1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Collagen-binding
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
3K72B 3V4VB 1ATZA 1LFAA 1M1UA 4A0QA 1PT6A 2ODQA 2VDKB 3VI3B 4G1EB 4FX5A 5KYNA 1JEYB 1MJNA 4JDUA 4NENB 3K6SB 5E6UB 1QC5A 3E2MA 4CN9A 1UEXC 4UM9D 4CNBA 4IHKA 1DGQA 1JEQA 1T6BY 3TCXB 2VDLB 2VDOB 1PCXA 2I6SA 4HQLA 2I6QA 3ZDYB 4Z7OB 1SHTX 1MQ9A 5HJ2A 5E6RB 3GXBA 2QTVA 4HQOA 1MHPA 4BJ3A 3ZQKA 3PPWA 1BHO1 1U0NA 3TW0A 3HXOA 1AUQA 1U8CB 2XWJI 2X5NA 1YVRA 3ZE2B 1MF7A 1PD0A 1CK4A 4DMUB 4HQNA 2ADFA 4Z7NB 1QC5B 3TXAA 4F1JA 5KYWA 1AO3A 3V4PB 2I91A 3EFOB 4C2AA 4PN7A 4WK2B 3EFOA 2XWBF 4F1KA 1JEQB 2VC2B 4CN8A 3EGDA 5KYUA 1JLMA 2NVOA 4IGIA 4UM8B 3N2NA 3PPYA 1DZIA 1M2VA 1TYEB 3EOBI 3NIFB 1FE8A 1N3YA 1SQ0A 3NIDB 2NUPA 5HGJA 3FCUB 3ZE0B 4O02B 1IJKA 3ZDZB 1OAKA 3NIGB 4C2BA 5ES4B 3BQNB 2VDQB 2XGGA 3EG9B 3EG9A 3EOAI 3IJEB 3PPVA 4WFQA 1SHUX 3F74A 5LN1A 2WW8A 1IDN1 3F78A 1BHQ1 1M10A 5E6SB 5HDBB 3ZE1B 4HQFA 5E6SA 1YVPA 3EGXA 1U0OC 3VI4B 1N9ZA 2NUTA 1ZOOA 3HI6A 3EH2A 3PPXA 2IUEA 5KYWB 4WJKB 1M2OA 1XDGA 2M32A 2VDNB 4XW2A 4C29A 3HXQA 1RS0A 3EH1A 3TVYA 1QCYA 4NEHB 3K71B 3M6FA 3EGDB 5KYUB 1Q0PA 3ZDXB 1JV2B 4MMZB 3FCSB 5KYYA 1M2VB 5KYXA 2VDMB 3T3PB 1XDDA 2NUPB 3IBSA 1RD4A 3QA3E 1XUOA 1ZOPA 1T0PA 1V7PC 3BN3A 3RAGA 2VDPB 3T3MB 4MMXB 1L5GB 4UM9B 4G1MB 1JEYA 1ZONA 3EGXB 2ICAA 3Q3GE 4NENA 1IJBA 2NUTB 5E6UA 2VDRB 3K6SA 1M1XB 4WK0B 2ODPA 5BV8A 1CQPA 1RRKA 1RTKA 1IDOA 1MQAA 4HQKA 1AOXA 4WK4B 5KYYB 1NA5A 2B2XA 5KYXB 4M76B 4Z7QB 2WINI 1MQ8B 1FNSA 1PD1A 4MMYB 5E6RA 3BQMB 4IXDA 2O7NA
chains in the Genus database with same CATH superfamily
1AQNA 3MK31 3IUYA 3B53X 3DJFA 1L5YA 2FEPA 4X1IB 1KC3A 5JMOA 1Z39A 3PGLA 1DEKA 4PZDA 5EP4A 2XUDA 2WYHA 2PLWA 3KSAC 1XVUA 3EMVA 1K9SA 2YHIB 5LP1A 2MSDB 1ADGA 2OCIA 3I64A 4L4SA 4M0FA 2BE7A 1XALA 3EVBA 4TMXA 5B3LA 5BV7A 1MB4A 3SZOA 4FIDA 1A7JA 1YHYA 1PQ4A 1YNOA 1DXQA 2PL5A 2XZLA 3W9YA 3FLMA 1VI5A 3UF0A 4LF9B 3QP9A 5JIBA 4DL9A 4EY8A 3KVVA 3ZDRA 3A6PC 1XCBA 2GPYA 4BBZA 2PMFA 1KFEB 3AF6A 1KEVA 1RJGA 3PE3A 4QYMA 5B37A 3VH4A 3VO9A 4EIWA 1UUFA 2E1RA 4Q6WA 2E21A 3RUIA 5K03A 1I3MA 3W9BA 1WS6A 4M1MA 3RS4A 2V5UA 4DNQA 3GEMA 1PI3A 3ZW9A 1B00A 3SYLA 3CEPB 2YIJA 3JALB 3CZQA 2B5OA 5BVHA 5BV0A 5EWLB 3LSTA 5H7XA 5JSZB 3ZYZA 4BWGA 5ETJA 4WBNA 4JS0A 4Z4QA 1CB7A 3PC2A 1WZUA 3GRPA 1W1IA 2JAPA 4MR9A 4JK3A 1SD1A 1E1YA 1TMYA 2Q5LA 4BV3A 2PXAA 1GNSA 5JQGA 1DT5A 1XZ8A 2CNKA 2X6TA 3MJVA 4E4YA 4EVRA 1JKMA 4I1IA 5GPBA 3DDUA 4PLHA 1SBQA 4C7BA 2GQ0A 1T8PA 1W5BA 3UAGA 1RC8A 1U3CA 1PZMA 4JU8A 1I32A 2WD9A 4OB6A 4LIPD 3A11A 2H59A 1U8FO 4KGXA 4E03A 4MIYA 2CVOA 4EKIA 4GI3A 3KM0A 4Z8YA 1Q1BA 4Q4DA 3A3KA 4JL5A 5LMUB 4HNGA 4RV4A 2A9FA 4BMCA 2WM9B 3BE6A 5EJ8A 2ZJ4A 2YVAA 5DRTA 2WNHA 4O4JB 1ZYUA 3VJKA 2OM2A 2CMHA 4J0EA 4ZHSA 5FAXA 2FWJA 2QJRA 4KNWA 5CEJA 2DY0A 4ZARA 5HVNA 1MCZA 4QXOA 1W73A 3R75A 5DH9A 1WTAA 2AQKA 2G6TA 3B6EA 3ZGXA 2ANCA 1YUMA 3ZE8A 2B8WA 5JC8A 4IJQA 3H4MA 3OJ0A 2OZPA 1ZU5A 2I5PO 4V0ME 4A1OA 5ITWA 2YWCA 2JFFA 2P2LA 3DHVA 4Y2TA 4L7VA 2V1XA 1N9GB 5DBOA 3TTXA 3GRAA 1K3UB 4RDCA 2YYYA 5BP7A 3MEQA 5IZ4A 2I1WA 3MUEA 4J2TA 4MWGA 4QRIA 1P9OA 3O3NB 4GWGA 1G2OA 5CGZA 2J4DA 2OHXA 3I34X 5ALRA 3KB2A 1O8CA 1SIUA 2Y9PB 4LTMA 3LCMA 4YWHA 2NACA 4LG1A 4G9GA 4PG5A 4KR6A 3D4NA 4FHFA 3OJWA 2XRZA 3FBWA 1RKUA 2OC4A 1W9MA 2WTXA 4I1UA 4IHQA 4IUCS 5LQSA 3I23A 4FLFA 4DQ0A 1FDRA 3THSA 1E9BA 3FYHA 3RKRA 5KNBD 3TD9A 1O95C 1Z07A 2HEGA 2DUMA 1IVSA 3LS2A 3LT2A 3P32A 3SSAA 2O8BA 1V1JA 2AG8A 4IXTA 3OD1A 4EENA 3RWMB 2XMDA 3M7IA 2FZCA 5KNBH 3TAUA 4L1KA 3DEZA 4Q4AB 5SYAA 4BYMA 1MKYA 1ZGHA 3LLMA 2QHXA 1KZ4A 3CZRA 4Q3CA 3P2KA 4F60A 3GIDA 4GLOA 4ZMSA 2P9FA 3DAYA 2WKQA 4QYIB 5THQA 2WYOA 3AM3A 3IMCA 4MAFA 4ZA2A 4EFKA 5EJGA 1NULA 1MOQA 1Y3IA 4GWKA 3W2HA 1CRPA 4DIBA 1PQYA 2HSGA 3WLAA 4AVYA 1KEUA 1H2BA 2JEOA 3HDYA 3PPWA 3EEIA 2XOEA 3OFNA 3OBIA 3QPUA 3AHGA 1Z4PX 3KOUA 4TLLB 5FUVA 4KN6A 1YRAA 3HDGA 3WLFA 1LC0A 1UWCA 1SOAA 1Q3TA 3NUZA 3KPVA 4B73A 4BX9A 1NKTA 3AR7A 3BBPA 1BD3A 1MW9X 1FMCA 1R0WA 4W5JA 3EWIA 1PEYA 1ODIA 3KVNA 4EEXA 4WLOA 2ZRAA 1NX6A 4EKNB 2K5UA 4F4IA 4ZVUA 1CZHA 2GARA 2XBLA 2CDCA 2HI0A 4J7AA 4JLUA 4Q24A 3WKBA 5BUZA 1V25A 1FYVA 5AW4A 5TQ0A 4MYSA 5PNTA 3M2PA 3IJEB 4PRKA 1T1IA 1UL1X 4AY3A 3SIPA 2EFGA 5HDBB 3LF1A 1D0VA 3CHYA 3QW2A 3QVKA 1U9ZA 2IYTA 5AVJA 5FB3A 1YJCA 2A6PA 4HDKA 1PU2A 1UFOA 2EFJA 3KZNA 2PGAA 4KXVA 4W1SA 3RT1A 3AF4A 3NXKA 4M88A 5IVHA 3GFVA 3HY4A 3LDGA 4XPIA 2AMJA 1I7PA 3TL2A 2YNMA 1TAHA 4IG4A 3L6RA 3KL2A 4RMHA 2J3MA 4E5KA 2CV2A 1TKRA 2GH1A 3VAZA 2QN8A 4KMSA 3N8GA 4LJAA 2BEUB 2O07A 3I28A 4ZOLF 3RUFA 4XEUA 5F5XA 4OHKA 1TECE 2AFIB 4OLHA 4DDWA 1FP4A 2P9BA 3TLZA 3WHLA 3BULA 2BBSA 3G89A 3ROEA 2EF1A 2I6UA 2ZYIA 5J2UA 2JJMA 3PUXA 4ZI7A 2VH5R 3G2KA 2APJA 2ALJA 3Q3GE 1RXYA 5U4QA 5JD6A 1QYWA 2RGDA 3DTVA 1FJ2A 3MBOA 4PSUA 2VAXA 4MUAA 3CCFA 3E18A 5SY6A 4C04A 1I6LA 4Z8XA 1UPTA 4R2JA 3TSZA 3PDUA 3IGFA 3BMNA 3W3ZB 2BE9A 2IF2A 4N9WA 3NIBA 4QBKA 2KHZA 3Q85A 2FR8C 5AK3A 2NAPA 4B43A 4Z53A 4OF4A 5ALYA 1JG7A 3ROTA 5F5NA 2ZIEA 1JDJA 4H7FA 3RVMA 4GFDA 2BEVA 2GJ9A 4YRBA 1RQRA 1CWUA 4C4OA 4RBNA 1OLUA 1U90A 4YUVA 4CWAA 4DT1B 2VNIA 4CV2A 4JVNA 4E5UA 10MHA 1OTHA 1WIWA 4WKPA 2VXYA 3UFXA 3ABSB 1PW5A 2C4UA 3UBMA 3DE0X 1LC3A 2PL3A 2RIPA 2X4LA 4HSEA 1K6EA 1LVGA 1HQDA 4ZQGA 4YAIA 1AGNA 1JAXA 3UBTA 2YWRA 4W4TA 3KJGA 3UJ6A 5EPUA 4CN9A 1VL5A 5KYVA 4DDVA 1VCMA 1VMDA 2AE1A 1PDVA 2R84A 2RI1A 1NVTA 1PW7A 5TRTA 5KHLB 3AU8A 4RTPA 1WZCA 3TIVA 4E2XA 5IRCD 4TS4A 5HF9A 4E88A 2CNBA 3QPCA 3BCUA 4P5EA 3VV3A 3VU1A 4DEVA 3AUXA 4WACA 3W5HA 3IOEA 2QORA 1GGHA 3RIMA 1KHHA 4I4CA 5E6RB 1J8YF 2OV4A 3IH5A 1OXVA 3VR4D 2ZXFA 1C14A 3I45A 5A1TA 1G19A 1U9JA 3QFCA 1NIJA 4JJZA 2V3WA 2O8CB 1I2CA 3MAJA 1JALA 2ZAIA 4BZXA 1M5RA 1R9NA 3CN9A 1UP4A 4ZP1A 4HS4A 6REQB 1O6FA 1W8IA 4NRDA 3LP8A 3PR1A 2XRMA 5DX1A 4KZPA 4IIDA 2J0UB 4XWAA 3ZNNA 3D8SA 1SQSA 3MTEA 1Z5GA 2XQIA 1OD6A 1P1HA 4J4BA 4WUVA 4JLPA 2P40A 4I1SA 2ZI3A 4P38A 4REOA 3GJ6A 5T7BA 1G4AE 1R88A 2GJ4A 4OGGA 4WESA 2X5KO 4UU0A 1AS3A 2WD7A 3TCNA 4A82A 1RQ7A 1GAEO 3NJ8A 5LFAA 2Q0HA 3IKJA 2DUJA 3I2YX 3PL1A 4TGLA 5DEIA 1E8NA 3C3WA 3D6JA 1MOSA 2E4VA 2QX9A 2AZTA 3DZIA 3IMKA 5G02A 1Z62A 1E2UA 5ES4B 1XRQA 3FHTA 3EXEA 1JLRA 3WISA 2H17A 3DM9B 1RSZA 2IYAA 3LXUX 4WD3A 5K6TA 1TQ4A 2PKCA 5EVCA 5E9AA 2CXOA 5IMSA 2BGLA 1KARA 2IYEA 2QL6A 4XVRA 3KHSA 2LD4A 5IBRA 3WIDA 1QFSA 1HE4A 3OWXA 3QLEA 5TMPA 1QH9A 2WIGA 3KQYA 1J33A 3KJFA 4Q16A 1UINA 3R7DA 1YR6A 2V59A 1KBOA 3HJRA 4LRWA 4BB0A 3IQXA 4LF6B 5AM4A 1UMDB 1JHDA 5C4MA 4UPDA 4C4ZA 2QLFA 3GG2A 3PTZA 4I9UA 2XNDA 1Z12A 1C41A 2MMGA 3B9QA 3P7MA 4P0TA 1L5NA 1JF8A 3SDSA 2OBYA 2XDQA 1OX4A 4MCJA 1IN4A 3S8YA 1AK1A 1ISRA 3VPXA 5AW5A 4C4SA 4UE6A 5D51S 2IH4A 4KWIA 3PGA1 1KJIA 4MJLA 4QRHA 1QP0A 1KZGB 2X3FA 3DAPA 3VJLA 1ESMA 4RW0A 3UMMA 3RSLA 3FR7A 4TN1A 3S2UA 1YQQA 3BAFA 2YV5A 4G09A 1GZUA 2WF9A 3HNPA 3RDPA 2WTBA 2YJ3A 3THXA 2FW7A 3UC9A 4I36A 2FDRA 3JAKB 1QK5A 3NCTA 1NBMD 5HS6A 5JT1A 2SCUB 1SIBE 2O2ZA 2PD3A 4LDJA 3KUXA 1Z7WA 4J1TA 2O5VA 4B9EA 1NVXQ 1L5LA 4R2HA 4BOYA 3UFBA 2VBIA 2VOEA 1U8EA 2R6DA 5JSKA 2ZCVA 1E6EA 4UZFA 1QH0A 2IW3A 1F8FA 1WD5A 2Q5HA 3HM9A 3ZQJA 2QUAA 1SXPA 4J4TA 4AW9A 4GPZA 4M7OA 3IAFA 3RRMA 2ZZKA 3KFLA 2GVZC 1WCWA 1VMIA 5BWMA 1ILEA 1PJQA 1VLZA 1QHHA 3OG9A 1BDBA 4YRZA 4TKMA 1QG0A 5F12A 4AF6A 5C5CA 5ALZA 2HPVA 2C4VA 3D2CA 3K20A 4H18A 2LR0A 5FDFA 1N6LA 3CW2A 4OQXA 3DE2X 4BQOA 2DQZA 2PAFA 3E7PA 4HTFA 1II9A 6PFKA 2W9XA 4MKXA 3PNVA 1II8A 4RH3A 3WA6A 3R41A 3WYCA 1T5DX 1GZSA 4YS6A 1V9CA 3MINA 3SHOA 3ZN2A 2YC4C 4J1NA 4G5QA 2PSFA 1OTYA 421PA 1W0CA 2XIJA 4G86A 4Y3UA 2DR3A 4K26A 1ENPA 1CR4A 1YDMA 1Z47A 2EBHX 4PYNA 4CBVA 1H2WA 4G5OA 4DWJA 1E3EA 5C53B 2WAXA 1W34A 1YZQA 5DSZA 2DAPA 1XWWA 1DG1G 4O2LA 1XTJA 1XMIA 5MN6A 4ASUD 1P4JA 1Z7EA 4N5MA 4HQNA 4BTEA 5SZIA 4B47A 3UGJA 1AG9A 5C1DA 3MS7A 1RXWA 4PN7A 3LQ2A 3NWJA 2NTVA 3QLUA 3QKTA 4PCAA 3ZHSA 1D07A 2YS7A 5AJTA 3P71T 4NPHA 1H42A 2Q3MA 2W2KA 1JIUA 3LHSA 3F3MA 3N2NA 1AU9A 3WK7A 4TXNA 3WE7A 2WLTA 4XR4A 1FE8A 2GN6A 4L2IB 3ZJVA 3VPFA 5IWCA 1DJNA 1Q2UA 1EAMA 4YAFA 3UOAB 3VBCA 2G8NA 1LSJA 2IHZA 2P5TB 3K6KA 3HR8A 2VWPA 3KUUA 2C5LA 3QVVA 1RHUA 5F78A 2RKOA 4HLCA 4Q3AA 1EG2A 4MVJF 4NSNA 4E7PA 3G8YA 4HAXA 1O1YA 4P3KA 4X8LA 1K7EB 4DIFA 3BWCA 2YASA 4H6XA 2P68A 2Q5OA 1JDPA 2YWBA 1WV1A 5CBKA 1QM5A 3SY8A 5LXTF 1FUIA 5E7MA 3AKDA 4IVQA 4NLLA 5EOVA 2NUAB 4B34A 1FX1A 1RQGA 2OFWA 2I76A 1RLOA 5TLSA 3TLBA 1STOA 3UJBA 3U40A 4RX1A 3H8JA 2VF8A 1Q7BA 2MSCB 1YD7A 5LMZA 4TOIA 3I12A 4OIFA 2FKAA 1QZXA 2JAXA 2ZT7A 3JVIA 4HI0E 1QB8A 2YVQA 4B40A 4J91A 5CA0B 1W88A 5CNMA 5I7UA 4AZ0A 4UMFA 3QK7A 1Y42X 2E48A 4H0NA 3RGWS 1G6KA 1KIMA 3MCWA 4TZ0A 5EXDA 1XE3A 4B44A 3FYSA 3BXGA 4LOHA 5THXA 4EUHA 4HYTA 2IEBA 4V02A 5HFJA 4DCTA 5FOQA 5DGCA 3DVSX 3KQKA 2A1TR 5AXCA 4GM0A 1EP1B 2ONJA 2IOQA 2H3EA 4U02A 3ZIUA 3B2NA 4TSFA 3G5UA 1ACMA 4OP1A 1SEPA 1FYEA 4C4PA 4FR2A 1ECFA 3AVVA 2P27A 1N57A 1VRCA 2W2LA 4R41A 5ERGB 4FFPA 3DFMA 4GQIA 1NNLA 3K0BA 4Q4HB 5KQGA 3PX7A 1N8TA 3IDAA 2ZYAA 2ZWPA 4M2LA 3LGXA 2RHLA 2O8NA 2X76A 2HREA 1QV9A 4BO7A 4LMPA 4R6WA 4ZT3A 4DLNA 2A5LA 2Q5EA 3EEQA 2IPLA 1BMFD 1ZY2A 1IOWA 4ZFNA 4L3OA 3BWVA 1CEQA 1SA0B 1VLMA 3N0VA 3JQGB 3FNIA 3M5CA 1SXJD 4ZT5A 1K66A 2EW2A 3C41J 1MFPA 4AP5A 4Q02A 1Y6FA 2F00A 4QOGA 1Y5RA 2D06A 5CTJA 3X2SA 5KCZA 1GA1A 1PJ8A 2HU8A 1JEQA 2XOKD 4IHKA 4YXWA 3WGGA 4BATA 4F6RB 4C87A 1NW7A 3T7KA 2FR0A 4I4TB 4BMSA 4EJSA 3GMSA 4EITA 2X2PA 1X1BA 4LXQA 3LQYA 1NJ2A 2G4VA 1YSCA 1LBQA 2V54A 1FVFA 2P75A 3RU7A 5BN4A 3TDKA 1L5OA 5EE5B 1IRXA 3Q88A 4PTZA 5JCZA 1MPTA 1DI0A 2GXQA 2QKYA 4I3FA 2JHFA 3OCWA 3I3OA 3KLOA 2HHCA 4INOA 5L6LB 3BWDD 1QPBA 3OZFA 4FOPA 4CI9A 4Z54A 3KD2A 2NTNA 4Y6SA 4L5YA 3IUEA 2C2HA 2O2JA 3EDRA 1L2TA 3NOXA 1RRPA 3WNDA 4DC0A 4O4HF 1DQPA 1E9AA 5BOVA 2A84A 5A4KA 2WFMA 1X7XA 2OENG 4TXJA 3IHKA 2JJ1A 4IICA 5KSYA 1JLMA 2JKZA 2VSOA 5EIXA 1M67A 2BEJA 1HQCA 2RHOA 1C9NA 3PNKA 3WLIA 3G0GA 2WF8A 4FBLA 4P81A 1KXZA 2ZVPX 1RI5A 3LT5A 2FP4A 3OIWA 3B5JA 3OPQA 4WDRA 3H6KA 1IEVA 1KJZA 2J3JA 5EIBD 5BV1A 2PGDA 1I24A 2OY0A 5FTWA 3U0BA 4DY4A 3F4BA 5A6SA 3GUZA 3LY9A 4LV6A 3WRXC 4ZV4A 1OH6A 1EBUA 5CYGA 2FLKA 2IUEA 4HEA6 4URHA 5K8CA 1CNMA 1MEOA 2A1TS 1U28A 1WHSA 4PWYA 3DDZX 1BDHA 2P2NA 3DEKA 1E6WA 3FCSB 4MWOA 1PV2A 3W3AA 1ZGJA 3WLKX 4JJGA 3P9IA 4KE8A 4WH0A 4JUFA 2VTEA 2OOKA 1DKPA 1XL1A 4K9RA 2BTQA 3WMRA 3WIEA 2CE7A 3DD1A 2DBYA 5IHPA 2QYOA 4LJLA 1EVEA 3EWAA 3PR2B 1U0BB 3EZGA 1J7KA 2ZYRA 3S8MA 1Y34E 3H5WA 4W63A 3RCBA 2C7RA 3J7TA 3W9SA 4UM9B 3BRSA 4FXPA 2JCXA 5DIZA 3U4AA 3WZ2A 4YHHB 5CYOA 4B74A 1ZGAA 3ONWA 5C8YA 5SICE 2EZ8A 3N5KA 3SC2A 4W7IA 3LRXA 2BWJA 4B31A 2CFTA 2E82A 2N1MA 2R2AA 2ZIXA 4BXOB 1NBEA 3O38A 4DZZA 2WSLA 5D3QA 3AR8A 1S3GA 4IJWA 4JC4A 5JJKA 1DKNA 2RI6A 1P75A 4L0CA 4RF2A 4W7SA 3ZYCA 2ST1A 3QTTA 4DNFA 3ZEAA 2QTZA 2DQSA 1JNYA 1PV1A 2A9OA 4RA6A 1MC8A 1VQ1A 2UVPB 1SUEA 2P62A 3GLVA 3PB3A 4IYRA 4A6DA 1FRZA 3F3YA 2GD1O 4BX0A 3G0CA 2XT9A 1IIRA 3PNOA 4HHEA 4MB6A 4RVDA 4YJDA 5IDWA 3LI2A 4MPJA 1VIDA 2ODQA 3LYAA 4EG4A 1RZRA 2E4YA 3KQLA 1V8DA 3WG9A 5K8VA 1GTZA 1MJNA 4I9HA 4QLBA 4C0HA 3KQUA 4DPMA 4JBIA 4N0EA 4RTQA 1QC5A 2WI8A 3EF0A 4MO2A 1NT2A 2FPXA 1JBEA 3B89A 1XPJA 1IY9A 4PNZA 1JVNA 3EWNA 1NYLA 4UUAA 5DNYB 2OECA 3OCVA 1M9NA 4EA8A 4JLSA 2YFYA 1PCXA 2AZ4A 1BXRB 2NU7B 1WABA 4AJ2A 1BDIA 2MSKA 1Y81A 1U5BB 2JFWA 2IXDA 5EIHA 1P6QA 3M33A 4GZ3A 3WI7A 4BU1A 1MDBA 2YQ5A 2A35A 3ESXA 4UUQA 4IKEA 4X85A 2OFXA 5E3IA 1KAQA 1NZFA 1QVRA 1SHJA 4QO8A 1GG5A 3TR0A 1UZMA 3K8QA 1G8KA 2W4QA 3CZPA 1DJMA 2DWCA 1XAGA 5C46F 4XPZA 1LI4A 5DTEA 3GGCA 1CR0A 2OCPA 3ROXA 1RQ2A 4X61A 3JVDA 1B43A 4S1WA 4C0XA 4IZIA 1DO2A 2AFIE 1GCIA 3DWFA 1E3JA 3ETDA 2JLZA 5COQA 2XYHA 4Q47A 3WKDA 3I58A 4PPFA 1OVGA 5FO1A 5I8WA 1HEIA 1KETA 1F4PA 3QENA 4BO2A 3F8TA 2V97A 3LLCA 4C78A 4I5EA 5CFMA 3BCSA 3L7BA 1SVKA 2IE0A 4DQDA 3BRWD 3M9WA 4KQWA 1E3LA 4Q9HA 3V7UA 2Z2XA 1CZRA 1JBQA 4D9NA 4QFMA 4JSRA 4MV6A 1L4GA 1NJ5A 2XUJA 1H9CA 3I0MA 3ZPXA 4E2YA 4QA9A 1K75A 2CFSA 1R5OA 3TTWA 4O63O 5JCOC 1HE1C 5KJ1A 3U56A 1P1IA 5C18A 2ZI4A 1GG9A 1VCIA 2PWAA 2GZAA 1N6IA 1PX2A 4JKOA 3IHWA 4D4HA 1I7QB 2RGBA 4BMOB 3K3PA 2QMYA 4BO9A 2ZITA 1MNAA 1K2WA 4QQ8A 2C04A 1JFLA 3HYRA 3ESZA 3GJZA 1CS0B 2OV8A 3QV2A 3R5HA 5F76A 5IKOA 3WMXA 4F2HA 5HUJA 3ST7A 1RXVA 2GJKA 5DXJA 1GPH1 3UEOA 4LXTA 1R27A 1H4QA 3I5MA 1QK4A 1LBSA 1W0KA 4D8YA 4UDYX 4CXMA 4BMYA 2GPWA 4FHCA 3DMTC 1K6XA 4WCFB 3RRJA 2RBKA 2NN3C 1GSHA 2NUPB 2X5JO 2FN7A 3IBSA 4DLBA 3PQ6A 4UC0A 2YIMA 1CDEA 4R5MA 1NJFA 2XWQA 3KE9A 3AVUA 1Q11A 3BH6A 2FMIA 1PLKA 4JVOA 2QI9C 1SXJC 3PE6A 3R3WA 2CLOB 1OI7A 3H9JA 5E6UA 1F38A 4IY1A 4R7GA 1M1XB 4O0LA 1TZ2A 4ZI3A 3HKBA 2QNBA 1QHGA 3LCUA 2QLTA 3DL2A 3UHPA 1KYVA 1UDAA 4DIMA 4DPLA 1EVLA 3F2VA 2LVBA 4CCAA 4FUTA 3HXPA 4AB1A 4PLCA 1KH2A 4QREA 4A9AA 1CDOA 2P4EA 4FNGA 4GT1A 5D3KA 1CQIA 4CF5A 4CU5A 5BN3B 2R47A 4AQ7A 2I4LA 5EG5A 3ZDCA 2DPLA 1GG8A 4G9BA 4UVEA 2ZSKA 3W1VA 1OI3A 2WTMA 3OEHD 4JBYA 2ODEA 1FSPA 3NBMA 3G82C 4PGAA 4XCXA 5CLIA 4TPKA 1JKJA 1DBIA 1VE1A 1ZLYA 2AX3A 4GI7A 3DXZA 1YR1A 4OX9B 1GRVA 1ZM7A 1DIAA 5HFAA 2H5LA 4C3VA 4XDGA 4HYQA 2DUUA 4DLZA 2P2DA 3DKPA 5LB4A 2O57A 3R7AA 3ABZA 2OE2A 4OMCA 3CWCA 2ZB8A 3MWKA 5FV7A 3D3WB 3TGLA 3ZWQA 1R0XA 1B6TA 1Z18A 4IJ5A 1EVQA 1ZDMA 3UB2A 1R6XA 1H2EA 5AW7A 1YZFA 2A9KA 2VA8A 3BHJA 2I4OA 3DSRA 5EJEA 1AQUA 2D0OB 3KUDA 3MWLA 4FGKA 4EPVA 3S4YA 4G0ZA 1N7IA 3NWEA 3OTGA 3ZGOA 1B6GA 1QVVA 1DV2A 1F2UA 4GMHA 4BQEA 3BE5A 1RAEA 1UQUA 1ODKA 2CWDA 5CLFA 1M8JA 1U4SA 2PY6A 4YCJA 4EQZA 1ID1A 2HCTA 2ZATA 4BLSA 1VGVA 1UOEA 1NUSA 3B12A 4OI4A 4DA4A 3Q41A 4QX6A 3CVWA 3CURA 1OYWA 1ADCA 1RAIA 2RHDA 1WHTA 3D7LA 2OPHA 3VU3A 2ZSBA 3ZVLA 5L8VA 2JRCA 5AKJA 2R86A 3ILSA 3OPVA 2B4AA 3JYPA 4QU9A 1N36B 3QMPA 2RCYA 2WWYA 3FY4A 2ZB2A 4TRJA 1QBGA 2RH4A 3NIDB 4MS4B 3IDZA 4CVNA 4O0MA 2JFOA 1SUWA 1I9CA 5F9FA 1QHSA 3F5DA 1Z0JA 2PX0A 2ZRFA 3QNWA 2OM6A 4FWTA 2IV7A 3W5JA 3S1LA 2X42A 4IIFA 3I1JA 3KE8A 2UU9B 1V16B 2DPGA 1EFVA 2VPIA 3K9HA 3MVEA 5B58T 1DBWA 3NHBA 3PU6A 3R9XA 2C4MA 3RVLA 1Z83A 4OHBA 4BO8A 3NTUA 1FVXA 2BRUC 3MC1A 5ITZB 1SEVA 5GONF 3G2IA 3Q2KA 1WXEA 1GQFA 4TT3A 1U1GA 2N47A 2YJ4A 4IQ8A 3WLEA 5JS8A 4B3MB 3L1IA 1EXMA 2PUFA 1RLTA 4K9NA 3BK7A 3FUUA 1LSUA 3WRWA 4E5SA 2WTUA 2GO7A 2O2SA 2XTJA 3P0FA 4K0RA 4NAVA 2FMKA 3QFFA 4R2IA 3RAJA 5ALDA 4ER6A 3TLJA 1YJBA 1SK8A 3T3MB 2PWYA 2PX8A 2QR2A 3LU1A 2A33A 2MWMA 3CW8X 1Q92A 1AZLA 3N0WA 3OLQA 2QYTA 3P0EA 2J6BA 1BWRA 1MOZA 1Y63A 1V3VA 3Q3CA 4H08A 4YRIA 1Z29A 4EDFA 1HL7A 1ES9A 1FX0A 4Y2JA 1F12A 2GFHA 2ODPA 3WDLA 4BZWA 3UMCA 1L8AA 1QLHA 4CM8B 1T8TA 2J3IA 4DIEA 1RRKA 2CNOA 1PFKA 1MQAA 1Z3CA 5CDSA 5HZKA 1IQUA 3VZDA 5JPDA 1ZM2A 1X7YB 4PC6A 4DRZA 3ZUPA 4AF7A 2QF7A 1MB3A 4Z7QB 1WKVA 3PVSA 4FYPA 1LLQA 1EXVA 4MLDA 1E1QD 2LTAA 4BFXA 4BMNA 4FU0A 2AJLI 1M8FA 3V34A 1UBOS 4HNVA 1W4AA 4A8JC 4RULA 3LA8A 4JDPA 2O2XA 4R1PA 1QHXA 1POWA 1R37A 3CWZA 1GITA 4IBOA 3WGJA 1MN6A 1YI1A 3Q7PA 3X1YA 1PYDA 2IXGA 4B80A 1BE6A 4Q3OA 2I8LA 5A2GA 1UEXC 1A71A 1GU1A 1T9HA 2ZYTX 4G1VA 5DBHX 1DBRA 1UMBB 5B12A 1UBCA 4X3CA 1TVCA 2W11A 1QRSA 4WQMA 1E7WA 5DKFA 2JI6A 1DAEA 4P22A 5A0FA 3C1TA 2WT4A 3FPHA 2Z8YM 4O8ZA 2AUMA 1W5AA 2IYWA 1HK7A 4S1NA 3LO8A 1YOVA 3Q98A 4HDSA 5I4KA 1X14A 4KLZA 3SXPA 4Q93A 1RPZA 4P4GA 1QANA 2OHHA 2P8JA 3VGJA 3ZE2B 4KVFA 2B5WA 3Q4GA 5F1YA 4EVQA 4J07A 2Z09A 1M1YA 4Q6BA 2RKBA 1XLWA 4C2AA 2Z98A 3GFRA 4ZOLA 1T1JA 3QU7A 5C8DA 1WF3A 3K0AB 4GNRA 5HK9A 5JNSA 5KYKA 2JBWA 1UJ2A 2EJWA 3ACBA 4IKOA 3VPHA 3WJ1A 2HEIA 5EL0A 2C7BA 3TQIA 5A0VA 3VTAA 1J7JA 1NUUA 5ARBA 2XQGA 1A9XA 4B6OA 3L4JA 1PIWA 1U2ZA 4MIKA 2G77B 4MYDA 2X7JA 1W2GA 2BN4A 3FCOA 4CM7A 2PRSA 3KXIA 2H1OA 2PL1A 1EFPA 1SMKA 4UBKA 2IYOA 3ZS9A 1GHTA 3VMFA 3Q3HA 3AQ4A 4X1KB 4DCUA 1Y6RA 2BFFB 2O3TA 3PR3A 1W5SA 4BNDB 4JJ4A 5CIQA 2DSTA 2OAP1 1D1SA 5FWYB 5KCMA 3X3HA 3LCJA 4W5NA 1M2VB 1YQUA 4LYFA 2BCGY 4L0DA 2YHUA 2BUAA 2UUBB 2B99A 1EFRA 3PXXA 5EA2A 2DWQA 2ZTMA 3AJRA 4FYHA 3VRHA 4X1YA 3TF5A 1V8OA 1P3DA 2PVPA 5IABA 2YV2A 1DEHA 2G6BA 4R3NA 4DUYB 3KKKA 4RORA 2WY2D 3RYHA 1R74A 3OUZA 1N1EA 1THTA 2ZYHA 1FUYB 1K6MA 1GRRA 4NEGA 4L27A 4NH0A 2IXBA 3KZKA 4RK5A 3ZVRA 4YYZA 2JANA 3LPAA 2BEWB 4I5DA 5AK0A 1JS1X 3E9QA 3EPRA 3RHFA 1EIWA 3OKAA 5F73A 3O83A 3R5TA 4H0CA 4LN1A 1D09A 2FSVC 2BEKA 2GD6A 4B3RB 1Q0LA 3UCEA 2QT0A 3B8HA 4UEQA 2UYOA 1N2IA 2IBSA 2IEAA 3L8FA 3HB5X 2EWMA 1ID8A 3QHPA 4HFMA 3T95A 3T06B 3FNEA 2XR1A 2H31A 3R5SA 2AS0A 3P2OA 5DBEX 4JHXA 1CDDA 3EEBA 1V11B 1YS1X 2O7NA 1BEZA 1BQ4A 4FJ2A 2TSYB 3WWZA 1ZJ6A 3D5EA 3OY2A 4NFYA 3PP8A 4PLTA 3NKFA 3HM2A 3HYCA 1VYTA 4NBKA 4KV9A 4IUYA 1T5HX 4BNFA 2CEAA 3P2EA 3TL6A 4PRLA 3X1WA 4RGBA 3OZXA 4B85A 1FFAA 3BL6A 3OT4A 1OFGA 5GM1A 3NM5A 1BOFA 3JYHA 1XN1A 4L5AA 1ZCBA 1JAYA 2HRDA 3QBEA 2VWQA 1R4MA 3WJ7A 4IDAA 5C7IO 4L5JA 3AIOA 3H65A 3NHLA 5AJVB 4FNMA 3TOSA 4AO7A 5JSUA 5KOHA 4NJOA 4ZO4A 2F1JA 5DN6D 3JQ9A 1JR4A 1IWOA 2HZ7A 2OILA 621PA 1KRHA 2OGSA 1Y5NA 2GCNA 1W48A 4ZT2A 2QTVA 5HKBA 4QJBA 3LC2O 4GECA 4D8WA 5KU7A 2IF0A 4M0DA 2I8CA 4KXQA 1KFCB 2VJKA 4XDZA 3URMA 1NRXA 2OG2A 1TU4A 2JH9A 3ECCA 4AU1A 1OYYA 1EFKA 3A4LA 4IRUB 4B4OA 1PKEA 2UUPA 4TRMA 1E9EA 3QOFA 2DB3A 4G5XA 1XZHA 2WYIA 3EFOA 4IV5A 4B7CA 4M1ZA 1NBIA 4B3DA 4Q4JA 1VLVA 3EY4A 2FGKA 5NLLA 4E1VA 4F86A 1D1QA 1XDUA 4HGPA 4ZQCB 3K0SA 3RADC 3CRNA 3OPYB 1CUHA 2HK9A 3DAHA 1AC5A 1Z0IA 4L73A 2R6CA 2G40A 5EKSA 3D6TB 2MSWA 1CUEA 1NC3A 2B35A 2BLNA 2DWPA 2WILA 3OIVA 5DT9A 3HG7A 5DHRA 4OP2A 4DTIA 1OLXB 1ND6A 3S8EA 1VA4A 3IE1A 2JIOA 2JCSA 4YDHB 4EECA 4OXRA 3PCXA 4QFCA 1DSSG 4B1FA 3FKSA 2GBFA 3I83A 4YLYA 3EFHA 4HGZA 1W85B 3D6NB 3AV3A 3RG8A 4WJKB 4NCNA 4DSOA 1JIXA 2VQ3A 2BUCA 3U49A 1REQA 1ZH6A 3V7YA 1TCUA 4ENSA 5KYUB 3PJEA 1E3TA 4N7BA 1ZA2A 2FFQA 4L74A 4B45A 3D7NA 1NXWA 1USUA 5EESA 4RL6A 2IZ6A 2ZJ5A 2FFRA 2GEUA 3I6ZA 5L3QB 3NH6A 4IVPA 2WT8A 1A76A 1NJSA 5E1BA 3WB1A 3ROZA 2BZ1A 2OZKA 3KJNA 1APBA 2YFQA 3KVRA 1FFXB 2WKSA 3IV6A 5BYBA 1NVAA 5F35A 4AJ4A 2CFIA 2VJAA 2ZYSA 1BD4A 3W77A 4LV8B 5IG2A 3ZH9B 1XT6A 3T54A 2QL9A 4L9RA 5EHNA 5K3SA 3N86A 4R2WA 1RYFA 1XZEA 5EE9A 4A0RA 4OQNA 2EIHA 3A1SA 3IP1A 4OQPA 1ADYA 2FUG6 1CNEA 5J23A 4QVKA 4TXMA 3V8MA 3OLCX 1L8OA 1T13A 1YZVA 4KPUB 1Z6TA 4OAOA 2VYVD 4UMVA 1WDMA 3OP1A 2QY6A 4RABA 4EY4A 1UBFA 4UTOA 3R6WA 3P4XA 1F7UA 1FDUA 1VXOA 1U7PA 3GDGA 5FXMA 2Q3HA 3C3AA 2WPDD 1QO7A 3MYYA 2ONZA 2OQ2A 5D86A 2PZBA 3SD7A 4DCOA 1Y1LA 3WXBA 4C88A 5CT4A 3VZCA 2C31A 3LCVB 3R5FA 5F3DA 3CUEF 5TVGA 2W6OA 1DOHA 2QQ5A 4RPIA 4N0PA 5ED4A 3HB9A 2E5LB 1TK2A 2JARA 2Q4OA 5IUKC 4E08A 2RH9B 1CBUA 4DV5B 4LC9A 1HZZC 1AUOA 1H0SA 1N2BA 1XU9A 2C5HA 4QGAA 3OOJA 4HADA 3ZCUA 4D1YA 1FRQA 1Z13A 4LY6A 4EI7A 4TMZA 5AVZA 4YCSA 5LUBA 3TR6A 4Z1MD 2X2FA 1S9DA 4MVJA 4JT8A 4XCQA 3Q15C 4I55B 1LPSA 5AP9A 1HEUA 4ANFA 1SHLA 5C1OA 1KQPA 3FWZA 4PINA 3U3DA 4UTVA 5LXTA 5LQAA 1SVSA 2GEDA 2R7NA 1CZNA 4XM0A 3VR2D 1ZISA 1V26A 3DZKA 3VZSA 1HDRA 4KHPB 3EIFA 1J2JA 1JLHA 1W35A 1SPBS 3MSCA 4JYBA 2BISA 4JJFA 4MB0A 3BFXA 1HMYA 4YMSA 5KNDH 2VOJA 4NI5A 4EG8A 4LI3X 1DIHA 1MJ5A 4DWWA 3RVNA 3OHPA 3RREA 3PD7A 4KEAA 3TSAA 1SXQA 2OK8A 4Z0PA 3D81A 1ZM4A 1YZ3A 1GTJ1 1R1DA 2VYFA 3JTMA 2EXXA 3LOUA 4HRXA 3VKFA 2IYXA 5JNWA 5E3JA 1KYWA 3UJNA 3TZCA 1XNQB 1MD9A 3Q8KA 3FBTA 1QOPB 1YE5A 3BGDA 2DEUA 1WG8A 3MW8A 4P3NA 3C6KA 3VYTB 1KVSA 4BC0A 4D9CA 3AINA 3QXXA 2IYVA 2ZJ2A 4QD3A 2C2KA 3L4SO 3ZE1B 121PA 4FI3C 3DWIA 5ADUS 4US2R 3CEJA 3LT0A 1SCKA 3OM9A 4QSMA 4HT3B 2NXJA 5DP1A 3TQHA 3U1VA 2VKTA 4QTZA 1ORTA 1ISJA 1HBJA 1TZCA 3F3SA 2PJDA 2OGUA 3TIIA 4DC9A 1YH3A 3T35A 4F4CA 1JH8A 3KKPA 4FOLA 4MR7B 2PD6A 4XJXA 1Y1QA 3N7TA 1OGJA 4JI8B 5AK4A 3U5TA 1V48A 4WOPA 2RG7A 2BSAA 2J5QA 3LP6A 2LGJA 2A86A 2XT6A 3LKBA 4KSBA 3X43A 1DARA 3HCFA 2FQQA 5FA6A 3CEAA 4D4JA 3DQPA 3HJNA 2ZRMA 2F1OA 1JEAA 1ZOLA 3FDJA 2PBZA 3M5PA 4W9NA 4Y6QA 3TB6A 821PA 1EEXB 1E4OA 2W48A 4IDOA 2CXSA 2BD0A 2Q2VA 3K2QA 1NDUA 2GNOA 5CH3A 4ED9A 2GTPA 4CEIB 1T5BA 2A5FA 2NXNA 3O0TA 3WNQA 1P1KA 3WIVA 3KHKA 2CE2X 1X87A 4LSMA 1ZBDA 4S2UA 5SZJA 1E2LA 4O4HA 4XE5A 4YMTA 1VB5A 3B1YA 2NPOA 3LVBA 5ER6A 2FOLA 1XNGA 3S1AA 5BQXA 4M99A 2C8JA 2QVLA 3EVTA 1AHHA 2P6OA 1B26A 2J9XB 3NGXA 3RVPA 2C98A 2TMDA 3V46A 5BURA 4R84A 4X7PA 4GM4A 3F3KA 4NENB 1PEKE 1M54A 4Q1CA 3UJ3X 5I01A 2PSSA 4WLNA 3TVTA 3R3VA 2G04A 2ZSUA 2C59A 2F64A 1XOIA 4G0UA 1G7CA 3NO4A 1E3SA 1A5TA 4A0FA 2PH7A 2VHXA 1SR8A 2PX3A 1IPFA 1J2UA 1E3WA 1RM3A 1TPZA 1YQTA 2MHCA 4MO9A 4R8SA 5DF1A 2FPWA 3AVOA 3CRVA 2YJNA 3R4VA 1M0EA 2AKEA 5AVTA 3BSSA 3DKIA 4C03A 3TQSA 3LY7A 3RVRA 4AJPA 1WF6A 2DH5A 2I99A 4FDMA 2Z6AA 3TZ6A 2UZ1A 3CVXA 2XDAA 1YBHA 3ZI0A 1PJSA 1N8KA 4DA8A 3QZUA 2WE7A 3WS7A 2VUIB 4HN9A 2XVYA 5LD2B 1ZC3A 4EATA 3TK1A 3VR6H 4LFAB 2BR4A 2A30A 3HKEA 2MYTA 1K8RA 1ZRSA 2F90A 4EHJA 2XZDA 2B94A 2ATXA 3LKDA 7ADHA 2ZT5A 3O5AA 4FGJA 2A67A 2HIGA 5AVRA 4TKLA 3O03A 4ZV9A 3GELA 2RGNC 3M6VA 4H6PA 1C1DA 5CUQA 2I9KA 1WJGA 2W5UA 4TYYA 3LA6A 4HGNA 5KINB 3GJ5A 2AFHB 2C88A 3N07A 2HJHA 3VYVA 5IANA 2FZKA 4CEJA 2VPYA 3ZHXA 3WRYA 2HBQA 1JHZA 4LWZA 2G9VA 1LUAA 2XECA 3PDWA 3IAS6 5DCWA 2J9RA 1V3QE 4DKJA 5JAOA 1LGYA 2INGX 2D54A 3M4YA 1RM4A 3GPCA 4MAMA 5E6SB 5F1KA 5LA6F 4LY9A 3LDFA 3NONA 4WKOA 3ZX4A 3A0UA 3GZJA 2IOYA 1SZPA 5GIPE 3GLSA 1XDGA 4PSDA 3ELUA 2RGAA 4HRVA 4PPGA 4DZTA 3L9XA 3RV4A 1SVIA 1VKJA 5JRZA 5A4JA 3ZHRA 2VJQA 3WV4A 2JBAB 2VF4X 1RW4A 4TMFA 4UCFA 1ZD4A 3I6IA 5REQA 1PEAA 1CNFA 2FW6A 1H2FA 1XMJA 4NESA 4ZT7A 3D1LA 1N0VC 4ZQFA 2XAUA 1H2HA 1I7SB 5AXDA 5HZMA 2IQIA 2OD2A 3IALA 4AS1A 2QJWA 2NZXA 3AOEA 2KW5A 2XCSB 3QBVA 3QTLA 1E1LA 1NR1A 4KTTE 2H2HA 4QT4A 4HNQA 3MMZA 3ZKAA 6NULA 1RLIA 1XZLA 1Z6YA 5JJBA 2WU1A 4I08A 1R00A 3RHTA 2OC9A 2XXJA 3OFND 3QVUA 3SS7X 4AM8A 4ER5A 2UYHA 4OLAA 2X8LA 2UZ0A 1GAXA 2JNWA 1QR6A 5BV8A 2W42A 4JGBA 1BJRE 1GZDA 5HIJA 3UICA 2QLBA 3I39X 3HRIA 4WOJA 2GZ1A 4CQLB 3PEWA 2CXPA 3E3MA 1ZPDA 3IBTA 2PUJA 3G17A 2HGZA 4WFKA 2RGGA 1TM1E 4JJIA 4NJMA 4DLWA 3PICA 1IC6A 1E3IA 1LFDB 1MQ8B 2AJDA 3MZ0A 2MMCA 4IDGA 5JASA 3EMBA 3GX1A 3LNTA 5E3HA 4TX1A 1Z4OA 1E9CA 2OB1A 3A9RA 1WCIA 4E11A 5LP6C 2RHHA 4K6FA 5KVAA 2EIXA 2QRVA 3GPBA 3PS9A 5EMNA 2CF5A 5KOIA 4D9FA 5EERA 3R3YA 2QW8A 1P17A 2X2EA 1MT3A 1O08A 4E09A 1OF1A 3D7KA 4CF7A 3OOEA 3VU8A 3REGA 3P0HA 2AW5A 2FF7A 3U3JA 4DVJA 221PA 3E7FA 3LDUA 4MA5A 3X1KA 3LBIA 5IHXA 1W25A 2ZG6A 3R3ZA 4LHSA 3AM4A 1DPFA 3SAJA 3INYA 5H8WA 3HEMA 3IMEA 4IUBS 2VQSA 3L40A 4QDTA 5EIAA 3QF4B 2DQYA 3U4CA 1A4XA 1GZHB 1AY0A 2JB9A 2WFZA 4LVUA 5FPYA 3JZFA 4MSUA 4IJMA 4LWPA 2O59A 1ZXXA 2X3YA 1Q0HA 1IHOA 5FYDA 3LQ1A 3N1UA 2BBTA 2O0HA 2WQZA 4TM8A 2B25A 2AEMA 2X5XA 4FEGA 4LXYA 1YAHA 5IJXA 5JW6A 5JRDS 4DMUB 3QWFA 3A58B 3L41A 5AVVA 3QV1A 1RAAA 2BJVA 2FQXA 1M83A 3GZ4A 4E13A 3B52X 2N46A 2QROA 3H2IA 4FPXA 3C3YA 3CB4A 4MB2A 4CGYA 1OPXA 2QVGA 3DTVD 3L0OA 4P93A 1YOBA 3KP1A 4OX9Y 4K0KB 4MLZA 3T3GA 4CW7A 3QF7A 2GN9A 1W6UA 3Q0TA 1DLJA 3W05A 3V00A 1NPTO 2QNRA 3UJCA 4AMGA 3B7WA 4PLFA 2DKOA 5LBTA 3FDIA 1OQAA 4G01B 2OVBA 1DNPA 1E99A 2NXEA 4WIAA 1N5KA 5CNJA 4CM5A 5KOYA 2R3SA 3HFGA 4PLGA 1GYQA 2GZMA 2YZ2A 5AHWA 1F6WA 2PIDA 3AY6A 3BXHA 3DAOA 3KSUA 4Q1AA 5DZSA 4DSNA 2FPIA 4CL2A 2PRKA 4WT7A 3RVKA 4BBJA 5KQMA 4XJTA 2NSYA 3G5LA 5MN5A 2VAMA 3N7AA 1KAMA 3VPGA 4JUIA 2RAPA 5BNTA 2RK3A 1OJ7A 4A1FA 2VAWA 3F6YA 3MOGA 4L0QA 1YS9A 4WOKA 5HGXA 2WF7A 1I1OA 4PYLA 3B1ZA 1ULUA 2XCTB 3BGVA 1WEHA 5JZSA 1NW3A 3TZBA 1GT91 1SCUA 3I04M 2DM6A 2FFJA 3CT6A 3CLTC 4MRSA 1PR6A 3U4QB 1CUBA 1G3IA 3S1SA 1R66A 1DRVA 1EFDN 4O1HA 4BB5A 2FPGB 3V4OA 4DIOA 2VCHA 2FRVA 3B20A 3UJPA 5B2FA 5IX8A 2IHVA 5EPEA 2UXCB 3R20A 3MERA 3VXKA 4BGIA 2V0NA 2IIVA 1OBOA 2O50A 1UXJA 3LCRA 2B1GA 2QN7A 3LWDA 4RELA 2UXBB 1E9FA 4BEJA 3V2GA 1A9SA 3BXOA 4PO9A 4QUDA 1AH2A 2ZSIA 1EK5A 3QYAA 2Y0CA 4KUHA 3DVQX 2ZZMA 4NBSA 1P33A 1I4WA 2EKZA 4B4VA 3HCWA 1R5JA 3DQZA 3OZ7A 2REQB 4HWOA 5CDFE 1QCCA 3GOHA 4YPOA 1IN5A 3D4PA 2EJTA 5BNFA 5KSPA 1AKMA 1IZ7A 4KMMA 4HEQA 3C6QA 4M38A 2YRWA 5J2TF 3RRBA 2G09A 1GL9B 4K3UA 3LUBA 1KEWA 3FNGA 4GLBA 5EZYA 1Y3HA 1Z9BA 3OY7A 4RJIA 3SBEA 2WHXA 3E7XA 4GU5A 5LIPA 2O2GA 2Q49A 2QTBA 2IHYA 3GAMA 3UCFA 4W9RA 4OKNA 1HFKA 4Z4HA 3R2JA 4UE2A 3VU0A 2YMMA 3F7TA 1QE3A 3CE6A 3NBKA 3VHXB 4AZWA 1CUVA 4FQ7A 4QYSA 2YHBA 3L05A 1VKHA 1HDYA 2PQMA 4C6SA 2I1QA 3EUEA 1T6XA 3ZDDA 5KSZA 5CK5A 4FYKA 4RVUA 3IKVA 3CJQA 1DKOA 2JI9A 2X1MA 4RJLA 4BJ3A 5KJ6A 1PNRA 2XNDD 4KXWA 5GONA 3CMCO 4I1RA 2Q5FA 3PTLA 3T61A 4CM6A 2PS3A 1MABB 2LP4Y 4Q7EA 3B85A 3E5HA 1PQPA 2JCBA 3AVXA 1ZHFA 1U3TA 5EMHA 3KAKA 4R1TA 1AO3A 1SCJA 3OOYA 4GPTA 3M6LA 3V8BA 2WKWA 2GEFA 2GCOB 4QTYA 1N0WA 3C98A 4YP0A 2LV8A 5HF5A 5DM2A 4NIMA 1W4RA 3WBJA 1OTXA 1Z0AA 4YJFB 4ML3A 3H4IA 2ZR0A 3U7JA 3DE5X 1U7UA 1FU8A 1G42A 4MVXA 1OXUA 2HCRA 3T0GA 1KY3A 3RARA 2D1RA 3D2BA 2DETA 3QLTA 1NQTA 1ZM9A 1RE0A 1BJKA 3G9ZA 1UZUA 3KPJA 1NXSA 4F4FA 1YTUA 5DPMA 2I2WA 4UCWA 5T4BA 5GTDA 2VZ8A 1Q0SA 4W8OA 1NVDA 3OTIA 2O8DA 4HUJA 5BSHA 4OVKA 1XKQA 3I9FA 1GM5A 4M46A 2AIRA 2VJMB 4FSHA 4RDXA 3K9QO 4XW2A 1RS0A 5IFLA 4UHEA 3F9IA 1QQ6A 2FZGA 1VPEA 1FFWA 2J4CA 1FTYA 2QLLA 3KT6A 4U2GA 3CX6A 5AO9A 3MRTA 5K05A 4MKIA 2PS0A 3HP4A 4KVAA 1J0CA 1Z0DA 1PSZA 1U3FA 4WNCA 3ZZ0A 1HQYE 2XGOA 1GEGA 4HEA1 3EEOA 1N2EA 1QCDA 1CUZA 3AERB 3NDPA 1G5QA 1P9RA 1AZSC 3PUYA 5HJ5A 2JZOA 1M3SA 3C6MA 3CGWA 3RAGA 3WHKA 4G97A 2NW6A 1MRNA 1JIIA 2C2WA 1SC3A 1YDWA 4X20A 3EGXB 3ZWYA 1ORWA 3V1YA 4AMYA 1INLA 1QH8A 2IPMA 3IEUA 3KJIA 4DBZA 2G25A 2R85A 3PEFA 4U7TB 3UJHA 5JSHA 1XHEA 3T4PA 1E0KA 1QP8A 1UBKS 2Q4RA 1HURA 1QZ3A 2BV3A 3BB3A 4INZA 2NVUB 3U39A 4DYDA 3QI2A 4NG4A 3GLGE 1E2GA 4MTLA 5DI3B 5DTJA 4N7JA 4O8CA 5JCJA 4R0NA 3OQ1A 1NFQA 3EAGA 5EXEA 3F6SA 2L0XA 2HWUA 3FVRA 1QV7A 2YNMC 1EVKA 3EJ6A 4ZDJA 3RSCA 2RJ3A 4N1AA 4DGSA 4EPYA 3ADPA 4UTPA 5DW3A 2A7QA 2RK6A 2XWPA 2A8YA 3EUFA 3WMWA 3PFIA 3Q3VA 9MHTA 4OI2A 1ATZA 3R6LA 4KPFC 3U7QA 5KREA 2CLDX 4FE3A 1JTEA 4Z0NA 4LHWA 4KO3S 5ELLA 3FCYA 2KM1A 2WIKA 1X7ZB 4QYXA 1IL0A 4XYMA 5E4TA 2BAGA 4JYMA 3WHPA 2H2IA 3MSXA 1G20B 3LY5A 4AFNA 4BKRA 3RKSA 4EG0A 4PGGA 2WVJA 2I62A 1YJ5A 1MXHA 3BREA 5DYWA 4QO7A 2Z43A 4WVLA 2WHYA 2FMUA 4UHCA 4WZAB 4N5DA 1ICEA 5EJ4A 4PX5A 1FOEB 4OYRA 3RUHA 2QGZA 1Z0UA 4RK4A 1HT3A 2HQRA 1RWOA 3OLVA 3AUKA 3EWSA 3ESAA 3KZXA 2PT5A 3LUAA 4CIVA 5AW8A 2ZXUA 2HRRA 3BWMA 4JJ8A 2EX1A 3PWSA 5I7EA 5KNCA 2ZRHA 2IUFA 2W58A 1Z08A 2V5VA 2P2CA 4JN6B 1OWOA 2Y2VA 4FHEA 3UN1A 3C8ZA 1JRLA 4GNKA 3BMQA 3I5AA 4JR2A 2EDAA 4F46A 5JATA 3FWKA 1W5EA 1QGUB 3AUYA 3PUWA 1XZKA 3ND8A 4YALA 4YRRA 1FVOA 3HLYA 2P35A 1N6RA 4UARA 3W7AA 2F9LA 5I3ZA 1CRZA 1G2IA 4FCVA 3ADBA 3U44A 2BMVA 2JGFA 2JIZA 1FTSA 1SOWA 1W47A 2PMWB 2W2LD 1DOAA 3HE3A 2G80A 3MB8A 2Z9BA 3B38A 1IUNA 2RK4A 2X41A 1BN7A 2ZUUA 4ITVA 2YXBA 1SWWA 1XC7A 2RIRA 4S35A 2IU0A 4BAGA 4BO5A 2HNAA 3BJIC 3N05A 2I54A 1ZUIA 3VPAA 1H6AA 2E55A 1AKEA 5FOXA 5GVSA 1WOYA 4DB2A 1XQ1A 5BNWA 1QHIA 1QB7A 2J7PA 2R1VA 2VWHA 2Z4SA 3DL0A 4HATA 3N70A 4DJFC 1U1EA 2QXYA 1N6OA 1I13A 3DVAB 3UMJA 4J3NA 2VEOA 1E7QA 4XJSA 2D3WA 3IQGX 4MKRA 4EYEA 3EXFA 1VC2A 3C4JA 2W2OA 4BCBA 1FFEA 2RMKA 3E3LA 1DRKA 2WYUA 1X3SA 3CS3A 2AJ8A 1Y8RA 4RKWA 4DNXA 4DLUA 4G5GA 2D2XA 4TTRA 4YXWD 2PS9A 3RVSA 1MIOB 4JELA 4P4SB 2PG3A 1XYYA 2FWRA 3IVMA 3ADKA 4K9LA 1CY0A 4RAOA 1M7BA 3ICVA 1JR3E 5T41A 5I7HA 5JZMA 2AMFA 2HU5A 5M7EA 3A10A 1Y9AA 2QAGC 4F4UA 3AJEA 4DDHA 1DTSA 2H57A 4URYR 1E5LA 4K9PA 5L40A 2P79A 4RKYA 3GLUA 1U63A 4CTMA 1ZKMA 1XLVA 2PV7A 5CPFA 1SKQA 4B3IA 1UJ5A 4BP8A 1V6SA 3EDQA 4PYQA 2GDJA 5BXQC 5TGTA 3I2KA 4OBEA 2FETA 3ELYA 1WMEA 5J47A 3HUFA 4L85A 4WK4B 3KKOA 4NXNB 3H5LA 4FOTA 1TM4E 2VT6A 2F4VB 3KG2A 5EHGA 5KYXB 3WY9A 3ZNOA 4ER0A 1H2ZA 3B3JA 5F9HA 2JJ1D 2IYNA 3IAAA 3AUTA 3DMPA 3PDIA 4P33A 2HCFA 1A82A 1DC8A 3F6RA 5SZKB 1D1TA 2I6TA 2J32A 4I0WB 1OU4A 1RKQA 1TPYA 2H9YA 3AX6A 4M1EA 1DXHA 5AHOA 4CMBA 3TNFA 1B8OA 2AFHE 2OV2A 3C8MA 4HH1A 5EPOA 1US8A 3E9EA 2XMGA 1RMQA 4N4AA 2Y9MB 2HMUA 3GFSA 4EHKA 4M1KA 5CT5A 4HX2A 4PZ0A 1CUCA 1HT1E 1KZ6A 2CMGA 4I5GA 4ZU3A 5GIOE 2PGNA 4ZQIA 3T1NA 3O1HB 5BMVF 1T5SA 4PFSA 4WW0A 2C5AA 3N39C 1CFJA 3L1KA 3JX9A 3LZDA 3I62A 3TQCA 1ZZEA 3ZV5A 3MUFA 4YQEA 4EA6A 1TJPB 4FC7A 3HXMA 4DA9A 3LW8A 4ZGBA 1LK0A 3F2IA 3A14A 3S3TA 1L9XA 3PZRA 2WHEA 1GPJA 4KN8A 4ZEOA 1CUXA 3W3AD 1I0IA 4OU5A 4FT4A 4W5QA 4QU5A 4WNIA 1BU8A 1YL5A 2JH8A 4O4LF 4F11A 2W83A 1BXKA 3A2NA 5EIOA 4UOZA 4OGLA 5ABPA 1P45A 3K1ZA 4NCKA 2ASVA 1XVLA 4ENWA 2R7AA 3SXUA 1N77A 1ZAKA 3ET5A 4Q9IA 5D7BA 3HVHA 4M8LA 1JHPA 1ZQ1A 5FTJA 1J8QA 3V4PB 2B0CA 2YYAA 4BWFB 1YFJA 2WNSA 1NP7A 1Q6YA 3FOAA 1I2AA 1RXEA 1RXUA 3ZU3A 1DO0A 3AV0B 4UM8B 1G21A 2PSHA 3RAFC 3B6IA 1B0AA 1XA0A 1J0BA 2OO7A 3IELA 1XCLA 5E4FA 5B3JA 1VRVA 1QIGA 1KEZA 2RGXA 2Z8XA 5F33A 3FZNA 3VOTA 4KSCA 3T1YB 3RIHA 3LE8A 1CJCA 5D3MA 4K6MA 4B35A 1IM2A 2ORIA 1PGOA 1VPLA 3P9QA 1CV2A 1G5RA 4XVHA 4BGVA 3VUFA 3KB6A 5IPFA 2ZTUA 1U0EA 1L5SA 2GK3A 1AGYA 3DOOA 3DV9A 5ENDA 2B78A 2JJYA 1YI8A 1A9OA 4UPVA 2B4RO 1QV6A 1C0EA 1QFMA 1FP6A 4IDDA 1S2LA 3SQWA 4X24A 1GGFA 4OBWA 1EM8B 1QGAA 3K1AB 4C0SA 4F72A 1RZRD 2FRDA 1TQ8A 4OK6A 3DMRA 2H0AA 4RTSA 5G0VA 3VNUA 5AYVA 3QFHA 1BIFA 3IVXA 3Q7EA 1WRBA 3CB2A 1V1MB 3F6EX 3ND5A 4U9HS 3GQBB 2P77A 3IP3A 4NYIR 2AQHA 4YASA 3UMFA 3PXBA 1ZUNA 3ITEA 4P7KA 3PGJA 2VQ6A 5ECYA 5CYFA 1A96A 1EKXA 1XQXA 3PHCA 1ZGBA 4RD0A 3RG2A 3QVJA 4GAEA 4CHTA 1L5HA 2NZVG 2Q99A 1DIRA 2B69A 3PV0A 3C24A 3TW8A 3FVTA 3SFTA 5HRCA 4COKA 4H16A 1NP3A 2NYRA 5CCEA 4TTIA 3HTXA 4Y9SA 1O87A 1UXGA 1H65A 3D8HA 2A9QA 4KN5A 1G7TA 3LPMA 4NDNE 4KDCA 3LBAA 2BC9A 5T64A 4W8HA 3MTGA 2F3SA 1RTKA 2X0RA 5DSTA 1L3CA 4KN9S 3PTAA 3DE1X 4NS1A 2AUNA 2FYTA 4OFWA 5JCPA 1JMVA 2AOTA 1Q0UA 5CDUA 3HJFA 3DTYA 2CL6X 3HCBA 4RNCA 3ROMA 3GRVA 5EHZA 1Y7HA 3GB9A 1X8XA 2AC7A 4CMIB 1PSDA 3FMOB 5A6VA 4IHJB 3PJGA 5BWBA 4H7IA 3GJYA 4Q82A 5IFKA 1E60A 2CV0A 2NO5A 3HA5A 5JDCA 3P0RA 1FYDA 2IS6A 5G4LA 2XGSA 2LDBA 4QBIA 4YR9A 1A9QA 2D74A 4ZYLA 4UVIA 5A05A 3HHEA 1T0IA 2P3OA 1MB9A 2H2WA 4ZT6A 5A62A 4DR7B 1WAMA 5TC4A 4FN4A 4I2NA 4A6XA 1YDGA 5ARCA 2GZRA 2G0AA 2VDLB 4QPZA 1T0BA 1JIJA 2DCMA 3TBFA 3BFPA 5FJIA 2C2XA 4J9VA 5GGXA 3WKAA 2P5SA 5FBRB 3ZLUA 1Z6PA 2PVSA 3GRRA 1W0KD 3PQ2A 2IGTA 2LIVA 1I1HA 5BWNA 2DLNA 3BRQA 3CUKA 5HKAA 3E22A 2RD2A 3OT1A 5FQNA 2O8VA 2PBRA 3V5NA 4KHZA 3NRBA 5GWXA 2CUTA 4BNGA 2H2GA 3EA0A 4P7FA 4Q15A 3V9AA 4LNHA 4EGAA 3SEAA 1XQ9A 4D9HA 4LYGA 4TTVA 2SHKA 3MXTA 1AUXA 5EWLA 3WTCA 5J58A 3SHVA 4WZBA 5HZGA 4KK3A 2FZLA 2BJWA 5IVDA 4NBLA 1RC1A 2N0SA 4W6ZA 1XKLA 2D5CA 4DUGD 4CJXA 3TAHA 5G0SA 2CXXA 4HB4A 1V8ZA 1QAQA 2XXAB 2EF0A 3EOBI 1U9YA 2FW0A 4BV2A 5U9CA 1DJOA 5HJEA 1GYPA 1HYGA 3SZ3A 4EJSC 3FLAA 3R0QA 3D8TA 4X6LA 2Q1YA 3MRXA 4MROA 1MC5A 4EQ6A 4NPAA 4C76A 2QENA 1ADBA 2PFKA 4L7QA 4MVJI 2GKOA 3AGQA 3F67A 4KG7A 2OB2A 3OEYA 1YQWA 4TLDA 4US0R 4G63A 4O3MA 4MUEA 1VZ2A 2QI9F 1WPGA 5C35A 1LPMA 1M73E 4DAOA 4FD3A 1BXZA 3DAGA 3GLFE 1DAOA 3KO8A 4MW5A 3A4NA 1XV5A 2XUKA 3FNQA 2H2DA 4MQBA 3FPSA 3Q8MA 1I7NA 3TE6A 3E9YA 3B70A 1IG3A 3ZZTA 4EGFA 3K8ZA 3VZBA 1XNRB 4LBZA 4RSHA 5HF6A 4XVQA 3PFCA 5D2CA 4B3BA 1BMQA 1J09A 4YRLA 2LW7A 2J3DA 2WM2A 3EQ6A 1FMTA 1Q1GA 1UQRA 2XIQA 4HLNA 4V0RA 4AX4A 5AW2A 5SV2A 3SCZA 2G88A 2O8FB 3E82A 2ZJZA 4JEMA 3RUDA 4WNAB 1C9EA 3GLHE 1RADA 1AVTA 3KKLA 4WLUA 1F6BA 5KQRA 2EEPA 4K6KA 2XUIA 3V4SA 3RAEC 2BH9A 3KL4A 3A2KA 2P78A 1YCHA 2IYRA 5LYJB 4IIGA 3GJSA 1A2BA 1FDTA 2P67A 4H77A 2A5YB 2PPVA 5CDGA 2PMKA 4Y2RA 2GHTA 2P4UA 1GPBA 1N2GA 2ZR7A 2WPNA 1USGA 5AJZA 2XUHA 2BR3A 5EUMA 1U28C 1PR9A 2JGDB 1LBIA 2VDWB 3FSGA 3GBPA 3CU5A 4M76B 4DV2B 1RJDA 2OHJA 3NHKA 4FK8A 2P9HA 5KTNA 2NZUG 1BYIA 1OZHA 3OH8A 4C0JA 2WMYA 4DLSA 4M9CA 3RVOA 1ZVMA 3IC5A 2F3PA 4QPCA 3FSJX 4GRDA 1CUYA 1SM4A 3H2ZA 3T9CA 4J7CA 4N8EA 5A04A 4H7EA 2CWWA 2A5DA 4IVNA 3WBKA 3JWEA 4RJJA 1JQKA 1K68A 4IWXA 4ZVNA 4DQLA 1YB2A 4CMAA 4CKCA 4BVBA 4P2GA 4Z9FA 3RIEA 1IHXA 5K0ZA 4RVSA 3IAM6 3MFQA 2R0QC 3QVXA 1LY1A 5JXWA 3AFMA 1TJ5A 2JHCA 3Q87B 4YJHB 3MGBA 3ZV7A 5H16A 4UDOA 2ZUEA 3F49S 3WWPA 3ILYA 3TIXB 3FZYA 4KK4A 5CDHA 2VT7A 5EVJA 1ETHA 4UEWA 5LA6A 1JQJC 2R1UA 3T7RA 2JI8A 1FBNA 1A1VA 3ZE6A 3DMYA 5TSDA 4TQAA 5EQTA 1CF2O 4NCJA 3OPXA 2FH5B 5G40A 3U5ZB 3KJHA 4JVSB 4N0MA 1ORVA 1PD0A 1XKXA 5HIIA 2VRNA 1T3TA 1JI3A 2AC4A 3HEBA 4IF4A 4YO8A 2ZIGA 4ZQBA 5FPHA 5I47A 5KYWA 5CGQB 4UUNA 1BMTA 2ZFUA 3T41A 5J4YA 5AI9A 3H8VA 4D7AA 4H1WA 1ZESA 5T6BA 3R7BA 3OQIB 5G1OA 2Z58A 3GNQA 2FN9A 2H5EA 1ZUWA 4MULA 3PNPA 1HYEA 3UT5A 4PZCA 3IFSA 4QYTA 1M6YA 5KDLA 1QLWA 3U4MA 3FXAA 1YVUA 2AD1A 1E6KA 5HE8A 1YU6A 2Q1UA 4LVNA 1H69A 1OXTA 4X91A 5CIWA 5DYNA 5FA8A 5LQDA 5EQDA 4WFQA 1FUEA 2JFBA 1CE8A 3GLFA 1NYTA 1MH9A 2FN8A 2HLNA 4DR2B 1IOZA 4RVFA 2CLLB 1OU0A 3IDFA 1HLFA 1UK9A 3BE8A 4TUYB 5CW2A 4NOLA 5C7LO 5B55A 3E53A 3CN7A 4A27A 1Z22A 4R9SA 4DV7B 3ETLA 1SN7A 1G0NA 2HH9A 4LMBA 4DMFA 3IHTA 4BN5A 2W6QA 3JQ6A 1PGJA 3ID6C 1G20E 2OCBA 4KIFA 4MRPA 1E2HA 2FEXA 3LC1O 5EZYB 3G68A 1O89A 5FR1A 3UYLA 1U8TA 3GLHA 3H11B 4GO1A 4WL0A 5A06A 1WDTA 3MJFA 3AFOA 3TQRA 2CD9A 4KFTA 2D0PB 1YC5A 4YRCA 3BMCB 5BSTA 1SXJB 4S0XA 3MCUA 4MEBA 3BIWA 1BDMA 3NNDA 2ZPUA 2FCAA 2AEJA 3AYZB 3O4JA 4F45A 4TN5A 2VJOA 3KZOA 2JAWA 1UK6A 1JEDA 3PFHA 1XXHB 2YZ7A 2H7VA 1QS0A 3AR5A 5D3MB 3TCKA 1VJDA 4LNUA 4G4JA 4LOKA 4ARSA 4YMUA 2VT3A 1PZFA 1Y5MA 1ZD3A 3HWSA 1OLSB 1R0LA 2Q2OA 3IT2A 4LWQA 2DKFA 1VG9B 2FEOA 3IV9A 2C03A 3O2NA 4IGEA 2XX3A 4KAJA 3I1FA 3LX8A 2M6RA 3R0XA 4OH7A 3GVIA 3ROQA 4ZJPA 5A9SA 1Z06A 1YZYA 1HFEL 5AVKA 4TXLA 2YXPX 5CW1A 2QV0A 1TA4A 2VKQA 3MMNA 3UQZA 3H1TA 2OLEA 1CHNA 1R50A 1U02A 4D6YA 1XWFA 2NP6A 1BRTA 2MSNA 1NVVQ 1N7JA 1M1ZA 1P72A 2YIDA 3I4CA 4FMCF 4R1NA 1WR8A 2V6BA 2FUG1 2VRWA 3HYSA 2HX1A 2WA1A 2XPCA 5IT4A 4DT1A 4XGKA 3CF6R 4FYXA 3K0CA 4ILEA 2GKSA 1XF9A 1RI2A 1P4RA 1PS8A 3M6AA 1UBGA 2OBFA 4G1BA 4GMGA 3OAAA 5U1PA 2BKXA 2IWRA 5K0NA 3FDZA 5CK4A 2AZXA 3K6SB 2G1KA 2Q5IA 3PXEA 5BQFA 1PJLA 2W71A 2P6RA 1SCAA 3BA1A 3V8EA 3OO0A 3QELB 4COOA 4W5OA 3STUA 1U5AA 4W1RA 2A7XA 4LE1A 3ZD9A 4PHFA 5IBPA 5AM2A 4RNDB 1ZI6A 4QIHA 4ILKA 4I3HA 1SCQA 5FUQA 1WUTA 3UPUA 4MITA 1KZ7B 1TJ3A 2OO3A 2ZBRA 4DPKA 3TN7A 2G5PA 2KS6A 3QUSA 1NASA 3L0SA 4H1TA 3IE2A 3PVZA 4BN0A 5EQFA 1FMLA 1YGPA 3DPUA 1EFRD 3OZDA 3UCXA 2ID7A 5HKLA 3GLTA 3AEYA 4IIJB 3UKDA 1U8YA 2IEZA 4UVHA 5ISMA 3VV2A 1E5QA 2IKQA 2OZLA 3KR1A 3Q0EA 4NPCA 2RB4A 3GDWA 1USWA 5F2KA 2FF5A 2G36A 3AFHA 3QE2A 1J25A 2J4FA 3AILA 5FWXB 3I8XA 3ZWKA 4E3ZA 3G85A 1MEJA 1YBMA 2JFZA 1DOZA 4ZN6A 1U7ZA 1YZGA 3HO1A 4HH4A 1JSCA 1FQJA 2GM3A 1N2JA 1Q7TA 1FLVA 3FLEA 3KHTA 3PQEA 3C3XA 5AIAA 5T57A 4AULA 1OWPA 3Q11A 4ARZA 2QZ4A 4OKSA 2AOVA 2ZKLA 5K9ZA 5KPDA 2HFKA 3THYA 5LNK1 4GLLA 1FSZA 3D0RA 3U7GA 1U9CA 5GJCA 4F8EA 1UIRA 3KEQA 1IOLA 2JLYA 2YKGA 1YIOA 4EGQA 1T4GA 4QUHA 4IQ0A 3I2HA 5DOZA 4D4LA 2OBXA 3B6ZA 3GJ0A 2IXEA 4YRQA 1T29A 5BNZA 1J2TA 1TLTA 5L7TA 1CY1A 3UTDA 4ETIA 5B6JA 3TECE 3LJKA 2E6KA 2KMLA 1H1LB 1TW2A 2POCA 1DHTA 4G4SO 1RBZA 4JL8A 4OYYA 4DEYA 1KO5A 5I45A 2Y6UA 4Q0MA 1Y1TA 4WCVA 3VJMA 2Q2WA 3AI1A 3O2SB 2ZVDA 3HACA 1GSIA 5F9MA 2FJPA 3B5EA 3KEMA 3SR0A 3U60B 1ZCFA 1ADJA 1GFZA 2ID8A 4F4JA 3EXIA 2GM4A 1FB5A 2O2YA 5JHHB 4PSAA 1VSTA 4G0YA 1FNCA 1SZDA 4HDNB 4F92B 5CB4F 5J2TA 3N74A 4MJXA 1X92A 1ZW1A 3RU2A 2Z8YA 3JATB 4RC9A 4E2FA 4ME6A 1TGYA 2GYVA 1LQUA 4MUYA 4PYOA 4WBXC 2R6JA 4L6CA 4RLHA 4XGNA 5ES3A 5KOJB 4AICA 3MTQA 2XCQA 3N8DA 4BO1A 1ANKA 1T8SA 2UDPA 2QQEA 3MD0A 4GC5A 1IHUA 1AF4A 3FOBA 4DSUA 5KDOA 5I7WA 3QU4A 1UZLA 2IEIA 5TV2A 2PRZA 5ALMA 4R54A 3H83A 4EI2A 3PHJA 1R4ZA 4ARVA 1OBHA 1ZO8A 2P2ZA 3D54D 5EWJB 3GLRA 1PT9A 3DGEC 1P2SA 3R3JA 4P98A 2A9PA 2A0WA 2G0TA 2QYSA 3I9OA 4K81B 3UJAA 2PL9A 3FF4A 4IKPA 5HHTA 1PWXA 3WWDA 1YL6A 1N2ZA 2ZIVB 4A8JB 2PK3A 4LOJA 4QUKA 1U0LA 5LLSA 2WUVA 2C99A 2BMEA 3EZ9A 4MRAA 3CKLA 4MV8A 3HKDA 5JNUA 5KHOC 2F9MA 3L8DA 3NCHA 3SU8A 1YZNA 1XU7A 4GPBA 1Y3BE 2W8ZA 1CJBA 1JSRA 2OLJA 1C3OB 3RK4A 2PZJA 1IM5A 3TZEA 4TWZA 2R62A 3SIXA 4MQFA 2QSYA 4RS3A 1NHGA 2QN3A 1U0FA 4QICA 1AM4D 4HDMB 1Q50A 4QUIA 5EE3A 5C4GB 2Y67A 3LPLA 4H7KA 3ZIDA 5JNTA 3QWIA 2I6SA 1QO0A 3DMFA 3MT9A 3W78A 4K9SA 4YQFA 1KU6A 3K7EA 3U4IA 3VPBA 2JS7A 3QE9Y 4E94A 1P1JA 1U8XX 3GZTB 2HU2A 3EDOA 2BJHA 3DO5A 2W2VA 3KEOA 4HQOA 3JQAA 4TQGA 4NNJA 4AJJA 4TWRA 1I0LA 2Q2QA 1MO6A 3COWA 2IOFK 3NM4A 1AJEA 3HVIA 2HJWA 3JQ8B 3NOQA 4AECA 5I7SA 3K9WA 3O8QB 2ADFA 1WXQA 2RHGB 1I51A 2Y0EA 2TS1A 1WCV1 2P9EA 2JD0A 4R31A 5AOVA 1X70A 1HDXA 3WLLA 4U6SA 1NOKA 1YCGA 3BDIA 1J23A 4P3OA 3L6EA 1A0OA 4FKZA 4ZVLA 1DQRA 1K97A 2YHAA 4OMUA 2LCQA 3V1UA 4D46A 1Y7PA 3LHKA 3L7JA 1PK7A 4EYKA 2P5UA 4GIBA 1MQSA 3PUIA 5FYQA 5ALUA 2OKGA 3L8CA 1E79A 5CCDA 4O02B 4ZVPA 1R0YA 1Y8AA 4MP3A 5I9TA 3ISJA 3NIGB 4K05A 5AUOB 3JW8A 1V4BA 2C1XA 4OHUA 1YDHA 4BFCA 4Y18A 4L4YA 1ECBA 1T91A 2ZBUA 2JASA 3I9V6 3DC2A 3NTRA 4MWCA 5AK5A 2CGEA 5ICCA 1E1CA 3T4EA 3WYFA 3ISTA 4BE7B 3DBVO 5H59A 1TAGA 4FVTA 3OQBA 2NO4A 4Y2PA 4BNYA 3E05A 4P0PB 7YASA 3H5IA 4GBMA 4BLWA 4ZJZA 2ACKA 3IAS1 2CVZA 5JMPA 3RYCB 2EBUA 3O75A 2IP4A 3CJRA 3LLUA 3L93A 1QIMA 3A1CA 4HNTA 1UOPA 2I78A 5K0EA 4LOAA 1BOOA 3IIKA 5CB8A 4JITA 1XQWA 1ISIA 4LXUA 4B33A 2PRYA 3MMPA 1UBRS 2GWRA 3BN3A 3CRZA 3GROA 3KCQA 4MVJD 3LG2A 1H1TA 1P60A 3HN6A 2I2DA 1U2QA 4EJ2A 3H9UA 1ZONA 4KREA 2YYZA 1IJBA 1J2EA 3L2OB 2C9OA 2F3UA 3TZKA 3HN2A 2E5WA 5TEVA 5IASA 3D8BA 2HDNB 3NAGA 3ZZ1A 2C00A 1YMVA 3PZBA 3H1EA 2ZYGA 4DNOA 2A5JA 1YA6A 2XJ9A 1AMUA 4ER3A 4HUTA 2EG9A 1YE8A 3SHWA 5JEDA 4P34A 1ZR2A 1N7GA 1KP2A 3QVSA 1LJ8A 1RIIA 3O21A 2X15A 2PCJA 1IEWA 2Z0MA 4U63A 5H80A 3G2PA 3VSEA 2C20A 2GAOA 5B7NA 3HUTA 4E31A 5HX7A 4B5LA 4QWMA 3FJ1A 5B58C 2QRGA 1GKYA 2MTBA 3AF5A 3DOFA 1W59A 3I1IA 1IXSB 2PTHA 4JZYA 1NN3A 3MCTA 3NTQA 1GA6A 1QO9A 1VSUA 2JKVA 3K9LA 5D5PA 3DEJA 1D2GA 4KE6A 1KEEB 1SU8A 2AEFA 3K5HA 4P4TA 1SULA 1NI4A 1FUUA 1M2EA 3DZFA 3OLYA 3KWJA 2QBYB 2C5SA 4NJEA 3T7AA 2A1UB 2CUZA 4Q3NA 1SFRA 1G17A 1NDQA 1RLJA 5CM2Z 5F51A 1G8FA 5JXHA 2R8BA 2GX6A 2X8JA 4II7A 4LTNA 1ZXLA 4ZCRA 2JC3A 4JKYA 2IZ7A 2OYRA 3A3YA 3BZUA 3IBGA 4S1VA 4WN9B 5JY6A 1L7EA 2P2SA 3ADOA 4QXAA 4JI5B 3WGTA 1WU8A 3BORA 3KX2A 1YJ8A 2BMJA 1B14A 2AJCA 1VIAA 4WY5A 1FY2A 1NGSA 1QFJA 1JB9A 1UJNA 2D6FA 4PVDA 1UT5A 1A50B 4ZZ0A 3CFYA 1QMGA 3SVZA 3B51X 1C3XA 2Q7DA 2ET6A 1RZUA 2ATCA 4QQRA 2COEA 4PYKA 3NI2A 3RTEA 4AO6A 1EK2A 1PK8A 5ALSA 1DRWA 5TVKA 3MCVA 3PQ4A 1WZNA 3QKSA 4FI3F 1ZD2P 4V3CA 1GZ7A 3OCXA 4JLKA 1V71A 3K16A 3DDCA 5JALA 5CHEA 4DXHA 3U4GA 4E30A 3UUEA 4E32A 1TTHA 1GAQA 4EO9A 5KWSA 1JHYA 1SVNA 2RHTA 5DGHA 4B3XA 4CLDA 5IKPA 1UP7A 4C0KA 3AF0A 2YVUA 4BPRA 1OYVA 5JYCA 2ZBPA 3SP1A 2CB0A 2Y1FA 1N8NA 3T5BA 2VK1A 3TG8A 3VX3A 4D97A 3SLGA 4JXJA 5EHIA 4J6EA 1K08A 3NP7A 4JNCA 1IXZA 4JVMA 1E2FA 4HPWA 4W9MC 3GT3A 1SHUX 3MTIA 5EJ9A 1N3IA 3RUCA 1UT6A 3MM4A 3V55A 4JH0A 1BEUB 1WO8A 3BDVA 4HN2A 4BVHA 4MGIR 4W99A 2OPBA 1FFCA 1K7YA 1TTPB 4G0OA 4GVPA 4PV7A 3DVRX 5GADl 2FFBA 4BVKA 4GBED 3R7WB 5FPPA 4RFSA 2H1HA 2JHGA 3KU4A 3K9CA 4JSTA 3MWFA 1D0SA 5IJ9A 1CSEE 1MAUA 2ZVQX 4RTMA 3ET4A 3BMOB 1DQSA 3KS9A 5H1YA 3P9NA 3UW1A 5LC1A 1H4SA 2P6MA 2WJYA 4UUMA 4F5EA 2EKDA 1XJ5A 2QVXX 4IX1A 4P9NA 4S1OA 1UDBA 2VJCA 4PQFA 2FJUA 1RXSA 1PZNA 4TL8A 1E5VA 4D3DA 2R00A 3IUQA 4M0EA 1KMHA 2QX4A 2AFVA 1HI9A 2VDRB 3DT9A 3KHUA 1FTQA 4M0CA 4BQQA 5AOBA 3ZWCA 5FQOA 1HKUA 4CCSA 5KC9A 1IY1A 3E5MA 1EP9A 4QBGB 2QGFA 1NMSA 3CNEA 4JFAA 4QXRA 4W5RA 1H05A 5KKNB 2YWEA 3ZBTA 4V0KA 5IF3A 3RODA 1A7AA 3DD5A 3E2PA 1OBFO 4O4LA 1G9XA 3MYRA 3KSMA 1Q7CA 2ZWIA 3AJAA 1ODFA 2ZJBA 3KQSA 1P9LA 4YEDA 4M6WA 2Q9CA 2LBPA 3CBGA 3UMSA 4KP7A 1V39A 4REQA 1PO7A 1T10A 2BMWA 3DV2A 3WRXA 4F5DA 4FYJA 4BECA 1E2NA 1PT6A 4RADA 4YJ3F 5TPWB 5EWMA 2OUKA 2XKBA 1K4MA 4EZBA 3SEQA 4B7UA 1RI1A 2UYCA 1G291 4FR5A 1WEKA 3KJEA 5L95A 4NFHA 4YQYA 3HCCA 3SC3A 4FJ1A 4B4WA 4U5XA 5LDGA 4BNVA 3HQ4O 3UWOA 3F71A 3FBGA 4Z51A 2ECFA 2J0VA 3R23A 4Q1FA 1M2HA 2VYNA 1FDVA 2HMSA 1QRAA 3A4VA 1U7DA 1KEPA 3EBPA 1AGPA 3MT8A 4Z9XA 4RKRA 3ZDYB 1U5BA 1ZIPA 4PY2A 3ABOB 1VA5A 1KERA 2QP4A 3DTTA 5DM70 4M8IA 3U26A 4EO7A 4FT2A 1E69A 4WWHA 5DVZA 4BP3A 1CY6A 2V7XA 1R0RE 3K0FA 3WVNA 3MELA 5KTRA 1CIPA 1YQDA 3KALA 2HMTA 1IY8A 4ARIA 3KQQA 2GPTA 5BRNA 2HB6A 3LTEA 3VX4A 2JIRA 3UIEA 1WETA 3HYLA 3D8RA 1SXJE 5KQPA 3EZNA 1ZVJA 4B7ZA 3BD7A 1WZIA 3GRFA 4UAGA 2PX2A 3REOA 1JKIA 5BVGB 1A7UA 1L1RA 5EY5B 2CLCX 4UATA 4IZHA 4EB6B 4TT8A 1JIVA 1U3DA 4BNKA 5C4IA 2O05A 1QKJA 3GWGA 3IQZA 3OPNA 3KETA 1B6SA 1CETA 4BB6A 4CM1A 1AKNA 1T6YA 2WSMA 3ED1A 4MJ3A 4R16A 3ZY3A 3MJRA 4AWXA 5JC1A 1UDXA 2PZGA 5AKGA 3DZGA 1WB9A 4OATA 4CIYA 4U7GA 1GQSA 1PF7E 3KKMA 5JYDA 2EG5A 1MNQA 3LHDA 4WUTA 4WKCA 3EC2A 1GUBA 3NXSA 1WXXA 4IDQA 4U5QA 3ORRA 1Y4SA 4ZVVA 4LX8A 1TIPA 1C8KA 2LCIA 1D0IA 3G3EA 3IP8A 4QU0A 4TV9F 3VAAA 3W2GA 4JLAA 1H0HA 1RMTA 4CM3A 3CKKA 2PX5A 3OUUA 4M9SA 5HQ3B 1A9PA 5K3EA 4FMDB 5ALFA 4A91A 3A26A 5TQVA 1OFTA 4CM9A 4HWPA 4TKUA 4F93B 2KE5A 3R6GA 2V45A 4P80A 4J8PA 4J0GA 4G1CA 4NARA 4YP5A 1PT8A 3E70C 1JG1A 4UPEA 2I8AA 2BFWA 2XSZA 3GL9A 4FYYA 4B8ZA