1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
b'QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Collagen-binding
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
5KYUB 1XDGA 1PT6A 2NUTB 3PPVA 4G1EB 3K72B 4A0QA 4HQKA 1M10A 3TXAA 3K6SB 2ADFA 1M2OA 1QC5B 1YVPA 5E6SA 1OAKA 5E6RA 2M32A 5KYXA 1RRKA 2NVOA 4HQLA 2WW8A 3ZE0B 3ZE2B 4CN9A 3NIGB 1RS0A 2O7NA 4WFQA 5HJ2A 3TCXB 1M2VA 5HDBB 1PD1A 4O02B 1IJKA 1QCYA 5ES4B 1ZONA 4UM9D 4CN8A 3F78A 4F1JA 3HXOA 3TW0A 3HI6A 4WK2B 1YVRA 2I6QA 4F1KA 4CNBA 5KYYA 4WK4B 1FE8A 4M76B 4Z7NB 1FNSA 1XUOA 1TYEB 4C2AA 1Q0PA 1U0OC 2VDMB 4IHKA 3T3PB 2IUEA 2NUPB 4WJKB 3EG9B 2I91A 2VDLB 2ODQA 1RD4A 1LFAA 3IJEB 4MMZB 1N9ZA 3EGDA 1JLMA 1JEQB 3V4VB 1JEYB 4Z7QB 3EGXB 5KYUA 3BN3A 2VDOB 2NUTA 1JV2B 3ZQKA 4WK0B 3K6SA 1MHPA 3EG9A 3EOAI 3PPXA 3ZE1B 2WINI 2ODPA 1QC5A 1U8CB 1MQ8B 3ZDXB 1IJBA 4IGIA 4DMUB 3F74A 3EFOB 4HQFA 4HQNA 1DZIA 1M1XB 2QTVA 3BQMB 4BJ3A 2ICAA 1SHTX 5KYWB 1SHUX 3TVYA 1AOXA 3PPYA 3T3MB 1AUQA 1NA5A 4FX5A 5E6UB 4HQOA 1U0NA 5BV8A 1BHO1 1RTKA 4NEHB 2XWBF 2VDRB 1MJNA 1IDN1 4UM9B 1N3YA 1SQ0A 4JDUA 2NUPA 3N2NA 2B2XA 3VI4B 2XWJI 1ZOPA 3E2MA 1T0PA 1UEXC 3FCUB 3QA3E 5E6SB 3V4PB 4C29A 1L5GB 1AO3A 5E6RB 3HXQA 1JEQA 1JEYA 3GXBA 5KYXB 1DGQA 3EGXA 1PCXA 5HGJA 2XGGA 3RAGA 1BHQ1 4C2BA 3ZDYB 1M2VB 3NIFB 3K71B 3M6FA 1IDOA 1CQPA 3NIDB 4UM8B 4NENB 1ZOOA 3EOBI 3EH1A 1CK4A 1PD0A 3ZDZB 3EH2A 5KYYB 3EFOA 2VC2B 3Q3GE 1M1UA 3VI3B 3PPWA 3BQNB 1T6BY 2VDQB 4IXDA 5KYWA 1MQ9A 5KYNA 1MF7A 1V7PC 3FCSB 1ATZA 2I6SA 4MMYB 2VDPB 4NENA 2VDNB 3IBSA 5LN1A 5E6UA 4G1MB 4XW2A 4PN7A 2VDKB 4Z7OB 1MQAA 3EGDB 1XDDA 4MMXB 2X5NA
chains in the Genus database with same CATH superfamily
3FYDA 4BNDA 5M7EA 4CU5A 2LXNA 1WRBA 2ZLBA 3K72B 3KR2A 2Z3ZA 3QE0A 1KH2A 1N1MA 1NM5C 4W1RA 4L9WA 5TSDA 4AY3A 1YHYA 1QYCA 2VP9A 4U5XA 2P3OA 3JZDA 4HADA 4ZC1A 3ZNQA 3I8OA 4RFVA 2FDCA 2QJRA 3A4IA 1LY1A 4QRHA 5JCXA 4MRPA 4CG3A 3A1VA 2RC5A 5HKLA 1E3JA 4FSHA 4KR3A 2BM1A 2IEYA 1K3UB 2XYPA 1DUIA 2NTYC 3K8ZA 3ZLTA 3NONA 2N1MA 3N07A 4BE7B 3OZBA 3BJRA 4F8YA 4GBGA 5T6BA 2OENG 2Y1XA 3AHFA 5I51A 1NDUA 4IOLA 2V7TA 4CNBA 1S4MA 2EG9A 1PSZA 3CHYA 4F2DA 5LUAA 1Z4JA 2FQYA 3I01M 3OIWA 3BRWD 1SOAA 4YCDA 4QVKA 4NTZA 3MCZA 4BMYA 1U04A 1PT5A 4PYLA 2BUBA 3CR8A 3KPVA 3ZU4A 4ZYZA 4JYBA 1VJTA 4O4HB 1XDBA 2Q7OE 5FWDA 1YR9A 2GESA 5EHIA 1WW8A 1MB2A 3H1FA 1DKRA 1YQ9A 4K6KA 5DRTA 1W47A 2ZZNA 1SU7A 1CUBA 2GA8A 5EGNA 2ZSFA 1KMQA 2IXEA 2REBA 3LPNA 2IYVA 3IIJA 4A6XA 1WKBA 2QR5A 2Z04A 1CUHA 4HAYA 4QFCA 4F5DA 2H4YA 3UENA 4DR6B 1BQ4A 1WS6A 2MINB 4JJ4A 1T5HX 4W5NA 2FPPA 2WI8A 3FPSA 1X6VA 1XZPA 2F9MA 2PFKA 3GCGA 3DE3X 4X7BA 3U3DA 3VDMA 2FPXA 1CZOA 1M1XB 3TZQA 1S9HA 1HR0B 4NU8X 3OTQA 1XF1A 2P2LA 4IJWA 1EBUA 2IK8A 1GA6A 4GQBA 4J4BA 5CVVA 4NOLA 1UL1X 4O6VA 5ECYA 2EYQA 3T1HB 4BVBA 4YMSA 4CW7A 2NV2B 3G88A 1AV7A 2AE1A 2CL0X 4W1SA 4CQNA 3EF3A 2WSBA 2ZB8A 2V7EA 3CCBA 4FKMA 3W79A 2C4TA 5AFSA 1KAGA 2VP3A 2NZ2A 5EKTA 3K5HA 1ZK2A 5I4CA 2JIOA 4RPHA 1ORWA 2EKBA 2Q3HA 5IYZA 2YHSA 1MAAA 2CD9A 4UFNA 1OT3A 3VR6A 1WDWB 1UEJA 4ZMSA 2D5AA 5JXIA 4AI6A 3RSLA 1C4OA 1ADYA 1II8B 5HFAA 3ANXA 2JARA 1ADBA 3ZD6A 5CVCA 4R69A 1JN0A 4Q05A 3NTUA 4TV9A 5GV8A 3MPUA 1K08A 2KMLA 2VP2A 3NRJA 1LQ2A 1Y7TA 3F9CA 4B7CA 4X20A 4IR7A 3JYNA 2ZT8A 2OPBA 1NUHA 1E1RD 2A9VA 2PZLA 3KOMA 3L8DA 3Q12A 2HCFA 1NZFA 3MUOA 5DI9A 1E6MA 1AXGA 4R7ZA 5JXWA 3FRHA 3EWAA 2J0UB 4JBXA 5KNBD 1I33A 3ONVA 2XYHA 1O8CA 2FP4A 5IBCA 3F6CA 1L6IA 4JX9A 3FCSB 4Q9AA 2D1TA 2PMFA 4CKEA 3H0CA 4G4GA 4KSBA 3U09A 1F8UA 3LCUA 5HKOA 4PYRA 5AXBA 3FNRA 1V8ZA 1GXSB 1RJDA 1XHEA 1NV8A 2G07A 3LLUA 3MRVA 1YA6A 3ZW7A 1LV8A 5BSKA 9ATCA 3ZR4B 2YYAA 1P6UA 1SMKA 5ADHA 2PU7A 2I6UA 2ZSIA 1JJAA 2JD0A 3BK1A 3OPYI 2Y92A 1ECFA 5E4TA 4HVCA 5IABA 2ZZMA 4DZRA 4IJQA 3BSSA 3GEGA 4AP5A 2BJHA 2JKYA 3LNTA 4CDMA 4ARIA 2XKBA 1ZH4A 4EFDA 4ENSA 1ADGA 1W5BA 5FD8A 5B3KA 1Q3HA 3BXGA 4XFJA 3O90A 3VTKA 4DR5B 3KKQA 2O7NA 5LP1A 3GUVA 4RGVA 2NZYA 3FZYA 2BKLA 1PQ4A 1YZHA 3LRXA 2POQX 4N1AA 4XAQA 3QYPA 5LFAA 3GGSA 4KXNA 5FRDA 3GA7A 4BLSA 5JCOA 4BFWA 5IAOA 5B1EA 1RJ9B 4F3KA 3R7SA 2GBCA 3PU6A 4N5HX 3IA2A 5ILGA 3GYBA 4GX2A 2VNJA 2J3HA 3DHVA 3LQYA 3W7AA 5CLJA 2O5EA 4BMNA 1LFAA 1SXJA 1KFKB 2HQOA 2QMHA 1QP0A 1NASA 1EUDA 1FUUA 1QPGA 5HFNA 4RA6A 3O8DA 1BCRB 2UYGA 4BWFB 4TZ0A 2FFRA 4OSPA 1LPAB 3GCZA 4MW6A 1A4RA 2N0SA 4Q1CA 3LIPA 3VOAA 1KGDA 3IQXA 2PGIA 3AU8A 2YIMA 5D51S 4YV0A 2DTXA 1E2BA 2FE4A 4HAXA 1JXQA 3HA7A 3KB1A 3W5BA 4G1VA 2HIMA 4P4SA 1VHQA 1A9XA 1NM5A 4JKOA 5DK4A 1NLMA 3OZAA 3H4TA 5HVNA 3DTVA 1JHZA 1Y1LA 4ESOA 4EVQA 4ZDKA 2CFIA 3X2EA 1ORHA 1YUNA 3JATA 4LBVA 2O8NA 1BH6A 3IBGA 3KU4A 4PFSA 5IANA 5FAXA 2ZAYA 5JWRA 4BXOB 1YK0A 4DIBA 4MUHA 1U0BB 1Q0RA 4RIIA 4Q34A 3MK31 4F91B 3FZQA 3Q3IA 1FVXA 3OEEA 1AA6A 1RXVA 4RENA 4CXMA 3KKZA 4FGUA 5DI3B 2XUAA 4Z3DA 2IWHA 4JBGA 3BF7A 4YJGB 3LCCA 3OMXA 1XDUA 2OK7A 4YUXA 5FLXA 4QBKA 1EDBA 4D0LB 5TQVA 1AN9A 1F9AA 5EMMA 3OFKA 3E2MA 1L3CA 2XT0A 4D4LA 5JHHB 2MIIA 1XMIA 4NBNA 3I42A 5E6SB 3RM3A 3EGXA 1P33A 1JAIA 2V7BA 3VGPA 3CG0A 2ILTA 1XVUA 4JI1B 1V6CA 2YCBA 1IOZA 2HF8A 4LRQA 1SC9A 5FBKA 1NW8A 1Y98A 4JJGA 4ZD6A 4MVXA 4DF3A 1N0HA 3IIEA 3A9CA 3EAGA 5EKSA 3HJFA 4JI7B 4PRZA 3G59A 1DAHA 3BE8A 5K8LA 3GF4A 4CCSA 4X1IB 1GADO 4W5WA 5A3VA 3VU0A 2EQ5A 1M0TA 5CFMA 2JZNA 2C57A 3NVMB 4NPHA 1XAIA 4D46A 2WUDA 2I22A 1X1RA 2VDNB 4EA7A 5HYVA 1I80A 3A28A 2NADA 2Y9MB 4A0RA 4LMPA 4DCUA 3OQMA 5C8YB 1GFWA 2HIHA 3EK2A 3VM6A 3Q87B 4QXOA 2FFHA 4DANA 4YPVA 1U90A 3ZBPA 2EKQA 1HKHA 4JQSA 4RHEA 1QORA 1W73A 2FSFA 2Z8XA 2O20A 1G7RA 3P71T 1GQYA 1TVKA 2GB4A 4DV5B 3PNOA 2Q3JA 1IHDA 3BFPA 3AUXA 4FQ5A 4Y7CA 5HZHA 2P3QA 2HSDA 1CJVC 3C6XA 3FTNA 2HREA 2FMHA 3AVQA 1WXFA 1QB7A 1XYVA 2NZXA 5CUQA 2CD7A 3N0TA 4TMKA 4ZZ1A 2VF5X 2OFOA 3ZE2B 2R60A 1UBKS 2QYSA 3A32A 3O9ZA 1I6MA 2AG5A 3NIGB 5ESWA 2OD7A 5DLQC 1CR0A 5FBLB 3AHCA 3IE0A 4HFMA 3IEMA 3RSHA 2PKXA 5KOYA 3CLRD 2ZGVA 4G23A 2BTQA 3C70A 4NVRA 3V80A 1ZJWA 2FN4A 3NAMA 1B16A 3AESA 3CLSC 4FI3F 4LYEA 3ZWBA 2X7XA 4KXWA 3EXEA 4M7WA 1K8YB 2BDEA 4HXFB 4ZJYA 3R7WA 1LI5A 1YOVB 4CMEC 2WU4A 4Y6PA 1N2CE 1KE2A 3DZCA 4C43A 3M5WA 4FT2A 3OI7A 3TZEA 1AUXA 2XUFA 5C8ZA 3GJ4A 2OXIA 3QOYA 4E09A 4CV3A 3L8FA 1CUJA 3OICA 4XZ3A 1H0RA 1T5IA 3FPCA 3EW7A 3LBIA 1PYOA 3PI6A 2A0WA 4HN4B 4LOIA 5TMEA 4EO7A 3NWJA 1EFPB 1U31A 2WYOA 3FOFC 3AP3A 3DNMA 4QPJC 4AMBA 1V3QE 1PZFA 2C5HA 1E3SA 3UJNA 4GT1A 3CPJB 4E30A 1AV6A 2C9DA 3ZEIA 2PHZA 4BE4A 3KKEA 4RK1A 5H82A 3FNFA 2BMFA 3GYGA 2FUKA 2ZCVA 3M1LA 5LYYA 3U1VA 3KCNA 3WWOA 4V0ME 1XZAA 3HUDA 1EX7A 1YDGA 3GLIA 1U98A 5DB4A 5IDYA 4CQLA 3KQQA 4KFTA 5FI5A 5A9TA 4ARBA 3R8XA 3VPAA 5KS2A 1JALA 4W5TA 1RXWA 1YHZA 5C7LO 3OZ7A 2JL1A 1MABA 2ZYVX 5AJHA 1MW8X 2CMGA 3L4SO 5LYJB 1J0DA 2YJTD 3KR9A 3MTJA 4OP1A 3ZYZA 4FGLA 4WJZA 2H4ZA 3K8YA 4BO7A 1N3YA 4A73A 2C4KA 3RYCB 2VBIA 4JJ8A 1L8XA 1OPRA 1WJGA 2IHBA 4Z86A 3FCUB 3OWOA 3OWXA 1GITA 3DV0A 4GYKA 1F17A 1FSFA 2DKFA 4Q4JA 4HBGA 1U7TA 3DUFB 1DAMA 4FDMA 2C82A 5G3YA 3GDFA 1D2GA 1XNHA 3F8SA 2HF2A 4FGWA 3NALA 1WP9A 3LHIA 3LLVA 1I9GA 2Q3EA 1TKBA 2C4WA 2R5FA 3OF2A 1GKKA 1MRZA 4BN5A 2O52A 4NENB 3V9PA 1IQPA 4B8ZA 1DOAA 1AT1A 2ZJ0A 3WNZA 4PLWA 3A1TA 1DDGA 3C48A 2AZ4A 4MIKA 5ETJA 1IHXA 5IBQA 4DM3A 3R3WA 1D9ZA 5EVJA 1JLRA 4H08A 1S6YA 2ZE5A 4EKEA 2BEVA 1JVNA 2P6NA 3EYAA 4HS9A 4O2AA 4GX5A 2VPQA 2AA3A 4PTYA 4UVIA 1N6HA 1XPUA 3A3NA 4ZOCA 4MPDA 2YQZA 1F2UB 5DMXA 2PBFA 3AVUA 1XDDA 2C42A 3CMCO 2QTZA 3K73O 4GR9A 4ZP1A 3Q3CA 3OWHA 4JITA 3TNJA 4MPTA 1JA9A 2VQ3A 3I52A 3S99A 3VU1A 4TWIA 4FFRA 3T9AA 4IWYA 2KYRA 1QUEA 3UH1A 1JFTA 4QSHA 3LCMA 1QH0A 1MR3F 4P1ZA 2O0JA 1PRYA 1ZYUA 3BWVA 3D7NA 2WYVA 3FCCA 3IQDB 3NATA 3P9KA 4WOKA 3MWJA 1E2UA 4JT4A 2PYDA 2ZJ6A 3QLVC 5B1SA 3FLBA 2QVGA 1CWUA 1JFRA 2OLJA 5E8JA 1ZIPA 1VDMA 2VKTA 3H1AA 5D6NA 5EXXA 4A1FA 3OEHD 1JUDA 2B3TA 1NNSA 2W2TA 3I5XA 4DB2A 2GPSA 3JQ8B 1CJCA 1M2NA 1QM5A 1Z5PA 4PW0A 1G8HA 5AP9A 4CN8A 2FG5A 4RF2A 5FV4A 3IDZA 1YRBA 1OGIA 3MOGA 2OWEA 5F9HA 4YJHB 4EDFA 4CV2A 2BFCB 1T2DA 3BIWA 3EDCA 2X8JA 2CXXA 3PFCA 3I1YA 3KL4A 5EXEA 2Y2UA 3H7AA 4QJ3A 1BOFA 4UUMA 2PBZA 1NBAA 1JQEA 3FXAA 1W36B 4WJKB 3C5WP 1IJFA 2GYVA 1IZ8A 3WK8A 1GVHA 5CLGA 2FZ4A 1EJ0A 4L4ZA 2QVCA 1PTJC 2NYRA 3E9MA 1Q0HA 3HJBA 2WDPA 4M1SA 2D2IA 4RKFA 3AG5A 5ARCA 3N7AA 1A98A 2WY2D 1WMDA 1CJKC 1DJQA 1QWSA 2DU8A 2Z5LA 2NAPA 4RLFA 4DADA 4EYQA 3OTOB 1H6DA 1VGQA 1YT5A 2OP0A 1CULC 4H7EA 4JUDX 4MROA 3U7GA 3U0VA 4AMGA 3MWEB 1FDVA 4YT2A 3RYHA 2VTBB 3W78A 4N01A 4EGAA 5CEFA 1Q7CA 3NT5A 2P67A 1XXHB 3DXYA 1QNFA 3FCAA 5FWYA 3PJGA 1MW9X 2QVLA 3R5JA 4ZHQA 3LBFA 2QHXA 1N5IA 1J4AA 4LXTA 4DAOA 5DNCA 2ZPTX 1GZUA 5AH0A 5FWXB 5BSWA 3B53X 4R40A 3W8EA 1J0CA 3N58A 5FBWB 3KT8A 1B76A 2J08A 1T6ZA 2X22A 4QHSA 3RSZA 4BFSA 2R97A 4EO4A 1SOMA 3ND6A 1UBCA 4A36A 2O14A 1N8KA 2OV1A 3K6KA 3N75A 4QQ8A 3GPIA 3ZU6A 4PSAA 3O5AA 4OJMX 4C6HA 2X7JA 1ISMA 2CZGA 3A2NA 4F6LA 2IZ6A 4EEZA 1KNXA 4CMEA 1YBVA 3ENWA 4IIGA 2BSQA 2OV6A 3PS9A 4GZ3A 3RVSA 4WKNA 1YB5A 3EZYA 2GT1A 4QDJA 1W96A 1UFQA 2CLKB 4E7PA 4F6RB 2O8DA 3ZXIA 1KC3A 4M0FA 5TLSA 3GAFA 1GPBA 3KCQA 4GEGA 4L5JA 2A0FA 4XUGB 5AJZA 3D3NA 2J0EA 4B6EA 4TRRA 5CT9A 3I30X 5AHRA 3R5KA 3JQFC 4J03A 4RVDA 3L0DA 1W36D 2BKXA 2HGSA 3TL2A 2ZYUX 3RWBA 5GJCA 5LD2C 2W4MA 2XT9A 2RBKA 1M8KA 3FOCA 3A26A 1H2FA 4PNEA 1P7CA 3GIDA 4EATA 3VR2D 3KJEA 1C2YA 3DSRA 1ZICA 1WCWA 3HCDA 1OTYA 2X8WA 2PX3A 2GZ3A 3EDYA 4R2XA 1KGSA 3FGNA 3KQLA 4L8GA 3WRXC 4JMPA 5BMOA 2EDAA 4KW7A 3G2KA 1ZR2A 1T24A 1YAJA 3FNIA 3OEWA 4R5HA 3CX7A 5NULA 3WVNA 4CIXA 3WJAA 2LTAA 3TXAA 3SVLA 1Z5NA 3ZC3A 2IH5A 3BXHA 5LNK6 3DD1A 3FZNA 4CEHB 1UM9B 3RUPA 5JNTA 1HZZC 1KJ8A 1YVPA 1OV4A 4XOUA 4X7RA 3X1JA 1U94A 4N7BA 3ZOKA 1X77A 2Q4RA 3NKFA 5ALXA 3ZCXA 4IDAA 4IQ4A 1RLMA 3WDSA 4LI3X 1NBMA 1Y7PA 2QORA 5E4FA 2IQ5A 4YT4A 5K3FA 5BXYA 1Z5UA 2OSVA 3O9VA 1I2ZA 2AJTA 2VEDA 2GETA 4B5LA 1DCFA 3R24A 2GNOA 5DX8A 3TMAA 2DFPA 2R7KA 4E2ZA 1Y42X 1V43A 1NJSA 3W2HA 1P0FA 2QM7A 1Q7TA 1OI2A 1PJ8A 2VYNA 3G9TA 3DTYA 4BKQA 5F1PA 4BTVA 4PZDA 1NW6A 3UAZA 6ADHA 5DNVA 2ZJ1A 3KYJB 1QVZA 2HWXA 4HYQA 4OBWA 2QJFA 5AUNB 3WLQA 5BWBA 2V03A 4IF6A 4I7EA 4AO7A 5LL6P 3H2GA 3NNDA 4FXPA 3CZ9A 1EA7A 1QG2A 7REQB 1C2TA 4XJTA 1MC8A 4MQUA 1KZ9A 3CZMA 2R1ZA 4N9WA 1U7OA 1E7RA 2FWBA 3LH5A 4C4ZA 1OU4A 3LY7A 2HWKA 1E0SA 3QJYA 1PWHA 1NVXQ 2ZBUA 3I76A 4GIBA 4HLUC 4K3UA 5E1DA 2ORIA 1B3RA 2XXJA 2GCGA 3A37A 1U3DA 3DOJA 3NAQA 3O38A 1DAEA 3PHHA 3OPQA 1ODCA 1EWQA 3BL5A 3KSRA 4OLJA 3BMOB 4DDUA 1YZVA 3PVCA 4D9JA 1Q0SA 4EEKA 3KLBA 1UJ5A 5E4JA 4GAEA 1NVVR 3AKYA 1GM5A 4QRIA 4E2XA 3QYFA 4DV4B 5CMLA 1EQAA 1Z33A 5I7FA 1LJUA 2VP5A 5AW1A 3IL2A 3OLQA 2XYGA 2MDTA 4UU0A 1EM8B 2Y1EA 2Q62A 4L75A 5AKZA 5F7JA 1WTCA 3LDFA 1QO9A 5EZQA 5FO0A 2GM3A 1Z0SA 3BXZA 4BJ5A 5AW3A 4TUYF 1V3UA 3AB8A 1Q50A 3QELA 2D5IA 2I7DA 2O2EA 1B0UA 2Q3CA 4PLFA 4CMCA 1MO2A 4KUGA 1ZQ9A 1YMQA 1NDHA 3Q8WA 4IMJB 5CB4F 3DO6A 3TSAA 5DGDA 1Y81A 3ED1A 1TM4E 1OFUX 1PTJA 3MJVA 1TCCA 3FKQA 4OQXA 5FTNA 4MRNA 3PLRA 2QWXA 5TEWA 3CXRA 1N0IA 4O4LB 1GG5A 3V46A 4J0CA 4XJVA 3TRFA 3BXOA 3H1TA 4LAFA 2WFMA 3IP7A 2Q46A 3SN6A 5EP3A 3EFOA 5KYYB 3QVWA 3BMCA 2C7QA 4B3TB 2IS2A 1A95A 2HBRA 4DZZA 3OZDA 3DOHA 3IBFA 4OF4A 1KZ4A 4KKVA 3NG1A 2O2JA 3QY9A 4LE2A 221PA 5KMGA 1U0GA 5EZYA 3B2QA 4J9VA 3THSA 3BX1A 2XDQB 1G3QA 2A9JA 3G8BA 4MUIA 1DC6A 2B92A 1R4MA 1VL8A 2HDWA 2J09A 3HB7A 3PIDA 3QEAZ 1PAUA 1HA3A 2O57A 3QENA 4EHFA 1DXQA 3SD7A 4A0QA 5JPDA 3O0TA 4TTSA 1W8DA 2YHIA 1K92A 1N5DA 1UQUA 1XKLA 2X7HA 2J1LA 3GDWA 1YJCA 3P2IA 4YEDA 4CMGA 5JE8A 1OF1A 3ACDA 4H77A 2ZRCA 2NZWA 2CJFA 1V48A 2HHCA 5LSAA 1GQFA 2L82A 4WZZA 4CTOA 5AVWA 2ERCA 1LDMA 4CBVA 5L7TA 2DFNA 1MCZA 1M2VA 4R6WA 1PD1A 2D8AA 1H69A 4BNKA 2GA9A 1EJBA 3QM1A 4K9LA 4LBYA 3I0ZA 3THXB 4MW9A 3EZ7A 1KYTA 2GYUA 1MN6A 2QQGA 4IVQA 1JMKC 4LDJA 4OYHA 3MWYW 5I7SA 4HTFB 1RU3A 3KHTA 2H5LA 5BN3A 1ZOSA 2NO6A 1XO1A 3JQFA 1O77A 2HSGA 1JWAB 1RKBA 1SHJA 2X3UA 2IEBA 4GWKA 2WJWA 4WNYA 3RAJA 4EP1A 3UTCA 5ARBA 1EEHA 1W4RA 3G82C 3S7ZA 4CIVA 4L6IA 3HXKA 4TV8F 1N9GA 3QVOA 5TDHA 3AUKA 2GZ2A 3NEPX 3CUSA 1IOVA 2IPAB 3ND7A 1V5FA 1HI9A 2W8BB 4YACA 5CLLA 5T64A 2PLAA 4PYQA 5H59A 2CF5A 4O4IA 2IU0A 3VPFA 3VXKA 3GL9A 5C8XA 5B4TA 2PWPA 2X1MA 4FFNA 3W5HA 3WRXA 5IH3A 4EECA 1BVHA 4JVNA 3EEYA 3DLAA 1ULHA 1Y3DE 1N5RA 2QSYA 4UU8A 5BV2P 2N3ZA 2DQ4A 5AVQA 4DMKA 1WMBA 4UQPA 4BVJA 1V7ZA 2ONYA 2BMJA 4I4LA 4ND2A 4YJ3F 3U7IA 2VT2A 1WO8A 1FK8A 1HZZA 5F9FA 1VLVA 3GU3A 4CCYB 1JKFA 2HA3A 5HHTA 3N7TA 2OXTA 3UJ6A 2ZIVB 4LQ4A 4FCWA 2OUIA 1QIMA 2BFPA 4MRSA 3OLZA 4MUBA 5E1OA 4BX9A 5K01A 1JH8A 3FYHA 2VWPA 3VOTA 4ISBA 1QQ6A 1KVUA 1CUSA 1Y82A 3NVAA 4NEHB 4OVKA 2VDRB 2Y77A 4ZT6A 3TZCA 2GYYA 1C30A 3MJRA 1KFBB 1XL0A 1HE8B 3UJDA 3W8DA 4EQZA 2JLUA 3CE9A 3I05A 4D98A 1ORVA 4R81A 3S0JA 2ZDGA 3MHTA 1AGRA 2AB0A 4HP8A 3PQ4A 2P77A 3LUDA 3RS3A 2FUG6 3V5NA 1WG8A 1C3XA 3O2QB 2SNIE 1DXHA 1UBLS 3IRVA 2O3SA 4RNDB 3I9KA 5L7YA 1DLIA 5EMLA 2I2BA 5DNUA 1V1RB 3K5WA 5F9MA 1NW3A 3GP5A 1I2CA 1IBLB 3L8GA 3QKIA 4MV7A 3CX6A 3SQXA 3S2FA 4H6XA 3I9FA 5JLJA 5TR9A 1RVDA 2HLHA 1D2MA 2WPDD 4GOMD 4IIJA 2WD7A 2C84A 3VISA 4PO9A 3F5FA 3GPLA 5DXFA 3BKWA 3FKSA 4N12A 5KX5F 4TZTA 4AYXA 1DBVO 1SCNE 2ANCA 1LX7A 1NVUQ 2OBMA 1NUUA 4MI9A 3SJZA 3TR5A 3U49A 3PE6A 1BVYF 3QKSA 3ICQB 2VNHA 4Z4HA 4YIKA 1JQLB 2PWAA 1N2ZA 3QBEA 4IHJA 3WBBA 3DLPX 4A8HA 4EQ6A 3AT1A 3WNQA 2J9YB 5EWLB 5FUMA 1P29A 4HWSA 4BX0A 4OU4A 2BE9A 3R0ZA 4ZQIA 2ORYA 4N7MA 4PHTA 4B9EA 1NXWA 5BYKA 3PYLA 1ZM3A 1XYYA 4TKVA 2G1KA 1MIHA 5DF1A 4LC0A 3IEXA 5BV1A 2ZZKA 1KDRA 4RPIA 2NG1A 1GZHB 3Q7SA 3IBTA 4L16A 1S01A 4KMOA 4HHEA 2ZJ8A 1JECA 2I2DA 3L8HA 3FFAA 2D1QA 1MFPA 2BEUA 3JYHA 3KDSE 3ZJ4A 4HLDA 2DBQA 4O0LA 2GOYA 3DFUA 3U31A 5JS6A 2PQ6A 2O8CA 2W0SA 4ZYTA 4LJKA 2ZXFA 1GPWB 2Z3WA 2VVTA 1NF8A 4K9MA 2C1EA 3Q7PA 5D1HA 2CXQA 5KNDH 1G63A 3OOSA 4QNNA 3I9V6 2JA1A 4BECA 2O8EA 2CXHA 4HVLA 2WIBA 1W2WB 2RONA 1OXVA 4OA8A 3RVOA 5LQKA 4JP2A 4WXMA 3C45A 1EM6A 1KK3A 4J4TA 4YJ2A 521PA 2VF4X 3HI4A 3JALB 1XQ6A 3AWDA 4HC4A 2N42A 2V59A 2ZU0C 2B8TA 1MD9A 3PNBA 4I2NA 4RL4A 1NTRA 3DQQA 4HPXB 4N9QA 5F77A 3EYWA 4P35A 1Z6ZA 1XG5A 3KSBC 2P65A 3PVZA 1Z6XA 2QM8A 5A6SA 2IZ1A 2DZDA 2FFQA 3K31A 3I6MA 4TLDA 1J9ZA 2WF7A 3EMVA 4BTEA 2ATCA 2XCLA 3TD2A 3ZKWA 3KSAC 3MMSA 3UFXB 1W9MA 4YUAA 4CUKA 1G5FA 1WZCA 2IELA 2N75A 2A1TR 1CY1A 2NU9B 2F7SA 3EC1A 4IHQA 3NJ8A 5C3MA 2PH7A 3GG9A 1UMKA 3O73A 4B33A 2PGOA 3PFWO 3WGYA 3TK1A 2IHUA 1EMDA 3A6HA 4MINA 1YIAA 1K0UA 1P61B 3D8NA 3HFJA 2RAUA 4CKWB 4ASUA 5HKKA 4FGKA 2G0TA 5ITWA 1BEZA 1Z45A 2F8LA 1KJZA 1LF0A 1G60A 1NOJA 1XSEA 5KWJA 3DMFA 4HLUA 1HPLA 2O4CA 2R62A 1M8PA 1QXSA 3SQLA 1CY4A 3D1JA 4FONA 1ZDMA 4TXLA 4IOJA 4EKIA 5AI8A 1EX6A 2JJ1A 2QUJA 2V4UA 2Z9CA 2FWMX 4CLXA 4GP6A 1PSWA 2IU4A 5K6RA 2BF4A 4ZDIA 4KQKA 2PPLA 4LCEA 3PRYA 4YMUA 3WL4A 1N33B 1I3MA 2F67A 3Q6IA 4FSDA 3QKWA 1C81A 1JYSA 3KPYA 3IR7A 2PUEA 5FCDA 1EZ1A 2BGUA 2Q41A 4N5DA 3LT1A 4Q1DA 1OA0A 4FYWA 2CJWB 4ALJA 4C7OA 3RTCA 1XFAA 4YREA 1KDOA 1BA2A 1XJCA 3QW4B 3LGSA 3V8VA 1E5QA 1X7WA 1SQ6A 4P34A 2RHTA 1UBTS 1KH3A 1ZWLA 2A7QA 2P1DA 4IJ6A 1PO7A 4J0IA 1P81A 4CR6A 2FCAA 4YUZA 5BNTA 1UBFA 2ISQA 4LSWA 2C4MA 3HB9A 2CFSA 2C92A 2ATXA 2HAEA 1FNDA 3NIBA 4OHMA 3CUVA 5H02A 4U9HS 3RYIB 4EUEA 3LPAA 5HJ7A 4AG5A 1R50A 4FIDA 4D8VA 2BFBA 4JP5A 3WG9A 3DZDA 4AO8A 2JHCA 1HDYA 1EGQA 3T7IA 1NNUA 4HD8A 1FP4A 4WN9A 1ZGCA 3UZUA 4AECA 4CDRA 4DCCA 1DRVA 3AIOA 4YCSA 2I6TA 2SBTA 3I6BA 5IS2A 4R41A 1TTHA 1LLUA 3LRPA 4YUVA 3ZNNA 1YUBA 4HOYA 4N8DA 3LCRA 1EP1B 2BWJA 1VFNA 2FSVC 3TZBA 1DBRA 4ZT4A 3M6UA 2WB4A 2MT9A 2JLVA 1Q95A 1CS0B 5HZKA 3IUJA 9LDTA 3ONNA 2A2ZA 4Z4IA 1HG0A 1I0ZA 2O4UX 2PXHA 1NNEA 2ILVA 4X5OA 3F0TA 1X1TA 1Y1TA 4JVLA 2E4XA 4QA9A 2JG3A 2QLFA 1EK6A 2MSCB 1QFYA 2WAMA 1GG2A 4KR9A 2LRHA 5HS4A 1AZWA 2RGXA 4CLOB 2ET6A 2J32A 4JBHA 1CJUC 1UFRA 4LX8A 1KJNA 5TQ0A 3P94A 2HLPA 3UMBA 2H7CA 3NHYA 4M83A 4NS4A 3TDNA 1U1FA 4EB3A 3B9BA 4IGAA 1QP8A 1RXIA 3WRWA 1NKVA 2RG1A 1VHWA 2R2AA 4R2HA 1DEAA 4NULA 3RC3A 3WWCA 1RE1A 5FNVA 4XIFA 3ZDXB 3RBVA 3QV1A 2FE1A 1UFKA 1M0SA 2RGCA 1R27A 2Z2KA 4MWTA 3C3XA 3MSXA 1TJ5A 1XD8A 2IS6A 5LZ5A 1SU6A 1LFDB 2PA0A 3WC4A 4ZCQA 3PNLA 3D7RA 4H15A 3ZQJA 2XH8A 4JJZA 2JI4A 4J7UA 4MRRA 1U9IC 2BSXA 2QN8A 1VI5A 2QD4A 3OQIB 4GGPA 1U7ZA 3GGCA 3IVGA 3A6FA 1XL1A 2G06A 1JKXA 3AL3A 3ELUA 1G1MA 3OMWA 4ZK6A 3WA6A 1NW9B 3AERA 4US0R 3ZHOA 4A0SA 4XGIA 2RHBA 4YN3A 1WXEA 1QJ4A 2ZRAA 1H4VB 121PA 1ENZA 4L8FA 2C5SA 4RVFA 3OA0A 2W2LD 5B3JC 1KVTA 3QKRB 1JHOA 4PYMA 5AQEA 4BU1A 2CV0A 2TS1A 3V7FA 2O05A 2RHCA 4C06A 1UR5A 1Q15A 3OY7A 4X8HA 4X6UA 4RDHA 5AK3A 1SD1A 1XEWX 2ZRHA 1T3TA 1YULA 2XGSA 1J9GA 4MEJA 4P2GA 4PNPA 4RJJA 4RJLA 4YDRA 4EW1A 1XMOB 1M73E 2PFGA 3VVMA 4DRZA 3R9XA 4FXOA 3IV6A 2GZRA 3HG7A 4TWAA 4JX8A 3LECA 4MUMA 1ISGA 1IY1A 4DLXA 1PV4A 2OZPA 5FI1B 1OBVA 5JFOA 4ARUA 2BGKA 3V97A 2C2HA 2DULA 3ONFA 1B43A 3CUYA 1K88A 3WJ7A 2E4YA 5G1OA 2D0DA 2BGGA 1KR5A 2OHVA 5JH7F 3MINB 3G6WA 3VH3A 4AN0A 1ZCZA 4A92A 2HSWA 4DLNA 5FPTA 1JE1A 3DNFA 5BQPA 3WKEA 4FB4A 3HP1A 4NBWA 4NBUA 4GX1A 4HRXA 1OGYA 3MC1A 3VR4D 4EGJA 5T4FA 3P0JA 4KPUA 4Z49A 5JSHA 3NLLA 1ZESA 3ISJA 2VHQA 1PS8A 2E4AA 3L6DA 4Q4AA 2CMDA 1WZEA 1N57A 4C0AC 4UTNA 4AG6A 4BJHB 1M8JA 4G0UA 2Y68A 4FLMA 2E21A 4JLJA 4M1ZA 4C4YA 4NZZA 2FJ0A 3W3AD 3DE7X 3FD8A 2HGZA 4R5MA 1QH9A 5AM2A 1ZSYA 3PNSA 3QF4A 4N8SA 2A7XA 3VZPA 4YV2A 1GEEA 1CNMA 1GFSA 3B3QA 3R2JA 5G3ZA 3WKCA 1L7VC 1UKVY 4KPFC 3QI2A 2I7XA 4FKBA 4UMVA 4UUAA 1POXA 1U2QA 3WK4A 4R98A 5FFNA 3T06B 1VJ1A 3EXAA 3ONDA 4EF6A 1FS4A 3L8ZA 5KPJA 3OFSA 1HL3A 2PAAA 1XMPA 2CNWD 3COJA 1NVEA 2QOEA 4HNGA 5IDQA 1S3SA 5AXDA 1FYDA 2LBPA 3KXDA 3OJLA 1KO1A 3AEQB 1DMRA 2C97A 1NN3A 3MQ2A 5JR3A 2JAHA 4OMDA 3TQRA 2W22A 4JIMA 1IZYA 5DSZA 3DVLA 5TQJA 3KIPA 3LZCA 5L3ZA 2QRHA 1P7WA 5K3AA 3L7AA 3KUDA 1BXKA 1ZXBA 4OLBA 2VHUA 2VA8A 4UTRA 2QN7A 3QPUA 4MYRA 4NSNA 3VNRA 5BSEA 3MUFA 1Z06A 2QJOA 2Q9AA 4KV9A 1YCDA 1LPMA 3I64A 4Z0HO 1G6KA 2FZEA 1ML3A 2FWAA 1Z0ZA 1UT8A 1AMOA 1SCDA 4QGHA 2H9AA 1OVMA 4L6AA 2J7PD 4MVJH 2CNOA 4Q3LA 4NIMA 5E7QA 3RARA 5JJIA 1BGXT 2FDRA 3R5FA 1RKUA 2IIPA 2QU8A 2IEIA 3MILA 3G7UA 1OFUA 1CNFA 1TMKA 4PGGA 1UH5A 3H6GA 4HGRA 3PPYA 4IY1A 2DX7A 2QA5A 1UUFA 1UXGA 2J7KA 3PX2A 4K86A 4RMIA 1BDHA 1GO2A 2FSVA 3D0QA 3GB9A 5FX2A 5B55A 1LNSA 4Y67A 3CRQA 4C7BA 1A9ZA 1Z17A 4PANA 3P9NA 5LA6F 4X3OA 4BGVA 4GPBA 1VLMA 4A0FA 4K03A 2J5BA 3Q9SA 3OQJA 3LD9A 4EUSA 4YS6A 4EMUA 5EWJB 2OGTA 1ITZA 1MH9A 1WMFA 2IYXA 1V16A 1C0IA 4L72A 4OHUA 4P4NA 5JJ5A 3PTAA 3PE3A 2E1PA 2JFVA 2Z5FA 3FOWA 3SDZA 2D1SA 1E6LA 1NYLA 2EEZA 3ENQA 3IALA 3UJ9A 5HQ3B 1MUUA 4GOLD 2B99A 3T38A 3RI3A 3K71B 1G20B 2ZRQA 3A1WA 4PYKA 5C7YA 3KVYA 3SJ7A 4X1KA 4GS5A 4OB6A 3SHWA 3ZCPA 4ZI7B 5GAJA 1AU9A 2FWIA 5CDFE 1VYTA 1RJFA 3QU9A 1Q1BA 2JC3A 2R1UA 2XI4A 3EFEA 1Y4ZA 3QWFA 2QXUA 1JHXA 2DH6A 3KJXA 4FFSA 2PBLA 3H42B 3NGXA 4R7TA 4J0JA 2LWIA 5FTJA 1I3LA 3N1UA 3W2IA 5FR2A 2JH8A 1XELA 1VE1A 4KXVA 4P92A 4OQZA 1U9IA 2B25A 1C7JA 3ICVA 5JD6A 1BOOA 4QPPA 4A6PA 4X3CA 1WPXA 4UM7A 4XFDA 2P2GA 2JBAB 3OCUA 1RP7A 4GI3A 4WBXC 2Q0QA 4GMXA 4YB8A 1T5LA 1NXXA 4QWMA 4RMNA 3NAGA 3HJUA 3SX0A 2ZTUA 1K8RA 2Q1TA 2ZUWA 5B3JA 3UG7A 2E37A 4IQGA 4BGIA 5HR5A 3KFXA 4TTJA 4R31A 3I2GA 3JSXA 3GCXA 1H1DA 3KLNA 3OIDA 4D56A 2PZ8A 4QFMA 4ZYXA 3KRTA 5D5HA 5LLTA 5LP6A 4AMZA 3CIOA 4JLAA 4QASA 4PO8A 1UBUS 4R0MA 3C43A 5F51A 3L92A 4MYDA 4B8WA 1B6TA 4J7XA 5IF3A 2O0KA 3LFHA 3OX4A 5K1ZA 2QRKA 5L40A 3EHDA 4G41A 1G55A 4O2BF 5I9TA 2VYQA 4BFTA 4EI2A 4F3NA 3OIGA 5IT0A 2YNMC 2Y0PA 3PX7A 1O57A 2FV8A 1AURA 1BQEA 1K6IA 1CR4A 3B6KA 1KTIA 2GBFA 3PB3A 3VSAA 1NJ5A 4S12A 1QIHA 1J6UA 1FLNA 1ZMBA 2QUBA 2XNDD 2CXPA 2JIZD 3GT7A 3QVKA 1RZVA 1YQEA 1YQXA 2JH9A 3IVMA 1GTL1 4WD3A 3R74A 2SICE 1O4VA 2QZJA 1GP2A 1C7EA 2CMHA 3HWRA 1OR8A 3WB2A 2PV0A 3GRYA 3S6JA 3B9RA 4CGZA 4EJ6A 2YY7A 4U7PB 4E32A 5G0WA 5AVVA 2O3TA 3ZQKA 1XGKA 1ZHOA 4GOOD 5ALEA 1A8UA 2D0IA 2FFAA 5ARDA 5AW7A 3L2OB 1DXYA 3BUSA 4TTPA 4ZO8A 2G6BA 1EFRA 2YOHA 5BR4A 3ADBA 3KWLA 3HNPA 4B73A 4ZI2A 3LL7A 3T41A 2ZXEA 4E6EA 1ILWA 1JKIA 2GEKA 1I8TA 4ZCPA 2RCYA 5T5QA 2QR3A 3M6IA 4NBLA 3Q0TA 1E9AA 4WKCA 3SQNA 2QG6A 3BQMB 3WE7A 3GNQA 2ZS8A 2BZSA 3ASVA 2CVHA 3K6JA 2IUSA 5DTEA 3PZRA 3SZOA 1XQ1A 4KQCA 4RF3A 2QTAA 1BXGA 1ZPDA 3DL2A 5AM3A 2Y8EA 2A4MA 1H6CA 2F4NA 3QTLA 2RHMA 1GZSA 4GWGA 4JVSB 2FG6C 3UT5B 3KZXA 1F6DA 1UADA 4F84A 4G5SA 3R9KA 1T8PA 4MGEA 4RPKA 3OD1A 1VJDA 2IXBA 4XWAA 3AEXA 3IESA 3RWOA 3CX4A 2F3UA 3A1FA 3UATA 1CUWA 1T34A 1NI5A 1KEUA 8ATCA 7ABPA 1FFGA 3BPSA 4N6OA 3LY9A 4KGZA 5SYNA 2ZQ5A 1V5IA 1QTRA 3F67A 1GIAA 4DMGA 4OY3A 2YQ4A 3RAGA 1QRRA 1BHQ1 4KODA 9GPBA 2G3YA 3S29A 3FWPA 3CZAA 3CURA 3OP1A 1ARZA 1B8UA 3UGJA 2PNJA 4PGMA 3UYLA 4OHWA 2OFXA 5HMMA 2XRMA 3HKCA 3ITDA 3RO7A 2G5TA 2Z8ZA 3M81A 4W7HA 1A7UA 4Y1FA 4J1SA 4ZQBA 3UG6A 2ZB3A 2BKUA 3RVNA 1QVAA 2XVAA 4HUQA 4INZA 4DDVA 5H4GA 3Q8KA 2XIJA 5DYWA 4BO5A 4TTAA 5KIAA 5LBUA 4B79A 1EP9A 1YA8A 4ND8B 5FOQA 4BB5A 2CY0A 3K4QA 4O2LA 1M33A 3JQQA 4EKNB 5CA0F 1M75A 1WV0A 2OG1A 3HLYA 1QE3A 4ZPJA 4R9VA 5THXA 3ZWKA 4Z3OA 4ZTUB 2ZSAA 5SZKB 1W0JA 1KZ7B 3JTEA 3V1MA 3KYCA 1USGA 4R71A 3NTLA 2CJYA 3PD0A 2R8BA 1QB8A 1OCEA 2NTVA 4N47A 1E92A 4CE6A 2HY7A 1MORA 4KFUA 4KXMA 4R8RA 3T4UA 3BSYA 2H1SA 4EKDA 4DLWA 4GE0A 4DA4A 1JSCA 3CW9A 1P2DA 2WSYB 2HPZA 4LE1A 1ES9A 3QVUA 4OQDA 3TJRA 3I9NA 4QPDA 1P1BA 3WWEA 1ZU4A 2BE7A 3CMMA 3ELDA 4PCUA 7MHTA 5FULA 3VC3A 1HM5A 1VL0A 4X9XA 3HVKA 4KLCA 3JD2A 2PLNA 1N3BA 4ADSG 2OBLA 3H9GA 1TZBA 4M2LA 3JQBC 4H7KA 3BWXA 3O83A 2IW1A 4MDYA 3OFVA 1I6KA 1KS2A 2YHBA 3ST7A 2FVYA 2PJDA 2P9HA 4L7QA 4EW2A 3TTTA 2BT4A 5HBGA 3QNUA 1P17A 2G36A 2J45A 4G9EA 5F78A 1GFIA 3SCZA 4PX9A 5ADWA 4L1KA 4WXEA 3KT0A 3NW9A 2PMWB 2NTEA 3UK0A 3LQQA 4YCLA 3D3EA 3L7NA 4KTVE 4X3PA 2X40A 1NFFA 3AGPA 4TLBA 2MSEB 1JDBB 3CE6A 4IF4A 2OL4A 5J1TB 1C7QA 2D1RA 2ZYWX 4CEJB 4I8XA 2Q2OA 1G6OA 1IXSB 4HEA6 1BN6A 3RREA 2XTJA 1XZQA 1H8HA 2Q6OA 1T15A 4REQB 3H6KA 3MD9A 4YAJA 2PS9A 3EASA 1TUBB 3MTEA 3AJ9A 4J2TA 1U0FA 4RFLA 1NULA 2W4IA 3M83A 3CX3A 4HAVA 4TV9F 8MHTA 4HGZA 3K20A 1NXQA 3TLYA 2AK2A 3U9LA 2C61A 3OZCA 4BNHA 3ELWA 2J5RA 2VUHB 5B4UA 3AV3A 3PUHA 4UTZA 4UOQA 2IH4A 2BUAA 2ZRFA 2XTNA 3CZRA 3FOBA 5KTTA 3T5PA 2IJGX 4JB2A 4L74A 2GJ9A 1YQQA 3DDWA 1HDRA 3W9SA 4U8GA 2XOXA 4GOND 3MTQA 1G8PA 1T0IA 3DHNA 3E3AA 1Y8ZA 1FDRA 2GTIA 4RSMA 3QYJA 1HDEA 2BEWB 1IDN1 5KWSA 2FCRA 4R8SA 2IHKA 4C7KA 3WKBA 4C6TB 1E2FA 2YNMA 4MVJD 4NAVA 5JECA 3M9XA 4IIHA 3QFCA 3D7MA 5T4HA 3C1UA 3S27A 4DEYA 4BBAA 2NP6A 4YMTA 4X44A 3RSFA 1GSOA 5KUTA 4GW3A 4O3FA 5JS2A 3JV7A 5JTTA 2HT1A 4FR5A 5TF4A 1Y4DE 3E1GA 5L53A 3K9FC 2A0XA 2PCLA 3LYAA 1L4BA 1LUAA 1FMFA 1A97A 3SR0A 3TIGA 1JQJC 4X6YA 2I9KA 4W5OA 5IAJA 3RIMA 2WBLC 5EMNA 2HMSA 4PZLA 4B8YA 2H1HA 1PJRA 4EAQA 5KU1A 2YY5A 2M1XA 4D97A 5U1PA 5ISMA 1J2JA 3JQAB 3PWTA 5DNYB 3GG2A 3Q3GE 4LJRA 4P83A 2F1HA 4Z9YA 3SR3A 3ZXUB 1VPDA 4EUHA 1K3TA 2PEYA 1EX1A 3P26A 1JE0A 3V2UA 3VJKA 2IEAA 1SULA 1RKQA 2FF5A 3GEIA 1KXZA 5JARA 2GN6A 2H9IA 3EIHA 3KELA 4RNCA 2PUTA 4P58A 4ZVNA 3JZAA 4AICA 4BZZA 1K8ZB 4HAIA 4EHNA 2FW9A 4LHZA 5F1OA 2P9ZA 2JFOA 2J87A 1Q92A 4FIZA 3TYXA 1E7SA 1IYZA 1DBWA 2HO5A 4MV4A 5ENZA 5HQJA 3O2SB 5JADA 1D0VA 2AV6A 2JGDA 3V7YA 4TXNA 1SQGA 1RVV1 3TEMA 2CLFB 1SCUA 1BROA 3GFQA 1GXSA 2B30A 4BMZA 2R751 5I47A 1Q20A 2HCJB 3VSEA 2NX2A 1JQAA 3M4XA 1KFEB 1U8AA 1XVIA 3SSOA 3O82A 3ZS9A 1F0YA 4JOQA 2F43A 1O96A 4KAXA 2PUDA 2RB5A 3E7WA 3WMGA 1Z2NX 4M0MA 4GXRA 4G5OA 2VDJA 3OKAA 4J2HA 5IWAB 3ETCA 3EEBA 3EGIA 1UKZA 1SOVA 4M49A 4XPZA 4GYWA 1E2MA 4IFIA 3OTIA 4PBRA 4WLUA 1FEZA 3CUUA 4BC0A 3AM4A 2ECKA 2ZOSA 2Y0DA 3N2LA 1JW9B 3T5BA 4R1OA 4D0RA 4UUOA 3ZW9A 4NU0A 3G1WA 4NU6A 4F4DA 1HE2A 1BXRA 2NYUA 3HUTA 3M49A 1HE1C 4G2TA 4G63A 4UUQA 1JLSA 4BRUA 1NU8A 4DLBA 2QYHA 4YGXB 4LOLA 5EUCA 4WESB 4PZ9A 4WBSA 3UHPA 2E87A 3V8MA 1S89A 2Q1WA 4Z51A 4AZWA 1U28C 3R9WA 1SOUA 2FX5A 4AKIA 1E2NA 3I8SA 1UQRA 3JAWB 4B4KA 4Z9AA 1P4RA 5KJEA 3VVLA 5JTUA 4GECA 2XWPA 3JQAD 4YJFA 1KDYA 3K6SA 4MKZA 5LJIA 2C59A 1JAZA 2E49A 1Y9DA 3HDYA 4H7IA 3ZG6A 4R8VA 1C41A 5IJAA 1MEEA 1DUSA 2CHQA 2YC4C 5AHXA 5G0SA 1Y9ZA 2GGSA 3E23A 4L07A 3I62A 5M34A 3HY4A 3EIXA 1YZQA 3TDMA 1RXUA 1V8OA 3AZOA 3WWDA 1N32B 1RZ3A 3SNKA 3ML1A 1WHSB 4Y9SA 1WXGA 1DJNA 2ZSUA 1PZMA 3DVQX 3LTEA 3ZHXA 5BSHA 1GLGA 1QFZA 1I1QB 3EVEA 3IA7A 1P9OA 3TPZA 2XRYA 4DM7A 5FOXA 4ZOQI 4CIBA 1E1KA 4KYVA 4TUYB 4G0XA 1VSQA 2IZ7A 5D00A 4FN5A 1Z8NA 4CIDA 2NIPA 1XCMA 4N0DA 2W9XA 2D2VA 2XE7A 4HAWA 3RQIA 3GA5A 3JQBA 1NRWA 3FBWA 1M2JA 2VZ0A 1N75A 1GQSA 1NLUA 3N2NA 3WGLA 4LN1A 4MUEA 1M5TA 2X14A 4DMHA 2R00C 3HJTA 4DG8A 4HT3B 2WP8J 5KYXB 3U4CA 4PRLA 1ZIYA 4GXQA 4HQ0A 4DLVA 1GLNA 4W9MC 3HO1A 1DC5A 5ENDA 3HEAA 3ZDYB 1DKUA 2HU2A 4CLEA 2NQ2C 3D02A 3T9DA 1G4AE 1M6VA 1F14A 4QTZA 5JY1A 2QVBA 5LBIA 2RH8A 5J3JA 3OAAD 4J0KA 2DBZA 3F96A 2AXQA 4KE7A 1MV8A 3AY7A 4YWJA 1N2CA 2B8NA 1TKAA 1AUVA 3HWX1 4MB0A 2KX7A 4MITA 2R85A 1XKTA 4N3GA 1UZAA 3P5SA 5ALFA 4ZWNA 3UHOA 4B3GA 2QV7A 3QHQA 2IYZA 2OEPA 4PN7A 421PA 1H42A 1AN0A 1JIVA 2XKJE 3JQGB 3B8EA 1MENA 1P2FA 4LKOA 2GEJA 3HGQA 5JZ9A 2FMXA 2DUWA 3VX4A 1DP4A 1N2GA 4L22A 1A72A 4MQFA 5K45A 2EG5A 1E9CA 4FW8A 3UB4A 1X7ZA 2ADFA 1M2OA 2AJBA 3C3WA 4RXUA 5CNKA 2J59A 3QU5A 1PWXA 2GN0A 3LMKA 4V0MA 2PRSA 1RXYA 1MJFA 3LDAA 4HMQA 2FR1A 3T7TA 4AKTA 4HZIA 1IHOA 3DE2X 4CKCA 2OORC 2WIJA 2GHIA 3KQUA 1BWSA 1E1LA 1LBTA 3UHJA 4KP7A 1XP8A 2NPIA 4F4UA 4NDZA 3ELYA 3WIVA 2Q27A 1BKSB 1Q7EA 3EVNA 2IWRA 2V7QD 2LPMA 4I9HA 3ICEA 3QQPA 2B0JA 4HX9A 4WZ6A 1LLDA 1ZHHA 2DSTA 2YH2A 3GR6A 4RPGA 5K4AA 3B38A 4Q9DA 3T54A 3AEKA 1N7IA 1RHJA 1FIUA 1XE3A 2FAXA 4YRQA 2HJ9A 2R8ZA 2WJ3A 4GI1A 3V8EA 2BFNA 5HRUA 3MJDA 3LVFO 3MQFA 3OZRA 4LYAA 1LTHR 1RCUA 2VDMB 2XMRA 3WFZA 5I3CA 3T3GA 5DT9A 3QNMA 3CVXA 3P96A 3AF2A 2GN8A 3PHCA 3WGIA 3AINA 4IQFA 3B9PA 3STTA 1PF7E 4PQYA 4BBJA 5L4SA 3OIYA 3NT2A 1EXNA 1GGVA 3QLEA 2IUYA 4HWOA 4KJXA 1XZDA 4MLZA 5ERXA 3TMYA 3IQIX 3ZV7A 5EI5A 3A7DA 2PMKA 4PLGA 4G1UC 1WF3A 4WK0B 4YJ3B 3WL5A 1NVMB 4GR5A 1Z74A 4AMVA 2VUIB 2Q5JA 1NLZA 5DULA 4RD3A 3LGAA 4XX0A 2Q8QA 4UHFA 3GQVA 1PZHA 1Q6ZA 2HNAA 3MQ4A 2ACEA 1N8TA 1KOJA 4R3NA 1ORRA 2V5VA 1K75A 4B5KA 1K06A 2SECE 1GGEA 4JXXA 1YZGA 5IVDA 4IWNA 3ROZA 3W04A 5BUCA 2P0YA 3OOWA 4BHTA 3E4DA 1QHGA 1BYUA 4B3CA 3RGGA 1G2OA 3NDIA 5K2MA 3V1LA 3OJ0A 1A5SB 5KDDA 2VH1A 1KTVA 4UCXA 2BMVA 2WJPA 5EJMA 4DWWA 2WYIA 1KAMA 4O2AF 5HIIA 2QRLA 3RK1A 4INAA 1MTZA 1P6QA 1WBBA 2E18A 3TOCA 2NO7A 4AULA 2QT1A 1A9TA 3DAOA 3UK7A 3TQSA 2AG6A 4UKDA 2I9PA 4GQIA 1L5GB 4YI5A 2OAGA 4BOYA 5BWOA 3C3AA 3DZIA 4PYOA 1OY1A 4YHBA 4U7DA 1TKRA 1OHHD 4MR9A 1ZINA 3IKTA 3JD4A 1YZNA 3TAXA 3T5GA 2ZYAA 3ZGXA 1WUIS 1U28A 3HY3A 4XJSA 5TQ2A 3H2HA 3N2KB 1UBRS 5DBFA 4QUJA 4ZKDA 3KE8A 2A5YB 2R66A 3LO5A 5KVVA 3A31A 4POOA 1NXVA 3ZDAA 1TC1A 3BH6A 4MWEA 1ZP6A 4BV2A 2BH2A 3AVWA 4ZANA 1YRHA 2R6R1 2ZSEA 3ROQA 4D9FA 2RIPA 2CL6X 1E60A 4NENA 4Z1OA 4KOEC 3G0BA 4QDUA 1YRYE 2BFWA 2HLDD 2I1VB 2YJ6A 2Z1NA 2H1VA 3IQFA 1MXHA 3OU7A 4N0MA 4ZV9A 2FSHA 2Z9DA 5LM3A 1GYQA 4OGGA 3HKBA 3NBUA 5JNLA 1EESA 1FMJA 3T0IA 3WKDA 5T67A 4W5RA 3A10A 4YLEA 2OVFA 5EMJA 4M1YA 3COVA 3CGGA 2JGIA 4G84A 3T1TA 1YQTA 1RC1A 4J16A 2X0KA 4MVJG 1QC5B 2A9PA 5I45A 1F2UA 2XF2A 5T8KC 3K0EA 1A2QA 2DH5A 2M32A 1HTBA 3QFRA 3MGKA 3TLBA 3WHLA 1W29A 3BGSA 4DA7A 1NSYA 3AL0C 3HYNA 3UM9A 1QDLB 3C97A 2A4KA 2HA5A 3UV7A 2R00A 3EVFA 2KS6A 5E9AA 3WSWA 3DWFA 4G0OA 1FOEB 2VRBA 4FVTA 3MJHA 5C4GB 3AYZB 3WGMA 3W7BA 4DWOA 4EWLA 2AZXA 3HXOA 3FYTA 5TC4A 1T9HA 1A2BA 1L7NA 1DEKA 1X92A 2A1TS 2NUAA 2FEOA 3H84A 3NO4A 4BQRA 4ESHA 4EW6A 4ZHQF 1JHVA 3G8DA 2FWNA 4HWGA 1RMYA 3TX6A 4ZGWA 1DG9A 2YOGA 4X94A 3TR0A 4CIAA 1R4NB 2ZYRA 4UE6A 4BQEA 2A14A 1T13A 1EVEA 1DC8A 4OKSA 2O48X 2GCIA 1SKMA 3GLGB 3DVRX 3MCUA 1C1YA 3GDOA 2V6GA 1JV2B 4YCNA 4XWOA 3PNVA 3V33A 4LZPA 3LY5A 2ODPA 4NYIR 4PE5B 3THYA 3QXJA 2HMUA 3AU9A 1U8CB 3ZWVA 3NCHA 2VQSA 1XCOA 3GD5A 4D82A 5EJ2A 5F5XA 4DR1B 3W6OA 5LDGA 4BNXA 3EXFA 2ZRPA 3FPKA 4LS3A 1KI1A 3E81A 2NXNA 2AJ8A 3T7RA 2FEKA 1HX7A 3CM0A 1AKYA 3MPOA 4BFCA 3I83A 5DXJA 2GERA 3HCPA 3UJ7A 3LT4A 4NWIA 2GTHA 2ZVJA 3QU7A 1J8DA 1C7IA 1X7YB 2OORA 5CPBA 4FGJA 2VTBA 4DCJA 2YMPA 2WB2A 1CY8A 4BCCA 1YJ8A 1PDOA 5CIQA 2YV5A 3R20A 3SJBA 1YRQA 1N4AA 1SQ5A 1E9VA 1SVIA 2LVBA 5EG5A 4RVCA 4EGCB 1D2NA 2WIAA 1HDCA 1NUSA 1RLTA 2WT4A 1PV1A 2P91A 4N76A 3L5OA 1WL8A 4KRYA 3W05A 5FWNA 1JWBB 3PA6A 4E70A 4G5HA 1VFPA 1M66A 5FBZA 1FJHA 5CJJA 3WAJA 1VRCA 3FA2A 1JEYA 3I5MA 1DVRA 3NBMA 3E7PA 2PN1A 1W4AA 1XDSA 2WTNA 3GPDG 2G63A 2I0FA 2WJ4A 3OM1A 4L8VA 1ODTC 1WHTB 1E1QA 1LV7A 4LPSA 1GU0A 4F0JA 2BI8A 4L4SA 4MW0A 2NU7A 2QX6A 1SVSA 4IINA 1YDFA 2QKYA 1YR6A 3JWIA 3M6LA 5K0LA 1ZEJA 4TWBA 4KR0A 3AJEA 4A3SA 1A7AA 4IXTA 1W5TA 3RFXA 4QQKA 3DVAA 4L27A 2Y3IA 3GRKA 4OTZA 2CBGA 3NDJA 2GKSA 2CNNA 3BL6A 3GEHA 3NGMA 3PIIA 4MO9A 5DE3A 1FFCA 4HCJA 4DTIA 1KZ6A 3CJQA 4W5HA 1K98A 1XOIA 3H5TA 3ZLUA 4EKYA 1X7DA 4FYVA 3VO1A 5JBNA 4WINA 2V7UA 1L4KA 2DHRA 1U11A 3FBTA 4ETWA 4TZ6A 1XZMA 3FYUB 2ZTVA 4S1WA 1NI4A 1V8DA 2QW1A 3O8OA 1PX2A 4G37A 4HFNA 2GASA 3QVGA 2FJPA 3A70A 4RKQA 4L4RA 2NXCA 2UYHA 2CYCA 4XGKA 1K6MA 2PZAA 1KQFA 3VSBA 1U5CA 2FHPA 3IB6A 4OBEA 2AC2A 4WFQA 2CC2A 1BX0A 2XE8A 2JEOA 2WC1A 3W4IA 4NCAA 3FFXA 2IDJA 3MM4A 1J25A 4RDCA 1THTA 1HO3A 2V5UA 1MOPA 3AX6A 2F8MA 3H2YA 1ENPA 3AHEA 5B2FA 4V24A 5HBRA 3T95A 4GICA 4MTCA 1CETA 3X3HA 3VNVA 2R5NA 5ITZB 4DEXA 2QENA 4MW5A 2DRIA 3DZGA 4O2RA 3S2EA 2FN9A 3WXBA 4L8WB 4Q9HA 4M76B 2FPSA 3CB2A 4N40A 3VHLB 3DDSA 3WYCA 2F3PA 1OA1A 5DHTA 4ZGGA 1FMTA 1YZFA 2H2AA 3A6DA 1E79D 2ID7A 3GRVA 3JAKA 3W8FA 5C1OA 4N0EA 4X1YA 4WERA 3ZKWB 1JZQA 1OXKB 2IXAA 1FDIA 4UEWA 1Q7BA 2OAQ1 4OB8A 3BEOA 1W2HA 1AKUA 3NUGA 5HFJA 1AQJA 1BH2A 1GT91 1G8GA 1PLKA 3FSRA 3GLHE 4MGYR 4AWXA 3AONB 3LAWA 3QV2A 6YASA 1ZM4A 3BE5A 2UZ1A 2AFHE 5DHPA 5KZMB 1Q57A 1FDOA 3EY9A 4KE9A 1N2EA 2AKEA 2FXIA 4XCVA 1AG9A 1XFDA 2AMFA 2XCQA 4J76A 1Y80A 1ZZGA 4R9SA 1L5ZA 2WF5A 1U8ZA 3A3OA 4X7MA 4Z0TA 2A59A 5T8KA 1DZIA 1XXHE 1AHHA 3HE3A 3HO6A 4NH4A 4J7AA 1XVVA 4U7JA 1KYZA 1AK1A 1V35A 2BDUA 2Q2QA 2ZTSA 4BQOA 4GBJA 4MDHA 1SD5A 3LJKA 3P9ZA 2COKA 3REGA 1MDFA 4F38A 1XTVA 2H92A 3HRIA 3VPXA 4DCMA 1G0OA 5JJBA 3D0RA 1WM1A 2I2FA 1ZRMA 3C3KA 4JU9A 4NQRA 4QYIB 1W34A 4MCAA 4HNRA 1KOLA 4LVUA 5JAPA 1RRMA 4C7VA 5CYPA 1J70A 2VS1A 5EZYF 2W83A 3DKVA 3HBJA 2FG7C 4YI3A 2O2DA 4N4AA 1YF3A 1N3LA 1NQOA 1X9HA 5AXCA 2B2NA 4YAOA 3VPDA 3GLFE 4XQEA 2ZYTX 1Y3FE 3L1JA 5ANRB 2RK3A 5IUKC 1AHPA 2C2MA 3MJEA 2WHEA 5G40A 1QTQA 4PV7A 3VMFA 1RI1A 1T0HB 2VJQA 2I3GA 2QPOA 3O75A 3HU3A 3QW2A 1H85A 3FN4A 2YZNA 4P0TA 2G72A 4OXIA 4Q24A 4DIFA 4KN5A 1WNFA 3DBHB 1J0AA 4TOIA 2WMYA 5G4KA 3D5TA 4NCHA 4JAVC 1E7WA 1Z6TA 1GGFA 3I1IA 5TJHA 3UGQA 2YYZA 4RZ3A 4EI7A 4RD2A 3VZQA 4FGSA 4KDFA 1P9RA 3IJRA 2JJYA 1HYGA 1HETA 2WA2A 3D8RA 2GCOA 3M9WA 3GAZA 5BQ5A 4OQNA 3A6EA 1A76A 4YP9A 1CCWA 3Q0IA 4DLKA 2GJ8A 4QNMA 1T1RA 3HBNA 2DBRA 4YP7A 4JMLA 3H4MA 4LKRA 2PD4A 2D13A 3WAKA 1TIPA 2V9ZA 2W2VA 3FM9A 3G5AA 4Y2TA 3KWJA 5K8TA 2ZR7A 4CLRA 3UIEA 5J1SB 2ZBRA 1CXZA 1JI0A 2DLNA 1G8YA 3K2BA 3LPCA 1MIOA 4LWOA 5BURA 4RTNA 2GD0A 4N3NA 4PTLA 1RYYA 1Z4LA 2PDAA 2IIBA 4RF4A 3QI7A 4IAOA 3BDIA 2WUEA 5JANA 4Q5IA 2WG1A 4TS4A 4JV5B 1M67A 2GJSA 1AQIA 4DJFC 1Z2DA 3HB0A 1GNVA 3ENKA 3V55A 2OR3A 2GZSA 1FFAA 1P2GA 3FVRA 4Y6SA 4XLLA 2AD5A 4E08A 4ENVA 2B1JA 2PSHA 1J8QA 3KEQA 3B52X 2BLLA 1YB6A 4RWEA 3O2NA 5THKA 3F78A 1GA1A 1TAQA 5FL7A 1A4XA 1L5LA 1FFXB 1FLAA 2JIRA 5CG1A 5K9ZA 1NG1A 3B1VA 2PUJA 2X86A 4KG7A 2DSNA 3WX0A 3CEHA 1KJJA 2FMTA 3RHTA 3DYBA 1EX9A 1E3MA 2YWXA 1WSWA 2ZUSA 4RJIA 4JC5A 5L6LB 1Y7HA 3VKHA 1TU0A 2GILA 4NCNA 4MARA 1QS0B 2GTPA 2FJUA 2WUFA 2PY6A 3HM9A 2ODWA 1TX4B 1JPUA 3UB2A 4L0CA 2WNIA 3KPWA 4H35A 3T5DA 3T61A 1CQZA 2R7AA 1P19A 2QE6A 4N65A 1IQ0A 2B5OA 3AC0A 3QK7A 4QOIA 3BGIA 2B4TO 4HDMA 4A23A 1WZNA 4EY3A 2PA3A 4I5DA 4BMXA 3JWPA 1D07A 2DUNA 3PRHA 5EIEA 3NHPA 4XA8A 2HWUA 2PVCA 3GJXC 5IVPA 3QUBA 1Z0JA 1UBOS 2NU8B 2WJHA 4L5IA 3U4QB 3RS0A 1N6OA 5JLAA 2JDIA 1VA5A 4BEJA 2OV3A 4B2YA 5CDYA 5B3AA 1N6LA 3DPIA 3HA2A 4XSVA 1ZU5A 1IEQA 3MYRA 5HILA 4DLAA 1BX1A 3ETNA 1RLIA 4WBNB 5DM2A 3WIEA 4JZKA 1BZYA 2O59A 1TTQB 4PONA 1BGVA 2B1QA 2P3LA 3LXXA 3SQMA 1GUBA 1GJRA 3L84A 4RXTA 4AY2A 3NIWA 3CNEA 4AUEA 2Y1CA 1R0SA 3HLKA 1PGQA 1RI5A 3PHBE 3U3KA 2PZJA 3R3XA 1FC0A 4PYJA 2VPWA 3FCOA 1SR8A 1WEHA 3PGXA 1RYHA 4KPGA 1WULS 2B5VA 2KLHA 4EPWA 5M2QA 4CM4A 1PG5A 1KPIA 2JD1A 1XPOA 5C1DA 2OCDA 1X7GA 1DWOA 2AVDA 4MWOA 1H8ED 1I10A 2HTFA 2WAXA 2Q6LA 4ZAXA 5G53C 5BSUA 4HTAA 4XB2A 1Y63A 1EUCB 3W5SA 4Z3KA 4FFVA 3SK0A 3N2ZB 2JGJA 1JU4A 1LTKA 4KIJA 2WNSA 2E2WA 3V1YA 5IAAA 3L0CA 4U39A 3CVVA 4IV5A 2EFYA 4MLDA 4MCJA 3EZXA 3DNPA 1RYEA 4LXHA 1V1RA 4R1MA 1G5RA 2J46A 2PPVA 2B1IA 2YYYA 2YXBA 3O2JA 2V3CC 1O54A 2J6IA 2B69A 2PQ0A 4RETA 3U9TA 4J3JA 2FH5B 1ND5A 1DFHA 4EH1A 4LJ8A 2NO9A 4Q21A 1DV1A 1HXHA 3AM5A 2NOAA 1QIIA 3LA8A 1LTQA 1FVOA 1K4YA 3N87A 2WZBA 5AW4A 1VL6A 3KALA 2FSPA 1E7MA 5K3SA 2YWFA 1WW3A 4OQFA 2KB0A 5E6RA 4RX1A 4YQZA 4OI0A 3Q88A 1DQSA 1FDTA 3MMPA 3EY4A 3RFFA 4ZI3A 1HOXA 2BGLA 5FPPA 2AX3A 3DONA 4R05A 1XTQA 2EV9A 1DLJA 3UJCA 1RHQA 4OM8A 2IOYA 4P32A 4RE6A 4QDZA 3KWMA 3EUEA 5INTA 2NYAA 2B20A 3L9WA 1TRKA 5EHGA 5GMOA 3ZHTA 2HJRA 3ZV4A 5LXTF 2D5CA 5BSTA 2C2XA 4MOWA 5EIAA 1LZKA 5L3SB 1U3WA 1TA4A 4MAAA 4X71A 3CFYA 1Q44A 2C77A 1RI2A 3KU1A 2EW1A 1TYEB 1E3EA 3IXMA 3HYRA 1G3IA 2XA9A 1RHMA 3TVDA 1QGUB 1DIAA 1QKKA 5JDCC 1J1IA 4QXMA 3D6TB 3F6BX 3CINA 4YO7A 3TLJA 2BSAA 3AB3A 5LIRA 5K3BA 3SC3A 3T7CA 2Z6UA 3VNUA 4B85A 3ACCA 4I9NA 2FPIB 5F4ZA 3JQPA 2WZQA 2O5VA 2HV8A 1XCJA 3CKYA 4ZVMA 1UMCA 3DCIA 3AUUA 1JPVA 1PBNA 1PX0A 2Y6VA 1CE8A 3DC7A 3PCTA 3SE0A 3VR3A 4AURA 4ZMBA 2PL3A 2NVUB 3IEKA 1KPGA 4BWVA 3JVIA 4F6CA 1T4GA 1B26A 3DV2A 1MA0A 3DE0X 4NESA 3EGEA 3PQ7A 1ZNZA 1HQYE 3H5LA 4IJMA 2AUTA 4LOJA 4FILA 4OUDA 4CM9D 3S40A 1OYVA 1NF2A 3K4HA 3HADA 5JRJA 5EJAA 1NGSA 2O6LA 3CF4G 4GMDA 3LP6A 4ER7A 2P27A 1S2DA 2DHCA 1DJPA 2QTTA 4OGLA 2XKAA 4H6VA 1OROA 1ODSA 3UCFA 3W2TA 2JFQA 4JLUA 4G9BA 4FYYA 1JR3D 3T1VA 3UXHA 3NETA 4MK4A 3VU9B 2DPMA 2XDAA 3I9V1 2ATEA 4BNDB 3WV5A 5IU6A 4WK6A 2NU9A 2EHDA 3HN7A 1N6KA 1YRLA 1HY3A 2XMQA 4JQOA 1BYIA 1H23A 5IDVA 1KI9A 2QRZA 4PRKA 5K20A 2A8YA 4EA8A 4WDRA 5BUQA 3C74A 3EUFA 4EHKA 1KARA 2PS1A 2QF7A 5F5LA 3H1EA 4OFWA 3WMWA 1Q21A 3C8ZA 2V0GA 2ETXA 5HKAA 4KREA 2D2FA 3L1KA 3WYNA 3I28A 4GO1A 2MU1A 4AWAA 4BTLA 1GYPA 4OATA 4QREA 3VPGA 1AQ6A 1P5ZB 4PIMA 1SZJG 3ECAA 4AN4A 1ONBA 1J0XO 1KI2A 3EH1A 4ZYWA 1ZNQO 1G98A 3HCOA 2WWFA 1FQOA 2OCGA 1R8QA 1SK8A 3INRA 2JI9A 3JSAA 3NNNA 3PBKA 4H0CA 5AVKA 2JK0A 3I1FA 1XT6A 3MTGA 2FUEA 3NHMA 4D79A 3EIUA 4HN2A 3E9YA 2EJWA 4Q1AA 5BW4A 4F86A 3CZPA 4I55A 3UA4A 3K1JA 2R6AA 3UXEA 3H9JA 5EIXA 2OD2A 4HVTA 4OU5A 2BGWA 3DAGA 4KU4A 1QQBA 1QKJA 2OO5C 3RLFA 4U6SA 3TKLA 3EEFA 1KDPA 4JEMA 1QR2A 1V5EA 4YP6A 4DLLA 4R1QA 3EDOA 3VDNB 5J4KA 2EKPA 2EJUA 2IBTA 1G8JA 2YRFA 3P2YA 4WLOA 2YZ7A 1EUZA 4R9NA 2PMDA 1N7GA 3IERA 4M8NE 1O95D 3TSWA 4WAUA 3OECA 5I6DA 1EUQA 4DJTA 4H31A 1ZFNA 1EJ6A 4KIWA 2Y1KA 2FPPB 5FNVF 4HRYA 4TQUS 4X7PA 4ZPXA 3VR1A 2I78A 2Z5VA 3K2IA 4EDHA 4HXEB 4YROA 2LDBA 1UOEA 1Y9EA 3F3YA 2NO5A 1LQTA 3G7SA 4NX2A 5F2NA 1NRJB 2KE5A 3I58A 3IO3A 4Y2XA 4D9HA 1DWUA 3AUYA 4RF5A 4DA6A 1NN1A 3HGTA 5DP2A 4NONA 1EFUA 4KJZA 1T43A 1GGKA 3A1CA 3P2MA 1Q0LA 3VJMA 3BMXA 1H2WA 4BMPB 2XVYA 1MVOA 2FPLA 4ZALA 4F8JA 4BAGA 1I9CA 5DCUA 5IP5A 5A03A 1AHIA 4ND3A 4QECA 3OUTA 4M8IA 2DHDA 2C8LA 4O08A 5IYZB 1OIWA 2O3UA 1IWPB 4S2UA 2PT5A 4DBLE 5KTMA 5MFPA 4LVOA 3FAZA 3UT6A 1V1MA 3MRSA 1RXCA 1LPSA 3E5HA 4TV9B 2P68A 4JR0A 4NLLA 3VPBA 1DIRA 4X20B 1QRSA 1NVAA 2CWWA 3QGMA 2JJ2A 3U7RA 1GPKA 1OH8A 1TQ4A 1K7SN 2HXYA 3E9DA 1DMSA 4M7PA 5ER9A 4ZXFA 1DADA 3B13B 1C9YA 2DQYA 2AKAB 3HRKA 3OTGA 4PXAA 4L73A 3TR6A 2BW0A 4B82A 3G9XA 2J9RA 2WVHA 1ECCA 2FP4B 4U7GA 4B7XA 3WRVA 2UV8A 2LCFA 2NV0A 4CKEB 2HBZA 1CUEA 2NT4A 5LZ7A 3BG5A 3RD5A 1DRWA 2ZWVA 3ZE7A 4QT4A 1C80A 3DMDA 3HL0A 2HV9A 5BV8A 2EFEB 3Q6NA 2YIDA 3FGPA 4B74A 1N4DA 3ZDEA 3OFNA 1N5MA 2F55A 4IIXA 2BI4A 3V4RA 2YHAA 1QLJA 5E7MA 3TTUA 2JI6A 3C8MA 3QFTA 2WD9A 2Q1XA 3IVRA 5IWCA 1FUIA 1X86B 1ZRHA 3B51X 1O9HA 3F5SA 4HN9A 5DBHX 2O3JA 2M6LA 1QQ5A 4BDSA 2BGNA 5EJ6A 5JDCA 4PAMA 1I2MA 4RM3A 2WQ7A 4XQCA 2FTKE 4DG9A 2ZPUA 1V95A 4LY9A 4ZOAA 4YP0A 3KKPA 1N25A 3B8HA 2IDKA 2PR2A 2W2NA 1XHFA 5B1YA 4BP8A 4PAWA 3TZLA 1GGMA 4RSRA 3EQ6A 2VHTA 1IVSA 2R6HA 4GZ5A 2CHUA 2CL5A 2JAUA 3GA0A 4Z1MA 3VR6D 4FYMA 3VZCA 3WDMA 2WUGA 5L3VA 1XDZA 3I9JA 4A82A 5KYWA 5H0IA 1PR6A 1VP9A 1WB5A 2R65A 4OSEA 2OECA 1U1GA 3KQPA 4WQMA 5IN5A 3VVBA 3HZHA 3INYA 2XYVA 3MGGA 4I8DA 1A04A 1YJXA 5AKGA 1P0MA 3WMEA 2W6CX 1E9BA 2GFIA 1SXJB 3GUZA 1KXJA 3NTRA 2WZCA 1EUDB 3P9XA 3VHXB 4BU0A 4JJKA 2Q4DA 4IZHA 1HSOA 2Z2IA 4RA6B 5SZHB 3TB4A 1JA1A 4CM1A 4ESVA 1C3EA 5HK9A 4L76A 4UFPA 1R15A 2JLBA 3QPCA 2PSDA 4URHA 2O7QA 3EN0A 4JB3A 3HNRA 4TM7A 3DKPA 1FLDA 1JSZA 3QE3A 3SC2A 4PEVA 3CBQA 3RWMB 1A9XB 3C0KA 3T4XA 1O89A 3D8HA 3TIVA 2JRCA 3DTVB 3W1VA 1D1PA 1Z6QA 2J4FA 3JATB 3Q7TA 1C9DB 4AXBA 3L0ZA 2J3LA 4AJEA 3KZCA 1PKXA 2OAEA 3CR7A 2VJPA 5DSTA 3WWYA 3VAAA 4DSZA 5LOVF 4UW9A 3EXG2 4BP3A 3NH6A 4IOKA 3HFGA 2JFBA 3U2QA 1CRZA 4EPYA 4ZDJA 3KQMA 5K6TA 3RVKA 5EUBA 3QPWA 5KSZA 1BXZA 3QEBZ 1TTPB 1PLLA 2A9FA 2GLXA 4RZSA 1YQGA 4LZWA 4UDNA 2ZM6B 4MRVA 3DL7A 1ZOLA 1PW7A 3QFSA 3I2IA 4OGFA 3TMKA 4AUNA 2XA2A 5A5DA 1OLSA 2XB9A 1J8FA 2FZCA 3ZDBA 2HADA 3VR4H 1Z12A 3I6ZA 4ZK2A 4DSOA 2LDXA 1HT3A 2YX1A 3EGDA 1CVLA 2NNLD 2Q0XA 3ZH9B 4C03A 4YX9A 3D54D 3D5EA 2KW5A 3EGXB 4LC1A 4ZEWA 3WGQA 2C2KA 4YWHA 4JUBA 3IJ5A 3OUUA 1E2KA 5JSQA 1KJYA 1TW2A 2OO5A 2XB8A 3CNNA 3PFKA 3KOOA 2UZAA 4KLRA 1LW6E 3CF2A 4FLEA 3A3YA 5TF0A 4C7XA 5KYKA 3PUXA 5JU6A 5CDFA 1IJBA 3CZ4A 5DHQA 4OLFA 3DCNA 1TIKA 4MA5A 1IN4A 1CVRA 2XV1A 3VTFA 3SQWA 1E9EA 4BQIA 3S2ZA 1DPGA 1KC1A 2NLOA 3F9IA 2OLKA 1SXJD 4ENUA 3UAWA 4MIOA 1J99A 4LJSA 3QOWA 2OGUA 4BLRA 2PH3A 1PR5A 1TYBE 5FHQA 5BXQC 1ONSA 2G09A 1A9OA 5I5GA 1NA5A 1FUYB 2IOFA 3M4YA 4FX5A 3L6BA 1QFXA 3A0UA 3FNEA 3OE7A 5AW8A 1PUIA 1F8FA 1PQUA 3ZV5A 5A04A 3IKMB 3AF6A 4DQDA 3E1SA 1SPBS 1CEYA 2GZDA 1DEHA 2OV2A 1P5JA 1PR0A 4CL0A 1N0WA 4ZQEA 1FFEA 2BFDA 1TVKB 3M5DA 3M6XA 3OUZA 3DTVD 3AFNA 1F2TA 4ZOBA 3UKDA 3KBBA 3UF0A 4NNOA 2QRNA 1L5NA 2FB9A 4TXHA 4URWR 4Z6KA 4V39A 2G71A 1N6IA 2AZDA 3CH7A 3CIFA 4NF2A 3STVA 4C0LA 3IURA 3OEED 1TVCA 2RH4A 1H0KA 2J3MA 3KEGA 4L15A 2E4WA 2UU9B 1Y6ZA 5DGHA 2BTQB 2YFKA 3ABRB 1X42A 3KBOA 2UZIR 3AESB 1FS5A 2HU5A 1A5BB 1Y3AA 3G2PA 2ERYA 4NABA 3EXEB 4R1UA 5TARA 3R7BA 3USES 5CA1A 3R7WB 5LMCA 1HRKA 3DBIA 5AIAA 2BEKA 2ZRBA 3FWNA 2BH9A 3PFBA 4R6XA 1EB8A 2W7TA 2ZAGA 3C6MA 3Q40A 4IXMA 1JG7A 4M46A 1XEFA 4WIAA 4BKPA 1F0NA 3O1JC 3NEAA 1EI9A 4BVKA 4AJHA 3IPAA 5IX8A 1PU2A 3ZU3A 3DKIA 1SCKA 3AR7A 2O2XA 2X5NA 1Z0FA 3G49A 3MT9A 4KH1A 4XM0A 3ABZA 4LXUA 2Z3VA 3HP7A 4AS1A 2OMEA 4FMDF 2MMGA 3B6ZA 2WT9A 2QZZA 4NZNA 4W82A 4KI7A 2DQSA 1XC7A 2OHGA 1HDZA 1NQUA 1P44A 1K97A 4INPA 2YIVX 5H3CA 2IHTA 5BSVA 2BR3A 1P74A 1CVIA 1GNTA 1U3GA 2P9BA 4QOEA 3GLIB 1FX0A 2IUUA 2NSLA 3U80A 3CEJA 1RMTA 1C3JA 1M2GA 1V11A 4I6JA 5D87A 3LKZA 3V8RA 1JL3A 2HIAA 4PFKA 3CX8A 4AJOA 4N49A 1BSVA 2HZ7A 2CLCX 2I4MA 4HEQA 1FSSA 4MS1A 1MABB 1ELOA 4CWAA 2J0SA 4Q3KA 1JT9A 3JS5A 1EFVA 1XD2A 3ETEA 2VZ8A 2EWVA 3GP8A 4HRVA 1T1EA 1T5OA 4HZGA 4I4NA 5HW0A 3Q11A 2QTFA 1LPNA 3SLKA 4BIIA 4F4HA 3PKJA 4MS4A 4V0SA 4J43A 4GLOA 1OJ7A 1YC5A 2WWVD 3GT4A 3DH0A 1JMYA 1NKSA 4XSHA 3BYZA 3D3KA 16PKA 1W0KA 4QDKA 2XUKA 3DV0B 1QMPA 1SIWA 4Q4JB 5C52B 2QP9X 4NXNB 3A1SA 2CDRA 4PYIA 3IHTA 4UHKA 5HUHA 1CU1A 3IT1A 4MVJM 4M9RA 3X1WA 4BNYA 4NAHA 4DE5A 4BO3A 1ZRSA 1U6IA 2XYQA 4DN6A 1ZUIA 2XVMA 3I04A 3KTOA 2CJXA 1SC1A 1C4KA 5TMPA 3IVCA 2RGBA 2JGRA 3K2QA 4P31A 4ATNA 2R7LA 3THOA 5FTWA 3GJ3A 3TIIA 4PX3A 1TT7A 4UJ5A 2Q0HA 3JWJA 2V98A 1JAYA 4PHCA 3SF8A 5KREA 4X41A 1IQUA 1IOWA 2PR7A 4KDEA 3LFTA 5AM4A 4BNNA 3PEYA 2RK4A 2BEVB 4O2AB 1BMQA 1KHHA 3B1JA 4FINA 1A9YA 1S5PA 2OV4A 4PVDA 3GFOA 2NQTA 5AKIA 1P75A 4LZLA 4P7GA 5AMXA 2GM4A 1LDYA 1BGWA 2YWDA 2FSUA 3C7TA 5IW8A 3OLVA 3UWMA 4HWRA 1K86A 1E3WA 1P4HA 2ZJ4A 3WTCA 2WIFA 3DDNA 4YJKA 3UC5A 5BNWA 3NFYA 1UK7A 4MV5A 2II6A 4ZCIA 3ZVNA 3W77A 3L9XA 3CRMA 2VT3A 3B1ZA 3NPMA 4GKBA 4X0EA 3NMUF 4DR2B 4HDCA 5BNFA 1KH1A 1X80A 3NBFA 2IL1A 4Y30A 2J3QA 5FPYA 3WFIA 1JGTA 1IJEA 3VOBA 1V37A 4LJYA 5B3LA 1FYWA 4KRXA 3W2GA 1L1RA 2D7DA 1COZA 1IDOA 3ITNA 3TBFA 4Q4HA 2BM0A 2CZCA 3TE7A 3WYBA 1JIIA 4I1PA 3AFGA 1PL6A 1RIIA 2BN4A 3NWOA 5LPNA 4IZ6A 4Y2JA 2ZDQA 4TTRA 4U0JA 3EQ7A 1NSTA 1PJTA 1HF3A 2X8JB 4WLVA 3UW1A 1FYVA 2CB9A 1Q91A 3V8NA 4G67A 2PYIA 4DA8A 5LN1A 2K6GA 3R5TA 4J4HA 4JLPA 4MA0A 4TL9A 1D2HA 3E8MA 5BW5A 1JPJA 5IJ9B 5LQNA 3F97A 5DXAA 4U4AA 3DXFA 2NSDA 4DMRA 3BZWA 4QUHA 2XQKA 1C5KA 2R96A 2ACWA 1NFRA 1M6EX 1ZUD1 3Q5GA 4EHLA 5A3QA 4XIJA 3TO5A 1JTEA 4B76A 4D5EA 1FXSA 4Z9FA 4BUZA 4CEIA 4BPBA 1PQYA 1EGHA 1K89A 1TYAE 2XUQA 5FUXA 5EPEA 3RYHB 4QPNA 3RCBA 2NP7A 2H4HA 1PUXA 3C6BA 4OQQA 5FWYB 3NANA 4JD5A