1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Collagen-binding
molecule keywords VON WILLEBRAND FACTOR
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
4NENA 1N3YA 4UM8B 2ODPA 3EGXA 3T3PB 1JEQB 1MQ9A 2VDNB 3PPVA 1RS0A 4WJKB 3TW0A 3NIFB 1SHUX 3HXOA 1U8CB 3PPWA 4IHKA 1ATZA 3EGXB 1N9ZA 1M1XB 4F1JA 4IGIA 1JV2B 4C29A 2VDKB 4C2BA 5ES4B 2B2XA 2NUTB 3VI3B 2I6SA 3E2MA 2NUPA 3TXAA 4M76B 2I91A 1MQ8B 1DZIA 4JDUA 3EOAI 2X5NA 1T0PA 1RD4A 4NEHB 1QC5B 3TCXB 5E6UB 2VDLB 3EFOA 1MF7A 3IJEB 3NIDB 2VDOB 4Z7QB 1RTKA 1MQAA 1ZOOA 1FE8A 1PD1A 4CN8A 1BHO1 3F78A 2ODQA 4Z7OB 4WFQA 1JEYA 2ICAA 1L5GB 4UM9B 1BHQ1 1SQ0A 3IBSA 1AO3A 3M6FA 4G1EB 3VI4B 1AUQA 3GXBA 4A0QA 3RAGA 3ZE0B 4MMYB 4WK0B 3BN3A 4UM9D 4BJ3A 1MJNA 4IXDA 5KYUA 3F74A 3V4VB 1XUOA 3ZE2B 5LN1A 2WW8A 4O02B 3T3MB 4Z7NB 3EG9A 1YVRA 2XGGA 3K6SA 4MMZB 4NENB 3FCUB 1JEYB 1NA5A 1U0NA 2XWBF 5HDBB 1PCXA 4HQKA 3BQNB 2VDPB 2XWJI 3FCSB 5KYYA 1ZOPA 1QC5A 2VDRB 1Q0PA 2I6QA 3Q3GE 3PPYA 5KYYB 1ZONA 4FX5A 5HJ2A 5KYWB 2WINI 1CK4A 1T6BY 1OAKA 1JEQA 1PD0A 3V4PB 2ADFA 1XDGA 2VDQB 1AOXA 1M10A 1PT6A 3HI6A 1LFAA 5KYWA 1TYEB 5E6RB 3EH2A 4HQLA 1SHTX 2M32A 2VC2B 3K71B 1V7PC 4HQNA 5HGJA 4C2AA 5KYXB 3PPXA 5E6UA 1IJBA 2IUEA 4CNBA 3HXQA 3EGDA 1RRKA 3EOBI 4WK4B 4F1KA 1QCYA 3EH1A 1XDDA 4G1MB 1IDN1 3K6SB 1IJKA 4XW2A 1IDOA 1M2OA 3TVYA 2VDMB 3EFOB 3ZDZB 5BV8A 4PN7A 4MMXB 1FNSA 4CN9A 3EG9B 3ZE1B 4DMUB 1YVPA 1U0OC 4HQFA 4WK2B 5KYNA 5E6SA 2NVOA 1UEXC 3NIGB 2QTVA 4HQOA 3EGDB 3K72B 1M2VA 1JLMA 1M1UA 5E6SB 5E6RA 3QA3E 1DGQA 2NUTA 3N2NA 3ZQKA 2NUPB 1MHPA 3ZDXB 5KYUB 3ZDYB 5KYXA 1CQPA 1M2VB 3BQMB 2O7NA
chains in the Genus database with same CATH superfamily
4WXRA 4M7PA 4RPKA 3UA3A 3HL4A 4I50A 4FP9A 2YVAA 4WT7A 4DCTA 1JQJC 2JFGA 2QWXA 3VAAA 4TYYA 1CJBA 3H8SA 3JQ9C 1W9MA 3EW9A 1ODIA 1L7NA 1HYQA 2ECKA 3Q7IA 4KX5A 2X2OA 3V8EA 2PUWA 3GARA 3AKDA 5EJIA 5JYEA 4C2BA 1YZHA 1CU1A 4MV8A 4UJ5A 3OIFA 1C5KA 3I9FA 4FYMA 4ZYLA 3IEUA 2CLEB 2RGGA 3D8BA 1FBNA 1XZPA 2OP1A 2YRFA 2BHSA 2A2ZA 4OLHA 5KWJA 3T5CA 4N0MA 4NXMB 2L82A 4D79A 3J7AC 1XQWA 3QKWA 1KPHA 4BBPA 2C96A 4RF2A 1Q3HA 2WAMA 1E1QD 5AJHA 3S40A 1GEEA 2AMYA 1GSHA 2ZRBA 4K81B 1MGOA 3QF4A 4F86A 2OHFA 3LWZA 5B3JA 1SOWA 4JLPA 4DLBA 1EFHA 1ZD9A 3NWEA 4PE5B 1FQJA 5ESRA 2AF3C 1R0WA 4KAFA 4B87A 1EP1B 2VYQA 1N6RA 5BQ3A 3AK4A 5JH7F 1BQ4A 5AOBA 2NQ2C 3BD9A 3TQIA 5GZ3A 1DXHA 5BRJA 4D3FA 1E7QA 3ENKA 4NH4A 3F74A 1KKUA 5KMGA 4KBFA 2NTJA 4D4JA 3T95A 3C98A 1AV6A 3M6LA 4QPZA 1X1AA 1M66A 4D2IA 4JQOA 3UJ6A 2RGXA 1JKXA 1GTL1 2QUBA 3N8HA 3HYRA 1XZDA 3IAS1 2EP5A 4BP1A 4BWFB 3NORA 2C2XA 3O4HA 5C1BA 1F8GA 3B1XA 2CYCA 4TQ9A 4X54A 4W1PA 2Z9CA 4QD3A 2ZR7A 2R79A 4EGFA 4YY3B 4XQGA 4CHGA 2PVCA 1H1LA 5KYWB 1EFDN 5WRFA 1VMDA 2G36A 5IKPA 1AQLA 3BMNA 3D6AA 4ND3A 2WG2A 1XO1A 4FXPA 3T7AA 1FCJA 3CTMA 4I55A 1BDMA 3C5HA 2C92A 1XL1A 2BGLA 3H18A 1VLJA 3KOOA 1TPYA 2A84A 5FD8A 1SK9A 3B7GA 3PGXA 1DX9A 3PITA 2E1RA 4R6XA 4YLGA 4E30A 5DXJA 3PPXA 3TW8B 4II2A 2P2SA 1JMVA 5FLXA 3UMYA 3B3AA 2Q7OE 2I67A 1RRKA 2YJGA 2OOSA 2ZETA 2YMLA 3ANMA 3VYRB 3S2YA 4C4OA 3L6CA 4N9WA 4DJJA 4Z99A 4MSUA 4MUFA 3WYFA 4NDNE 1NU6A 1HT0A 2FN4A 3R6GA 3SKXA 2NUAA 2Q9AA 2QI9F 4MQLA 1TL7C 4FFOA 1SCAA 4WACA 2YYZA 2HWYA 3GFGA 5LU8A 4URWR 1QK3A 5DO9A 4O2AF 2VJQA 3E22B 3HHPA 2XSZA 4AKIA 4YROA 3MOSA 3IP3A 4KE8A 5JSYA 4Z4GA 2DFVA 1GXSB 3FLMA 1P7ZA 2QAGB 1NQWA 1FSFA 1SU6A 2W2LD 5EXPA 5JS1A 1DJQA 2W2PA 1EZ4A 1VJRA 1Z0FA 3JD0A 4IDDA 4AP9A 1WXQA 4ZO8A 1RLUA 3PGKA 5FORA 5BQXA 5AFSA 1FK8A 4HJRA 3GAMA 2PUCA 1IEWA 4CIAA 4MCHA 1ZM9A 3URMA 2YY7A 4YUZA 5JBIA 1O58A 3U7QA 3O5AA 4XH9B 4FFVA 2DT5A 2XOKA 3MOGA 4TV8A 4CLEA 2ZJ4A 1ES9A 2OLEA 2C5EA 1QH9A 1SHUX 2VQDA 4NH0A 3HXOA 3JVDA 5KMGB 1K98A 1GIAA 4M0UA 4WBNF 2DJIA 2EJWA 4JVOA 4URUR 3H9JA 1B93A 1GA1A 2WT8A 1JIJA 5E0KB 3CUUA 1XEWY 3IIKA 1FFWA 3EEBA 4OSOA 4OP3A 5AO9A 5BYJA 1GRRA 2CLFB 4FD3A 4P22A 3RW9A 2NZXA 1WNFA 2Y1WA 3KPJA 4LDJA 1ZMXA 4O4LA 4MB0A 4BJ5A 2JDID 1OA1A 2ATCA 2AMVA 3FCXA 2HU8A 4XVUA 4YRIA 4GXTA 1ETUA 2V1XA 1QDLB 1WXDA 4YHHB 4DB2A 1YZYA 3I2HA 4JEHA 3IT2A 4GGMX 4IFEA 3QKTA 1JSLA 4BFVA 1CY0A 2WYWA 2G06A 4ZYZA 1T8WA 1OILA 1M5TA 1OA0A 1G8KA 1HSZA 1VIAA 1DEHA 4OCZA 1FMCA 3WGQA 2WDZA 5L51A 2G4LA 2QYHA 3DE1X 2ZYAA 1GLVA 4YJHB 1L4MA 1RXSA 1SBCA 3HDYA 4EELA 2MYPA 3BWYA 3HU1A 5BOSA 3ZS9A 3RIEA 5ED0A 5B1EA 4XKJA 4WA7A 3N8GA 1NNUA 1B1AA 3L1IA 5EIWA 3SFZA 2Q50A 2IA5A 1LZKA 2ORED 2X77A 3KDSE 4CKXA 4ECEA 1OPRA 1JEYB 2EKPA 1TJ4A 3MZ0A 1CY6A 1FXSA 1UXKA 3QMMA 2BJWA 3WLAA 1Z34A 3CC8A 3H5OA 3B48A 4ID9A 4NYJR 5I8ZA 3JD3A 3AB3A 3QPCA 3PTZA 1MC8A 2BSQA 1YE5A 1TAQA 1JQ5A 2GLUA 1MVNA 2W6IA 2SHKA 4I46A 4L5IA 1KP9A 3QSYA 3CYFA 2Y6UA 1K2VN 1OAKA 5ALTA 2CXTA 1TM7E 3GJ5A 1XXLA 3A31A 1THGA 1ZCBA 3OZRA 1NUPA 4I1UA 4RJIA 5CJ2A 1MB3A 3JZAA 4GBGA 3CCBA 4LISA 2QM8A 4Y1GA 5KSYA 1OHHD 2XW6A 2DWQA 3IUBA 2VT3A 1L5HB 2CDCA 1P7VA 3H83A 4MDHA 2C9ZA 5M34A 2H8GA 4L07A 4OA8A 2Y77A 4WN9B 3GZNB 3W6NA 1JQDA 5IBCA 1G5FA 4TLEA 2V55B 3VR4H 1EJ6A 5J5AA 3BKXA 2G0AA 3NBAA 2QRUA 2AJDA 4WERA 4WZBB 1RI2A 2ZIXA 5CBKA 2FGJA 4A15A 1WKCA 4EYSA 1E60A 2VPPA 2PPVA 2ST1A 4DCUA 3KJIA 4JAVC 1WCIB 3NP7A 4ICIA 5G4LA 1DINA 1SHLA 3RAFC 5BN3B 2O2SA 4EHAA 1WXXA 2BGMA 3FSGD 3JCZA 4ADSG 4IHJA 2XDWA 1MRZA 3E9ZA 3P9ZA 4ZCRA 4PG6A 5CDYA 3DWEX 2XGJA 4C7BA 3CUEF 1J20A 4PZ9A 2XIQA 3L07A 4B82A 3UN1A 3LHFA 2FOXA 2QV7A 2ZBDA 4MWEA 5J47A 2DLNA 3DBRA 4I66A 4S3MA 1Z88A 4HPXB 5D3MA 4O29A 4TVBA 4N7MA 2ZE7A 3RS7A 3TZBA 3U26A 3Q72A 3FOWA 3W6PA 3T5AA 1QKIA 2AN4A 3UKOA 3PRKE 4KODA 1YQDA 2RSLA 2K4MA 3AUUA 3AMVA 3TLBA 2C57A 5FBZA 5I4CA 2B2CA 1P2TA 1U0BB 3U48A 2JLUA 4M0FA 2IXEA 3EXHB 1J06A 1JV2B 2CNNA 3KQMA 4G85A 4IQ0A 2VDKB 2VRCD 3SXJA 4OP1A 2Z6UA 5JRJA 2B8EA 4PC3A 5AVOA 4Q3KA 2JIMA 1VCMA 1YQWA 4WAUA 4XDGA 3WGNA 3ZHVA 2BFDB 3U4IA 2V7BA 3K2QA 4RHYA 4QU9A 5JANA 1RC8A 3WIBA 3V1UA 3A1TA 1I30A 1N2ZA 2HRBA 3F7MA 5BW4A 5CFZA 2W4MA 1X15A 2YQ4A 3N74A 4MUBA 3TD6A 3KSUA 3JWEA 4LE1A 4EHDA 1VHLA 1W88B 3HU2A 3Q5GA 1YHYA 3RQIA 4B79A 1AQJA 1IPFA 2YDXA 5EIBC 4ZDIA 2QVXX 1TIBA 1QGOA 4TLMB 1GFSA 4UVEA 2ZI4A 2J3KA 3R0ZA 4IDQA 1D2RA 1HDXA 5BT9A 1UJMA 1R7RA 1W6RA 2E9SA 2Y9MB 4K9NA 4RUKA 3SIXA 5CCEA 3L7KA 1QH1B 3OUTA 4MVJP 1EINA 3DPIA 4RZIA 4BP8A 2ZT6A 4LYGA 2IHBA 4CKCA 2IV3A 1M0EA 1K8ZB 3L43A 1E7SA 4B5LA 1C4XA 3A1WA 4M55A 3R3VA 1CDDA 3D7MA 1TU3A 4EKGA 1QHYA 5T8KC 3TQQA 5IC5A 4IDPA 1GKIA 3W0LB 4TSRA 3S29A 5LB2A 3WL7A 3EX7C 1J56A 2QR3A 2I4OA 1E3WB 3HFSA 3MB8A 1XZBA 4EPWA 3OZCA 5GOTA 3U7EB 4BS9A 1HDEA 3LXMA 1DL5A 3IUEA 5DI3A 3MGGA 1P45A 4NE2A 4RPCA 2B8TA 4Q9HA 4X71A 2RD2A 4CKCB 2XJ4A 1V7PC 1JXAA 4QELA 4WOJA 1R37A 4H1WA 3LQ2A 4FNAA 1QGUB 3CPEA 3HUEA 4C20A 2VJAA 1GPKA 2D06A 3A3YA 2R1TA 4FEYA 2XVZA 2I80A 2IEIA 2CE7A 1VLMA 1OX4A 2FVYA 1SRRA 2BH9A 2WWXA 2XUDA 3ZUPA 3P9CA 3GFQA 4MKIA 2P8SA 4XSGA 5JMWA 4QNMA 2CUZA 4CMJA 1YI8A 4GQAA 2DC1A 3DH0A 3H2GA 4LRYA 3MJSA 4XLZA 4YA6A 1BE0A 4UAJA 3H04A 1UJCA 4V0KA 4B6QA 3W2TA 1J00A 1TI7A 4FVTA 3R77A 3X1YA 1AM4D 3TVDA 3FGOA 2I78A 2EZ8A 4P0TA 2ODBA 3VDXA 3V8RA 1OVMA 1P6QA 2OENG 4I08A 3UXEA 4F5EA 2QYTA 4KI7A 5FLEX 3T4PA 3ICWA 5DYWA 1S7GA 1RHJA 2A0YA 1ZIOA 2HMYB 3AJDA 2NUTA 4J29A 3R7SA 1TX4B 3FPCA 5K3DA 3R8CA 1Y33E 4OXRA 3OY2A 2VSNA 4Y2GA 4DVGA 2V65A 3D1JA 3MS2A 1VJ0A 4RLHA 1QLJA 3N2GA 5DX1A 4E21A 4V3CA 4I9FA 4W5NA 5JTUA 4M87A 3MGBA 2DQYA 1NLYA 2I1QA 1R8JA 5FOUA 1LUAA 4BZWA 1NG9A 2UUBB 1XELA 2I7VA 2VZEA 4CUJA 2JFUA 1P2FA 5JDCA 5H70A 2JJ1D 2GJAA 1Y1QA 3CO5A 4P38A 3OKAA 1NW5A 4FHDA 5LOVB 3SWWA 4ZGWA 3VKUA 5JAZA 3FMVA 2ASVA 2PUHA 2ZBPA 2RHDA 1F4VA 3K4QA 3L7AA 1XRMA 2A30A 3MCAA 2PA0A 4MS3A 2P0EA 4EFMA 1YL5A 4OJKA 1KTIA 1EUYA 2VN8A 3CG0A 4J9VA 2JAUA 2MU1A 1L5ZA 1XXHE 1Z06A 2ZTUA 4Q3AA 4FC7A 1E1CA 3V42A 5GADl 1T2VA 3IP9A 4ARAA 4A92A 1XRJA 3OWHA 3EHEA 2FWRA 1OH8A 1D2GA 5FUQA 1BRMA 1AIPA 1R6DA 1EPUA 2HADA 4M9XA 3BG5A 4DL9A 4F8EA 5JCJA 4HDNB 1E3QA 1RADA 1RYNA 3USZA 1T4BA 3FAKA 3GXBA 2C7VA 4RQBA 1HSOA 1SC4A 1NWCA 3ZE0B 4HSGA 5EMJA 1GCGA 4Q12A 2ZT8A 3A1DA 1MB2A 5E9JA 4AYTA 4EHNA 4Z54A 4WW0A 5IF3A 2AN1A 5JDIC 3Q9UA 1TRKA 2BEKA 2H5JA 1I24A 2EZ9A 2VWPA 3MWDA 5CA0F 1L7VC 4IXDA 1EXMA 1KL7A 1E2IA 2VF4X 3Q5DA 4L4YA 4WN9A 5K4AA 3PS9A 5SYAA 1DP4A 1E1RD 1TKRA 2EJCA 2YFQA 4P4GA 4W8HA 1Q14A 4G0PA 4P31A 1W35A 5B3JC 3FPGA 2B3DA 4EWLA 5K3EA 5K0JA 3HO1A 4RGQA 1XAGA 4LSMA 5G4KA 5I9IA 4PU0A 3E9CA 3KOXA 1KKMA 4K46A 1T29A 1THTA 4PCVA 5KSWB 4B81A 5HS6A 1CY2A 1J5PA 4RTOA 3U56A 4OI4A 1SWWA 3DKVA 4U0KA 5TJHA 3WLLA 4DG8A 1DKQA 1XMVA 1SUSA 1ECGA 5AJVB 4Y2JA 2C20A 2D1YA 2C2HA 4JC4A 1ZLYA 4BB0A 1FMJA 3U9LA 1K6EA 3LCUA 1Y80A 2FVXA 4NU6A 5AKGA 4R0NA 2G08A 4EX6A 1ID8A 4Q9KA 3I72A 3QEBZ 3R6TA 4BNJA 5EHXA 1DKUA 4FNOA 5AW4A 1TYEB 2AXPA 4Z8YA 1I4OA 3QV1A 4FNGA 4RKFA 4DNFA 1WUHS 4POOA 2OAP1 1RKXA 1ZJ5A 3A1SA 4WY8A 3VQTA 1TVKA 1UPFA 3TLJA 4EPXA 2C7BA 3AHJA 2GESA 3GZ4A 3UBMA 4Z9FA 4DDKA 4S1VA 3UOGA 3UO8B 1EDDA 3FB1A 2NAFA 2O14A 3DAGA 1DXOA 3QNUA 3O8RA 4FE3A 1A71A 4GE3A 4OJTA 1MG5A 1QSGA 4WL0A 1Z0SA 3UT6A 4ZHQF 5KS2A 4B3GA 3HA2A 4BNVA 3X0DA 4C88A 1F9EA 1E6UA 4C5CA 3SM9A 4DSTA 2LR0A 3GJ7A 3PXCX 4RFSB 3B3JA 4XUEA 1KZ9A 1NVVR 2XZDA 1YD7A 4TV9B 3SGLA 2C94A 3SSAA 1JFLA 1DAEA 2ZI7A 3MELA 1XLTA 2GFQA 2NVOA 2Y93A 3LPAA 1CJSA 3OJ0A 2Q6VA 3T0FA 1F48A 2AGVA 1NUHA 2JJMA 1H4SA 2FI1A 4NPHA 2R68A 3KJNA 4QRIA 1U0JA 3G0OA 2C2GA 3NRBA 1QMGA 1UBTS 5JO0A 2QL9A 3L05A 2UAGA 1IWBB 4DPKA 1DQYA 1PS9A 2H59A 3A4IA 3DEFA 3NBMA 4IIYA 4RD1A 5BT8A 1FVHA 3EIWA 1D9ZA 3N0VA 2ZM5A 1IN8A 1IY1A 2H4WA 3NTVA 2GASA 3E5RA 3PPVA 4HDKB 4OSEA 2HDNB 4PBRA 3NIFB 3RBZA 2B69A 5HWSA 2DJ5A 1J1IA 3EIQA 3STXA 3UA4A 3BGWA 4W8OA 2DG2A 3A2MA 1W4BA 2HV8A 4D8VA 3PA8A 4EUHA 2WPDD 3TO5A 2IEDA 4U5QA 5HQJA 4E94A 3L6BA 4G1BA 1IXRC 5JY6A 2BBOA 3LY8A 3RYHB 2WYHA 2WJAA 1RJFA 2O5CA 2FP4A 3N9IA 4YRZA 2NV2B 2O3JA 4LJ6A 1WCWA 3FNEA 4E0BA 3V55A 2ZRAA 4ETNA 1P18A 4FFBA 1Y7IA 1JSRA 5DK4A 2BGJA 2VOEA 3NOQA 3ZWYA 2GAOA 3U44B 3VZRA 5C80A 1I6MA 3DDUA 3H86A 3GRFA 2G9UA 4KGVA 1V26A 4LXQA 4WADA 2ZYIA 2JBHA 1SUEA 1XHEA 5TB5A 1Y7HA 1QIGA 1DNPA 1HT1E 1KAHA 1PS8A 2I62A 2QTCA 1TMOA 3B2NA 3LPCA 3A3OA 4RD3A 4AN1A 1FZTA 2YOHA 5DULA 1W2WB 3ND8A 2IGTA 3CRW1 2R8EA 4LJ7A 1GQ2A 4MKHA 2BH2A 1JTFA 4ZVPA 3QKUA 3O8OB 1T9CA 1V9SA 2QG6A 3BC1A 3DL0A 4YEDA 4HAYA 4C43A 4QXOA 1XWWA 1YIDA 2A7QA 1KO7A 4TQAA 2ZRQA 3GP8A 3L8DA 1HV8A 4FGJA 4A0RA 1Z7YA 4AJ9A 5DTMA 3DXYA 1T8YA 3HV2A 1E79A 2ZXEA 3GMIA 3ITNA 3PUWA 3JV7A 1UMBB 1A7KA 4PLYA 5AVZA 3A0RB 4K1LA 4JJIA 4X1KB 3CN9A 5IMBA 4XSVA 3AR4A 2N9UA 4F71A 3BWEA 3SEFA 3PFKA 4LNHA 1VE7A 1LW7A 2GAIA 2WD7A 2YNMD 4Q19A 1N5OX 1QG6A 2JJ2A 2UYCA 2DEUA 1NX9A 2FF5A 3DA8A 2CLIB 1QOQB 3BWCA 3WGHA 1RR6A 3ZBQA 3B6IA 1QH0A 5DCYA 1PLLA 1C1YA 2HLNA 4GVPA 3W77A 2WQ7A 3ZVMA 1NBOA 2G1PA 5L3SB 3UZUA 4LY0A 4GM4A 5K2OA 3I1FA 4TYMA 1NBMD 2C82A 3IP6A 3LXRA 4WK4B 1QO9A 2KMLA 4R31A 3OZXA 3AFIA 3WLOA 1WR8A 3JVIA 2GUWA 2C1XA 1A7UA 5LJLA 1SBIA 3O74A 3QU5A 4Z6KA 3O26A 3PTLA 3PQ5A 1G9SA 2Z9BA 1T4GA 5EMLA 3WQBA 4JWKA 2VJPA 4PSUA 2Q5FA 1T36A 4ZI7A 4NBSA 1AZTA 1K5HA 3K0BA 4YJ2A 3QVXA 3NI2A 1Y4AE 5JNSA 4HQFA 5KNCH 1OU4A 4B73A 4L57A 5HJEA 1C1XA 5A5GA 5AW6A 3P9IA 3O4VA 1CNFA 1OOEA 4IH1A 3K72B 3KALA 4O59O 3LRTA 3SXUA 1VHWA 1VRVA 5FOXA 4DR7B 3Q3IA 2NU7A 4NQRA 3AGQA 5KYGA 2TECE 2VTDA 4B32A 3CF4G 2WP0A 4EFNA 4QSMA 5IM4F 1TB4A 1Y7PA 1ZLXA 4NFHA 3TRJA 4Q7QA 2XQKA 3R5FA 4F11A 1JEAA 1ZH6A 4KI0A 3PQ3A 2I1VB 1Y3AA 4EF5A 1E9DA 3C3DA 4UM8B 3BWXA 4FZ3A 5IU6A 4KGXA 1MZVA 2QQFA 3J81A 1MJ5A 2ACKA 1TYBE 3CRRA 5F9FA 2NUBA 3FM9A 3REQB 2XNDD 2PSFA 1FX0B 1N9ZA 4K6CA 4ND5A 3K4PA 1G8AA 2D2FA 2X9QA 5EIOA 1MBZA 3VYSB 2DU8A 3WGIA 3PB3A 2P2LA 1V1RB 4M7WA 5EI5A 5BN4B 3NS7A 2FY8A 2XVYA 5J1SB 5D7NA 1P33A 2ORVA 1GQFA 3I62A 4J7AA 5JPCA 2A8YA 1RD4A 3ML1A 2QN3A 3SYNA 4CEJA 4B31A 5CXUA 4RJLA 3I58A 1PJQA 2DFTA 3BA1A 3EZLA 4RKEA 5KPJA 1IN1A 5F78A 2LWIA 2XB2A 2DR0A 5AM1A 5LYJF 2ODQA 1HNNA 3P1JA 1JEYA 1SCBA 4Q9DA 1N77A 1I32A 4ZGGA 2JF0A 2PJZA 4J7XA 4EYOA 3VDNB 5KDDA 4H2DA 3L7IA 1ZH2A 2ZJ5A 1W1IA 4MGKR 2BMWA 2ZIWB 1JJBA 3KEOA 4UDXX 4ZHSA 2LV8A 2CWWA 2QS9A 4J7UA 4QYIA 4IAOA 4XVHA 3GOHA 4MWGA 1U4OA 1BQEA 2DRIA 3A6HA 4K6FA 4FSXA 4D8UA 3FHTA 3GRVA 1YVRA 5AICA 5ECGC 2XA1A 1Q11A 2WHXA 3GUYA 1W4LA 3LUCA 3NNNA 4WGGA 5LQUA 1LJ8A 4MUYA 4YP6A 2B4AA 2HCTA 4M9UA 4JVNA 3ZH2A 4D3DA 5CD1A 2GCOA 3LWDA 1ZVJA 1RYDA 4CZ2A 4YAIA 1OLOA 1H1LB 1CZRA 1P0IA 2JZCA 4DM7A 1IXSB 2GCPA 4DCSA 1E1MA 4KQEA 2OO5A 2RHBA 1DTEA 4LTMA 5FUWA 3ZYCA 4ZT5A 3TZHA 1ENOA 3M70A 3EVTA 3UB4A 4FHEA 4H0NA 5DM4A 4LQDA 3PXXA 4N5IX 2CMKA 1W0JA 2QI9C 2FRXA 1GSIA 4X7MA 3E0QA 3P8ZA 3QKIA 1DO0A 3ZY4A 2HF2A 3ZVLA 6REQA 4W63A 1P1KA 2GA9A 2NQTA 2YY6A 3CUKA 3E9DA 5K3BA 3AGPA 1M72A 1C3LA 4JUCA 3QG5A 4YC7A 1XRSB 3ZWWA 3D6TB 4DARA 5JBQA 3HXTA 5SY9A 4JLNA 5JXWA 4HWPA 3U13A 3T7KA 4FHFA 4I5IA 2AYXA 5TLSA 4RABA 1T1SA 1L9KA 4P3PA 3PQ6A 3EEYA 2ZI9A 3L6RA 2ZIZA 2WIAA 1R6VA 1LI4A 1NATA 3PZRA 3MWKA 4IS2A 1F1JA 3R9KA 2WIJA 3D7SA 4U2GA 2WP8J 3CIFA 4KP7A 1SUCA 4RQAA 5F4BA 1UDCA 2C0CA 2KM1A 2VYNA 1KS2A 4RZ2A 2REQA 3AV3A 3TIXB 1MT0A 1NNEA 1S1MA 2PFSA 3HDVA 2W6JD 4UXJA 4BTVA 2GTPA 3D59A 4K6OA 5G1NA 1BH2A 3ZU6A 5IDQA 1Q57A 2QPLA 2ZWIA 3X1XA 2PRKA 2VNIA 5IZ4A 1IWPB 5E8RA 4FLEA 1DC6A 3NUQA 4I2VA 5JCPA 2F3SA 1TM5E 4M9SA 5ALYA 1VJDA 2IYUA 1N25A 3W9SA 4D0RA 2CV0A 1GG8A 2NPFA 4MQUA 4TV8B 1NNI1 4K2AA 3FDZB 1KHTA 2O5EA 5BNZA 4MI9A 1YR1A 3QM1A 3ZH9B 4BQOA 3TLZA 3M49A 3JWHA 1SOUA 3WK7A 1Q17A 1B7GO 1KERA 2LPMA 1EFPA 1HL3A 3F97A 2BYTA 3ZU5A 1YUBA 2FPPA 1LLCA 4IHKA 1PK9A 3RU7A 4BVKA 2CSUA 3GLFA 2O8DA 4AC9A 4ITVA 3PCRB 5G02A 4DUGD 4X1IB 1CDEA 3TKLA 2ZUFA 5TMPA 1JR3D 3ITKA 1S7CA 4IDBA 3DNFA 4M76B 2J3JA 4CLOB 3A2LA 3I4FA 2H11A 2GJSA 4Q3EA 4NXNB 1AX9A 2Q27A 2Y1XA 1PR4A 3B5EA 2RK6A 2ZKLA 2HLHA 2ZRFA 4KK4A 5B3AA 4CG3A 3EF1A 3WGYA 1P5JA 1E5LA 4X7RA 1K7FB 5D3MB 3E0XA 1A8QA 1N57A 2EXXA 4V2UA 1TTTA 2MYTA 1XP8A 2E4UA 1Z4NA 4GZMA 5EHIA 3WGUA 5DSXA 1EVKA 1NYRA 3M1IA 4R40A 1KJQA 4D43A 2O4UX 3LT0A 4AQYB 2RG1A 4C6HA 3MQFA 2YV2A 4C4PA 3EWNA 3Q3EA 1O9BA 3H0KA 4DIDA 3RS4A 3DLAA 1OYVA 1ZKMA 4D82A 1S96A 1WW8A 2PV0A 2QVLA 3BJRA 3FIJA 2RGRA 1WUJS 1ZQ9A 4Z8XA 5E1BA 5EWLB 3ZVKA 3AR8A 4MW9A 1B15A 2IGBA 3E8MA 4DLUA 4R51A 2WAXA 3GFOA 5D86A 1E9FA 3IE1A 1TQHA 3WXMA 3ZI7A 1W4AA 1E0JA 1UKZA 4LJ8A 4Z1MA 2AKYA 3SMVA 1H93A 1ZK3A 5HUJA 4ZRNA 1GZ6A 5MDHA 1NXVA 5K8LA 1PV4A 4LJ9A 1LK0A 1VCOA 2OKCA 4GLFA 5K3SA 4EEKA 2R8PA 1RRFA 1X74A 2Z3ZA 1YQUA 1NAIA 2IYRA 4IIFA 5SZIA 2FG5A 1RWNA 1Y42X 3KYDA 4MR8A 3LUFA 4FFPA 3R3UA 1TC1A 2J3QA 2PSDA 4NY1A 4XJTA 2CF5A 1ZYUA 1J7KA 1G19A 1R88A 4LOKA 4ARUA 2V5UA 2PUJA 2Y3IA 2BL4A 4PSVA 5GONF 3TDNA 4E1AA 4EGAA 2ECOA 4RE5A 3VKWA 3THOA 4EZEA 3T5PA 5IHPA 5KKNB 1A4IA 1P2SA 3H8JA 4V0NA 3GPCA 3UY4A 4CHTA 3O8CA 4DFDA 1ADBA 4M2LA 4PAQA 3HL0A 2VRCA 3AVUA 5ILOA 2KLBA 5EKTA 2ZAGA 1SQ6A 1FXWF 1GDHA 2CY0A 3EXIB 2WFLA 4G5QA 4ZZ1A 4WKPA 4R2HA 5IANA 2BBWA 2IZ7A 3RRMA 1IWOA 1LSSA 3JATB 3L8HA 4LZPA 4RSGA 3COSA 5C8DA 1G291 2AFRA 3M3PA 4DV4B 2JGNA 3P9RA 4KH0A 1ECCA 2EW1A 2GPYA 2V0CA 2XQGA 4HDSA 1NP6A 4FIDA 4QIHA 4ZVLA 2GERA 4ZPXA 1BE1A 1MW9X 3KAKA 3IAFA 3R6DA 3WNBA 3FA2A 1DEOA 2EBUA 4YRDA 4OJQA 4UUBA 3OZFA 4BFUA 3BT7A 3N8NA 2XAUA 4RX1A 3SR4A 1ZK4A 3ZQKA 3COJA 2WFLB 1M6NA 1XLWA 5AUOB 3HR8A 2ADMA 1RVDA 4X6YA 4UNNA 4KKXB 4D4GA 3KKMA 4A6PA 4E32A 3GRPA 4GUAA 2CLHB 2ISCA 3GFVA 2CBZA 2IHYA 2IY8A 2OD2A 3QXCA 2Q41A 4UXHA 1P73A 5HTOA 3TTXA 4C4RA 1IVYA 4F3KA 1LCIA 4ND8A 4PFJA 4YGXB 4B75A 4KH1A 3S4YA 2PR2A 4UVGA 1G6Q1 2NUPA 4L8VA 4LYAA 3BA6A 3UAXA 1J2EA 3VJMA 5BSGA 4YJGA 1RM3A 1L4NA 3UKJA 1GVNB 1OLUB 1RBMA 2HMSA 5KAMA 3GT0A 4GOND 4WZZA 1E2FA 3QFTA 3H13A 2JW5A 4DANA 3DTVD 1Y3DE 3BTSA 2VTVA 1SZCA 3GPDG 1GY8A 1T9HA 1PSWA 2YRXA 1HI9A 4GR4A 4GYYA 4JXZA 1WZCA 4PM4A 4PYLA 4EG0A 2CXXA 3PDHA 3ZCRA 3WWDA 4FYHA 3K4HA 1N0WA 4ZCTA 1ZD3A 2HJHA 4PHGA 3IBSA 4GXQA 4LRTB 1YS4A 4UU0A 4E31A 5K9ZA 2AEEA 3CISA 1H4QA 3G0CA 3HN7A 4IIEA 2ZS8A 1XNQB 3IBYA 2AFHA 2J3EA 1H2XA 2WD8A 1JF8A 4UQPA 3ZE2B 1T9KA 2DUWA 2CHQA 4K9LA 4K9PA 3CGWA 4RXMA 3UWDA 2ACEA 1MB0A 1CE8A 4RJ2A 3QX9A 5DN6A 1H0RA 3GJQA 4E4TA 1N75A 4EEXA 4YXWD 4LZLA 4NAHA 4YNBA 4B09A 2O57A 1HLPA 1EUDB 1OYOA 3CZRA 3U09A 2NQ8A 1KVQA 2OV8A 4E5NA 3CX4A 2EP7A 3EISA 2MCFA 3ZW7A 1MRSA 1QIJA 5E2AA 2XEDA 3NVDA 3WZ2A 4ED9A 2EJUA 2EFGA 4UDOA 3M6MD 2EATA 5CPBA 5IJWA 1E69A 2NGRA 4B6FA 5CM2Z 2GCGA 4ZVQA 4YAWA 3V3TA 1OI2A 1ZRHA 4E4YA 5IUKC 1F2TB 3ZZ0A 4KU4A 3JASA 2ZITA 5KYWA 4L6IA 2QBYB 2IY9A 1HK7A 3CKMA 5E6UA 3TUJC 5CA1F 3D2BA 1BEUB 3IOBA 3EEOA 5C8VA 2VYCA 2VKQA 3QFCA 2GBPA 4G0NA 1XKQA 2R5NA 1U2DA 2H1OA 4KLCA 3ZGVA 4CM7A 3OC6A 5TXGA 4A8JB 4WZAA 4R68A 5ALHA 2Y92A 4B71A 2DKFA 2WUFA 2XT0A 4Q1DA 1CYDA 3Q1LA 1IHUA 2K2QB 4YRRA 2BEUB 1IRXA 1S3IA 2QVYX 1SHKA 5DBGA 2FZEA 2R8RA 5E1MA 1S8NA 3OZUA 3QLEA 3QUCA 1KVRA 3A9VA 2GF9A 2COEA 4H4DA 4L78A 1C1DA 4X5OA 4G0VA 3N1UA 1LRKA 3FAZA 3ME5A 2MT9A 3Q8XB 4C6SA 4PGMA 4HY3A 3LH5A 1GNQA 3BF8A 1QR2A 2X22A 3IIIA 1WXEA 1HWYA 1YK1A 4CM9D 2FPIA 1BXZA 4L95C 2W6PA 3DMGA 3LGAA 4RD2A 4UHFA 2CC2A 3FNHA 4J1QA 1L5FA 2O0KA 2XB6A 3ENVA 3SX0A 1R0KA 2QK4A 3VR2A 2VBGA 2NZ8A 4GEGA 3CEAA 4Y8VA 2VXBA 3GLIA 3DE4X 3CINA 2FR8C 1XR3A 4PGAA 2XMZA 1CB0A 2F2TA 5JJIA 5B4TA 1N3LA 4II3A 4I5GA 4UBJA 5EKDA 1RWQA 2AHRA 2JEYA 2OORC 3LOPA 3WGOA 4EPTA 4B45A 2OILA 5A1TA 2RGUA 4OD0A 3Q12A 4X85A 1P61B 2KSQA 3GT3A 2B2NA 1DADA 2QLNA 4OU5A 1QP7A 1Z13A 1HURA 3F1KA 3NIDB 2B5WA 2WM9B 4MUHA 3ZV6A 2HA4A 3RREA 5MGBA 2J3IA 3TOVA 2CNDA 2YMPA 2CDNA 3NTLA 4JXXA 5ALGA 3C3KA 3CIOA 3G2PA 3I6ZA 5GM1A 2ZE6A 3BVPA 3HSKA 3AI2A 4FZJA 4G0OA 4B85A 3EZ2A 4PINA 3U19A 2O52A 5FWXB 2R6ZA 4KXVA 4D99A 5E4TA 4J9UE 4MGIR 4CE6A 2WUWE 5ALKA 2BMEA 2G9QA 2P9BA 2W0MA 3NGMA 4ZXFA 2GLTA 1ZK0A 2YWGA 3NBYC 3K31A 1W4CA 1CBUA 1CQZA 2ZW9A 2CV2A 1YZTA 1G3QA 1YO6A 2MSCB 3PC6A 2QU8A 3K70C 3RIMA 3RU2A 2QT0A 3LIPA 3G9TA 1KEKA 3PG5A 5BW8A 4CMAA 1YVUA 2RAVA 1KEEB 1YZGA 5DM1A 3Q2IA 1SBZA 4NSNA 3E9QA 1KKLA 1DIOB 2TMYA 1F8XA 3NBZC 3STVA 1JUDA 1F2UA 2P41A 1YHNA 3AYXB 3T7DA 4N47A 2BC9A 2WVGA 3MM4A 4GUDA 4R9SA 2O8BB 2G6BA 4AS1A 3ZWXA 2FPWA 3ILXA 2AHOA 1Z6AA 1R8SA 2QPOA 4M21A 3FKSA 4ALKA 2QRVA 3TTTA 1N2OA 2IYEA 2J08A 3LFHA 3IP7A 4MQFA 3AM4A 4LBZA 4P0QB 5T57A 2OQIA 3PC3A 5A2GA 1ZSNA 4LJKA 1B76A 3AW8A 3K9QO 1JDJA 2WSSA 1Z8HA 2OHOA 4NICA 5CVVA 1DKLA 1Y5MA 1XRLA 2NO1A 2PD6A 5TPZA 2E2WA 1YQXA 5MF6A 2WU1A 4BLUA 3K9LA 2O8FB 3ESQA 4AZ3B 3S7TA 1KY2A 4EGJA 1OFGA 3ZCUA 5DTRA 1ZIYA 4FT4A 4DA9A 3KJQA 3ZNPA 5E38A 1RIIA 2XDQA 3N39C 5JD4A 4R3UC 4IOKA 2PD4A 4P3NA 2PUDA 5IYZB 1ZCFA 2X0NA 4OM8A 3BIOA 3AVVA 3SG0A 3TL2A 3TM5A 4W7IA 5LP6A 2GFHA 5A9RA 3KSBC 3IUQA 2XB4A 4L8YA 2DHCA 5FL3A 4BWYA 3UW1A 1HYBA 3O1LA 4GH5A 5TMBA 5A4KA 1RC0A 4UBNA 4BKUA 2JBWA 5HMLA 1WB6A 2WI8A 1P0MA 4XZ3A 4CCWA 2JLSA 5K8IA 4PPYA 3I6BA 2VUSA 3WLHA 2GHIA 3QV2A 3VZQA 4N3BA 4OV6B 5B58C 4DLAA 2R2GA 5IT4A 1ZUNB 1XTKA 3IXMA 4OJYA 4RESA 2Z9DA 1SJ9A 4GOXA 4QDUA 2VK4A 2CZQA 4COKA 1VA4A 2Z2YA 1PN3A 3HGTA 1ODFA 4OQZA 3KEQA 5D3KA 7ABPA 3T1TA 3KYBA 3M0EA 2PL3A 1RJGA 2Q5JA 1KO1A 1H65A 2H5LA 1HYHA 2PWZA 2QGNA 3KWLA 3OF3A 3F73A 1YS1X 3L5KA 1LBQA 3L18A 3DWIA 3O93A 3G79A 1HDOA 1UXHA 1FC0A 4BX9A 1SVWA 1Z2OX 3VTZA 5JFOA 3ITEA 2V59A 4XRRA 3ZJTA 2Q5CA 3LO5A 2R11A 4H77A 4HI0E 3DEZA 1TF5A 4YTEA 1CR6A 3R1IA 1ZICA 2PEZA 4UCFA 2DKOA 2OPHA 3MLEA 3DQPA 5CH5A 3WHKA 4BB6A 1KDRA 1TA4A 3DCNA 3WSVA 3N07A 2AKEA 3EQ2A 3IPCA 4DY4A 4FWIB 1KZ1A 4QTUB 2QTLA 4B84A 2I2BA 4S12A 1EFUA 3T5DA 2YQ5A 4I3FA 4B7CA 3OTGA 1EAMA 4OVKA 5ALZA 1JVSA 1LV7A 5EHZA 1DUSA 1QRDA 1WEHA 4WK0B 5ER6A 2YVUA 1E20A 2OSBA 4MO9A 2WVAA 3RVLA 2GJ4A 2BFEA 3TTVA 2P0AA 2A9RA 4E2WA 1QZXA 3E1SA 1F14A 4IJWA 4XQEA 5HJ7A 2RHMA 3JZIA 4K0RA 1I14A 3CY6A 2GR9A 3E48A 4FDUA 4EYQA 1G1MA 4MHOA 1E3LA 3FCOA 1AUOA 1BOFA 4N3AA 4CCAA 5JJBA 4EHBA 4BNKA 2WFMA 3C3AA 5CYGA 1PQPA 5TGDA 5CT6A 4JELA 3TSZA 4A6EA 4KN5A 4P7GA 1VYTA 4N48A 3AX6A 3CZ5A 3DBOB 4YJDA 2NVWA 3KQHA 4CEJB 1XF1A 2FWJA 3S2FA 1H85A 1NVKA 3ESZA 3AVXA 2OV4A 5M2QA 4HTFB 3KYDB 1HA3A 4NHOA 4Q4DA 3ZK8A 2VPXA 3DZJA 3G6KA 3S27A 4AKSA 2B6HA 2JVKA 2WKQA 4JIGA 4S1OA 2PO5A 1AS3A 2B8NA 1VIYA 3CONA 5DGIA 1ESZA 4KFSA 3GRYA 5HXAA 3G8BA 1ZOLA 3MBOA 4XSHA 3AIMA 5FEMA 3IGFA 5BW6B 3BSYA 4MHSA 4N0QA 5K6RA 5HGJA 3KG2A 1QOZA 3GCGA 4YRMA 3M4ZA 4XYBA 5DNAA 1WQ3A 3GGOA 1O0CA 2X3FA 1NOJA 1L5SA 1P3Y1 1MKYA 1KARA 1R0RE 1TF2A 5LXTA 2ZVDA 4ZXPA 1PBTA 1OV4A 2R7AA 1G8SA 3JWJA 1QG4A 1GHTA 1I9GA 5DPMA 4GC5A 4MLPA 2PYZA 4DLTA 2YXPX 1IPEA 3QUAA 4BGIA 2FWAA 3L3BA 3P9QA 1W36D 1YQ9A 4MI1A 4BVEA 2UVQA 5CIWA 3QSGA 4J0HA 1P7WA 1V95A 3PKZA 4QQFA 3NDRA 4F6RB 1C3JA 3DL7A 2WV9A 3DB2A 1VBMA 1YRQA 1X7YA 2ARKA 3R2JA 4JYMA 5FV4A 1S0UA 1ITZA 4K1XA 3NHMA 5K3FB 2NZVG 1RU3A 3R6LA 3RUFA 3EEQA 3DMDA 4IDHA 1DG9A 4CLOA 1K06A 2V7XA 3A06A 1QUEA 3W1VA 1WSDA 4RTMA 4WJKB 4DZTA 4MINA 4MXDA 4EHKA 1OQAA 4B4VA 4HUJA 4LY9A 4HEHA 4K6KA 5EKXA 3CBQA 1WSBA 2WILA 4MV6A 1AHHA 5IAOA 2VSQA 3QEOA 4GRAA 1N2CE 5I3ZA 2GK3A 5G41A 1ZNXA 2WLTA 5DGHA 1K7XB 1Z0AA 3IKTA 2PQ0A 3R8FA 2XT9A 4REMA 2Q5EA 3ZE7A 1W7AA 3G49A 4MS4A 1FEZA 1O6GA 1UBJS 4OA5A 3ZX5A 4DLLA 1MA0A 1EM6A 5DHSA 5IBPA 5DEOA 4I3GA 4XWYA 3DDCA 2HIHA 4H3HB 4P6VF 4PX5A 1XTIA 1IQUA 2G76A 1WF3A 1XZAA 4Y2TA 3IYLW 2QLFA 4R7TA 4U9HS 1CY1A 4DWJA 4N01A 2WBLC 4E5YA 2CKDA 3USCS 2AOUA 5CNKA 2FMXA 3PK0A 2RHOA 4K87A 1OBOA 2WZDA 3GMSA 2CVFA 2WOJA 3AW9A 4OQNA 3UPDA 3KD2A 3NT5A 3G2JA 4Q4HA 2NTEA 2OCLA 1JGTA 4S1PA 5J5CA 4BLPA 4D8YA 1C9EA 2VQ3A 3PHLA 3AF2A 3FI0A 3UH1A 2J07A 2O2XA 1YTLA 2WF5A 2P9FA 4JP8A 4YDHB 3ZOKA 5IK2A 2V7VA 4XB6B 3N2KA 4JGIA 3E2PA 3SZMA 3UUWA 3I1JA 3W5JA 4QG3A 3IBCA 3KPVA 2AVNA 4MWZA 5TRTA 5KYYB 4TLCA 3P0IA 2BFCB 3OETA 4RD6A 4MS3B 4LN1A 2FUKA 1EGQA 4K7JA 4KQ1A 3GN1A 1CV2A 2Y4OA 2IZZA 4DE5A 1BWRA 1GL7A 2QN8A 3RFXA 4JP1A 3M5WA 2YV1A 4NBKA 5JRDS 3I2FA 4TVOA 2X9GA 2ERXA 1UODA 4GYKA 2WD9A 2AEJA 4MYSA 3CPSA 2FDCA 3CLTC 3LYUA 1FFXA 4P4SB 3N2YA 3LA8A 1PZHA 1YZLA 1W5FA 2IX3A 4Y7CA 4O25A 1E2EA 4RJKA 4EY7A 4LI3X 4JMLA 4YJFB 1OH5A 2GEFA 4D74A 1IK4A 1XEFA 1Q6ZA 2J6CA 2ZRHA 3V8BA 4URZR 1N6OA 2OZLA 2PGDA 4YACA 2FFQA 4L3VA 1OT3A 4UNQA 1PNRA 1KTVA 2HJSA 1AS0A 1MA3A 4LEIA 4HPWA 1U2GC 3A7EA 5FT9A 4B4DA 2Q28A 4F5WA 2J3HA 2Q46A 2QRGA 4XDZA 4EQ6B 6ADHA 1I4EB 1JDVA 2X86A 3LQQA 5IT5A 3ETHA 5EYPB 3I9MA 4G25A 5GQSA 3KVRA 1BWQA 2C1ZA 3HVRA 2AQIA 4O33A 1KBQA 3OZTA 3OU2A 3PD1A 4NOJA 1II8A 5ECYA 3U39A 4NU0A 2P2NA 1A1VA 4JB8A 2ZS9A 1CEXA 2H4XA 1OC4A 2JHPA 4MZXA 1RRMA 3KEGA 3AZQA 5CMLA 1G2PA 2P67A 1ZD8A 3JR7A 3L9WA 2QSJA 3ZNOA 3ZWQA 1JWLA 2X0KA 1NW9B 2BGIA 3IX7A 5ADWA 3ZWOA 3NYRA 1GADO 2DQKA 1KJNA 1XYVA 5F52A 4FSDA 1AV7A 1PDWA 2GVNA 1NUSA 3RUIA 4EHFA 3WAGA 2DT8A 3GA5A 5REQA 4G0YA 2C84A 5DI9A 2FMHA 5C7IO 3DOOA 4N9QA 2JLWA 1WKBA 3M33A 1ZN9A 3SZLA 1DEXA 2BTQA 3HCOA 4HAXA 1KI6A 1S2GA 3RRFA 4CKWB 1I3CA 1OH7A 3AF0A 1EFVB 2ODTX 1ODLA 4E3ZA 3C6BA 4ZAWA 3D64A 2GAJA 4K3UA 2TYSB 1QKKA 4M6WA 1N6KA 1FFGA 3IT0A 3VSEA 2XHZA 5DBIA 1JZQA 3H4MA 1QH1A 4P3YA 4UASA 3KETA 2IYOA 5I7OA 4GWGA 4MR9A 3OPXA 4H6VA 2JK0A 3MFYA 4AU1A 2O0MA 1NZJA 3FFAA 4YYEA 4U2EA 1U90A 2BTQB 2D2XA 2CVZA 2F17A 2UUOA 1U65A 1Z6GA 3QEMB 4H7PA 4OMUA 3BXPA 1GZVA 1WHSB 3BIJA 3PF8A 1ICIA 4BJ6A 4EPRA 3EYAA 1SCNE 1GPJA 3LE8A 3IEVA 5IVDA 1FSGA 3THXB 2HK9A 3NJRA 1QBGA 2XVAA 1XJ0A 2H1HA 1ESEA 2GAFA 2PTGA 3VH3A 3ETEA 1F0KA 2D3TA 1URPA 2CXRA 1DX6A 3EIXA 3KTAA 5J3JA 2PUEA 2XJ9A 4ZCPA 2BOVA 4G9EA 2VHJA 5DGXA 5EIHA 2JIQA 1ULSA 4ONEA 5B1YA 1BDHA 3HCAA 2ZB3A 3IVRA 3JAKA 4KO1S 4JYPA 3LWBA 1UM9B 2OKGA 3QELA 1LLUA 4PG7A 2PSEA 1I6LA 5JD6A 3K0HA 5BVHA 4B80A 1G5HA 3PX3A 4JROA 2F43A 2F6RA 2IYQA 3GEIA 4Z4IA 3VHRA 2D7DA 3DZIA 2DBZA 3I9LA 1NYTA 4R3NA 5GONB 4F3TA 4KNVA 1KMNA 5KYKA 4IOLA 2YMMA 1Y3IA 3TB4A 3CVYA 3I6IA 1OCEA 1SXJB 2WU8A 2VQEB 2IV2X 3F6YA 4ERNA 2R8YA 4D9GA 5JAIA 2Z5FA 3B78A 1Z0IA 3MXOA 4C04A 1BXGB 3CLUD 3SQMA 3ETNA 5FJIA 3UUGA 4ASUD 1VL5A 3FDIA 4GSKA 4HAIA 4ARCA 4YX9A 4I4TF 3NALA 4X6UA 4YCSA 2Q3LA 5TIIA 5CB4F 1EP9A 5AQEA 4HD8A 5IASA 1KGSA 2CFCA 4JJKA 4HB3A 2AS0A 4RKYA 2JAHA 3RJ9A 4WZBA 1BH6A 3KQYA 4GI5A 5AOCA 3WBFA 1BQ3A 4ES6A 2ONYA 5TPWA 4YMVA 1V48A 4KDEA 4AMVA 3WK5A 5DNUA 4IIHA 4IHJF 1U6JA 1F2DA 3DG9A 4BGDA 5EIAA 1NVDA 2D1FA 3SLKA 3AR5A 3VX3A 4D3YA 5AW0A 5CDFE 1Y6FA 2JBAB 4DQXA 1Q3KA 1Q7TA 4NU8X 4TTIA 2OO5C 3AKEA 4BXOA 1AGRA 2AX4A 1V96A 3L8MA 4PAGA 3TDKA 1P5HA 1XZHA 3AHGA 4ZJYA 5EEGA 5LBUA 4XWKA 1UP4A 5A3VA 4RSMA 4XLTA 3MJEA 3V8NA 2XUGA 2FF7A 1T0HB 4HAVA 2PE5A 1KIFA 3FOFC 1E8NA 2WIBA 3ZZMA 1DBSA 5JCZA 3MC1A 3OQIB 2A9VA 3FPFA 1MDFA 2C4UA 4DMMA 1J8FA 2CMFA 2FXVA 4KIFA 1V6CA 1Q44A 1AKRA 5D8DA 4C3VA 1VPWA 1O8BA 8LDHA 3H65A 4I5EA 5B58T 2HNKA 2JLZA 2ZQZA 4HGYA 2E4AA 2WAAA 2Z30A 5LYJA 1HTBA 1QV9A 1P0CA 2GHRA 4XARA 3LDGA 3VYVA 3CZAA 1G59A 3GZJA 4C0KA 4I50F 4JLOA 1FTQA 1VPDA 1OKKD 5AI6A 3WOHA 2X4LA 4OQFA 1Z9BA 2FZCA 3AF6A 2DBVO 3F7TA 1RWWA 2BM1A 2VDWB 4EDFA 3IUSA 3LSYA 4ZYWA 3HNPA 4CLRB 4AMYA 1ZZEA 1XVVA 1BGWA 1MOSA 2XUJA 2ZRIA 3A28A 1WCYA 4PLGA 5KSPA 4FB5A 3KXPA 3E3MA 2JFPA 3U1VA 3PWSA 3GLHA 5TQ2B 4KXNA 4PIPA 3HBLA 3FPAA 2BDTA 2WHYA 3L79A 3YASA 5EIEA 4DF3A 1WSWA 2GCOB 2VDRB 1BKSB 5LOVA 5GV7A 5LQCA 2OHIA 3P2KA 2NVUB 2EX4A 3FG9A 3LCJA 3THYB 4K3VA 4FGWA 5EVJA 1EH5A 4FS3A 4OKIA 5HJ2A 3U7HB 4LF9B 5DOVA 2O2JA 1R5OA 4H7DA 4URXR 4NV1A 5AXBA 4YI3A 4F9TA 4HT3B 3RTEA 4DNPA 5FBWB 2R85A 4RTLA 1IM5A 1JIQA 4JI1B 2PZKA 1EDEA 1Z0KA 4UTOA 4NAVA 1DOAA 2P30A 4I4IA 1QF6A 1UBNA 1M3SA 1V4VA 4CQJA 2EIXA 3FBGA 2HWXA 2NO6A 1HEUA 2C98A 2XLCA 4BCBA 4PC1A 5L53A 2Q5OA 1UXGA 2X0IA 4JEIA 4FX2A 4ZTZB 3SZGA 4UTRA 2V98A 1UQTA 4R8MA 2QE7D 1BWPA 2DBRA 2V74B 1WM1A 5FV7A 2JAPA 4HQ6A 2L19A 1LGYA 5BW5A 3U4AA 1WY7A 1O57A 4Q03A 1E6WA 5THQA 1I3MA 3MQ2A 2VH2A 1Z35A 2PG3A 2Q3MA 4R6WA 5AVQA 4OMCA 1FVXA 1SAYA 1S2NA 3O8LA 3FWKA 4EB6A 2P8JA 3FLAA 3SAJA 2CBXA 4HG2A 3KSDO 5HKOA 3RRXA 3HP7A 3DE6X 3BBLA 3VR6D 1ML4A 4O2BB 1B74A 3HRIA 3MGKA 2IE0A 3GH3A 3THXA 5C5CA 1Y1LA 3GUHA 1WL8A 2DP4E 1QK4A 4XIIA 4BV3A 1TA0A 1YR7A 1Q1QA 1T5IA 1Z36A 1T6XA 2CDRA 3TMAA 2JCXA 1NR5A 4EABA 5KWEA 5EE0A 1ADFA 3OVMA 3Q41A 1GPYA 1DUVG 3M4NA 2IELA 3QXJA 3C97A 2ZZMA 5I7WA 3IB6A 1HO3A 3B9BA 4QHSA 3WQSB 3MAGA 3IA7A 3VI3B 1VL1A 4R01A 2FPRA 1G2OA 3NTXA 4X1IA 3W79A 2I3ZA 3I5YA 2H48A 3IILA 3QQPA 4FBGA 1K4MA 1ZC4A 2NT4A 4EZIA 3CHYA 4RH3A 1VLQA 2CFRA 2Y66A 3QYPA 3QEJA 4Y9DA 1G8HA 3FJ1A 3QWHA 4GX2A 4QUEA 5DLQC 1XD2B 2EFDB 5AVKA 4HK4A 1BKDR 3O83A 4B3RB 1CJUC 4H59A 3THSA 1H4VB 3WL6A 1CF4A 2AUNA 1B8UA 3NDIA 4QU8A 3SQLA 1JQ3A 2OZEA 3PHHA 5B57C 2J87A 2GWRA 3LUBA 1NBAA 1O95D 3RB8A 2D5IA 1JDBB 4RV4A 3WHLA 1RI3A 3EMKA 3IE0A 5AI0A 2I29A 3V8QA 1Q95A 3JQ7A 5DZSA 1G18A 4ESEA 3I61A 3F6PA 3N0RA 1GPBA 1FU4A 4PG8A 2ISQA 5JAMA 4EUEA 2VF5X 1L7BA 1P62B 5J40A 9LDTA 2D2IA 4RVGA 3P52A 5JLJA 1QH8A 2OZPA 2X8JA 4E5KA 1GRCA 1U6KA 3NHKA 3ER8A 4KMOA 4ZD6A 1SUPA 1FRVA 3SS8A 3A36A 3OTIA 3PL1A 5DCLA 2GN8A 2YNMC 4OQDA 5HIAA 2ZZNA 2D5LA 3VTFA 3ESRA 1QIEA 1R6AA 4L4ZA 4LJYA 3HADA 4O4JB 4CKEB 3PIIA 1ZN2A 1T9AA 3NRCA 2PY6A 3V7UA 4UEOA 1WPXA 3BHNA 2O8BA 3O8QB 4Y30A 2ADFA 1UBKS 1JPNA 2FKAA 3BL8A 3I28A 2GJ8A 1X7HA 3H5AA 3CX3A 2QTTA 3HNOA 1X7DA 3IAUA 1JG7A 1R4ZA 3L84A 4RZHA 2KYRA 5TX7A 2Q5IA 4KG7A 3UB3A 4EJMA 1PVOA 3AUXA 5FYQA 1KY5A 3KYJB 4LHXA 4TWRA 3U7JA 3ZEAA 1TT5B 1ESCA 1ST3A 3CUSA 5IC6A 5ESXA 3S0JA 2KBEA 1KNXA 2Q62A 1K92A 4U1RA 4B48A 2GD2A 2Z08A 5K0NA 4AJIA 1FY2A 5B55A 2Q3HA 3HEMA 5LP6F 4QWMA 3QTBA 2HNBA 3GLRA 1FDVA 2OEPA 2OAGA 3W9YA 4ND7A 4CIVA 3R7FA 2VDMB 2W2KA 1PJLA 5HA5A 3LP6A 4PPFA 4RH0A 4BFWA 4PC2A 1E7WA 3DNPA 3VO2A 4GNKA 2PKXA 2HJRA 1GZ4A 5ANRB 5K20A 2W58A 3U5ZB 3HBMA 4WNCA 1G9TA 1WBBA 5E7MA 1GAXA 2V7GA 1T5SA 1PFKA 3EPKA 1T5TA 1W75A 4EITA 2LDXA 2YASA 1A9PA 1US8A 3FX2A 3TW4A 5KOIA 3TWOA 4GF5A 2FEKA 3BM5A 3ZJYA 1HQKA 3JYQA 3WQQA 1NT4A 2AN9A 3DAFA 4RZ3A 1DTWB 1K8XB 3EZ7A 2I6GA 4JCOA 4ZEVA 4EVQA 4D1YA 5EXTA 4HBGA 4O3FA 5JJLA 4ALLA 3JRNA 3T3PB 1AC5A 4G4SP 5KOYA 3DVRX 3LGXA 1MV8A 4HNVA 4Z5XA 4TYWA 2A92A 1HLFA 3IEXA 4US0R 5DBOA 3DPUA 4WA8A 1KZGB 4F1JA 8MHTA 2V54A 4GKKB 2GD6A 4R7ZA 3ZOZA 2WT4A 3AESA 4J3NA 5K2MA 3RVRA 2EU8A 2Y76A 3MIIA 3PLAE 3GAAA 1J9EA 3TVTA 1W36B 3P9PA 3VX4A 3EZNA 4NRDA 4BASA 1U3VA 2PMWB 3LDAA 2Y05A 3IALA 1GN8A 3FBTA 3ZY6A 1GUFA 2W48A 4UE6A 4DCJA 1W6UA 4FDLA 2W6QA 1L8XA 3HXPA 4K8OA 1QGDA 1L7XA 2X2FA 5JEEA 1YL7A 4L74A 3ZGOA 4YCMA 1Q77A 3QH4A 5CFOA 1TEVA 3QXXA 1U8AA 3W3AA 1JHZA 2APJA 1NMSA 2FDXA 1WP9A 2MMCA 2QN7A 2VWQA 2XD4A 2D1TA 3DAYA 3HVJA 3ITDA 3LBHA 3NHWA 4RVOA 2ZB4A 5TV2A 5CT8A 5BNWA 5AK5A 1FFEA 1YKGA 4URYR 2X1HA 4QDZA 3CW8X 5IS2A 3LBYA 2ZBFA 1ODKA 5AHWA 1EVIA 2ID8A 6Q21A 2V4ZA 1I5OA 4RFSA 5ALVA 1PK8A 4BDTA 4N6GA 4KXYA 3FW1A 1E0KA 3MSCA 2QSYA 3BMXA 4CUZA 2BKEA 4IVPA 2P9GA 4JX8A 3IUPA 2GM4A 3F7NA 3HP4A 3TXXA 5I01A 1C30A 1M34B 4F72A 1JJIA 3DLCA 1W85A 3CH5A 1D03A 1P3JA 3EIUA 4AD8A 1SVOA 2VRWA 1JAXA 2WWYA 2AZTA 4FOSA 5IVHA 1JI3A 4CEHB 5EGSA 5J1TB 3DAHA 3ASUA 2ZCJA 3L92A 4JR2A 5FWDA 3V2IA 5T3YA 3ZXYA 1TCAA 2W8ZA 1AF4A 1IVNA 4C0SA 4IJUA 4MI6A 2C4HA 2WJGA 4JH0A 1P2VA 4CV1A 1IDN1 2C07A 1UPAA 4EKEA 3G0GA 2CL6X 1DT5A 2I2FA 3RUHA 3QU2A 1EVZA 2WTUA 5HKAA 1FZQA 3AQ4A 16PKA 3F0TA 2Y68A 4LMBA 5JWOA 2FWBA 1Z7GA 1IRIA 4M98A 1QUFA 2XKBA 3K8YA 4FLMA 1MD9A 4R5MA 3TQTA 5A5FA 1U0OC 1HE4A 1W0JD 3K32A 5LZ7A 1U0FA 2NPOA 2Z98A 3H99A 3Q0EA 4FLFA 4CT0A 3ES9A 1FSPA 2WK1A 3CRMA 3SN6A 2B92A 4LVNA 3PNQA 2IPNA 2BUAA 3GUCA 3DGEC 2QMOA 1QE3A 4W82A 2OV6A 3PQ7A 2Y1LA 1NG1A 4GLOA 3QPVA 3V7WA 4A0HA 2BFOA 3AM5A 1IZ8A 2M6KA 1QQBA 1YTUA 4MVJE 4Q9LA 3A11A 4YO8A 2MHCA 2QJTA 1PJ4A 5ALFA 1JRLA 1KJZA 1QIHA 1WCXA 2BGTA 2J09A 3KM0A 4PQGA 4EPYA 5CA0B 4R9NA 1RXCA 2ZJ2A 3TEJA 1B43A 3BWDD 4KKVA 5AJYA 1M5UA 4H7JA 1K1EA 1ZFNA 2JGEA 3MTDA 2J32A 1P72A 4N4AA 4XIJA 1AKYA 2DLDA 4EW3A 1NRWA 4BBZA 2NUTB 3BYZA 5IK2D 1RRVA 4NYMQ 1FLVA 2X13A 3DDNA 1BSVA 4HLQB 5JSHA 5G1PA 3QU9A 1MZPA 1RI5A 2FPKA 4INZA 4JFRA 4FGLA 3U3XA 2BISA 4NZYA 3HCWA 4HDCA 4ZRMA 3R9XB 1Y89A 4KOAA 1WLSA 2EAUA 3QVVA 4D4IA 3U37A 4BVBA 1FYDA 4OLFA 1KJIA 5JSZB 4YRBA 2X0JA 3HFJA 1SY7A 1U2PA 4LF6B 5K4HA 1MC5A 2R1TB 4UUPA 5LOVF 1P81A 3AUSA 3RBAA 4G1FA 3VU3A 1U0SY 3M6FA 4G1EB 3IQEA 4NPCA 2HWUA 3OFND 1WMFA 4EUSA 3CVVA 5AKJA 2Q8QA 3GEEA 4MMYB 5AXCA 1J2UA 2NU9A 4ZI5A 4EHIA 3RQSA 1DIRA 4UM9D 1XC7A 2FTKE 4IV5A 4MQ6A 1ZXBA 1Y63A 4YP0A 2NW6A 5FOWA 3U4CA 4HGNA 5F23A 4IKEA 4HF7A 3MRVA 4Q0MA 1WMBA 1DPFA 4PC7A 3I32A 2Z8ZA 5EIBD 5BQOA 2XEXA 4KQMA 3TF5A 1WOMA 1CZHA 2PV7A 1LPOA 1RZ3A 1UIMA 1ZGZA 3PUXA 3NVKI 3FCAA 1BX0A 1R50A 5ALPA 5D1HA 3NIBA 1XPOA 1LTHR 1U1FA 2QLTA 1KOFA 4G07A 4I8XA 1V45E 2IT1A 1Y6ZA 3WJ2A 4BNXA 1CF9A 1LW6E 3D5TA 1PW7A 3ETCA 2BSAA 2C29D 2GPNA 1Z6PA 2C99A 4G4JA 5BWCA 3SICE 2JFVA 5LLDA 4KQIA 3JARB 4U7PB 2PKQP 5GMOA 4FBLA 4MJLA 5CCDA 4DPLA 1Z6ZA 3CH4B 2ECPA 1B16A 1ZOIA 1Z68A 5ADHA 3ICCA 2MR6A 3QHQA 3JQAD 4WFJA 4UNSA 1LPMA 2EJBA 5ALJA 1PLKA 4C7XA 3L41A 3FNGA 2R6DA 3TRDA 1FP4B 2JGMA 1XGKA 2Q4DA 2XYGA 1A7AA 2YXLA 2D2EA 3ZDRA 2H5IA 5CA0A 3EGDA 4JWTA 1GILA 3EBPA 4B6SA 5JHHB 1KJJA 2ZWVA 1LWOA 1E94E 4IZOA 4PONA 3JQBA 3S99A 2O2HA 2H2AA 3C4QA 1WBJB 5K8TA 1IJKA 3F5QA 1G7TA 4LECA 5ARDA 3EMVA 3RS8A 1UBMS 3WRWA 2CXHA 5BN5A 2F8LA 2VP2A 3OZAA 4GHWA 5DMHA 3KSZO 5EMHA 2PUVA 2Y67A 1YCDA 3AF4A 5DNCA 3DCJA 1PGJA 4PZAA 3S8EA 2OBXA 5EZ6B 4NVRA 4I81A 4OL9A 1E3TA 3KT8A 4BBAA 5GJBA 2PX3A 2FRDC 1VGRA 2FJPA 1CZUA 4JKIA 4LVOA 1PTKA 2F1KA 2FEMA 4GPZA 4QPDA 5AQ1A 4HYEA 4DIOA 4DMLA 1I2MA 1E96A 2BDUA 1KS9A 1FNNA 4PRZA 2PU7A 5P21A 1F2UB 1JZSA 4A4DA 3NTOA 4TWBA 4AJNA 4YP5A 1GPMA 4ZQIA 2R751 1ZWKA 4QXRA 3QBDA 2J3LA 3F6BX 4PV7A 1RBYA 3ZIUA 1KI7A 1U7XA 4F97A 2XRMA 3H97A 3HZHA 3N2ZB 1RI4A 4FILA 1ZN7A 3PPWA 3TRFA 3ZV5A 5BVGB 3HWWA 4D0SA 4BU1A 2ZYWX 3KVVA 3LFUA 4FZ5A 1QHHB 1SXJA 4U63A 3X1ZA 3EAFA 2I3DA 4GX5A 1NXSA 2X1MA 4CYMA 1KQ3A 2P5TB 3DZDA 9MHTA 2JZNA 3MG9A 4QOEA 1PZGA 2CHEA 3VBCA 3D3WA 3S5JA 3PYXA 3HABA 1Z0DA 4RZQA 3C6KA 4DG5A 3D0OA 4O3MA 1AN9A 3GO4A 4UKDA 4ZRDA 4BAGA 2ZBUA 1N5JA 4RPLA 3HB0A 4CF3A 2QW8A 5FWYA 3P7MA 1IG0A 4TWIA 2A5JA 1P9OA 2ZTLA 1T35A 3UGKA 2CB9A 1EG7A 1SURA 1DKPA 2H18A 4FHZA 3WKAA 4ZC8A 4XD2A 1XNGA 4EB3A 1CKEA 3NHUA 1X87A 4TTQA 1G6HA 2WJHA 1M8PA 4FEGA 1KU0A 3NHPA 3ZLUA 5BSEA 4KQHA 4MPJA 4O1IA 3T9FA 1CRQA 4G8JA 3T99A 1PW5A 3G8DA 3ONEA 4BLOA 4XVCA 3BTOA 3P71T 4DMHA 2J5BA 1QRRA 4RGBA 4ZALA 3UJDA 2E18A 3HJRA 1TTPB 3TL3A 1TJ3A 4KR0A 4G1CA 1N6HA 3TR5A 1VXOA 3LYLA 4BVGA 1HNWB 1Q1NA 5CLHA 2FQQA 1N2GA 1L5WA 3G0IA 2EDCA 5F3DA 1HFJA 3G9ZA 4CKBB 1H0HA 1UC5B 2LZ0A 4IMPA 4JOQA 1KO4A 2XWSA 3OCUA 1X8XA 3FKQA 5LMNB 1LNQA 3OPQA 1SXQA 4AWXA 3SE7A 1YJXA 3F8WA 4CL2A 1H22A 2B35A 4ZWNA 3TOZA 4ARSA 1PNQA 4DWWA 1ADJA 1QFMA 2PKRA 4BN0A 4DSZA 3UMGA 5A1JA 5A3RA 3LQRA 1SVLA 4HMPA 3SS7X 1N0HA 2X1LA 4G2TA 5IBRA 2AYZA 1WXIA 2IYWA 7MHTA 4PC6A 2HDWA 4UFNA 3MJFA 3I0MA 3OE5A 3U5TA 3EXHA 3I3OA 3RVJA 3E5HA 1YI0A 2QP3A 3RFVA 2G6TA 1OXTA 4X8MA 4C4XA 1J8QA 1XZ8A 2YH2A 1T3HA 2IX9A 1T0IA 4PLZA 3MYRA 3AOEA 3ABOB 1IHDA 3B1ZA 1NDUA 3EOBI 4KUEA 1DIHA 4YXWA 2FYTA 3RTCA 1B0ZA 4IIBA 2AOWA 4DNQA 3K2BA 1ZU4A 3OX4A 4Z53A 1M33A 3H1BA 1XROA 1J6UA 4NBWA 4QUAA 4UHEA 3KPYA 1GGEA 2EEZA 2CK3D 3TNDA 1NW3A 4LVCA 4PNHA 5CTJA 4DLRA 4R0MA 1EQAA 2BN4A 3N0XA 4TRNA 3LW8A 4KLAA 4KACA 5EUBA 3K8ZA 3TNFA 1U7TA 1QP8A 4R9RA 2QN9A 3ORHA 4PANA 1ORVA 4KN9S 4P82A 2OSVA 1WZUA 3ZDXB 2I71A 2PXCA 2VYVD 4EJ6A 4FOTA 3IUNA 3NKLA 2O7NA 1A2OA 1N3YA 4CDGA 1VJ5A 5MN5A 4A26A 2OV3A 2HRRA 5EKSA 5IH3A 2RHRA 2E48A 2F67A 4HZUB 1JYEA 1S8OA 2H7XA 3DAPA 1ZUD1 3BFKA 3GFRA 4JBIA 3RSSA 5AVTA 1N9GB 1M67A 1PG2A 2QAIA 2OOKA 2CBGA 3C8DA 3E7DA 4AYXA 1QZUA 5LU9A 5DKFA 3SOZA 2VPIA 3D6FA 4LQLA 3GCWA 1Y6QA 3PEVA 3Q7SA 4U9IS 4WXPA 2F55A 1UM8A 2JGKA 3AUKA 5HUHA 3HCCA 4O4HB 1RWPA 4F3RA 5IC4A 1TZCA 1ZA1A 4PLFA 3UFBA 2O2IA 3HCEA 1BG6A 3I9V1 2DYKA 3KLBA 4KRXA 4BBJA 2ZIGA 4RCYA 1OWMA 3SR0A 5G1OA 4GSYA 4ZVVA 3T1VA 2E4YA 3HQ4O 2P4SA 4BUCA 2IYYA 1L5QA 1S1CA 4Z7QB 1CEEA 2J9RA 3K53A 4BNUA 4C76A 1UFQA 2CHGA 3G5LA 1KGDA 3MUNA 5EE1A 5EJAA 2AQKA 4OB6A 3ZVRA 4DQKA 1J09A 4EJ0A 4B7ZA 1E1KA 1M8KA 5JCXA 2IEBA 4KO4S 2ZAIA 3T7RA 1Y37A 1TNDA 1V8OA 1WKVA 5FOQA 4CR8A 5ILQA 1HZZC 4BYGA 4X66B 3TE7A 1EXDA 3ELYA 3JD4A 2WW8A 2BZ0A 3ND6A 1O96A 5F1YA 4FWTA 3Q15C 3K20A 3EUAA 3JAKB 1S6YA 4KREA 4HB2A 4MMZB 1TK2A 4UEJA 1IXKA 3SJUA 2XZOA 1W0KD 4H3KB 1M2FA 2Q5QA 3JTEA 1IQRA 1J0DA 3DV9A 5J4VA 1ZAYA 5HNKA 4EK9A 4B46A 3R9IA 2IYVA 4JASB 1M6EX 2V4UA 4OHUA 4QBKA 5T4EA 1GL9B 2ZYRA 3WRXA 2DXIA 3SC2B 5FADA 2DVMA 1D0SA 3RGGA 5ITZA 4K0KB 3EPHA 1V37A 4LDPA 3M9WA 1SKQA 2VOJA 1YIOA 1X1DA 2P1RA 5JZVA 2FZ4A 2H16A 2NWQA 1D6NA 3VSDA 1VG8A 4DIKA 2QZSA 4DC0A 1VYHA 3GBPA 1OR8A 3W8FA 3ADCA 2J6IA 4KIUA 3X2FA 4MCAA 1XI2A 2PSSA 1QNLA 2WJPA 1IH8A 3OIWA 4V39A 1QFZA 3V80A 1DC7A 1L7RA 3ROFA 1UT8A 2ZB2A 1AUXA 2CHFA 3EXIA 4RKQA 1JP7A 5KEIA 5FXMA 2P3QA 3IKMB 3M6WA 2CHVA 3TMYA 3FUUA 3K8QA 3KQKA 2ORWA 4Z2AA 1X38A 2FSHA 4ENWA 3C8UA 1V11A 1QLHA 2QVBA 2VL7A 4Y6RA 3KYCA 1QX4A 1X0VA 3LPDA 4OYYA 4C0HA 3NVAA 4EUNA 5CFNA 2M6SA 3IPYA 4ZZIA 1J25A 1RHKA 4QGGA 2C2BA 5CLQA 1IOVA 2NLOA 3BCHA 3JASB 3N7TA 4EB6B 1ZH0A 5CLJA 2VA9A 3ILVA 4A5OA 3LY5A 4HDNA 4LV8B 5HQ3A 1YVPA 2D1QA 1UBGA 4KXQA 4Q1AA 2HQOA 2I1WA 2AZ4A 1HKUA 3DO5A 3DLTA 4BXOB 2POCA 3IVMA 1VHQA 3S1AA 3INTA 4XWOA 1P9LA 1M74A 4JBGA 3PFCA 1B2RA 3RTAA 5KX5A 1JFTA 4GYWA 5JI2E 3AR9A 4DVJA 2IZOA 4O63O 1L7MA 1L5LA 2HPVA 4IFIA 5AW8A 3GG2A 1NDHA 4Q4AB 3GBSA 3RRBA 3VFDA 4UARA 2PT7A 4IJQA 1BD4A 1RCTE 2YYAA 4OUDB 4QDOA 3PVZA 3COVA 3O2SB 4R7GA 4XE5A 3ZWMA 3HXQA 1KPIA 3CLSC 4JJ7A 4L72A 1PTJC 4OKNA 2IP1A 2DHDA 2ZIAA 4TLBA 4WBXC 5FFFA 4CRWB 1FNBA 2NSHA 2OFWA 3FYCA 4IMJB 4S1WA 1Q1BA 1DJOA 5AOAA 3NEPX 5A6SB 2FSGA 4REQA 3LGSA 2W6ZA 1ZM7A 3QMVA 1W96A 2FZWA 3UBTA 2GEKA 3M4XA 3OPNA 4DZZA 4ZT3A 4L16A 4WCFC 5HS4A 2VP4A 3AWIA 5ITWA 4HATA 2IK8A 4J2HA 4L75A 1KAEA 2PO7A 2P62A 1T26A 1U2EA 2PRYA 4OOEA 5JMPA 5F98A 4A1OA 2OC4A 1QXSA 1XTQA 4ZVRA 2FPPB 5YASA 5M5BA 1II0A 3QX7A 1FFBA 1LKZA 1DAPA 3MFQA 1RTKA 4MW2A 1NF9A 1FE8A 1CNEA 1RXYA 4V24A 3C6QA 3PC7A 3VKVA 5BMVA 1L5GB 2GXQA 5KX5F 5FBQB 5HQTA 1V1JA 4JK3A 4UZEA 2C9OA 2JH9A 5DTJA 3GEMA 5GONA 4FZRA 3VPSA 4A0QA 1IEVA 2AC7A 3JQEA 4PGGA 4I6JA 3CRQA 2GPTA 1JA9A 5F5NA 4FPXA 3KZKA 1QVRA 4R0VA 1RAEA 3LUJA 1CP2A 3P5SA 4B6RA 1A1SA 3P0JA 3KKOA 1XQYA 1LPNA 2DUJA 5FPTA 3IPXA 2CXOA 2QJRA 5JT1A 1DFHA 4KMMA 4QUJA 5AM4A 2IUYA 4ZOLA 3S7ZA 2O5RA 1E4EA 3WDMA 5TQ0A 4UTVA 5L8VA 4BTLA 5AK4A 5HGXA 5L6LB 3BMCA 4PX9A 5EL0A 4Y98A 1U7UA 3H1EA 2JC3A 3G2HA 4F3CA 2F9MA 3GFTA 2ESRA 3GHYA 3BGOS 1FRZA 2DHRA 4MQ4A 1WW3A 3AHFA 2UVPA 4E7OA 3KQUA 4KMSA 2QMHA 5FH9A 1DAGA 2V7PA 4U6SA 4DLWA 5LQAA 2NTVA 3L0CA 3CF4A 5BSWA 2HUPA 5FB3A 3ORYA 3O47A 2RFLA 2WIGA 3WK8A 5L4SA 1MB9A 3THRA 3OESA 2I8LA 2JVJA 4C7MA 1SR8A 1JIXA 3KQPA 4CFYA 3LBIA 3SS9X 4H27A 3U81A 1R0SA 1AZWA 4G0XA 4L73A 2WA2A 2BHRA 3I42A 2N1BA 4MKFA 2PEYA 1JJAA 4GR5A 3UQZA 4EENA 4F85A 4F4CA 2Z2JA 4HVAA 1H9CA 1CR0A 1R4MB 3WKCA 1M2OA 1JXOA 5IAJA 3OIDA 3AOEC 3I05A 1NDQA 4WLOA 3RCBA 3ZS8A 1PFYA 1CUAA 1VHTA 3B6EA 3H5LA 1TF7A 2A0UA 3QVTA 5TARA 1SG6A 2ZTSA 5CJPA 4B6GA 5IWAB 1MABB 3SE0A 1UL1X 4WZAB 4Y0VA 1S2IA 2XPCA 3DMRA 5JNUA 2O20A 2WT9A 3KQNA 1TPZA 3PQ4A 4NCXA 3BWBA 5K3FA 2KLHA 2XMRA 3H2YA 4GKVA 1XZLA 3RIHA 3VAZA 3KOWA 1Y9DA 1QB8A 1LEHA 3PU6A 3E9YA 5KYXA 3GB9A 3RKSA 6ABPA 3CR8A 1UZAA 3TX6A 3ZDAA 3WLIA 5DX8A 4EG1A 4ILKA 1ONPA 2WKRA 4HGPA 4BVHA 1PSDA 1AA9A 3D1VA 3NHAA 1O94A 2B8JA 3L46A 4G3XA 3ZKWA 4JOSA 4JOBA 4DHWA 5KZMB 1NFQA 4CQMA 5CD9A 4KHZA 1L5RA 1GTJ1 4DQDA 5ES4B 3D3WB 2C88A 4N8EA 4PTYA 4WCFB 3V00A 2PGIA 4J1TC 2Q4TA 4GPIB 4PY2A 2QQEA 4N49A 4XVRA 3SBEA 1N5IA 2G1JA 2X9LA 2ZR0A 5TQVA 4E2FA 4IDGA 4DR4B 5JZOA 3D81A 3GP5A 4AP5A 2WWWA 2X6RA 5BN5B 2GNPA 5LQNA 5KNDA 2PXHA 4ZZ0A 4P5EA 4RY9A 4F04A 3WBKA 1MOQA 1VCHA 5FWAA 1YDHA 2WJYA 1XL0A 4ZYTA 2DETA 4IILA 1X8LA 2MJLA 2R8OA 4UU8A 3GJ6A 1RLOA 2F62A 2W6CX 3HRKA 3WLTA 1BHQ1 4XUGB 3G23A 4DDTA 1S4QA 2QM7A 3GJ4A 4O4HA 1ZD4A 2O6HA 3DQZA 4LGMA 4QOIA 5JJCA 2NADA 3EXAA 1JHAA 1LBHA 4K05A 4BKRA 1NBEA 1NOKA 3TPFA 4CTMA 1E1QA 1L3BA 2QGZA 2RJNA 3BX1A 1MPXA 1HQYE 1W94A 1NIJA 3AFNA 3UJCA 4Q1BA 1SZJG 4GLLA 5AKHA 3VNAA 3HU3A 3V9PA 3WMGA 4MYCA 2YY5A 2D1SA 2YJTD 4G1UC 1KBOA 2I55A 3DVLA 2IUTA 3IE2A 2XNKA 2PZJA 1JT9A 4JP3A 5BY2A 1V11B 2YVQA 3GT4A 2MR5A 3T7JA 1TT5A 4AICA 3LVRE 1AQUA 1Q0TA 2VDPB 2C31A 4G67A 1QE5A 4LGCA 4XFDA 3P26A 4YV2A 5JFTA 1CFZA 5KYYA 2GS9A 1I01A 3QUTA 1CC1S 1P4HA 5KUTA 2BM9A 4MPRA 3OE1A 4MUNA 4XIFA 1YB7A 4LF7B 4I1PA 2XBMA 2UZIR 3V4LA 3FBWA 5C51B 2FW1A 4RMHA 4B9AA 4YUYA 3HDQA 1QDUA 1U3DA 1TUGA 1LF0A 2D13A 3FSJX 3QK7A 1Q2XA 3FE2A 1XPUA 4YMWA 5BV2P 2E55A 4POAA 3C5EA 3OFJA 3VNSA 4KQ9A 3PHBE 4F12A 2NO4A 2QR2A 4F93B 1ZHHA 5DEIA 4OAOA 3T12A 4G8DA 1OW3B 1W581 2ZT5A 1QFXA 3LC1O 3MLAA 3O1IC 3R0XA 2XDYA 3M3HA 1YRBA 4A73A 3HUFA 3K70D 3PUYA 4LJSA 4B3DA 2RHJA 1J2YA 4D4KA 1Q0ZA 4D9KA 4JI0B 1VLVA 4C07A 2LXNA 5EZQA 3RF6A 4AMBA 3RC3A 1NM5C 1RABA 2I3AA 4K40A 3U4HA 4RHXA 3A10A 3AUYA 4YMSA 5A4DA 5SY4A 4W5RA 3ADDA 4XGNA 2OHJA 5A9SB 5BUSA 1WMEA 2XVXA 4DNXA 2EJVA 3RTGA 1T0BA 3M81A 3C6XA 5ALWA 3OY7A 3TLMA 3LCMA 4OK6A 4TL8A 1IXYA 3GDOA 1ZUNA 1KDYA 1FPMA 2FDRA 2PBFA 1GCOA 2HJVA 4P8RA 4AZ0B 2ZQYA 1PNTA 1ST2A 3WY9A 4EFDA 2R4TA 3BTVA 1JIIA 4ZAVA 2ONZA 5ECDA 4KOEC 4HRYA 4BRSA 3EZYA 3LDFA 3K9NA 3O4IA 4KFCA 2HQSA 3ER9A 2CZGA 1JN0A 3V8MA 4KAXA 1LLDA 1EP3B 2X3UA 3JSXA 3L1KA 3MRTA 4YRQA 3LRPA 3K2IA 3KLMX 4YGYA 1DAOA 3H17A 1ISHA 1I36A 2IWHA 2GBLC 4BEJA 4MTLA 1NULA 4Y2YA 1NTOA 1N5MA 2VDVE 7AT1A 2XMDA 2OV1A 3AH8A 3ZWVA 1NY6A 5T4HA 4D8WA 1RBQA 2HMTA 1LPSA 2EW2A 4YB8A 5B6IA 3TQOA 4LYDA 5JIBA 2HRZA 4X1YA 3DFZA 5IAEA 3KVOA 1LJUA 4AF7A 1VBNA 1MQSA 1D4AA 3ZLTA 1L5NA 3LHKA 1G4UR 2C0PA 5BV0A 1WIWA 4P86A 1JECA 2WF9A 3KQOA 4PRLA 4AO6A 1ZOOA 3LECA 1O03A 1BXRA 4C2TA 1J0XO 2C5SA 3CUYA 1MDBA 3EIHA 4KR9A 3WIDA 1UDRA 1Y1SA 3ZY5A 4BV9A 2E49A 2AB0A 4MQFB 1NBME 4AJKA 4NBTA 4N7JA 2XNJA 3K15A 2IITA 1E6CA 2OGSA 2WMOB 5EYPA 2R66A 3V9AA 3MTQA 3QLUA 4LX8A 4MX8A 2GK4A 4BO1A 3C4VA 1C30B 1M34A 2ETXA 4RHCA 1RMYA 3FHCB 5EJ4A 5H3CA 2GJKA 5EE5B 2RJOA 2DZDA 1CQWA 3QUSA 4D9EA 1N1DA 2QB5A 2XMPA 4HADA 2NZWA 2G71A 4OP2A 4TKVB 2H1LA 2L2QA 1XMOB 3WE7A 1JDBC 1OTHA 4ZVUA 2I0FA 3ZZ1A 5L3SA 2Y1EA 1HF3A 2Z5GA 4AT1A 3I39X 4QLOA 1XTPA 2VI5A 3QKRB 4JLWA 5TF0A 1WSAA 1YXMA 4D9NA 3GPLA 4RACA 3NEJA 1IFXA 4NNOA 3LX4A 2JGDB 3ENNA 1PQYA 3X43A 5IVKA 4K88A 4ZI7B 2ZUSA 5F21A 4YPVA 4WLEA 5FAXA 5IT0A 3FYUB 3O9MA 2UUPA 4HQNA 4HUQA 3R7WA 3D6NB 3ZX4A 1MX1A 3C2QA 4YAEA 1AGXA 4CU5A 3DSRA 3H5VA 2WPNA 3OO1A 3CNBA 3C8MA 1SXJD 3IA2A 5KDOA 4AKHA 1H8HD 3LTEA 1AKVA 4INAA 2A33A 5FL7D 1IY0A 1F06A 1R8XA 4AUMA 4W5QA 1KVTA 2PXAA 2VJLA 4GIBA 4KRYA 1XKLA 3DDSA 3HJNA 3IAEA 2H07A 5G2OA 2XXAA 3PRYA 1V0JA 1Z3IX 2G1KA 4RXUA 3RWMB 3U9SA 2IU4A 1RHUA 4BP9A 2W2KB 3HPQA 4MRRA 1C7ZA 3SM3A 1JG4A 2MOKA 1QGUA 3C43A 4IX1A 4X92A 5DYYA 1EP2B 3CA8A 4GD3Q 3H75A 4K9KA 3JARA 3UATA 1XRQA 2HSZA 5ENZA 1EX1A 3IR7A