1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Collagen-binding
molecule keywords VON WILLEBRAND FACTOR
publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
3ZDXB 4F1JA 3Q3GE 3PPWA 1AOXA 1T6BY 2M32A 5E6UB 5HGJA 3ZE0B 3BQMB 2VDKB 1ATZA 2NUPB 2I6QA 1YVPA 4CN8A 4HQKA 1AUQA 1CQPA 4HQOA 3EFOB 5KYYA 1ZONA 1BHQ1 4DMUB 4A0QA 5KYWA 5KYXB 3FCSB 1RS0A 3EOBI 5E6RA 3TXAA 1M1XB 3VI3B 1QCYA 1LFAA 4BJ3A 5BV8A 1U0NA 2WINI 4MMYB 1SHUX 1NA5A 4IXDA 4WK4B 3V4VB 1M10A 2I6SA 3BN3A 3PPVA 5KYWB 3EG9A 1MHPA 3HI6A 5KYNA 3EH2A 1QC5A 3ZQKA 1RRKA 2WW8A 1FNSA 1XDGA 1YVRA 1ZOOA 2O7NA 2ODQA 2XWBF 2ODPA 5KYUA 5E6SA 4IGIA 2VDNB 4XW2A 3ZE1B 4UM9B 3EG9B 1JEYA 1U8CB 4F1KA 1MQ8B 3EOAI 1QC5B 1XDDA 3VI4B 2ICAA 3V4PB 1M2VA 4Z7NB 4C2AA 1OAKA 3ZDYB 5E6SB 1DGQA 3FCUB 5HJ2A 1SHTX 1XUOA 4IHKA 1JLMA 3EGXA 5KYYB 1L5GB 4G1EB 5ES4B 4M76B 4NENA 1M2VB 1IDOA 3T3MB 3TCXB 3EGDA 5E6RB 4JDUA 4CNBA 4MMZB 2B2XA 1MF7A 3M6FA 1JV2B 2XWJI 2XGGA 2VDOB 4WJKB 4MMXB 3GXBA 3K6SA 3EGXB 4O02B 1DZIA 3TVYA 2QTVA 1IJKA 3RAGA 4NENB 1PD0A 4C2BA 2VC2B 3NIDB 1RD4A 4WFQA 1CK4A 2X5NA 3IJEB 2NUTA 1AO3A 3F74A 3ZDZB 1TYEB 1V7PC 1PCXA 1N9ZA 5KYUB 3ZE2B 3K6SB 3HXQA 1N3YA 5LN1A 3NIGB 1T0PA 3NIFB 4HQNA 4UM9D 3E2MA 3K71B 1JEYB 3QA3E 1SQ0A 3BQNB 1JEQA 1IDN1 4Z7OB 4NEHB 1MQ9A 1FE8A 1Q0PA 3PPYA 2NUTB 2NVOA 1U0OC 3TW0A 2I91A 5HDBB 1MQAA 4C29A 1BHO1 3F78A 4UM8B 1M2OA 1MJNA 1M1UA 1RTKA 3PPXA 4PN7A 4FX5A 4CN9A 1JEQB 2VDPB 3N2NA 2VDRB 4WK2B 3EH1A 1ZOPA 4G1MB 1PT6A 4Z7QB 3EGDB 4HQFA 1PD1A 2ADFA 2VDLB 3K72B 5E6UA 2NUPA 4HQLA 1UEXC 4WK0B 3HXOA 3IBSA 2VDMB 2IUEA 3EFOA 1IJBA 3T3PB 5KYXA 2VDQB
chains in the Genus database with same CATH superfamily
3WB2A 4F1JA 3OF3A 4MAAA 1RAIA 2BFBB 2HQRA 1DC6A 3WBBA 4RXTA 3T61A 4WINA 3LU1A 4IG4A 1ZN8A 4JJKA 3C5CA 4JU9A 5AVUA 3IBTA 1VFNA 2FSIA 3FPSA 5AXDA 4R83A 2BEWA 1EFAA 1XQXA 1T1EA 2GLTA 3R7LA 2O2ZA 3UHOA 5T6MA 1E8MA 3EG5A 3UT5A 1RI1A 3CKMA 2AUNA 3L7NA 4NS4A 3TNFA 4MS3A 4WL0A 2ZQZA 1Z7WA 1MW8X 2L2QA 2PPLA 5HZMA 3KETA 4GZLA 1WPXA 4OHMA 4ZMRA 4PXAA 5F2NA 2FE4A 1OXKB 3UWDA 1JBEA 1QZZA 1J8YF 1KXZA 5KMGA 1MQSA 3D4PA 2PKRA 4MV7A 3U80A 3ZD6A 1ZGJA 1RRKA 3H83A 4GWLA 5CFLA 2HF2A 2G9RA 3AU9A 3NAQA 1RNLA 4R68A 5G40A 3OFJA 1JZTA 5CLGA 1IM5A 5B6JA 1G5TA 2EGGA 1B15A 1NOJA 4A8HA 3N53A 1NYQA 1RJFA 4KNYA 2XNHA 3FSEA 3A70A 2J3LA 4MARA 2WHPB 3AUYA 1MJGM 3VR4D 2A5LA 5MDHA 4KI7A 2G09A 3MUOA 2B7CA 1EFVB 1PTJC 3IUYA 2DPYA 3H9QA 2PSSA 1JALA 4K3VA 4QELA 2GEBA 3B6MA 1R4AA 3HCPA 4POAA 5IM4F 1T1GA 4BFSA 2CZQA 4UU7A 2CWWA 4DPLA 3UK2A 1AA6A 1FOEB 2Y68A 2EP5A 1JP7A 3SMVA 1KPIA 4L02A 3C1OA 5EFOA 1CUZA 3OT4A 3P45A 1QAQA 4D9GA 2GJ9A 1GKUB 4QRHA 4DQKA 4FHEA 4AP9A 1AG9A 1Z88A 1DP4A 4LCJA 2V7VA 3JQ6A 5C8YA 3ZWYA 3W04A 2VNHA 1UK6A 2BGWA 3OG9A 1FBNA 1JSXA 1DIOB 1MH9A 2VDOB 3DKRA 3DMHA 3K5IA 3L8FA 3U40A 4AN0A 4DMRA 1L0BA 3MFYA 4YAUA 1PWYE 4PHCA 5FI0B 3DWIA 3GPLA 1USUA 5CNKA 3DLPX 1WA5A 5KJ6A 1KPHA 1O1YA 3DZGA 4YP5A 1H3EA 4XQ0A 2W11A 3K0FB 4ENUA 2F59A 1JAIA 1PUJA 2IUTA 3ANYB 2IPAB 4MV4A 2PWAA 1UBFA 5JR3A 4KUGA 4A8TA 2QVCA 3E7DA 1A8QA 4TL8A 3CEAA 4PU0A 3RGWS 5BSWA 3KEQA 1PFWA 3K4HA 1OLXA 2ACVA 5B4TA 1PVDA 1R3DA 2GXAA 4HEQA 3Q10A 2C7BA 4CIDA 2B0CA 1CUXA 5A7GA 4DRZA 1YL6A 2I4RA 1X1QA 2PNJA 4ASUD 2Q4RA 3H4TA 2FFJA 2VIIA 1VLJA 5G53C 1RXVA 5E1BA 4MKZA 1LLUA 3LPNA 1LRKA 2X0KA 3UW1A 2BMDA 2VRWA 1TC2A 2IEYA 3E5HA 3HY4A 5EPUA 4CT0A 3AR9A 4S1VA 4K9LA 3QU2A 3P0EA 3W6PA 4LZPA 3TB4A 3ZIUA 5IT5A 2Q6TA 1FMCA 3K35A 2VN8A 3MJVA 5BV1A 5CVVA 4DJTA 3E18A 2ZUBA 4Z2YA 2O8DB 1R0CA 3C3MA 3QVWA 3DDHA 3LPMA 1YNOA 1YRAA 3ETCA 3M0EA 1GTRA 1KE2A 2V0NA 3WGLA 3FA2A 5I9IA 4MYRA 5ALPA 1QIFA 4ZGBA 2HNBA 1Y33E 1P6XA 3R3JA 4QVIA 3MHTA 3QJ5A 3A37A 1KI6B 4QULA 1MV5A 4DRYA 5SY4A 1CDEA 3W3ZB 3WWOA 1YRWA 2QL9A 3UNXA 3IEPA 3QH4A 4O4JF 4DDMA 1KDRA 5K8IA 2BGIA 1A9XA 2NVBA 4LTNA 1EVIA 3GWZA 4YJDA 1YZKA 3SZRA 1VPLA 2AW3A 2IEBA 4CF6A 2X42A 5EZ6B 3KDAA 4D8XA 3PFBA 5E3IA 1XKXA 3ZHOA 4H6PA 1W4BA 1IWPB 2Z5LA 3DBHB 3S5UA 4EO9A 4AIIA 5BOSB 3WWZA 1KFEB 2WYOA 3NV7A 2IP1A 5FBWB 3CUYA 1ZI6A 3KYCB 3YASA 4PC3A 1ZK1A 4JGGA 5J58A 1ONOA 5REQA 5CA1B 4W8OA 3W2IA 5EJEA 1L5SA 3OQPA 5T57A 3Q98A 1BJTA 1N0IA 2ODQA 1G21E 4PO3X 1GYQA 5BQ5A 5F73A 4TYMA 1M8GA 1VE6A 2JIBA 1R88A 4IXNA 4JBLA 1TJ3A 2F9FA 3G23A 1QG2A 3VH4A 4BP8A 2O23A 2QRNA 3CNNA 1P39A 1SUAA 1XEAA 1SBQA 3HFGA 1G8KA 2ECOA 4HXYA 3BS4A 5AI9A 3FVWA 1W2HA 2R8RA 3EGEA 4J75A 4XUEA 5LNK6 3AEUB 4H17A 3ZDYB 5M2QA 4JVSB 1IATA 3CZQA 4LJ4A 1ZPDA 3ONNA 5KNDD 3K0BA 1HRDA 5A2GA 1XXHE 1N5KA 5CPFA 2W2LD 3FPBA 2HW8A 4IFBA 1E2BA 2EP7A 1TDJA 1XL0A 2J3QA 3U7IA 3P2JA 1QBKC 4KLNA 4MVJH 1W93A 2VHJA 3PNKA 1JQ5A 3PJDA 3WKAA 4BX2A 3AI2A 3RKRA 1UJNA 4IVPA 5FO1A 2GTHA 2FJUA 4NMHA 1JFSA 5BSKA 3UW3A 1YD7A 2X5OA 3TVYA 1HT2E 3MINA 2NZVG 2WA2A 4M9RA 2OHJA 4LI3X 2H5JA 4CQLA 2VDWA 3BORA 4TL6A 2Y0PA 5CH3A 4D9KA 2RGUA 1XD8A 5DGXA 2OILA 2SBTA 2YWBA 4N41A 2CXOA 1BMFA 3PQ5A 1FVOA 3WKEA 3PNMA 1NW4A 2DPHA 1HKHA 1T5TA 4UVHA 1JJ7A 2JCYA 3KTDA 1ES9A 4QE3A 4Y0AA 4YI5A 4CKEB 3ESDA 3HBAA 1RAEA 1J24A 1YTUA 2H1HA 1LU9A 4I6GA 4LDZA 3RQSA 2JC3A 2GYWA 2RIPA 2ZKLA 1B00A 3AR5A 3PPYA 3E53A 3NHZA 1CT9A 2JI4A 3BMOB 4IIVA 4UC0A 1LPNA 4CMCA 5B5SA 1CFZA 1GQFA 2HCRA 2JIZD 3N8KA 1BROA 1MC8A 2GNOA 5AVXA 2RCNA 1DOAA 1Q1EA 4R8LA 1WD5A 1YCDA 2JF0A 1SO8A 2Z95A 2IV2X 2XBMA 2ZZMA 3BIJA 4OQFA 3C48A 3AVUA 2MSLA 3ZHYA 4RTNA 1SULA 2GUGA 2BMVA 3ZNOA 3LF2A 3OCVA 1KTVA 5K8CA 1MZVA 2FPWA 2PCLA 2XRZA 5C1BA 4DA7A 2MU1A 4GOOD 1WOMA 2QSZA 4JI5B 4B6JA 2GR9A 2MOKA 1IEWA 2PX0A 1T91A 2CL5A 1OFTA 3FIJA 3HADA 2E21A 3L6CA 3R23A 4NFHA 4UUMA 4C08A 2QQGA 4TT3A 1EXDA 4FBMA 4MV0A 1VJ0A 2VWQA 1G7TA 1RXUA 2HK9A 3CNQS 3PD1A 3S2UA 2XUPA 3SDBA 1IZZA 1JFTA 4RACA 5GJCA 2J5QA 3WA6A 3MRVA 2I2AA 3TDKA 1I9CA 4D96A 1GUDA 4EFKA 2B36A 4OHYA 3RVLA 3GEDA 3BWEA 4MEBA 1WB6A 4II2A 4F4DA 1EA7A 4ZO6A 1RHRA 3BMNA 7MHTA 1CQIB 1QCYA 1UCFA 1QAOA 1K89A 3MD0A 1JG2A 3OE4A 5CB4F 5FB3A 4N39A 4X8OA 4X1KB 4ZA2A 5SYMA 5CM8B 4LSWA 4QU0A 2VSOA 1AQYA 3QUTA 1F4VA 2A6PA 1SB8A 4J1SA 4BGIA 2OZPA 3GLQA 1OZ0A 4G5QA 4K03A 2NUAB 3CUWA 1QQAA 2IVFA 4MVJE 1JJVA 2G0AA 4PIVA 2E89A 3D02A 1COZA 2PUHA 1F20A 1ZL0A 3BK2A 4UBMA 4LE2A 3RIHA 4CG0A 2AC2A 4O0MA 1TL7C 2QXYA 4YJ3F 1W88A 1B93A 3LY7A 4IF4A 1GGNA 3C8UA 3O8OB 2Z98A 2CFTA 4CMJA 2I2CA 1R66A 4AY2A 2YFHA 5JVDB 2AR9A 4L8FA 2VJMA 4Z8XA 1IVSA 1R0YA 2NYRA 1EVJA 2FN9A 3A7EA 5TVGA 3K70B 1GDHA 3TLBA 1T9BA 3FTQA 3OMXA 1GLNA 1CFJA 3FPAA 1PIWA 1D8TA 3MYRA 2BP7A 3T34A 3SYMA 3H4VA 1JDZA 2OA0A 1UC4B 4IDPA 1K86A 5K51A 2ZIVB 4IICA 2RHRA 2E3JA 2HFKA 4LJRA 1GSAA 1SC4A 4ZC1A 2IHVA 1L1RA 3AF2A 1ZD4A 4DVJA 1NIJA 1JI0A 1TPYA 2VPTA 2V5VA 3EPRA 5FPPA 3U16A 2RHGB 4M7RA 1U3DA 4MLDA 1JEJA 1XWWA 1ZVKA 4JC0A 5DBFA 2C2YA 2I33A 3B1ZA 2P1RA 3RVJA 2O0LA 4YN3A 1UT8A 1M2GA 3ETNA 4HS4A 3ACBA 4DLLA 1QQBA 2PMBA 2JAQA 2PZFA 4FGSA 5CLQA 1VXOA 2AF3C 5L3VA 1HYGA 3Q8XB 2PL5A 1DIBA 3RRZA 2XA1A 4AM8A 4C5CA 5A7FA 1Y1QA 3VKUA 2DAPA 4QEZA 2DGDA 5JQGB 4FMPA 1XC7A 3QMVA 4UM5A 4RHXA 3BXPA 3TSWA 4C7MA 3N2KA 3F90A 1RKXA 2AJ8A 4UM8B 5IC5A 1JLKA 4GZMA 1H8HA 1KGDA 4OHRA 4MITA 4WLNA 3ZY4A 5L3SB 4RZ2A 3SJUA 2H1FA 4IY1A 1B2LA 1BX1A 1J20A 2IHUA 2PQ6A 3EH1A 4A6EA 3A9CA 4BBPA 1TT5B 3TR0A 1QRDA 2YWCA 3G2PA 4NYMR 1OHHA 3UG7A 2R6HA 2X23A 5KUTA 3COYA 1JUDA 1X9IA 2G6TA 3MWEA 4Q01A 4YQEA 3C5VA 4XQCA 1MJGA 3TE7A 3WL3A 4FEAA 4NPAA 1XXHB 4ZT4A 4ML3A 4ZVNA 3LDAA 5AESA 1SNYA 1ULZA 5HJ5A 3COWA 4PLGA 3P4YA 5KJFA 5KKNB 2C5GA 5C51B 1XKTA 4E51A 1Z4KA 5H1YA 3N7UA 3ROQA 3K1JA 3ICPA 3RROA 2BIFA 3ORHA 4KXNA 4WK6A 8LDHA 1PLKA 3OLVA 2POQX 5E38A 1I6LA 1Z7EA 4E5PA 1UBUS 1U4NA 4TMVA 2VNSA 4E4YA 4IDNA 3D8NA 3VKVA 1G18A 4EB8A 1HOXA 4V3BA 1RI5A 1UPXA 1YB2A 5FP0A 1YDGA 5KYXB 3ZKWB 3NM6B 2QN1A 4PPNA 5GGYA 4DR5B 4PZEA 1YI8A 1G7SA 2V0GA 2PJZA 2DT8A 2OP1A 4RMHA 4NIMA 1MOQA 1AGXA 4RA9B 3ROFA 2ZCUA 3N2LA 1S2OA 3G2KA 3E3MA 5KKCA 2C96A 4XUCA 2YNMD 4RTJA 1AH2A 1JHYA 1G7CA 3G17A 3QELB 3T4UA 3K7EA 4DM4A 4G07A 4TYQA 3SFTA 1IBLB 3E9YA 1SVIA 2PMFA 3NTQA 4FFWA 2R8BA 3EVGA 4KG7A 2FCAA 2NO0A 1NUAA 2M2IA 2VH2A 3AGPA 1QRUA 2O8EA 1VIMA 2QAGA 3LYHA 4U39A 4XW2A 5EJ4A 4EJ6A 2YHUA 4TZKA 4KE7A 3QNUA 3QP9A 4RTPA 2GUWA 3HVHA 4IZHA 1U3UA 1O95A 3I83A 2HX1A 1ZRNA 5GJVC 1XZEA 3AFHA 3OZTA 2IYQA 3FR8A 3QVSA 5JJKA 2I71A 1DGQA 2PPVA 4FZJA 4XLZA 5AUQA 3R2JA 3WJ1A 4D8VA 4JZYA 1DTWA 4F8EA 3GNLA 3W34A 1FP4B 4GD3Q 5IG2A 1K4MA 4QAJA 4A0HA 4GSKA 4OMCA 3V7UA 1QUEA 5KINB 3W2GA 5FAKA 4XDYA 4PYMA 3ZOZA 4KVAA 2VHQA 4MUEA 4MHOA 2PO7A 3ZNNA 1PYDA 1KY4A 1NVAA 1UC9A 3LUDA 3ZHRA 5I7SA 2R25B 3J81k 4M0CA 3M1AA 4ALKA 2H16A 3KJNA 1SHZA 1XZAA 1NFQA 2OHOA 4FI3F 1RLJA 1A69A 2YJ4A 3CPEA 3DT6A 1TTQB 1IRIA 3BFKA 2X8JA 1B0ZA 5H16A 1Y3FE 3C5EA 2HLHA 1MOSA 2PKXA 4I4CA 5C5IA 2Z2JA 5CFPA 4KR2A 5B1YA 7ABPA 1XCBA 2ZJZA 1P7PA 1QQ7A 5EYPB 2IIPA 1GQQA 4LSGA 1WZNA 4LYYA 4XD7A 3C39A 2OBLA 2WJJA 4IYRA 5KWSA 1TTHA 3E8XA 1Q44A 1Y9DA 3DUFB 6ABPA 5TARA 1NMSA 4E70A 1U9JA 2IS4A 4BC1A 1LBIA 4EY4A 4FMCB 3HP4A 3I37X 5ITWA 3G7NA 3BRWD 3GF4A 4K46A 3SHVA 4GSLA 3QITA 3FDXA 5DMXA 2IUSA 5C34B 2OHHA 1G2PA 4HRYA 3ISVA 1I10A 3VTZA 1DAOA 4JLAA 3AR7A 1QGED 2XITA 1EFPB 5KJ1A 1PQ4A 4N6OA 2JB9A 3W4JA 1EK2A 1GOTA 2XDQB 4CQMA 1QK5A 1QKIA 1TF7A 3V8PA 1MX5A 1A5SB 4LJAA 4TMKA 1V6AA 4R6XA 3SMQA 4AROA 1HE5A 2FW1A 4AW9A 2CCJA 4X1YA 3KB6A 1Y3CE 2WM8A 1DBPA 4EJMA 1OFGA 2C97A 1Z16A 4WLUA 4Q6WA 3HGMA 5TC4A 4Z6KA 3B1KA 2EW1A 3T9FA 3VZRA 1QPGA 1SD5A 3HZHA 4C87A 4UJ3A 4JHLA 3SYKA 3GOHA 1CETA 2CYCA 4Q1EA 7MDHA 4YPVA 4IDBA 1K3FA 1TYDE 3HV0A 4RTLA 1WNFA 2CCGA 3BMCA 2XB9A 4XKJA 1JDJA 2E49A 3D5TA 3LXXA 3OCXA 4NE2A 4C6TA 4D4LA 3IVCA 3PV0A 1KHHA 2Z3ZA 1AM4D 1DBWA 4LHWA 3RRXA 4FOOA 4PX3A 3ME5A 1D2AA 1EDEA 3CNBA 3LX8A 4JODA 2VDVE 1V8FA 2GYYA 1D4ZA 1G7RA 2I2XB 4G0YA 1C1DA 2TMGA 4OU5A 4H2DA 1VSUA 5NULA 2P6MA 3QQPA 2E4XA 2ZRJA 2DKFA 4AJ4A 4G5YA 2J9YB 1WKVA 4QUDA 4XWAA 3WMWA 2QRHA 3L7IA 4EPYA 3BN3A 2IP2A 5LWQA 2RHLA 2JA2A 4FSHA 1R9MA 3SKVA 3W5SA 4RJ2A 1WXHA 1BSVA 2EBHX 3L8CA 4MO9A 4NFSA 1ZHHA 1TYAE 5BMVA 1BXGA 2WZCA 2DR3A 3FLEA 2K5UA 3AP3A 3KS9A 3N8GA 4IH1A 5EIAA 2B3TA 5DGCA 5DTQA 4KR9A 2QYSA 4F97A 5FADA 2HZ7A 3KZOA 5A0TA 5KDOA 1XCPA 1XRSB 3I6YA 1CVRA 4X85A 1B73A 3O9ZA 1ZD5A 2OCBA 3WC4A 4UHKA 4D0RA 3KVOA 3O84A 1RAAA 4FD3A 5IJXA 1G2IA 5FOQA 3V4ZA 1V4BA 2H85A 3ZU2A 1NW9B 1S7CA 2HFJA 3NHBA 4H0NA 2D3WA 4MUMA 4RD4A 4XVQA 2BTOA 3F2VA 3UJ7A 1A71A 4AVYA 4TKMA 4OFZA 4DCUA 4EKGA 2QQFA 4LKRA 2Z2ZA 1UKBA 3GL9A 1SCUB 1WUHS 1XRJA 2R9VA 3PHCA 4P0QB 4LYGA 4DGSA 4HB0A 1CVLA 1E1CB 1PTKA 3PNOA 1HQYE 4J07A 5CYOA 3GB9A 5TJ9A 3KOYA 4F7DA 5HKAA 2ZLBA 4MYHA 2FZ4A 3GZJA 4GBJA 1VA4A 1CNFA 3MTDA 3PDIB 1Y0BA 5CD1A 2QF7A 3OOSA 4ZOLF 3ZVNA 5AHRA 4MRVA 4HX5A 4ILEA 1T8YA 1VE5A 1L1FA 2ZXFA 3CBQA 2FW0A 1RHKA 3LIIA 1L1EA 3PEEA 1QRRA 4Y6PA 5CW1A 5K0FA 2QVGA 4ZPXA 1P2TA 1J97A 1E2IA 4I5FA 5FOTA 5HBRA 1Q20A 3TR5A 2HIHA 1AF7A 4EI9A 3V48A 3TJZA 3KX2A 3V97A 5EMMA 2J4CA 5I9LA 2DETA 2TMDA 3HU3A 3JQBC 4CL3A 1SD2A 3KSZO 1PEAA 2GAFA 2VZEA 1N75A 4TOIA 2PSDA 3LHIA 3T5MA 3SX2A 4DLKA 2C4UA 4C0BA 4CM7A 1E8NA 3IBCA 4GBMA 1UDAA 3SLRA 3BXGA 1KQ3A 1YR7A 4FILA 5TT0A 2X6QA 3REQA 4Q12A 3K8QA 1DWOA 3HUFA 5G4KA 2I3AA 4DANA 1AC5A 3KIPA 5ALNA 3DGEC 6YASA 4PF1A 1IL0A 4FEEA 1VLMA 2KI5A 1RBQA 3E4DA 3E27A 1QOPB 1UH5A 2OV3A 3PXUA 2NM0A 4EECA 1CB7A 2XEDA 3DLCA 3JZDA 3LY8A 4KSCA 1X80A 3VV2A 2G40A 5B1DA 4AYTA 1G8JA 4JJ8A 1R37A 2Q2WA 3KJZA 3S0JA 2FW7A 3H9JA 3K0AA 4HZUB 4GOND 2ZYUX 7GPBA 1EBFA 3Q3GE 3UC9A 1KZ1A 2BV3A 2HU8A 1QUFA 3LC2O 5K3EA 3A1TA 1AZTA 4WLOA 1NE2A 1Q7RA 2RBEA 2Y0BA 3Q8WA 5DX0A 4BCDA 1DJOA 3HACA 2HV9A 3KB1A 4HQOA 1F5SA 4Q03A 2XVZA 4R2HA 4F0JA 4YV7A 3MB8A 3GAMA 1YAHA 1VGQA 4OFWA 4CLRB 3N1UA 1BCSB 1NJ5A 4IV0A 2PKCA 3ET5A 4L74A 2VCHA 2QN9A 2XMCA 1OWLA 1E5VA 2DMRA 1DG1G 3P26A 2XCTB 1T2UA 4L72A 4HNGA 3ED1A 4F21A 1U99A 2JJQA 3H5WA 1U7DA 3M6WA 4DWWA 1O6CA 4EPTA 1LSUA 2ADOA 3SXPA 3DAPA 1O4VA 1KDOA 3O82A 4I6EA 1Z0ZA 2AWNA 2PFSA 4KU4A 2MMCA 1EFTA 1PGQA 4LBWA 2P68A 3EZNA 4XQGA 3KJEA 1KIMA 4IIJB 4YDRA 2F8SA 2OZKA 2RAVA 3GUHA 3M3HA 1W2WB 1ZKDA 2OPHA 3CXUA 3WK7A 2O5EA 3ZJ4A 2WK1A 1PJ2A 3EGVA 3N05A 3D59A 1K6IA 2DY1A 1R4ZA 4MVJP 3RFCA 4A7PA 4EY6A 2JLYA 4TRJA 2ZWAA 2FEXA 2UZ0A 5B55A 1V0JA 2ZBVA 2P2YA 4RWZA 1G291 1UJCA 1T6XA 4HYTA 3TTXA 4D9CA 4LF9B 5K4GA 2Y9MB 1ZBDA 1YS7A 5D7BA 1DBQA 4EI7A 4ZO7A 4P3PA 2CE2X 1P2BA 1ZUWA 2PM8A 3FZQA 3HB4X 4TYPA 3V2GA 10MHA 1XTBA 3QKWA 4AF7A 1QF9A 1U1DA 2QE6A 4GP7A 3ZXXA 1QH9A 4LJ8A 1Z13A 4O02B 1QYWA 4R81A 4EYSA 3ZUPA 3IC5A 1E1KA 4GYWA 4MUNA 3WK6A 1RD4A 4PBSA 5AVQA 1XMIA 3IAFA 3KU1A 1NVVR 1XVLA 2IYYA 5JTTA 4NF2A 1TAQA 1WOYA 3S68A 1VPEA 1EM8A 2W6PA 1UPAA 5ENVA 4QGBA 3RUPA 4XX0B 2J0EA 3UF0A 5H7XA 3JX9A 2JFGA 1V3TA 2Y8EA 3NH9A 5LNK1 2ZB2A 4MIYA 4AYWA 1NIPA 4Q9AA 1KJJA 4KEAA 3DHVA 4ZCSA 1RYMA 3CB4A 4PQEA 4L4ZA 3EVEA 2UVQA 2NACA 2W6OA 2YJ3A 3OX1A 4NAVA 3AF3A 1M2OA 1OC2A 3ZLUA 4EO4A 3GLIA 3R3YA 5BVGA 3BC1A 1O8CA 4GE3A 1P9LA 2YCBA 4PW0A 2OVFA 2HWWA 4JLMA 3T95A 4EEZA 3U4QA 1JQ3A 2XE6A 3AILA 4OQZA 3GD7A 3H8VA 4IOJA 1CY7A 1ONPA 4ZGGA 3IVMA 3VDMA 1AQLA 4CQJA 3P2MA 5JV5A 1CF4A 1A9ZA 1E8DA 3HN7A 1FXUA 3AHEA 4M86A 1H5NA 1AZWA 2XWQA 1YCFA 3R41A 4W4TA 5H81A 3Q11A 2NPFA 3W5AA 3E48A 4IQ4A 1DU4A 4B3SB 1JYSA 2G5GX 4X44A 2CC2A 1XVAA 3ED5A 3ECSA 3OT5A 3EZ2A 2ZJ8A 2B37A 3VU0A 2FPGA 2WYHA 3OIGA 5A4IS 2JANA 3AFOA 2ZTUA 4DMGA 3IDAA 3SSOA 1BCRB 3VPGA 3GJ8A 2VJCA 3JXEA 3PYLA 3CH6A 4MS4A 4MVYA 4YC7A 3D3WB 3WQQA 4DBZA 5L6LB 2FPXA 1BMFD 1ZW1A 2Z9DA 3MCAA 4LWPA 4JKOA 2R1VB 4DWVA 4WHMA 4XEHA 2DR2A 3JYOA 4F9TA 3WYNA 3AETA 4RY8A 2ZWIA 2PGOA 2P77A 3SDZA 5KYNA 1IQ0A 1C30B 4ZVOA 1KYIA 1LI4A 3KZVA 3C4VA 3O0DA 1QONA 4NICA 1Q2UA 1ND6A 1T5DX 4D43A 1TK2A 1DXQA 4TV9F 4E88A 3EB9A 5FTJA 3DBOB 4NNPA 5KWIA 1XZDA 4O8CA 2ZBPA 2ZI5A 1H4TA 3PWKA 2ZI7A 4HNAA 5KX5F 1L4LA 4ZOEA 5D84A 3IHLA 1JECA 1W5TA 2WLTA 3SEZA 5A6SA 4I4TB 4JT4A 3O2NA 1K08A 5A5DA 4WOPA 2UUOA 3SLGA 3QU5A 4BLWA 6AT1A 1HOTA 4NAUA 5FNVF 4LFBB 4LBZA 2H2DA 3LA8A 3P5SA 1QRAA 3V4SA 3SR3A 1OI7A 2CDBA 3QK7A 5A3VA 5ALQA 1IDOA 4I50F 1Z25A 3GJ7A 4EUFA 5JH7B 2ZYVX 1E6KA 4LXGA 1Z26A 4B09A 1MU0A 4GC9A 1RJ9A 4QUAA 3IRVA 1WSBA 3GFTA 2QD2A 3MOGA 4FWIB 5DGTA 4BMDA 4DA0A 4RPHA 4ZTBA 3WLLA 2HF8A 4EOGA 1TVMA 5A1JA 5I01A 4H31A 4LX0A 4XRGA 4HVTA 5ICSA 1G38A 2VC2B 4CWAA 3T1OA 4Z9AA 1E2EA 1Z2OX 4N8SA 1QU2A 3UGKA 3EXIB 1QYCA 4CF5A 3LCVB 1Q0RA 3DKIA 4ZDKA 5B7GA 5BYAA 4XGRA 1RRCA 3AKYA 1XZGA 2ZREA 2GZ1A 4Q1BA 4B3CA 3JQAD 1QH8B 2QUAA 4IHQA 5GAJA 3SNHA 3ZWBA 1VBMA 3NIGB 5F3DA 2QM8A 4AKIA 3K71B 3OT1A 1WQ4A 5CCDA 4KPUB 5B2ZA 3RYCA 1KZ9A 1NJGA 1ZW6A 3F2IA 3GFQA 5H3CA 7YASA 2W58A 5NLLA 3IQWA 1LK5A 1PR5A 2NAPA 1HDYA 3BK1A 4FBLA 1PU2A 1RYBA 4NEGA 3UK7A 3OICA 1DX6A 4EW1A 3BWVA 2C2WA 1RRPA 4U7WA 2FOLA 4KQ9A 1LS6A 3MN1A 3LT4A 2HSZA 2DWUA 4L5BA 4QOEA 3WO1A 4MW2A 5HUQA 1WTCA 2AFIA 1KBQA 4C89A 4CEIB 4ZICA 4HSGA 3VOTA 1HDCA 1U7TA 2ZRBA 1IBKB 1G9XA 1XRLA 4J2OA 4FD2A 1JR3E 2EERA 2ZIFA 1E6WA 1FYVA 3FDIA 1FX1A 2COUA 1QJ4A 2HSDA 2YR0A 3I9JA 3MTEA 2MINB 2BRUA 3RV4A 3ELBA 3FVRA 4LHZA 1UADA 1DKOA 3IV9A 4FYVA 1BVHA 1P9WA 4DNXA 5JAZA 4H27A 1USGA 4G9BA 1IJBA 1E3EA 2IK8A 4GMDA 4WFIA 5TPWB 4B87A 1A8HA 3PGLA 3ANMA 5B30A 3BXOA 4XVRA 3BCSA 5AOBA 1KOJA 1Z2AA 2FZGA 2DBQA 3DZDA 1E5LA 1E20A 2QT0A 5CHEA 4DDHA 5F5LA 5BV2P 3WL7A 4BYMA 1TMGE 5BXQC 5KTMA 2OKCA 2ISCA 3AERB 3D8RA 2CSUA 3L7KA 3M4ZA 5DOVA 4DUGA 3NHSA 3GLFE 3H6KA 2OO5A 1ZIYA 1IHYA 2F9MA 4R41A 5AW3A 1Q74A 2FRDA 2PFKA 4EX7A 1GKLA 3KVNA 3ZGOA 3UA3A 5TJHA 5A4JA 5HKBA 1NKVA 5GIPE 3M9LA 1ZD3A 1VMDA 1EQUA 2IYOA 4NZPA 4TMXA 3TH5A 1TCAA 4K2HA 3LUBA 3MJDA 1AKWA 4L08A 1WCXA 4G26A 5EE5B 1MX3A 1OVMA 1JLSA 1R6XA 4J3NA 4UQLA 3M5DA 5B4UA 3BWYA 1H8HD 4OHVA 4EKIA 521PA 1OV4A 5JD5A 2VF5X 3ORSA 3GV0A 1DSSG 4FHFA 4H0FA 4MYTA 1FRVA 5IC6A 3VSCA 5FUMA 1GRNA 2P4QA 3ABRB 2GWRA 3FFWA 3GH1A 1LZKA 5T4FA 2G77B 3FMIA 3RBAA 4BVHA 1HTBA 3I9KA 2P90A 5F64A 4P58A 5J2UB 3VSDA 3WLOA 4B5KA 4YMWA 4UNNA 3CF4A 3OHPA 4O4IA 5BT9A 2JGFA 3KUUA 3NVAA 3TVTA 2VYNA 1V4VA 4BP9A 5HWSA 3OM0A 1EUDB 4CG2A 4R0VA 5EJFA 2FQXA 1M8PA 3JAKB 2D1SA 4KW7A 4I55F 2GAIA 5IJ0B 2QAGC 1W8DA 1Y5LA 2XH8A 1UEIA 1C7IA 3JQEA 3O94A 2FSVA 5DM60 3ZEAA 1DBIA 4E4RA 1F6WA 2FY8A 3KC2A 4I1SA 4NBWA 3E70C 1V8BA 1L3IA 1FSFA 4F45A 2QPTA 3V1TC 1WHTA 5JWHA 1PSZA 1K68A 1J7KA 1LDGA 3E8MA 2VF8A 4DDWA 3GZTB 3WQSB 1TD9A 2R44A 2WPDD 1PV2A 2P9TA 2PGJA 5IPFA 3IDSA 2OBMA 3Q3HA 3IEMA 4HAIA 1D9ZA 3KPWA 3LUAA 1S6YA 1E6EA 5A4KA 3JY6A 1G8MA 1BMDA 4PLPA 2W2QA 2J87A 3SGLA 2OBBA 4HF7A 2ZIZA 1OA0A 4YS6A 3UWPA 1TA9A 2Z09A 4UNIA 2NUTB 1HL3A 1E1QA 3RAEC 3DF7A 1GKIA 4ITRC 2N1MA 5T41A 3THRA 1CNEA 1O3YA 3TZCA 3H9CA 3EVTA 3X1YA 4IVNA 3B7PA 5DXJA 3G2OA 2NTVA 1U5AA 2P2ZA 4G1MB 4H3VA 1KYVA 4JFAA 4M0MA 5SZKB 1O95D 5K99A 2WWVD 2NN3C 3O03A 2KPOA 3S5JA 3S1LA 2PUDA 1LNZA 2OYRA 2NPOA 1P0IA 4DUZB 2EDAA 1PNOA 2RAFA 1BD3A 3CLHA 3EVBA 1JDPA 3L6BA 1QVAA 2QU8A 2Z08A 3OX3A 3TQSA 2Z04A 1Y63A 3IQDB 3R0VA 2EZUA 1DC5A 2I6FA 2RKWA 3X1JA 2BEUA 2XXAB 1NXQA 3NANA 1IAVA 3BSWA 4H7FA 1JLRA 3ECCA 4C88A 4DXAA 5I7EA 2I3ZA 4P32A 3VHLB 5B4VA 2V7UA 2Q0HA 1E96A 3COPA 4B3HA 4OJKA 1EHCA 5F78A 2ZI9A 4Y30A 3U17A 4N65A 4QU8A 5TQJA 4P8RA 1IHOA 1RPTA 3GFOA 4E3ZA 3VC2A 1Y4SA 3EVAA 4GICA 3S81A 3I92A 3K73O 1AQIA 1A8UA 2RSLA 5JY6A 1SHUX 1SC3A 2FW9A 3CINA 4JGIA 4AJHA 2D5CA 3FTPA 5T4EA 1O54A 1KU0A 3KLPX 1P0CA 3ZXSA 4QXOA 1I94B 1TIBA 3TL3A 2J4DA 1FQKA 2QV7A 1PBTA 2WVHA 1V35A 4R1NA 2OGZA 1P2VA 1QIDA 4BU1A 4XUGB 3L0ZA 2QX9A 1JH9A 4XFDA 1U5BB 2IU3A 3N7AA 1R15A 4IZ6A 4D44A 1LC3A 4WW0A 5JAQA 3H3FA 4M1KA 4D25A 4KV9A 4AWBA 5AM1A 5E1DA 5I8WA 4CLDA 2GCGA 2IQ5A 1XA0A 4GNKA 2D8MA 3TI9A 4D3DA 3D8HA 2JCSA 2PUWA 3EQZA 4XTCS 4CNQA 1PK7A 4F85A 3G9TA 5AK5A 4DIFA 2GASA 3OKFA 4JQZA 3QY9A 1UDBA 2BZGA 2NX2A 1J2EA 2Y0DA 3A6KA 3U4QB 1DDGA 5BRJA 1V7QA 1IHUA 3GP5A 3JYHA 3KSAC 3MTAA 3ORFA 5E6RB 3ZCRA 5F9HA 1SRQA 1KXJA 2CBGA 2PU7A 3OLCX 4BN0A 3UAVA 4CCAA 4KCGA 3R24A 3U6BA 1Z7BA 3T3EA 4M8KA 5LXTA 4I8DA 3W6NA 3ZOKA 3HYTA 1NI4A 3KJHA 1N0HA 2NTJA 4LHSA 5LYJA 1I3NA 4YDHB 2Q4EA 1UDCA 1THMA 4LDNA 4PSDA 3RBVA 2HSJA 3F7NA 3ZDZB 4DV4B 1RWWA 2JPDA 2NZJA 3F4LA 4KRYA 4NCNA 3U81A 2QTTA 2QW1A 3QFCA 4FR2A 3UMSA 1MRSA 1EE2A 3WNZA 4I19A 5AQ1A 1W8IA 4JBIA 2QMYA 3DVRX 3BE6A 4ZCQA 3ZGYA 1C3VA 4WVLA 1VLVA 3MLBA 3RIEA 2H5EA 2HRRA 1V95A 1ZXBA 1VGRA 3GQBB 2ENWA 2HCJB 5D1NA 2CLOB 3EEQA 1D2CA 5CT6A 3ZDAA 4JUIA 4NH0A 4YREA 1T9GR 2WJZB 1FUUA 3NGXA 1K5GA 3NHRA 2RB5A 4PAOA 1W36D 2BEJA 4HNQA 5AUOB 4UOQA 2XD9A 5GINE 3JQFA 4H77A 3UMFA 3LO8A 2BHTA 4DJDC 2V98A 3QPWA 3STHA 4W1PA 1G6KA 1WMDA 2FX5A 1QH1A 2FHSA 3CT6A 4C22A 1O97C 3TNDA 4RTOA 2NIPA 3A6ZA 4L8LA 1GEGA 2BMWA 2P3QA 3WGHA 5DRTA 1F0NA 1U7ZA 5HS6A 1IVNA 2H1VA 3A6JA 4GL4A 2B4AA 3IUEA 4R69A 3O8QB 1OYVA 2A1UA 1A5BB 3PCTA 1L7VC 2PKYX 2A5YB 3HSYA 4JJ4A 2QL7A 4QA9A 1QP0A 1AMNA 3NRJA 1IWOA 4MRRA 3KZNA 2AI2A 2XYVA 3CGWA 3OJXA 3AHGA 2JIMA 2G72A 5FUQA 1FFHA 3LP6A 2Q1XA 3H87A 1T2CA 3LD9A 4FLMA 4BNIA 3OZBA 1SXJA 3JD3A 1OQAA 4MA0A 1MABB 2RD2A 3KPYA 4B6PA 1S8NA 3VR5D 3AB7A 3WGJA 4UBNA 4XOUA 2FEOA 5DM1A 1FXSA 4DILA 4KQCA 3GCZA 1B8UA 1U8TA 3H8SA 5EXTA 3BB3A 2VRCA 4ESVA 2C82A 3G8BA 3D6NB 2D7JA 1FFSA 3HYNA 4RFLA 1LNSA 2I76A 4GWKA 4WXEA 5TMPA 1TUBA 3ZVRA 4Y7DA 3ROMA 4NLLA 4QUBA 3CUEF 1Y9ZA 1CQXA 2NZUG 2AOTA 3VR2A 3CLRD 4GKKB 1E1DA 3B12A 4M22A 4MQFB 4B32A 1YC5A 3FFTA 1ETUA 2RHDA 5IKXA 3GNSA 5IFLA 3LYLA 3TZ6A 4EHHA 3KQUA 5FTLA 2J9XB 1PG2A 3SNKA 3FM9A 2AKYA 1Y4ZA 4PX2A 4E0BA 3OIVA 3PDUA 5K0LA 1CPYA 1BGWA 1YQWA 3M5WA 3RYHB 5HXAA 2LGJA 1NNI1 3RIXA 3HKCA 3MJRA 1KEZA 2QE7A 4LJLA 2G82A 3WE7A 1TJYA 1R18A 1AGNA 1DZIA 1NQWA 1C8LA 1Z5WA 5JCJD 2BGGA 1FMTA 1G3MA 4UHEA 2FF5A 1OSNA 4IKOA 1BD4A 1Q12A 4RIIA 1YZTA 4P7GA 1M5UA 1E7QA 4JOBA 4IIFA 4F3CA 5GMOA 3RC7A 2VKTA 3HZZA 2XQGA 2R97A 4K9KA 4DCOA 2NV2B 3HO1A 3E0XA 2E4VA 2XDAA 4I14A 5BW5A 1Z33A 2OGUA 1ZMRA 4MKXA 4JUFA 3O3OB 1KH2A 1Q21A 1QE3A 2AF4C 4NHEA 1NUUA 1CYDA 4TV8A 4B3BA 3CR3C 2P5TB 2YRFA 1BJKA 3HLYA 3NAGA 4ZI2A 1CULC 1U8ZA 4G4GA 4GZ5A 4WLFA 5J5AA 3IVAA 2ZT7A 3BGSA 3R44A 2XLBA 3A4LA 1TQ8A 1ZK2A 1M2NA 2JGLA 3FH0A 1XNJA 3RVPA 1A98A 2VQ3A 1B8PA 2PUVA 4JC4A 1KTIA 2GDJA 2A0UA 1GCUA 2OYSA 3F6CA 3GRCA 4BFXA 4XWOA 2X3YA 1CUAA 1E9EA 1U2QA 2PMKA 2YMMA 3FYUC 3H2KA 4M1OA 1KH3A 5BNIA 3AFNA 3KSMA 4WESA 1FJHA 5BW8A 5IZCA 2HYDA 3IILA 1Q83A 1YQEA 1Z4IA 4XWYA 1Q1ZA 3HXOA 4MR7B 4QQFA 4C3ZA 1QKJA 2DPXA 3L93A 4HDSA 4Y2YA 2NPIA 4CGZA 2ZYIA 3AHDA 2YVLA 2G04A 3U4CA 5KYVA 2PLNA 2O8CB 1CHDA 4YGYA 3ZDXB 3MCZA 4MCHA 5JAPA 3KRTA 2QSJA 1E2JA 4EG3A 1EP1B 2P0AA 4MHTA 3AZPA 3MWGA 2YXDA 4UEOA 4WZAE 1RKVA 4CM1A 1Q11A 4LYEA 5EE1A 2EARA 1BHQ1 3C4QA 3LC1O 5IXYA 1TVCA 2QN8A 2CXSA 2P9EA 4V3CA 3RVMA 2F1KA 1YSCA 4RGBA 4C6HA 4F4CA 1SVLA 3RSOA 1U0BB 4L8VA 3H2IA 1JFFA 3QBEA 4JN6B 4Q1DA 3UAZA 2ZYTX 2AGVA 2FU5C 4NCAA 2I78A 3CNEA 5KYWB 3KSRA 1YMQA 1PWEA 2AEMA 3RW9A 2GVZC 2PK3A 4HQ0A 4DCMA 2PUJA 4DLAA 1FTYA 1NHGA 2VYCA 2ZRIA 5J4VA 3L6RA 2XQJA 4MDYA 3KAKA 5KHOC 4MRMA 3FTDA 2PXXA 4M1YA 5DM0A 3WGZA 5AQEA 5DNCA 1EP2B 1Z29A 1JWAB 3MRSA 4J4HA 1NLFA 5H0IA 4GL2A 5C9ZA 2H18A 4QICA 1CZKA 3LUPA 4QOIA 1XCLA 4LNHA 3QG1A 1A9YA 5EP1A 1XDZA 3V8MA 4NK4A 2AVNA 1Q3KA 4QQKA 4WN3A 1FPQA 2KQUA 2VT2A 1T43A 3E9DA 3FYTA 3A3PA 3M6AA 1Z62A 5CU7A 5GONA 3F9CA 3SS9X 4F84A 1ORTA 1SPXA 3LK6A 2C29D 3FZGA 4RF4A 1TQHA 3BFXA 4HDMB 3X0DA 3WGYA 3QUQA 4BE9A 3V46A 1PSWA 1GPBA 1MB3A 1V41E 3GT7A 2AMJA 3I6MA 2ECKA 1C5KA 1TKRA 2XCLA 3D7MA 3IEXA 3QOYA 1ZSVA 3UUFA 5ELXA 4P4NA 4UE2A 2PZAA 1RLIA 3MWYW 4F3NA 4U2FA 1GDDA 3E9CA 1BDJA 1ITZA 1US8B 1XROA 4IJVA 5LU8A 3H5NA 1NN5A 1AO3A 3UEOA 1V7PC 4DC9A 4YT8A 8GPBA 3A6EA 4IQGA 2PV0A 1YVEI 1T5IA 1OTXA 5IUNC 2RH5A 4HAUA 3UJAA 3TD6A 2PL1A 2C54A 3KDSE 2YOHA 4Y1EA 1HK7A 3DE4X 3WZLA 3O8DA 1UFRA 2JCGA 3T1YB 4FR0A 1SUWA 4Q21A 1DWQA 3T35A 2FWAA 2Q9AA 5ISMA 2A3RA 4ZZ2A 4QSHA 5E1MA 3Q88A 3LDUA 3I4LA 2ZCJA 1GV0A 4MKFA 4ENSA 2Y3IA 1BWPA 2VEOA 4PTYA 2FR8A 2XNSA 4YRDA 1WZIA 4AXBA 3IDOA 1L1QA 5HQ3B 4MVJF 5KVQA 1FLNA 4RVFA 4WCFC 4CDNA 2VYVD 2VPXA 3AIKA 2CDNA 4U2EA 5TVKA 1U1EA 2AI1A 1G5QA 1U1FA 1NN3A 3IT2A 5CP8A 2AK3A 3MEQA 2DFKB 1A1SA 1JTVA 1Q57A 2H7CA 3PRHA 4MWOA 2P7IA 2P7HA 3LSTA 5TEVA 1OH5A 1N3BA 1CY1A 4D74A 3RKSA 2NU8B 3PYXA 3W7VA 2Z5VA 3MCVA 2ZVQX 1KAMA 3HP7A 3PI7A 5PGMA 4DNFA 3O26A 1HT0A 3EMBA 1WUJS 2VTKA 1YVPA 2IXEA 2VWHA 3G8DA 2FEKA 1YZHA 2J3KA 4G37A 1KDVA 5G0TA 1GIAA 2B8WA 3OWXA 4L28A 2N46A 3DV9A 5AH0A 2YY7A 3T3DA 2BRUC 3KUCA 2NSYA 3ZWDA 4MCIA 1G8SA 3RSHA 3B70A 5FV4A 5MN6A 2GBGA 2MWMA 5DM2A 3KD3A 3V33A 3OLWA 3O9VA 1PHPA 4EMUA 3GEGA 2HBQA 3PPVA 2WIJA 4XCXA 1BVUA 4YI3A 3AIOA 3KLOA 1UBCA 4NRDA 1ZNQO 5I9NA 1FFXA 2H29A 4AL4A 3CXRA 2BGNA 3BG5A 1QCZA 2B6HA 3JQCA 3P96A 2Y0CA 1CP2A 4GT1A 3TCNA 5FWYA 5GZ6A 1JZSA 4TKUB 3KKMA 2ZBUA 3QBDA 4HLNA 3VR6A 5GPBA 5JSYA 3WRYC 3SF8A 2IIQA 1P1BA 5CFMA 4E2XA 4YJ2F 4GP6A 4AS3A 2FRDC 3O2QB 3N3BC 3P2EA 1EGHA 1PNTA 2WWGA 4MI1A 1G63A 2G25A 1JPVA 1M2HA 1P0FA 2J0VA 3CRNA 3LCRA 3LJKA 4MVWA 1V47A 4PTLA 3VZCA 4BNLA 1NRXA 4YEDA 5BV0A 1OE0A 3D8TA 4EKEA 5KQPA 5KYYB 3IMEA 3FYSA 4YFYA 2J5KA 2LZ0A 1SH7A 1OAOC 2FUNB 4JSYA 1XPRA 3LTEA 5MF6A 4OM8A 3J80A 1LDEA 1HEIA 4U02A 3L40A 5H5JA 1O0CA 2A5JA 5CA0A 1B8OA 1C9EA 4CCWA 2CKDA 1BE8A 4KMRA 1KZYC 2OGWA 5JNUA 2IPNA 4B4DA 1QRTA 1KK1A 4NZYA 1EWVA 1QHEA 1PGOA 2OFXA 1UJMA 4RV5A 3ZK9A 1P44A 3DPIA 1FC0A 2XMQA 5DNVA 5TR9A 3FGOA 4EBFA 4OAQA 1JT2A 3UBTA 1RAHA 2Y99A 2YV5A 3BMXA 4L76A 4OH7A 5E9JA 3ZGVA 1IN1A 3GVIA 3DEAA 4IOKA 1XZNA 1UXOA 1K92A 3L46A 3N76A 1PK9A 1VHLA 1XMSA 1KYQA 3IDFA 4MGKR 1SBIA 3MJHA 4W7IA 3V7YA 2DERA 4G01B 1C7EA 3L7MA 3JVEA 1IZ9A 4O6VA 5ALLA 3V9AA 5AVYA 2X4GA 5LP6B 1SUDA 3GRPA 2AS0A 3IO5A 1KOFA 1ZA1A 4FX5A 3KHSA 3I23A 4CN9A 4ZCTA 2GN1A 2YIDA 1FFWA 1UP4A 3DOIA 3JQ8B 2JFYA 4CLHA 1JPNA 4TWJA 2CN1A 4J9UE 1N6PA 1YDFA 3NT4A 4ZVSA 4XGIA 4YONB 3KOZA 1P1JA 4O1MA 4BNTA 1TX4B 1YVUA 2A4KA 2OV8A 3NWOA 3NDBB 1S3SA 2O50A 2UYQA 4J4TA 1U7PA 5DT9A 4DDVA 1JDVA 1WWKA 3OEED 3R3VA 4A23A 1YB5A 4M1ZA 1AJEA 2EQ5A 2WSLA 3U7EB 2BT4A 1JDBC 1NJ1A 2DQZA 1RHJA 1NF8A 2IY8A 2J5BA 2JFZA 2VQ6A 3GFGA 3I2IA 3IP8A 3NI2A 1KA9H 2NZXA 5E6UB 5LWHA 1UK7A 3P9QA 2JFFA 4Z4FA 3ZN2A 2JJMA 2QQEA 1ZU5A 1SRRA 3MAGA 4PCVA 5ALZA 4ECAA 4H9GA 3TIFA 3VNVA 4G09A 3L7JA 5BWOA 4G8CA 4TT8A 1KH1A 3SSMA 3HXMA 4B6RA 1E7WA 3H5VA 1Y80A 4PIMA 3K2BA 4BLSA 3LVBA 4DV1B 5DCYA 2P91A 1QRSA 2JD0A 5DK4A 4BV8A 4IJMA 4BTVA 5BORA 1BXZA 1G5PA 2BEWB 3DO8A 1HF3A 3Q6IA 3F97A 4OM7A 3RUIA 5CIYA 1GLGA 1F3OA 3UT5B 1QNLA 1PFUA 4G0WA 4F86A 3CLTD 1Z5VA 3HFSA 2RH4A 3PENA 4NDNE 4G5SA 2WIAA 4HO1X 5C4GB 3QNWA 3P2YA 4FKZA 2XT9A 1X1SA 4O2LA 1NPDA 2VJBA 3FBTA 4PLCA 5EHQA 5AVVA 2PYIA 2DP4E 4UTNA 3RFTA 5KMGB 3BT7A 5BWBA 5HEKA 2HBYA 4HHEA 3ZQ4A 3CZ9A 4JYPA 2GF9A 4YT5A 5FHRA 1SQGA 3WLKX 2C3PA 3CEHA 1ZN2A 3VC7A 3IR5A 3G13A 1EGMB 4C2TA 1NRIA 1TT7A 3R3ZA 3HJTA 1QSGA 3Q2IA 5THXA 2YZKA 3VU1A 2SKCA 2C0PA 2CLDX 4OQEA 4ARVA 2MR6A 3KLNA 5F9MA 4URXR 3WRWA 1M75A 2UZIR 5F98A 5HM6A 4FOSA 3EXEB 3RC3A 5FFFA 2V6JA 1EB9A 1ULSA 2PMEA 1D1QA 3ZWPA 4EIWA 3H5IA 3WB0A 1AS0A 1L5MA 4AP5A 5C8YB 1SCKA 2GPNA 1KVRA 3V8BA 4RYDA 1DQZA 1NPYA 2YN0A 3FPKA 3PHGA 4MPRA 2IHYA 2ZYDA 3PE6A 3FKSA 4AIRA 1T35A 1ML4A 4DJEC 1TU4A 1P5ZB 4OHPA 3EPKA 4Z4IA 2XNCA 5MGNA 4L4RA 3IMFA 3QX7A 3RCBA 3BREA 1JDSA 1WKCA 2YMQA 5JJIA 4PG7A 5I7WA 2QRKA 2WTEA 3LG2A 4S12A 4JLPA 5ECYA 4F4IA 4MIOA 1XQ6A 2QTZA 1NUQA 3CZCA 3L18A 4G3XA 2WWYA 1GD1O 1P6QA 2C0CA 1YA8A 4DLNA 2W2KA 1GR1A 2ZTHA 3KB2A 3NRBA 1M0EA 2JGDA 4TRRA 2QN6A 4R2LA 5EE0A 1DQPA 2YFQA 4AWAA 2PX4A 3W2FA 1H9AA 2P2SA 2QMEA 4WMLA 1YFZA 2FZ5A 2QGZA 3MLAA 1N3LA 4HLUC 2O0JA 1ZXLA 2WJYA 3ND8A 4ZRMA 1M6VA 3TL2A 4X3PA 3K72B 4DCVA 4LJYA 2GLXA 3CLUD 4RGVA 4MV3A 4UW9A 4N3AA 3KVVA 2OBXA 4OH1A 4YQZA 2VP6A 4GXNA 4WOKA 3I1IA 2M6KA 2JFPA 4IRMA 1A97A 5FKJA 1A2KC 4TS1A 3TBHA 1CRZA 1Y1TA 2A9VA 2B3DA 5DWQA 5EZYF 3S2FA 5ITVA 2PUFA 3JQFC 5I4CA 2QIPA 5KTSA 2QTGA 4IP0A 1Z6AA 1H93A 1DRUA 4LZOA 1JIQA 4O1IA 3ISTA 2O48X 1S96A 4K05A 5L7YA 3RTGA 4B0OA 2EW8A 2O1XA 2PT6A 3TTTA 2BJWA 3OX4A 3ZD7A 3D31A 3Q9LA 4U7GA 1U2DA 2MR5A 4I81A 3LQ4A 2PEZA 3T7DA 3QVGA 4C4YA 4CCYB 1KI3A 1QTRA 5TSDA 2W90A 1OFHA 4R2WA 1H2HA 2ATIA 2NO5A 3GH3A 1PJ8A 4MZDA 1MHPA 3HKBA 3D6MA 1X39A 5EKTA 2NYAA 3ZPXA 3BXZA 5ELLA 5FBZA 1AY0A 1FLVA 3LUHA 3SJZA 2WD9A 1LV7A 1S5PA 1W87A 2C58A 2F1OA 2IZ7A 2ODEA 1YMUA 4Q02A 3GUCA 1VE1A 1TQ4A 3OIWA 3SBXA 3UXHA 1EESA 2WF9A 5FR2A 1SXJC 5JD4A 1BKYA 1JB1A 1Q1NA 2QMUA 1BWQA 1LW7A 1N2GA 2GBCA 3M6IA 4J7XA 1VLHA 4YALA 5AJHA 1TD1A 1ZQ1A 3WO0A 4C1NA 3DHEA 1YB1A 1YRLA 5FTMA 2PS3A 3VSEA 2GHTA 1MC4A 3NHYA 4GMXA 4NNJA 5B58T 3NMUF 3DS8A 3KPUA 1TAHA 1VI5A 1SBCA 3RS0A 4D56A 3LLUA 4EB0A 4WKGA 3WFZA 4CTMA 5JS8A 4G8BA 4U7PB 4Z9FA 1QVRA 4O2AA 1X7DA 3ITDA 3QMPA 2ATEA 3E0QA 1CZRA 3T3MB 2A0FA 3EGDA 3KQYA 3RVBA 3WVNA 3FTFA 1OBOA 3R3SA 4RF3A 3T9BA 5EIFA 5C18A 3GPBA 2OYCA 2BI4A 4MXDA 5HKOA 1LSOA 1W1WA 1QO0D 1ODFA 2E82A 1IJKA 4F4HA 1PD0A 4X7PA 3NDPA 1A7AA 4KAAA 4KTTE 2K6GA 4TUYF 1KDTA 1F7UA 4GX2A 3JYPA 2HDNB 3CE6A 2QJRA 2FP3A 3G1UA 3HY6A 1E63A 3RSFA 1GNSA 4HQNA 4Z54A 4NMXB 1D8AA 3MINB 4KSYA 4PGAA 4S2EA 1M6YA 2OHVA 1YULA 4IO0A 4K86A 4CQLB 4EEKA 2VDWB 3M34A 5G2OA 3U3RA 1TJ5A 1VHTA 4CI0B 2O2DA 2QP3A 3GHHA 1LI5A 2BBWA 3SEQA 1R5JA 3DKVA 3L1KA 1VKZA 1G64A 3D4LA 2QUIA 1YUMA 2Q6IA 1T9AA 3N28A 3PHBE 1OKKA 2PSJA 1YFJA 2YQ4A 3RADC 4KQJA 2ORWA 3ND5A 2ST1A 2WF5A 3ESQA 2QQ5A 1EXMA 3FPHA 4J0JA 4KX5A 3VR2D 1SOMA 4HUJA 3VX3A 3VYWA 4AJNA 1ZGZA 2JFUA 4Q9HA 4NR0A 3ZYZA 4E14A 5CFQA 1H3FA 1Z4JA 1QDLB 4QGAA 3ABSB 3JRNA 4XB2A 2YWJA 3C70A 1A7KA 1ZM2A 2ZAGA 2Y2UA 3CPJB 1ISRA 1M5TA 1ADGA 4GYYA 2ZM5A 5T3YA 5ICFA 1IUNA 2YIJA 3AMVA 1GL3A 3L79A 1DUSA 4MQ5A 4EHJA 2DWOA 2VDKB 1G5HA 3P9XA 1I3KA 4ZO9A 3ST7A 3AGQA 2QE7D 4PPFA 4I1OA 2GMWA 5A3RA 2A88A 1CDZA 1YS6A 4Q1CA 5CT5A 5EVJA 1IQUA 3R76A 3UFXB 2Z4TA 2IOFA 2QAIA 5IZCC 3IUSA 3WQBA 3A0UA 1IQRA 3TQIA 3E35A 2JJ1A 3FNHA 3F96A 1HSZA 3Q6NA 2H65A 3CR8A 4O2BA 5JXIA 4LV8B 4Q3NA 3COVA 2RONA 2AEFA 2JLZA 2QI9C 2VXBA 5K8VA 4YLEA 4BMYA 2ACEA 1LDYA 1QQTA 2FZCA 1VHWA 4OU4A 4I2VA 3HHPA 3A4TA 3I2JA 4MZXA 3ZC3A 2XLCA 2D2IA 3LPDA 3BMNB 3IE2A 4MV5A 4MPJA 3DO6A 4QREA 3RJ9A 821PA 1IB0A 4KUHA 1ZR4A 3IUBA 4QECA 3ND6A 2P62A 4YNBA 1WCIA 3WADA 1D2HA 3FY4A 2D4HA 2VAMA 2HO4A 5HFNA 2CMDA 1K2WA 3PRYA 1S89A 2J5RA 4URUR 3ZWQA 3M2PA 3KXKA 2V6GA 1UFQA 3EEYA 4P82A 2GN0A 2RJNA 1CIVA 3NTVA 4DADA 2FUCA 4JP3A 3PTAA 1EK1A 4G86A 3EDRA 5JEEA 1GUAA 1I1OA 1VBNA 2OHIA 5DB4A 1WV0A 2ZI4A 2PBLA 3ACDA 3QVVA 3PCRB 3F0TA 3L0CA 1XUOA 3BWXA 2LBPA 1N2BA 2SECE 3EUEA 1ZISA 3CB2A 4M8SA 4MS1A 2XJ9A 1I13A 4QO8A 4BFLA 1VJ5A 2IELA 3IIEA 4YECA 3RD5A 3DBRA 3F98A 3WBJA 4JITA 5C7YA 3PD7A 3QFHA 3TMYA 2VJMB 4NJOA 1AUVA 3SD7A 2ZEJA 1KO7A 3MUFA 4K6KA 1ODSA 3JARB 1XRPA 1RRVA 3AHFA 5JIBA 3U9SA 3AR4A 5I51A 2BP7B 4KO4S 2P6OA 4ENTA 1FYEA 4C7OA 2DTXA 3T5CA 1JXMA 3K09A 4US2R 4OO3A 4R3UC 4KJZA 4MAMA 2GS9A 4JWKA 3NBMA 5EIXA 2I34A 2WD7A 4O63O 5EUBA 1OXTA 3HKEA 2XQIA 4Z1OA 1IXRC 1I0LA 2DUNA 1QK4A 3KT0A 4EL5A 1PYGA 4MCJA 5JMTA 2CV1A 3COJA 1I4WA 4Z2AA 5C1PA 2WHQA 4ZQBA 5ALGA 3FHLA 1H5UA 2EX0A 3CIOA 4I1YA 4BE7B 1MQAA 4PS0A 3TZLA 2IU4A 4KKXB 5HF6A 3DPUA 4QM6A 2V03A 3OZDA 3D0RA 3OMLA 3ZHCA 4ZMBA 3I72A 3C7TA 3GPCA 4DA8A 1F7VA 3KYBA 3AVYA 3JPWA 4MEAA 1FDUA 4IAOA 1WVMA 3AFIA 1NR7A 1YJAA 3FCOA 5DW3A 4EO7A 1E6MA 1QV9A 4MV1A 5DYIA 1ZOLA 3N2KB 4GPAA 5SY6A 2EVWX 3TB6A 3W06A 2VHTA 1P0MA 2BFNA 4UEWA 2Q45A 2FMUA 2F9LA 2ZJFA 2ALJA 1KY2A 1ZD9A 1LJUA 4QYIA 3CZRA 2R7KA 2R6AA 2CFSA 4HS9A 2VUUA 3MWEB 1R74A 4PFQA 3SJ7A 1EZ4A 4R31A 3G3EA 3GLTA 3SZLA 3U6KA 2FR8C 5ILOA 2ZS7A 3OCWA 3F3SA 1NXXA 1RVV1 4K9QA 1P7ZA 2W6QA 1ISHA 1GG9A 2D0DA 4ZVTA 1E2PA 2P40A 4LV5B 1X7YA 2ILVA 4DM7A 3CN7A 4HFJA 1EEHA 2FP4A 1W44A 4ZRNA 3WDMA 4E5SA 2WJ4A 1GG5A 3DVAA 4KXYA 1ZGCA 4JJFA 4Q4AB 3RC2A 3ROTA 4FFBB 4R0MA 1LD3A 2DR0A 2GZ3A 1VYVA 1QIMA 5JATA 4O0LA 1VG0B 4E2WA 4HLCA 2P69A 2FA9A 2XDWA 3OZIA 4MWZA 3FNIA 4V0MA 4AJOA 1GPJA 2WZQA 5HMMA 4GR5A 1Z47A 2P1ZA 3UQZA 3L1UA 5AKKA 4YV1A 3E15A 1VJTA 2GHQA 5LLSA 5IKMA 1CLUA 4FHCA 4BLPA 2X8AA 4ZHQA 4OMUA 3NHPA 3QLJA 1K8XB 3IQGX 4JJGA 2QMHA 2XQFA 2X9VA 3K0FA 3L49A 4KIUA 4BNFA 3NX4A 3WYEA 5INTA 3HB5X 5E9WA 3QF4B 3QWHA 1FMLA 2OCYC 2DH6A 2DHDA 3QY0A 3RVQA 4P3KA 1OI4A 3DOHA 4FGZA 3S27A 5CFNA 1B42A 4HTAA 3F1KA 3JR7A 1Y5MA 1UQRA 3H8WA 4QARA 2O8EB 4JP1A 1CZOA 4C20A 2QZPA 4NY1A 4E1BA 3WNQA 5EHIA 1AMUA 5DYYA 5MFPA 3MOSA 1OTYA 3SOPA 3DB2A 3T6KA 3O4HA 2D2EA 3F4BA 4PRLA 3FNBA 3HJRA 3K4QA 2LCFA 3DEKA 4IDFA 3WJ7A 1WDLA 2VCEA 2B8EA 3ZZ1A 2J6CA 4CL2A 2PIDA 1DTWB 1N2OA 2A57A 2P30A 3VZQA 3D6JA 1POWA 2V9ZA 5FLEX 1B4DA 2E85A 4FGWA 1W0KA 4NVRA 3KFVA 3BE5A 1CUEA 5GZ1A 5LIPA 4M0LA 1NQOA 3NKLA 3ZCSA 1IWBB 5HQTA 1RRFA 1T4MA 4Z3KA 4IPTA 1P7WA 4BPRA 1K97A 4JY7A 4N40A 3LNTA 1SQ0A 4RUKA 5ELMA 5K0GA 1Z36A 3PIDA 1IQPA 1DHRA 3S2GA 3W79A 1MTZA 3FVTA 4PFKA 4RVCA 4Q1FA 3T38A 4NJMA 2XUHA 2YDYA 5D51S 2Z58A 3LXUX 4FMBB 2CL0X 2YZ2A 4LZWA 4UU8A 3HNOA 3QTTA 1DJNA 3HVJA 2D0PB 3PPXA 3VR6D 4UDYX 1F2TB 3KYCA 1ZP6A 1Y8AA 4XOIA 3QEKA 4K5QA 4EG8A 3MRTA 1ZWKA 4HQFA 2QYTA 5JS2A 5J2TA 3VXKA 2H00A 3PDJA 2D5BA 3OQMA 1E89A 3KTOA 3IBSA 3B60A 1XRRA 5L3QB 3B5EA 4NBUA 4F60A 4WE3A 1E79D 4J1NA 4X92A 1ELOA 1D3AA 1O03A 2JK0A 1AN0A 1GPMA 1XTRA 1Z6ZA 3DBLA 4M9SA 4EARA 1LX6A 2G1UA 4LPSA 5LZ7A 4CQMB 3RFUA 3SZGA 2GILA 2VXYA 4O4HA 2WYWA 1JMVA 4KVFA 4R1LA 1WW8A 4PPGA 5JE8A 1ABFA 1GTG1 2ZR7A 1VP3A 2GD2A 2FX2A 3WYAA 3OOEA 2O8VA 4CN8A 1EGQA 4IXMA 1KSGA 2WR8A 5AIAA 1CJVC 1G3RA 2BC9A 5F52A 3UJ6A 3UQYS 3DR3A 4BQSA 4WBNF 4LYFA 5YASA 2FN4A 4JVOA 3N2IA 1RPZA 5JNLA 3VHXA 2VWGA 5IH7A 1KP3A 3AW8A 4CKBA 2FQYA 4FYPA 3HGTA 4BNJA 1P9OA 1HMPA 3P2OA 3SQMA 4FBGA 4PNHA 1Z82A 2I6GA 4REMA 4QPCA 1CS0B 4FYKA 4BVKA 2ZR8A 4Q16A 2EP8A 4U8HA 1K7XB 1L6IA 3BMCB 4D99A 2ZWOA 4I4IA 1YQXA 1F8FA 3ZWVA 2FN8A 3L0PA 4N3GA 1R8QA 2AQIA 4IDCA 1GFIA 4Q93A 2AG5A 4J16A 3REQB 5IDQA 1C1DB 3JTEA 1CQWA 2WJWA 4WXHA 2RH9B 3R5JA 3JZMA 1WF3A 4LQLA 5CXSA 2L19A 3GEMA 3ZE1B 2R1ZA 4CKEA 5BSFA 3G2QA 1KQPA 1P61B 4RQUA 1K2VN 3VNQA 3T4XA 5EKDA 1GCGA 4M1SA 4EUKA 3KZ1E 3Q9SA 3Q0TA 1BXGB 2BEVA 5DM70 2QG6A 4M2LA 1QIIA 3BMOA 3OCJA 4DYHA 1YZYA 2F1HA 1XN1A 1QXSA 4QWWA 1IAQA 1FL9A 1W36B 2IH4A 2KMLA 1N92A 1XVUA 2WSMA 4H1TA 4CMIA 1N4DA 1XO1A 2HM7A 4P92A 5HG0A 3UJHA 3Q3VA 1A8SA 1LVUA 2FMIA 4R5HA 3A14A 1PWXA 1KBOA 5DN9A 2PWYA 5AM2A 1FX0A 1LZLA 3SM3A 3ZV4A 1ZK3A 5JS6A 3NO4A 3BHMA 3D5EA 1M7HA 4XCQA 4BLOA 1RYDA 4LYJA 4XTRA 1TM4E 3A04A 1JJAA 2ERCA 4KYIB 3JQGA 3GGPA 4M36A 1Y6RA 4QHSA 1Y1SA 1T0HB 2J3DA 1FUIA 1IIBA 1E2LA 5TQVA 3S8YA 1LWNA 4N7BA 1KIAA 1QCCA 1YNSA 5J9FA 1TUGA 2MYNA 3TYXA 3MMNA 2Z8YM 3OZSA 3IYLW 2C95A 4IS2A 3ABZA 2JNWA 4NOLA 3RU7A 4E09A 3DQPA 1EE9A 3OZAA 2OXRA 4JBXA 4BB5A 1EPUA 4GBGA 3A6HA 1N9ZA 1ZKMA 2DUMA 3PI6A 5SY9A 5C4MA 5IARA 3QVMA 2NO9A 4G4SO 2CMKA 4PVCA 3UWSA 1MAUA 3AJDA 3LWNA 3B13B 4ZV7A 1YBFA 4BNUA 3DC2A 3P0FA 4H4CA 2H5IA 1Q1BA 2ODWA 5G0UA 1E1RD 4W1RA 4DKJA 4G41A 3ZS9A 1DJQA 3U60B 1M7GA 3TTWA 4R1UA 1NRJB 4XZ3A 3OFSA 5A4DA 5CBKA 1BFKA 4EZEA 5K05A 3BHJA 3R9XB 2UYOA 3LT0A 1MJNA 3N2NA 2CFCA 2VDRB 2CV0A 1K1EA 3P9KA 4MOWA 4V38A 2VO1A 2PGIA 2C00A 2HI0A 1BQ3A 2PNFA 2QPAA 4KV7A 4BO0A 1G17A 1QOZA 1WQ1R 1M83A 1T8SA 2B1IA 3A1CA 3R09A 4X7MA 1B6RA 3E1SA 3AL3A 1ESZA 2NUPA 4RK0A 3M7IA 1WVIA 3VU8A 3HP1A 2Y1KA 5E8RA 1ECJA 1L8AA 1AUXA 4FDUA 5G4KB 4AS1A 1CRWG 1SVWA 2HJVA 1USVA 1FW8A 4AJEA 1VA5A 3AYXB 3O8OA 3AM3A 4ZU3A 1ZZGA 4BL5A 3H2GA 4F4FA 3THWB 3V7NA 1U3CA 2VJDA 3BQ9A 3ZVMA 5JVDA 3ACCA 2ODNA 3LF1A 3BK7A 2Q4DA 1X80B 2WAXA 3IUNA 3AR2A 3NATA 4GS5A 2PHZA 4ZRDA 3GJRA 1OXSC 1SWVA 5HZGA 4BQNA 2A67A 3GZNB 1X8JA 3K0AB 3OFVA 5MN5A 4HAWA 5DHQA 4CT4B 3GLHA 2ILTA 4PNEA 1I7SB 1VSQA 3KJGA 4M37A 1DLIA 2NP6A 4CLEA 1U0HC 3VTKA 4AZSA 1JEAA 3WGKA 5EZSA 3TQFA 3DDSA 3VU9A 2ZYSA 4GQAA 5CLJA 1II0A 4HK4A 4BV3A 2ISQA 3ILSA 4ENWA 1EQ2A 2G9ZA 4RPKA 4TTTS 1IVYA 2Q29A 4BZQA 4KWTA 1KI1A 3IDQA 4RA6A 2W71A 4EFLA 3ASYA 4X71A 2H2GA 3CG0A 4OBWA 4WKBA 2GX6A 2ZTMA 2O3SA 1U2DC 4CIVA 4DR2B 4IUCS 1N36B 1MQ8B 3V6LA 3G0OA 1R00A 4KDRA 5ER6A 3ZWXA 2O1SA 1U0FA 3UAYA 2SNIE 1B3RA 5K8JB 2WWWA 1RWQA 2I4IA 1SGWA 5JQGA 4IGKA 1W9MA 1TI7A 1Z17A 1R50A 1N0WA 5BW6B 4MW4A 3LI2A 4GH5A 1RXEA 3SFVA 1HBJA 3UZUA 3VRHA 4GHWA 4IV8A 1GA1A 3B3FA 2AR0A 4FUQA 1QFZA 1SOVA 4NECA 4DQ0A 7REQA 1TT5A 1TGVA 2AFIE 4QRDA 4D9FA 1XCGB 1DAGA 1MZPA 1E1NA 2HOQA 4A3SA 5IJWA 3QEOA 4UD6A 2FN3A 1FNBA 4UDXX 1KJYA 2H9AA 4G1UC 3ZDQA 1Q0QA 4DHWA 5E7MA 2Z6VA 3R7SA 1ETHA 4M0PA 5BRAA 1G59A 1NKSA 1N57A 1VIAA 3B9BA 4FOPA 2R3SA 5H9VA 4HXFB 3LX4A 4MUGA 3SYTA 3UUGA 5C7LO 4OK3A 2C4HA 1ZNYA 2GZAA 2HA6A 1XZIA 2ZUEA 4F6LA 4EFNA 4DNQA 4RVOA 1R1DA 2ZDQA 4C0JA 2DFTA 2N1BA 1RAGA 4AQ7A 2W00A 4CW7A 4CKYA 3FUCA 4HWGA 3LX6A 3SQXA 1GU0A 1MG5A 2IHKA 2R5FA 3ITNA 3NHFA 1RLMA 3PUKA 4Y6GB 3X44A 2J46A 5FDFA 5GQSA 4N8EA 1PT7A 4TSKA 4HEA1 4CHTA 3RIMA 1ODKA 3A3KA 3IODA 3HVRA 1QP7A 1TCBA 3KZMA 1EM8B 3BOSA 4WJZA 2HHAA 1NX6A 1MB9A 3QELA 2AN1A 5ALUA 1RSZA 3R8CA 1Y7LA 1E4VA 3O7WA 1Z3IX 1JYFA 2X2PA 1TMYA 3LHKA 3T0IA 1OBHA 1ZO8A 1B16A 2OGTA 4P4SA 3LLMA 2AUMA 2C1EA 4RQBA 4EPRA 1VL1A 1M2OB 2GK4A 3G5MA 2FGKA 4Y1RA 4R2XA 3L05A 4KXWA 2JGJA 2RAPA 1KJ8A 2G1AA 3DCYA 3LO5A 3H05A 1LXCA 4Q6BA 4JJEA 2IZZA 1E2NA 2YHIB 3C5HA 4INPA 1KK3A 4PZPA 4MW5A 4U2BA 4ZQCB 3RRJA 5CK5A 4FMDB 4B7UA 1KQGA 3JD1A 3VM6A 2VHZA 4FNOA 3CRVA 3PKZA 1D0VA 3DG9A 2EX1A 2X0EA 2VH5R 3D6UA 5HZHA 1EIWA 2WFAA 2XDYA 2PGAA 1SK9A 1PGPA 3LK7A 1WL8A 1Z0DA 3A9UA 4KPFC 1XZLA 1CQPA 4HJXA 1M34A 3ZHTA 4LXHA 1RXWA 1AHHA 2C07A 2RGEA 1ZC3A 2NUBA 1WXEA 1DV2A 2PV7A 1HLGA 4OFBA 3I62A 3PEYA 4RPJA 4JMPA 2BM0A 3OE7D 3HR7A 3ZQ6A 3TJMA 5JISA 2MYUA 4XJVA 1E69A 2FPGB 3G6KA 1OGIA 2OFOA 4B7AA 4RNCA 4N3CA 1OVGA 2XPCA 3IIIA 5F23A 2WE8A 5JBIA 3OTHA 2GPJA 5TB5A 8MHTA 4GR4A 4LVOA 1QC5A 1K8YB 3DONA 5FI1B 2ZJ5A 1R64A 1RIIA 3JS5A 3LH5A 2HDOA 1YVRA 2V7BA 1H5QA 1TOAA 1KMCA 1WCYA 3LP5A 4FQ7A 1J06A 4IKPA 4UBLA 5B6PA 3GLGA 1O5IA 4LOLA 4NBLA 4QOJA 1VJGA 4IGIA 1RXYA 1Q6ZA 2OHXA 2Y1WA 4H3HB 4P7BA 5AM5A 3RRNA 2CXQA 3EQ8A 3ZVLA 5K0ZA 2CBZA 1A4RA 2W6JD 4WWHA 4REOA 1SXQA 121PA 4MVCA 1E59A 1YS4A 3C7AA 3KBBA 2ZTLA 4JT8A 4YMTA 4HTFA 1C41A 1LNQA 2DULA 3GLRA 2ZS8A 3HVKA 3I6QA 1C4WA 1ZICA 1BQEA 3QNMA 4PHHA 1ZMTA 2D5IA 3C3YA 3R7FA 5K3CA 3ZCXA 4BVLA 4F4UA 5IM4A 2VTBA 4WZBA 4BFTA 4N49A 3SX4A 1ZIXA 3WLEA 3WLIA 4HNAB 1E3TA 3F7MA 2Z5FA 3D6TB 1EFPA 3ENQA 5ECWA 5EJAA 4FKMA 4NXMB 1DXYA 3BBLA 5A6SB 2IS6A 4RH3A 5AO9A 3SHFA 1HE4A 4Y1GA 3AXSA 2GTPA 4QASA 2ZCVA 3IKMB 2O2IA 4U9UA 1DWPA 1ACMA 2IYAA 1B8VA 5K3FA 2HRBA 2ZBRA 4UNQA 1OI2A 5IK2A 2FNAA 2AUTA 2XTMA 3GCDA 3C1AA 4Y7CA 4YB8A 4DLTA 5ALMA 5H4GA 3U3JA 5IDXA 1J2TA 2WAMA 2X3UA 2QDKA 3QWIA 4FEYA 3V9PA 1N5JA 3GDGA 4WOBA 2JJ1D 1OI3A 1QG6A 2Q07A 3NGLA 1N5DA 2P9FA 4CM4B 1SA0A 4MNTA 3R6GA 1RJ9B 2QROA 2RGNA 2O6LA 2ZJ1A 5FA8A 4BU0A 4W63A 4CKCA 1JR2A 2CBXA 4WKPA 1AN9A 4V39A 3OPMA 5FX2A 3RTEA 3S55A 3G5LA 2WJ6A 4L4UA 4YMUA 1XJCA 3WISA 2C2XA 1JIIA 1I2AA 2VSYA 3H5TA 4BO9A 2IF2A 1PS8A 2GJAA 4Y6RA 5FNZA 4BO4A 5CURA 4EG4A 3GMDA 5CYPA 1R6DA 2QXUA 1XT6A 1P8JA 1F8UA 3ETEA 4IWNA 3ZNQA 1H0KA 5LKRA 1O96A 3K09C 3OT1B 3IKJA 2XE7A 2RCYA 4QXRA 5TY0A 5KZMB 2AYZA 2FW6A 3QEJA 4D8TA 2HQSA 4TLAA 1JPUA 2FSGA 4MUFA 1L8QA 3KD2A 2ZVDA 4Q15A 4UAJA 1OYOA 4B79A 2NADA 2QN2A 4F91B 1RC1A 5AFSA 1H2XA 2O2XA 5CIWA 3OJWA 4NESA 1K6MA 4AO6A 1WMSA 4D8UA 2BUCA 2VT3A 1PT8A 3HA3A 4EHKA 4UNRA 3SOZA 2JAPA 3C3DA 1JKJA 5AR1A 2AFIB 2Y92A 3G2NA 2QGNA 4IO1A 3K5PA 2EJCA 4K6MA 2WSIA 5IEJA 1XNGA 2FK7A 2R68A 2IYSA 4FSXA 4UEQA 4YAOA 3UJDA 3UK0A 3ANSA 2Q5OA 4DS3A 1E99A 2O20A 3M6UA 5HTKA 3RC9A 2ZDHA 3TGPA 1KVSA 1UBTS 4QGHA 1W52X 2JFXA 2REBA 2AZXA 1D2EA 1KJZA 1S2GA 4MROA 3SLKA 4BTEA 1ZONA 2ZQYA 4EELA 5HW0A 2IU6A 3L6EA 4E12A 3ROEA 1KFKB 1XK6A 3JWIA 2ZJ3A 2ZDGA 3PVZA 4FFDA 4HDRB 4K6CA 4O4JA 3BXEA 4YP9A 3UOWA 5CD9A 1ORRA 9ATCA 1YRBA 4PBRA 5TXGA 3HBMA 1HV8A 3E82A 1UBLS 5KOJB 2Z8YA 2AXQA 4CFSA 2HN9A 2Z30A 4G23A 1D0IA 1ZM4A 2R6DA 3DKKA 3QLVA 4D0GA 4HLQB 3OOJA 3IS3A 5LU9A 2WG1A 3KQLA 4OXQA 1FYWA 5JXHA 1LDNA 2ID4A 1SG9A 5IVHA 3QF7A 3BWCA 4IX1A 1I7DA 4LIPD 2ZUVA 4OUDA 4XARA 1YR6A 4DZTA 1Q0ZA 5FBKA 1XNHA 3MS4A 4R3WA 5DTIA 2AMVA 4KFSA 5PNTA 1Z37A 2X77A 3DT8A 3GAZA 5E3HA 2H4HA 4J29A 4OP1A 1GZUA 2YQ5A 3UXYA 1EWKA 1FXWF 1NJSA 5AMXA 1JGTA 2X5KO 1X14A 4Q9DA 5GV8A 3KWLA 1H42A 2CUTA 4Z49A 1DQRA 4WUVA 2AZDA 1KIFA 3CYFA 2P5SA 3PUIA 4TZTA 2A1TR 1C8KA 3PUWA 2R1UA 3ANXA 4B6OA 1S9HA 3B5JA 3GGJA 4WTOA 1ZC4A 3VVBA 1JLMA 1RLUA 2AFHE 3G5UA 2W6NA 3VR3D 4URVR 4F93B 1Z15A 1Z5UA 3SXJA 2CKMA 4KGVA 3R5KA 2HYIC 3P4UA 4EPWA 2QMOA 2ZBEA 4ZTUB 3DMTA 5EPEA 3UG6A 2A92A 1U6IA 1JE1A 2PL9A 3DTTA 4CBVA 2FSPA 4M6WA 5E0KB 1P1IA 1H2EA 2DJ5A 2QVZX 2WP0A 4ZCRA 2H4YA 3CVYA 4RV4A 3GC6A 1YR3A 4Z5XA 1O5TA 2XTAA 1T3HA 3K6SA 3DHNA 1YU6A 1NC1A 1SG0A 3I0ZA 1GZ3A 1L5WA 2BFMA 2G8LA 2B99A 2Q2QA 2R7MA 3AHIA 3OQNA 3IQHX 3TQHA 1JHXA 3EBOA 1JHMA 4HZUA 3CVWA 2R8ZA 2N47A 4F6RA 5AXCA 1HLPA 1ZU4A 1KZGB 2GPYA 5D5PA 1GLVA 2BR3A 1YZGA 2EZ4A 1J49A 3H97A 4IEFB 5E95A 3BB4A 3IAAA 1WHTB 4LPKA 1E2UA 4Q3OA 3WK8A 3T4PA 1JEYB 1R5NA 4LXIA 1QM5A 2FHPA 2SKEA 2CL6X 4DLRA 4R0NA 3KYIB 2XZOA 3UHJA 4QYTA 1N8NA 1UR5A 3E2PA 4MR9B 3N8HA 2PMCA 1SXJE 4YR7A 4XGKA 3ZX4A 1J8DA 4HFRA 4MRAA 4G85A 4QNRA 3REOA 1YRYE 5CGZA 3T9EA 4IMIB 4C0AC 2BKLA 4PEVA 2AA3A 2H1RA 1W1UA 3PKIA 5FF9A 5SICE 1Z2CA 3RB8A 4JQCA 4B74A 3RAFC 1TIPA 1PD1A 3I8XA 3EIEA 1P6UA 3L0DA 4UOEA 4RMNA 1HLFA 3D4NA 2VNJA 4F8YA 3K92A 1BYIA 1KU6A 4I36A 1WMBA 5J63A 1ZCJA 2PR7A 3WDKA 4LHEA 4D3YA 5C31A 5JJLA 1BEUB 3P71T 4RIHA 4GAEA 2WMNB 4RMIA 3TZKA 5A3SA 3GUVA 1JI3A 2ONCA 1QF6A 3N3AC 1VGVA 4ZAVA 3FJ1A 2PT5A 4YRZA 2OV2A 3IQEA 3GMIA 1SEPA 3PP8A 2QUZA 5IYZF 3SKXA 4HWKA 3IBYA 4D9NA 5B2FA 1JB9A 4ROTA 2ZE5A 2XSZA 3L0BA 3LUKA 1T1SA 4PHFA 4B5LA 1R5OA 2D00A 2Z6QA 3ODPA 1VPTA 2R7NA 1V9CA 4PLZA 4C7KA 3HJBA 2A0XA 4YROA 2EJUA 3PDCA 3CONA 4JI1B 4DZRA 2GCOA 3MB5A 2FMXA 3KJFA 5ALXA 5ALEA 3INGA 1SY7A 1LVHA 2GARA 2VATA 5CB4A 1OREA 3VH2A 4J0GA 3H3XA 2AN4A 1DDIA 2A33A 2VHXA 5EMLA 3FNRA 4YXFA 1DUIA 2FXVA 1V39A 1AD2A 3DTNA 5DCUA 4EW2A 4QT4A 4PYIA 4BP1A 1R9JA 1VI6A 3NJ4A 4QFBA 1V6CA 1ORVA 3KR0A 4RK5A 2HT1A 3BX1A 1DC4A 2QTLA 3H4MA 3QHAA 4R9NA 4RHEA 2PO5A 2HIAA 1TXGA 3JQQA 5F1KA 1U8CB 3KBOA 2R7LA 3NOOA 4RSRA 3NETA 4JBWA 2FPRA 3IOMA 4FJ0A 2D1TA 3TSOA 1C9JA 4YJ3A 3ZU3A 1Q3HA 1SG6A 1ZNZA 1NAHA 3EIWA 3FROA 1DARA 1LQ2A 3L0SA 4E32A 2ZWVA 1C2YA 3KTAA 4A73A 1JHPA 4DR6B 1KSHA 3EDCA 1F14A 3ZUGA 4QTUB 4J16C 1DUVG 4NPHA 5KTOA 3N2GA 2HCTA 5LZ4A 2MT9A 2YC2C 3D2BA 5D5QA 3S6JA 5L95A 5IAAA 2C7QA 4AMUA 4X93A 3UXMA 2I1WA 5AM0A 1IBCA 1BS1A 1ESDA 3GRYA 4UE6A 3EFBA 1BRTA 5EI5A 3B1FA 5EHXA 2CXTA 3M81A 5C3UA 3OLQA 3T9AA 4MMXB 2XB8A 3IAM6 5DP1A 4M53A 4CUJA 1NR1A 1FS5A 2VA9A 4EP1A 3KWJA 1N3IA 3F4KA 4DJ5X 2OBFA 3HZOA 2XMGA 1Y5RA 3S8MA 3A6FA 2CLIB 2OV1A 3EIXA 3LQFA 2EAUA 4KLCA 4XCVA 1MVOA 2PLWA 3W90A 5LXTB 1X7XA 5C3MA 2CVZA<