1U8AA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
165
structure length
163
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Shikimate kinase
publication title Crystallographic studies of shikimate binding and induced conformational changes in Mycobacterium tuberculosis shikimate kinase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 58
structure length 163
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8aA00
4C7OA 1FFHA 3B82A 4KFRA 2PMKA 3KB2A 5CLLA 5BN4A 1E9BA 4UNSA 4LV6A 1TNDA 2Q3HA 2GA8A 1SZPA 4A0FA 2WZQA 2GK6A 3FHCB 2CL6X 2RCNA 4F4CA 2ZRKA 1T5LA 5FOUA 1ZNZA 1T3LA 1NMZA 3THWA 3ZVLA 3AVXA 3OEEA 3FVQA 1J70A 3LH5A 4HAVA 1CXZA 4L8GA 4RD4A 4B74A 4D80A 3AKYA 3IPYA 4EFLA 3F0TA 1MABA 4AD8A 1P4SA 1G17A 1NVXQ 5EUMA 4Q7JB 3UANA 1NLZA 2OESA 3FMFA 3OIYA 3UMFA 4CT4B 1UDXA 5KNDA 2DB3A 2JLVA 1TU4A 5F9HA 1FPMA 1HE8B 1N5JA 4DVGA 3HU3A 3SNHA 1S9DA 2OCBA 4Z51A 1GTVA 1Q1EA 4AURA 1G20E 5BYJA 3ZGXA 4NL4H 2ZRAA 4MRSA 1EFCA 1OYWA 1QG2A 4TMKA 2ZR7A 1DEKA 3NEJA 4IVRA 4EPXA 5FTLA 1Z28A 1J7KA 4A36A 2NO0A 5JBQA 5JS7A 1JNYA 1G3QA 3ZDQA 3HYRA 1DAGA 5EUQB 5HCIA 4B3GA 2QENA 3M1IA 3MWLA 4FMCF 1TAGA 4I99A 1H8ED 4OQNA 1G3IA 2JLYA 2BKUA 3DZDA 3K09A 5BXQC 4TMTA 4G5RA 3GLFA 1GILA 5K8IA 3PUWA 4A8JC 5B64A 5JEEA 2WWWA 2ONJA 1KI3A 1OH6A 4AKEA 5C46F 2C03A 1CRQA 4ABYA 5IK2A 1L4YA 4BLPA 2OM2A 1OXSC 3PEVA 1BYUA 3FOZA 2H8KA 2WKPA 3RS3A 3CRQA 1VTKA 2ZI9A 4XTCS 1OH7A 4KBFA 4EFMA 2EYQA 4IOMA 1R7RA 1HY3A 1PLJA 3PFIA 3TE6A 2FGJA 2HDNB 2IYXA 4CT5A 3B6EA 4DSOA 1J99A 2V8OA 3T5DA 1LV7A 1RE0A 1L2TA 1M34E 2EFDB 2NO9A 1J8MF 3BH7A 4UNRA 5GADl 2GCOA 1XXHE 1Z6XA 2W6JA 3OIWA 4OBEA 1XNJA 3RDPA 4JLMA 2AFIE 5JI2E 4S2EA 1R0XA 1JJVA 2OXCA 4C4PA 2OFXA 1XF9A 3LW8A 3K9LA 1OB5A 1GKIA 3A4NA 1XJCA 4QNRA 2G0NA 2V3CC 3AH8A 5K8TA 4JBWA 3T12A 1MO6A 2QP4A 3LD9A 3B9QA 3U3MA 2ZAMA 2R6AA 5JFGA 4WIAA 3TNFA 2P5SA 4AKIA 3WYFA 3GLIE 1YRBA 2W00A 4J0QA 4K8OA 5KHOC 3BB3A 2ODNA 2ZRMA 1IJEA 1XMVA 3B8HA 2QM7A 4QBFA 3R7WB 4BUJA 4M2LA 4Q9JA 1G1MA 1OT3A 3K70D 1Z08A 4Q1CA 3WMFA 2PBRA 3NC1C 1TQ4A 4ZPXA 4PHHA 2WAYA 1P2VA 1E2KA 1E9FA 4L16A 4M0LA 4L15A 3FHOA 5HR5A 2J0QA 5JHGB 2C77A 1UAAA 1KSFX 2JJ2A 2FOLA 3FHTA 2FPLA 2WM9B 2GCPA 1CR0A 3X1DA 3UWKA 2VPPA 1P6XA 2J9RA 3A6PC 2ZYVX 1DO0A 1NVUQ 2FA9A 4MRRA 1ETUA 3U7GA 1VG8A 2A5YB 1YR8A 2V7QD 4Q7MB 2J7PD 1DOAA 5CDFA 3AEZA 4DDUA 5CJPA 2QMOA 3VR4A 1FP7A 1YZQA 4EQ6B 4JKIA 1W36D 2WIBA 2QEQA 3DOEA 4FMDB 4HLDA 4FCVA 4OHXA 5F98A 1IM2A 2IHYA 4V02A 2XTMA 1Q22A 3B85A 1KK3A 1UEIA 3BB1A 3NBZC 4B3XA 5KPJA 4C0LA 4LYFA 2OG2A 5LPNA 2OFOA 3UG7A 4CVNA 1IOZA 5JSZA 1UKVY 2BMJA 1RJ9A 2IF0A 3T15A 2ZSAA 4LJ8A 1ZYUA 2VA8A 1VG1A 2HJVA 4TMZA 3AVYA 4M1KA 4OQMA 2ZI6A 4Q4AA 3Q3JB 1SXJE 2PH1A 1EGAA 2QTFA 1J90A 3EASA 4E09A 1E1QD 4PO9A 3GJ8A 4A0GA 4ZIRA 4GZLA 1E1RD 2QQ0A 4DB2A 3CLVA 2BDTA 5J5CA 2IS2A 4TQUS 3X1WA 1BMFA 2IHBA 2QT0A 3Q85A 2AXPA 2ZITA 1E9EA 4UJ3A 3RAPR 4A8JB 5KPDA 2FH5B 1VIAA 1G19A 1VCOA 4Q1BA 4DSUA 1SKQA 4FN5A 2FSIA 1L7VC 3D3QA 5L3SB 5G40A 3L0OA 3T1TA 2LKCA 3N2EA 1FUUA 1KZ7B 2ZS9A 4AC9A 1NSTA 3KX2A 5L3RA 2CNWD 3K9NA 2GEVA 1YZGA 3GFTA 1T3HA 1Z6YA 3UATA 4IDQA 3EA5A 1M7HA 1U81A 3KQNA 3OEHA 1A5TA 5CDFE 5KOYA 3ZYCA 1X8JA 2GWHA 1E0AA 1JQLB 2YWFA 5E95A 3OF5A 4NYIQ 3RNLA 5LD2B 3EZ6A 4FD2A 2GDJA 4EIWA 3DZ8A 4H9GA 1CR4A 4DDWA 4OJKA 5DYGA 1H8HA 4HB0A 5EXSA 4A2QA 2ZRIA 1V5WA 4D4KA 2J5XA 1EK0A 1MO5A 4PAQA 1KY2A 4CGZA 3L2OB 3IHLA 3SQWA 3OIUA 1IXRC 3QKSA 1XBTA 1ZC4A 2HF9A 3EAQA 3TIFA 2F3TA 2CCJA 3KJGA 3LWNA 4DBLC 2QM8A 4TLDA 2R6DA 3BE4A 5IHPA 5EXTA 4TLCA 2Q6TA 2W58A 3C7KA 2P67A 4Z8YA 2CMKA 4HAYA 1TTTA 2REBA 2IL1A 2QMUA 3R8CA 1LNZA 4U02A 2J0UA 1CJMA 2QQEA 3THOA 2V1UA 1ZIPA 3AF0A 3SE0A 4JLDA 4B2IA 4D4JA 3AVWA 5LB4A 4UXJA 2RGXA 1DTSA 4IFBA 5EP4A 5TXGA 2WJGA 4PTLA 2G1JA 3VU9A 2XJ4A 4JSYA 2BWJA 4RFSB 5D3QA 2D3WA 2H5EA 5B57C 3X1YA 1DPFA 2MSDB 4BASA 4IXNA 1NVWQ 4TT3A 2ZQ5A 3OESA 1G18A 1G4UR 4WA7A 1A2BA 2GVDC 2ORIA 1SVOA 5P21A 3TSZA 2WSSD 2Z4SA 5BYKA 4AKHA 1C1YA 4QGAA 4BFWA 5CYPA 2CJWA 3I32A 3UWOA 3E2IA 2Z6VA 4B6EA 1OFIA 3TAHA 4TL8A 5FTMA 3U44A 2H92A 1N6RA 3IPXA 3TQCA 3BWDD 1FMJA 4YDHB 3E5HA 2B7BA 5EZ6B 3UG6A 3GLGB 4OK3A 3WNCA 2RGBA 4M1YA 1NKTA 5CK5A 1US8A 3WMEA 5K8UA 1OPXA 2FJUA 4IDPA 3RRYA 2G77B 3ADBA 3ICQB 4WXPA 4QJ3A 5HE8A 1W5TA 2ASEA 4D0GA 2XOKD 2IYWA 3W6PA 1KDOA 821PA 3BGWA 1XCMA 1Q12A 4V0KA 1TL7C 5FI0B 3ADCA 1CEEA 3T34A 1H8EA 1E2QA 1GKUB 4LBYA 3IIMA 3TVTA 4HAUA 2BBSA 3PXGA 1A82A 3I8XA 1HUQA 1QHYA 1GP2A 4C2UA 3JZAA 2EFGA 1R8QA 3I8SA 1NIPA 4NKRA 1OIVA 2P0EA 4QOSA 5EJEA 2JA1A 1JR3A 3WP0A 2ZRCA 5A5GA 1FTNA 3BBPA 2P2LA 3T35A 3PITA 3GQBA 4FWIB 4P33A 1HA3A 5HTKA 2ATVA 2D7CA 2VYFA 1OJLA 2WWIA 4EJSA 4YMTA 2RGDA 1S1CA 4IDHA 4CEJA 2W6ID 1Z63A 2RHMA 4MA4A 4PQRA 3FMPB 2VP9A 4H1VA 3OE7D 1NBMA 2A5DA 2GK7A 3RS4A 2D2FA 4KFSA 4QBGB 2VIIA 4QRHA 4WBSA 1KNQA 4B43A 2A5FA 3AUYA 2CHGA 1NNEA 1WBDA 3EZFA 2A3RA 3IHWA 1YVDA 4DEXA 1GRQA 1YKSA 1ZM9A 2Y8EA 2F43B 1N6HA 4N0DA 5FOWA 5IRCD 2OUKA 4RZ2A 4M8NE 3H1TA 3OEED 2CL7X 3ZQ6A 3AM1A 4MYHA 4DCVA 4PPNA 1HQCA 2FNAA 2WJYA 4KYIB 3H0KA 5H1YA 2XNDD 4CEIA 2WOOA 1FX0B 1E3MA 2HEIA 3TW8B 4HAXA 1XEWX 2WWFA 5GJWC 3ND8A 4S35A 3QJYA 1GNRA 4XH9B 5DLQC 1EFUA 1P61B 3EWAA 2HLDD 2ZE6A 1P60A 3LA6A 2V55B 3BORA 4BFVA 2GVZC 4DHEA 5GJBA 3CO5A 3U3KA 1GAJA 2P6UA 4YONB 1W4BA 4IXMA 1I2MA 1UKYA 1NI3A 2ZAOA 3BFVA 3QG5A 4DWJA 2XB4A 3BS4A 3QIAA 4XWAA 5J40A 3IIKA 3KQLA 4LHWA 3HP1A 1I2DA 1ZINA 5HPYB 3X2SA 4PZYA 3HWSA 2BMDA 4TLEA 2GAAA 1COWD 3U2QA 3A1TA 4E22A 3KKMA 4UNPA 3SQXA 4Q1DA 2J87A 3H4MA 4GP7A 2V7QA 1SHZA 2J7PA 4A92A 1TEXA 1WMSA 3FPAA 3P32A 3TRFA 4V0LA 2IYUA 1OXXK 4BECA 3QE0A 2QAGC 3QXHA 3C15C 4II7A 3RLFA 4YDSA 2J0SA 3K0FB 1UKEA 2QPAA 3NH6A 3AVUA 1N5KA 3SZRA 4C0HA 1F2TB 4R7ZA 4RZUA 4PC6A 3P4XA 1VECA 4DXAA 1YQTA 2G0TA 3EW9A 2IYYA 2G3YA 1E98A 4FMBB 3A1WA 2GILA 4RD1A 2Q0HA 4HLUC 1FQKA 2OFWA 1KKMA 3DEFA 5SZJA 1FZQA 2KE5A 3CX7A 2C95A 2ZANA 3GMTA 1G7RA 1E1QA 1RVDA 2W6JD 2C96A 1D2EA 3B9PA 1R0YA 2WKRA 2XNSA 3HR7A 2FWRA 5AUOB 4ARZA 1JXMA 3EZ9A 4Q4HA 2ZUBA 4BEBA 3SBEA 2Q3FA 4GP6A 3F8TA 2ZTSA 5AJXA 4ZCIA 1QHXA 2QBYA 3R9WA 3QF7A 2DFTA 5EP2A 1YRAA 2ZVPX 2ODWA 1K8RA 2CCKA 2QY9A 3I62A 1N0WA 3CRRA 1MT0A 2GETA 3KL4A 3U3OA 2HXSA 2CNWA 3DHWC 2DYKA 2ZJYA 2YHSA 3ZVRA 1GL9B 3QF4A 4XSGA 2EWWA 3IO5A 1XD2B 5D3MB 4JLPA 2FFQA 5DHAA 1G21E 4PO8A 3A1VA 1MV5A 5KYKA 4MYTA 3LQQA 4LZZA 3TR0A 2JJ2D 2ZU6A 3FDIA 2GBLA 3O8CA 2JLXA 2ECKA 1JEDA 1EESA 2FDCA 1GL6A 3KQUA 3OAAD 5J4VA 4ESVA 1ZUNB 4PC1A 3NC0C 1Z0DA 2PEZA 2C5LA 5CJ2A 1R5NA 5AJZA 4YMVA 4MKHA 2QTHA 3H2YA 1P2SA 4OHVA 3PR1A 1AA9A 1SKYB 2ZRNA 4MYCA 2ZRPA 1G8HA 4NONA 1AK2A 5L3VA 5B58C 4KO8A 4MGYR 2GXUA 5JCZA 3TUJC 3A4LA 1NMYA 1K5DA 1RZ3A 2ONKA 4TYPA 4IVQA 1T0HB 1G291 3VFDA 2QMHA 2JAQA 3NDPA 1KSJA 2XJ9A 1W47A 3AVVA 4B48A 3GLHE 4Z54A 3N5CA 1YZTA 3CX8A 3MG9A 2IXEA 1J8YF 1Q0UA 3ZVMA 1HYQA 4CDGA 4CYMA 1IXZA 1OH5A 1Q1ZA 2XTZA 5HCNA 1M2OB 4Z1MD 4LX0A 5LB2A 2WSSA 2Q3MA 3CRVA 3CH4B 5ANRB 2D06A 1QHHB 3JZMA 1GRNA 1N6OA 4NE2A 3B1WA 3KKPA 5JCPA 4LHYA 4HZIA 1Q44A 3TVDA 1KO7A 3KKOA 2GXAA 4NYMQ 1ODFA 2OE2A 1NL3A 3G82C 4HATA 1H65A 4HB4A 4LGMA 2V6JA 4HUQB 1XRJA 3S1AA 3W8NA 3CM0A 4JVSB 3O8BA 2AHOA 4B32A 2HXYA 2FSGA 5KO2A 1XDBA 3NG1A 3QI2A 2O8CA 2P6RA 1W0KD 4KVGA 3AUXA 5FOTA 1W5SA 3ZD6A 1G5TA 5J47A 4TYNA 4LJ6A 3QEJA 4LWZA 2XB2A 1NY6A 2OILA 4BLOA 3V9PA 1CJTC 1DAHA 1E2PA 3CF6R 2GXSA 2B8WA 2PZFA 4PANA 1KO5A 1Y3AA 4LHZA 4IJMA 5JI3E 3HR8A 3K09C 1H8HD 4DT1A 3M0EA 3ADKA 4QL3A 2YVUA 1A4RA 3AF4A 4LSGA 3E70C 2AR7A 2YZ2A 2PCLA 1JXOA 2R65A 3L43A 1G64A 1D5CA 4I1OA 3ZVNA 2A7QA 2RAPA 4URZR 4ZI3A 1OFUX 2A9KA 2ANCA 2KI5A 3C14C 3BIFA 3QBTA 4PSVA 2Z0MA 4GMDA 4EPVA 3R9XA 1VMAA 2RGNA 1YZNA 1IXSB 1LF5A 4NU0A 2DR3A 2AL7A 3OE7A 2EQBA 3UK6A 5M04A 2R6GA 4LC0A 4A82A 4R98A 5GVSA 4LY6A 2OLKA 1QBKC 4U5XA 4FW9A 1DAEA 3U3RA 3QVVA 4JZKA 1W2GA 5E7MA 1PVOA 2L0XA 3D31A 1OW3B 1M1YE 2QNRA 4N0EA 1IY2A 3LLMA 4B33A 3CNOA 1BO6A 3AV0B 5CK4A 1TUIA 4TT3D 3KXIA 1RFLA 3PJRA 2FFHA 4GSYA 2OSBA 1GDDA 1G3UA 5KSZA 2WWGA 5J4KA 1IY0A 4ASUA 2A2ZA 4DIDA 4W9MC 2B8TA 2BEKA 2C9CA 2XNDA 5H70A 3Q5DA 2OEPA 3F3YA 4GNKA 2IBMA 1CP2A 2ZRBA 1E6CA 1KK1A 1HQYE 4RJLA 1AJEA 2W0SA 2VQSA 4GT1A 2HLDA 5BN5A 1NKSA 1SXJC 4WZBE 1KMQA 5C2JB 4POAA 2FG5A 1F2UB 1NG1A 4JLBA 3AKCA 4KJZA 5JRJA 1VHTA 4BQSA 4IFEA 3LW7A 2ZJ2A 1XWIA 3PEYA 4F4IA 3IIJA 3VR3A 3QVUA 3T5GA 4F4JA 1GNPA 1GFIA 1FOEB 3KQKA 3I61A 4IEEA 2NO7A 2MSEB 3QKRA 1I4DD 1V43A 2YOGA 3MSXA 1COWA 4Q4LA 3W5JA 3THWB 3TSOA 3DKVA 2CE7A 2PLFA 4O2LA 4C0SA 4BRUA 2XGJA 3AP3A 1ZD8A 1JAIA 2WKQA 2JLUA 3JVVA 1G5RA 1MABB 3KXLA 1LF0A 4LUCA 2D2EA 1E2FA 2JGNA 4TZ0A 4I1SA 2QORA 1JR3D 1VCMA 1E2JA 3T1OA 1E9CA 3I4LA 3RHFA 4KITB 4FCWA 1XXHB 1X86B 2BCGY 2RKOA 3K0SA 1NG9A 4RCZA 2XAUA 4KCGA 3VHLB 4QFMA 5UKDA 4LC1A 5KNBA 1Z6GA 4DDVA 2LKDA 4F92B 1XPRA 1NBMD 2GF0A 4JVMA 1R4AA 5FPYA 4UXIA 1Z0KA 2PT7A 3GPLA 3VKHA 3U61B 2ZM5A 5CIWA 1I4TD 1SHKA 5C1BA 3GLIB 1S3GA 2GNOA 4XWOA 2JEOA 1EXMA 2O52A 2QGZA 1DO2A 5J4LA 4GFDA 3FKSA 2KB0A 3AKDA 1E0SA 3OZXA 4Q7KA 1XCPA 1MH1A 2O0JA 2QZ4A 2QP9X 3KZ1E 3L0IB 4URYR 1D9XA 1ZRHA 2Z83A 4Q48A 3FWYA 3L0SA 3A4MA 3Q5EA 4P4SA 4XOIA 1CTQA 1XFAA 3ASZA 3RWOA 5J4YA 1ESNA 5KDLA 4LJ5A 3CZPA 4TLBA 5FI1B 1ZCAA 3VKWA 5JJIA 1LY1A 1UBEA 3FKQA 4HZUB 2NG1A 4NHOA 3OHMA 5L3QB 4Q18A 1GG2A 3LV8A 5LBIA 1P73A 1W0JD 3SJCA 3AF2A 3GLFE 3ZD7A 1ZU5A 1IQPA 2OT3B 4BRWA 1RC8A 2CEAA 2PT5A 4EPWA 2N42A 3ZZUA 2ZVQX 3CW2A 3L8YA 1WRBA 2KJQA 4XVQA 2ZRHA 2A78A 2OXRA 1P7CA 5A0FA 3AGQA 2WOJA 2GEDA 2REXB 4EQ6A 2BC9A 3LAWA 3NEYA 4TYYA 3EWSA 1CS4C 3TUIC 3OAAA 3WBJA 3DM9B 1NMXA 2DFKB 2XXAA 4DUGA 5DE3A 1XPUA 1KI1A 2D62A 3CPJB 3KKQA 4E5UA 4XIGS 4UNQA 1KJYA 3Q7PA 4KLNA 5FFMA 4BFUA 3VR2A 4EPRA 1E0KA 1PUJA 1VG0B 4ZDKA 3O8RA 1Z22A 1HH4A 3HPRA 2ZUCA 3KKNA 4PPGA 4DCUA 5JWOA 4TL6A 3UXMA 2NZ8A 1JBKA 1HURA 1SXJB 1Z0AA 5FUVA 4H1UA 3WXMA 4GI7A 1Z0IA 2QMEA 3WRXC 3M6AA 2IEZA 4KBGA 1AGPA 1DE0A 4KU4A 3L0PA 1QHGA 1X6VA 3F5FA 4DLSA 3AGPA 4HYYA 2DPXA 3W6NA 1EX7A 2HYDA 4PC2A 1NVVR 1AKYA 2YC2C 1Q3HA 4JT2A 2YKGA 4Z1MA 2BV3A 4DLZA 4LHXA 4D26A 1JALA 2JIZA 1II8B 1R5BA 4R9UC 4MUAA 4DLRA 2JDIA 5TMPA 3KQHA 4P4UA 4GBMA 4PHTA 1G4AE 4M9QA 5L3SA 1RRGA 4QGGA 2E87A 3I92A 3RS5A 2IYVA 3A37A 2WIAA 4IW3B 1HV8A 4CIDA 4FI3C 4BEJA 2X8AA 3MRSA 3NIBA 4RZ3A 5KSOA 5DI3A 3EPLA 3K9GA 1KMHB 1WB9A 3MCAA 5FR2A 4Q47A 4ACAA 3B60A 3I5YA 2G83A 1QVAA 4D82A 3D7MA 2JLSA 2JATA 2QGNA 4EDHA 3K0AB 3AVPA 3AVTA 1XD9A 5FBVB 4LJAA 4NTZA 1J2JA 4M21A 5HKKD 3BRWD 3KXKA 5FBLB 5TV2A 3HPQA 1MRNA 5FBWB 2H1LA 1NJGA 1W0KA 1G9XA 4KFUA 1UFQA 1PLKA 2WSMA 1CJKC 1P75A 2IXGA 1ZM2A 4TMWA 1L8QA 4D6PA 1JPNA 1W44A 4P32A 2FEOA 5JSZB 2MMGA 1G7CA 3ETLA 3VNVA 4B2PA 2D7DA 4LV5B 1WF3A 4RY2A 1KK2A 2ZRGA 3CWZA 1PZNA 2IX3A 1QHNA 1OIXA 4JL6A 2WWYA 2BBOA 2H18A 2NGRA 2RB4A 3K0CA 1QVRA 1N6LA 3C16C 5KDOA 4A9AA 2GESA 4JSTA 4PQFA 1ZP6A 4MGKR 4B3FX 3CF0A 1NP6A 2YWEA 4OYHA 4ACBA 1KSGA 4BLTA 1KJWA 3VQTA 1TQDA 4WAUA 4U00A 4GDFA 1VKJA 4EJSC 4RFSA 3BXZA 3Q7QA 2A5JA 4DRZA 4RD6A 3MGCA 2AKAB 1KO8A 2FU5C 2C99A 4EUNA 4PPFA 3MWKA 2OHFA 5CM8B 4B3BA 4US0R 2XTNA 2ZJZA 4KLZA 1KI4A 1CULC 5BWMA 1IN5A 2PMDA 1LS1A 4Q5IA 2ZYUX 2X19A 1KI7A 1A7JA 1JPJA 1M74A 3LXRA 4RKEA 1OIWA 2O8BB 4GMXA 1GL7A 2IC5A 2ZS8A 3I1FA 1DVRA 4QXAA 3RRNA 1UF9A 4RSGA 3GLGA 4URVR 5KTYA 1E96A 3EIQA 4V0NA 5CYOA 4ZKDA 3ZQJA 2EYUA 1P9NA 2JJ1D 1OF1A 3SDZA 4D0LB 4QC2A 4A1FA 1KAGA 4TSFD 3T1QA 1W48A 1X3SA 1AS3A 4DSNA 2KSQA 2OBMA 4B75A 3K70C 1VCIA 4BFTA 5C18A 3VX3A 3DPUA 1SVMA 2GHIA 4MH0R 3IBYA 4WW0A 2G9NA 2JLWA 4YXWA 3R8FA 2QRNA 3AVOA 4Q1AA 1OE0A 5FPKA 2BM0A 2NPIA 3K9HA 4G0NA 1D2NA 1II0A 3LRPA 1JAHA 4A0RA 2VF7A 5A4JA 4LBZA 4YC7A 3EPJA 4JMPA 4C0KA 3THYB 1JB1A 1T4GA 3B13B 1OYYA 4Q19A 2OCYC 2OCAA 4EPTA 2Q9BA 1ZCBA 2ZU0C 3PUXA 3CUEF 4X8LA 1TADA 1GIAA 4B76A 3IDQA 2ZSEA 3MMPA 3TSWA 3ADDA 2ERXA 1LFDB 3LBNA 2RGAA 2UVQA 4D81A 1KDPA 5DISB 3U44B 1W36C 1TF7A 3VX4A 2NPFA 1E2LA 1ZUHA 3REGA 3IQXA 2CVHA 2WPDD 3IILA 3RWMB 3DKPA 4OI1A 1ZNYA 1RW4A 1BH2A 1NSFA 2QSZA 2F43A 2ZPTX 4QJ4A 1AKEA 1W4CA 5BW8A 4CF7A 2NZJA 1US8B 4QBHA 1B0UA 1R0WA 3DL0A 5H8WA 2PJZA 1TU3A 5EE0A 3B1ZA 1OV4A 3KTAB 4IDOA 1M6NA 4TQ9A 1AZTA 3U7HB 1Z6TA 4JKYA 2QAJA 1YR6A 4FMCB 4EPYA 3MLEA 2ZRJA 2OZEA 4KV9A 5E4FA 1G6HA 3C4JA 5TDHA 1DADA 5TB5A 3LVQE 3KB1A 4ASUD 2A30A 1VYUA 1ZVQA 4NP6A 3FYHA 4AK9A 4KI0A 3EZ7A 4HDCA 4RD0A 4L5BA 4BLSA 1F60A 2C04A 3IUYA 1WDTA 3MFYA 1E79D 3DDCA 3SYKA 4BFYA 3U4QB 1G7TA 2RGEA 5HE9A 3WHKA 1XEFA 1W0JA 1FW6A 3CR7A 1XEXB 2QT1A 2GEUA 1W49A 4Q1EA 2QI9C 5AJWA 2IF2A 4W5JA 1YZUA 3VKGA 2X77A 1JR3E 4G1UC 4LBVA 3NVAA 3KDSE 3VHXA 4BWYA 5FPTA 3ZJYA 2R8RA 1S4QA 4GOJA 2GBLC 3A1SA 3AVQA 4ERNA 3TQFA 4BPBA 3KJEA 4X8MA 1NN3A 5EE3A 3K0FA 2H17A 1NBME 2C78A 4HI0E 1Z0JA 2VEDA 4L9WA 4MGIR 4Q9IA 4DLYA 3AKEA 1G41A 4OJQA 2BEJA 2ORVA 4Z8XA 5JMTA 2H7VA 5TY0A 4CRWB 3FE2A 2QE7D 3I3SR 1DARA 3LNCA 4TL7A 3WYAA 2ZE5A 5FBRB 2WJVA 2I1QA 2R9VA 2WMNB 3EG5A 3HU1A 5BQ5A 1AIPA 2IYRA 5EE9A 1D2MA 2XX3A 3LDAA 4YMWA 3TR5A 1XMIA 1NIJA 4ZV4A 4F7WA 4TMXA 4M1OA 1XTIA 2B7CA 4U7DA 4O25A 1UADA 5CITA 4M9ZA 3NWJA 1Z0FA 5EXXA 2HCJB 4HLQB 1KI2A 2F3RA 4HLCA 1YR7A 4TTRA 4AYWA 4BFZA 4Y0AA 4DJTA 4QJ5A 4DIEA 1CIPA 4G5OA 2R2AA 1KI8A 4G5QA 1DG3A 1DBSA 5FUXA 1IN8A 1Q3TA 2CLDX 5EP3A 2WJHA 4PR0A 2GZAA 2FPMA 2DBYA 3EARA 3FKSD 5EE5B 4A6PA 3NDBB 2JJ8A 4I4LA 4AG5A 2EVWX 1D8TA 2ZI4A 5F2EA 1NN1A 1W1WA 5KSYA 1T91A 1XD2A 4MRVA 4Q9LA 1GSIA 5D3MA 3B78A 4EAQA 2LWIA 3EX7C 1MO4A 5FL3A 5HKKA 1NF3A 2F6RA 3GJ7A 4V0MA 4DDTA 1N5IA 3Q8XB 4EFNA 1VG9B 5FUWA 4A6XA 1I4LD 3GP8A 2YINC 4DCTA 2ZI5A 3PVSA 1Q20A 4DLUA 1Z83A 1OLOA 3BH0A 2WICA 1RKBA 4B34A 4PSAA 4BFSA 3UMSA 3PUVA 3M4YA 4LOAA 2BKEA 2J3EA 2Z43A 1F48A 4XTRA 2FN4A 2QG6A 3RS7A 2WMOB 3DM5A 1XJ0A 1U2RA 2UZIR 5EE1A 3SYLA 2FSFA 1OB2A 1ZNXA 2GZHA 4KVAA 4QM6A 5CLQA 2O5VA 2VL7A 4FMDF 3TMKA 4M4SA 4ARZB 5J4HA 5JLJA 3SN6A 4P0TA 4TLAA 3W9YA 4PHFA 3RRZA 3A58B 4LJ4A 4IOLA 5AJYA 2NQ2C 3GLHB 2FSHA 4DUGD 1UBGA 2AKYA 3RC3A 2O8DB 5E7IA 2QBYB 4BE7B 2NO6A 3THXB 2IA5A 5FTJA 1N25A 1U8YA 1G3MA 2RGNC 2EWVA 1TX4B 1OH8A 2G6BA 3BD9A 4KSCA 1T3SA 4QM7A 3ZS8A 1LTQA 3CIOA 5AUPB 1QHHA 1SGWA 1TMKA 1E2EA 2JCSA 1IN4A 2ZR9A 4JVNA 3P27A 4M9XA 2CK3D 2R6CA 2K5UA 3DMDA 3CR8A 2XZOA 1X1RA 4MRNA 1PLLA 3T06B 1DAKA 4M1WA 1KTVA 1UJ2A 4HUQA 4OI2A 3OFND 1XEWY 1KI9A 1Z2AA 2W83A 1XB2A 3LBHA 2JIZD 4L9SA 2JDID 4BGDA 3ASYA 2N46A 121PA 2NIPA 3A36A 1KI6B 4MRPA 2O0KA 1UBCA 1VYVA 3RABA 621PA 1EWQA 1NJFA 4NCJA 1TQ2A 4KHZA 2JJ1A 4W5HA 2ZJOA 3TW4A 3IKJA 1Z2CA 4TSFA 3SU8A 2UKDA 2GRJA 1P2TA 4E07A 2VLIA 5JWRA 2JLRA 2QAGB 3CONA 3QKTA 3JVUA 4R2IA 1JQJC 4LJYA 2WAXA 2CDNA 4CZ2A 5AR1A 3BOSA 4Q4JB 4CEHB 4C30A 2CCGA 3PUZA 1BKDR 2PLRA 1IN6A 2G88A 3W90A 2W2TA 4MGZR 2IS1A 1XZPA 5KUTA 2J0VA 4KXFB 4QHSA 2O8FB 1GITA 3BERA 2OO7A 4P3YA 4PC3A 3W8RA 5FOVA 2BIFA 1SVKA 4TMVA 3L82B 3GEHA 4C2TA 1KNXA 4NH0A 5FPSA 2BHRA 1GVNB 1YJ5A 1JEEA 4LYHA 3NTUA 2GJ9A 1U90A 1WP9A 3KJHA 2AWOA 3PEUA 4BFXA 1G8YA 4LPSA 2ODBA 4WZAE 4DLTA 2I4IA 2PX0A 2VF8A 2WPDA 1ZM7A 1YR9A 2CLSA 2J41A 3S1AB 4YQFA 2O8EB 1ZD1A 4MKFA 2IYSA 3FTQA 4XWKA 3GJ4A 4PAMA 5GJCA 4DCSA 1OHHA 1U9IA 5FH9A 2VHTA 3QXXA 1EFHA 3V4RA 3U5ZB 2VH5R 3AB3A 1SVSA 1Z29A 4R2HA 3ZH9B 2R62A 4A2PA 5G53C 4QBIA 3BB4A 5KU1A 2YWGA 1AM4D 2FMXA 1IN7A 3IBGA 4A15A 1ZBDA 3P20A 2HCBA 4MKGA 2FFAA 3LY5A 2ANBA 2ZSFA 1KZGB 4GPTA 4Q1FA 1QG4A 4P4TA 3W6OA 5E3HA 2X1VA 2HJGA 4QGHA 2WVJA 1U0LA 4HB3A 1A1VA 1O3YA 5KDDA 1LB1B 3EPHA 1UKZA 4DT1B 1F2UA 1P62B 4HDOB 3N2IA 3SJAA 1K5GA 1RIFA 2B92A 1D9ZA 2GJAA 3TAUA 1QHSA 3RANA 2D74A 4D25A 1QHIA 3GJ3A 1E79A 3EIEA 4IRUB 1FP6A 2V6IA 5HZHA 4NDZA 4M53A 3B5JA 3EC2A 4RKFA 1M7BA 4LHVA 4PX9A 2V54A 4RD3A 1RRCA 1N0UA 2XEXA 3U7EB 4B6FA 4YXWD 2X2FA 3U60B 2FGKA 3SEAA 4PC7A 2YOFA 3SFZA 4LJ9A 1F6BA 2YYZA 3ZZTA 3WY9A 4C7OB 3VNUA 2ZI3A 3FGNA 5IDVA 4BZQA 3QXSA 4NCHA 1N6PA 4X8HA 1S2MA 1WE2A 4JLOA 2BVNA 4O3MA 2GJKA 1E4VA 2FV8A 1R2QA 3QPWA 1XXHA 2AK2A 1ZMXA 3IGFA 3EIHA 3MWJA 1N3BA 1JI0A 2ZR0A 4JLKA 2HV8A 5SZIA 1UPTA 2VHJA 4TQAA 4NPHA 3VR5A 2QE7A 2OBLA 4QG7A 5G41A 2IYZA 5DGXA 4B71A 1IHUA 3FFBA 1ESMA 4G3XA 4M1SA 2BBWA 2ZE7A 2QRZA 4HB2A 2ZETA 3RSLA 3GLIA 2IT1A 4US2R 3KJIA 2MSCB 1VPLA 4RFVA 2NMVA 1EX6A 1T5IA 1N6KA 3EC1A 2YV5A 1S8FA 3GFPA 5JEDA 3UKDA 4PAOA 5JRZA 5JJLA 3WHLA 3CPEA 5CB6A 3QKUA 4EKDA 1F3OA 4ESHA 1EWRA 5HZKA 4LI0A 3QOFA 1OXVA 4QNMA 2DWQA 2OV2A 2E1RA 1GZSA 2XSZD 3QKRB 3RS0A 2VP4A 4KODA 4A0HA 4TTPA 2GKSA 4G5SA 1U8AA 3R7WA 1X8LA 5AJVB 2QU8A 4HZUA 4RVCA 3SJBA 5L3QA 1ZUIA 2QPTA 3U6BA 3QSYA 2IYTA 2N1BA 5EP1A 3SHFA 1TEVA 3MUFA 3GLFB 3I5XA 3D6TB 4B35A 3P4YA 1P9WA 2FE4A 4IHQA 4AYXA 2VO1A 2ZIAA 5LD2C 1NN0A 2GAOA 1SULA 3MD0A 2P3SA 2WWHA 3GJ0A 4OHWA 4HAZA 3ZIAD 3SR0A 1XZQA 1N6IA 2F1RA 3GEIA 3PG5A 2WHXA 3VR6A 5FOXA 3CNLA 4MITA 4FWTA 1OXTA 3SBDA 1LVGA 3B1XA 4HSEA 4B44A 1XX6A 4WXRA 4XD7D 2YJTD 3VAAA 1FQJA 3NHAA 1DS6A 4BLRA 1KO4A 2PZEA 2GCOB 4NMMA 2VP2A 4XSHA 3TJZA 3HU2A 1BIFA 3K0CC 1CRPA 3DVLA 3G0HA 1ONBA 2ZSDA 2HUPA 1NVVQ 3GJXC 3RSOA 2ZRFA 1U0JA 1RYFA 1SXJA 2PJRA 2VP0A 1R5OA 3DOFA 1MRSA 1CJUC 4JBYA 1YZKA 1W7AA 2V9PA 2VHUA 3T61A 4XVRA 3R9IA 3CNNA 2GTPA 4P4SB 4Q03A 4D4LA 1E2HA 3BFXA 3QQ5A 1E9DA 4GZMA 2AX4A 1GWNA 3CRW1 1W4RA 3LBIA 2RH5A 4OKSA 1II8A 2IS4A 3CPHA 1ANKA 4JJZA 3NBXX 3EPKA 2OLJA 2IW3A 2EU8A 1KKLA 5DHFA 4DC9A 4JLNA 2IUTA 1R10A 3PV0A 2ZREA 5FL7D 2CK3A 1AS2A 1DAIA 3VMFA 3NXSA 1GKYA 5DIFA 1JJ7A 1KMHA 1UBFA 2VHQA 1P72A 2W2VA 4A8JA 3OFNA 3LLUA 1XCGB 4HUTA 3K0AA 1TPZA 3FMIA 1G8PA 2FEMA 2FZ4A 2WJIA 4AIIA 3NKVA 2XXAB 2J59A 4TN1A 2IWHA 2Q9CA 3MWYW 1GM5A 2F55A 4Q00A 2J1LA 2AFHE 2IEYA 2GZDA 5F3WB 3IEVA 2AN9A 1MR3F 3QXCA 5FUYA 1CU1A 2C9YA 2OBNA 2PEYA 1BYIA 1VHLA 1FUKA 1KDTA 1CF4A 3WBKA 2DY1A 3O47A 1C4OA 1S1MA 2CHVA 3REFA 3CRMA 4OHYA 3C41J 2Q9AA 3ZS9A 4LJ7A 2NOAA 4YLGA 4C0QC 1N2CE 2EFEB 4IOKA 1KAOA 1RJ9B 2GXQA 4JLVA 2BJVA 1RPZA 5C4GB 4KFTA 4LDJA 1OKKD 3EZ2A 1FTSA 3IO3A 4B73A 5AK0A 4Q4AB 4FXPA 1R0ZA 3WRYC 4YMUA 4ZIRB 1T0JB 4ZCLA 1NY5A 5CB8A 4ZDWA 2J45A 1QZXA 1XD8A 2OAP1 2IUUA 4ITRC 2ZYWX 4OQXA 4NCIA 2SHKA 2YC4C 2ZSBA 5DI3B 4US1R 4ZDIA 5DNYB 4WOPA 3CH5A 4UQOA 3SC3A 1RRPA 4ON9A 5DYIA 5FBQB 3LFUA 4M1MA 2ZRLA 2ZJ5A 5TARA 2O8BA 2ZJBA 5KNCA 2J7KA 3DO6A 1E2IA 1IBRA 3SI7A 1CLUA 2J46A 3X1ZA 1AQYA 2C98A 2F1IA 2P65A 4URUR 4NYJQ 3Q9LA 2OCPA 1EG7A 3AF3A 4B47A 1E94E 3C8UA 5C4MA 4GOKA 1HTWA 1T9HA 3EXAA 4MUBA 5SZKB 2QUZA 1T8UA 1VYTA 3O8DA 4WVFA 2DFNA 1XTJA 1Z47A 2F9LA 4C3ZA 2KWIA 2VP5A 1IJFA 2WTUA 4R71A 2V4ZA 2C9OA 4N3NA 4NCKA 4ZDJA 521PA 4UKDA 1B23P 1PV4A 1T6NA 1SVLA 4Y0VA 5JWHA 4MYUA 2ZJAA 4NYIR 1BS1A 1U94A 2F1JA 3K0EA 1OFTA 3QKSB 1ZU4A 3W3AA 1TQ6A 5IT5A 4D4MA 4NYJR 4PFSA 1XU4A 1CR1A 2Z5FA 3TUZC 3THYA 3V4FA 1E9AA 2J0UB 721PA 3BK7A 4OL0A 4IOJA 1LS6A 3ECCA 1Q21A 1YZLA 4K46A 2I3BA 3WMGA 2VP6A 2WWXA 4AKGA 5G3ZA 3RRMA 1MKYA 2AK3A 1UDWA 1L4UA 3VU9B 5F9FA 1MOZA 4AWXA 3VTKA 4O0MA 2HT6A 1KHTA 1T8TA 2P6NA 4WZ6A 4ZCMA 5JHHB 1YE8A 1Z5ZA 2XZLA 2CJWB 2BCJQ 3ND9A 3QEOA 1E4YA 2FX3A 3H86A 1XP8A 2BMFA 1E9SA 5JECA 4RD2A 2H16A 1DG1G 2B6HA 4JVLA 1D6JA 1P2UA 2RHDA 5DN6D 3KTAA 3QXJA 3I73A 4A4DA 1KOFA 1WBBA 1XJQA 2QN6A 3B1VA 1YHNA 5L8VA 2ZI7A 1UM8A 4JS0A 4OHZA 1EFRD 3GLGE 3ICEA 2R44A 5IF9A 4I1VA 4IEIA 1OHHD 1SVIA 2GJSA 4PQYA 3Q72A 4KYUA 4MQBA 1GNQA 4LYJA 1PUIA 1WA5A 1VDZA 4ILEA 4RZXA 421PA 1C9KA 1M8PA 1QF9A 2IXFA 2IYQA 2WV9A 3NHBA 4MDEA 1DELA 3IQWA 3TH5A 2HT1A 1FX0A 4ZKEA 1FNNA 2VSOA 2XSZA 3LO5A 4CW7A 1HT1E 1SVWA 1XTRA 3KFXA 3CB4A 1IONA 5LDDC 1IY1A 3U4QA 1S96A 3T1VA 4C9BA 3KUCA 4BZPA 1BOFA 1A2KC 3LQRA 4FINA 4B3DA 4C0JA 1XEXA 1U99A 1E32A 4URXR 3GEEA 4Q66C 2JLQA 2VBCA 2QPOA 4XJXA 3RS2A 4DLXA 2W0MA 3P26A 5ELXA 3E1SA 4OK5A 1OXUA 4V03A 3IEUA 3ZIAA 4EJSB 2BMEA 4IKEA 3H84A 4YMSA 3SHWA 4CEJB 2B21A 4F38A 2H57A 1RYHA 4PPQA 4JYBA 2XITA 1W2HA 2F1HA 4LYAA 2VSFA 3BC1A 1E99A 4QKQA 2A5GA 3W5IA 4DLWA 2AD5A 3BH6A 1K6MA 4XD7A 2GCNA 2YNMA 3PUYA 3NH9A 4X8OA 2CE2X 2I1VB 3W3ZB 3J81k 2QL6A 1ZJ6A 4ZI2A 1CJVC 4W7SA 2AWNA 1DAMA 1NN5A 4N1AA 4I81A 4KAXA 2F7SA 3GD7A 1Y63A 5CM9C 4AI6A 2KBEA 4NZYA 2DWOA 5FPHA 2Q21A 1N6NA 1FNMA 3V00A 1HE1C 1JECA 2ZEJA 1F2TA 3GJ5A 3WNDA 3UPUA 4G01B 1TF2A 4JIMA 1S9HA 3CWQA 4ZO4A 2ZXUA 4CEIB 1ZNWA 4BLQA 3LVRE 5GJVC 2IS6A 3R20A 1G6OA 1WXQA 4OK6A 2C2HA 2CLCX 3N70A 1KGDA 1XMJA 1ZC3A 4NBSA 3RVBA 3RC8A 2JASA 5AUNB 1N0VC 3K70B 4B2LA 2ODEA 1ELOA 3CX6A 3TLXA 3DMNA 2IYLD 1U8ZA 5FL7A 4OI4A 3WP1B 1EFTA 2QA5A 1G8FA 3C5CA 2OAQ1 1VIYA 3A8TA 4PZZA 3UIEA 4OQFA 3SS8A 1G8GA 5BN3A 3PEWA 4PZLA 2QTVB 4QGFA 1YU9A 2FFBA 2RGCA 4A2WA 4B3CA 3BAFA 1Q57A 5IK2D 2Z4RA 1F5NA 4LV8B 4W5WA 1WQ1R 1OSNA 5DH9A 4F91B 1CBUA 1CR2A 2CVFA 4TYWA 1Z8FA 4DLVA 3TBKA 2NO1A 4GL2A 3PCRB 1P9RA 1QRAA 4QHTA 2WBLC 2EFCB 2DCUA 2PZGA 4HEJA 1E2MA 1E69A 1E2GA 1S3SA 1P5ZB 1W36B 4Q7LA 5FOSA 2ORWA 4AY2A 1KSHA 4DCNA 5JS8A 4Q01A 1R6BX 4Q9KA 2QROA 3CZQA 4UNNA 2YOHA 1KJZA 4JLAA 3HDTA 1AGRA 1E1RA 2PL3A 2G1KA 2IK8A 3AP1A 2CHQA 2YWHA 1FMLA 2FPKA 4UXHA 1M7GA 2BJWA 2NTYC 1AZSC 4K81B 4V0OA 2F9MA 5FTNA 5TVKA 4TYQA 4DZZA 3X1XA 5EZ5A 3GFOA 1JR6A 1TUEA 2KBFA 2LCFA 3GLHA 3AQ4A 1AN0A 5DSZA 2BOVA 2E9SA 3KFVA 1OKKA 3PQCA 2O8DA 2QSYA 2UZ3A 5KSPA 2WJJA 3BFKA 3LX5A 3THXA 2GJ8A 2R6FA 5EQTA 1NLFA 4MKIA 4O2RA 5B30A 1AQUA 2VHCA 4IVPA 2PCJA 3A1UA 3B2EA 1N5LA 5CIQA 2ZUDA 2ZS7A 3PIRA 3QBVA 4TTQA 4LPKA 3NBYC 4Q4HB 4DKXA 1UEJA 4UJ5A 3QUSA 1OFHA 1SXJD 2BM1A 3I72A 2ZJ8A 4E03A 4QHYA 5B2ZA 1G16A 4GRAA 2O0HA 4Q9HA 4Q21A 4DEYA 1KYIA 4JL5A 5JJKA 1R8SA 5DO9A 4L4UA 1U9IC 4P31A 1U98A 3RYTC 4C0BA 3U7FB 2CBZA 1Z06A 3BJIC 1GRRA 3LX8A 1Z3IX 3FB4A 2FZLA 4GOXA 2GF9A 1KI6A 5G3YA 1XPOA 3W34A 2EFHB 1GOTA 3QF4B 2C8VA 1XMSA 3QG1A 2AXNA 4KSBA 1AS0A 2CL0X 4BZXA 1G3RA 1ZM3A 1ZD9A 1G7SA 1VCNA 3G5UA 3MJRA 5FR1A 1IAQA 1P3JA 4LBWA 2EW1A 1ZM4A 4M9SA 4V0ME 3VR1A 2QAGA 3QENA 4OI0A 1Q1QA 3SYNA 3ONWA 3ZZ0A 2HYIC 4JL8A 3TKLA 4LCBA 3UMRA 4Q02A 1G5PA 221PA 4Q4JA 4IDNA 1HT2E 4CEHA 2X2EA 4FIDA 1KDRA 1WCV1 4D2IA 2D4HA 2CXXA 3ZLJA 3B7GA 3OIVA 4PO1A 2ATXA 3MAAC 1SKYE 1ZW6A 1XTQA 1W46A 4C0AC 3TK1A 2O8FA 1X1SA 4HLUA 1CKEA 1QDEA 4DSTA 2W2XA 1HEIA 5SZHB 2ZE8A 6Q21A 4TL9A 1DAFA 5DI9A 1KK0A 2FF7A 3SJZA 3QNUA 3FFAA 4LK2A 1XTKA 3GCGA 5EXPA 4JJKA 1NRJB 4M1TA 1RRFA 1KIMA 1II9A 3QPUA 3LXXA 4PSKA 5AUQA 1GUAA 5AWFC 1BMFD 3NBFA 2DHRA 3K1JA 1KY3A 2O8EA 1NLYA 4URWR 1W4AA 3P1JA 4HAWA 1TF5A 3U3JA 3CKLA 1E9RA 1XTSA 2VSXA 3K8YA 4NCNA 5FTKA 2VTKA 3SOPA 4AG6A 4XVUA 3TGPA 4G5GA 2ZRDA 3L8ZA 4FCTA 2TMKA 3B1YA 5DN6A 2REOA 2ERYA 4JT4A 2XOKA 5JZVA 1Q1BA 4D0NA 4F93B 2RGGA 3OEHD 3WYGA 3PENA 2XZPA 3QPVA 4JBXA 1EFRA 3CF2A 4LRWA 3MJHA 2ZYTX 3HJNA 4TWZA 2V1XA 1E0JA 4OQLA 3D8BA 3AP2A 1PJRA 3QY0A 3U6KA 2JLZA 4NYMR 2AD1A 2O8CB 1E2NA 4M22A 1LW7A 2QP3A 1KO1A 2DWPA 3KUDA 1Z6AA 4MDFA 2RMKA 3K53A 2BBTA 4I1UA 4JYCA 2DFLA 1O87A 1FL9A 4AYTA 2PX3A 1ZAKA 3FMOB 1Z07A 3CBQA 1ZIOA 3EA0A 3HYTA 8OHMA 4RCYA 2W6IA 4JLJA 1MO3A 1SQ5A 2MMCA 1X8KA 1E2DA 1S0UA 4PHGA 2IWRA 3AF1A 3GJ6A 3WNBA 4TZ6A 5K8LA 2HF8A 5H68A 1U0HC 4PXAA 2ZROA 3SFVA 5GVRA 5E7JA 4DB4A 3C5HA 2VRWA 4HDQB 2IUSA 2P5TB
chains in the Genus database with same CATH superfamily
4BFLA 3B82A 4KUHA 5LP1A 3F6RA 3KB2A 3PC4A 1DBVO 4FYKA 1E9BA 2B5VA 4C3OB 4B6SA 5EJ9A 3MPOA 4HYEA 1TNDA 1UFRA 2G72A 2AZTA 4JR2A 2FLWA 4WKPA 3SXUB 4BX3A 2CL6X 2B1IA 2RCNA 3C3JA 4IIHA 1T5LA 5FOUA 5CDHA 5EVJA 1AK1A 3AVXA 1EE2A 4NCBA 3OEEA 2QD5A 1QKKA 4JENA 5PGMA 1U2DC 5IM4A 4HAVA 1CXZA 4ROSA 4B74A 1EVJA 4DVJA 3IT1A 3L8HA 1FSPA 4NOJA 1A5SB 4P2BA 4RHTA 3AKYA 5EJMA 3HCEA 4CF6A 4D74A 3I1YA 4GLOA 2EP5A 4I1IA 4QVIA 4LOIA 1PZHA 4MW0A 1XQ1A 3IUNA 4Q7JB 5MF6A 3TTXA 1DUSA 3UANA 1NLZA 3FMFA 5LNK6 1H1TA 4XX0A 1B93A 1UDXA 1SCDA 2H2GA 2R1VA 3ELBA 3IOEA 4C05A 1V1MB 1J9ZA 3K9CA 4YMHA 2VDUE 1VE7A 3SNHA 4Y1RB 2IQ5A 1U7WA 3EBPA 4BP3A 4AURA 1G20E 2F3PA 5C7IO 2CD7A 3B20A 1KU6A 3DZKA 4O2AB 4TUYB 3RV3A 1GEEA 1LPAB 3JQAD 4OBBA 3W2FA 3Q8KA 5DHSA 3R0QA 3S2YA 1R18A 3JAMA 1WCIB 4EVIA 1Z28A 3G2HA 3UB3A 1J0CA 2D2VA 1Y7HA 2BKAA 1WXHA 2BGJA 3ABZA 1EWVA 3F8SA 1I3KA 1J4AA 2LVBA 5FBHA 5HCIA 3HY6A 1R6XA 1KHHA 1HDYA 1OU4A 5EMNA 4I99A 3G6KA 4EVSA 5D5HA 1QGAA 3W4IA 2JLYA 3LY8A 3PFFA 1O89A 3DZDA 3GWGA 1IOLA 4TMTA 3IDZA 3PD1A 3GLFA 1IWBB 1PAUA 2VDNB 5K8IA 4Z4IA 4MS3A 4H3HB 5L40A 5A2GA 1VLMA 1OH6A 3OLQA 2C03A 3GEPA 4FT4A 4MCIA 2CD9A 3DTTA 1D2HA 1NE7A 4NAVA 3D1LA 2AEMA 3DBLA 3PHJA 1J5PA 2OM2A 3PEVA 1FSSA 1PHPA 5EY5B 3RS9A 2H8KA 3VYUB 4LHEA 1O77A 2XBLA 4EGAA 3FDZB 2V6BA 3OLCX 4ZI7B 4RTPA 4F46A 3L7NA 3SX4A 5TT1A 1QYVA 1R7RA 2ZT8A 1HY3A 2FGJA 1CUVA 2IYXA 3GZNB 4CT5A 3RV4A 4ZYZA 3ZJTA 4AMUA 4MQ4A 3T7CA 1M34E 2EFDB 4NG5A 1FDSA 2XQIA 3BH7A 3OTGA 2I66A 2GCOA 4XGQA 4DSZA 2GFQA 3OJLA 4EHJA 1XXHE 4F12A 3ND5A 1KEVA 1XNJA 3IJPA 2DQSA 4L0CA 4N3AA 4S2EA 4WFJA 5FP0A 3ZLTA 1UDAA 1TM2A 4ARAA 1R0XA 2BP7B 4L7VA 2OFXA 5KOIA 2V0NA 4IJUA 2V6FA 3OOSA 2G0NA 2WYHA 1SOAA 3AH8A 1CUJA 4YBRA 4KR2A 5LNK1 2XWQA 3LO8A 5FFFA 4BNFA 5K20A 2EZ4A 2IBSA 2C20A 2W37A 1CQZA 2HLNA 3EEIA 4MVJH 1H1DA 1X80B 2A7XA 2O14A 3AOEA 3H5LA 3KRTA 1Y5MA 3WYFA 4K8OA 1TQHA 3I9JA 2A86A 3BB3A 4E5VA 1QRTA 2ZRMA 3ZNQA 5CDGA 5I8PA 4N8DA 3R7WB 4C7KA 4M2LA 3M2TA 5TF4A 1T15A 4Q9JA 1CZKA 2QRHA 4Y2RA 1OT3A 3WLLA 1H2RS 2PTHA 4FYYA 1AUVA 4F9FA 2IGBA 1T36A 3FJOA 2PBRA 3NC1C 4FBLA 2I9PA 3U3DA 2ADOA 2VNHA 1WW3A 1PL0A 1P2VA 1E2KA 2Y71A 2X8JB 4L16A 1EA7A 3FHOA 4QQRA 4BQPA 5HR5A 1I8TA 1OI4A 4E94A 3TEMA 2W70A 1XZGA 3BJEA 2C77A 5JHGB 1FVXA 3QELB 1QTQA 2B8NA 3PE4A 4AX8A 4RULA 2WFZA 4Y7DA 2QM0A 2FPLA 1Y6RA 5LLSA 4R1UA 4IYJA 4JAVC 4ZMBA 5A3QA 2NX2A 1E1MA 1J8VA 1Y3BE 3UWKA 2VPPA 2J9RA 4HT3B 1IJKA 3A6PC 1NVUQ 2FA9A 4MRRA 1QTNA 3IERA 1YUMA 2KX7A 3JQEA 1UJNA 2A5YB 5C8XA 1YR8A 4Q7MB 1UOEA 4K9NA 1EP1B 5CDFA 4CU2A 4DA0A 2C82A 3M89A 4DDUA 2WAOA 4ROTA 4ZOAA 1FP7A 1GVHA 1YZQA 4HWTA 4P54A 4Y0NA 5ALJA 2WIBA 3DOEA 3NUQA 4HLDA 4HPWA 3T38A 4CN8A 4FCVA 3OPYI 4OHXA 4DCPA 2XRZA 1PZXA 1N8SA 1UEIA 3ME5A 3BB1A 2WJAA 5C7LO 3P9PA 4R84A 3ENWA 2VRCA 2OG2A 4LYFA 3NHYA 3OU6A 5LA6B 3UG7A 4DQVA 3JVIA 2YDXA 1AHIA 3J81k 2G8LA 2DUMA 3T15A 2A1TR 1DJNA 1IE3A 2ZSAA 2JJQA 3A4IA 2GT1A 3MJSA 2VA8A 2XA1A 4IDFA 4LJ8A 1TTHA 3D6UA 2WHPA 4WKNA 1XVIA 2WHRA 3H3JA 3QU7A 4KMRA 4UUOA 1EGAA 3B2QA 4RABA 1E1QD 3X43A 3SSMA 1S02A 4A0GA 2GN9A 1E1RD 1NI5A 1E7QA 1IBCA 1MG0A 1O94C 2QQ0A 3F98A 3CLVA 3FDFA 4OUDA 4EW3A 4IM7A 4DV6B 1C9JA 1J0AA 2Q0QA 2YW2A 4R83A 3DAOA 4CM4B 4YUYA 5A4MS 1ZXLA 3RAPR 4CL2A 4EUKA 3V46A 4JVOA 1VIAA 2QSJA 1CV2A 5LVAA 1VMIA 1KZHA 2RI0A 4UTNA 3HKBB 1CQJB 1FFYA 1L5WA 1SKQA 4FN5A 4IXDA 3JD0A 3D3QA 5CG2A 3H11B 3TYXA 2R7AA 1P6QA 5L3SB 5G40A 2A67A 1NU6A 4C0XA 1MIOB 1XTZA 3T1TA 1FUUA 4L4ZA 3PYMA 4LOLA 2WM2A 4DCJA 3F6YA 2HU2A 3IXQA 2VZEA 3AFIA 1Z6YA 1KZ1A 4G89A 4EO7A 4IDQA 2EKQA 3KSDO 3RHTA 5C8DA 2GCGA 3EA5A 3UK0A 1M7HA 1ZH6A 1A5TA 2I3AA 3OEHA 4UBOA 3OUUA 2IODA 2PUTA 5DDIP 1M0TA 4NNPA 1JQLB 2OM6A 3QPBA 3OF5A 1GL3A 1ENYA 2VYND 1E89A 3HACA 3MERA 3EZ6A 4FD2A 4X94A 5BOSA 2GDJA 5IKEA 3GELA 3CLKA 4HN2A 3DZ8A 4H9GA 3N0RA 4XUGB 3HJHA 4FKZA 1AMNA 2IV3A 3MCUA 4DDWA 5JMOA 2WDZA 4OJKA 5DYGA 3EYWA 3AX6A 4ZEOA 2PS1A 1FLAA 2GF2A 1MO5A 1PGPA 4O63O 1QG6A 2FW1A 2GAIA 3ANSA 1V6AA 1QAMA 3E3OA 4PYMA 1VSQA 2MIIA 3L2OB 1RPNA 3DMYA 2FCAA 1R9MA 4FEEA 3ZW7A 4CNBA 5H4GA 3QKSA 3BT7A 4YAWA 3EAQA 3OCUA 3RYFA 3EFBA 3OM1A 2NPOA 3ANYB 4L6IA 3BE4A 4BMOB 1WB5A 5EXTA 1L4KA 2W58A 3EFHA 4RVFA 1FUYB 2C07A 2H3EA 2CMKA 2QTNA 4QELA 1XNHA 5FNVB 4DY4A 1TTTA 2Y99A 3CINA 3FD8A 4X6UA 2QQEA 1CJMA 3LLVA 4EHLA 3MBOA 1QPGA 3ADPA 2VZ8A 2QUHA 4EW2A 1CC1S 3AF0A 3SE0A 4YPOA 3ZOZA 5FBKA 3MILA 2RK3A 2RGXA 2JAUA 4RVDA 4GOMD 1N7HA 3G1UA 3Q9UA 2CFTA 4PTLA 4QEZA 4YT5A 3HUDA 1DWUA 1BCSA 2BWJA 2VWQA 2D3WA 1H93A 2H5EA 2O6LA 2YX1A 4BY9E 4PF1A 4NMLA 3NHFA 1AZLA 1NVWQ 3LFTA 2ZQ5A 3OESA 1VE6A 3HDHA 4YUXA 1A2BA 2GVDC 2IZ5A 2NYVA 1G0OA 1OLSB 2CDRA 1M8FA 2H5IA 2VCEA 4YEDA 3TSZA 4A91A 4BRZA 5TQJA 5HK9A 1W75A 2CJFA 2ZSHA 3MT9A 1N4AA 1RXUA 3SX2A 3ZK9A 3UK7A 1U9ZA 3UWOA 1OFIA 2WLSA 5F9MA 3V8MA 1KIAA 3LECA 2LCIA 5ED4A 4TL8A 1BE0A 2AG0A 1N6RA 3IPXA 3MXOA 2GM5A 3PF8A 3IVXA 4UDOA 3E3NA 4LVNA 2XMZA 1DRKA 3FUVA 2H2FA 5EZ6B 4AMZA 3UG6A 1G2OA 3USES 3HN7A 3SC2A 4LZNA 4M1YA 1E5QA 5IJ0A 1NKTA 5CK5A 4PYRA 4MR7A 4MB2A 1U3VA 1XUOA 2P5UA 1Q17A 1PR3A 3AEUB 4BVLA 2JJMA 5K8UA 1ZHHA 1NASA 1SUIA 4WXPA 3DKRA 2QL9A 3N2KA 3MS2A 3IPRA 1YQWA 2IYWA 5MFZA 2OBXA 3U5TA 1G8SA 1DX6A 5D3KA 5SYAA 2VCYA 4G85A 1EXDA 2WW8A 1DQZA 3PF9A 4NCXA 4TV8A 2XQFA 1TL7C 2GPTA 1GKUB 5CX1A 2GM3A 1U2TA 2I8LA 3TVTA 2D4AA 4XWYA 3PWKA 4PQGA 5J3JA 4QYWA 3V8NA 1DIGA 3GNTA 1SCIA 3E4DA 3I8XA 1BXGB 3SF8A 1GP2A 5H59A 1FVHA 3SBOA 5EOVA 1OGIA 2SKEA 2YVAA 4ZPJA 1HEUA 3AY6A 4INPA 1OBHA 4NKRA 3OLZA 4XFKA 5IF3A 2PE5A 2P0EA 3HWWA 4HXFB 1CB0A 1LGYA 1POXA 1QZZA 2FDXA 2JA1A 3CWCA 2PLNA 5A5GA 1KZYC 2P2LA 1PT9A 3BBPA 3T35A 4PXSA 4HQ6A 3GQBA 1FQWA 5HTKA 2QE6A 1C9MA 2WWIA 4YMTA 3K20A 1E8MA 3B7WA 2RGDA 4IDHA 3VH2A 5HJ7A 5JNUA 1BE1A 1C30B 2FB9A 3H9GA 1Z63A 3FMPB 3KSRA 4C6TA 4H1VA 1NPTO 2ISSD 4MHSA 2A5DA 3IUPA 3LQ1A 3RE1A 4JLSA 2GK7A 1VOTA 3OQNA 1HFJA 4NMWA 1KWGA 1V7ZA 3G7UA 4C4OA 1XZAA 5CCXA 4U0JA 4KFSA 4GZ3A 4LYDA 3TTSA 2VIIA 4CV0A 4JXXA 1ACJA 1Y6FA 4B43A 3AUYA 1FP4B 3HVHA 3UM9A 3EZFA 1E58A 4HADA 2H5LA 1ZM9A 3N2YA 4LXQA 3WYDA 1A98A 1SBQA 5IVIA 5LZ8A 3QBEA 1YOBA 1JYSA 4FBMA 3UMMA 5IRCD 3U56A 1NVKA 4HN4B 2CL7X 1PNRA 4DLYA 2W2KA 4MGEA 4AUMA 2XWSA 4OLFA 1HQCA 3E5NA 4D97A 3DW3X 5LJLA 3MAJA 4CEIA 4XWTA 2O2EA 1FX0B 4RTJA 3DTYA 5IH7A 1N34B 1QCYA 4BL5A 2WWFA 1OX4A 2XD9A 1GV0A 3IDAA 4OHKA 2I2CA 2QV7A 1USKA 1UBJS 3U16A 3K94A 1P61B 5H3HA 5AW1A 1GT6A 1ORWA 1XIVA 1H3FA 1P60A 4NZZA 1PKEA 5I9TA 5KREA 1GGNA 4RE5A 4IJ5A 3W9SA 3S8YA 5CVCA 1VXOA 4IICA 2ZB4A 4KQ6A 1MHTA 2VTEA 3E9RA 2P9FA 2YV2A 3BDAA 3PA8A 2I2DA 4KW7A 3B89A 4DWJA 3BS4A 1KDZA 5BPHA 2R8YA 4DNQA 4IMRA 3IIKA 3ROQA 3LP5A 3HP1A 5LLDA 1ZINA 3ZIUA 3VR3D 1AF7A 3OPYB 4ZQBA 5IN5A 3U7RA 5JSKA 4BCCA 1C2YA 3HJUA 3EVFA 4OHOA 2NU8A 3U4CA 4H60A 1A04A 3C6QA 4U6SA 1COWD 3OX4A 3A1TA 2A9RA 3GLQA 4GP7A 1WETA 2QT9A 3CTMA 5LP6F 2PV0A 1TEXA 1WMSA 3C2QA 3FPAA 5KU7A 4G0MA 1OXXK 1NXPA 1T6ZA 1X19A 1XVVA 4D9FA 1SM4A 1NWHA 1H2FA 2QAGC 4II7A 4TRRA 1QR6A 2CZQA 2WG0A 2J0SA 3K0FB 4OFWA 4K6HA 4N7BA 3AFHA 3NH6A 1M2VA 3TXYA 1D03A 4U2GA 4KOEC 1W5EA 6PFKA 4R7ZA 4YMGA 3O84A 3KR1A 1RNLA 4DXAA 2AJCA 3PNQA 3EW9A 2IYYA 3FUXA 4J7XA 4RAQA 1QC5B 4D92A 1Y8QA 2R7KA 2AEJA 1YV9A 3CNQS 3SR3A 1FQKA 3PNYA 4MYRA 2JLUA 2O05A 1A9SA 3DEFA 5DXJA 1K2WA 5AKGA 2ZANA 3GMTA 3ZY2A 2I4OA 1E1QA 3PPYA 2X0JA 4HC4A 2C96A 1UL1X 2VBFA 2X4LA 3HFGA 1YUNA 4O5OA 5AUOB 4ARZA 1PG2A 1EP2B 4Q4HA 2ZUBA 2Q29A 3BXXA 4WDQA 3IYLW 4WHMA 2Q3FA 1MJNA 4IZOA 3F8TA 2ZTSA 3R3UA 4BNXA 4ZCIA 3VU1A 3R5HA 4NS4A 1TJ4A 2Q2QA 5EP2A 3OPNA 2QR2A 2UZ1A 4GBGA 4Q12A 3IVGA 3PP8A 5FV4A 1RABA 1CIVA 3O94A 2QD2A 2X4GA 4I1RA 4I3FA 3U3OA 3VPDA 4ALNA 4PIPA 1QU3A 5K4AA 2NU9B 5JQGB 1PJZA 3FUUA 1XCOA 3KK0A 2DYKA 4IO0A 5DMHA 3T9CA 3ZVRA 1GL9B 2D1TA 3W5DA 2H4FA 1X7DA 1QG0A 1QB7A 4R54A 1U3WA 4LFCB 5D3MB 1YZVA 1JQ3A 4GBJA 5DHAA 3TZEA 4M46A 4E32A 2I91A 2VYNA 3MSCA 2QNIA 4JX8A 5IS2A 3GUVA 3UAOA 2D0PB 3BIXA 4H4EA 4HH3C 4DIOA 3LQQA 4Q3EA 4UBKA 1MGOA 4JUDX 2JJ2D 1HFKA 2JAHA 2IPOA 3A2MA 3R0ZA 4R2WA 2ECKA 4EZEA 3O8CA 2JLXA 3O8OB 2ZUFA 3JWGA 1FYFA 1ECGA 4WERA 1EZ1A 3DNMA 3ST7A 1Z35A 3FPLA 1GLNA 2Z8YA 4PC1A 4IWXA 5J4VA 1FQOA 2QVXX 2XKAA 1MXHA 2PEZA 2DT8A 1R5NA 1U0GA 1ZL2A 1WLYA 2QTHA 4MKHA 1P2SA 3PR1A 1FTWA 4KQEA 1H6CA 5DTQA 3KLOA 4U8HA 2XMDA 4BNUA 4MYCA 2ZRPA 1G8HA 1TYDE 4JN6B 3C3KA 5L3VA 1X13A 2FEAA 2X13A 1DZIA 3NOXA 4N4AA 5B58C 3LK6A 3A4LA 1DIBA 3B48A 3FX2A 1TD1A 2ONKA 4TYPA 3TUJC 3ZX4A 4JI2B 3I53A 1SIOA 3B38A 4LXTA 3X2FA 2TSYB 1EVIA 1ISHA 4ETIA 1G291 1PGJA 2QMHA 1VKOA 2FK8A 1T9KA 2WV7A 4UVEA 5JZ9A 4LJKA 3PA6A 4TZKA 1GZVA 1JEYA 1VPEA 4RK6A 1ZRNA 5I9NA 5AW0A 4B48A 3GLHE 4LMAA 1LRKA 5BP7A 3VDXA 3MG9A 3PPVA 4BKMA 4EUHA 4WZAA 4MV9A 2GPWA 3S8MA 1N0HA 3JTMA 3KOYA 4PLWA 2I80A 4D8TA 4YCAA 2R97A 3NAQA 4JI1B 1V9LA 3GYGA 2V4MA 5EKUA 2NU6A 3FLMA 1WZIA 2VR1A 4W5QA 5LB2A 4WBNB 1LC0A 2Q3MA 5A9SA 3CRVA 1F8FA 3HMQA 3P9YA 2YIVX 4GMKA 1KMNA 4GPEA 4LA4A 4YGXB 5ANRB 3T3OA 3TTUA 2M9MA 4R7GA 3DB2A 2JFXA 1ZOOA 1MAWA 4HZIA 4LHYA 1PSDA 5HDBB 1Q44A 3ZG6A 4CN9A 3E48A 5U9CA 5EAIA 3TVDA 1YBHA 3PX7A 3CFYA 3H17A 3DE0X 2VHWA 2P2YA 3QEMB 3CRNA 4J6EA 2IV2X 3HYLA 1H65A 3BE8A 4AQDA 5AI9A 3NRBA 2C5SA 2AI2A 2DMRA 1KYWA 2PVPA 3PQ3A 3QW4B 4HUQB 4W1QA 4IG9A 3S1AA 3TKYA 4MV7A 4CL8A 2UYQA 2CEKA 1PQWA 3OQIB 1RI5A 3R3WA 3G5LA 4RY9A 2NUTA 3VVLA 4FDVA 1QV9A 5FHRA 2ZM6B 1OOEA 3SDSA 1R15A 2O8CA 3FJ1A 3RFVA 1KJ8A 2IY8A 3FW1A 3IULA 4OYLA 1DEOA 3MTQA 2C88A 4P8RA 4ZO8A 1E6MA 4YQEA 2JLAA 3HVJA 2P0AA 3BDIA 4AAYA 5KX5A 4L2IB 1PJBA 3QEJA 4LWZA 2XB2A 1MB4A 3FUCA 1HDXA 4G4SO 4DWVA 1YS1X 2QRMA 1Q6ZA 3HXPA 3CF6R 4B85A 1EJ0A 2B8WA 3LMKA 2PZFA 5E4TA 3RSSA 1ODJA 1K6XA 4IJMA 4F72A 5DBIA 2OECA 2HA7A 3AZQA 1XZMA 4RE6A 3TSAA 4B7CA 4BQIA 5I51A 4QL3A 1JHQA 2WJPA 4LSGA 3E70C 9GPBA 3OE5A 2R65A 5ENZA 3BGSA 1RZRD 1D5CA 2DLNA 1L9XA 2I4RA 3P2OA 4V1CA 4TTIA 2DQZA 1RJWA 4RC9A 4XDGA 4EPVA 5REQA 1J6UA 4O8CA 3LBAA 2Y0BA 1LF5A 4A2CA 5I7EA 1P2DA 2NT3A 4NU0A 2DR3A 4YRRA 3TM4A 4PYKA 2CUTA 3CNHA 3A32A 3UK6A 3ZQUA 4KDFA 3T1NA 4A82A 1IZZA 5GVSA 4MP8A 5A6VA 2WG2A 2W6PA 4LY6A 2AJLI 2OLKA 4U5XA 2CNDA 4R41A 4BB0A 2D5LA 2HHCA 3QVVA 1E4EA 1GPMA 4JZKA 4QTUB 4C7BA 3C97A 1YQ9A 3CZ4A 5BT9A 4UHBA 4BB5A 1SBCA 3ZC3A 5EI5A 1DHRA 1K3UB 3IIIA 1SHTX 4Y2UA 1PJQA 2BEUA 1L7PA 1MAVA 1Z4MA 3MD9A 1MW9X 4POOA 4UC0A 1L8OA 1SELA 4DIUA 2Y9PB 2XUDA 4HGRA 2OSBA 2PAFA 1IY0A 1C3JA 4LECA 3TB4A 4OJNA 2VJKA 1NDHA 2XR1A 4HBGA 4MS1B 5BXYA 4BJ6A 4JI8B 2IUYA 2H2HA 3PI7A 5H70A 3MRXA 3PUKA 3Q5DA 4H7HA 1WKVA 4NOLA 4DADA 3GOQA 3WGKA 3OZEA 3AOEC 3ZBPA 4FYVA 4Z0TA 3V1NA 4GNKA 2IBMA 4G36A 2ZRBA 1KK1A 4CQLB 1L7XA 3FWPA 2W0SA 5AVUA 4S1VA 1SCBA 1VE5A 4XYGA 4AS2A 1SXJC 1V7PC 1VE3A 4WZBE 5ALKA 5LUBA 4AF8A 3BWEA 4PZDA 1GT91 2XEDA 4G6ZA 1F2UB 4E12A 3LHIA 5CH5A 1QH8A 4KJZA 3MPUA 2VHYA 3DAPA 3B36A 4NU5A 5L7YA 4IDGA 5JSYA 2ZQYA 2I1WA 3IVAA 1MFPA 2C7BA 5AJHA 1X2EA 1AD2A 1MXFA 1O97D 3VR3A 2I55A 3I62A 4AO6A 1O57A 1XLUA 5G4KA 1TZKA 1FOEB 8ABPA 2ES4A 4AFNA 3DZCA 2NO7A 3T7IA 3IXLA 4RGYA 3K30A 4IZ6A 1COWA 1EQ2A 2PRIA 3WB0A 1WZEA 3TSOA 3DKVA 3OPMA 1N2IA 4MZDA 4BRUA 2H1RA 4OSOA 3ZOKA 1Q7RA 1KJQA 2VJMB 3DL4A 4W9RA 2EW2A 2HREA 3JVVA 1YRQA 3KXLA 3O03A 4LUCA 3TRHA 4C0WA 2JGNA 2GCIA 4I1SA 2F62A 1GTJ1 4YASA 5EERA 1BA2A 5ALSA 5H9VA 2X5XA 1T13A 3LC2O 4CLHA 1NQXA 3T1OA 5GIOE 4XJVA 4KITB 2FMIA 4FCWA 4LS3A 1GCIA 3H2SA 3ZWCA 2BCGY 3NEPX 4RCZA 1EE9A 4YFVA 4KRFA 1FDIA 4KXVA 1Z6GA 2HHJA 4F92B 4PW0A 2W6OA 3F90A 2HRCA 1XPRA 3EXG2 1IPHA 2VXCA 3NTRA 5G1PA 4KJXA 2HQ1A 4Y9DA 3QVGA 5FPYA 3L79A 4Q4DA 3GW8A 3PFKA 4QQFA 4XM1A 4ZVKA 2PWAA 2QY6A 1I1OA 4DJDC 3LXUX 1MZPA 3GLIB 1S3GA 2GNOA 1XSEA 1WHTA 3D0QA 4XWOA 4F04A 3FNHA 2CHFA 1M8GA 2KB0A 1CUUA 4Q7KA 2O0JA 2YS6A 4FDTA 4ZVVA 2NVOA 2QP9X 5EIBC 4URYR 4ZCQA 3KHSA 2DX7A 2JAWA 1ZRHA 4WFIA 1YKFA 2Z83A 1SCNE 1CQIB 1VKNA 3PICA 3DQQA 4UREA 2WTXA 2VPQA 1F9EA 1OC2A 2GERA 3AL2A 3BRCA 1XFAA 3ASZA 5L51A 3EGXB 3PDUA 2ILTA 1M67A 1ULHA 2JCYA 2ZYHA 1IULA 2GNPA 1ZD3A 2WVAA 4JLWA 1V11B 1PWYE 4TLBA 3NTVA 2HIMA 1AHHA 5ERYA 3VKWA 4N3GA 1LY1A 5K3BA 4IL5A 2GBCA 4KMOA 2I2XB 4N5MA 2DT5A 4JUFA 2R0QC 2RHWA 3WTCA 2O5CA 3RBZA 4TKLA 1MMFB 2WTAA 3IR6A 1PJSA 1P73A 3SJCA 2OCKA 4BBJA 3AF2A 5C1PA 2IFTA 5EIWA 2ZIXB 1KH2A 4I5DA 1IUOA 5E1BA 2FR1A 3ENKA 5AT1A 3TOZA 4X97A 2PT5A 4EHKA 4JDPA 3ZZUA 3RUCA 4XLTA 2A14A 1SCKA 3L8YA 3MIIA 2ZRHA 2WYUA 3KSMA 3WK6A 1KTIA 5HGXA 1MOQA 1P7CA 3AGQA 2REXB 3HA2A 3OHPA 3ZD9A 4P7JA 3PTAA 4CMBA 3NEYA 3HRKA 3SSAA 4Q0MA 2ZT7A 4MR8B 1EPUA 4DUPA 7MHTA 2BR5A 2H4JA 2CHUA 2WMDA 5DE3A 2GTHA 2D62A 3T3IA 1XPUA 4L0DA 3KKQA 4Z6KA 4E5UA 4XIGS 2OBFA 3L7AA 1B73A 4UNQA 3Q7PA 1K06A 1N2CA 4MR9B 5FB3A 3P0IA 1E0KA 1DFIA 1UFKA 2GAFA 1LLQA 5FOQA 4BVBA 2DUNA 3WK9A 1Z22A 2DP4E 2OORA 3HPRA 4Y30A 1ZDMA 1C4WA 4YQZA 3NX4A 1A69A 3E3LA 1JBKA 3M1YA 1PKXA 1HURA 2SKDA 3HJCA 5FUVA 3HVRA 3BHNA 1JSXA 5IMBA 4GI7A 3UJDA 1I5RA 4ED9A 3M6AA 1L5HB 1AGPA 1DE0A 4B3SB 4KU4A 4X1KB 2BHTA 4FC6A 2Y1FA 1QHGA 1N2SA 1A71A 2I7TA 3UJ8A 2BFCB 3DL7A 2G63A 3GLUA 2HYDA 4X0EA 1SU6A 1XTUA 3W6NA 2IOQA 2YKGA 1DHTA 2C2MA 4RTNA 1MJFA 2VRNA 5TMPA 1II8B 4DLRA 4R9UC 1KPGA 2C2OA 2JDIA 2XYPA 5C37A 1LXCA 3O92A 2WUFA 3H19A 4GBMA 4BO9A 1UWKA 4QGGA 1N1GA 3FAZA 2FX2A 2A0KA 1F8XA 2ISQA 4K9RA 5AKIA 4MW6A 4OMCA 3HHEA 4BMDA 4FI3C 4WK6A 1VJ5A 1M2KA 3LRTA 5AQ1A 5IXJA 4TLLB 4MQLA 5DI3A 1WR8A 2F1KA 4L4XA 2DULA 4UTOA 4YJ3B 4RY0A 1V39A 4CM8B 1WB9A 3CS3A 2ZP1A 3SE7A 4YRSA 1I3MA 2JLSA 4EDHA 3WGUA 1C0PA 3ULKA 5DPMA 2V0GA 3K0AB 3OQBA 3DE7X 1AKQA 3NKFA 3UV7A 5FUQA 3KXKA 3NBMA 4B4DA 1KP2A 4DIMA 1NJGA 1G9XA 4Y6LA 1DC8A 1USVA 2ACWA 1ZM2A 3GHHA 1L8QA 4KP7A 3TZHA 1SUPA 3UAYA 2AUMA 4D6PA 1JPNA 1X1CA 2ZYSA 4GECA 4P32A 5JSZB 5LWQA 2C4KA 3I5AA 2HIHA 1R6AA 1XVTA 2L82A 2W2OA 3MJDA 3VPXA 2Y0EA 2D7DA 1WF3A 2FFJA 1KK2A 5BVHA 5CFOA 5KNBH 5DBGA 5AVWA 4UBIA 3VA7A 4RHFA 5C9ZA 3KUKA 1PTKA 3LUJA 3OX2A 4DPKA 1N6LA 3LUPA 5ALRA 5FA6A 4IGFA 3E7WA 4FE7A 5AVXA 2Q4TA 3RD5A 4B3FX 1IRIA 1P5FA 1NP6A 1N57A 3F5DA 1RZRA 1C4KA 2YWEA 3RC1A 5FAKA 4BLTA 1X70A 2O8NA 5F52A 1KSGA 1FRQA 1NUQA 4WAUA 1V16B 3ZXIA 3E27A 1LJLA 3GAFA 1N32B 1UR5A 4U00A 1VKJA 2BRUA 2K2QB 4J6FA 3BREA 4RFSA 1Y82A 3FCUB 3QVSA 3C1TA 4IGAA 2B4QA 1PCXA 3F5QA 3Q7QA 3WWZA 1L7EA 1ES9A 1JN0A 4P3PA 4GUDA 1AV7A 3MGCA 4K6OA 2AKAB 1PWEA 3CG4A 2C8JA 2C99A 4IIBA 2B0JA 4PPFA 4RENA 4YJ2A 5T4FA 1U1EA 3HCPA 5CM8B 3JX9A 2P2NA 1H1LB 1XZEA 2Q46A 3HG7A 3R9KA 4A27A 3DQPA 4US0R 2ZJZA 1HLFA 3KO8A 1CULC 1V25A 1ORIA 2C5FA 2PMDA 4Q5IA 3ZE2B 2ZYUX 1UMDB 2X19A 3PGJA 1FFBA 1K8XB 1C3OB 4MRMA 4JJIA 1A7JA 1JPJA 3AR3A 2XADA 3EMKA 3QBJA 3ICOA 4BGIA 5EG5A 3VR6H 4TWAA 1UMCB 2Y1EA 3GFGA 1UF9A 3N7UA 2WT8A 3PUIA 3H5IA 4FOPA 4URVR 5DLDA 4P7KA 2EXXA 4P0PB 1CLEA 1I10A 1SC9A 4EY3A 2V7VA 1LLDA 2ZIFA 4S3MA 3ZQJA 3FLAA 4ARCA 2JJ1D 2JK0A 3SDZA 5BQXA 4PVDA 4QC2A 4A1FA 4EJ0A 3CNEA 5A6SA 4TSFD 1YA8A 2WYIA 3T1QA 1W48A 3I58A 3OPQA 4II3A 3JSXA 1T2FA 4FLMA 5E8JA 5HFAA 1Z13A 1P81A 1LVHA 3VX3A 1SVMA 4K6KA 3AERB 3HB9A 4L5YA 2W43A 2VAMA 3PFBA 1WJGA 1B0PA 2AMLA 4CTJA 4OV6B 4YN3A 3KZVA 2XUFA 1H05A 3INRA 3GJRA 1E3WB 1Z56C 1W34A 2FUKA 2PWBA 4ER5A 3AESA 3NUGA 5ECYA 1XCJA 5A7HA 3VR0A 1B8PA 3JD3A 1TKCA 1EWYA 1TECE 4ZXFA 2DUUA 5LXTB 3ZHCA 3NWBA 1UPBA 1NJ6A 2QZ9A 4LBZA 4YC7A 2B36A 1JZQA 3P2JA 1G5HA 1LK5A 1Z82A 1VL6A 4JMPA 1JB1A 1T4GA 3TZCA 4FDLA 2FDRA 3TX2A 2OOKA 3VGJA 4Q19A 2OCYC 2OCAA 2R4TA 4WCVA 3ROPA 3U3XA 3A3PA 5JD3A 4XM0A 4DNXA 4QXOA 2ZU0C 5CW2A 3PUXA 3SYTA 1YHYA 2HU7A 1NVMB 1B4DA 3ROXA 3L7IA 2ODAA 5JJCA 3ZKWA 2R8PA 2HRZA 3L7DA 3W1VA 3V97A 2WY2D 3NIGB 3REGA 1VLJA 1ZUHA 4PYJA 1YS9A 3IQXA 3ZDEA 3IPAA 5HVNA 3F3SA 4R81A 5HQJA 3PQEA 1WOMA 5I45A 5LQDA 1ND5A 2OLEA 4TV9B 4K6GA 2L69A 4CF7A 4A8TA 2LNDA 2PMCA 2HSJA 1US8B 2JD2A 2VT7A 5B4TA 3DL0A 3LUKA 2H11A 5H8WA 4I3HA 1YZ3A 4FXOA 3RRXA 5EE0A 3B1ZA 4RA6B 1TAHA 1J5XA 2VDWB 3BZWA 3FGPA 3OC6A 3H7AA 4W5NA 3LC7O 1ZGJA 2F3SA 1SIBE 4WOJA 3JATA 2V98A 3JQGA 3MOSA 1SU8A 1M3SA 1Y8RB 1Y9EA 4GUAA 2V7WA 1Q50A 2B30A 2QAJA 4JKYA 4K6FA 3TW8A 4G0WA 3QVWA 5ES3A 1V6CA 2YYYA 4L3WA 1WNFA 4ENQA 1M6VA 1X74A 3C4JA 4H18A 4HPJB 4ALMA 4AP6A 1T29A 1MPTA 1I2CA 1E5TA 1BMQA 1IOVA 3FYHA 4UBJA 5HIJA 2XB8A 2BGNA 2V6MA 3ZWKA 3TAXA 3L6UA 4BMNA 1V5IA 3HFRA 3Q0EA 4AJ9A 2P9CA 2VDLB 2RARA 5FO1A 3IUYA 4O2AF 4BC1A 4XR4A 4NC9A 4BVHA 2VQEB 3AY7A 4BDSA 3GCXA 3C39A 3WOHA 3NHMA 4HN9A 1G7TA 5HE9A 1PEAA 4I2NA 3WHKA 3BYZA 3ZY6A 1FW6A 3CR7A 4YJFA 3WLOA 1XEXB 2JGLA 2K6GA 2LW7A 2Y0DA 4QT0A 1I7QB 3FKJA 2JFVA 5AJWA 4FFBB 1JEJA 4ESOA 1M66A 1BXRA 3P5BA 2WUGA 4IGKA 4N03A 2WFAA 5G0SA 1JR3E 1KVQA 3VKGA 4YUAA 4NZPA 2IZ7A 4QPZA 4NBTA 2DPMA 4F85A 1JFSA 4F7DA 5ALTA 2J9GA 1SXPA 5FPTA 3G2QA 4R05A 5ALHA 2LIVA 4RQUA 1ZKDA 2IEBA 2RHHA 1P4GA 3I6YA 3KJEA 4AU1A 4X8MA 1P0PA 4S04A 5EE3A 4XCVA 1T2NA 4PWYA 3RU9A 3GDWA 1Z0JA 2P30A 5C8YB 2W22A 1ITZA 2Y6UA 2N1MA 4XSVA 5LBUA 3M6XA 1LK7A 2A59A 4XARA 4EX6A 1EHYA 1EQAA 3AKEA 3MJFA 2ZATA 1O7JA 1G41A 4WVLA 4OJQA 2BEJA 2ORVA 4GI1A 4NQRA 2H7VA 4Y18A 4G0YA 3FE2A 4IF4A 4CRWB 5FWYA 5JMTA 3TQSA 2ZIGA 1DARA 1PK7A 4I6EA 3LNCA 4WN9A 3V55A 2R1TB 3LUDA 1CZNA 5TGZA 3GROA 3T6KA 2P4UA 1XTVA 3DH0A 4ZCSA 1ABBA 4MA0A 1LVUA 2A1IA 3TQHA 5JH7B 3PXXA 1AIPA 2BEVB 5BQ5A 3F8WA 2XX3A 3BIWA 3ZD8A 1GY8A 4YMWA 1G9TA 4HXEB 1XMIA 1XHFA 2QTRA 4B6JA 3B3QA 4NBRA 4U7DA 1MH9A 1F3LA 2F90A 2GAJA 3R0IA 4KB5A 3OD5A 4M9ZA 3UGTA 3ZZMA 1OZHA 4WA8A 1NJ2A 2O2HA 3A3YA 4L73A 1KI2A 4H4CA 4X20A 1YR7A 4I8XA 4XASA 3JYOA 5FBZA 3RNOA 4DJTA 4MLZA 2UZ4A 1V8OA 2E21A 1DBSA 2F67A 2DR0A 1TIBA 2I4TA 3OC0A 1Q3TA 2C97A 2GBPA 2UZAA 3UAXA 2J3JA 2WJHA 3RYHA 2FPMA 5EE5B 1E64A 1M2HA 2O8VA 3FPFA 4KVFA 4QT4A 1OZGA 4NECA 4WK4B 1D8TA 1NVFA 2ZI4A 2C3YA 5B1YA 3LL7A 1W1WA 4MVJG 2I7CA 5KSYA 1SZJG 2OCLA 3BTSA 3Q4GA 4OHMA 1DCKA 1FNDA 1EJ6A 4MUMA 4Q9LA 3CGWA 4ZVOA 2BH9A 3SZLA 3QMMA 2LWIA 3VOAA 4EAQA 5K3AA 1UJMA 3HS3A 3MTIA 5LUAA 3TGWA 1O58A 2AMJA 2GRUA 3DNFA 2EKBA 1HC7A 3GJ7A 4DDTA 1N5IA 3BL5A 4EFNA 4GG1A 2G6TA 4WOKA 4QOFA 2ADMA 1GAEO 1NHG