1ATZA

Human von willebrand factor a3 domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
QPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Collagen-binding
molecule keywords VON WILLEBRAND FACTOR
total genus 69
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1atzA00
1L5GB 5KYXA 1QC5B 1DZIA 1OAKA 4HQKA 3EFOB 4HQLA 3VI3B 1IJKA 3N2NA 4HQNA 2VDOB 3K71B 3EH2A 4O02B 1ZOOA 3NIDB 2VDPB 2XWJI 3TCXB 1SHTX 5E6UA 1IDN1 1UEXC 1AOXA 4NEHB 2B2XA 1MF7A 3K6SB 2NVOA 1XDGA 4JDUA 3EOAI 1TYEB 2NUPB 1V7PC 3T3MB 3T3PB 4CN8A 1M1UA 2ODPA 5KYNA 1CK4A 3EGXA 4DMUB 5KYYB 3HXQA 3ZE0B 1JEQB 5KYXB 3BQMB 1QC5A 1MQAA 5E6UB 4M76B 3NIGB 2M32A 4C2BA 2ICAA 3EH1A 2I91A 1FNSA 1U8CB 3V4VB 3HXOA 1CQPA 1M2VA 5BV8A 1MJNA 1N3YA 1QCYA 2QTVA 3QA3E 2WW8A 1NA5A 1U0OC 2ADFA 3TW0A 4CNBA 1AO3A 3PPXA 4Z7NB 3M6FA 5E6SA 4HQFA 4F1KA 4G1EB 1RTKA 2XWBF 3ZQKA 4Z7QB 2O7NA 2VDKB 1ZONA 1T0PA 3PPVA 1U0NA 3F74A 5ES4B 2VDQB 3K72B 5E6RA 2ODQA 3TXAA 3BN3A 1ZOPA 4NENA 4A0QA 2X5NA 4F1JA 3V4PB 1RS0A 3EG9B 3K6SA 1JEYB 5KYYA 4UM9B 4CN9A 1MQ8B 3NIFB 1SQ0A 4MMZB 4WJKB 3VI4B 4WK2B 1M1XB 2NUPA 1DGQA 3FCSB 2I6QA 3RAGA 4BJ3A 4G1MB 3F78A 1M10A 1ATZA 1N9ZA 3E2MA 4FX5A 3PPWA 2VDNB 4HQOA 2NUTB 4IGIA 5HGJA 5HDBB 1RD4A 1IJBA 1XDDA 3GXBA 5KYWB 4MMYB 1PD1A 4Z7OB 1JLMA 1MQ9A 4UM8B 1Q0PA 4WK4B 4WK0B 2VDLB 1PD0A 3FCUB 2WINI 5E6RB 1YVPA 3EFOA 1JV2B 4C29A 1BHQ1 1AUQA 1PT6A 3Q3GE 2VC2B 3IBSA 3EG9A 1XUOA 4IXDA 1JEYA 4IHKA 4UM9D 5HJ2A 5LN1A 5KYUA 2I6SA 1FE8A 4MMXB 5E6SB 3ZDZB 1PCXA 5KYUB 3EOBI 3EGDB 1LFAA 1M2OA 3IJEB 3ZE2B 3HI6A 3TVYA 4NENB 1M2VB 3EGDA 2IUEA 4C2AA 3ZE1B 1YVRA 2XGGA 1IDOA 1MHPA 2VDRB 4WFQA 3ZDYB 1SHUX 1BHO1 4PN7A 5KYWA 1RRKA 3PPYA 1JEQA 3EGXB 4XW2A 2NUTA 3ZDXB 1T6BY 3BQNB 2VDMB
chains in the Genus database with same CATH superfamily
4QXOA 1TM4E 4MYCA 4C78A 4D57A 1ZUHA 4FNGA 4HUQB 5I4IA 2FW6A 3VPCA 1B6RA 3DAOA 3NRCA 4O02B 3QXXA 3LUCA 1A9TA 1IN5A 3V2UA 4X93A 2OCAA 3H6GA 4C0BA 2CXUA 3CF4A 3DB2A 1TJYA 2JFOA 3FVWA 4GYKA 1JBQA 5AOBA 3EEFA 1KH1A 5T6BA 1PUJA 1G9SA 1Z73A 2GBIA 2PVSA 2C1ZA 4YRPA 2HRCA 1HQKA 3KXPA 1MENA 4F9TA 3CSDA 1SOAA 4D8TA 3CPJB 1OXVA 1PUXA 3E0QA 4FBGA 4WKPA 1NJGA 1QWOA 2VOJA 2X86A 1C4OA 1X1SA 2GJ4A 3P0EA 1Q22A 1V95A 3A27A 1FJGB 3AINA 3ET4A 3IUSA 4MV9A 4X54A 4DDVA 4D9NA 1BU8A 2E21A 3U3ZA 2YYAA 3W6ZA 2R4QA 4D99A 2O8FB 2OCGA 4MI3A 1C9MA 4PPYA 5TXGA 3IPAA 1R2QA 4I08A 4Q9NA 2ZIAA 4KVGA 3D8TA 3PXCX 4OXQA 2MIIA 1A9XA 4GICA 4LQDA 2QTWB 4KO3S 1GZSA 4MVCA 4NG4A 4Y67A 4CEHB 4F1KA 1K63A 1R0WA 1G8MA 5CB6A 3PHLA 2DOKA 1SR8A 2ATVA 3F4KA 2O3TA 3OF5A 1WR8A 1QV6A 1FFXA 4ALMA 3TD6A 3BT7A 4JD5A 1E4EB 1G7CA 4J75A 4BVFA 2GN8A 3H9QA 4XVHA 5KOIA 3AM1A 3NBKA 3LOQA 3SKVA 1J0CA 3QBTA 1E98A 4GG1A 5EKTA 5KX5B 4RD4A 4ARBA 2CYBA 4B2IA 2WF7A 4PV7A 3AEQA 1RXIA 1MQ8B 2DKFA 2PYDA 3L1KA 4LRTB 3WLKX 2HHHB 1P2SA 2G0TA 3SU8A 3IL2A 4X7BA 3G9XA 5TF4A 1XZQA 1FVHA 5H80A 4EJSB 1JS1X 2GUWA 2IGTA 3IOEA 5CMLA 4QM7A 4RHEA 4XJVA 3LUHA 4PLWA 1G98A 2QRVA 4NC9A 3E2MA 4XTCS 3AIIA 3GMSA 2DUWA 3UWPA 4X3CA 3KOUA 1YS2X 3R3HA 2V7TA 1DJPA 3N0WA 4GOND 1SU4A 4XIIA 1YZ3A 3RT7A 1IE3A 2G6BA 3W6PA 2XZPA 4GLJA 3ZE6A 4D6PA 4EGJA 2CLOB 2YVQA 3A9WA 4BJ6A 4KR9A 5BV0A 3IKTA 1S1CA 2PUTA 1EM8B 2H0RA 2OSVA 2VDLB 3BFVA 3C85A 1N1EA 1LBQA 3P52A 3DSRA 4DGQA 1H94A 1OZFA 1TYBE 2CE2X 2XOEA 4YMGA 2OV4A 4TMKA 2G9ZA 4PHFA 5D84A 4QODA 1XSEA 1MORA 3PQ8A 5JD6A 1YZFA 1QH1A 1TJPB 2R2GA 1U02A 3OZFA 1TT7A 3R44A 4D8XA 3LO8A 2QR5A 2PMCA 3EFHA 2K6GA 4EYEA 3UTDA 3NAQA 1KORA 3E35A 4M2LA 3E9NA 3LP5A 4YQEA 4HBZA 5IAGA 2DT5A 1K8YB 2XOKD 3DMYA 1Q1AA 3WMWA 3WBJA 4WADA 4BB0A 3G9QA 1OY1A 2ZJYA 4F4FA 3VZQA 4OQEA 2J6BA 1YB1A 2I2AA 1U2GC 3P0IA 5CLLA 3AXTA 3DHYA 3K2BA 4LWZA 3S8MA 3QHQA 1T6BY 1W4RA 5FXMA 5H9VA 4Q9HA 4F2GA 1QS0A 3A8TA 4PNZA 2XR1A 1Q50A 4O2RA 1R8SA 3NHMA 3VPSA 1CUYA 3VYVA 1KVQA 5HXAA 5K03A 3I8OA 4NECA 1OGJA 4RVFA 4ZPJA 1ZR4A 1VPDA 2CXPA 1YCDA 2BHLA 1VYTA 2DVMA 1UK8A 3H75A 1F6BA 3EC7A 3JTEA 4JU8A 5HM6A 2VHEA 4INAA 3AG6A 4R31A 1BDIA 4D9HA 3DLHA 1DRWA 1T1SA 3FTCA 1U2ZA 4D79A 4KFCA 2ERXA 3I52A 4JA0A 2H57A 4BUZA 4KQCA 5EKDA 1RCFA 5J2UB 4DXDA 1DJQA 1K6XA 4RD6A 2GM3A 4AWAA 3OO0A 4HC4A 4P0PB 4ZXPA 3ILHA 2E49A 4KAFA 4LZWA 1IK6A 4EENA 4Q19A 1SAYA 2I03A 1W9MA 4PAWA 3HHPA 1E1QA 1NDHA 2W6IA 3EODA 2OSBA 3T5TA 1R6TA 4KKVA 1UFOA 1SXGA 3PJEA 2JI7A 5TY0A 3GCWA 4UHFA 2H07A 5DZSA 1YRLA 5CVEA 4ZZ2A 5F4ZA 2X2FA 3DHEA 1NMYA 2IYVA 5HUHA 1UMDB 1GZ3A 2Z30A 3CLHA 3DHNA 3UA3A 3V3TA 3ML1A 5CG2A 2XBUA 1J0EA 2ZRAA 1W5BA 1YBMA 2OUKA 4MRMB 3RUIA 5I4KA 3JYLA 1ONNA 5EJ9A 1Y6JA 4PONA 5J1TB 4ZMBA 5IT9A 1SQ0A 2G88A 3KKNA 2O1SA 2RAUA 3KCQA 4BC0A 3NR2A 5AJWA 3PEUA 3N39C 4MOWA 1K7YA 1J56A 3HJRA 3FMOB 1V41E 4JJEA 4OMUA 4WK6A 2HFJA 1O94D 5KCMA 5K4GA 1TLLA 2R97A 4A0RA 1K8RA 4DIUA 2AI2A 4HWOA 1IHXA 1CUVA 3N2GB 1MJHA 4BQIA 1NI5A 4FUTA 5CUQA 3LBHA 3OG9A 3OE1A 4NATA 4C4TA 8LDHA 1WETA 1LRLA 1C1DB 1OT5A 4MMYB 3A6ZA 3VZPA 5CXSA 5KQGA 3DOIA 4IGAA 4IRXA 1Z26A 2Z5LA 2ROQA 1AKYA 2JFHA 2ACWA 3T4XA 4L3WA 1RPNA 4C29A 3WLFA 3W5HA 1DKQA 5B1EA 1MRNA 3G5AA 5B7GA 2OILA 1IJFA 4N0PA 4TZ0A 4J7CA 4EO7A 3KRTA 4OREX 2AOTA 1B73A 2NTNA 3QUAA 4H15A 2CUTA 2ZIVB 1CDOA 2ZSJA 4Q6WA 1JIJA 4JLKA 3IPYA 3N05A 4CKZA 1L5VA 5JARA 1XHEA 4EG6A 1IHPA 3JWIA 3B52X 2AKAB 1USIA 5FWXB 1RWPA 4GT1A 1A4UA 4RACA 4CQMD 3FDFA 3EF0A 2JJYA 3OOHA 3ZHBA 1GRNA 4CKXA 5L4SA 1JVSA 3UMRA 1U0LA 2P90A 3VOSA 5EMHA 3I61A 1SXPA 3NT2A 4ALKA 1VXRA 3FPHA 4MS1B 1NX6A 4GKKB 3HBLA 1Z36A 4EELA 3UT6A 4RZQA 5DGCA 2QG9A 3N07A 4B45A 2DLDA 3OP1A 4P38A 3OE5A 3NIWA 1J33A 2FSHA 2RBEA 2X2EA 4GGPA 5BUSA 4PNHA 2JLYA 4WDRA 4JKIA 2N42A 5I9LA 3D7RA 4L57A 2WVGA 2PV0A 5IYZB 4BJ5A 1PWEA 1MV8A 3TOSA 1J9ZA 3GRKA 1Q12A 2WTAA 1JG2A 3CLTC 4NBKA 2WUFA 5FLYA 2O2DA 1OPRA 2FTKE 5EIFA 4JBGA 4U5QA 4EWLA 1I1QB 3TGWA 2CF5A 3OIUA 4FFOA 1A4IA 5HQ3A 2ZVPX 1W85A 2NXEA 4D4JA 2QK4A 3IAEA 3KAQA 3KXKA 3VBEA 5F7JA 4PANA 3H9UA 4KIJA 4DT1A 3D0RA 1CUEA 1JQ5A 1V1JA 4IPTA 4EJ0A 2O8CB 3K0EA 4PSUA 4FHZA 4M21A 1PL8A 2HSGA 2JEYA 4GPTA 2DETA 5AXAA 2JBAB 4JLBA 3HNPA 4KIWA 4YY3B 3I5AA 2JZOA 4UTRA 5BY2A 2J30A 1AC5A 1S4QA 5KVQA 3QA3E 2XKAA 2WF5A 4FMBB 3OE7A 1UDWA 5ELXA 4HX5A 3K8OE 2RI1A 4G5QA 4KN5A 3KKZA 5E1OA 1YQDA 5C3UA 5GAJA 2ASVA 3WSVA 1KP3A 5BXQC 4CEIA 1DT5A 2XWQA 4NNPA 5CX1A 4L75A 2ID4A 3T0IA 1WL8A 2QUHA 3ORQA 2ORYA 1QU2A 4CQJA 1NF2A 1YAHA 3HJHA 1RWQA 1JG6A 3LD9A 4DLZA 4DV2B 1QFJA 1E1RD 1QB8A 1XZJA 3K72B 1J97A 4OGGA 1Z8NA 1QH1B 4X3PA 3GJQA 3DP7A 1UM9A 1IN8A 1SKYE 2HMYB 4LQCA 4GQIA 5FTKA 3SZ3A 2DPLA 3MB5A 1AKNA 2GSWA 1P1JA 5ALRA 4PX5A 4E3WA 4U1RA 1IVSA 2AOVA 1AHPA 4EHDA 5L3SA 5IMBA 1KDVA 3UUFA 4F8YA 3UKJA 4LCJA 1YZKA 4TV9B 1VL8A 2EBHX 4MIOA 4Q93A 2QM0A 3BICA 4HGQA 4KIGA 1JEOA 2JH8A 2QRVB 3ZNOA 1V4VA 4IH9A 4LHZA 2NYUA 2F9LA 3AUFA 4GIBA 3HWX1 1P6UA 1YKGA 1FBTA 1RBQA 4GPD1 1VPEA 1WM1A 5F3WB 1U0RA 3EQ8A 3JZIA 3MT7A 4F46A 1DQPA 2WWYA 2QTTA 3COJA 3FHTA 3EPLA 1E9SA 3A6FA 3B78A 3M0EA 1KFJB 1NQWA 1VLLA 4K1XA 1EBBA 2OO5A 3I23A 3FR8A 3A1SA 3MIZA 4IWNA 4XEHA 3P2IA 1S2IA 2R2AA 3UK0A 2G06A 4RHTA 3W9BA 5K2OA 4XR9A 1NNLA 1RI5A 1EFTA 5CW2A 2DG2A 1GGMA 3HUFA 1FP1D 1GM5A 3AWIA 2QLNA 3CRW1 4NJMA 1CIJA 5AFSA 1CRWG 1IJEA 3JQDA 3U2QA 4DJTA 1DUSA 3C97A 1MGPA 1XQXA 4FOLA 1YDEA 2AOTB 2VKTA 1SA0B 4CLXA 1ZD2P 3B8EA 4J90A 2X7XA 1MBZA 2C2ZA 5AVXA 2FXIA 3OT5A 5HCUA 1U98A 2UYOA 1XD2B 2YICA 2E6KA 3DCJA 3TPZA 1DBPA 3LA6A 4YNBA 4IJUA 3L0OA 4MO9A 4Z3DA 4EJ2A 4D4LA 1C1DA 3S6JA 4EYKA 1U3FA 1XMIA 5JVDF 2HW8A 2AYYA 2C2GA 2HV9A 1Y37A 2JLZA 4ARCA 2I7XA 5HKAA 1VC2A 5SYMA 4HVLA 4JJZA 1JH8A 1K66A 3Q87B 4C0QC 2F1JA 4ZI5A 4AZWA 2GVZC 5GZ3A 1WXXA 2VQ3A 3RYFB 1NKSA 3FMPB 5ADVA 2QTAA 3IQWA 4WV3A 3AR5A 2EP5A 1J24A 3E53A 5ALPA 3EULA 4MLCA 2ORIA 2R6JA 4PLHA 4DMUB 4MGZR 4BO8A 1V8PA 1QC5A 2X42A 3Q7PA 1YDHA 4RHXA 1OMOA 4LHWA 3RHZA 3QSYA 2OFXA 3Q1KA 2C82A 5EPEA 2JEZA 4G5FA 2XUQA 4PG4A 1E7QA 3F1KA 2BTEA 1NULA 1X1TA 4OO3A 2C94A 3DR3A 3LDFA 5ED0A 1QB7A 3HKDA 2P6RA 2GZSA 1EFVA 4QJ4A 2HEGA 3INYA 5FWYB 2WJ6A 4W5RA 3I9LA 4RH1A 4KFTA 4TWBA 2PD6A 2O0JA 2C04A 1IY1A 4PAOA 4UBOA 1T6NA 2VDUE 2IZ5A 4ER7A 4ESVA 3TLGB 1ZH4A 3KUUA 4GC5A 4HB4A 2RI6A 4RULA 5EINA 1IVNA 1L4YA 1GCAA 3WFZA 1UXHA 2PX4A 1YOVB 2ZDQA 3MS7A 4A0QA 1L8OA 2JDIA 3U31A 3I9V1 1BFDA 1JEJA 4OYYA 4URYR 3ZY5A 4DOMA 1ECFA 5AVKA 1XKLA 4B40A 1SKUA 1ECBA 1MX5A 5DOZA 3LECA 3KTAA 3NWEA 1NQ5A 2I4OA 1YUNA 3F3SA 3TW6A 3RC1A 1YHNA 4NBTA 5HM8A 3R0JA 3IEKA 4MW7A 4UUMA 4HX2A 1E2IA 3Q1LA 4FFSA 4OHMA 3VR5H 4YVFA 2V74B 2A9RA 4PC3A 5EUBA 2G1AA 1Z56C 3DE3X 1SIWA 3K4QA 1KL7A 5IKOA 3H5RA 4EF5A 1FDIA 1EGAA 5KYWB 3NEJA 4LJRA 2GZMA 1QVWA 5EE9A 1PDWA 1FSFA 1X13A 3M6WA 4JELA 4LDRA 2P6MA 1YVPA 2DPGA 2R5FA 4M6WB 2FR8C 3WWCA 2DP4E 2JARA 3DE6X 2WSYB 3HUEA 4KLAA 4TMFA 3AUSA 4XI9A 3AI3A 4CG3A 1UF9A 5I51A 1UJ6A 5HHTA 5T6MA 3NHKA 1KI6A 5LMUB 1M7BA 2R6CA 1U31A 3IAS6 1J5PA 4X44A 1AKEA 2VPIA 4K6HA 4RNDB 1LUAA 1G3UA 1ADGA 4JT8A 4RXUA 3VPGA 1VHJA 2Q2QA 1NF3A 2YV5A 3KQVA 5LP6F 5J3JA 1QRRA 1GNLA 3JVIA 3FLBA 2GF2A 3PFGA 2R84A 4OKSA 4B44A 2WSLA 4B9AA 3OQNA 1Q19A 4LZNA 3U80A 1OXBB 2HM7A 3E7FA 5IN5A 1DXOA 3GT4A 4J4HA 1FSSA 4J0QA 1HWYA 2W2NA 5AJHA 1T3HA 2I9PA 4Y6LA 2P9ZA 5A71A 1EESA 4K05A 4JQSA 3ACDA 2WU0A 1C80A 4FOPA 4ZQFA 1PWXA 1GZ6A 4PWZA 1PZGA 2Z4TA 1U6JA 3CZ4A 3SHWA 3UFBA 1D2RA 4B43A 3EUWA 2DCUA 4C7MA 4CW7A 2FWIA 4DQUA 3IAHA 3IJRA 3DBRA 4NBUA 4GXTA 1M5TA 4J2TA 2PLRA 5E3JA 5E7MA 3RR2A 1M2WA 1NW9B 3KHTA 4ARSA 4F1WA 2AR9A 5AHRA 4F2HA 3DKPA 3F2IA 3FNRA 3N8HA 5G0TA 4KDEA 4I36A 1UC8A 5JEDA 3O21A 4H4EA 5CVUA 4IIJB 1MDFA 2I87A 2C4UA 3KOMA 5HSGA 2ENWA 2AWNA 5DHRA 5KTYA 4C5AA 1UBUS 5D51S 2GAJA 3BD6A 4HX9A 5FV7A 5J1SB 2XCQA 3U44B 3DBOB 4EG4A 1RBMA 1VOTA 1C8KA 4DEXA 3BREA 3IB6A 3V7UA 4DCJA 3PE4A 1B15A 2G0NA 4TQAA 3VNRA 2BEWA 2P40A 2QE6A 2QN8A 4FUQA 4Z4EA 4QHTA 5I48A 1DC8A 3LRPA 2EGUA 2WM2A 4MS4B 3D2CA 1M2GA 3LU1A 4I50F 1CS4C 1ENOA 1H05A 2HWUA 2H1HA 1I6KA 3FFXA 4IY1A 4CNBA 2GETA 3TLMA 3ADCA 4BFVA 3MWJA 4LFAB 2PKEA 1NRIA 2B0JA 5HE9A 3RPEA 3G85A 3VVMA 3ZX4A 1LTHR 3VHQA 2UUBB 4YHBA 1XTJA 1XZ8A 3I09A 4RMHA 5IW8A 1B23P 1TD1A 1CTQA 5EHNA 5EKXA 9LDTA 3P2YA 1ECJA 2G5PA 3OETA 1KGDA 4NAHA 2EERA 4P4TA 1OYWA 2ZG6A 2HNAA 2Z8XA 5H1YA 3E7PA 4YA6A 4GM1A 4NENA 2QQFA 4CI9A 2A1UA 4DLAA 2QL5A 3OTWA 4M9UA 3V4PB 3WGYA 1HEIA 1NRWA 3HGTA 4NU8X 4M0CA 1GRQA 1N2SA 2JGJA 3DT9A 3GLGE 4J6EA 4PCLA 1HNZB 5DHPA 3PRYA 5DHFA 2I6FA 3QPVA 1PSWA 4GOLD 2JLWA 4FILA 1J07A 2XODA 4YB8A 4HNVA 3U7EB 2WKRA 2Z9BA 3BRCA 4KWHA 1ISRA 4X8OA 821PA 1YR7A 3DLBA 2AWOA 1YQQA 2IVFA 4R51A 1WG8A 4MNTA 3PEWA 4HZUA 1A5AB 1X80A 4YP7A 2FE1A 1VIAA 2C0QA 3ROQA 1K8QA 3JPYA 4KHPB 1MQ9A 1L7OA 2IYSA 2QD2A 1LKZA 1K5HA 3F8WA 4G0PA 5H70A 5FR1A 5D3QA 3UGQA 3EGCA 4R2WA 2NZ8A 2X2OA 1ZD9A 3W3AH 5KSOA 1M2HA 3PPIA 4X1IB 2XNDD 3QPWA 4BIMA 1FBNA 5C7YA 1TMGE 5BWNA 3CRMA 2RD2A 1B3BA 3RVLA 4JUDX 2YJTD 5CDHA 1Z2DA 1G20B 2PXXA 1MC5A 4KU4A 4I4TB 1E5VA 3L8FA 3KLNA 2PMDA 3NKFA 1GPDG 4CM4A 5F33A 1Z0SA 1DC7A 1M6YA 4OI2A 4ZN6A 2PH1A 4D80A 1OAOC 1POWA 1QJ4A 2QN6A 4E6PA 1S8OA 5C3MA 1SVSA 3N6XA 2H0AA 2P1DA 1UQUA 1ZEJA 4AQYB 3FY4A 1A69A 2IYAA 1UJCA 4TSFD 2WUWE 4CEJB 3J7AC 4LJ7A 3DMPA 2PIDA 1VE1A 3OU7A 3ZY2A 3T1YB 3L6DA 1N3IA 2PSSA 4R1PA 4RH0A 3RAEC 1LBHA 3VC2A 3VUEA 3NBMA 5CYOA 1U4SA 4X63A 1N6OA 1GU0A 3ENZA 4YPFA 1P75A 2J7PD 4EAQA 1OAKA 5AM0A 2AKEA 2O8NA 3F7NA 3SR4A 4F3RA 2XCUA 1DAOA 2NU7B 1Z06A 3ETHA 3L0PA 2DHCA 3UUGA 5J4YA 3WZ2A 4EW1A 4TTPA 4JC4A 3EZ9A 2G17A 4HWTA 1LV7A 1GTG1 1S3GA 2D1FA 2FKAA 3GL9A 5ALXA 4WBNF 4GX2A 2YXEA 2XNJA 4KPGA 1NATA 2OLEA 3G9TA 4WOBA 5I7HA 4ZALA 3ND5A 3ECSA 1T1RA 4Q24A 2F55A 3HKEA 1KF0A 3R6DA 2ZI9A 1JAXA 4AVYA 5LWQA 2WJWA 5F7XA 1OBFO 3EC1A 3I72A 3WX0A 3GZ4A 5KX5F 3GRVA 5HIAA 4R1OA 3CRNA 3DBHB 4A2PA 2HA6A 3G2KA 1XKXA 4H17A 3S81A 3TAHA 3I5MA 1BXRB 2XHEA 3U49A 1Z2EA 3BD8A 3DP9A 2G80A 2VF7A 1ODCA 2WF9A 5LJIA 3MMXA 1DPFA 1FVFA 3OPYI 3P9XA 3DOOA 1RTTA 2F64A 13PKA 3FI0A 1AN0A 1NURA 2P3LA 3CA8A 3GFVA 4DHEA 5GIPE 1GUYA 1SBCA 2B2NA 1HYQA 4ENVA 1YQWA 1JVBA 2JGAA 4V38A 1KEPA 1WHTA 2XUAA 4XFJA 3PD7A 4RADA 5DCYA 5E6RA 1D9XA 4BNMA 3VDRA 2XAAA 3MT8A 2GFHA 2ZAIA 4BWFB 2Z08A 3AJRA 4JVMA 3RU7A 3C6QA 3TDMA 2Q8NA 1SG9A 2VCEA 4P7FA 3CUEF 1G8PA 2R4TA 4U5XA 4HEA1 2OXFA 3DTNA 5T67A 3VX3A 3PVCA 3M83A 2WG2A 4FFWA 1JZQA 5JJCA 1PVOA 4K3VA 2BMVA 1PEDA 3IOMA 5H16A 4R9UC 3QOWA 3FHJA 2PGIA 3HB9A 4N5NA 1TQ6A 3E15A 4GSYA 5DP1A 3AVXA 2ZR0A 3V4SA 4QRHA 3TAUA 3HBAA 4GLLA 3FNHA 1V1MB 3IKJA 2WAAA 1RI4A 4JI3B 3GLIA 2IBSA 3PC6A 3OZIA 4N12A 2DUNA 4BQNA 2FPSA 1YH3A 2GSDA 2ETVA 2YOFA 1V35A 4D9CA 1LSJA 1LEHA 4JS0A 2HXGA 4GQBA 1KJ9A 4HTFA 5B4TA 1V26A 3RVJA 3CVWA 4WD3A 4OFBA 5FBWB 1VRVA 1BU5A 4YV1A 2BI8A 5TPZA 1Z34A 4PQRA 2LIVA 4BP3A 5ALNA 4YRDA 1WQ4A 1X7DA 1PLJA 1TK9A 4X64B 3UN1A 4AFNA 4DRXA 5BUCA 4M0FA 4TMWA 5AUQA 4JQZA 1XV5A 1UOPA 1A76A 1C9YA 3E81A 3R5XA 4H7IA 4OQQA 5GOTA 4EYGA 5KTNA 2BCGY 4HYQA 4QEDA 3UJHA 5CBPB 1JAIA 5JAUA 3CVVA 3C7KA 4XCXA 5EXDA 2FWNA 4H6PA 1Z0AA 3CRZA 1S9DA 1FFWA 1ZAKA 2WT8A 3RS9A 4B31A 4BLUA 2ECFA 5CH5A 1BX1A 3DZ8A 3GPCA 2BFDA 2I1WA 3BE5A 3KVRA 4IIBA 4LRUA 2I78A 4A6DA 4BVEA 5A4MS 3IBTA 2ZZMA 4J0GA 5K8TA 2PUGA 2WB4A 3GEIA 1YU6A 5DISB 1Z82A 2W2VA 2O7SA 3FTNA 1N5DA 4LJSA 3I9JA 4S04A 2X3FA 1FW6A 2A5GA 2CLCX 1E2PA 1TU0A 4QVKA 4ZQBA 1SXHA 4OK3A 3TEFA 4DR2B 2VWQA 3I8SA 3AR4A 3H8JA 4LNUB 1PZFA 1U04A 2WG1A 1JHRA 3Q9UA 2QN9A 3QOYA 1K7CA 1ZM7A 2W48A 1U8AA 3KHUA 3ON5A 3RVQA 2VJMB 3WQSB 2JVKA 1EK1A 1W88B 1JLRA 4FWTA 3DE7X 2JGKA 3PNOA 4WOJA 5K3FA 1C8LA 4RKWA 4DYVA 5ESXA 1ECPA 1XU7A 3C6BA 5K3AA 4IFBA 3CCBA 3F67A 3C8HA 2KE5A 2X0FA 4FU0A 4CIVA 1Z08A 4UVDA 3VUFA 2DMRA 3IMKA 3GFBA 2CZGA 3ED1A 3EVFA 4L4RA 3CY6A 3Q85A 4FCVA 1H9BA 1VBNA 2EL9A 2ODNA 1BE6A 4OI0A 4LJAA 1W2GA 1Y9ZA 2IOHA 3RRNA 1AHHA 1U8CB 3D8HA 1IULA 1ZRNA 3STTA 1EX6A 2FMIA 4JLDA 4IKOA 3RVOA 5ILGA 4JB8A 3TB6A 1R1DA 4JMLA 3IEVA 2ZWIA 3L8MA 3HVIA 2NO1A 4DRYA 4QD3A 1KEUA 3TMYA 4TTRA 4ZAFA 3X1DA 1BW9B 4QU5A 1KO7A 2VSYA 4QDTA 5H3HA 5IUKC 3MVEA 5G0SA 3GEGA 4CG0A 2QZZA 4BN5A 1GU7A 1NUUA 1KYZA 3CURA 1Y1QA 4DPMA 4JYMA 2Q5IA 1GVHA 2RC5A 4UHEA 1UBJS 4P5DA 3THWA 4QYWA 2Q2OA 2PR2A 2HMTA 3RS8A 5LIRA 1AKTA 1XCLA 3FTPA 1P3Y1 5A2GA 1XRSB 1RXWA 5D8DA 5J47A 3ZZUA 5CDYA 2CNDA 2OFOA 5IDWA 3KOXA 4L4UA 4LTNA 1F6DA 2FUEA 1V8FA 1Q7TA 3CV3A 2L82A 3G0DA 1CCWA 4X8MA 2B4QA 1B1AA 1HOTA 1ZM9A 4RSGA 3VNAA 2XQKA 2HMAA 2BZGA 1KETA 3QUQA 3R4CA 1VJCA 2C84A 3PHBE 4FXPA 3WZLA 4IGKA 5ALIA 1SKYB 2C1EA 4IQ4A 3RQSA 2XT0A 2FLWA 2IZ7A 5BUQA 2AZXA 2V55B 3D3QA 3FNQA 4B3IA 4D43A 1N8KA 3DBRB 3TTXA 4YV2A 4RNCA 4ZI7B 5K09A 4WGGA 3V32A 1PEAA 3TH5A 4CZ2A 2VTEA 3RTCA 3E0XA 4AX4A 2W4MA 2NU9A 2X4GA 3GJ5A 3HXKA 1ISGA 3OKPA 3OTQA 4P31A 4Y2XA 1EXNA 2H1OA 2AH5A 2BRUC 4B3RB 5G40A 4BLRA 4IMIB 4YCCA 5HBGA 2PIAA 3PXBA 1NXWA 1W29A 4MWDA 3RBVA 3VGPA 4DCOA 3MWDA 5F3RA 1PJ8A 5HA5A 4KRFA 2H4WA 2JS7A 3HSSA 2QRQA 2VQSA 3NTRA 4JV5B 1AV6A 1U28C 1R5NA 2C03A 1LLFA 2OHIA 1OFIA 3E18A 3IDFA 4PEVA 3RW9A 2YWFA 4COKA 4QLBA 1CEEA 1P4RA 2ZUUA 2O2XA 3RVBA 2JZNA 1J70A 3SM9A 5CA0B 5JC1A 4A6PA 3CH6A 4MIKA 2LIPA 4RESA 4Z9FA 3R6WA 1W5TA 5AP9A 1OIVA 4HSGA 4ZO6A 4LJLA 3RSFA 4JXXA 1PQYA 1XDUA 3KEMA 3S7TA 4F2PA 5IBCA 2BEJA 4Y1GA 5FPYA 4CEJA 1ZPDA 2WJPA 4RF4A 4NMWA 5K6AA 4GZ3A 1M3SA 3DEJA 2P67A 4FR2A 1L5KA 1DAEA 4RPGA 3W8FA 3NZEA 1GYQA 1D2GA 1VBKA 4BNTA 4HDQB 5DGDA 2E4XA 4Q3EA 3ILYA 1VL6A 4QDZA 4WWHA 5A5VA 4W7SA 3TZKA 4HQLA 4ETMA 4KXUA 2QRKA 1YCFA 2VEOA 4IV5A 3WO1A 1DBVO 1YTUA 5LUAA 3Q7TA 3RBXA 1NI4B 3KM0A 5I45A 1E5DA 1XL1A 2VAWA 5IDVA 3UHOA 4C3ZA 1X1BA 1YHYA 1W8DA 2PLFA 3IIJA 3JSXA 4NCNA 1XPUA 2QE7A 3ESQA 3KTAB 3RU3A 2XT9A 4WINA 4D3XA 2VIIA 1DPGA 1Y1SA 1P7YA 3HZHA 1JJBA 3DNFA 4YTEA 4BJ1A 1BGWA 2JBHA 1HLGA 1RE0A 1VMKA 2B8JA 3ED5A 4JUCA 4EUHA 1EQAA 2WNIA 1H22A 5IVIA 5M3BA 5FJJA 3PRHA 5IKXA 1XC7A 2YFKA 2FJ0A 4URZR 4ZT7A 1Y81A 2CT8A 5T7BA 1N92A 4NYIR 4HWSA 2C98A 5IBQA 3SC3A 3FHCB 5L53A 2AN1A 5CH3A 2YCBA 4RQAA 3T94A 4II3A 5BRJA 2P1ZA 1KSFX 1R27A 4LMAA 1PJ3A 3DTVA 3B1KA 3LPCA 3LRTA 3WBKA 1ENZA 3OJEA 5AM3A 5HKKD 4IZOA 1I7SB 1HUQA 5LQMA 1ZD4A 1MEEA 3GZTB 3F9RA 3TUJC 5THKA 3INGA 1GL6A 2PMFA 4DV1B 3RHSA 4OLAA 3LK6A 1U3WA 4GPAA 4QUEA 4OX9B 2RHCA 2Z4SA 1E6EA 4D96A 3EQ6A 3JQ8B 3IILA 5TS3A 3O47A 3O8NA 3QM1A 4F6LA 4B3GA 3HR4A 2BP7B 3DEAA 2RHOA 3G0CA 2CMGA 3GFFA 7AT1A 3R5FA 4I1YA 1E1RA 2QMZA 3HCRA 1MXHA 3SJZA 4JI6B 1NSTA 2VBCA 2GEDA 1LPSA 1RRVA 1JSZA 3TCNA 1E3MA 1YT5A 5FB3A 3CXUA 4OOFA 2O1WA 2W98A 2JW5A 5FOTA 4UQPA 5C1DA 4KITB 5F9HA 2HADA 1OPXA 1S0UA 4K0RA 2C7GA 2WWVD 1UBNA 4ZICA 2QMYA 4IDGA 1FRQA 3FCEA 4L9SA 4OLHA 5DXJA 2ERCA 4YACA 2HF8A 5I9NA 2Y1DA 1RD4A 1G3IA 4J0KA 2ZYTX 3O73A 2Y05A 3R75A 1M1NB 4KQJA 4WZAA 4JMPA 2ZE7A 1I8TA 1CEYA 2HTEA 2W0SA 1Y5IA 2TMYA 4CTJA 2MHCA 3E3AA 5JU6A 2BBTA 1QPZA 3P19A 4HNAA 4NV1A 5AW5A 3URMA 5LL6P 3OIDA 3B1FA 1VKOA 4N9QA 4P7KA 5FBQB 4YMHA 3REFA 4DMCA 3PNLA 4IIJA 4EH1A 3F2VA 1C0LA 1LSUA 2HCJB 3NDIA 4PCAA 5EWLB 4XYLA 3GZJA 5DXAA 5KNCD 3UB2A 1BHJA 3OX2A 3BMNB 4X61A 4AZVA 5LDDC 3M4ZA 4LE0A 5LYJF 5E9QA 1UZAA 3TQFA 3ZGZA 4Q21A 2QIPA 1P0PA 2BC9A 1JUDA 1OLXA 1ZGZA 4FPXA 3LT1A 4FC6A 1O95C 2ZT5A 4D42A 1EJ6A 2VZ0A 1SUFA 1ZJJA 1JZSA 3UG7A 1QGUA 3BEOA 4B3SB 4LF5B 1M8GA 4HNTA 1U4OA 1HDOA 5AOCA 4J3NA 1R0BA 1NNUA 5F51A 2VJOA 3WP0A 3RG2A 1E61A 1GUBA 1G7RA 2FSUA 4OJKA 7GPBA 3ZOZA 1YOBA 2WE7A 2CGEA 2RAFA 3USES 5JTUA 2FWBA 3HU3A 4GH5A 3D0KA 1W0JD 1GSHA 4QECA 5CW1A 5G4KB 6NULA 1GITA 2EKLA 2IIPA 3LWDA 1EP2B 1NLMA 1RVV1 1ZUIA 1XAGA 4JWKA 5DYYA 1UT5A 2GUGA 5FBZA 3SZRA 1S1MA 2W4QA 3U7QB 3OZBA 3MW8A 4MVJG 5AYVA 4C76A 3FCCA 2PUCA 1QVRA 1KI6B 3N0TA 5KNBD 1NU6A 4H3HB 1LS1A 3QKUA 5IXYA 4F3TA 3N70A 3DWEX 2HDWA 3NH9A 3GLUA 3WP1B 4H31A 3I2KA 2X1HA 3E70C 2WILA 1EI9A 4HDSB 4BWGA 2EX0A 1Z8FA 1SCUA 2PUJA 2WG0A 1DHTA 4GI7A 4KLNA 4TTTS 1LI5A 5GGYA 3RUPA 1UOOA 2M1ZA 4J16C 4QA9A 1JKMA 1I7QB 3JQBA 3KJGA 3O7MA 4R8LA 3H7AA 5FI3A 1U4NA 2CHUA 5ANRB 3TW4A 5HYVA 5JANA 1GQ2A 4IKPA 4DILA 2WVAA 3C45A 3J81A 3I9NA 4ZEXA 4O5AA 1Z37A 3WL7A 4O3MA 3TQQA 3LY9A 4A26A 4CEIB 2H3EA 4WKBA 1Y1LA 1I4TD 2UYGA 4QX6A 4GD3Q 4QWMA 1AS2A 2C83A 2BDTA 2FFBA 2P6NA 2WIGA 4MV3A 4OQNA 3BTSA 4QUDA 3ZQKA 1L1EA 2XD9A 3K0BA 1AGNA 1E8DA 1IN7A 1RXYA 1J22A 1R4AA 1EHIA 1N3BA 2FOLA 3KUKA 1N0HA 5FBLB 5KREA 3GD5A 4ZVLA 1WU8A 1X7YA 1AHIA 3HA3A 4R2JA 3ZY4A 1KI7A 1P1IA 5JXHA 2AR7A 5KIAA 1Q17A 2NXJA 1TC1A 3SHOA 1JA9A 4IYJA 1QHEA 2Q0HA 2Y1KA 4X3OA 4B7UA 5MGNA 4U7WA 4MUFA 3KYBA 2X41A 4XVCA 1Z28A 4JK3A 1MABA 1W85B 3B6EA 3GCXA 3RAGA 4UMDA 2ABWA 1E0SA 2BFPA 1NE2A 1XLWA 4ED9A 1TF5A 3N2EA 4LZZA 3RYCB 3LK7A 3LDAA 2PX6A 4IILA 4XIFA 3IALA 1WEKA 3LCJA 4MPPA 2J32A 1VZ3A 2I2BA 3COZA 3OKAA 4KXWA 4L15A 1V4BA 2FJPA 2HJ9A 4YCDA 1NI3A 1LPMA 1JL3A 2CNNA 3H6KA 2QTNA 4TKVB 4MUAA 1O8BA 1XZPA 1IFXA 2BDUA 3CVOA 5J59A 3NBQA 3F5MA 3R0XA 4LRWA 2IJGX 3DMTA 4KBGA 3N3BC 2R8YA 1Y4ZA 3AVQA 3I1FA 3NLLA 1TUBB 3R40A 5DV9A 3SS7X 3ZCSA 1DEXA 4RW0A 5JQWA 1SUSA 3P5BA 3ZDAA 4GDMA 2N46A 2M6SA 5BURA 1IRIA 1UOEA 1OB2A 2JKVA 3P20A 1YZGA 2IEAA 2H11A 3CZAA 1E96A 2QUAA 2XH8A 4FSHA 4GM0A 5T5QA 4RX1A 1XCBA 1PU2A 2Q5HA 2Z8YM 1J00A 3E8SA 1I9CA 4AWBA 2YOHA 4RANA 4UXJA 5LYYA 1QHNA 1N2BA 2OV2A 2WY2D 3RT1A 5BVGA 5JW6A 3PYXA 4AKEA 4RM2A 2BRUA 1AUOA 2KB0A 1YJBA 3VKUA 2F00A 3JQGA 1W581 1WW2A 2OHXA 4JLOA 1YSCA 2FPRA 1WB4A 4L7VA 4LAFA 3ZIAD 5AVZA 2ZKLA 3B9PA 3KQUA 5G1PA 3U4GA 3TL6A 1DAHA 1A27A 3WK9A 5EE3A 4M89A 1A9SA 1KNXA 1E1MA 2JASA 1I33A 2PZBA 4UUOA 3DL4A 3JAKA 3VRHA 2I4MA 3HY4A 3M34A 2DJIA 3GBPA 1MNQA 4MUYA 3G5UA 2AEMA 2FPPA 3KYCB 1YBAA 2VO1A 2F8LA 3ZGNA 1CF2O 2XTMA 4QOGA 3Q3JB 2PFGA 2JHGA 3AHHA 1PJCA 3BYZA 3RJ9A 2NVOA 4OMCA 2V7GA 1PJRA 1VTKA 1GILA 3O38A 4H1UA 1YIDA 1QTNA 2RG7A 4MQ4A 1BO6A 2JEOA 3C1UA 3QNUA 4CI0B 3EDQA 3WLOA 4LWOA 1R10A 4LRYA 1NFQA 4MVXA 1UQTA 2OMKA 2WJIA 3MLAA 2V3VA 3TINA 1RI2A 1CQZA 1RLUA 2DERA 2ACEA 2OPHA 1C3EA 3OT4A 3WLNA 2E85A 4RVHA 1D6NA 1OBHA 3FKQA 4L0QA 4P0QB 1GNRA 3EVNA 3GEEA 1OX4A 5GGXA 2ZBPA 4OHWA 2Z5FA 3TEJA 5H8WA 1JE1A 3VH3A 2O50A 4AYXA 1JQAA 4MWZA 4P3PA 5I7VA 3JSAA 3GYGA 3PC4A 2IYPA 1H2FA 3G6WA 4Q3LA 3SFVA 5CJJA 2BWJA 1A5SB 1UM9B 2RHMA 3FWKA 3I05A 4BMOB 5DN6A 1V5IA 1DL5A 3V8NA 3ZXSA 4AIRA 3S7ZA 2JFBA 3U1TA 3DFIA 4UARA 4GRIA 3LHSA 4UVHA 3HYRA 3MAJA 3FZQA 4KQ2A 4S1VA 4DJJA 3PWZA 4D82A 1QE5A 3IIEA 3ZWKA 4LOKA 4U9IS 4F9EA 3ZJYA 1KO1A 2QP4A 5AOAA 1W4CA 4XFKA 3SDZA 1B8UA 4N6NA 4O5OA 3VU8A 3HSKA 3PC7A 3D0OA 2Q9CA 4LKRA 5F5NA 2VK4A 5AD1A 4YJ2A 2O5EA 1JMYA 2GZ3A 4TM8A 1U7HA 3CCCA 4WPGA 2ZWOA 4RVNA 1QFSA 2VAXA 1EB9A 1LS6A 1UJMA 2DH6A 1LSSA 2VWPA 5BWMA 5CLQA 4N0EA 3GRCA 5DMXA 4RYLA 4B7ZA 2VT3A 3K9HA 4O4IA 3ZZ1A 1UP6A 3W6OA 3U4HA 2GF0A 5B3JC 4FYWA 1EKXA 2EJBA 3PUZA 2YHUA 1JIIA 2OAEA 3O9VA 1FUYB 1RIFA 1JLMA 3TQTA 4AP6A 1MDBA 5GONF 1PLKA 3GUCA 4PICA 4A16A 4PNEA 5ICEA 4G0WA 3ZEAA 3F49S 3JALB 1TM7E 2WFLB 3PXEA 4R6WA 5E3IA 1F4PA 2C0PA 5JZSA 1N9GB 5C2JB 1ZU4A 4U9UA 1PT7A 4ANFA 1LPNA 2OP1A 1O7JA 1P61B 3PDUA 1E9BA 3NC1C 2VPYA 4N49A 3CW9A 4LY9A 2X8WA 3GLGB 2XTNA 3WKCA 1NDUA 2YHBA 2ODTX 2BFFB 2IDJA 2VT7A 1V45E 1M34E 1S2NA 3C6YA 4RCVA 3VPBA 3BGOS 2XA9A 1AZWA 1DJMA 3A1VA 2OVBA 4K9SA 2UYYA 4NQRA 3UC5A 1HMYA 4N8DA 1R5JA 4JT9A 3FRHA 4ZC8A 4GZ6A 1P1RA 1VPLA 3EGXB 4G4SO 2AJ8A 1GN8A 2IS1A 5IXSA 5IN4A 5JS1A 1NVFA 4JZKA 1Y8ZA 2NMVA 1WUYA 3V4ZA 4GVLA 2FPOA 3T0FA 1K7XB 2YN4A 5EWMA 2A0FA 4FZVA 3QU4A 3T8YA 4LSGA 1ADBA 2D2VA 1XZKA 5ITZA 1YZHA 5LB4A 1KZ7B 3NHSA 1Q91A 3ABRB 4W5NA 4ZEOA 1WXHA 1ZY2A 2DQZA 3GJ6A 3H3XA 4OJMX 3USCS 1LQUA 4NOLA 4UEOA 4EGQA 4EHFA 1R66A 3N2KA 3QNMA 3FOCA 4M9XA 1RYMA 3LUJA 1Z2NX 2C9DA 4B79A 4M8LA 5JSYA 4V0RA 4GBED 3QJ5A 5F4BA 3AKYA 5FPHA 3IOYA 5A7HA 2NO7A 3DQPA 5CIYA 2CXNA 2ZQ5A 3AEQB 1Z83A 2DHEA 6LDHA 2A6PA 2P68A 1EFCA 3GA5A 3QOXA 4QOJA 4XX1A 4JR1A 4RTKA 3OCWA 4A5OA 4F06A 3WAGA 4NICA 1YU9A 1WDLA 3A58B 2VPPA 1K9VF 1PR5A 1TUIA 2J87A 2YHSA 1XZGA 2EG5A 3AESB 3FSGD 3KEFA 3BXXA 1NUQA 4B3BA 2J67A 1WO8A 3K16A 4B6EA 5FUQA 1E3TA 1IY8A 5FEMA 4G5SA 1G4AE 5IMSA 4FLMA 2A0KA 4PQEA 4FLEA 2H1CA 3P2KA 5E4YA 3W8EA 2GN4A 4ZO9A 4ERNA 5A3RA 1P39A 3LS2A 3WVNA 5KO2A 2WD9A 4Z7QB 5EUCA 3I32A 4QU8A 3G79A 4YFYA 3DDUA 3PXXA 5IAKA 1E64A 1LPOA 1UJ4A 3SDSA 2I67A 5CEEA 3PR1A 1Q1NA 4JNKA 4UOQA 3TUZC 1TU4A 3DE1X 3FHLA 5K8JB 1RAGA 3IMGA 1E7SA 2PSJA 4QGBA 1R6BX 5CCBA 1RQXA 1CB0A 1WUKS 2JAXA 2XDQB 1QFZA 1D4AA 3KX2A 1VRWA 1WMDA 3G68A 2IITA 5JMTA 5MN5A 4RIFA 4I1IA 4TYYA 3GNQA 3SFTA 4PLPA 3UO8B 4WBNA 1CNFA 1YVUA 3B5EA 4NQZA 2I2CA 4TRRA 5K0ZA 1RQ2A 2QUZA 2FPIB 2R48A 3KB8A 3PA6A 4E88A 4EG8A 2WKQA 5E7JA 1NIJA 2FW0A 1KMIY 3C24A 4I9NA 1DX4A 1KMNA 2QPOA 4LTDA 2DBVO 3OEYA 2A78A 4HUQA 2NU8B 1CERA 3HUUA 4H08A 3GW8A 4DG9A 3QQ5A 3T99A 4IHJA 4A2QA 2MU1A 1A95A 4FCWA 4G25A 2P2ZA 2VRBA 5FOSA 1ZAYA 1J42A 1FP2A 4Y1FA 1I7DA 4AS3A 1IL0A 2QW0X 1Y3DE 4P3KA 3RS4A 3R77A 4LXXA 5HW0A 2BJHA 3UMMA 1LK0A 5FOVA 3LPLA 2R8BA 4JB0A 1DDIA 2AZ4A 4MX8A 3RRXA 4Q1DA 1Z0JA 2OESA 1T0BA 1ZQ9A 5TGZA 3Q0IA 4ID3A 4MUHA 4B3TB 1PR3A 3S0JA 2O7VA 4MITA 2HIAA 1OREA 3PU6A 2ZROA 3U0VA 5AQ1A 4F4IA 5A5FA 3A1FA 3DVAA 3RABA 4FI3F 3PS9A 3RF7A 2ZUWA 2QGNA 2WYHA 3U9LA 1C1XA 3EQ9A 3FFWA 4PPQA 3FSRA 4TL7A 5JDCA 3L8ZA 5BW4A 4OFZA 1CP3A 1Z5ZA 4W5HA 4Y2HA 1Y9EA 2B1JA 4G0UA 4OYHA 1HQDA 4X95A 4L8VA 3FLEA 4QL3A 4XX0A 4OHYA 2R1TA 5TVGA 4ROTA 2JJ2A 3KT8A 2H4ZA 1EH5A 3IFSA 3OLQA 2DT8A 4CF4A 2R7LA 5EEGA 3BQ9A 4KZKA 3LCMA 1WBBA 1J25A 1GLVA 4PLCA 4ESOA 5D5QA 5ALQA 5KQRA 1KJNA 3NIDB 1U8UA 3WV4A 4UMVA 3LCCA 4N3AA 4XSVA 3ZDBA 4YECA 4EOGA 4QYXA 1NP6A 3KEGA 3I92A 2BKUA 3CN9A 3NDPA 1KMHB 5JAHA 4TVKA 1ZHFA 3A4NA 2Z58A 5KNDD 3KV1A 3ZHYA 4UREA 4BNKA 1TVKA 4R2KA 5JD5A 3JZFA 2YMLA 3NIGB 2HBYA 4OU4A 4R3NA 2Q6VA 3SZGA 2JIBA 1QYVA 4F56A 1VPWA 2QUIA 3SR3A 5A3JA 1A8PA 3BWVA 5IJAA 1W93A 3SQNA 4EJSA 4OUKX 3SHVA 2XAUA 3GDFA 2J31A 5EA2A 2XI4A 2ADFA 3MCVA 1EUDA 4FYKA 3NHFA 5EIOA 2BSAA 4O8ZA 2GKGA 3VYTB 4B6GA 2HTFA 2RGUA 2XXAA 5J4KA 1O96B 1HFKA 1BMFA 1R8YA 1OLOA 2AEEA 2CKDA 3CPEA 2ZI4A 3H16A 5I8ZA 5K9ZA 1QIGA 2G5GX 2Q0XA 4PPFA 4AL4A 1EUQA 4IV0A 1ADYA 3G23A 4FYPA 4KLRA 1GG9A 2PSHA 3MWYW 1AIPA 3DOFA 4LXYA 3QKIA 4UUPA 2WJGA 1KY4A 3R9XB 3DMDA 1CQJA 2F3RA 4KYIB 3DD1A 4CEHA 1PR0A 1GL3A 4ZHQA 1P6XA 5H83A 1KVUA 1Q1EA 1QR2A 3LDHA 5CDGA 1IZ7A 3I39X 4RK7A 3FCSB 3D31A 3OX3A 5F9FA 3N87A 4PC2A 4OGFA 4RJLA 2IRWA 1B41A 4E5KA 2RKOA 5JC8A 4OATA 4M38A 1JDBB 4QGGA 3GLIE 2JFYA 2BH9A 3PPWA 5C8XA 1AM4D 3DPIA 5REQA 1N2IA 4NCAA 4K6OA 4EFMA 3IHTA 3WL4A 4GRAA 4J1TA 4BKPA 2B1GA 4Y98A 2OWDA 1SWWA 3VYUB 4E70A 1H2EA 2JF0A 4CDRA 2IZ0A 3U7RA 4C4XA 2P79A 2GYWA 4FZJA 2QRUA 4O29A 3LC0A 1LLDA 1T3TA 3K35A 2QLFA 1KI2A 5B7NA 3U7FB 5C8DA 1RYBA 3F6BX 3ABIA 4QO7A 4BWYA 3I2GA 2JVJA 4X00A 5JSZA 5JXIA 1JT9A 4KWIA 5AKYA 2AG6A 1L4NA 2OZVA 1MX1A 1NKTA 4H0CA 3C0KA 2D4AA 3ZS8A 1UJNA 2QW1A 3IUEA 4JQOA 2V1UA 1J6UA 3L7AA 1ZH2A 4E12A 4G67A 1KIFA 3WK6A 4BNZA 4D0SA 3S1SA 1C2YA 2QB5A 3I58A 4CGYA 2WYWA 4NAUA 3S28A 4FFVA 2Y1CA 2OGZA 3OUZA 3B7PA 3JQAA 3WRYA 5K0TA 4P54A 4LYYA 4ND3A 1EPUA 1F14A 3L4SO 1SBZA 4EAAA 2DQYA 5IJ0A 4HDAA 4ZYZA 1UBSB 3WJ7A 1JKJB 2FHPA 3VVLA 1OFTA 2GXAA 4K7JA 3ZHVA 3CR7A 1IQPA 3EZYA 3O3MB 4Z1MA 3B3QA 3ECCA 2HF2A 4CM5A 2OGTA 3D4NA 3RFUA 4W1PA 1SH7A 4J9UE 4EI9A 2PMEA 2ZUCA 2CVPA 2EKBA 3K0AA 3KKEA 3QV1A 3SHQA 4DNFA 3JZAA 3L7IA 1QVAA 2JLVA 3GAAA 3N2LA 4DV7B 5CAEB 2GD2A 2JGDB 5GONA 4BFCA 3MD9A 3AWDA 4YXWD 4LYDA 1GGHA 4YYEA 1MR3F 1HG1A 1FP6A 1M2EA 3GGGA 1R0XA 1FDTA 1IXRC 1QHHA 1ZHHA 3A9TA 2QAJA 4JHXA 3JAMA 4OKNA 2GRAA 3AX6A 2C77A 4UCWA 3KQNA 4OHZA 4FSXA 1SVLA 1JEQB 4M9QA 2E4YA 1SUAA 1WUHS 2MT9A 2NSLA 3FRJA 4OBWA 2ZUTA 3WK4A 3ZY6A 1FC0A 1KMCA 2NYRA 2AJTA 3VJKA 3K96A 1EYZA 1OT3A 3VU1A 3BB3A 1XR3A 1U7PA 5G1OA 4B32A 1Z47A 1E2JA 5EUQB 2HIMA 2QRPA 1H6BA 2J07A 3B6IA 1T3LA 4PSAA 4INOA 4P4SB 4TTIA 3RUEA 1P0FA 3RFCA 3K4PA 4D97A 2W2LA 1JLSA 3ZV5A 3L4KA 2H06A 2XUZA 4OJNA 1NZJA 2IELA 1WCXA 3B82A 2F6RA 3FLAA 5B6JA 5C18A 5LP6C 3JQ6A 3O8BA 2BAGA 5IABA 1LFDB 2HI0A 3TQCA 1CKEA 4DLPA 1Z16A 2ZWAA 2YYSA 1X86B 2PFKA 2TMKA 2GOYA 4D4IA 5FBVB 4MTCA 4P22A 2PL3A 1L9KA 2ZJZA 1J39A 2C5FA 2QTHA 4H1VA 4AUEA 4D5GA 1W48A 4KI0A 1YRWA 2IW3A 3QZUA 3UK1A 4YRKA 4OP3A 2FSSA 4F86A 3NEPX 2AYZA 1HT3A 1H0HA 1WIWA 4N6GA 2I8AA 1JF8A 4OG2A 2Q4EA 2G1JA 2XMSA 3GBSA 1XELA 4BUCA 3NUQA 5ADHA 5GQSA 1N9KA 1YMUA 1YZVA 1BXZA 4QNRA 2ZITA 5HIJA 2M98A 4Z0PA 4YUWA 2Z2ZA 2V7PA 2WJ4A 4EPTA 4L8LA 1TB4A 2HIGA 5JFGA 1L7RA 5CGQB 1KBQA 3DQZA 1EQ2A 1MO2A 4WZ6A 5K51A 4ZCSA 2Z1MA 4HBGA 4E46A 2Q1TA 2ZEJA 4L5AA 4LHXA 1C3JA 3F97A 2B94A 4CF7A 3W5VA 3A6DA 1PUIA 1NYLA 1QGOA 1S8NA 2ZBUA 3EWAA 4CUKA 3HJNA 3LG2A 3TAXA 1PNRA 2WRZA 1J4AA 3HGMA 1PV4A 1PZEA 1DAFA 1Z62A 2WWXA 4GVXA 4IXDA 2AMJA 3GRRA 3P4XA 3PC8C 4JJ4A 4JVNA 2Q5EA 1XTRA 4BZPA 1AA6A 4REMA 3G88A 4E13A 4WLVA 4HH1A 3RYHB 2CV1A 2A59A 2BMEA 4QGFA 2C88A 1VJDA 3PGKA 1EJ2A 3UQZA 3VSAA 2G4LA 4DM7A 1RM3A 2E2WA 4UOZA 5CB4B 1GFWA 2PY6A 5BT9A 3W1WA 1Q7CA 4RTOA 1UT6A 2UZ1B 1RBZA 2GBLC 2X4IA 1QIEA 1X7WB 4QDXA 4IICA 4HK4A 4UULA 3MHPA 4RA9B 2QRZA 4XZ3A 2J3HA 4LMBA 4N5IX 4PPGA 2XXAB 1QIJA 1IN4A 1BCSA 2PZFA 4G4JA 3E58A 4KH0A 5DF1A 5B1YA 4NOKA 3ZZTA 4BLSA 1L3BA 1ZGBA 2MR6A 1JVNA 3RUAA 4B3JA 4J0JA 2CBZA 5FAKA 2WQ6A 3ZE7A 1I3CA 3IIMA 2HMVA 1AGRA 2PJZA 4FINA 3MLBA 4C4OA 4YRSA 1QQ7A 3MFQA 4HPXB 3QFSA 2AG1A 4MQBA 2JAHA 3DDNA 4J9VA 3CQ9A 1RP7A 3PUJA 4BNFA 4PYRA 3D3KA 2LDXA 5K3OA 3WA7A 3CZMA 4KQKA 4ZGBA 2PX5A 4KLZA 3V1UA 3E27A 4DM3A 1H6DA 1RAIA 4EARA 4WNAA 4EA6A 1D8TA 1EXMA 1LW6E 4MW0A 2MDTA 1YS1X 2IXFA 1RVDA 3EXIB 1HRKA 3EGXA 3FCYA 4OH7A 4BEBA 2C9CA 2REQA 3ETJA 1IPEA 4HOYA 2R44A 1OZHA 3GV0A 2I5PO 1ISSA 2ZYHA 4Q4HA 5JCJA 3ZKAA 4BVJA 4YRNA 2H2FA 1U11A 3JD0A 4G4IA 1WF6A 3EHDA 4IW3B 4L07A 3SGLA 4C03A 4JQYA 3QEOA 1W25A 2QV0A 5DYIA 1SELA 3VYWA 1KARA 1V47A 2GTHA 2IP2A 2VG8A 1MQSA 4ZVVA 4MDYA 3W78A 3I42A 4B1FA 1U0SY 1G7SA 3KBOA 3KVOA 4PRKA 5IWCA 4HB2A 2BM9A 1WULS 1ZL2A 3IIIA 3L1JA 3VSDA 4R5MA 1QF6A 4GX0A 3OCUA 6AT1A 1KY5A 3KKMA 4GXRA 2ECOA 3G6KA 4IDNA 4A3SA 1Z0KA 2PJRA 1U2DA 1NN3A 4KUEA 2JFNA 2PL9A 1WUIS 4FS8A 3D64A 3R6LA 5KOJA 1U7TA 2DX7A 3AY0A 2WFLA 2F90A 3K32A 2PGJA 5BPFA 2DBQA 4LSZA 4D0NA 4OHVA 3GLHE 4GC9A 1BXGB 3OWXA 1W0CA 5COAA 1K8ZB 4MR8A 3UAZA 1PZXA 2B69A 2PQ6A 2O57A 4R1MA 4DSNA 2VSXA 3B9RA 2G4VA 5BYAA 5JCXA 3OPMA 3CVUA 4UHJA 1CHNA 4YAEA 2QT9A 3EAQA 1PEYA 3P9ZA 2VHUA 1JP7A 1KR5A 1I1OA 1KJ8A 2IOQA 5D5PA 3BJMA 1H2RS 2XDWA 3OFND 1IOLA 1UZMA 3C4VA 3RTAA 5HDBB 3EDMA 3PKZA 4NU0A 4UFPA 4J7XA 3KWJA 5DNAA 2IEBA 3GNLA 3JYQA 2ZZKA 1ZK3A 3SZOA 1JR3A 4U8HA 3DAYA 3FPEA 4KX3A 1H2BA 3AEKA 4TN1A 2W6MA 3QEJA 5GP1A 1IQUA 3NOOA 3W9YA 3OEHD 4UEWA 1QJCA 3OQ6A 4EUEA 4JX8A 3HADA 1FPQA 4C0HA 2X5XA 4RTNA 1XJQA 2XCIA 3ZWWA 2QM7A 3HVHA 3G0OA 2CLFB 1NMZA 5DWDA 2HPZA 3DUWA 4UBNA 4Y6RA 5JXWA 4MUGA 1GDDA 2GJKA 2W93A 5E6SB 5KYUB 4PTZA 2P6OA 3ROEA 2AXNA 1DC4A 3RSGA 2ATIA 4DBLC 1MHTA 2GEBA 3AF1A 4HO1X 3DHWC 3HCOA 4ID9A 4JUBA 3PHJA 3SF8A 5KQLA 3U5TA 3PF9A 3QYPA 4IR7A 3V1MA 2X6RA 1U3CA 1VJ0A 4P82A 5EKSA 1NTRA 4YCLA 1AK2A 1I3NA 1MGOA 3HXTA 3KTDA 3O4HA 4JLAA 3ORHA 1HI9A 4M8IA 1M1YB 4UCXA 2G1UA 2AZTA 2ZIZA 5EQTA 3SYLA 4DMFA 2B36A 2V4UA 3C3EA 5AM5A 4QGSA 3U16A 6Q21A 2WSIA 3CUKA 1QGZA 1K3TA 2CC2A 1IXKA 3E5RA 4CL3A 4O2AA 5H9WA 1Q92A 5JRZA 3ZV4A 5JCPA 3ADDA 4BKOA 2OQ2A 3IYLW 1HZZC 4YCSA 4GKAA 4D9GA 1R00A 1T2EA 4NBVA 3QHAA 5BSEA 5EIEA 1SHTX 1WCV1 1YK0A 1FUEA 2WD8A 4HQ0A 1AOXA 1AQUA 2GKOA 1MF7A 4PQFA 2P6UA 3EY9A 3LLUA 4PYOA 4QDKA 3WYEA 2HSJA 2WUVA 2W71A 4BP8A 4B09A 2OZLB 2RCNA 4GYWA 5H68A 4IIDA 1I3MA 3LHFA 5G1NA 4DCVA 1E6LA 2G9VA 1AGXA 1QH8A 3AEUA 4M1KA 1DQZA 4O2LA 3ESAA 4PO3X 4B4DA 1FNDA 2HPAA 3K0CC 4EFLA 1P1HA 5AVSA 2ASEA 5EHXA 3TUIC 1EIWA 4KW7A 3OCJA 3AERA 2OCIA 2C4TA 4IIFA 3E9DA 1XTVA 4ZPXA 1Q0TA 5B1SA 1SQSA 4N03A 4E4RA 5IS2A 1KH3A 4PTYA 1FUUA 4E5PA 4MJ7A 4O1IA 1UIRA 4ZU1X 3PNQA 1ZVQA 3AHEA 1G64A 2C92A 4J91A 3GVIA 1O97D 1PZNA 1Z15A 2PS1A 3TQOA 1AU9A 1JDBC 2JH3A 3B48A 5FUYA 5FL3A 3GLFA 1HE8B 2ZRBA 4X66B 3EGOA 1JQJC 1I2ZA 2IU4A 4M1MA 4D02A 1XTQA 2C3MA 2OHJA 5DK4A 1OXTA 3I1IA 3F5SA 4BVGA 4J8PA 1S3SA 2P2NA 4I50A 4XAQA 4EI2A 5HFAA 1XLVA 2I2WA 4F4DA 3VQTA 5FPKA 4QLOA 2JGRA 2G83A 4L2IA 2IYRA 3CZ9A 4LW8A 4O8CA 4PTLA 5JECA 3R3ZA 3L4BA 4I50B 4W9MC 4G0VA 1M6VB 2C7BA 3MEQA 4Q4AA 2YXDA 3A06A 4YASA 2X2PA 2NTYC 2BHTA 1BA3A 2V7EA 4B0OA 1PWHA 3DV9A 1ZOSA 2KSQA 2Z4RA 4V02A 3U62A 4UOEA 1O0CA 5I9BA 1SC6A 1UBTS 1YUMA 7YASA 4IFEA 2XYPA 3LDGA 5CXQA 1ZBDA 2OLKA 1P18A 1ZH8A 3AUAA 1ZC4A 2B9EA 3IR6A 4OHXA 4UNQA 5TMBA 2R8EA 3HK2A 3DEZA 1KAMA 4A8PA 1A72A 3GPLA 2JHPA 1AUQA 1G21E 3WJ2A 4ND8B 4DCMA 4ENQA 1JEYA 1K06A 1QQAA 3ESRA 1Z18A 1PL7A 1KAQA 3CEPB 4IIUA 4NHEA 5EIHA 3T5GA 1FDOA 2QLJA 2QJOA 4IDHA 4ZOCA 2NU6A 4J2OA 5G53C 1YL6A 2B30A 3RNLA 4Q48A 1LGYA 1T2FA 1NUAA 3ZE2B 3P2JA 3FROA 1INLA 1VSBA 3NNNA 4MKFA 1NBAA 2WD7B 4QUKA 5K0NA 1NR1A 4DMMA 3PGA1 1O5TA 4FN4A 3RTDA 3OCVA 1A5TA 3KZXA 2CJYA 1TEXA 2FP4B 1GJRA 2R96A 2X14A 2OPBA 3AEUB 4W9NA 5DM1A 3QUCA 2IV2X 1LW7A 2FZ5A 3KC2A 2O54A 4RJIA 2NVWA 2PMWB 1SVMA 1VHLA 3LZ6A 4KN8A 3VH4A 4B4WA 4ENRA 5JOQA 2OZLA 1RIIA 4WUVA 4AMYA 3ZHUA 1BMTA 4RK5A 4XPIA 3R7LA 2D0OB 1PJZA 2Q9UA 3VJMA 3PTAA 1N5KA 4OP2A 4ZVMA 4LCEA 1OROA 3FMIA 3LMKA 5THQA 3VFDA 5AVTA 3T7JA 2BGTA 4JGIA 2C4MA 1Y6FA 3AVTA 4U63A 2VJYA 1QYCA 3TFQA 1M8FA 1C0IA 1SRQA 3HDHA 4EQZA 3AIOA 2VTBA 1RXSA 3K9BA 1VECA 3VOAA 1W5SA 3OPNA 3ELDA 3PG5A 3STVA 4PR0A 1OKKA 2R62A 5K1ZA 4AG3A 1BWPA 2D5CA 2IYEA 3LVBA 5KYKA 5FT9A 3TTSA 2JCGA 4DW8A 1Q5PA 1N7IA 4L8YA 3BF7A 4YMUA 5KAPA 1HGXA 1XJ0A 2VCYA 1FSZA 2BFBB 4QDUA 4ZQIA 3DG9A 4BECA 5GVSA 1Z0ZA 5M5BA 1Z4LA 3D7MA 4IINA 3H1GA 4ZU6X 3OJXA 3V1LA 4AS2A 3T4EA 3PR2B 5E6SA 4F5DA 2ZYIA 5HCNA 1A97A 1VCOA 1XG5A 2J3MA 3R3SA 2QYTA 3RJMA 2ZIXA 1DFHA 1H1DA 4BX2A 3G13A 4K87A 5I7WA 5EWLA 1DMSA 2HQBA 4TYMA 4E15A 2JGEA 1JR3E 1PJSA 3C3JA 1E4OA 4N18A 2IFTA 2GNOA 2JJMA 3F74A 2BHNA 2JJ1A 4LVCA 2ALJA 2SHKA 3DH0A 1ZGAA 2HJSA 1PJ2A 3W05A 3TN7A 3H9BA 4YT5A 4H18A 1IM5A 1E5XA 1JXMA 1CY4A 4Q3KA 1QONA 3T7EA 5BW8A 3Q8LA 5I7SA 3PD0A 3WL5A 1E58A 3EIUA 1M1NA 3GVCA 3H11A 2CMKA 4G0XA 4GI3A 4WZAB 4EY7A 2I7CA 1UR5A 2CFSA 3UW1A 2R6HA 3JQEA 3MCZA 1P72A 1PFUA 1NVWQ 3LC7O 5HRAA 2X1LA 4WMLA 2NV6A 2RJ3A 2XEDA 4BY9E 1T4DA 2D6FA 1Q1BA 3DULA 2HYIC 4OQZA 1WQ3A 2YWEA 3DXZA 5CM2Z 1QCDA 4ON9A 5JYBA 4KVZA 1YI8A 3CX7A 5C8YA 5HRCA 4UVEA 3IPLA 3E1KA 2EGHA 1JBKA 4LG1A 5B58T 3RU9A 1P91A 1WZCA 2XRYA 3BIJA 3U37A 5CA0F 4F0JA 1O9GA 1WXIA 2ARKA 3CMMA 2J3QA 3ZWXA 3TZBA 4CLOB 1II0A 1K6JA 1P3DA 3A28A 3DBLB 3FIUA 4BFWA 4MQEB 1P2TA 3NW9A 3U81A 3VR0A 3VKHA 1JFLA 1E1CB 3HY3A 4PIVA 3IBSA 5FI5A 4EY4A 1Y9JA 5JNTA 1U2GA 3TDKA 3U60B 1MABB 4RSRA 4DHWA 1NVUQ 4L0MA 5A3VA 3WGKA 1XKQA 4Z99A 3U5ZB 2FG7C 1EAMA 1FE8A 3GH1A 4A8JB 1WW8A 4KXFB 1A50B 2HLDD 4D8YA 4GZMA 2IHUA 4HAVA 5CDSA 5IZCA 4DKJA 1BAPA 2DPMA 2X0JA 4FMDF 1Y7LA 1ZVJA 5AK3A 2OBMA 2JK1A 1NHWA 2ZSAA 3NORA 2I22A 3T7IA 4GLOA 4OP1A 3T5BA 5K0BA 1NV8A 3KCNA 3C43A 4DDKA 4KNWA 3KSBC 4JASB 5ER6A 2Y0EA 2Z5VA 4F97A 2NLOA 4DC0A 2GCEA 2P4EA 4NOMA 2EQAA 1SGWA 4HYEA 5FTWA 1U0FA 5H3LA 1TZBA 2NZUG 3OZWA 3Q7IA 4N40A 1ILWA 3ZX5A 1NOJA 2WHPB 5DBHX 2NTVA 2YTZA 4ZYLA 1UDRA 3O83A 4QBGB 5JFTA 2C4WA 3LFHA 4G5XA 5EP4A 4P9NA 1MTOA 1X0VA 3MLEA 5DHTA 3FWHA 2O9JA 2IW1A 1OV4A 2ZK7A 1XZIA 2ADMA 2IIVA 4MS3B 4M55A 4JI8B 3T7TA 1VYVA 4JDUA 4CXMA 3PJGA 4X7PA 5LYJA 4ASUD 4F5ZA 2UZIR 3GLTA 2V5VA 2DBYA 1Y33E 1XP5A 2AOWA 3AGQA 1IBLB 2IS4A 3EG5A 2JIDA 3W8DA 1G41A 3RAJA 4WI1A 1WSAA 3EYWA 2A9QA 1U90A 2REBA 2BTOA 3GFQA 1XK6A 3HKBB 4HGRA 4RA9A 5FYDA 3B8HA 3CO5A 4W6ZA 1I0LA 4MRRA 3QMMA 4WLUA 1D04A 2OY0A 1Q1QA 2VOEA 3K5PA 3NBAA 1T3SA 4ZCRA 3VZDA 4Y2VA 1QH0A 1I13A 1QORA 1ND5A 4NTZA 4MA4A 4KTTE 1BQEA 3RTBA 2ATCA 2B82A 2OOSA 3ANTA 2W4IA 1DTEA 3BWYA 3OWOA 3MS2A 3P2EA 3QY9A 4JJ7A 2FSFA 5KSPA 4D8VA 5CIQA 3A31A 5HEKA 2QN3A 3FOWA 1MC4A 2FYTA 3ENNA 1KZYC 1EUZA 3FWNA 1GAWA 3ONVA 4EEKA 3EVDA 4J76A 5DYNA 5MHTA 2QI9F 2AEJA 4L51A 1JPUA 1JAZA 4KRXA 2W2LD 2R47A 3DS8A 3NALA 1XEXA 2H9YA 4C6HA 2X5NA 4GLBA 1ZK1A 3K30A 4PVCA 3BAZA 1ZZGA 4YQZA 2GD0A 4ZCLA 1T8YA 3KG2A 1M54A 2W8ZA 3ENWA 3RIMA 4J0CA 2BISA 4L95C 4B5LA 5FUWA 1C3OB 2CB0A 3ZJ5A 3Q72A 4MQFB 4WFJA 2FW7A 4IMPA 4LIPD 1JFFA 1J9EA 2QJFA 1V37A 3RE1A 2O2CA 3K70D 1MJGA 4HNAB 4XM1A 4FMCB 3FTEA 4ASUA 3QMPA 1FX0B 2WPDA 4XQ0A 2A5DA 1PX2A 4FGLA 2DRIA 4JUIA 3EISA 1KS2A 3ZK8A 3MMNA 3BHNA 2W2XA 4TUYF 1Y0BA 4RKRA 1WKVA 4E2ZA 4RTPA 1YRYE 3NM6B 4FONA 1K9SA 2RGCA 2C97A 4U2BA 5T3YA 1A5BB 1AMUA 1ZCFA 1L7AA 3SG0A 3GHYA 1FYFA 1GO2A 4CMCA 1PS9A 1NLUA 4UPVA 5DPMA 5LQUA 1BW9A 1OZGA 3AJ8A 4YBRA 4KUGA 4G8JA 1UFVA 5LLDA 3ROKA 1GR1A 5KPDA 4US2R 2LKCA 2WF8A 2ZSKA 2GD1O 3C4JA 1ZN2A 3QBVA 4PHCA 4R8RA 5FUBA 3TLEA 2A9JA 1E3WB 3JQ8A 1I4OA 1NC1A 3O31A 4QVGA 1BN7A 3DV0A 5L6MB 5CLHA 2DPHA 2CFOA 4JYBA 1NHGA 2CMDA 1N6KA 2D1RA 2VAVA 3F3YA 4PYNA 4OXYA 1JU9A 4DIKA 5JATA 3SJCA 4Q1CA 3X2SA 3F90A 4GBGA 3ZXXA 4AF7A 4J3FA 1JEQA 4UBMA 3HUTA 4Q12A 1U8EA 1NNEA 3FWPA 2Z8ZA 1ZLXA 4D56A 3FCOA 3ZJUA 1PE0A 5AXCA 1ZO8A 2YIJA 3AI1A 2VRWA 4BO1A 1J2YA 1T36A 2WKWA 1PR2A 3BSWA 1BJKA 3U9TA 4XR4A 4D9FA 5EQDA 4WXYB 2J0UA 3CKKA 3A6LA 2IYOA 1OI3A 1M1ZA 1W88A 2GO7A 1CUHA 1J0XO 2ZI3A 3VR6D 2P9HA 3HEMA 4BO2A 1L4BA 1CPYA 1Q15A 4S0ZA 5K0EA 3FCXA 4GQAA 4PLTA 1ND6A 4PAGA 2MYTA 3AR9A 3T7RA 3LM8A 3P9IA 1X87A 2W8BB 1X1CA 1NE7A 3L7YA 4DY4A 2IGBA 1KYYA 2J1LA 1MO3A 4OBBA 5ECWA 5EYPA 2J6IA 2RMKA 5TARA 1ML4A 3EGIA 1H3FA 1WCIB 1DXYA 1J0DA 2H85A 3QX7A 3SQXA 2F3UA 1FQKA 1D6SA 3SBOA 3IJ5A 1CFJA 4AYWA 3HM9A 4DB4A 2RCYA 2MWMA 3A25A 4PZZA 4JITA 5T4BA 2UU9B 2FSVA 4CQLB 1FFBA 4YRIA 1B6SA 1Q0RA 4INJA 4I6GA 1O6GA 2V6GA 1M0TA 3C3AA 3KHSA 4E30A 1G4HA 1ULSA 4D0RA 3DLIA 4ZOAA 1T0IA 1T5BA 1P9RA 1RTKA 1VSTA 2ZAOA 3AFIA 1T8PA 2ZJ8A 3AETA 1JR6A 3FWZA 1U8YA 1UUFA 1G18A 3ESDA 5BSHA 2D2FA 4QQKA 3ANXA 3B3FA 5D7NA 1BWQA 3MILA 2I2XB 2FVXA 3M8KA 5CA0A 1UBKS 4BVKA 2QQ0A 1PQPA 3EZGA 4B4KA 1NXTA 4W1RA 1L7QA 3LZCA 3O4VA 4QJ5A 2Q4BA 2SKEA 2YRWA 3D1LA 1MAUA 1JIKA 1MG0A 2J9FA 3D2LA 3R5KA 3RAPR 4KPUB 1QGDA 2OQVA 3JD1A 4Y2RA 3IBYA 3PX7A 1D0SA 1Q11A 2A86A 5FX2A 1XNJA 1Z17A 2B5VA 3ZHRA 5JJBA 5K8LA 3THYA 5LQAA 1ESZA 4CGZA 1L5QA 2A0UA 4JAVC 1BKDR 5J58A 3LPNA 3WNQA 1L7PA 4W63A 3W2IA 2V9ZA 5IZ4A 1N78A 2AXPA 2VUHB 1AURA 3ISJA 3L0DA 5JSQA 1HKUA 1Y1TA 2OVFA 2ZATA 2ILVA 3R9XA 4HDMB 5JYDA 1NDQA 1AGPA 5DK6A 2YHIB 1DELA 3F47A 3P0FA 2QF7A 4PHGA 4JT2A 4KLCA 2V45A 1H8EA 3TVTA 1Z39A 3ZV6A 4E0BA 1HE4A 2ZUFA 1CR0A 2G72A 3Q11A 4NESA 4GECA 3NM5A 1VCMA 1XZBA 2NSJA 1P3JA 1A7JA 2ECKA 2Y1EA 2BR3A 3DW3X 5CYPA 2H18A 4RK4A 2BKLA 1Z5NA 3L6UA 4GHWA 4CETA 2CVFA 1ULHA 3AQ4A 4NARA 4OKIA 1IOWA 3GVPA 3FF1A 4D9BA 1E6MA 2YVKA 1KZ6A 4WDQA 2VYCA 3OBIA 2YZ7A 3DHVA 5H02A 2CEKA 1AT1A 4MR9B 1ULAA 1E2DA 4TKZA 1ADCA 2BTQA 4XYMA 1ACMA 1KSHA 1N2JA 3FA2A 2ZVJA 3I2FA 1CHDA 4AZ3B 5CB8A 4P35A 3CVJA 5DEIA 3N86A 5LBUA 3WY9A 4ZODA 4LQ4A 2O19A 1UDCA 4TVBA 2QU8A 1W5AA 4U02A 5EXEA 4Q4CA 4LF7B 2VT2A 3UMFA 4B34A 5TGDA 4MAFA 4EDHA 3ONEA 4MB6A 5I01A 3T9EA 1XMOB 3Q8KA 3I5YA 3VR5A 2G5TA 3BD7A 1MMFB 1TXGA 4QQRA 5DE3A 3BS4A 2VPQA 4G56A 1OFVA 4PYIA 2V6JA 3ZNNA 4U2DA 1VMDA 4MRSA 2ZJ5A 4Z2AA 2M6KA 1QZXA 4ADSG 1Z0DA 5JASA 1EUCA 3ILVA 3VVCA 2AOUA 4O59O 1FDWA 5I7AA 1CR1A 4DV3B 5I5GA 5HGXA 3CG0A 1FYVA 3O1LA 1HNWB 2HR1A 2O14A 3LUKA 4QQFA 3FOFC 5BWLA 4JB2A 3SJ7A 1WDKA 2AHRA 2B9VA 1ZUNA 2H17A 2O2SA 3GPBA 4LOAA 1BEEA 4C43A 4CKBB 4EHJA 3V7WA 2XV1A 4ILEA 1RKQA 2ZSHA 2D8MA 2NZJA 5E7IA 3SQWA 2WWRA 1QAOA 2QDXA 4A0GA 5A0TA 4P92A 4Q3OA 2ZYUX 2V0NA 5LYJB 2GCIA 3JYHA 1KO4A 4OFXA 4EY3A 3N0VA 4NAVA 1YL5A 4WY2A 3LBYA 4I8XA 5EXSA 2D2EA 4N6OA 2GPAA 1SM4A 1NZDA 2J4DA 3E3NA 4DTIA 3G5MA 1GTSA 4BQRA 1OHHD 1DMRA 2KI5A 4UXHA 1ZRHA 4E4YA 3ZXIA 2AUTA 1S2OA 1MAHA 4WJLA 1RLMA 2HLNA 3AEZA 1K7FB 2QRHA 1SUWA 4KHZA 1R4ZA 1J99A 2XLBA 1ZH6A 2XUPA 1F8YA 3CLKA 4M0UA 4KKXB 3OFSA 4C2TA 1E66A 4KDFA 2TYSB 3RRJA 4QE3A 3K0SA 5SY4A 4UU0A 1X39A 3L0CA 4ZEVA 4F3NA 5A6SA 3II6X 4B0PA 1KH2A 3SEQA 1NUTA 4TLDA 2HU8A 2VHJA 4RDXA 2Q41A 5LVAA 3HCAA 1W0KD 2W6CX 4M99A 2QXYA 4WKOA 3WLQA 3X44A 2A0XA 2V7VA 4UJ3A 4DRXB 3K70B 3FYSA 3TXXA 1Z4JA 2POCA 1K4MA 2WWIA 2YFQA 3OP4A 4NBRA 4OLBA 4DN6A 4OLFA 1Y8CA 3OTIA 3PNPA 1CVIA 4TVSA 5H7XA 4HLUC 1OI7A 2QTCA 2RHBA 3ENVA 4HTFB 3YASA 1B0PA 5DNWA 5TT1A 1R74A 4JI5B 3SJAA 1TW3A 1JX6A 2F7SA 3OTGA 2O3SA 1PSDA 3CEMA 4J43A 3HRKA 5AJXA 4Y0NA 3DO8A 1E1DA 2NUAB 1CIVA 4IEEA 4XGIA 4KOAA 5A9TA 1Q77A 1TCAA 2WA1A 2CD9A 3AZPA 2WTBA 3LAWA 1A1VA 4MUBA 1ACJA 1JHQA 1EAYA 1QTRA 2JHFA 8ADHA 4ZFNA 1IY2A 1EWRA 4L3OA 2WU1A 3SIRA 3WLEA 5P8WA 3H0CA 2FW9A 3I6MA 4XRGA 2AG5A 3OC6A 2IV3A 1NN1A 3ANLA 1COZA 4U2EA 1M75A 3A3OA 5LUBA 1TA9A 3H4IA 4W99A 4TWJA 3SKXA 4EFKA 2VHCA 2P78A 3G49A 3H1AA 3CLRC 1EK6A 3O8QA 4MPJA 4OCZA 4S2UA 4TKUB 1R0SA 1EWKA 2BFCA 2VK2A 2Z1NA 3NTLA 3MJFA 4PFKA 4PW0A 4CV3A 4EZEA 2ZRQA 4J7AA 4UASA 4EPRA 2OG2A 3AW9A 3GIWA 5JBQA 5KTMA 3G8AA 3L6BA 5SZKB 5BN3A 2WWTA 3RUFA 3ZDXB 4RQUA 5PNTA 4HAOA 2PLWA 1XXLA 2QZPA 2H2WA 3OY2A 5F35A 3TD2A 4EUKA 2Z57A 4ARZA 2WFZA 3O2JA 4CMJA 1BXRA 1USWA 3USZA 2DY0A 3E05A 4IHQA 1CYEA 1TAHA 2E0IA 3OLCX 4M0PA 1C3VA 3T9AA 4OB8A 1US8B 3PRJA 1GZVA 3BAFA 2X19A 5EZ6B 4KMRA 5F5LA 1VG9B 4EO4A 5HNKA 4NKRA 1WNTA 4IS2A 5D01A 1SU7A 3MT0A 3NG1A 3TCXB 2XRMA 5DN6D 4GP6A 3REQA 1O2DA 3GFSA 4P2GA 5D3ZA 1ECCA 1NAHA 2VJAA 3G5TA 1M1YE 3KO8A 1WXQA 2GPJA 5DGIA 1KTVA 3VSEA 1XJCA 2OHHA 2V96A 1RI3A 5KMGA 1ZRSA 3DE5X 4NH0A 3A10A 4MTLA 1A5ZA 4Q6BA 2NADA 4UNRA 1UJBA 3R9WA 1QG4A 1TNDA 3PE3A 1YS9A 4INPA 2V65A 4A10A 2H9IA 1VE9A 2HLPA 2ZWVA 4WUTA 4V24A 3FM9A 2JLAA 4BEWA 1QPGA 3AB3A 3IMEA 2HA4A 3KQMA 3KYDB 4K8RB 2AG8A 2IODA 3QXGA 4PX3A 4UMEA 4XX0B 3WTBA 2YC2C 3ABZA 4JBYA 4EVSA 3UJNA 1LQ2A 1F9EA 3OHPA 4HLDA 1MH1A 4M53A 4P98A 4OJYA 3P2MA 2IYTA 1A82A 3B6KA 3ZYZA 2WKPA 4M6WA 3B36A 5EP2A 4DA0A 6ADHA 3RB8A 1M5RA 4B3MB 5FO1A 1KY3A 3AF2A 4GPEA 1NVGA 4JSRA 2FF5A 2PS0A 4XIGS 1KWGA 5GZ6A 5JSUA 3STHA 3ZW8A 3GXOA 4OQFA 3BFXA 3G17A 1NMXA 2J85A 4S2EA 1KU0A 1NQOA 1JXQA 2AC7A 4F85A 4MRVA 3EZNA 2WM8A 2Y77A 1M66A 3LH5A 1KI1A 5KTPA 4CKWB 1Y4UA 2HJHA 1BRMA 2JHCA 3IXMA 5I7EA 1V71A 3BSYA 4BQOA 4GWKA 3O4IA 4D26A 3MCWA 1WX1A 5K2MA 3LBNA 4R2MA 4RSMA 3UMCA 2A9FA 1XDDA 3HP4A 3IVXA 1THGA 3L1UA 4U7DA 1SBNE 2SKDA 1X80B 3P9SA 2I2FA 1UJ5A 2Q1XA 4PAMA 1AF7A 1UBOS 5EHQA 3GA7A 2NU8A 2OL4A 3IA7A 3PTZA 3UAXA 1M0WA 1V1RB 3ONNA 4MWOA 4WN9B 3GG2A 5KJ6A 3RSZA 2YDXA 3DEFA 5IUNC 2LXNA 1T5IA 1Y3AA 4OVKA 2ST1A 1DEAA 1ZITA 3TLGA 3HO6A 3QHPA 1DB3A 1G16A 4MKHA 1JQEA 4OJQA 2YZGA 1AKUA 1JNXX 2XOXA 4HWPA 4UKDA 1GCUA 1LBSA 1RHKA 2H7VA 3VJRA 4MWGA 1DAMA 1NW7A 1DKOA 3HNOA 2YUIA 1X8XA 3HS3A 3ITEA 3L7OA 4OK5A 4H3VA 3HCPA 3FIJA 1MJGM 3AY3A 3PQEA 4FX2A 2EJCA 2XGGA 3NASA 3NB0A 1FJ2A 2AW3A 2X0NA 3TG2A 3GT7A 1UC4B 3A0RB 3CISA 4JYCA 1B42A 2ZJAA 4WECA 5KJCA 1FSPA 1PJQA 2OD9A 1RI1A 4IOKA 5TF0A 4BX9A 3EVCA 3C3MA 4EIWA 5BNIA 1SCJA 4OXIA 4EK9A 1YE3A 1WD7A 2ZXFA 3U26A 1UKZA 4BLVA 1XNGA 2H8GA 3NTQA 4BO7A 4BNXA 3OQMA 4JGBA 3WKDA 2HPHA 2FV8A 1RQLA 4UCQA 4C88A 1WLYA 5DCWA 2ID7A 4UD6A 3UHFA 1XU9A 1Y98A 3FWYA 5TLSA 2FP3A 5AW9A 2E55A 1YE5A 4MWEA