1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Collagen-binding
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
5BV8A 1FNSA 1ZOOA 1M2VA 3EGXA 3RAGA 1DZIA 1SQ0A 3EGDB 1AO3A 5E6RB 1MF7A 2VDPB 2NUTA 3N2NA 1U8CB 1RRKA 4NEHB 1MJNA 4F1JA 2VDLB 1SHUX 5E6SA 5KYXA 1M1XB 1RS0A 2VDNB 1IJKA 2VDKB 4CN8A 2B2XA 3FCUB 1N9ZA 5KYXB 5HDBB 1JV2B 4DMUB 3TXAA 3IBSA 4HQKA 5E6UA 1FE8A 3HXQA 2XGGA 3F78A 3TW0A 1CQPA 3FCSB 5HJ2A 4C2BA 1IDOA 3VI4B 3EOBI 5LN1A 5KYWB 3PPYA 1TYEB 3EH2A 1AUQA 3TVYA 1RTKA 2X5NA 3EFOB 3EG9A 4JDUA 4G1EB 4NENB 5KYUA 3ZE2B 2VDMB 4A0QA 4C29A 3V4VB 1MQ8B 1M2VB 3EGXB 3TCXB 1T0PA 3EH1A 3PPXA 2NUTB 2IUEA 1BHO1 4M76B 4WK4B 3K72B 3ZE1B 1BHQ1 2VC2B 5E6SB 1L5GB 1SHTX 4IXDA 1XUOA 1IDN1 1V7PC 4MMZB 4F1KA 5E6UB 1JEQA 1MQ9A 3K6SA 1M1UA 1IJBA 1YVPA 1PCXA 3Q3GE 4IGIA 2ICAA 2VDOB 5KYNA 5HGJA 1XDGA 3BN3A 1U0OC 3NIDB 1JEYA 4WK0B 4UM9B 5KYYA 1LFAA 1ZOPA 4HQOA 3EG9B 4BJ3A 1JEYB 3NIGB 4UM9D 5KYUB 3ZQKA 2WW8A 4WFQA 1M10A 1OAKA 2VDQB 2ODPA 3M6FA 2NUPA 2I6SA 1QC5A 3HXOA 1PT6A 1N3YA 2QTVA 3GXBA 4IHKA 2XWJI 3F74A 3BQNB 1UEXC 1ZONA 1MQAA 4O02B 3IJEB 4WJKB 3HI6A 3PPVA 1JLMA 2VDRB 1NA5A 3ZDYB 1RD4A 3EGDA 1JEQB 3QA3E 5E6RA 2I91A 4CN9A 3K6SB 3T3MB 2ODQA 3ZDZB 5ES4B 1U0NA 4Z7QB 2M32A 4CNBA 4MMXB 1MHPA 5KYYB 2ADFA 3EOAI 1Q0PA 3V4PB 1AOXA 1DGQA 2WINI 1QCYA 4MMYB 3T3PB 3ZE0B 4Z7OB 3E2MA 4FX5A 4HQFA 1CK4A 4HQLA 4UM8B 3VI3B 3K71B 2NVOA 2I6QA 3ZDXB 4Z7NB 2XWBF 4WK2B 4XW2A 1XDDA 3NIFB 1ATZA 5KYWA 3PPWA 2O7NA 1YVRA 2NUPB 4G1MB 4HQNA 4C2AA 1QC5B 3BQMB 1PD1A 1M2OA 4PN7A 1PD0A 3EFOA 1T6BY 4NENA
chains in the Genus database with same CATH superfamily
1Z7WA 5ITSA 2PX8A 2DQSA 1GTZA 4AMGA 4JVMA 3DP9A 3DDWA 1E3IA 1NN5A 1GL9B 4POAA 3VFDA 2IS2A 2Q62A 2G9NA 5JANA 2HRQA 4JQZA 1CR4A 1O9BA 4LG1A 4F6CA 4OKNA 5K8CA 3KZNA 4IWYA 1NNI1 2OZKA 4KE6A 3WKBA 3BXOA 1HDEA 3ZIAA 3UG7A 3DXYA 2FEWB 3P52A 3V42A 2ODEA 3LPDA 4K46A 3OFND 4G5SA 1EA7A 2PWPA 1VPTA 5L4SA 2UU9B 2CD7A 4HH4A 2UUAB 4OHWA 1JMVA 3N59A 1XG5A 5CBPA 1FP4B 3FTFA 1Z4LA 3DAFA 4ZT6A 2OV4A 3A27A 1CUWA 1WSDA 1YZFA 2FW6A 4RY9A 2DGDA 2YS7A 5AT1A 4F1KA 4F6RA 4XPIB 5ENVA 2YWJA 4FMDB 4ZPJA 4F2HA 2AJDA 1F3OA 2W98A 1T5OA 2PD3A 5JYEA 3HKBB 4ZHQA 1IBLB 5FR1A 2XRZA 2C1XA 2N9UA 4RJ2A 2HPZA 2NWQA 1X9IA 3G89A 3LDFA 5ER9A 5HIJA 1CYDA 1SKYE 1OHHA 4WNAB 3RU3A 3DXXA 3DXFA 2Y1FA 3NP9A 1VBNA 1Z5ZA 2YDXA 3WNBA 4CF4A 4F97A 1TMGE 3AIMA 1KPIA 1XP8A 5DZSA 3WJ1A 1BDIA 3IVRA 3IP3A 4Q82A 4OQZA 4O4LB 3HL4A 4MICA 1ICEA 4JODA 4OMUA 4K9DA 4A9AA 2IU6A 3FDZA 4CF6A 1AHIA 7MHTA 1VJ5A 1EFRD 1XWWA 4GZMA 1E5VA 2N46A 3SZGA 2GEBA 3N0RA 1TKAA 1EESA 2IS6A 3LP5A 5FI1B 4AG6A 1V95A 1PWZA 4BJ1A 4Y1EA 4CQLA 7REQB 1E3JA 1JLLA 2DFPA 3BBLA 4UXHA 1JKIA 2XXAB 4FD3A 1A8SA 3VPDA 1ZR4A 2N47A 3ANXA 2HF2A 1Y9JA 5FBHA 1Q44A 4PBTA 1ISRA 3TBHA 2EKPA 3BRSA 2A92A 2ZYIA 4W1PA 3NC4A 2WIBA 3IUNA 1IOVA 4JJAA 4LRXA 4BIIA 2V7TA 3D3EA 4E31A 3ONWA 3RR2A 5A5VA 2E21A 3C6YA 4QUEA 1PVOA 1YK0A 5F64A 1GZ5A 4LYEA 4U39A 4UUOA 4QSHA 3RUFA 4JSYA 3PFNA 2W4QA 1XZEA 5H82A 3VUEA 1R74A 2G1JA 5C4IA 2ZB8A 2PSFA 2R6GA 2V6GA 3DL0A 2GHQA 4RJKA 1KZHA 4CT5A 4DEYA 2D8AA 3HYSA 2DR2A 1J49A 1PUIA 1WW2A 3D8NA 3BBPA 4YVFA 1WA5A 2FQXA 4IP0A 3UMFA 3AW9A 4NV3A 4CIDA 4EPXA 4URXR 2VCYA 4NHOA 1VKHA 3O8NA 3EVDA 4EG1A 1MX3A 2G36A 2RCNA 1IBMB 1Y5IA 4LWOA 4MGEA 3ZI4A 1GTL1 4OUDB 4W9NA 3LUDA 3PDUA 4HNSA 1GTRA 4ZT2A 2OB2A 5K3CA 3VMFA 1YL6A 1BKYA 2AB0A 1YL7A 3BULA 2QPLA 2EHJA 1GU1A 3UW1A 3SQNA 3QF7A 5F5XA 5LXTA 2I80A 1STOA 2IIPA 4TLMB 1QE5A 4WWHA 1QVVA 4CEHA 4Q9IA 1PG5A 1M3SA 3BQMB 5B53A 3DE6X 2Z98A 4CLEA 2FOXA 4K6HA 5DOZA 2R4QA 1NKTA 2FPMA 4AWAA 1CUEA 5LBIA 3HB1A 5JSZB 3DAHA 3GNQA 4I55A 3D1LA 3CNBA 3UWMA 2QTBA 1QDUA 1M34A 1SOUA 3C3MA 4XI9A 2GSDA 3NWPA 2HA5A 3RYFB 3DB2A 3PL5A 1RKQA 1JKFA 1DHTA 2KJQA 1W4BA 4DYHA 1S2GA 3KEOA 3QFRA 5AM5A 4EL5A 3SQWA 3GJZA 4B4VA 4KE7A 2D5BA 1EWKA 4HDAA 3U7IA 1CP2A 3GU3A 4FFDA 4FN5A 4EUHA 3DE0X 2VYVD 5TPZA 2YJZA 3CLTD 2BE9A 3IXMA 4G5YA 1KYYA 1SIWA 4GE3A 5CB8A 4CEJA 1ZSVA 5BSWA 1W96A 1CY8A 3C6ZA 3DT9A 3WYFA 4RKEA 1HDYA 5GOZA 4R9RA 2GM9A 2XKJE 3L8GA 3P9SA 3IQGX 5IP5A 2X5NA 3KG2A 3H5RA 5EL0A 4XYMA 4EGSA 4PE5B 1XAIA 3JW8A 4KO3S 5ALKA 1VFNA 4YP9A 2BHTA 1HQCA 1T2FA 1Z7BA 3IP6A 4DADA 5KTSA 4JJFA 3U7GA 5FPKA 3QPCA 4KXUA 1PS8A 1E0SA 1ZM4A 5TB5A 3M0EA 4B44A 2FVXA 4BO8A 2ODWA 5JSFA 5H8WA 2YCLA 3CWZA 4YUZA 1KVSA 4HAOA 4LBWA 1QHSA 3A36A 3IQWA 4IRXA 4G9GA 4L16A 1N5IA 2I34A 3E23A 1H1DA 4Y1GA 3PC8A 4MQLA 2BM8A 1A4XA 4JLMA 5JWHA 2R00C 1GUBA 2QA5A 1M9NA 1NNSA 4AJOA 1KYQA 1NJGA 4C7MA 1SCJA 3AI1A 5J58A 2XQKA 2QJTA 2I2WA 2H48A 3A1VA 1RTTA 1WUIS 4EHNA 1EM6A 3VU9B 2I7VA 2Z2YA 1P9OA 2JIRA 3VYUB 1TJPB 2C78A 4YCNA 4OQMA 3EPKA 4KQ2A 3RVLA 5FO0A 4EWLA 2G9ZA 3FWHA 2EGUA 3MT9A 3QXXA 1DKQA 1XAJA 4HJRA 5EWMA 2OQVA 1H0KA 4NYIQ 1L7NA 4V0OA 3B9BA 3RGGA 5CA1B 5IHPA 4M0CA 1SQ6A 3I9OA 4JX9A 3W34A 1QO0A 1VSTA 2VL7A 3ROMA 2ZYRA 3UGTA 1EFUA 5TF4A 2QTVA 4BKRA 5ANRB 4QNNA 5J63A 4B8YA 4RNDB 2VQFB 4QECA 3W3ZB 4JB8A 2BRUA 3U4MA 5GVSA 2XDWA 1L6RA 1A77A 4UMDA 3RT1A 5C34B 3AM1A 1VZ2A 4NATA 1QPGA 3H9QA 2JGAA 3L04A 3RIMA 3FBWA 2NU6B 2XCUA 1JU3A 1BMFA 3RU7A 2ZROA 3P8ZA 4MA0A 2OFPA 2OENG 3DMNA 2JHGA 4XARA 5GGYA 3D6HA 3GMSA 4GRDA 4Y2YA 2NVBA 1Q1QA 4AJIA 1U8XX 1XDSA 3EOAI 4ZA2A 5EIBD 4J8PA 2DPHA 5CLLA 3UH1A 1GSOA 1XQXA 1YH3A 3CMMA 2FCAA 2V58A 4BASA 3DVAA 4B85A 1HSZA 1HORA 2W71A 3VI3B 4WOPA 3BMXA 4KV7A 4Y3UA 3W5AA 5CLQA 4XDZA 3X43A 2F90A 1LPPA 2X86A 2H9AA 4IEIA 4UAUA 3RVDA 3QX7A 3CU5A 2PLRA 1XZNA 1T5TA 4ARCA 5FOVA 2Q8PA 1PFVA 3LO8A 3TOCA 2HZBA 1SB9A 2AGVA 3FR7A 5DNAA 4BV3A 3QU2A 3SC2B 1GYPA 1YGYA 5JY6A 3DL2A 1UKYA 2DBYA 2R87A 2V98A 2B78A 3AKYA 3ZUPA 1XCJA 2X13A 1PYGA 1LEHA 4JJ6A 3R0QA 4PYKA 4ABYA 4C6RA 5AW2A 4K5QA 2ZCVA 1T2VA 2E49A 3IEPA 1JE0A 2DC1A 3WK5A 5DLEA 1CY6A 4M38A 3GELA 2A5DA 3WL4A 4DZRA 2QAGA 4Q39A 1J5XA 4LYGA 4JP3A 2E4YA 3C5HA 1YIAA 4DSZA 3CV3A 1I24A 3CNQS 4YAIA 4AB1A 1WG8A 1RRVA 4QHTA 4OXQA 4OHXA 4R3UC 2WWHA 3VKWA 1LBSA 2NO6A 4HN4B 2IV7A 3KHTA 3GQVA 3D8RA 1Z33A 2ZIFA 4QPJC 3QTBA 5KVQA 2C96A 3DTNA 2A88A 2CCJA 4CCSA 3AIOA 4JNKA 1LUAA 1DPGA 4RZHA 1U7DA 1WZUA 1U5BB 1K92A 1YASA 2QP4A 3BXFA 3FIUA 3I8SA 3OMLA 5TQ0B 3IPLA 1K0UA 4Z2YA 5K8UA 4IIJB 2PWZA 4M55A 2DBVO 4C0WA 3ZE1B 3EISA 1EDZA 1FB5A 1SRRA 2H6EA 2Q1UA 3UMRA 2WJJA 2MSWA 2XYGA 3HFRA 3D0RA 3N87A 3G17A 4GP6A 4NU0A 2OTCA 1N4AA 5BN5B 1WCYA 2JHFA 2YJTD 1EVIA 3WLMA 2VJMA 2OLKA 4TKMA 2C97A 2IIBA 2VHUA 5I48A 1JA9A 1Z38A 3AMVA 5BW8A 3QELB 3UV7A 4KQXA 3HP4A 3QUCA 4D45A 1T9GS 4B47A 1X7XA 2H4FA 1KSFX 1FSPA 5BURA 3COZA 4DVJA 1R16A 4XVUA 3CR7A 4UHFA 4IF4A 4TVKA 1V7ZA 4X7RA 3DE1X 5EHZA 1ECJA 1W4AA 2XAAA 2OM2A 2BFDB 2BC9A 1AB5A 1AQYA 2DUMA 3UBTA 3PTZA 3KFLA 4QTXA 2D2IA 3JQ8B 4UULA 4OHBA 4UDOA 1R7RA 3GRPA 3RSCA 5TMEA 2DP4E 2ACKA 1QJ4A 3KDPA 4RLSA 4Y9DA 4YBZA 3B60A 3ENZA 1QRSA 2AC7A 2IYRA 3CX7A 4JIMA 3SS7X 3PGXA 1XXHE 4MRAA 2TMDA 2EWVA 3RB8A 1KSHA 1EX7A 4LBVA 1HA3A 1WZNA 1YA8A 2GAJA 4JXXA 4WLNA 2OBLA 4BQRA 1W35A 5MF6A 2VJBA 4AL4A 3IPAA 2Z4RA 3C3CA 1B73A 1SXHA 2EYUA 2IIVA 2WYWA 1I51A 1M74A 2QUHA 3M6AA 4M1KA 4O8ZA 4R8KA 1XPJA 1RXVA 4MI1A 4KVFA 2DQKA 3ZZ1A 2PTGA 2R48A 1SEPA 1W4CA 3GP3A 1CK4A 3PNMA 4KWCA 1GGVA 5CLHA 1GSHA 1WVIA 1ZUNB 3ANMA 3HJBA 5AOCA 2QY6A 4DT1A 5LSAA 3ZTTA 4P2GA 1TUGA 2DQ4A 3FUCA 4Q01A 2X6QA 1YGPA 2PUJA 2B99A 3TKAA 1GNVA 1C9MA 3ED1A 5JH7A 5K6RA 3Q2OA 4XLTA 4ENRA 4CHGA 4MIKA 5AMXA 5CB6A 1T5SA 1GZ6A 3KBBA 4FFSA 5IAKA 3HZOA 1ZA2A 2A4KA 4OATA 2QTWB 3LT4A 4KQ1A 4G8JA 3BILA 4PG7A 4Y30A 3I92A 2WU8A 3G2OA 1H2FA 4MJXA 2EC5A 2P9ZA 4Q02A 2CB0A 4MPJA 4V38A 4V3BA 2IX9A 1EZ4A 4S1VA 3TL2A 4A2QA 5IBCA 1SIOA 2GNOA 4LXQA 5J2UB 3LFHA 1SWWA 3P9PA 2BBTA 4BLPA 2JGJA 1JSZA 2P9JA 3GJTA 4A27A 3F4BA 1US8A 1WCIB 3CRNA 2CMKA 3D64A 3GPIA 4UXIA 2I2CA 3KP1A 1DRJA 1X9HA 3SDSA 5K05A 1FE8A 2HXYA 1APBA 2TSYB 1NOJA 1PHRA 2CNNA 3KHSA 3H4TA 3L0ZA 3O2JA 3N7TA 4R2JA 3T5MA 4CGZA 4L15A 4N7RA 2BEVB 3PTLA 4GWLA 1Z0JA 2GH1A 1WP4A 3I30X 3ZY5A 4LVCA 4EELA 3CMCO 3E0XA 2KB0A 2FF7A 5AQEA 1QWOA 5JYCA 3GT0A 3FI0A 1IK4A 2JZNA 3UTCA 5I9BA 4BO2A 5ITZA 2PUTA 2ZRMA 1BCSB 2QN6A 1Z5PA 2BL4A 1YJXA 4FEYA 2VS1A 1MQ8B 4PRZA 4YMIA 5EMNA 1W581 3TJMA 1T4GA 1Y63A 3CUTA 5KTYA 4LS3A 1NVXQ 2ZSJA 2A84A 4EB8A 1IIRA 1W29A 2AW3A 1UMKA 3ITEA 4EW1A 4A0FA 2LCFA 3EWSA 3T9BA 3UCXA 1NQOA 1HQDA 1JR3D 2ORED 4Q3AA 2E6UX 2IE0A 3WK8A 1Y9ZA 2A9RA 4MQFB 4W5QA 3HH8A 4HZUA 1VE9A 3U0BA 1XPOA 1JEQA 1SCDA 2BJHA 3ET4A 2GK3A 4PO9A 1TYCA 2HIMA 4QVIA 4ZMSA 4IFIA 4ZTBA 4ZVNA 1RWPA 2GPAA 2VDOB 4L2IB 5DWVA 5HGJA 1NT2A 1KI2A 1N8NA 1SCKA 5C1BA 5KNDA 2XZLA 1JR6A 1TUIA 2IUUA 3VZSA 3IDFA 4TTAA 2IYOA 4QUHA 4BB5A 3C43A 1U81A 2Q99A 4HB2A 3ZY6A 1M76A 3NBAA 1CUSA 1OAAA 4BOYA 5AM2A 5BVHB 4TWZA 4EUNA 3QSGA 1WCXA 3IUBA 4PWYA 4BP1A 1C0IA 4WZAE 3CF6R 1HTWA 3IRUA 3DBHB 3ZDBA 1JHOA 3CY6A 5A9SA 1Y6FA 4G36A 1XMVA 4GQIA 3RJTA 3TRKA 2O4UX 2PCLA 1AQUA 2P35A 2FH5B 3NAGA 3DGEC 3MZ0A 5MDHA 3VTZA 4BFWA 4DXDA 1F8YA 2IBTA 4UFPA 3NCHA 3EA5A 4I4IA 4DR2B 2OAP1 3IAEA 4Q9AA 3DYBA 1P0QA 1SCBA 3HGMA 3WX0A 3GPDG 2CSXA 2NUAB 1ABBA 5A03A 1B00A 2J7KA 2J0UB 1JBQA 4TYPA 4YAKA 4IIHA 2A7QA 1XDBA 2BTQA 3S5JA 2REXB 3EAFA 1L5SA 4UM8B 3O9ZA 3IOMA 4IHJA 2C7RA 3CCBA 1E9DA 2B8TA 3C5CA 1P17A 4P33A 1J2RA 3IVAA 3GN2A 4J2HA 4BO0A 5JVDA 1C3OA 1TF5A 1OI4A 4RE6A 2FEMA 4RPJA 2NG1A 1EEHA 3GAAA 3H6GA 5KJ1A 5A0TA 1N3IA 2YJ6A 3FF4A 4RMHA 3BORA 1R9NA 5LZ7A 4UNNA 2GBIA 4JQCA 3GDWA 4Z86A 2PNFA 2RHCA 3TM4A 4KHPB 2XHEA 2E2WA 3GHHA 1KI6A 1OSNA 3QW2A 4NYJR 3TIIA 2OHVA 4BO5A 4YONB 2XCQA 2I78A 3ZY3A 5E0OA 4EFMA 1E9SA 2QL6A 5DLPA 4U2BA 4BIMA 4MIOA 3RHZA 4JOCA 4XWOA 1A9XB 1NXXA 3BAZA 3DV9A 2B2XA 3F67A 1RYYA 3KC2A 3NTLA 4HN9A 4K6CA 4GMDA 4PXSA 1Z88A 2V7UA 3L6BA 3UFXB 3O1JC 1KFEB 5AHOA 1UM9A 1TCUA 2DQYA 1AGXA 3IHTA 4LZZA 2VEOA 4OGGA 3K7EA 4P3YA 3RSHA 1BE8A 3OO0A 1C30A 3I5XA 1Y8ZA 3CLSD 4F3YA 4JS0A 1OX5A 4Z0HO 4IHAA 3WK4A 2PZLA 4NCNA 3ZJ4A 4OU5A 1ZI8A 5JNWA 2I1VB 1U94A 3N74A 3QUTA 4ZALA 1JE1A 4RIGA 2XYQA 2RGEA 3THOA 3ZIUA 4XGNA 4EB3A 4FU0A 1YB6A 4PLTA 4Q00A 2RGUA 4FHCA 2NU8B 1E59A 1IG0A 2H31A 2GYVA 3CINA 3KFVA 3OZGA 1GGJA 4N0PA 4WVFA 5D85A 5FADA 4DIUA 5CFNA 3AUKA 3HFGA 4EF5A 3I6BA 1C9JA 2O5RA 1GKYA 3H0KA 1B8UA 1PNVA 1VECA 3PUKA 5E8JA 1BWRA 1AT1A 3JAKA 3FPCA 1MQ9A 4X20A 2WSMA 3IE1A 2Q5LA 2ZJFA 3IHKA 3GJSA 4UBNA 4HS9A 4RJTA 3ZU4A 4HTFA 3S55A 2QM3A 3RS7A 3R3SA 4WXPA 1PJ3A 2O2DA 4KQHA 4CL3A 5HGXA 2XMCA 2JBHA 3V8MA 5JSQA 4DR4B 5AKZA 1Y33E 1JLRA 1Q77A 1R64A 2H8GA 3QI2A 3C8ZA 2QI9C 4YJHA 3UWDA 4MQUA 3IO3A 5COQA 1UJ2A 3T3DA 4OV6B 2W58A 1IYZA 3OT1B 2NZUG 5KHOC 5JU6A 3QPAA 3M49A 3KQVA 1JXOA 3P4UA 1CJVC 1ST2A 3HRHA 1JECA 2G9QA 4OXXA 3PXAA 3TPCA 1KAMA 2P1ZA 2DETA 4WJKB 5FJIA 2O8CA 2XGJA 2YJNA 4KN6A 1R27A 5FTJA 4X95A 1NG1A 3E3NA 4C7BA 3Q6NA 2NVUA 1ECBA 1IY8A 1NVVQ 2R65A 2WHYA 1MO6A 5EYPB 4DSTA 1G7RA 3HKCB 3UTDA 1VCIA 1X13A 2BFCB 4DA8A 4Z7QB 5I4BA 5IN5A 2DH5A 2MHCA 4UUNA 4DTCA 3UMGA 2H0QA 3UC9A 4EW2A 5AVRA 2GTIA 2NNLD 1WQ3A 2GAIA 4PX5A 4TL7A 3M6XA 3MS4A 5DBIA 1KKMA 4ES6A 5G40A 2RBGA 2ZPUA 1NXTA 2YXDA 4QPPA 5BRJA 1JH9A 1KL7A 2I6TA 3NRJA 4LXUA 4X1YA 4CHTA 1Z2DA 5CDUA 3TI9A 4Y8VA 3N2YA 3GGPA 4NEQA 3W2FA 2AOTB 2YFHA 3A1WA 4ND4A 4R54A 1E2PA 1QHXA 4M0KA 4QUJA 1RLMA 3RFFA 1T2UA 2GWRA 1XOIA 2NACA 4Q9LA 3SQXA 4BMCA 2OESA 3D3JA 1E2FA 2OORC 3DMDA 3NHSA 1Q11A 3LNTA 1DZ3A 4HUJA 1IU9A 5AHWA 3UJ9A 4YMWA 4MSUA 3OKPA 2X8AA 4MTCA 1W49A 1QOQB 3GN1A 4LXYA 4TV8A 2ST1A 2DWCA 4TLBA 3RT9A 3GCWA 1XE3A 3EXG1 3H1PA 1RHKA 3D4BA 4G5FA 5H3HA 4KO2S 4RK5A 4CM1A 4Z4CA 3OJLA 5JC8A 5CCBA 3VHRA 4GO1A 1M7HA 3ZW7A 2ZTSA 3I9LA 1IPFA 3BXEA 3RS4A 4G0QA 5J59A 4MLCA 5CM2Z 4JLJA 1B0UA 4DMRA 4AO6A 1UK8A 4GYYA 5JG7A 1V7QA 4MWSA 4D8TA 3B20A 4MUIA 1NFQA 2WT8A 3FA2A 4GOLD 4MRRA 1J8VA 3B1XA 3RGWS 3ZWXA 3EEFA 4KAXA 3NDJA 5IBPA 4BATA 4DM7A 1AJEA 1N2OA 1T6YA 1FLDA 4QFBA 2Y77A 1S5PA 3JQRA 4A0QA 2GTHA 2X4DA 1XA3A 1OROA 2X9NA 2H3EA 3P2JA 3GVPA 4YP1A 3SVLA 2A57A 1KJJA 3OQ1A 4JMLA 1JPNA 2GDZA 4ZQIA 4L5IA 1E5XA 5AVWA 1X7ZB 2IHBA 3WQRA 1L8XA 2XBUA 3K2QA 2SKCA 3DO6A 1S3SA 3IP7A 5CD1A 1YJQA 3C24A 2MSLA 1ISMA 3KEMA 3OZFA 5AK0A 4R83A 3OZIA 1UXOA 1XCPA 2SICE 1UIRA 5AOAA 1M54A 1N1GA 3N53A 3HYNA 3L7NA 3T38A 2VDWB 4B43A 1ICIA 3WRVA 1VIVA 3VAYA 4IKPA 2NO0A 2MMCA 2ARKA 3DDCA 4DBVO 4E07A 1B6GA 2GKOA 4K6MA 3VDMA 5A4MS 1F7VA 4EEXA 2ZTVA 4H0NA 3H5VA 2FPWA 1VYHA 3G7SA 1KEUA 2ZE7A 1TZCA 4ESVA 5B7NA 1XVUA 1XTTA 3GLSA 1O6CA 1WP9A 3AR4A 4MVJE 4B6FA 4LZOA 3RK1A 5FFMA 1ZVQA 4NFYA 4UNRA 2A0UA 4ZI3A 4TV9A 3GK3A 4EKGA 2QWXA 4HVAA 3KLMX 3B13B 1QC5A 1HTBA 4JYMA 1AD2A 1RYZA 2IPLA 2W4MA 4AJKA 2IXDA 1VPEA 1H2AS 1MNQA 4NZPA 5CT9A 2A9OA 2VTKA 4JJ8A 3VPXA 2W4IA 2R2GA 1ODSA 1TJ3A 1RJEA 3PRKE 4PAGA 2J0VA 4HLUC 2PL9A 3F46A 4LVOA 4WLUA 1FNDA 1Z6TA 3H86A 1V96A 1ZK3A 1ZICA 2QTFA 1VSUA 3K1ZA 3PNYA 4ND2A 1JIUA 3L6OO 1ZMOA 3AFIA 3PU6A 1GXSA 3MTEA 4PLCA 1ZCFA 5KQGA 2CDNA 2OHIA 2PM8A 5DHRA 1N0UA 2MSDB 4BLTA 1RR6A 2AN5A 2R84A 2W70A 2XMDA 4V0SA 5FAKA 4A2CA 1NN3A 3KAJA 1ELOA 3IUQA 3ZWOA 5HZMA 1I1NA 2XE4A 1DRUA 2CDRA 1EUCA 4MIEA 2CNWD 4FT2A 3NIWA 2IZOA 2X1VA 4K40A 2IZ7A 4HVLA 2ZYGA 1N33B 4MB6A 5HFAA 2QDXA 4G85A 3DW3X 2V4UA 5FWDA 3VNSA 5KB3A 1Y82A 1LBEA 1IWOA 3LBHA 2X3YA 2JJMA 4PHCA 3QK7A 1G2IA 1U6IA 1KAEA 3ZWKA 1JUDA 4Q1BA 2WM2A 3UJBA 2O6HA 4DV7B 2C83A 5B5SA 1F0PA 2OECA 3RTCA 3UJPA 5U1PA 2YFQA 3GLHA 1V3QE 3OEWA 1Q1ZA 5E4JA 4RD4A 5J1TB 3VSEA 3VISA 5AFSA 1O94C 3K1YA 3T5BA 3WRXC 4DC1A 2HDWA 3R23A 4HMQA 1JW9B 1XJWA 1I6KA 2IVFA 4J16A 4MR7B 2CLKB 3SYKA 4DLBA 5IT9A 5EWJB 1G5IA 2VSQA 2WFLB 2GCOA 3FCYA 3Q12A 5E4FA 2QT0A 2UV8A 4M1EA 2H59A 4MUYA 4QGBA 3VSAA 2HHCA 2I1LA 4YH1A 1ENYA 4J76A 1NRJB 5HJ2A 2X4GA 1DMRA 2UUCB 3KYJB 2ZPAA 2R1TA 1Q50A 3IOEA 4MITA 4YC7A 3WDSA 5K8LA 1XKQA 2MTBA 3T0IA 3PK0A 1AKTA 4DQDA 4EKNB 4C7JA 3NO4A 4EJSA 1TTQB 3WJAA 4GR9A 3ZUGA 5AXCA 5IARA 3FCOA 1QGUB 4RD6A 1P44A 4C4OA 4UASA 4OI0A 3DPSA 1XTSA 1Z45A 1UP6A 1BHO1 4K2AA 5E9WA 1SXJE 3UC5A 3JQEA 2NPIA 3QWFA 4QL3A 1ZIDA 3LZCA 4V1CA 4ZYLA 1WUJS 1JF8A 4LK3A 4LYYA 5FEMA 2H1RA 5T8KC 3DAGA 4C4YA 1A04A 5CCDA 3VGJA 4K9PA 4PSCA 1GQ2A 3O8BA 4IEFB 1UBUS 3L7OA 1HKUA 3I9FA 2HMSA 1BX0A 2LCQA 3YASA 3CE9A 1R2QA 4IDHA 3B5EA 1OH8A 5TXGA 4NAUA 3AKZA 3TDMA 2ICAA 2RKWA 3G2MA 3ROGA 2F3TA 5ALOA 5AOVA 2GXSA 1SURA 2R751 2NV0A 4G84A 2GRJA 1LFAA 4YRRA 4JASB 4V0QA 5B4VA 1UBNA 1IUNA 1QM5A 1L1FA 2VP4A 5LP1A 3E9CA 3W9UA 4ESHA 5A4DA 3ABIA 3M6MD 2RC6A 4OHVA 3OTHA 2Z2KA 3I28A 4L76A 3CSSA 4B6QA 2ZIWB 1JEAA 5DNWA 1Y1RA 5D87A 1PW7A 2A9KA 2R6FA 3I42A 3OC0A 3WQSB 1HE4A 2Q7DA 1G1MA 1MGOA 4HYEA 1M1NB 1UADA 2C92A 1PHPA 2JIMA 4PVCA 1N9GA 1FSFA 1Q22A 4MEJA 3L2OB 1FYWA 4C1BA 5HRCA 2EW2A 3V2UA 2Z09A 4QPZA 1J39A 3GJ0A 3QP9A 4WKBA 1Q1AA 2QG4A 3OPNA 4ZDWA 3AVVA 4C7OB 4RFSB 5BW6B 5TJHA 2AKAB 1Z22A 3IR6A 5JRDS 1C0KA 3HB5X 2B2CA 2A0YA 1DADA 1J09A 1J6UA 2ECKA 2IYQA 2IU0A 3VZRA 5EC8A 1S6YA 3MLAA 4F3NA 4FX5A 3HCWA 3DL7A 1A9ZA 1N5DA 1TM1E 2H17A 4J6EA 3VC3A 3PE6A 2OC9A 3LIIA 1EUDB 4OHOA 3E8XA 3PPWA 2DSNA 3OPYA 1T0IA 2O7NA 3AOEC 1EVQA 4PR3A 4UFNA 5LXTF 3TRJA 4F8YA 1QGDA 4PGHA 3MUFA 1EVKA 3EBLA 4F5WA 2UUBB 1C4OA 4D92A 3CTPA 2EQ5A 2QK4A 3WNCA 2QE6A 1CZLA 1NYQA 5CYPA 5EE9A 6REQA 2AR0A 2C2WA 2NSHA 4JKYA 3FAKA 2AUTA 2C03A 2ZSAA 4QBIA 4C22A 2IZ5A 1AUXA 1WQ1R 1YKGA 2O1WA 3F49S 4I55F 2I4RA 5I9IA 2FN9A 1TUBA 1P1BA 1NVKA 1XTJA 1CZRA 3OEHD 4GRAA 4QYXA 1GFSA 5IUJC 3TD9A 1Z4JA 1TLTA 2C2YA 4V2UA 1QUEA 2AYXA 1M8FA 3CZ5A 1Q2XA 4M1QA 3OZ7A 3DEYX 4YT5A 1Q0QA 4LC9A 2VHTA 3DFUA 3FOFC 3DP7A 1FYDA 1FRQA 2QYTA 3IOCA 1Z2CA 1R6VA 1WNTA 3M6IA 1ND6A 2P9BA 2PSHA 3H5TA 5BSRA 4R81A 3SJBA 4I4CA 3T7SA 4X7MA 2PEYA 5IT0A 1UH5A 2B6NA 4IH1A 4BZXA 1AVTA 2HMYB 2W8BA 2JGEA 2WC1A 4YJ2A 1Z47A 3A2NA 3UJCA 4DGQA 1N5KA 2ADOA 3OOEA 2VAXA 3DEAA 3F98A 4IL5A 2R6R1 4Q7KA 4DG8A 4YMUA 2C7OA 4J7CA 2J3JA 3WYEA 3PXCX 2QR5A 5LBUA 3ZCQA 1WY5A 4LFAB 3I2HA 4BQIA 2C9YA 2MYUA 5F73A 1KQPA 4FGKA 4MKZA 1JTVA 2WHEA 3N39C 1Q7CA 4L07A 2O7RA 3P97A 2HI0A 2WDPA 1HDXA 1XLWA 1FTYA 1WXHA 1LLFA 2JARA 2HLHA 2BIFA 3N8IA 4ID3A 1W8IA 1FDSA 1U02A 2IKSA 5E7QA 2IEBA 4TVOA 5I7OA 2TYSB 2UKDA 1LY1A 5BXYA 3CEJA 3FB1A 3BK1A 2ZGVA 4N40A 1CWUA 1A2BA 3FPGA 4KKXB 3OUTA 2G1PA 1HMPA 4TQAA 4FYHA 4HQOA 4EQ6B 5BUQA 5K03A 3PLRA 4EMUA 3FYDA 1JKJA 1NU6A 3RNOA 1ZJ4A 1VE7A 3K6KA 5JWOA 4R9SA 1G8PA 4G5GA 3NBMA 1Q0UA 3INRA 4IJMA 1ZRNA 3AINA 4ZTUB 1KAGA 2GJSA 4EW6A 1N8KA 3SQMA 1E2MA 1UEXC 2VR1A 2PRIA 4IVPA 2XUFA 5KYYA 3Q5DA 2RB5A 1NJFA 1THZA 1XR3A 4P31A 4BNTA 4WQMA 2FG5A 2I6FA 4DANA 4DJTA 4F06A 2GTPA 4FYYA 2PBZA 3K9WA 2ZSEA 4FI3F 5FWNA 2COEA 1PS9A 4CN9A 4RK4A 1GU7A 4Q93A 4HWOA 3ECAA 3BSSA 3LBAA 2ZJ7A 3VZCA 5F52A 2W6NA 5DLYA 1F2VA 3P96A 3PQ6A 3S27A 5KINB 4G5OA 2QDKA 2QVLA 1DIHA 3NJ8A 2BDTA 1T1GA 2Q4EA 4E4RA 4KNYA 1CRLA 1WDKA 4LVUA 4RPHA 1WV0A 3THRA 3DLTA 4P08A 4C3ZA 1FP6A 4MI9A 4PSKA 2IITA 3V6LA 5CIYA 3RF7A 5CFQA 3SXPA 2ODAA 4WOCA 4HQ6A 4FR0A 4NX2A 3LV8A 3WL8A 3ZWYA 1Y4UA 2FN7A 2OMEA 1TAGA 2RH5A 3L4BA 1F2TA 2C9BA 4OBEA 4NZ9A 1ANKA 5TQ2A 2IUSA 4J0CA 4NICA 4QYTA 1M72A 1YFZA 1UMCA 1ZR2A 5C5IA 2NQ8A 4JP1A 4UBJA 3U39A 4QJ5A 3DOFA 3F7OA 3HBMA 4PVDA 4D4KA 1CEEA 2DCUA 4JUAA 4KODA 4D81A 4BV2A 3AVTA 1TU3A 5JZ9A 3VU0A 2AF4C 2PVPA 1E3WB 2JAXA 4HOYA 3OQIB 1X7DA 4Y7DA 4YDQA 4HNRA 4KWTA 3D6TB 3ZU6A 4W63A 2UYHA 2ZBVA 3DVRX 1SFRA 3D6JA 3G5MA 1RPTA 1R6XA 3TXYA 3CX4A 3QPVA 4YRBA 1NLMA 3RJ9A 5LZ8A 4LXTA 5DYYA 3WHPA 2ECOA 1QZXA 3WLIA 4D8VA 3HWWA 1EWVA 2YNMC 4PSVA 3UGKA 4QVKA 2X8JB 4E5MA 5A9RA 1B7GO 4Z3DA 1Z37A 1LSUA 1MA0A 2E5FA 2ABWA 1OOEA 4K9KA 4RENA 2I5PO 4B5LA 2O1EA 3DUFB 3O4FA 2YIJA 3PCXA 1QH9A 2IF2A 2ZBDA 3LH5A 1XRSB 2B82A 2FQWA 2CMFA 3NTOA 4CKYA 4WN9A 4KKVA 4JJ7A 5T7BA 4L0CA 2ODNA 2XA9A 2QZ9A 2JAQA 5LOVF 3FPAA 4BGDA 2XXBA 5T5QA 5A05A 5HKKD 5MN5A 4ZDJA 1MJ5A 1L5HA 1VTKA 4PCVA 4L0MA 4CG0A 2IWHA 4MJLA 3QVOA 1DWUA 1LPNA 4N39A 5FKJA 1EVYA 4MGZR 2PUFA 2O8NA 2V9CA 1MH1A 1C8BA 4LRWA 4PNEA 1WB5A 2PWAA 2NGRA 1HNZB 2B9EA 2Z3ZA 3OHSX 3PFCA 3B51X 1PF7E 5LQKA 1BW9B 5AJUA 2CE2X 1WMEA 2D7DA 1EK2A 1UXIA 1YCDA 3X1DA 5LVAA 4RYDA 1U2RA 4Q19A 4Z4HA 3O93A 1MX9A 1HO3A 2CXRA 2GXUA 1AZWA 1LPOA 2WV9A 4PZUA 2DZDA 3EXEB 4QPNA 2ZSHA 4ZOAA 4AY6A 1UJBA 1GPAA 2BR4A 3ASYA 2X76A 3EZGA 3H3XA 1P73A 1XO1A 4FJ2A 4IUYA 4ILEA 4F11A 1ZNWA 4JQOA 1WCWA 4BVEA 5CB4A 3H1AA 1ZW1A 3T5TA 4DLZA 1X3SA 1QHIA 3TIVA 2PUWA 2V54A 3L7BA 4JI3B 3ZHBA 4J1SA 1S7GA 1HXHA 4NC9A 2JAPA 1XL0A 3HE3A 4QD3A 3ZYCA 2AQKA 2QMUA 2AOXA 1VXOA 1H65A 4EG7A 5IWAB 1R15A 2FSFA 2XITA 3VH2A 4E4TA 1TQ4A 2FKAA 4GKBA 3TLGB 5I3CA 1GNTA 2WI8A 2AOUB 4Y6GB 4J94A 4MXDA 1XNQB 3BWMA 4XR4A 3FOCA 5KVVA 1B3BA 3AETA 1XP5A 2VUUA 3AFHA 3BTSA 1EVJA 1FZQA 2C42A 5DYGA 3RFTA 4ROSA 4CV1A 3S1LA 3W5UA 2CN1A 3DJYA 1KEEA 1WPQA 3GJ5A 3L7AA 1H2ZA 1TEXA 2NTJA 1O54A 2W0SA 3LWBA 1MFPA 3DW1X 4QAQA 4BUCA 1ZN8A 1UQRA 1YR9A 1CJKC 1WKBA 5EIXA 3WMGA 3U3JA 3FOZA 2JJYA 5L7YA 3X1YA 4RS4A 2C2BA 3IP8A 4KN9S 4I4TB 3FPEA 3ROFA 3UOAB 3PFKA 4M1OA 1NI4B 1JQAA 3V4FA 2I3BA 3HNPA 4YQEA 2WU1A 5JH7F 1IRIA 2RH9B 3O03A 5LB2A 1XZMA 1K63A 1PQ4A 3DONA 3DXZA 2PQ6A 2OYRA 3KQKA 3TZCA 4QGSA 4MVJI 1LK7A 2W90A 3GDFA 3IUSA 4JLKA 1AUPA 4Z9YA 4OL0A 1H85A 2OFXA 2CFTA 2P41A 3HYCA 5EIEA 3CGGA 5DKFA 3ZVKA 2WKSA 6ADHA 3QYJA 1W6RA 3QUQA 4F0JA 1O57A 4ML3A 4ZVMA 2AG6A 2JVKA 4BNZA 3PQ2A 4Q66C 4LJ8A 3OJCA 1W0KA 3RADC 4TMKA 5CDGA 1JB9A 3FCXA 3L6DA 1CLUA 4LCJA 4EG8A 2ZUDA 4OYYA 5CM9C 4K26A 5AI0A 3RTDA 1O4VA 3GJRA 4LN1A 1X38A 3Q3JB 5IBQA 1SUDA 4PPFA 3R6DA 4X8LA 4E51A 5JZMA 1C3VA 4GIBA 1I80A 1XMSA 2RGYA 4TTVA 5FRDA 4DJFC 4PGMA 2KLHA 2LXNA 4Q4AA 5B4UA 3REOA 3GLIB 2LV8A 4MI6A 4UD6A 4CMJA 1A5BB 2V7BA 1LKZA 1MZVA 1X1TA 4XQCA 2M1ZA 1N5RA 2DTXA 3Q11A 3ZGNA 1GVHA 4MCHA 4RFVA 4DWOA 1QR2A 1VLZA 3SDBA 3UUFA 2FEOA 4Y2UA 2G04A 1B23P 2ZANA 1NGSA 3GDHA 4PX9A 2VUIB 3T7IA 1FFXA 1SXJC 2B8NA 3KD2A 3VQTA 5I7EA 1A2OA 3OPXA 4L78A 4XOIA 4AG3A 5H83A 3INGA 1DSSG 1AZTA 3L1UA 3MWKA 1PZXA 3K4HA 3O1IC 4LSMA 5EKUA 4I3HA 3DC2A 5NLLA 4RL4A 4O25A 5L6LB 3CLRC 4OLJA 1YA4A 3WLOA 3MTIA 1VHTA 3CVOA 3DLIA 4G0YA 1A72A 3BICA 4UVIA 3I9KA 1KPHA 1UM8A 3QHQA 3Q7RA 4MQ6A 4DR7B 3RTGA 4X63A 2QM7A 3NIDB 4ZT4A 3J81A 2ZAYA 2RGDA 1JPVA 2DM6A 4Q1VA 1ZPDA 3HN7A 3SIXA 4A73A 1I3NA 1GA6A 4KJZA 1FMLA 2YJ4A 2IUTA 4EB6A 2DU8A 5D51S 3RYCB 1H6BA 1OKKD 1X7WA 1UXKA 2C5HA 4BO7A 3QVKA 2PRZA 1OR8A 2IEYA 2FRDC 4OP2A 2AWNA 4Z4GA 3BMCB 1IZZA 5IZ4A 4BKQA 4NV0A 2KYRA 1LC3A 2CJWA 5IJ0A 1TA4A 6ABPA 1E32A 3WK6A 1ETHA 1FU4A 4F3RA 2CVHA 4NECA 3W8DA 1OXVA 3KTAA 3RV3A 1EU1A 4DUZB 5JT1A 1GDDA 5D2CA 1WBDA 4BAZA 2C95A 4MCIA 4KXWA 4E12A 4BKPA 1HFWA 8ATCA 3PRYA 5BSMA 1M0EA 2O8EB 3QOXA 3LYHA 5J9FA 3AEXA 3E7XA 4F2GA 4EKEA 1P4AA 2YZ2A 1TRHA 1A8QA 3A0UA 3D59A 1DJMA 8GPBA 2BFNA 1CR2A 1JL3A 1ZNYA 2CNBA 4YLGA 4DCVA 2CF5A 4MS3B 3R0IA 1RYMA 2B5OA 2EERA 2GS9A 3RS2A 4Z7NB 3SEFA 1HNNA 3RIYA 1P4HA 1GA1A 1YI1A 1M2FA 1MT3A 2GZ2A 3PHBE 1T26A 4CU5A 1J5PA 3OQPA 3MQ2A 2WP8J 3TZLA 5JVDF 3A6GA 1TM7E 3W8FA 1OBOA 1A96A 4BLSA 1S4QA 2F3QA 2V9ZA 4PQEA 2CNOA 4F56A 2IQ5A 5HRAA 2O06A 1K75A 2Z1MA 221PA 1X7HA 3SEAA 1D03A 1JFSA 1MO3A 3HWX1 3AT1A 1JPUA 2ISCA 1P4SA 1K2WA 2V7GA 5ECWA 3T9AA 5B3KA 3PXGA 4DTIA 5LKRA 1VL0A 3D2LA 4XVRA 3EPHA 1ONPA 2CFIA 2ZRQA 1SXIA 1VBKA 1ZQ9A 2V74B 2HQBA 3FCUB 3H5WA 4DXHA 1FC0A 1Q16A 3DE3X 3FTNA 1PEYA 2R79A 5SICE 3ZD7A 2GEKA 1QP0A 1DUIA 5KSOA 4FCTA 1X8JA 1NVEA 2RBKA 4IG9A 3CC8A 1P5RA 3MA0A 3GPCA 2G3YA 1QUFA 5FBVB 2W48A 4KQWA 4ND6A 3TVYA 2O4CA 4IMPA 2B3TA 1QORA 3IQFA 3TSYA 3VKUA 4UU8A 4S35A 1L4HA 2BGLA 3E22A 4FCCA 3W5SA 2O54A 1DAEA 1U8UA 1A5TA 1YB2A 1P1FA 1WNFA 1YUMA 3HU1A 4BCBA 4EHJA 4F2PA 1NJ6A 2K87A 1HSOA 4AJ9A 3PQ8A 1IM8A 3H5NA 3HMKA 3ZK8A 3BPSA 2CBZA 2VSYA 4HNHA 4YMSA 5EXEA 2EP8A 3EDOA 4AKGA 4LKOA 4RVCA 5FH9A 7YASA 4LNHA 1VLHA 4YJDA 2Z56A 4YX9A 2X0FA 3KPVA 2BGKA 3PQ5A 3I6QA 5B3LA 2HREA 2MIIA 2O07A 3Q15C 2OYCA 1JDSA 2VRBA 4QWWA 3KX2A 3LTEA 5FL3A 2X9GA 4B7ZA 2UUOA 4CEIA 1OBHA 1F06A 1XB2A 4W99A 3ZWDA 1SUWA 3E9ZA 3JX9A 4AP9A 2Q5JA 1N7JA 1XVAA 3LGAA 2P6MA 2CVPA 4KMSA 4I08A 4ODIA 1QQAA 4K8RB 4O2RA 1J56A 1QRUA 4QTTB 2XPCA 1ZUHA 2AX3A 4E13A 3SYRA 3VSBA 1MGPA 4KSYA 3WICA 8ADHA 1OXSC 1OLXA 3R5KA 1R12A 1IN1A 4QOGA 1OA1A 1PL6A 1ZXBA 2MYNA 1E63A 3EUWA 1FSZA 2Y93A 3R0ZA 5KCZA 3BEDA 4FGZA 2C4UA 2HRZA 3KU1A 3A6DA 3S2UA 3DEJA 3AR5A 2JD1A 2HO5A 3C85A 3T3HA 5CDSA 2VA9A 1BKDR 5D5PA 1MHTA 1FQWA 1CJBA 1E9VA 3EXHB 3UMYA 5AVOA 4OSOA 4O2AA 4MW4A 2VYNA 3ACDA 1JWBB 1NZJA 1RNLA 3N2IA 4LJKA 4YCBA 4AJ1A 4DAEA 3THWA 2OAQ1 5B6IA 2RIRA 2YQZA 5AI5A 4BX2A 4XM1A 2VZ8A 4QUIA 1I32A 1UPBA 3V80A 5BN3B 3NTXA 1J9GA 5EP1A 1A1VA 1VE5A 2I6UA 1XPUA 2EL7A 4RMIA 3RRJA 1JSRA 2O2XA 1L4YA 4FXOA 3T3PB 2WE7A 3BCRA 3LA6A 4LGMA 821PA 1NUSA 1SC9A 1L7MA 1GTVA 4WA8A 2PKRA 3H2GA 1DAKA 2EX4A 2G70A 2NQ2C 4EIWA 4C2UA 3K1AA 4JNCA 4RMNA 2YYSA 2QD4A 4M9CA 4M1TA 4HQNA 2EOAA 4KGVA 2R8OA 2JPDA 1MVNA 1YTLA 2HA0A 4UE2A 4OHYA 1BS2A 2AR7A 5ALJA 4P2BA 5KJEA 3TTTA 1ZJ5A 2RE8A 3IVCA 4Q1CA 4D6PA 4DFDA 3CZMA 3W4IA 5EJFA 4FDTA 2ECPA 3SEZA 1MF7A 2XCOA 2ZULA 4UAGA 1UJCA 5JOQA 3DBOB 4DMHA 2IYYA 5LP6C 1GU0A 3PNLA 4WZBB 4C21A 3QUSA 1Z4OA 1X2BA 4XJTA 1PVVA 1NVDA 2OYSA 1XN1A 2GARA 5IXSA 3F97A 3D5QA 5KTPA 2EW8A 1VHQA 3HLKA 2HHLA 3FCCA 4UBLA 5G3YA 4N82A 2VTBB 1ZVVA 4QEZA 1VB3A 5DT9A 1O6GA 2X8BA 2C8VA 3PG5A 1QB8A 3IAAA 3S6JA 4A15A 1I33A 3GT3A 3QU7A 2C3PA 1U3UA 5BYAA 4LGVA 1EBFA 1Z8HA 2AMVA 2CBXA 3OZSA 2WWGA 1VG9B 3CXRA 5KVAA 3GLFA 3H16A 4AX8A 4G01B 1CERA 1QV7A 1SBYA 2H7XA 3B1JA 4ZN6A 3MVEA 4YLEA 2BEUB 5ITVA 3OJXA 1KMHA 1AG9A 3TS1A 1HQYE 3NFRA 5BUSA 3KYDA 3BKXA 1AF4A 4I5IA 1RAHA 1USIA 2GK6A 3PENA 1D2CA 1U98A 1PJZA 4YCMA 2KS6A 3A58B 4IXMA 2RAFA 2Z8XA 1UKBA 1TOAA 2JKZA 5GWXA 5DM70 4JR2A 3VV2A 3NBYC 4MMZB 3BE8A 2H5EA 1DRWA 3BWDD 4P6VF 3OX4A 5DHSA 2IPXA 2V1UA 5CMLA 4OGFA 2A94A 1NBMA 1ZN2A 3D0QA 4RDXA 4YS6A 3K9FC 3U6BA 2EIXA 2ZBGA 4OQPA 3DLHA 1A7JA 1KP3A 1G3RA 1UDCA 4M9XA 4DA4A 4NNOA 2OXFA 2IY7A 3V1UA 3IURA 5HILA 3LX6A 2XZOA 3UGJA 1P2GA 1PEDA 4D97A 2PKXA 2ZIXB 4WESA 1MO4A 1QWSA 1VLJA 2P3QA 1WBBA 5FLXA 3ZLJA 1UKEA 3VSDA 5I7SA 1JFLA 4TV9F 2H00A 3LDGA 3F74A 4WUVA 2ZYDA 3Q3CA 3WRYA 3ZIAD 3WB0A 2XLCA 3EYAA 5L51A 2QPOA 3DHWC 4Z4FA 1SVOA 2QY9A 4MJ3A 2BP7A 2YWFA 1W5TA 4HXFB 3WS7A 1PSDA 4TKLA 2WPDA 5B7GA 3L43A 4Q1FA 2XD4A 3HA2A 5AI4A 3Q10A 4BVAA 2J5BA 3HR4A 4GQAA 1UMDA 3VOTA 3B8HA 1Q0LA 1GSIA 4YRAA 1H6DA 3BGVA 1SM4A 2GBLC 2RHOA 4G5QA 4EX6A 3NGXA 4UQLA 1B43A 2ZWAA 2JA2A 4XB6B 4JL8A 2WINI 3T1OA 1O0SA 4QG7A 3U61B 1XU7A 4BUJA 4ZK2A 3WGKA 1HLPA 2AR9A 3T7RA 5KNBA 1BRTA 3GEGA 1W87A 2XCRB 1JNYA 1OHHD 2A14A 1JR2A 1U8EA 3HUUA 4Z8XA 2D1QA 4ZVTA 1XZKA 2JJ2D 3CA8A 3EZ2A 3IPYA 1IG3A 4QFCA 5T6MA 3TQOA 4B2LA 1UDXA 4XGKA 1QU3A 2GDJA 2UYGA 3ZVMA 1KY5A 2VOJA 3DD1A 5KBYA 3N07A 3ZKWA 1ZUD1 3N7UA 4KTVE 2DPYA 4FLMA 3IA2A 5LZ5A 5JNSA 1FNBA 1DOZA 4WN3A 3N0WA 4QBFA 4Q3BA 5AW0A 2RIPA 3KOMA 3ZS9A 3OESA 1V16B 3DM5A 3PR2B 4NIMA 4EPVA 1GZUA 3GPBA 4HB4A 5F2OA 4ZTZB 2HCFA 3OLCX 1Z6GA 3GJ4A 3CXUA 4YRCA 16PKA 1NW5A 5C4MA 4JYZA 5KYXA 2VAWA 4ZVOA 2IC5A 3TMKA 1C1HA 3M1AA 4IDCA 1C41A 3J81k 4DMUB 1HE1C 5CW2A 2EL9A 3R4VA 4HQKA 5E6UA 1LFDB 1SUSA 4L22A 5DXFA 1D1SA 4B2PA 2GXAA 3S2IA 3R9KA 5KZMB 1QLHA 1Z5WA 3JSAA 5H0IA 5DULA 1J99A 4JEHA 4RLHA 3FTQA 4AMBA 3DV0A 5CAEA 1UWCA 3J80A 1GR1A 3KZMA 1E2HA 4GI2A 4X9XA 3KSAC 1C3EA 5A9TA 2YW2A 4LDAA 2E82A 4HLCA 3L4KA 3K9CA 1BQ4A 2WHXA 1Z13A 3C3DA 1P3Y1 2PT9A 1XK6A 1GCIA 3PGMA 5FTWA 2X9LA 1Y6QA 2CSUA 1NULA 1XKTA 3FRHA 4MVCA 4QUBA 1IATA 2WJWA 3TLKA 5K0SA 2P0YA 3D3KA 4FCWA 1OLSB 4JBWA 1Y0BA 1DWQA 2RG7A 2V6FA 5C5DA 1HK7A 2ZUEA 2WZCA 1E3SA 3FFWA 1W85B 4RANA 4G26A 2CLOB 4LRUA 2IYUA 3E6AA 1Y3DE 2OV1A 3HL0A 3C7TA 4N6NA 4XM2A 4XSVA 3SI7A 3LUGA 3QVSA 4DLPA 4G0ZA 2WHPA 5CNJA 1W36C 1PNTA 2Y0DA 3X1KA 1H4SA 1YRBA 1JLHA 3Q3GE 3I9JA 3AP2A 1EK6A 1KJYA 3UHJA 2EVWX 1AKUA 3GAMA 3K2BA 1SRQA 1FK8A 4ZAYA 2P78A 1GGFA 3TNYA 4GP9A 2O2EA 1ZVKA 2OXEA 2HNKA 2R8ZA 4R2LA 1BEUB 2RKOA 3BX1A 1PFKA 3UA4A 4D3YA 3FD8A 4QPDA 3EZYA 1ZN9A 3PNPA 2GUWA 2VDQB 2VH2A 2FMUA 3GYBA 4RXUA 5CG2A 3FNHA 2I7XA 1QH1B 3UVEA 2AEMA 4RMGA 1UMBB 2V7QA 2JAHA 2POQX 2XBMA 1A5SB 2ZVQX 1KDTA 1KU0A 3KV3O 4IFEA 3G2IA 2JGMA 1WEHA 1OJ7A 3OPMA 2N1MA 4JCOA 3ESBA 2OBFA 1NA5A 3K6RA 3N2KB 3U80A 2P91A 3I2IA 2WYUA 4Q3CA 3KJNA 4ZYVA 1SK8A 1ULSA 2C3UA 2O2CA 2GZ1A 4MHOA 5TPZD 2O8BA 3DE5X 3WNVA 1Z2OX 3TMYA 3ZJVA 1NPDA 1O58A 4N3CA 4XTCS 3LTNC 3B85A 2NAFA 2ZZKA 1RQRA 3EA0A 3L0BA 3UANA 1AKNA 3ZVRA 3B3GA 3ZY4A 1VMKA 2O5CA 1DC4A 3I37X 3LFTA 3FSGA 3SMQA 3A6FA 4TKZA 2Y1OA 1ESNA 4YT8A 5BUCA 5CFPA 1SO8A 3DWGA 1LXCA 3FFAA 4UUQA 4X1IB 4LZPA 1IHYA 4I2NA 2GASA 5TY0A 4ALNA 3U4QA 1B2RA 1VSQA 1Z5VA 3EZ9A 1CKEA 3QKIA 3W6UA 4G1MB 4P3KA 5HZHA 4L0QA 1D09A 3QJ5A 4H7DA 5DISB 5I4CA 3LC2O 1VCMA 2WYHA 2FMTA 4EYQA 4H3SA 2PL3A 4TWAA 2EZ9A 2BGGA 4HQ0A 2HXGA 3I6YA 4N65A 2FXVA 3M82A 5M2QA 3S8YA 4JYAB 2X42A 5GJCA 1ZHFA 2AFHB 1JJ7A 1XJ5A 3FJYA 2IDKA 2QRVB 4DQKA 1F8UA 1U2SA 4C0QC 1M1XB 4CMGA 3EDQA 3FNIA 2BOVA 1XNRB 3R7BA 5EJEA 3AL0C 2QLNA 3HM2A 1E1RA 1RLTA 2Q28A 1BMTA 2QM0A 3Q9LA 5CRIA 5DYTA 3TLBA 4ZAGA 3WV5A 4IV5A 2UYOA 3QFSA 4BO3A 3BGIA 3R6TA 4J1TA 1GQQA 1CS4C 2AFRA 2GI4A 4NPHA 3AILA 5B1DA 2YWRA 5HOEA 1AY0A 2SCUB 1QMPA 2AG0A 2PHZA 2BKVA 3WYDA 2H08A 3TW6A 2WLTA 1QO0D 2EKQA 5U9CA 3FNFA 4G1UC 3PICA 4EO9A 1M2OB 1RTKA 2ERCA 3AR6A 2IDJA 3PDWA 4JC8A 4DDWA 1I4TD 5KYUA 4LX0A 4D9GA 1OT5A 1EFHA 1EFCA 5IANA 4YJ2F 3T7EA 4L75A 1R0KA 2H2FA 3UT0A 2BGTA 4UZFA 1U28A 5J23A 3UAVA 2YYYA 1IVSA 1HBJA 1BMFD 3TDKA 4KQKA 3C98A 3L7MA 1KS2A 2LDXA 3KJFA 5F9MA 5FOWA 3STTA 3WGTA 3T1TA 2OXTA 2XWPA 1Y42X 1B8VA 4ISCA 4WFKA 5HDQA 3B3QA 3V8BA 4PLZA 2I67A 4A2PA 2OCAA 1LTKA 4OHMA 5BVGA 1IZ8A 3JAMA 5F7ZA 5CBPB 3U3XA 1NMXA 1ZU4A 4M0LA 4BNMA 1X1EA 3MJSA 3QLTA 4EP1A 3Q88A 2PA3A 4QREA 4WXYB 3PGLA 1NBOA 4UVHA 4YXWA 4F6RB 3BB4A 4ZPXA 2G4LA 4L50A 1C7EA 3ER8A 1WLYA 1E99A 4ZHQB 4PLGA 5L4LA 2D2VA 1Y8RA 2B5WA 2FK7A 1ZBQA 3EQ6A 1HE2A 4BNWA 1H69A 1OAKA 4M9RA 1SVUA 3F9RA 4ATNA 4BE4A 3B6JA 3AVXA 4COOA 1D6SA 4WCVA 4HPWA 2J5QA 2PKQP 4GC5A 5BV0A 2ORIA 5K01A 3EIFA 3GPLA 5K2OA 3IHWA 3I9V1 4O5AA 1V5WA 3GGGA 3WOVA 5ED0A 3WXBA 2C58A 2GRUA 4K28A 1YUNA 2NADA 3K32A 5KYGA 3KDAA 1QLWA 1K8YB 2B6HA 4TM8A 3FDZB 1A2KC 3LBIA 4FPXA 3R74A 4ZYYA 3TSZA 4UJ3A 1KU6A 1WVMA 3U37A 3VNRA 2XVAA 1TF2A 2NP6A 1ACJA 3EVNA 1FS6A 3AM3A 2BEWA 3K5PA 1A50B 2HWWA 2ZIZA 1ODCA 3F0TA 3MINA 4CQLB 2GCPA 5TEVA 3RIHA 1JLLB 1L4KA 1R9GA 5DP2A 4PX2A 1ZS9A 1SBZA 1A9TA 2XUPA 3MJ4A 3WGNA 1BXGB 2D4HA 1OXTA 4O2BA 2UZIR 3RS8A 3VR5D 2ZBPA 2DFNA 1RQGA 3UA3A 1DKMA 1O5OA 2C4MA 2K6GA 2RK3A 3GUCA 4HL6A 5B37A 3GRCA 3TSAA 3ZH9B 1K2VN 4GKAA 4D98A 3Q8KA 4NNPA 1M2EA 1W2HA 4GLJA 3A4YA 4B6EA 1AC5A 1L7XA 4AJ4A 4CYMA 2D74A 2VJDA 3TJZA 5IK2A 1SIBE 5REQA 4IAOA 1LK0A 3KT0A 5EIFA 4J0IA 5JD6A 1EB9A 2X8WA 4WUTA 5TC4A 1GUYA 2OE2A 4PS0A 1OFUX 5T67A 3TUJC 3AKEA 2CVFA 3HU3A 4U7GA 3IQZA 1FFBA 3QHAA 4RTPA 4LXXA 5IT5A 3QITA 4QDZA 5BNIA 3SC4A 3QX9A 4B9AA 4BV8A 1LI5A 4HEA1 4TXJA 1LPAB 1TFRA 3V7FA 4CV2A 4NXMB 4IGFA 5TT0A 4P0TA 1D6NA 5IJ9A 4RTKA 5I9LA 1LRKA 2FRXA 4JL6A 4P81A 1VHWA 5G0WA 5JJKA 4M0FA 2LNDA 3TLJA 4FEGA 3TGPA 2B94A 1V1MA 3TW0A 5B6JA 5LXTB 3W2HA 3H1FA 3C6MA 4C2BA 2JAWA 3EBPA 2IRWA 4L5AA 3ODPA 4D26A 2BTOA 5GJWC 4CEHB 2R6CA 2XB8A 3B70A 3D5EA 4R1TA 3L1HA 3L84A 4A3SA 4XFJA 5AP9A 2HRBA 2ZI7A 1Z56C 3PDHA 3AU9A 1H2YA 3H5AA 3NAQA 1SVMA 3LCJA 2FR8C 4I55B 1W75A 3U4GA 4JP2A 4YP7A 1AKRA 5L45A 5IKXA 3DMFA 5IW8A 3W3AH 3CH7A 1FEZA 1M34B 3KK0A 4P53A 3A1UA 1E89A 2R7MA 3EVGA 2DR3A 3HCDA 4J4HA 4RKFA 3IODA 1XXHA 3E7WA 2X5KO 4OI4A 1F20A 1KVRA 4YJKA 3EIHA 1EQUA 3H0CA 4RK0A 5HBRA 1L5MA 1G6OA 2VF7A 1Z8FA 4YRSA 5BN4A 2KSQA 4F3CA 1BGWA 1VGQA 3ZXXA 4ARVA 3DDOA 4GGMX 3BHNA 2GO7A 3FOWA 4FTWA 4IXTA 1O89A 3PD1A 4REMA 3CB2A 2WAOA 3ZNPA 4BCCA 4CEJB 1QHHA 1VHDA 2VHCA 4G89A 3DV2A 1G5PA 1YONA 3CNEA 1GAEO 3L77A 1NXQA 2V9PA 2BVNA 3UK1A 2Z8YA 4QFMA 2R85A 5KOHA 1KI7A 4FZ5A 3O94A 1RWXA 4ZZIA 4FC7A 4J07A 5AKGA 5FNZA 2HYDA 4IOLA 3RSZA 2DEUA 2FZVA 4H9GA 5TIIA 1XMPA 5EZYA 3KO8A 721PA 2DJ5A 3D02A 5TGTA 4DA7A 3QBTA 4PYOA 4NE7A 5CB4F 4HFJA 3RPEA 3C14C 1OFHA 1O95A 1XCBA 2GRAA 1Y89A 1JB1A 2H5IA 1MQAA 1LV8A 2J3EA 2C5LA 2J5KA 2OCGA 4GH5A 4GZ6A 1EFDN 1FRFS 3SJAA 1VPDA 2EF0A 2CWDA 3DR3A 2EJCA 2Y0BA 2FUKA 1GRNA 3X1JA 1O94A 1Q7GA 2BISA 2Q07A 2X19A 4DLKA 3F6RA 2DKFA 5F7XA 4R9NA 1JRLA 3HADA 3G2PA 1T0HB 2E7ZA 2HWYA 3OECA 1GCUA 4KFUA 4P4UA 3RYIA 2XUJA 2FZKA 3DCYA 1ZI9A 4HEJA 4YXFA 2YVLA 1EAYA 2NUBA 2RHDA 5JCZA 5EWMB 2I6XA 4K8OA 1XMIA 2V6IA 3H9JA 4NYJQ 4HI0E 3WYCA 4CTKA 2VJCA 1KO5A 1ZKMA 4FUQA 2I22A 5AKXA 3B82A 2QTVB 1U3GA 4P83A 1MVLA 1JU9A 3PTAA 2J4CA 4P86A 4QE3A 3HXTA 5ES3A 3T4PA 3HDJA 3KTDA 3S7ZA 2XMRA 3A05A 2VHJA 2J30A 3O38A 2WSLA 4MDYA 4QLAA 3HVJA 4B83A 3EFEA 3WWDA 1FTSA 4HYQA 1OW3B 4M88A 3WV4A 1YV9A 2QRPA 4KAJA 5JNRA 2YV2A 2ACWA 1VDZA 1CIPA 2GFIA 3J7TA 5CT5A 5AO9A 5DNUA 5JD4A 5KNDD 3QLUA 4ZQBA 2G1KA 1VJ0A 3NHYA 5DTRA 4F3KA 1E6UA 2H4WA 4RLFA 5IPFA 1Z26A 1ZK4A 2HEGA 1CHNA 2QS9A 1TO2E 4Y1RA 3UJAA 1P5FA 3DVAB 2HSJA 1XBTA 2K2WA 4DJJA 1I7DA 2ZSKA 8LDHA 1GZDA 1NATA 3WTBA 4DXAA 1WUTA 3UHFA 2A4MA 5E1MA 4E6EA 1EBBA 4QQNA 2D0IA 1EE9A 4B3IA 3UOWA 5KQMA 1BFKA 3DZKA 1T6ZA 1VLVA 3KJEA 3TOVA 3L92A 1MIOA 2PO5A 2HL6A 3COVA 3T7CA 2BKUA 3MLEA 3VPSA 1XRLA 2EP5A 3OT5A 3AHFA 4KQEA 3VC1A 1JS1X 2O14A 4CF7A 5B2FA 4Q1EA 5EQDA 5B58C 1KWKA 4R1SA 1X1SA 2XX3A 4KXLA 2AJ8A 3WWYA 2QD1A 1GQRA 4WSOA 1LB1B 1W34A 1LTQA 4N03A 3TR0A 1NYLA 2H5JA 2ZTLA 1EVLA 3OJWA 2OQIA 5EOVA 1WD5A 5J5CA 1IUOA 1O87A 3CRMA 4KMRA 4WZZA 3OBBA 3VRHA 1S2DA 4BRUA 3FH0A 3I3OA 2HA3A 4D3ZA 1DO0A 1NLZA 1NSYA 2XVZA 4MNTA 3H19A 2B4RO 5I7VA 1CE8A 5JD3A 2FE1A 3IGFA 1DBQA 2JI9A 5HXAA 3A32A 5B2ZA 3KOOA 4ITUA 3AOEA 2Q1XA 4IIUA 2JAUA 1JXQA 3HHPA 3IUMA 4AMYA 2F55A 2O52A 3NYIA 2PKYX 2Q6LA 1OWMA 5JS6A 2KPOA 1GDTA 1JQEA 3RNLA 3CRW1 3MTDA 4D3FA 4PXAA 1Z18A 2WIKA 3KXLA 2FPSA 4ND8A 3VO1A 2A9QA 1FDOA 1AS3A 2H51A 1LVHA 3AUAA 2XOKA 4ZYWA 3MMXA 1HV8A 1A5AB 1A9RA 3AM5A 3K0KA 5FTMA 3ZIDA 3BXPA 1UBOS 3QBDA 1H8EA 2YH2A 4LUCA 2VJMB 5A3JA 1JDJA 4MP6A 3STHA 1WOYA 1U0NA 3EXFA 1U2DC 2FHSA 1NNEA 3CR3C 4ON9A 1E6MA 3NYQA 4WRRA 3VTKA 4YIHA 1V0JA 1M75A 5IXYA 5DDIP 1E2NA 2PZJA 1V2GA 1X7XB 4HGYA 2EU8A 2VBCA 3AUUA 4IDDA 3GO4A 3PFWO 4BEJA 4B6SA 4KDEA 3GFRA 2I4OA 2PNJA 1RFLA 2PUVA 1X87A 3CG0A 3E9NA 5DM4A 1DC7A 4RDCA 2DY1A 1G8JA 3GH3A 3WB2A 1L7DA 2OD9A 4Q3EA 4BX0A 5IC4A 2OG1A 3CN9A 2JGRA 4OQYA 4DV4B 3U19A 2QUIA 3U3RA 3H2SA 4OAPA 2Z8YM 4EPTA 3NH6A 3MWJA 1P9LA 3OIVA 4Q6BA 2ZSDA 2QUAA 1R9MA 4QYWA 1MX1A 1VIMA 2XGMA 3FVQA 1E2UA 4BKMA 4OMDA 1D6JA 1TIKA 1JFTA 1M0TA 2P8JA 5JAIA 3MLBA 4NF2A 4X1OA 3G9UA 2I0FA 4LPKA 5D3MA 5L6MB 2BH9A 1S0UA 4CKEA 1WCV1 2ZE5A 3L0IB 3O95A 3JASA 5GM2A 3SYNA 1LQ2A 1CR6A 1N6NA 1U9YA 2ZRAA 3CZ4A 1JHPA 1TL7C 1Z8DA 2X0IA 1ZH4A 4HAUA 4KH0A 4FK8A 4OBXA 2JEOA 4MLZA 4XOUA 3QXSA 6PFKA 1PLJA 2OC4A 4DZZA 1KZ1A 1I4OA 2BZ0A 4DT1B 4PY2A 1UBLS 4K9OA 1JA0A 5BR1A 2BF4A 1K1EA 3KR9A 2FFQA 4RMJA 5JPCA 3CNNA 2XTNA 3NBZC 5JH7B 1JBEA 3T5DA 4RETA 2QG9A 4BTVA 3BMQA 3NHKA 2YVQA 3GJXC 4NBUA 1FXUA 3ZGYA 3MGAA 4KP7A 2QLBA 5AJWA 2YXPX 4WECA 1SUBA 1Q0TA 3RBVA 3PPXA 2G8LA 3G8YA 3O73A 3LS2A 4EYKA 1CTQA 3WK9A 1PZEA 1U7OA 4UOEA 4QASA 3ZGOA 3IP5A 1KQFA 2L2QA 2ZR0A 2HT1A 1FLVA 1J70A 1M1YE 3QG5A 5AVUA 4DQXA 1YQDA 1US8B 4QATA 2QUKA 3U48A 4QJBA 1KRWA 1FPQA 1BS1A 5ARDA 2V3CC 2GBFA 4MYDA 2CYAA 4R16A 4UREA 1MJFA 3ZJYA 4DSNA 2G80A 4IGIA 5LYJF 4AXXA 1L7BA 3OD5A 1E8NA 3PSHA 4FXPA 4AKSA 4XPZA 5K7SA 2HV9A 1C7FA 3QVUA 1TMOA 3JZFA 1PGQA 4AMZA 3QG1A 3K0HA 2OHJA 2X2OA 5ITZB 4YGYA 5J4KA 3DFZA 3H2KA 4PCAA 4RVSA 4URHA 2NYUA 4F1WA 4JB3A 4V0KA 4LF5B 2C4WA 4C9BA 4KE9A 2A3NA 2I2AA 4UTRA 4GHWA 1KS9A 3RASA 2AHRA 5EKTA 2Q50A 2SHKA 2I8AA 1WB4A 1Y3IA 4ZK6A 3W9YA 2J1LA 4MEAA 2QRHA 4UU0A 1JEQB 4P58A 1SCNE 4UUBA 2I91A 2XMSA 1XZDA 1CNFA 1GARA 5D3KA 2AI2A 3KQUA 3F8SA 3IVMA 2GJ9A 1S02A 2NZJA 3U13A 3WMWA 3OZUA 2XUOA 2JH8A 3GY0A 4BMSA 3WB9A 2PCJA 2FHPA 3BXGA 1DGQA 1M83A 1W0JA 2FSSA 3I5UA 4WPGA 4Y2TA 5K4HA 1UBCA 4IR7A 2YVAA 1JDTA 4YNBA 5B3JC 3AR8A 3D6VA 2AMFA 4F9TA 2XCLA 2A1TS 3ZQ6A 1Q15A 4CGYA 2QZPA 4N7JA 1JTFA 1O97D 1RRGA 3E1KA 1UXJA 2IY9A 4B0PA 4BN0A 3DKRA 4XX0A 1JDZA 4E5YA 4AF8A 3NBQA 3D8BA 3BHJA 5C31A 3RAGA 2P0AA 1L3BA 3OZVA 4FFVA 1YJ8A 2IYNA 2C7QA 1GPKA 3I9NA 3N6VA 3TZQA 2C8LA 2UDPA 2O8FA 4BX8A 2C9OA 1G5FA 2EJWA 5HDBB 3R3YA 4U2GA 3RCBA 1SY7A 2BTQB 1JGTA 4AIRA 1EX9A 3TZKA 4ER6A 5EKSA 3RJZA 4LDNA 1CFJA 5JVDB 1SU4A 4LMPA 1C3OB 4AAYA 4LSGA 2FWIA 2ZAGA 2XDAA 1RXEA 4MVJA 4C88A 2RHBA 3B9PA 3TRHA 1KO4A 1YSCA 3ZDDA 1TYBE 4IH9A 1OH7A 3GLKA 3X3HA 3BWVA 1WHSA 2K7FA 1AX9A 1W52X 3N8NA 3PA6A 3UB2A 1KI6B 3USCS 3WL6A 4CMIA 2D1RA 4TXHA 1JG7A 4LY9A 4NONA 5EJ6A 1PJ2A 2QVYX 3X2EA 1QHNA 1XGKA 3QIAA 3KQSA 1KXZA 1UF9A 2EW1A 4EUKA 3F90A 2W6OA 3L01A 1NHWA 1L5GB 4C20A 4NAHA 1S2MA 1XUOA 4BLUA 4YA6A 4MINA 3FTCA 4CKWA 3H11A 3SIWA 1G2OA 1XZIA 2PRYA 2WU3A 3R0JA 2JANA 3VM6A 4D8WA 1QOZA 4NYIR 1L6IA 4HWTA 1UM9B 3K6SA 5EXXA 1NJ5A 3BD9A 4ZJUA 3SLKA 1XWFA 1YDFA 2C77A 2XECA 2ZUSA 2ZDGA 1JQBA 3PWZA 3IIKA 2E0IA 4ND5A 3VV3A 1C30B 1EE2A 1RYHA 1VPWA 4E21A 1NMZA 4K87A 3HN6A 3MWYW 4Z4IA 2XJ4A 4XXHA 2BKEA 5BNTA 3A6HA 3KQOA 2JIBA 2RI1A 3LXUX 4CR7A 1QIKA 1BQ3A 2BGIA 1ZD1A 1C1YA 3HJFA 1NWHA 3DULA 4XGRA 1ZD5A 2MYTA 5IX8A 2XMBA 2IDMA 3U49A 1TAUA 3I0NA 2IH5A 3LW7A 3CW9A 3AC0A 3H2JA 3HKDA 3CZ9A 3I12A 1QKJA 5G0VA 1CZKA 3RVMA 3ZZMA 4B7XA 1GL7A 2JI7A 3UHOA 1BCRB 4E46A 1VSBA 2RI0A 5DN6D 1RIIA 2G0NA 1OC4A 1D2GA 2ONJA 4UNIA 3DE4X 4QARA 1TU4A 3JAKB 4I8IA 4AZ0B 1IK6A 4LYAA 4X20B 2B7LA 2OAGA 1ORHA 3GMDA 4HTFB 1U8YA 3A10A 3HA5A 3R24A 4GR5A 1KE2A 5C7YA 1H6CA 4AWBA 3LL7A 2WWVD 2G0TA 1U7HA 3NMUF 2OK7A 3SS9X 4EYSA 4F85A 5KYKA 3V34A 4Q24A 5IAGA 1CPYA 2HGSA 3PHLA 421PA 2ZITA 3H75A 1NKVA 4LNUA 3S1AA 2ZU0C 2C2MA 3ABOB 2OAEA 4X0EA 4YJHB 3HB9A 4QBGB 3SFVA 1ZHOA 3O8QA 4J0QA 2I9PA 4K2HA 2WSYB 3UYKA 1PW5A 2QXTA 1MAVA 3N58A 2W2OA 3OQVA 1J0EA 2HHJA 2JA1A 2O3JA 3B36A 4B76A 3SQDA 3OE7A 3SXUA 3VKFA 2VWPA 4E7PA 5A0VA 4U2DA 3ZHCA 4AKEA 1K68A 3C1TA 1J0CA 2O8CB 2Q4DA 2J5XA 1K3UB 1Z0FA 5HZKA 2FZGA 2UZ1A 1WUHS 4MA5A 3P2IA 1MD9A 2R6AA 4J9VA 2NVUB 3L93A 1IVYA 1PJAA 5I7UA 2FSGA 5LJLA 2H9YA 4NEHB 4F1JA 1L5WA 4CIWA 2VUHB 2EZTA 2P9FA 1P1IA 4Q7LA 4Q3LA 5ICEA 4BVGA 5EJ5A 3KYCA 1DO8A 2K5UA 4HJXA 4RAOA 2QGFA 1YKFA 3U9LA 5F7OA 5KVCA 2XTAA 2M98A 2XGSA 4MPPA 4ZC1A 1X3LA 2QJRA 2XMGA 1L4EA 2XGGA 3ZU2A 3UN1A 1NW3A 4OQDA 5D01A 4X1YB 1DXQA 2II6A 4YREA 4BWVA 3CLTC 4UJ5A 2H16A 1XEXB 1GV0A 3WFJA 4J6FA 3L07A 2YW9A 3IAS1 1T8PA 3O3CA 3ZLTA 2FRDA 2WNSA 3I09A 3K0AA 3PNSA 4KQCA 5LMUB 1KWGA 3DKIA 2FNAA 4A6DA 1JIQA 3D3QA 2DFDA 4JVNA 4YCJA 2QGZA 1EIWA 4HGRA 5LBTA 5E9JA 2IF0A 3RT7A 1U0BB 2IJGX 2R8RA 3ADKA 3AJRA 4ZVLA 2HU8A 3OI7A 5TGZA 2HQ1A 4U9IS 4TV8B 4MQEA 4E5UA 5KJ6A 2VBGA 1CUBA 3ZHSA 4I9HA 2IP4A 3B6KA 4ZGGA 1S8AA 3QVMA 4WI1A 2X58A 4HEHA 5DHQA 3VNAA 3V33A 3GGSA 1AMUA 2EBFX 4UAVA 4BQQA 4HNUA 4R1UA 1QRTA 4Z0TA 1A9OA 1PJ8A 3A9UA 4KR3A 4G1VA 2HF9A 1XTBA 4F4JA 4EZEA 4MW1A 4IX1A 4MA4A 5BMVA 2JHCA 4CXMA 1H0SA 4C30A 3M34A 4HQRA 2D1TA 5JJ5A 1QKIA 3G6WA 2EKZA 2HU7A 3I72A 4MV5A 4NBKA 3DHEA 1VJCA 1YVDA 3GC6A 1A8PA 3HWRA 5G41A 1JEYB 1X86B 1NIJA 1VFPA 1MQSA 4G07A 4MW5A 5L95A 1U8AA 3A4NA 4X93A 4RA9A 2EBUA 1BSVA 4B3FX 1JMYA 1GPNA 4MW9A 3CJTA 4JA2A 4HNGA 4NG4A 4JIGA 3IC5A 2LW7A 2F59A 4GPZA 3PPVA 1GTG1 4I99A 4IS2A 4KXXA 1YCHA 2VT2A 4MVJM 5JNUA 5AKHA 2A1UA 4X94A 4LXGA 5G4LA 1KMIY 3ESAA 3EWAA 3I34X 3CEPB 4XLLA 3RIGA 3G0BA 1FFDA 3AX6A 4LQ4A 4OIMA 1AKEA 4N7BA 3V4ZA 1AHNA 3PF8A 1XEAA 4ZQEA 4ZOCA 1YB4A 1M33A 2GJKA 3B48A 2FCRA 1FFAA 2WMOB 2J9YB 3GROA 4RK7A 4Y2JA 5FORA 4JL5A 1FMJA 1PR0A 3LHIA 4QT0A 3ZCPA 1KMMA 3MJFA 4OHCA 4TWJA 1DOHA 1UPFA 1NOIA 2HD4A 1PK7A 3BC1A 5EIBC 4G6ZA 3UAYA 4EKYA 3PXEA 3UG6A 4C4PA 4OVKA 5C3MA 4FDVA 4WKCA 2O1XA 3DZDA 2HO4A 4XD7A 3FSJX 4TV9B 1Q6ZA 1TYAE 1XVTA 4JK3A 4KE8A 3ZBQA 2PUAA 1QC5B 3MJHA 4JAVC 3RUIA 4Z3KA 2XE8A 3KWJA 3C7DB 1DDIA 4MUHA 1YDWA 2Z8ZA 3H5OA 4IIVA 4LEIA 4F91B 4QJ3A 3BQ9A 1N0VC 4RVOA 1PI3A 4WADA 3M3HA 4NQRA 1LW7A 3D5TA 1KDZA 1QANA 3A7EA 4JI2B 4OFXA 3RHSA 1AGNA 5KWJA 3HU2A 2HJVA 1Y3CE 1OXKB 5SYNA 1JFFA 2Z1DA 1U1GA 1T1RA 4OLFA 1JDPA 2VPPA 4Z0NA 3RUAA 1Q0SA 1GXSB 3GZ4A 4MROA 5H1YA 2F1RA 3SBXA 4BEVA 1W6UA 4LE1A 4DCNA 5HP4A 1I0LA 3EWIA 1GITA 2ZKLA 4YMHA 4X64B 1KDOA 2BZ1A 2GETA 4GRIA 4BVFA 1TTTA 4FUTA 2GPSA 2RHJA 1PZMA 5DWQA 2WM8A 3BWXA 3U5ZB 2RAUA 3OBIA 2GZHA 5C4GB 1U8FO 3NEYA 3PUHA 2VG8A 1SXQA 1EUCB 3QXJA 1IONA 4D9BA 1QQBA 3KL2A 4RD1A 5IULC 2V7VA 1UODA 3T9CA 2D5AA 1YZVA 1VPVA 4R6WA 2IPOA 4X6YA 1MEOA 4GMFA 1YDEA 5EY5B 5FIUA 2F3UA 5HFNA 2EG5A 4IDEA 4QNMA 5AUOB 4BO6A 4ROTA 2WWRA 3VJMA 5JPDA 3TCXB 1G2QA 1JZQA 2IW3A 4JLDA 2PVSA 3B9RA 2IYWA 2R47A 2QF7A 4JHXA 3TOXA 3QBJA 4BNIA 3BCSA 3DDNA 1NQAO 3I0ZA 3PIIA 4KPGA 3L82B 2BUCA 1NF2A 3GLHB 3BZUA 4KCGA 4EITA 1B2LA 3D8SA 1AMNA 2HHHB 3HVRA 1Z0KA 5ABPA 3OOHA 2Q8QA 1Z29A 3R3ZA 3TLYA 1QMGA 1Y3BE 5D5HA 2OXCA 1NSFA 3TL3A 3IBGA 3HZZA 5LQRA 3WHLA 1QAOA 4PSUA 3KVNA 3PD7A 4MWDA 4YWJA 5JHGB 1UL1X 2GCOB 1ZCJA 3A7DA 3SF0A 3AUTA 4CLRA 3V1LA 2J48A 4DV0B 4OBWA 3OIDA 4OQXA 1DCFA 4P80A 4MP8A 3UB3A 1L3CA 1UBHS 2R1TB 3G6KA 3FPBA 5B1YA 4LTMA 2B3DA 5HIMA 2FR1A 4OL9A 4RVHA 1BYUA 1I1HA 3JZDA 1J25A 1XQ6A 2WTEA 2ZEJA 3IYLW 3LKVA 1OIVA 3K8QA 3NALA 4E1BA 1CJTC 1VI6A 2L69A 4EJSB 2W6PA 4ZQHA 1P18A 2OGTA 1E6EA 2FFHA 2V0CA 3CR8A 4R69A 1GNSA 1I3LA 2FG6C 5T57A 2FSVC 1R10A 2RC5A 1OI2A 1XROA 1LPBB 4YPVA 1TEZA 1S8FA 2R3SA 3FLEA 4V1CB 3R75A 4NS4A 2PKQO 4B3RB 3IMCA 1Z63A 3HI6A 4F21A 1O8CA 2B8JA 4M89A 3V1TC 3G0HA 1B0PA 1PVDA 1KEZA 2J07A 3EGDA 2COKA 2BCGY 1DQRA 4MCJA 4U4AA 1R4MA 3W78A 2HY7A 4DIDA 4J0GA 2EBWA 3TQFA 3OF2A 5CVDA 5DI3A 4OI2A 4LHXA 3RANA 5IDVA 4LF4B 2FVYA 3KT8A 4M7PA 1ORWA 2DHDA 2H7CA 1W7AA 3GRZA 3C7KA 2HFKA 1Z4QA 4X44A 2C7PA 2P5YA 2QLFA 4OUKX 2IL1A 4CIXA 4N8SA 2YTZA 4TXMA 3HK2A 4O2BF 2H0RA 2I6QA 1NXSA 3QENA 3E5HA 4W5NA 3BJEA 2AHOA 2HA2A 3KV1A 4ZDIA 3EQ7A 3NKVA 1H8HA 1KNXA 3UMSA 1TT5A 3EIEA 3KQHA 4IIXA 2HMAA 1OASA 1VE6A 2C5FA 2TECE 4JSRA 2IYFA 2OD2A 3C5EA 3F96A 2AYZA 1N9GB 4KL8S 3NVKI 3QPWA 2B61A 3HSKA 4FOLA 3AP3A 3PZBA 2ODTX 2P27A 1I7LA 4JOQA 3LY5A 4QU5A 5BR7A 1C3JA 2DWUA 1S89A 2EFGA 4HNAA 3FWNA 5G3ZA 1KJIA 3AZPA 2QJOA 4AS1A 1TA0A 4IJKA 2PFGA 5EJGA 1P0PA 4GBJA 3W8NA 5HOQA 4PPGA 2IYTA 2PZGA 1CZNA 2MSKA 1MAAA 4R84A 1R50A 1FUEA 3DFFA 3L79A 3IJ5A 1H66A 3FYSA 4LXHA 4QC2A 3LQ1A 2GSWA 4K81B 4DIFA 5ALUA 4XLZA 1W4ZA 2WIGA 1M2JA 3GEIA 1RRFA 2BJVA 2XMPA 3AEYA 1B6TA 2KBFA 3LXRA 3OPYB 1GT91 4GOOD 4XGIA 4JLVA 4IBOA 4G9EA 1KAQA 4NMXB 1HL3A 3IDAA 1A8HA 2IHNA 4QELA 2FB9A 3BJRA 1BXKA 1Q57A 2F8LA 3HRIA 5M7EA 1R4NA 1O4WA 1UBJS 1GR0A 4AFNA 2JZCA 6REQB 4EATA 4DB2A 1OAOC 2AZTA 2C3MA 1TT7A 2C88A 5DEOA 1NX9A 3NLLA 4QYIB 2KM1A 1PAUA 1U1FA 1TUBB 3RUDA 4U7DA 5C9ZA 1P5ZB 1V5IA 3H0EA 1UOQA 5D5QA 1OX6A 3KR2A 3V2HA 2BBOA 5C1OA 1R0BA 3AR3A 4OG2A 2WFZA 5ILOA 3ZH2A