5JCPA 1E0AA 1II9A 2J41A 4HSEA 1GSIA 3SZRA 4A6XA 3Q8XB 2Q6TA 2A2ZA 3X1YA 2PZFA 2BBOA 1NN1A 1JB1A 1MOZA 2NIPA 4TL7A 3WBKA 1L4YA 1NG9A 2W58A 4FCTA 2JAQA 3AP2A 4MRVA 4TTRA 1XD9A 4DVGA 3OEHA 2YKGA 4FD2A 1DAMA 1TF2A 3GFPA 2A5JA 3FOZA 2OFXA 5IHPA 3R8FA 1UDWA 4ITRC 4TMXA 3K70B 3C15C 5AJXA 1R5BA 2JJ2D 2KBEA 2IW3A 4Q4HA 3AVWA 1UKEA 3RRMA 2ATXA 2CK3A 4KITB 3WMGA 2Z83A 3RAPR 3RVBA 1VPLA 1GNRA 4DLUA 4MRNA 4OI2A 1M6NA 2D2FA 4DDVA 2VO1A 2JLUA 4B47A 4UJ3A 1J99A 1AS2A 1G8PA 4L16A 4QHYA 3V4RA 2REXB 2N42A 8OHMA 1OH8A 2QSYA 2A9KA 2QM8A 4PHFA 4AWXA 4DSTA 2XB2A 4QM6A 1YU9A 1I4DD 2RGXA 2Q9AA 1R10A 3V9PA 3D7MA 4A2WA 2NO9A 1SQ5A 4BEJA 5IK2D 5JJLA 2Q3FA 2ZAMA 1YQTA 3KX2A 3QF4A 2LKDA 1G19A 1SULA 4JLJA 1IM2A 2WZQA 1KKMA 3ICEA 2GKSA 2JATA 3B2EA 2XXAA 4XIGS 1ZUNB 1E2DA 1N6RA 4D4KA 1XD8A 4MYCA 4IKEA 3C5CA 4B32A 1E9BA 1LNZA 1MRSA 1U9IA 3IBYA 3U4QA 2ZJZA 3SJBA 1XTIA 5KSYA 1JXOA 3OFND 3TKLA 1KDOA 4XTRA 1G3MA 3EW9A 3Q9LA 3U3MA 2ZR0A 2QORA 2IYXA 4LBVA 1G8FA 4NHOA 5EP4A 2IEYA 2KSQA 3AKYA 2JLWA 1F2UB 1XF9A 3PV0A 3KB2A 5H1YA 5FOTA 2ZYTX 4PZYA 5JI2E 3AF1A 5IT5A 1J7KA 2VF8A 3R9WA 4A0FA 1DADA 4X8LA 1QG2A 1YZQA 4C0SA 4K8OA 1D9ZA 1S4QA 4TLBA 4QHTA 2F3RA 3PIRA 1NSFA 1NRJB 4BQSA 5AJWA 3TNFA 2BEKA 2VRWA 3KUCA 5JHGB 1E79A 2P6NA 2D06A 4Q03A 4D25A 4DLZA 1KDRA 1Z0IA 2OCPA 2QE7D 3CH5A 3GJ7A 3TLXA 3CO5A 3U3RA 3CF6R 1P75A 1ZU5A 4I1OA 4GOKA 1NMZA 1KI7A 1D8TA 1E9SA 4TTPA 4XWOA 3T15A 2REBA 1P9NA 5G53C 1YJ5A 4KBFA 2ZVQX 3C4JA 2ORWA 5EUMA 4CRWB 4Q1AA 4BLRA 1TEXA 2Q3MA 1M74A 1US8B 2QT0A 5CJ2A 2R6FA 4UNNA 3HP1A 3TRFA 1XPOA 4DDUA 1SVOA 3AF2A 2ZYVX 1A2KC 4CW7A 3TGPA 3JZMA 1OT3A 4ZDJA 5HPYB 1R4AA 1KDPA 4LOAA 2XJ9A 3T61A 1AK2A 4FMDF 4CEJA 5GVSA 1L7VC 4HAWA 4DT1A 1JECA 1G21E 1QHSA 4FMCF 4XVUA 4BFXA 1RE0A 5K8LA 2O52A 1VKJA 2WAXA 1NJGA 4EPWA 3LO5A 1BYIA 4LWZA 1D2MA 3KJIA 3ZIAD 1GL6A 2Q3HA 1HT1E 4P3YA 2XB4A 3VHLB 2ZRDA 1N6PA 3FMFA 4YDSA 1DAFA 3NC0C 2O0HA 1P5ZB 5SZKB 1CR1A 4M22A 1OH6A 2JIZD 3W3AA 4Q21A 2CMKA 2FEOA 1BMFA 2IF2A 2WJYA 4JLPA 4Q1FA 1CEEA 3ZJYA 5TY0A 1SVIA 2A3RA 5HZHA 3K1JA 1B23P 4EJSC 3GLHA 5E7MA 2BDTA 1S0UA 4JVSB 1D5CA 2FPKA 4B33A 3TH5A 5FUVA 4EKDA 3AP1A 4RVCA 4TYQA 4HUTA 3PJRA 2PL3A 5E95A 1E2KA 1GZSA 4JVLA 4KI0A 5G3YA 1DAEA 2V8OA 1LTQA 1XEXB 3SHWA 5KO2A 2B8TA 721PA 4MKHA 3RSOA 4PHHA 3V00A 3C41J 1OXSC 4B2IA 2D3WA 4QJ4A 2WKRA 1COWA 1XX6A 2BJWA 3B8HA 3KQKA 2J0QA 1S96A 4OQFA 1KYIA 3PFIA 1QHNA 1ZINA 1GIAA 3SE0A 2GEUA 5JJIA 4BGDA 1RKBA 1W36C 2O8CA 4N0EA 1NKSA 3FE2A 4K46A 3QKSB 1BOFA 1MH1A 1J8YF 1IN6A 4EIWA 1Z07A 3ZQ6A 5BN3A 4LV8B 1DBSA 2AK2A 4LJ4A 4KFSA 3RS0A 1DPFA 4OHZA 1U99A 2WWIA 3VR4A 4PO8A 2CVFA 4JJZA 5JS8A 2QAGA 3GLHE 2UVQA 1OB5A 3RS5A 4XWKA 3T35A 2QROA 4L4UA 1DO0A 2OEPA 4CZ2A 1U8AA 5FPKA 1XXHA 1HV8A 1YRAA 2WHXA 2UZ3A 1X8KA 2GA8A 3LDAA 3NC1C 4PZLA 6Q21A 3QPVA 4QNMA 1Y3AA 1TPZA 4DEXA 1G5PA 1YR7A 2NG1A 1HA3A 1P7CA 4LPSA 3VU9B 4Z8YA 5DYIA 3B1XA 4CDGA 4WXRA 2QL6A 2R2AA 2FFAA 1UJ2A 2H17A 3KKMA 2QGNA 2VHJA 1CP2A 2H8KA 2R8RA 4AKHA 1UKZA 1OFUX 1NN0A 3T5GA 2DWQA 3QVUA 1EX7A 4Z1MA 4KSCA 1Q1ZA 2F43B 1W47A 2C98A 2JLRA 3LBNA 1XU4A 1JQLB 4TYPA 3K70C 2GF0A 3B82A 3KL4A 4AKGA 3AH8A 3K0FB 4MQBA 2QMEA 4ZI3A 1AJEA 3KUDA 1IY2A 2N1BA 1FTSA 4WBSA 5GJVC 3RSLA 1CJUC 4DLSA 5EXPA 5KSOA 1XXHE 4WVFA 3CX6A 3U3OA 1G3RA 1E96A 4M9QA 2GBLA 2PBRA 2CE7A 4LHVA 1AQYA 2J0UB 4QBIA 1OYYA 1BKDR 3X1DA 4OQLA 4AG6A 4M1MA 3PVSA 1XD2A 3BC1A 3M6AA 4TLDA 4XD7D 5CYOA 5HE9A 4ZDWA 2OLKA 1E9DA 2HXYA 5KOYA 1E1QA 1JI0A 4EQ6B 4ZV4A 1OXXK 2CCKA 3TUZC 3AF4A 1OXTA 3NWJA 3X2SA 1IOZA 1SKYB 2P65A 3AGQA 5KDLA 3THWB 2FMXA 3BB1A 1NF3A 1MO6A 3B1YA 1Q20A 5JWOA 1CS4C 1JBKA 1YZGA 4DUGD 2ZRPA 3HU2A 4OQMA 3PCRB 5EQTA 3PUVA 1S3SA 1XRJA 2QSZA 2CHQA 3GJ8A 2FOLA 1UADA 3QPUA 2B21A 3UKDA 1Z28A 3LRPA 4Q4AB 3QIAA 1Q57A 3KKNA 3MCAA 3FHCB 1N5LA 4TTQA 1P2UA 1V5WA 1AS3A 1WDTA 1XTJA 4B3CA 2QQ0A 4GP7A 3QBVA 1KMHB 4ZDIA 4JT4A 5FOUA 4GL2A 2JJ1D 3ZIAA 1HTWA 2RGAA 2FGJA 4ERNA 1GITA 2V1UA 3CH4B 2BBSA 4Z51A 4UNPA 4ZIRA 1AGPA 1G7CA 1HH4A 5C4GB 4QKQA 1P9RA 121PA 2XTZA 4GFDA 2YC4C 2WSSA 1SXJB 2EWVA 4TQUS 2G1JA 1FX0A 1JALA 1G20E 3HR8A 4M21A 3SR0A 1M2OB 2ZS7A 4QGFA 4NCJA 2WKQA 2FH5B 3WYGA 4LGMA 1CJMA 4MGIR 4HLUA 3L8ZA 3GEEA 3RYTC 3OIUA 3WYFA 4OI0A 3QXXA 4H1VA 4GSYA 4C7OA 4M4SA 4KLZA 4V0MA 4WOPA 3WP1B 3AVVA 5FPSA 3MG9A 4YXWA 4KYIB 4D81A 2ZJBA 3VMFA 1SKQA 4U7DA 3K0EA 4BPBA 2GK7A 4BZXA 1E2IA 1N5KA 2WJHA 5G3ZA 3AUXA 3U60B 3Q3JB 2VP2A 4HB2A 1TUEA 1DAHA 2CDNA 2FFQA 3QG5A 4IOMA 4RSGA 1JNYA 1N25A 2GAOA 1UKYA 2ZRGA 3EA5A 4MRSA 1G41A 4IDNA 1NP6A 4QXAA 5CK5A 4Q9HA 2YNMA 2ZTSA 4IFEA 1ESMA 1W46A 2WKPA 4KODA 4HUQA 4FWTA 2HLDA 2V6JA 2BV3A 3BH0A 2ZUDA 3JVVA 3KB1A 4Z1MD 4ZCIA 3IIJA 2CE2X 5J47A 4DSOA 2ASEA 1IQPA 5TB5A 2C5LA 4OQNA 4V0ME 3CNOA 3Q5EA 3KFXA 2W6JD 2AXPA 2YOHA 1XCPA 4D6PA 4C0JA 2C04A 4QM7A 4DLYA 4RKFA 1CR0A 4FMCB 3SC3A 1DELA 1F3OA 4LYHA 1VHTA 1ZIOA 4GBMA 3W9YA 4AYWA 2O8FA 1FOEB 1T3SA 2DFKB 3OE7D 4TLEA 5LDDC 5AJZA 4ZO4A 2X2EA 2WWHA 1W48A 4B2PA 3ICQB 1J8MF 5FTKA 3A6PC 1WXQA 1TL7C 3GJ6A 2IYRA 1NVVR 3A36A 2FA9A 4KVGA 2IWHA 4B48A 1NVUQ 1Z06A 3EC1A 1ZC3A 2YWGA 3K9NA 1YZLA 3VNVA 4RJLA 4DWJA 2AWOA 1MO3A 1VCMA 2R44A 2RAPA 4RD1A 2IXGA 1PLLA 3FGNA 1ZM7A 3OAAA 4CEIA 1CRQA 1G8HA 1KY3A 1S1MA 1AZSC 3WY9A 5C46F 2OXRA 5DI9A 4HLCA 3KJGA 1RIFA 5EXTA 3IIKA 2HDNB 1H65A 1IHUA 5F98A 2KB0A 2JLYA 5LB2A 2PMKA 4B75A 3C8UA 5JMTA 2QP9X 4ZI2A 1JAHA 5LB4A 3OEHD 2IK8A 5FFMA 2ZR7A 2XZPA 1RJ9A 3A1UA 1N6IA 1OFIA 2V55B 2ZJOA 3TJZA 4KFUA 1VYVA 3AVUA 1EK0A 4AI6A 3B85A 4B6EA 2CK3D 1KO5A 3GFOA 3OIWA 1YRBA 2ERXA 1KI9A 2QG6A 3IPYA 4ESVA 1PLJA 3KQNA 3DMDA 3UWOA 5BYKA 4G01B 1U0JA 3ADBA 3PITA 4TWZA 1OPXA 1NLZA 4M1KA 221PA 1G6HA 3B6EA 3DMNA 3IPXA 3F8TA 5EP3A 1M7GA 4U5XA 3GJ5A 2IA5A 1FQKA 2J46A 4NDZA 2GEDA 2CJWA 3O8CA 1SGWA 4TMKA 1DEKA 3BB4A 4MGZR 1X6VA 2CHVA 4JJKA 1KGDA 5DI3B 1Z22A 3THOA 2OV2A 4FCVA 5AUQA 3RC8A 1KI1A 4BECA 4IDQA 3EG5A 5JLJA 3I8SA 4G5OA 2JJ1A 1JEEA 2ZETA 1WA5A 1SVLA 3LX8A 3MWJA 5AJYA 5L3SA 1PV4A 2BWJA 4JSTA 2ZSFA 4W5WA 1KZ7B 3PEWA 2IXFA 4PC6A 3DZDA 4TQAA 2WBLC 2E9SA 4UXIA 1E2GA 3VR3A 1KHTA 3EIQA 4ARZA 1ZM3A 1CULC 3EZ6A 1NBMA 2HEIA 1Q1EA 3CRRA 5CLQA 1I2DA 4DZZA 1T0HB 3QKRB 3HR7A 3EWAA 1AKEA 4CT4B 5H70A 1ZVQA 4TYNA 4C30A 1P6XA 3FHTA 1CIPA 5E4FA 2XGJA 2NQ2C 1KI6B 1E9RA 4B3XA 1VYTA 4CYMA 1JJ7A 3U61B 2VYFA 1WF3A 1UPTA 2R6CA 5JRZA 2XZOA 3ADDA 2WOOA 1OXUA 3FPAA 3U7FB 1W4CA 3DZ8A 4RD4A 5E3HA 4DLTA 3SYLA 1ZMXA 3AKDA 5DNYB 1NY6A 1RRPA 3TQCA 3R9XA 4HAYA 4EPYA 1DTSA 2Q9BA 3E70C 1XNJA 5D3QA 1UBFA 3WBJA 3PUWA 4RCZA 3FFAA 4DCNA 1E4VA 4NP6A 3NIBA 2I3BA 3THXA 2NPFA 1E79D 2ZIAA 2NO7A 3I61A 1OYWA 3TE6A 1W5SA 4BLQA 3B5JA 2X1VA 1M1YE 1PUJA 2EWWA 3EZFA 1NBME 2R9VA 2ZANA 1X8JA 4GI7A 2IUSA 4MYTA 5DISB 1NN3A 4GOJA 1AIPA 1ZUHA 3CF0A 3KKPA 3V4FA 2RGBA 4IVRA 2FSFA 1KSGA 1E6CA 2WIAA 1E0SA 2OSBA 4IVQA 3CF2A 4M9XA 1JXMA 3CX8A 3U2QA 4Q5IA 4RZ2A 3CPEA 1KJYA 1RRFA 1XTSA 1ZM2A 4M1TA 4TMWA 4TN1A 4I4LA 2RHDA 1EGAA 1M7BA 5IRCD 2W6JA 3EZ9A 3HYRA 2VQSA 4JLVA 1OIWA 1E9AA 2VA8A 3CRQA 4UXJA 5EE3A 1SXJC 3KTAA 2QENA 5KNBA 2CVHA 3GLFE 1II8B 3MWLA 1GKUB 4XOIA 5AK0A 4RKEA 3UMSA 1O87A 5KNCA 2ZI9A 1K8RA 3AP3A 3OE7A 3LNCA 1R0YA 3MGCA 4QBFA 4D0LB 4TLAA 4EPRA 1ZD9A 5K8TA 4IOKA 2HXSA 2EYQA 1P72A 1T3HA 1EX6A 1UF9A 5JHHB 1GNPA 3ASYA 4XWAA 1UEJA 2YHSA 1N2CE 1GKYA 4CIDA 3DEFA 4MA4A 1S9DA 4QG7A 3EARA 3NBXX 1E2QA 2O8EB 4C0LA 3MRSA 4AKIA 2G3YA 4F4JA 4H1UA 3QQ5A 4MKGA 2GZAA 1LW7A 1BMFD 3G82C 2YINC 4LC1A 1ZUIA 4PC7A 2GETA 1NJFA 1CU1A 4Q9LA 5AUPB 2RKOA 2WWGA 4CVNA 1NMYA 4ZCLA 3K0CA 4B34A 5EUQB 3ND9A 4KHZA 3L8YA 4FCWA 3OEEA 4GMXA 2BM0A 3CBQA 3CONA 1R0ZA 3U44B 2OFWA 2E87A 2VTKA 3MJHA 2HCBA 4F92B 4L9SA 2VBCA 4PPGA 5GADl 1FMJA 4HI0E 5BW8A 1F2TB 3MWKA 1Z6AA 2CLDX 1RW4A 1I4TD 1ODFA 4QC2A 5KDDA 2AKAB 4UJ5A 3KZ1E 2WOJA 3ADCA 1COWD 2CL0X 1U8ZA 1XBTA 2FFBA 2BCGY 2O0JA 3BWDD 4Q7MB 3QI2A 2FNAA 2YWFA 1MABA 4DCUA 3HPRA 3TK1A 2YYZA 3U7EB 3N70A 3AGPA 5FPTA 1OHHA 2BEJA 1DS6A 4Q4HB 1D9XA 2AFIE 2VPPA 4TMTA 3NH6A 2PCLA 1ZU4A 1BH2A 1ZNWA 4Q48A 1GL9B 1XEFA 3K0AB 3HYTA 1QG4A 2RHMA 1YZNA 2VP9A 3EIEA 1XP8A 3I1FA 4A0HA 2BIFA 1ZCAA 4IEEA 4LJ6A 4B35A 3ZD7A 2FDCA 2KBFA 3QPWA 3EASA 4G5GA 1G7RA 5FTJA 2GHIA 4EFLA 2AN9A 4DLRA 1PUIA 3DKVA 4TT3A 1II0A 4LHYA 4QFMA 1BS1A 2ZE7A 4X8MA 2R6DA 4YLGA 4BE7B 2XITA 2JCSA 2IC5A 1DVRA 1MT0A 3GPLA 3LH5A 2WV9A 4DC9A 5AUOB 5K8UA 3NG1A 2QBYB 1EG7A 2NZ8A 1VIYA 2YJTD 3LBIA 3HPQA 1T3LA 4QGGA 4NPHA 4JLDA 5HCNA 4D0NA 2MSCB 4JLAA 1QVRA 2V4ZA 1W2GA 2CHGA 3F5FA 3I4LA 3L0PA 2HJGA 3U7HB 3C7KA 1P3JA 1NN5A 3WHKA 3AVOA 1QZXA 2REOA 4KJZA 1F2UA 4I1SA 4C0HA 4YC7A 4LJ5A 4LSGA 3AB3A 4JLOA 1ESNA 2NGRA 4PO1A 4W9MC 4QOSA 4XVRA 2WJIA 3B78A 1JR3A 5JEEA 2GZDA 2ODBA 2IUTA 2W2VA 4PPNA 2GDJA 2J45A 3D8BA 3AVYA 3AKCA
chains in the Genus database with same CATH superfamily
2G9RA 1VL6A 3OPVA 5PNTA 4EB6A 4RKWA 2HYIC 4PU0A 3W5HA 4B3FX 4Y6LA 1PR9A 4LF9B 3W5IA 1VM6A 5KYGA 1IEXA 2HJRA 2BFFB 2G07A 4BFCA 2MSKA 4B82A 1KS9A 2XA9A 1HLDA 2R7LA 4YP9A 4ALLA 2GBCA 3EXG2 4OYRA 3A7EA 1SRRA 1AVTA 4FYYA 3V42A 1YHZA 1GHTA 2Q99A 1VFNA 1Q7BA 2WP0A 4R2MA 1B42A 1RZVA 4ID3A 4O2LA 4EJFA 5A1TA 1GTVA 1IB0A 3FCCA 4UUQA 1DGQA 4DABA 1Z2CA 1M6YA 3T1TA 4EG8A 1US8A 4ROSA 4IJMA 4RPIA 2J48A 4FK8A 4F46A 5J4VA 1WBDA 2ONKA 4MR8B 3A6FA 4EI2A 3PKZA 3T3GA 4RTLA 2QZJA 1XXLA 3OZBA 4ZJYA 3CZPA 4LI3X 1KEZA 1YUBA 4CKEA 1JR3E 1GL3A 1DT5A 2EWMA 3TUIC 5ER6A 3ZE2B 2RH5A 2OFOA 4KXLA 4GSKA 3UCXA 4YWJA 3AJ8A 4IP0A 2ODAA 2ZJAA 2PX3A 1KETA 1VIDA 2NADA 4RGVA 1IN8A 1T2NA 4ZO6A 3C6MA 4RDCA 1EWVA 1G8AA 1NWHA 5KSWB 5CR9A 3ZI4A 4NYJQ 2QRUA 4M1OA 1G9XA 4LHZA 4WASA 4WTOA 1UQRA 1NUHA 3BWEA 1X8LA 4Y1EA 5AHRA 2WIKA 1RQRA 2WSSD 3ECCA 4ID9A 1CZRA 1PS9A 1TRKA 2VP0A 3FMPB 4HGQA 4NZNA 4PYMA 5B53A 3ZCRA 4C1NA 4JEUA 5HZMA 2FVYA 5C81A 1SWWA 2HI0A 3WZ2A 2E0IA 1ZNXA 3QEMB 4P7FA 4R5MA 5LP6B 3GMSA 3D5TA 4QT4A 3WB0A 4QPJC 3TXAA 3GBPA 4EGJA 3L93A 5I48A 1VJ1A 2I7TA 3UMRA 2HV9A 4G1CA 1CP3A 2G9ZA 1XQ1A 3FNQA 4P5EA 1R9JA 2BRUC 1CRPA 5I6DA 3VDMA 4ZT3A 2VH5R 3D9QX 1FP1D 2BJVA 2XXBA 1N78A 3HU3A 4P38A 3NOQA 1GGHA 3A4VA 1QH8A 3HWRA 2X5OA 3W6OA 3L8HA 2RGNC 3LC0A 2W83A 1MW8X 1EFTA 1OW3B 4KK3A 3IODA 4I6EA 4E33A 3C45A 3B5IA 1KFBB 1S6YA 5P21A 1X80B 1XHFA 5EKXA 3T94A 3WFJA 4P3KA 5FUQA 1SIOA 3RI3A 5EWJA 1FNBA 1VHWA 3EN0A 3JQGA 1CZNA 3QKWA 4MYUA 5HRCA 1F0YA 3H04A 2ZUCA 1YZKA 5EWLA 1LA2A 1XYGA 3OZUA 2WIDA 3DDSA 5SY6A 3LW8A 1J33A 3DMHA 4R1OA 2EFGA 2JLQA 5JWHA 2QW1A 1T29A 1ZW6A 2NQ8A 4OAPA 2OY0A 1GA6A 2IDKA 1ORTA 4YDRA 5BWMA 4KQ6A 1CQJA 1T6ZA 1EHIA 1S2NA 5JVDF 1XMPA 3G2HA 2ZJ5A 3SYTA 5B12A 4Q02A 4YO7A 3QKSA 1HNWB 2C7BA 2VK2A 1G5HA 1U81A 3A37A 3B7PA 3MUOA 3ILYA 5A5FA 1GU7A 1ZESA 2J08A 5A5DA 4YT8A 1R3UA 2YIMA 1U28C 3T1HB 1FTQA 3TZKA 1UPXA 4ME6A 5KSPA 3VR2A 3DT9A 3TTYA 1NV8A 2PN1A 3AF0A 2GN8A 3D1VA 1SZCA 2H48A 3UC9A 3WK6A 3X1JA 2BTEA 2QRHA 3IT3A 4IICA 1IU9A 1BHSA 1PR0A 5K0ZA 3INGA 1VBKA 3K09A 2IL1A 1MR3F 2PANA 3AHEA 4FIDA 1T5OA 3O8QB 4R81A 3M6WA 4F3KA 5B6PA 1NP7A 4Y0AA 3ZLTA 1DEHA 3ZKWB 4XYMA 4QXRA 1VZ2A 3VNUA 4M1WA 3OTGA 1YL6A 4GS5A 1E9FA 3GN2A 4LJ8A 4WMLA 1F14A 1U80A 2LDBA 1X70A 2QWXA 3VHXB 4LYYA 3GLIB 1A27A 3C14C 2E6UX 3TD9A 5CJPA 4RW0A 3BGSA 4PFKA 3BHJA 4DGQA 1GAXA 1UJ4A 1EM6A 1VPTA 1WULS 3IIEA 4G1MB 2Y0DA 4YMTA 1AQLA 2RGYA 3LHFA 1GPLA 3ADPA 5HBGA 1QIEA 2MINA 2WJZB 3R20A 4IL5A 3RFXA 3ULKA 4LMBA 3VO8A 5JR3A 5KUTA 1DIOB 1JLSA 5KNDA 1PGNA 3TKAA 3BGVA 1FTGA 1E1LA 1KZ9A 3OAAD 4IVPA 4A9AA 5MFZA 1JF8A 2HIAA 4I46A 4Y9UA 3R3SA 4EYQA 3ORRA 1Q11A 5J59A 3R41A 4E51A 3K0FA 1BWRA 2PRKA 3U1VA 2YZGA 1IY9A 4RSHA 2Q5OA 5TJ9A 3UNXA 2FPSA 1XZMA 5JCXA 3WLJA 1VIAA 3BRSA 2D62A 3BSWA 3EIHA 5EJ8A 5CD9A 2B8NA 2DPHA 4F9FA 5CEFA 4J4HA 4OU5A 4KEAA 3SN6A 4NJEB 1XIVA 4C88A 1U2EA 4GZ3A 4OK3A 3BXZA 3SX4A 2KWIA 3M83A 4NE9A 4CKWB 2Q07A 4QUAA 4BPRA 4LN1A 1PUXA 2ZBUA 1P9LA 3AHCA 4U2BA 2V7PA 4TWJA 1NBWB 1OZGA 3IQXA 5IJXA 2CL6X 4FINA 3FYUC 3I01A 3TRDA 3WDLA 1FZTA 4BXOB 5A9SA 4XD2A 1IJFA 1AC5A 4TM8A 5DN6A 5BQOA 2R6AA 4LS3A 4KR6A 1MMFB 4WKCA 2WSMA 2O23A 5LMZA 4WFKA 4EQZA 3TLKA 1VE5A 1YZ3A 2UZ1B 5CNJA 4YJHB 1XTRA 2EG5A 2DWOA 1X1SA 2ZREA 5CFQA 1NVGA 2B1IA 4Q12A 4WV3A 3NEJA 3S4YA 2YJGA 4LX0A 3D0KA 2BKLA 3HFSA 3N5KA 1X86B 1B2LA 2NVUB 2JIDA 1YB5A 2QXTA 1SBHA 4TV9A 3ZDQA 1NU8A 4ZANA 4US0R 1L6IA 4BFSA 2I33A 3NTRA 3T0IA 3KVNA 5BN1A 5C52B 2QX8A 1EE9A 1ZQ9A 2FZEA 4Q18A 1WRBA 5B64A 4XCVA 5DNUA 5D1NA 3OCCA 1KSFX 2QN6A 1IXYA 2ATEA 2XMDA 1P1CA 3TTUA 4U7WA 3D8UA 1MW9X 2D74A 3ZW7A 1P3Y1 1TVKB 3VO1A 3W3AH 5DM4A 1IWPB 3ZH2A 5DYYA 1NBMD 1DOZA 2QUIA 5G0VA 4MULA 1LRKA 1IXSB 5HSGA 1BDMA 3THYB 1Y1QA 3FTNA 4JI2B 3HXLA 4AZWA 4B73A 4BGVA 1BS2A 4O4IA 1U2RA 4HDKA 2QOEA 4YPFA 1L4BA 2IP1A 3PQ3A 2JFHA 1QR6A 1HWYA 1F1JA 1YR3A 3JZAA 4FOOA 1EXNA 3TD2A 2PX6A 3OWHA 3W34A 3AF3A 4UHCA 5JD6A 2PGAA 1A5AB 1EPUA 2OCIA 1U2DA 1DO2A 3KT3A 5G4KA 1L9KA 3IMEA 2B4RO 3OKAA 4GVPA 3KD2A 1D0IA 1RVV1 4MQMA 1FUKA 4ZCPA 3PE6A 2AWNA 5JPCA 1PI3A 2V58A 3LWZA 4QECA 3Q41A 5DHTA 2OBNA 3H4MA 4GMGA 1GVNB 2VUTA 3AR8A 4C89A 4C7OB 1RMQA 3CH6A 2M2IA 4J91A 4U2EA 1QF9A 1RXWA 3I8XA 4MJLA 4YAWA 4CODB 3AHGA 2IUEA 4OXQA 1Z83A 4UE2A 1P2BA 4RHXA 2ISCA 2R6R1 3EF0A 1QVVA 4OMFG 2PXCA 5KVCA 4DSZA 4MKFA 4U2GA 4EWLA 2FPOA 1H4QA 2JAXA 3S1AB 1I2AA 4AO8A 4E7PA 4JGGA 2VJBA 2F3SA 1FXSA 4DIFA 1AHNA 1K97A 4M2LA 1YE3A 3QJ5A 5COQA 3ZEIA 3LXMA 2H5EA 3L02A 5KCZA 4WY8A 4IX1A 1NUTA 2BFBB 4C1BA 2IXEA 2LKCA 2NV0A 3DE4X 4U8GA 1T6NA 2YV1A 1F9AA 2J09A 3P71T 4LOJA 4PS1A 4QOIA 2GK3A 4NYIQ 3Q3IA 3AESA 1U9CA 2ZSAA 3BAFA 1PZNA 3D6NB 3MT9A 4IXNA 3RWMB 4D42A 1JHZA 5IFKA 4UHDA 1Y5LA 3WK7A 1M33A 2JBAB 5FUWA 1UMCA 1JQJC 2HMTA 3UTCA 5BQ3A 1ORHA 2W2LA 4A8JB 4ZCMA 4NCAA 4BB6A 4EARA 5KNCD 4HF7A 4CFSA 2PVPA 1CY8A 5AVVA 1AU9A 1AB6A 1P7WA 3P19A 4J1NA 2DH6A 5CA1F 2DX7A 2G77B 3QVLA 4J90A 5HF5A 4CFYA 3FFXA 4C07A 4G8CA 1N36B 1NUQA 1E92A 3OA2A 5C18A 3DVQX 1O95C 5A0VA 3HJHA 5EKDA 3JYLA 3MEQA 4XGQA 3TW8B 3DTVA 4HWRA 1PCXA 3U7RA 4ZK2A 5LQKA 2HSWA 4OGLA 2ODEA 4C6SA 3GJ4A 3HKCB 2G63A 3LX4A 4IFBA 4QXMA 1OREA 2KLHA 2EW1A 3FXAA 4DY4A 4GR9A 3VZRA 4MQUA 1QGZA 2NMVA 3DBOB 1I2MA 2YRFA 1LSSA 2TMKA 5F77A 1H23A 2R4QA 3ELDA 4ZI7B 4ND3A 3WO1A 4BRZA 1LDMA 4DDHA 1WQ4A 4E11A 3PWKA 1H1DA 1A69A 2IHTA 3TR5A 3OFSA 1GDDA 1SU6A 4P7JA 4UHFA 2EIHA 4OHMA 1SIWA 5HQTA 1VL5A 3E9YA 1M8PA 1BDJA 2M98A 1V8PA 4UASA 3RC2A 5IDXA 4BZZA 1Z12A 1XMSA 4F7WA 3RHTA 4OH7A 2QI9F 3AQ4A 4Q4CA 3GA7A 1Q0HA 3OG9A 4HRAA 1J2JA 4TMZA 4KO3S 3RFTA 2ZAOA 1OQAA 1EUDB 2E18A 1GTMA 1CKEA 1N57A 2X7XA 3ICOA 1RZ3A 4NEGA 2VEOA 5TMBA 2X2FA 1H8HA 1WHSA 5LP1A 3H1FA 2OOSA 3R3ZA 2C94A 4I4NA 5BYAA 4LY6A 1YIOA 1FTWA 2GLXA 2HGSA 4YP0A 4X6XA 3UMFA 5L7WA 3U1TA 3NWBA 4QICA 5ILQA 2X8AA 5JQGF 2H4WA 1DU4A 1X7DA 5CEJA 1FQOA 1YE8A 5IT0A 1OHHD 3QW2A 1QPGA 4TKUB 4GVLA 2NU8B 3T4PA 1LDNA 4B0OA 5JJ5A 3P0RA 1C8BA 4U1RA 3MT7A 2PQ0A 3IV7A 5BVGA 3R9KA 1H8EA 4YCBA 8ABPA 2F3PA 2PSJA 4U9IS 3IKLA 1W49A 3F1KA 3B51X 1OX6A 1QMPA 4M49A 5FRDA 4E3ZA 3Q8KA 2AZTA 4RS3A 2WWWA 2BR3A 5T64A 3FNEA 3VAZA 1R2QA 1U1GA 3E35A 3T1OA 3V97A 1JMYA 1KEPA 1XKTA 2P9EA 4KQHA 4RD0A 4AY3A 1GSAA 3CB4A 4YCMA 2K7ZA 2WVJA 2JJ8A 1UMDB 4OREX 1SHUX 4UW9A 1RJGA 3TCNA 4DNPA 4CEHB 2ORVA 3NP7A 5JRJA 1MVLA 2HCRA 5J2UA 1W2HA 5H80A 2NACA 3DD5A 3K9LA 1H2AS 2JB9A 2JD2A 4WA8A 3PSHA 2BFDA 2I6UA 4A2CA 1RXSA 5IDYA 4EZIA 2BYTA 1QB8A 5EJGA 5BO5A 3UUWA 1GEEA 3E5HA 1WDLA 2IHKA 2X8WA 1FYFA 3K9GA 4OQDA 4ZU6X 5HMLA 3WO0A 2DPGA 3AONB 1VPEA 2Q6IA 2R7MA 3K0KA 4X00A 4BAUA 3ETDA 1VSUA 3IVRA 2BKVA 2KLBA 3GAAA 4JR2A 4S2EA 3PRKE 3RYHA 5TNXA 3KS9A 1PZGA 1U3VA 3H18A 3CPJB 1M2JA 2P4UA 3AM3A 4OU4A 5FPHA 3ZLJA 3HHEA 1XZ8A 3OU7A 1OCEA 1YA8A 4BQEA 3WLNA 1V26A 3TSOA 1IHOA 2BUAA 3OBBA 3SGLA 3UKOA 2P9ZA 1Q92A 2WYWA 4U8HA 1Y9EA 3K1AB 3DVAA 4ND8B 5B1EA 1NVTA 2O50A 2TECE 5FO0A 4EBFA 3MTJA 4IJKA 3ZIUA 2HV8A 2PEYA 4RJJA 2ODTX 2BGKA 3UT6A 1C9EA 2PV0A 2OVFA 1LLQA 3PHIA 2BBTA 2Z09A 3SC2B 3SU8A 1JR3D 3ZYCA 3H84A 3DLAA 3ZHTA 1Q1QA 1HURA 2VEDA 3BD6A 2XY4A 4Q16A 1T8SA 4QFDA 4EGSA 2EYUA 3Q5GA 3K73O 4YT4A 3A1NA 4FGSA 1VHLA 2GI4A 3C97A 4UBOA 4A1FA 4DQLA 1J90A 1X38A 1Z8HA 2I8CA 2P62A 1CQXA 2YXNA 2FRVA 2YIDA 3OEWA 4HWOA 4J7AA 5K51A 5BSEA 2R751 1S8FA 2XNDD 1BTOA 2YWEA 2Z8XA 4DLPA 5KOHB 1PL8A 4G9BA 2VYVA 3WRXC 2OC4A 4YHHB 4UM9B 4WZBA 5AVOA 3S8EA 8ATCA 1G7TA 1MJNA 1XN1A 2PT5A 4V0LA 3FTQA 1EDDA 1O6BA 1VCNA 3D3NA 3F5QA 1E2MA 2IOYA 1F20A 1ORIA 2PG3A 1KK3A 2WC1A 3H1AA 4OMUA 5JIBA 4I4IA 1EWQA 3M5CA 1T4GA 9ABPA 2FG5A 3FFWA 2NUPA 3ENVA 1TM5E 1GNLA 2YVKA 3LCMA 5F2OA 3RFFA 4V0OA 1XMJA 1ZJ4A 4KWIA 3T1QA 4DIUA 2W2PA 5JPIA 3WHLA 1QYWA 4Y2VA 5F1KA 4PICA 4OBXA 3DLIA 2DMRA 4D4JA 4YUXA 2Q21A 1HFWA 3S1SA 4DREA 4LIPD 3GGDA 3PDCA 1Q95A 4DSNA 2WF8A 5LYJF 4MV3A 1II8A 4P35A 1V16B 4AKTA 3FCAA 1CTQA 1EVKA 3SEZA 2JCVA 4KMSA 3WL7A 4UNSA 3FLEA 3VQTA 4B74A 1TQ6A 1WOYA 5KTPA 2XYGA 2Z1MA 2IZ1A 3M6FA 1AHIA 3MWEA 3QQPA 3S2EA 1FYEA 4G5SA 1GQQA 3AY0A 1INLA 4RZSA 2O2IA 1G2IA 3FZQA 3N7UA 2ZYUX 3NU1A 4X7PA 4G0UA 3AUKA 2JJMA 1LPNA 2QX9A 1R4NB 2JJYA 3MOSA 4FLMA 3FBTA 4WZBE 4ACAA 4N6OA 2OM2A 1XCJA 2O5VA 2GZHA 1P1HA 1F5SA 2F1OA 3B7GA 3P4XA 4QU8A 3T95A 4IOJA 4ARUA 2WICA 1ZVMA 3A1VA 1ODSA 2VQ6A 4WK6A 2C57A 2YS7A 3CUEF 2PX8A 3OQ6A 3TOZA 1USGA 3AEQB 5GZ3A 2IS2A 3BL5A 2NTVA 1QRTA 1A8QA 3AC0A 4INPA 4IMPA 4M0UA 5T4BA 1M1XB 2HDWA 3CNLA 4BRUA 4DA0A 4I9HA 1SVUA 3TEFA 4KMRA 1FNDA 3KV3O 2QIOA 3UJ7A 7REQA 3ICVA 3LI2A 4C2AA 4YAOA 4DJFC 1WZUA 1DB3A 2YFQA 3A6DA 3BM5A 2IYTA 4ARIA 1T4BA 2QN1A 1WLSA 2ZS9A 2W2QA 3IEUA 3IAFA 3ZS9A 4YPVA 2ZVPX 2I2XB 4CWAA 2G1PA 4M6WA 4DY6A 1ZD5A 1XWIA 1QZ3A 1XZIA 1EG2A 4R1UA 4R8VA 2DFLA 3QYJA 2XCLA 4ZVLA 1HRKA 4IDCA 3V4OA 4QUIA 1IUNA 1U8TA 2I67A 3E3NA 1QBKC 4IH9A 5IKXA 3RVOA 1GQFA 1FE8A 3OLYA 2QTLA 4FXPA 4QBHA 3NKFA 4BHTA 3G85A 3KQQA 4NG5A 1VG0B 4AW9A 4TWAA 1H1TA 3C3BA 3L4BC 4E12A 4QGAA 5PGMA 2BM1A 2AR0A 1NQAO 4OHBA 4Y7DA 1QH1A 2ZIEA 4P31A 3VR2D 5BOVA 2N46A 3NHWA 3G9UA 3V9AA 4BWVA 4DAEA 2Q7XA 1PS0A 1QQ5A 1WW3A 2W98A 3A6JA 9ATCA 1I2BA 3NQ41 4B6GA 3JVEA 4ZDKA 4FDVA 3ZDDA 3ILVA 2QW0X 3DNMA 2A84A 2QD5A 3LAWA 3NOOA 1WWKA 1KYYA 2X42A 4HFRA 5K3CA 5J40A 3ORFA 1XK7A 2E6KA 2WSBA 5DNDA 3ZWNA 4YPOA 2UXDB 2MT9A 4EGFA 3EXAA 1R74A 3LD9A 5AI5A 1B0PA 3QF4B 2V7UA 3BS4A 4FFBA 3P9YA 2Z5FA 1XRSB 4YBRA 5CDHA 1MX3A 4B3BA 4W7IA 1Q7GA 1QZTA 2JFPA 3P5SA 4ZYVA 2XXAB 3HMQA 1X1EA 1ZVJA 3GV0A 4DMRA 3I37X 4JKYA 1A2BA 1LB1B 1BQ4A 1N3LA 1T1RA 1WUHS 2WJ6A 3H6GA 4Y2YA 1I1NA 2ZPUA 4CCSA 2J9FB 4WBNB 3EH1A 3ASUA 5TRTA 4CETA 2ACEA 5F7OA 3HVRA 1E98A 1HDYA 1DQZA 1ZG3A 2PDAA 3IAEA 3WQHA 5KNDD 3CPSA 2NNLD 1D2CA 2YC2C 2ZJFA 3G5LA 2ODPA 4ZEOA 3K6JA 4PSVA 1L5LA 2ZZNA 1KC1A 2W6ZA 3WBBA 1ND6A 3EGXB 4IUBS 3OU2A 4TTIA 5AOCA 2PZBA 5AUNB 2OHGA 5LR6A 3EGEA 2J59A 1RQ2A 2JBHA 1B16A 4HVTA 4AT1A 4RANA 3FKQA 4RTJA 2HIMA 2LCIA 1Z16A 2YW9A 3HU1A 2Q28A 3BMCA 1MAAA 2IQIA 3L05A 3L7NA 3U6KA 6LDHA 2QM7A 1N0IA 2CYBA 5IVPA 3ACCA 4US2R 1QLJA 4H6WA 3VOBA 3O2QB 1LY1A 1MIOA 2JANA 4AMYA 3FFBA 4O4JA 4O2BF 4UTOA 4ALJA 1ORVA 5DBHX 4PZAA 3L1KA 1NLYA 1LS1A 2A88A 4BNKA 2YXLA 3WTBA 4Q15A 3PTZA 4DG5A 1BGWA 4MV8A 1M72A 2NO5A 2UYOA 3Q15C 4AQ7A 1K92A 1XDBA 3LF2A 1J21A 3WQBA 1Y7HA 1WQ1R 4BN5A 5K6AC 4MVXA 3GA0A 5DN6D 3F2IA 1SUEA 2YHAA 3S2SA 3T0GA 5K0FA 2A9FA 2Q5IA 4JQZA 4GI3A 4IKOA 1NRXA 3R3JA 1PG5A 3RPEA 5LL6P 3PUHA 5CIWA 2H16A 3DBHB 2JVKA 2FFRA 3FVQA 3H16A 4ZXFA 2FLKA 4M7WA 2GPAA 3ESYA 3ITDA 4X20A 4ZCQA 3LBFA 1UPFA 1RSZA 2CXUA 3V8QA 2OPBA 4P4UA 1GP2A 1REQB 1RXCA 2G36A 1LBEA 3AZPA 4MRAA 3WVNA 4HQ0A 1J9EA 5C1OA 3BSFA 1TAUA 3SFZA 4EF6A 2JLXA 4D9NA 1JKMA 1Q0QA 2QM3A 3NBAA 3IUQA 3IHLA 4BVFA 1PDVA 4ED9A 1N2IA 5I4BA 5JRDS 5CCDA 2PUAA 3QWHA 2WUFA 4FX2A 4CEJB 1XL0A 4BVAA 5I9MA 3CLUC 4QRDA 1XVLA 1JG1A 3ABOB 3AUYA 4JBGA 3P45A 1QS0B 1L5RA 1JB9A 1A5BB 1W9MA 1N32B 3SZMA 1P62B 3KEMA 4E21A 3GX1A 3K6KA 3PHLA 4R8MA 5IXYA 4RH0A 2VFAA 1U11A 2Z95A 4PR3A 4E32A 4MB0A 1IBKB 1CEYA 1TM1E 3LCUA 4E94A 3S6JA 4NBWA 1ZVVA 1T5SA 5LBTA 5EIAA 4AX4A 4I5EA 1RC1A 2X5XA 3L1IA 4F3RA 1KVQA 4GM1A 2UUAB 1FFGA 4GX5A 4XJXA 1Z17A 3BCSA 4JLUA 1BO6A 1A9RA 1CJKC 1ZHHA 3OJXA 4HEA6 4LWOA 4AJ2A 1HDRA 3HABA 4ENTA 1DBWA 1Z8NA 4E14A 1XZQA 5AVQA 1HFKA 1E1KA 2J7KA 3KJHA 5B2ZA 3CLRD 3ZU6A 3RHFA 2LD4A 2FUG1 1TQ8A 4HS4A 4GR4A 4UBKA 4J3FA 1XI2A 4A73A 5JXHA 3PEYA 3K5IA 4XB2A 1XEXA 2JGDB 4KXYA 1KSHA 1AN0A 3FDZB 3PVCA 2XUIA 3D2BA 5HIIA 4AY2A 2VLIA 2GPJA 5IJ9A 1V4NA 3M3HA 1H2EA 1O3YA 1R6BX 3GVHA 3P4YA 3K30A 3PF8A 3AW9A 3KFLA 4P36A 3II6X 3IIMA 5BQ5A 3W8NA 1FYXA 3NOVA 3TW4A 4EA9A 2GCNA 2Y9MB 1Z2PX 4KDRA 5LZ4A 3LT1A 4OHOA 4XR9A 2WTAA 2V3WA 3MT0A 4TTAA 4CQNA 4JWKA 2OB2A 4PGGA 1B8PA 1H69A 3JSAA 2PZGA 3LC7O 4K6HA 5DXJA 2RI6A 4LY0A 4YDHB 2EDAA 4Q66C 4DG9A 4X1OA 4JLBA 4KBGA 4AC9A 4HZUA 4N8DA 3M9WA 3FPCA 2W6MA 4JSRA 5DGDA 2CZQA 1A8HA 3AI3A 1XO1A 1V43A 1XSEA 4N7RA 3EGWA 5EPEA 2XYHA 5FBRB 3P20A 1ZK1A 2O9JA 5EXSA 1AH2A 2IIPA 2ST1A 3TI9A 2NOAA 3RAFC 1SUBA 3T06B 1E2EA 1GFIA 2ROQA 3SXPA 2FEAA 3K9BA 2W2LD 4HAUA 3NUZA 2H54A 4KLCA 4XE5A 1PFGA 3P52A 4BMOB 4D8TA 3N6XA 2ZPTX 1NY5A 1O8CA 1PR4A 3OQNA 3NJ4A 4OP2A 3C8HA 5AHWA 1LH0A 2FPMA 5K8VA 3I3OA 1OLXA 2C96A 4LHWA 4NEQA 4Z8XA 5FWXA 3V1MA 3PC3A 2HRRA 1P7ZA 3U3ZA 3UXYA 5HNKA 3UJCA 4Z3OA 2ZJ1A 2BZGA 3PPXA 4ZOLF 1XOIA 4MRPA 1F0PA 4DBVO 1NM5C 3DTVD 1RI2A 4KI7A 4EM6A 3NBKA 4TRRA 4EH1A 1UMBA 3ANTA 5T4HA 1Z63A 1VSVA 3A9SA 3A3PA 3AF5A 4QDTA 3K0CC 3DE3X 1QU3A 2GS9A 2GYUA 4L5AA 2W7TA 4NI5A 2A7XA 4PO3X 4WVLA 1RHJA 4D9IA 4Q6WA 4Z54A 2V6IA 2E89A 5K3AA 4KVZA 4FDLA 1LKZA 3C85A 4Q24A 4DQDA 3A1TA 1KARA 5HJ2A 4RACA 2AKYA 1UC9A 4R0MA 5K20A 3NHUA 1RM5A 3VAAA 3D3QA 2HT1A 1GSOA 2NXEA 3O9MA 1SVMA 3EYWA 4RZUA 5HCIA 1GUAA 4QQ8A 3R7WB 5JAHA 2ZWIA 3LY7A 2GESA 2WNSA 4KV9A 4LXGA 4OFZA 3WGVA 1ODIA 2I0FA 4WY5A 4Y1RA 4DJAA 3QGMA 3PHHA 2HF2A 1C7RA 3W1EA 1XRRA 4N4AA 1LXCA 1AN9A 4MP8A 4X7MA 1X74A 3I28A 9LDBA 5TMPA 3N8GA 1KL7A 2YIVX 4DEYA 3NYIA 1VG9B 1MB3A 2IODA 1H8HD 2JI7A 1X3LA 2OBMA 2W6IA 3DEAA 1E94E 4WEQA 3WGHA 4ZGGA 3SEFA 2CDBA 3PFHA 4RK4A 1PFQA 2P6PA 5FB3A 1W581 2FEMA 4FLFA 3CWQA 4HTFB 1QHFA 1UEIA 4OXXA 1JYSA 3HP4A 4D3DA 5AD1A 3ZVNA 3HDJA 3NRJA 4I81A 1V3UA 1ZCBA 2VRCA 1L5QA 2XVAA 3GOHA 2NPOA 1SUFA 4Q1BA 4FR5A 1OJLA 3ZHQA 1H8ED 5KVAA 4CMBA 3FPHA 2FI1A 5ALLA 3WLEA 1VGRA 3BFKA 4N47A 2GNAA 4D80A 1WNFA 2IYQA 3IYLW 1YL5A 2IHUA 1KPIA 2YVUA 3U4MA 3LQYA 3O4VA 2XDYA 1AZTA 3M2TA 2BHSA 3ZGZA 1J1UA 3OHMA 4JI6B 1KNQA 4PQRA 4Q3NA 2FPRA 1O5IA 3AB7A 3AEUA 1Q3HA 5BQPA 2PZ8A 3E9EA 2WIGA 2PJUA 2O3JA 4A2QA 3QE9Y 4MV6A 2GTPA 1PLKA 2HRZA 4UPVA 1DWUA 1GZ3A 2CFRA 3Q98A 3ZV6A 4BWYA 2DQZA 4KO1S 4G67A 4JY7A 4GP6A 1WXFA 3LP6A 3B3FA 1NW6A 3FWYA 3TB6A 5A3SA 4S1TA 3ZQUA 1OFGA 1I3OA 1VBMA 3DCNA 2GXAA 2Q7OE 5KOJB 2YV5A 4KK4A 2A1UA 1SVNA 3HL0A 4MNTA 4DLVA 2QI9C 1DQYA 3AERA 4O4HB 1GPH1 1GKKA 1JZSA 3ZI0A 4XGRA 1UBLS 2NLOA 2HCJB 3M0EA 4YCAA 1ECJA 4O2AA 4B7XA 5FLEX 4B4KA 1SKYE 4PGAA 4JCOA 8LDHA 2ILTA 3PQ8A 1E2FA 3DCJA 4JOCA 1G8SA 3OPMA 4C3UA 3KTFA 4GH5A 2EBUA 2KQUA 4DS3A 1C9MA 2Z08A 2XOEA 3L8DA 4HAXA 2HPVA 4GPTA 1O1YA 2YV2A 3CW2A 3T4EA 2JCYA 5A7HA 1I7NA 1VFPA 1KI2A 3QWIA 2ZZKA 2Q4OA 3NHFA 1M34A 2EEZA 3WNDA 2FN4A 2XQKA 4M76B 1Z7BA 2JFBA 1V1RA 2BC9A 3ESRA 3OPYB 3I6MA 1L5VA 4WE3A 3RC1A 2VQDA 4X7BA 4DW8A 2P6RA 4BCBA 2BGIA 4P1ZA 4CV1A 2W2KA 4G5XA 1B76A 1ZCFA 2C4NA 2ORED 1M2KA 3L6CA 3R4CA 4QUKA 2AFRA 3PHCA 3H5TA 4IZ6A 1QAOA 1W85B 2ZTLA 1QHYA 4GMDA 4HQFA 4IQ8A 4OI1A 1DOHA 2GA9A 4L15A 1PNRA 4S3MA 3MAAC 1U7DA 3RIGA 4ROTA 5BW5A 1TT7A 3E3MA 3MOIA 1T10A 2P5YA 4Q9JA 1T91A 2VYVD 2QMUA 4YJ3A 4AZ3A 2CXTA 1R7RA 2CV1A 1SZPA 3A10A 4DNFA 3E8XA 4ZVOA 4C43A 1FPMA 3Q5DA 1WX1A 1BWPA 4E15A 4CG1A 4YV1A 3JQEA 1SZJG 5ETJA 1R9NA 4S2UA 5DF1A 2IV7A 4H7KA 1NOKA 2XMQA 5JV5A 4LF5B 1Z3CA 2H65A 3NXKA 4J76A 4HUQB 5FLYA 3RVPA 1Q0SA 4RE5A 4YAJA 2P68A 4YMHA 1UM8A 1N3IA 2NVOA 4HB0A 4R8RA 4JXXA 1M34E 5A06A 2HY7A 3I52A 1AMUA 2ZIZA 1V4VA 1QGUB 4LXXA 2ZBDA 4FNOA 5A0TA 4PSKA 1PFKA 3NCHA 3IT1A 1IK4A 1B8VA 2WUVA 5CLHA 3VSDA 3GUVA 1Z5WA 3RUDA 1OB2A 4A36A 1A4RA 3SR3A 1Z5UA 3RS2A 3BORA 1E1MA 2O7RA 2QE6A 2C9DA 2QN8A 3BYZA 2ZAIA 1RM4A 5DWDA 1J24A 1TIPA 2JASA 2PL9A 2EFEB 5SZJA 1RAAA 4P4NA 5F3RA 5CA0B 1G291 3WADA 1QCCA 5CBKA 3FYHA 4ZT2A 1U5BA 1WB9A 1XLTC 4NS4A 1Q7TA 3GCZA 4ODIA 3RU3A 2C03A 4S35A 1SOAA 1AKQA 3SNHA 4JDPA 4QEZA 1KQNA 1DE0A 2QJRA 2PMBA 5FPQA 1HEIA 3IJRA 4IHJA 4WBNF 5TE9A 3T9AA 4V1CI 4X97A 5JUWA 3AG5A 2PLAA 5E6SB 3UYKA 2VJMB 4RMIA 4S12A 2DP4E 1VG8A 2OT3B 2FMIA 2RKBA 3O1IC 1PIWA 5DHUA 2M6LA 4G0VA 2XZTA 3R3HA 5FPPA 4AWAA 3Q7RA 4CL8A 1W8IA 3K9WA 3AFOA 3I6ZA 2FPIB 3UXMA 4AMVA 1IOLA 1AQIA 2FPPB 4E30A 3EFHA 3I30X 4UBIA 2BZ1A 1LSOA 1RKVA 2H4YA 4FYPA 1D4AA 5AKKA 1CW2B 2HBRA 4H1TA 3NTLA 4MUNA 4Q01A 4RTNA 3ZHOA 4GOXA 4RTRA 1ZKDA 1DCKA 3EMVA 3T7AA 5LN1A 2X4IA 3IP8A 4N54A 2GVDC 4ZVPA 4PQYA 3ZU4A 2Z98A 4RD3A 4D7AA 8AT1A 3KTDA 3H3FA 3IDFA 4NATA 2ZSUA 3EW7A 3I6QA 3I73A 3PS9A 3IBSA 4QUDA 5FI0B 1EWYA 3H9EO 3BZWA 1T3GA 2AG5A 5DT9A 1RHKA 5CDYA 4HZIA 3JRNA 1RJEA 4JK3A 5BY2A 2CLHB 2GUWA 1W88B 1IBCA 2B1GA 1QG0A 1YR2A 2Z6AA 1Q6ZA 4O4JF 2O59A 4OG2A 2YOFA 1BIFA 2R6ZA 4XEUA 3ZY2A 3KQPA 3JAWA 3HKDB 3L01A 1HUQA 1VLQA 4UOEA 1TJ3A 4Q37A 1P0IA 4DIDA 3UT0A 3F2VA 2HNKA 3K09C 1Z6TA 4O25A 4Q4JB 3SOPA 3RWOA 3U5ZB 4H4EA 3O0TA 4AIRA 1BFUA 4HAIA 4R84A 4OFXA 1UBTS 2B7CA 2WJ3A 4KBYA 1AS0A 3H97A 2ZP1A 1FL9A 5E3IA 4O4LA 4MDYA 5IJAA 2KHZA 3AV0B 4BRSA 3GVCA 3ITKA 1AKUA 1MJ5A 5JBQA 3PXAA 3HO8A 4L51A 1D8AA 4R8LA 4GBJA 1WR8A 5FP0A 1H2WA 2NNWB 521PA 3LZ6A 2WG1A 4NPCA 3IUPA 1E69A 4U7HA 1Z6XA 1SKUA 4QYIB 2WWFA 1DTEA 1CDEA 4I50B 2V5AA 3DB2A 1JAXA 2WTXA 1T34A 1G18A 3C3AA 3EPLA 3RU7A 3QJYA 1AUVA 2BGUA 4TROA 1E9EA 3L6DA 5E4TA 3SJZA 2DHEA 4W5HA 1I9GA 1WHTB 1AZLA 4F5DA 3R3VA 1JG2A 1NXOA 1YVEI 3VGPA 2XE6A 1YIAA 5A4IS 621PA 3WYCA 1LZKA 3W5BA 2H52A 4KFTA 1ZM4A 3MYYA 4ZVMA 4QLBA 2GBLC 1KI6A 3RYCA 3RRYA 2BHRA 2CHUA 1ISIA 1SCAA 3ZCUA 1ZN2A 1DIAA 1HQDA 2ETXA 3A8TA 4JL8A 5EQFA 4D3FA 1JFSA 2Y99A 4U6SA 3MTBA 5AWFC 4UOZA 1B1AA 5E4JA 3T1VA 3OA0A 2VHUA 3I0NA 3LVFO 4M8NE 5IDVA 2Q7DA 3SM3A 3EVGA 1N6HA 1EH5A 1HE2A 3IR5A 4R2IA 4F1KA 2IHZA 1RNLA 4PCAA 3CMCO 3MWDB 4PTYA 4MMYB 1VGVA 2ODQA 2BI4A 4JELA 2RH9B 4EPTA 5AT1A 5C34B 5I47A 2B35A 1TJ5A 3I9FA 4C76A 1U3DA 4CNBA 3E0QA 2EJWA 2NYVA 1D09A 4HQNA 4PAMA 5B3KA 1W0JA 3VSCA 5HQ3A 2DR2A 3UJDA 5KQPA 3DP7A 5D3MA 2RHHA 3HBFA 4YRPA 1X7ZA 2WMYA 2RB5A 4KRFA 1Y42X 3CKYA 2XQGA 1SCDA 3COYA 3B6JA 1OV6A 3L1VA 4YREA 1SEPA 2IV3A 3UCFA 4EJSB 3GVXA 1TUBB 1T9HA 1ZGZA 1P0CA 3DCYA 2DKNA 2EJCA 2J6BA 3UATA 5SY4A 3IEXA 2RARA 4KQGA 4MGYR 1TYBE 1AHPA 1QFYA 1T1EA 5FH9A 3HACA 3N0XA 1ULZA 3P5BA 3SHVA 3Q7QA 1YDGA 4KR9A 4ZYXA 2XQIA 1T9BA 1KMNA 4KRYA 4XKJA 5E2AA 1USWA 5CLLA 5CHEA 5CYPA 3U16A 2QRQA 3GQBA 1EWTA 1V2GA 5CG1A 2I4TA 3AW8A 2V6GA 4G1EB 2MSEB 4BUJA 1E89A 2VHTA 5DIFA 5GVRA 2D5LA 1X9IA 2WMOB 1ZMBA 3RJ5A 4DLXA 4AKSA 1R6TA