4DM3A

Crystal structure of human pnmt in complex adohcy, resorcinol and imidazole
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Missing fragments: detecting cooperative binding in fragment-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dm3A00
1RI1A 1NKVA 2NXJA 3MQ2A 5T6BA 2YX1A 3SVZA 5E1OA 3CJQA 3EVCA 2QRVA 5EMMA 5FUBA 3UBTA 4C04A 1G55A 5DX0A 4CWAA 4R05A 4ER6A 5FCDA 3O31A 2AN3A 1R8XA 1BKYA 2ERCA 2GPYA 2OKCA 5LQUA 4X1OA 2FK8A 4QTTB 2VDVE 1KXZA 4E2YA 4QVGA 3KQPA 3REOA 1R74A 3E23A 5K0FA 2GAFA 4BP1A 1YF3A 4YV1A 1SUSA 3OU6A 2PX8A 5BW4A 2JHPA 1YFJA 2Z6AA 4PYJA 3FUWA 4FR0A 1M6EX 4DCMA 3MHTA 3CBGA 3KQOA 4KDCA 4EMSA 3NWEA 4LG1A 4AZSA 2NXNA 2FPOA 3NDJA 1QZZA 5E1BA 3FTEA 2BM9A 3G2PA 5BP7A 3NMUF 3SXJA 3T7TA 3TFWA 5K09A 3TPZA 4AZWA 3DXZA 3SGLA 4YUXA 5LQCA 3KQQA 1IXKA 5EOVA 3P71T 1I9GA 2PKWA 3G2OA 3EMDA 3M6XA 3PB3A 4YUYA 1RI2A 1KIAA 1RJEA 3M4XA 1SVUA 2BZGA 2B9EA 3NTVA 3KQMA 3NW9A 1SUIA 4FGZA 1G6Q1 4O29A 4PYKA 4XUCA 5E9JA 1G8AA 3NVKI 1ZGAA 4KIFA 3X0DA 1XDUA 4IKPA 1Y8CA 1M6YA 1BOOA 5E8RA 1JQEA 1YUBA 4X41A 1WY7A 1X1CA 3I9FA 3MCTA 3I58A 2AOTB 3M6VA 3DTNA 4HH4A 2QYOA 3JWJA 5GM1A 4RVFA 2UZ4A 3GRZA 5CD1A 3JWGA 2DULA 5DTRA 3FPEA 1QAMA 2GS9A 3GRYA 4FT4A 4CKBA 4RTJA 1DCTA 1VIDA 2AVNA 3T7SA 4RTKA 1B42A 2XVAA 3LDFA 3UA3A 5K0CA 3CJTA 3GRUA 4U7PB 4EKGA 3TKYA 2IH4A 4PCLA 3AXTA 2O57A 1SQGA 3GU3A 2AOXA 3OCJA 2QE6A 4MTLA 4WXHA 3QOWA 3T7RA 4QDJA 5GP1A 4KWCA 3OE4A 3KQVA 3LPMA 4LWOA 3GXOA 5EG5A 3UJ8A 5F2NA 5K0BA 3ER8A 2PWYA 3EEYA 3NDIA 4E31A 4R6XA 5K0JA 3MCZA 3RIEA 3LCVB 1FJXA 2P3LA 3A7DA 5FA5A 5KVAA 4M7RA 1RJFA 1ZGJA 2YTZA 5EQJB 3M6UA 3THSA 4PNEA 1XCJA 1VL5A 1ZQ9A 3FTCA 2PX2A 4QDKA 1ORHA 4LECA 5DXAA 3UWPA 4X63A 3LECA 2P40A 3VYWA 4DF3A 3DULA 4DKJA 3TMAA 3BGVA 1G8SA 3CGGA 2GA9A 4GBED 5EIFA 1VLMA 1RI5A 2FHPA 5E2BA 4E70A 4X61A 2HMYB 4OBWA 4H0NA 2IH2A 5DX1A 4YMHA 1KP9A 3B89A 5EEHA 1PRYA 1SKMA 2B2CA 4HTFA 4NECA 3KHKA 4OQDA 5DSTA 3UJAA 2I6GA 3LBYA 3JWIA 4RTSA 3UJ6A 5ERGB 1PJZA 2PBFA 1G38A 1JR4A 5EMLA 1N7JA 2C7QA 2PSSA 4RWZA 2H00A 2C7PA 5F2KA 5DXJA 1IM8A 4HGZA 1VP9A 2F8LA 2PVCA 3AY0A 4EVIA 1G60A 3G88A 1TPYA 3HA3A 4ER0A 3PVCA 3P9IA 3ELWA 4F84A 5DM0A 5FWDA 4BLUA 5GINE 3OPNA 4DMGA 4XUEA 3G2MA 1EJ6A 4RTOA 2AN5A 2YXLA 1T43A 4BLVA 5BW5A 2NXCA 4AZVA 3SSNA 3BWYA 2CL5A 3FYDA 4IV8A 1D2HA 3DLIA 2P8JA 3P2KA 5DT2A 2OYRA 4RTLA 4E30A 1XJ5A 2N47A 2ZBPA 2VS1A 2P41A 3EMBA 3U81A 3C0KA 3SR4A 3PFHA 4ER3A 3MGGA 5LQRA 3NVMB 3TRKA 5LQNA 4JXJA 1VQ1A 3HCEA 1R00A 2G72A 4OQEA 1X1AA 5EHIA 5ICEA 5F2OA 2GLUA 3BKXA 1KPGA 2KW5A 2AOWA 2OB1A 2P7HA 3KR9A 4RTNA 5G02A 1WS6A 3E7PA 5FULA 5DLYA 3ELUA 3TM4A 5GIPE 2OO3A 5HIIA 1NV8A 5KS2A 1UIRA 3MTIA 3KPYA 4E33A 2P35A 1P91A 3KR0A 4PINA 2LD4A 4C08A 4MHTA 3OE5A 3R0QA 1RI3A 2B78A 5T67A 4RTQA 3TLJA 5CM2Z 2CKDA 1KYWA 1MJFA 5EHGA 1Q0SA 1XCLA 4IWNA 4KDRA 2PJDA 3OZSA 1JQDA 5FTWA 5ICGA 3ERCA 2ZIFA 7MHTA 3CC8A 2BM8A 1JG1A 4QQKA 4FP9A 2IDJA 4QPNA 3DUWA 3OFKA 2JHAA 3T0IA 5HOQA 3MTEA 3CJRA 2VDWA 2CMHA 2ZVJA 3B5IA 5B1SA 1YZHA 2WA1A 4CTJA 5FHRA 5HIKA 5LSAA 4CXMA 1JG4A 1L3CA 5HEKA 5GIOE 2NP7A 2FCAA 2VDUE 2YUIA 3C3PA 4RX1A 1NW3A 1JSZA 1HMYA 2ONYA 1XXLA 3BGDA 9MHTA 4C05A 3B7PA 4RVDA 2PXXA 4DA4A 3DXXA 4V0QA 2OXTA 4YV2A 1AQIA 2I9KA 3BT7A 5K0EA 4E2XA 3A4TA 2VZ9A 1FPQA 4CKEA 4ISCA 1R6AA 5KYGA 1QYRA 3WSTA 4FT2A 4OA5A 4X60A 3FPGA 3THRA 2ONZA 3SSMA 3P9NA 3ER9A 2GH1A 4HSGA 1YZ3A 3G8AA 5JR3A 3OZRA 3GCZA 1XTPA 3P8ZA 3TR6A 2GB4A 4OBXA 1JTFA 2ESRA 1MHTA 3FUUA 2AOTA 3MERA 3DLCA 4RV9A 4KVZA 5DTQA 1SG9A 4EK9A 3KQWA 4F86A 2ZZNA 3FYCA 3EGEA 4POOA 1WZNA 2PXCA 2QM3A 2ZWAA 1KYZA 3EVDA 3LDGA 3LKZA 3P9KA 5CVDA 2ZBQA 3V97A 4A6EA 2IFTA 3FRHA 4KIGA 5EC8A 5HIMA 3HCBA 4PYIA 2FRXA 5DM1A 3O4FA 1FP1D 4PYQA 2YVLA 3M70A 3OU7A 1RI4A 4IV0A 1P1CA 2JG3A 3OFJA 2PY6A 3UJ9A 2EG5A 1NW7A 4WVLA 3E8SA 4PYNA 2UYQA 5E8JA 5E2AA 1RJGA 3I53A 2OPBA 1I1NA 1IY9A 4C07A 3PTAA 3HVHA 1AQJA 3ME5A 2BR5A 2G8NA 3NJRA 4GC5A 4PIPA 3MB5A 2OBFA 3HCAA 2IH5A 2G70A 4GC9A 4XUDA 2NP6A 1BC5A 4E2WA 2AOVA 3FPHA 2AOUB 3AJDA 2BR4A 1ORIA 2R6ZA 2H11A 3SX0A 3IEIA 3CKKA 1INLA 3O7WA 2YXEA 3G89A 4RYLA 5FHQA 2HTEA 4P7KA 4ER5A 5LQKA 2WA2A 5K8VA 5LQAA 2ZZKA 2I62A 2UYCA 2XYVA 2PT9A 1F3LA 1KHHA 2NYUA 3FTDA 2JHCA 4RSRA 2JH8A 3C3YA 1NBIA 3ELYA 4G56A 3LL7A 1UWVA 2IPXA 4V0RA 4A6DA 1NW5A 4YV0A 5KQRA 3HVKA 3A25A 2O0LA 4GUAA 4HRAA 5H02A 3G2QA 4DZRA 2HR1A 3A26A 1ZKDA 3EVEA 3B3GA 4HTFB 5CCBA 5E9QA 3QOXA 3LCCA 4PIMA 1P39A 1YFLA 2JJQA 4BY9E 3BWBA 5K03A 3EEOA 2IIPA 4EKIA 1VE3A 1NW8A 1D2GA 2OB2A 2V7EA 1BHJA 5IKMA 1XDSA 3AWIA 4AZTA 4GF5A 1EQAA 5EIWA 4EQZA 2G1PA 5K05A 4MWZA 3IHTA 4HGYA 2PX4A 3HCDA 4M38A 4E32A 5GOZA 2ZW9A 4GQBA 3FUTA 4PCAA 4XCXA 8MHTA 4DM3A 4KRGA 5DM4A 4P7FA 4PWYA 2ZIGA 3TOSA 3CCFA 2ZZMA 3GWZA 3GO4A 4OX9Y 2CWWA 2C7RA 5BXYA 2HV9A 10MHA 3HCCA 2PGXA 3PFGA 3PX2A 1ZG3A 2P3OA 2XYQA 5FQNA 3KPUA 2HNKA 3IV6A 4R6WA 5EGSA 2BR3A 3ID6C 3SSOA 4ER7A 1H1DA 1L9KA 4KW7A 5HIJA 1AF7A 3IYLW 4C03A 1XVAA 1OR8A 4PYMA 5DRTA 5MHTA 3SM3A 2XVMA 5HZMA 2I7CA 2P3QA 3KKZA 5EMKA 1KPIA 1KR5A 3LHDA 5IH3A 2QRVB 5CVUA 4RVGA 1P1BA 3DP7A 3M6WA 5DWQA 2AS0A 2ADMA 2B25A 2ZULA 3ELDA 3EVFA 5KQSA 3BKWA 1L3BA 1X1BA 4PYOA 4C06A 5GWXA 3R24A 1I4WA 5U4XA 5LR6A 3HP7A 4QPPA 4FS8A 3LX6A 5CVEA 4RVHA 3UFBA 4M36A 1QAQA 2JH9A 4Y2HA 2YQZA 3UJDA 3D2LA 2ZIEA 3Q87B 3VC1A 3BGIA 4RTMA 1JG3A 3BXOA 2OZVA 2R3SA 3HNRA 5EPEA 1N2XA 1UFKA 3P2IA 2CMGA 2ZLBA 5EKUA 3RODA 3DMHA 4YUWA 5E1MA 3OZTA 3B3FA 3TKAA 2Q41A 2UYOA 2AN4A 3K0BA 1ZHFA 1O9GA 3GJYA 4R8RA 1FBNA 2Y1XA 3F4KA 3DOUA 4RTPA 4BLWA 1TW2A 1YB2A 3HA5A 3BWCA 2VP3A 3UJ7A 2UYHA 5M5BA 4ZTBA 5JUWA 3HVJA 3HCFA 3FZGA 2IGTA 3UZUA 4ATNA 2ZWVA 2EJUA 2K4MA 5LQJA 2G71A 2QY6A 4PYLA 3G5TA 1EIZA 1NV9A 3GIWA 3KR1A 3P2EA 1EAMA 3PLAE 1F38A 5DPMA 2AVDA 1QANA 3GRVA 4P7GA 3TM5A 4GOLD 1R8YA 5D1NA 1U2ZA 3M33A 3EGVA 1JG2A 2AZTA 3E05A 2ORED 3GGDA 3G8BA 3NWBA 2XYRA 5C9ZA 2O07A 3GRRA 1DL5A 2PV0A 2PWPA 3KQTA 4U7TB 3RW9A 3HVIA 3EVGA 2FYTA 3KPWA 3EGIA 5CIYA 1JTEA 4Z2YA 2ZSUA 5FA8A 5FQOA 3HTXA 4QQNA 3C6MA 2YR0A 5FADA 2Y1WA 3C6KA 3GDHA 3LSTA 4OA8A 3EVBA 4DQ0A 1QAOA 3L8DA 5ICFA 1FP2A 5DX8A 2DPMA 1D2CA 2PT6A 4QTUB 2NXEA 1R18A 2E5WA 2PXAA 3KQSA 1M0EA 3EPPA 5K0NA 5EEGA 2NNWB 3MAGA 3AXSA 5E9WA 2V74B 1X19A 3LGAA 5P8WA 3S68A 4F85A 1Z3CA 2H1RA 1L1EA 4P7JA 3ANXA 1WXXA 5EZQA 5FWAA 5D1HA 5C1IA 4FSXA 1JQ3A 1SQFA 1VPTA 2ZTHA 3G7UA 3QV2A 3FPFA 5T64A 3VC2A 1JSXA 3PT9A 1HNNA 4CTKA 3KPVA 1NW6A 3JWHA 2IP2A 3Q7EA 5DSXA 3LCUA 3DH0A 1L3IA 4PGGA 3PS9A 1DUSA 3HEMA 4B17A 2O05A 5CCXA 5DM2A 4HG2A 2IBTA 2A14A 2EFJA 4DCGA 3EVZA 3A27A 2AOUA 2O06A 5HFJA 3FUVA 5EKXA 1O54A 5GM2A 5CVJA 4PONA 2AR0A 4AUKA 4MQ4A 5K01A 3BUSA 1N7IA 4UOEA 4LWPA 2FK7A 3PX3A 2P7IA 2EJTA 3BWMA 2WK1A 1RJDA 3DMFA 3HA7A 1VBFA 1EJ0A 3DMGA 3KPJA 4GOMD 4R8SA 5EZSA 3UJCA 2ZCJA 4AX8A 4YMGA 3DXYA 5EMJA 2XBMA 3KR2A 3P9CA 5HILA 2Z6UA 4FZVA 3A7EA 3H2BA 4E2ZA 3I5UA 4FSDA 3TQSA 5CVVA 5ICCA 1O9HA 3FPJA 5E1DA 4L7VA 3EVAA 4PGHA 4M37A 3VSEA 1XDZA 4CKCA 3R9XB 2YXDA 2C7OA 4YUZA 1WXWA 3FUXA 3R3HA 4YUVA 4GOND 3V8VA 2BH2A 3LDUA 2ZBRA 3DR5A 3R6TA 4Y30A 3CVOA 3FRIA 2PLWA 3BZBA 2HWKA 2OY0A 2PX5A 3LKDA 1WG8A 3ORHA 4GOOD 3UA4A 3G5LA 4QVKA 5DRYA 2IBSA 5K0LA 3P97A 4BP3A 1X1DA 4K6MA 4RTRA 3I64A 1KPHA 5CUQA 5DTMA 3SMQA 2IDKA 3OU2A 2EX4A 5K0GA 1Q0TA 1EG2A 3K6RA 4C4AA 2B3TA 2P1DA 1NT2A 3LBFA 3KQYA 1V39A 4P58A 3UJBA 1VP3A 2ZFUA 3HM2A 4HC4A 3FTFA 1NE2A 5EVJA 2Z6QA 3KU1A 3GNLA 5C0OE 3B3JA 4MIKA 4GEKA 1AV6A 1TW3A 1NBHA
chains in the Genus database with same CATH superfamily
1GTSA 4JVLA 1PT5A 2JARA 3SVZA 3JWEA 3ZHZA 4DA0A 3ENWA 4YGYA 5A5FA 4QDZA 2QK4A 3HB0A 3WI7A 3VO8A 3JRXA 4AZ3B 5DX0A 4C04A 2EGUA 1N2GA 3QHPA 2BE7A 4MRPA 1P62B 2XAAA 4E5MA 1LQTA 1NMQA 1GSOA 3INRA 3KLPX 3IQGX 3PNQA 4P98A 3OQ6A 2C0QA 4LYEA 4X1OA 3IP1A 4YACA 4J3NA 3SZRA 4NH4A 3IPRA 4PZYA 2DWPA 1AG9A 3K0CC 3JTMA 4UDYX 4D8TA 1VPVA 4LJKA 3W34A 3R3YA 1XAHA 4RM2A 4K03A 1QSGA 5YASA 2NSJA 4OXNA 2XNJA 1QFSA 3UMSA 1TTTA 1UR5A 2D4HA 1JA0A 2YICA 2NLOA 1E8DA 4JXKA 5DOZA 2NVUA 3D8BA 4RFVA 2JZNA 1LLDA 2C04A 2RGYA 3L02A 2DWOA 2AJCA 2JEYA 4FDTA 1O0SA 2VF7A 3G2PA 3NMUF 2AUNA 5D5PA 2XZLA 4LZWA 3UXEA 1GZDA 5I7FA 4KREA 2DFKB 1QZTA 3ESAA 2G28A 3PRKE 1XCPA 2GSDA 2VIIA 3L05A 2J5BA 4M0DA 4EY3A 1QUFA 4P0PB 4UQLA 4EG1A 3ADBA 2ZXEA 3DQPA 2G4CA 4ICIA 3WYFA 5DEOA 1SUAA 1Y8CA 1BZYA 3F6YA 1OZAA 1VSTA 5CNJA 2RIRA 5CDSA 4BB5A 3DNFA 3HFRA 1JXAA 3GEDA 4FFMA 1VXRA 1V4NA 2BMJA 1YV9A 2WU3A 4L51A 5AWFC 2C99A 3KZNA 1H5NA 2XDQB 3RROA 4BASA 4ZJPA 5CR9A 2UUPA 4FK8A 1RLUA 2OESA 3JWGA 4CLOB 4IY1A 1NZJA 1DCTA 2IS1A 1WV1A 3RJMA 3FJ1A 3MYRA 4LCBA 2Q45A 2X8LA 1UOEA 1N3YA 1QHXA 2WP8J 1KA9H 4X95A 2FWPA 4R2XA 4EI2A 3KQNA 4WCFC 5AI0A 821PA 1XD2A 2Z2ZA 5JQWA 2OV2A 3NHPA 1SXHA 4UEJA 4LZPA 2I91A 3GU3A 4K40A 3AG5A 2X8JA 5G4KA 3AB3A 2AXPA 4QVIA 1R0YA 2VJOA 2WJYA 3O47A 1DBVO 2C0PA 1JQKA 4JFAA 4TTVA 1UJNA 3UPUA 4KFUA 2VZLA 1FX0B 1AU9A 2OVBA 2UV8A 3W2FA 5DYYA 3WKEA 2R8YA 3Q3EA 3QPWA 4P4GA 2HJVA 2NUPA 4KKXB 1ECLA 3L4BA 3WYAA 5CG2A 5IABA 4K87A 5AW0A 1U65A 3KB6A 4KE6A 1HFWA 2FR1A 3WSVA 4GI1A 3LUHA 1TCCA 1UADA 1EWTA 3CNHA 5LJLA 1G4AE 2FZWA 2BI7A 2ZJ7A 1MJ5A 4QDTA 4G0XA 2PUHA 3BK2A 16PKA 2HLDD 1EM6A 2UYYA 1EA5A 1ORDA 3I0ZA 3I04A 3G2KA 3OJ0A 4IIJA 4MOWA 4XVHA 3CGGA 4QSHA 2Q4TA 1RWNA 1K06A 1GTVA 2PUTA 2Z2YA 2IE0A 3JQAA 3ACBA 3VC3A 6CHYA 2SICE 1M34B 2V8OA 2VDOB 4J0KA 4B7CA 3F98A 2XGOA 3SQDA 2XNDA 3TLGB 1O6CA 3IKVA 4HQKA 1IBCA 1W4ZA 2GCEA 2JGFA 2J33A 4KYTA 1H4QA 2NIPA 2EZ8A 3AFOA 4RMNA 3O2NA 1KSGA 5HRCA 1E9AA 2YWXA 4M99A 3ZV7A 1C0PA 4D9EA 5FPSA 1EDBA 2QD3A 3F67A 1ONNA 2QAGB 3BHMA 3SHOA 1W1UA 3KVOA 2H00A 1CVRA 3GT0A 2OC9A 2V0CA 3FBTA 2Q0SA 4J3JA 3RFCA 3HKEA 3DEHA 1LSOA 3PCXA 3ZI7A 6REQA 1C7JA 1G60A 3H2JA 2JLBA 2QZ4A 4S0ZA 4U0KA 7GPBA 1TECE 1GPBA 2W6QA 4W7IA 5A7HA 3LW8A 2HA3A 1EVZA 4BLUA 1IL0A 1CS0A 4DJTA 4LVCA 2WWGA 5FPKA 1U5CA 1JLMA 2AN5A 3EZ6A 3FLEA 4L95C 2C82A 1U8AA 3VR4D 3D0KA 3BWYA 4KI0A 1TK2A 4ZXFA 4L5JA 4F2HA 4LXTA 1VIVA 1TMOA 4XLZA 4FKBA 3MILA 3ROPA 1P5FA 3DD1A 1YJBA 3ZWDA 4ER3A 4RANA 5AK4A 4GM0A 3TRKA 2HIAA 1LK0A 4WK4B 1JEAA 4V3BA 1ZN7A 1KJZA 5EHIA 5A4FS 1S6YA 2WG0A 2D5CA 3IOBA 1YIAA 2ODTX 3CZAA 3E9ZA 4INOA 2YZ7A 2X5XA 3K7EA 4B31A 3SHQA 1ZD3A 1W73A 4EJSA 4AMVA 1NUUA 3HPRA 1I7PA 3HJGA 4BVHA 3ELUA 1QGOA 3QVJA 3PWKA 5BSGA 3AIMA 1BX0A 3UV6A 1KMIY 4FWIB 1MJGM 1ZU4A 3N8DA 4GKKB 4RORA 1PZEA 4Z9AA 1CUSA 3W5JA 3ZV3A 2CKDA 3MS4A 4BB6A 4EJMA 1OMOA 1J0CA 3NT4A 3DE2X 4P54A 1QIKA 2IS4A 2XE4A 3BXHA 5FLXA 2WVGA 4BMYA 1OW3B 2BMWA 3CJRA 1B14A 4ESEA 2GPAA 2MR5A 2XQGA 3B5IA 2R97A 2C5AA 3L1IA 5LSAA 3S81A 2WWYA 4BB9A 2HL6A 2FG5A 4FJ2A 2Z2IA 1M2VA 1DV1A 1V11A 1WCV1 3SEZA 3KOWA 6ABPA 4C2UA 3GOQA 1OAOC 5HE9A 3N53A 3WRXA 1O1YA 1UJ2A 1KOLA 3PC3A 4RZSA 3TQCA 1RAGA 1M54A 4OB8A 1TA4A 4WACA 2HSDA 4IQ0A 3UWOA 4EX6A 3AEQA 3ZHCA 2Q3FA 1LZLA 1GAQA 1LD3A 1PQYA 1V25A 1XRRA 2ZRQA 3ZWAA 5HE8A 2XJ4A 3LYAA 2XGMA 2JGJA 4HVAA 4HOYA 4EYEA 4NCIA 1DLIA 2DPHA 1N2JA 4MHOA 2WT8A 4HBZA 1KOGA 2VA9A 3W6OA 2DQSA 5JNTA 1X7ZA 3I8SA 1XDGA 4NEQA 1KIMA 2CL0X 1GYRA 1O96B 1U28A 2PFSA 4B09A 2X2OA 4INAA 2FX5A 2LTAA 2GO7A 1NJSA 1MHTA 5AJXA 5K6AA 4RV9A 4KVZA 4JWKA 4L8YA 5F3DA 4JB3A 2DBYA 4MR7B 5C80A 2AV6A 2XUJA 4ZRMA 3TJZA 4P92A 3TRFA 1HZJA 2QTGA 1VC2A 2GDZA 3NV7A 4A6EA 1ODIA 3B6IA 3L0YA 1ZSVA 1YQTA 1U0SY 1ZRHA 4HDNA 4P4SB 2XOKD 3SF8A 4ARCA 1M8PA 2FRXA 5DM1A 4QXMA 3E2PA 4B74A 3MSCA 3L7BA 3BMNB 1QHYA 5EXXA 1DVRA 4BUZA 3AM4A 3AEUA 3AM5A 3ZVKA 1THZA 4G86A 4MVJE 1N2OA 1CTQA 5FFFA 2PH1A 2OEPA 2NTEA 1CRLA 3QE9Y 4P36A 5AKIA 4K1XA 2W2QA 1M6VB 4RZ3A 2O2YA 3IODA 1RMQA 3EN0A 5A6SB 4B3XA 1GRCA 2PFKA 2ID7A 4BX0A 4LFCB 1ST2A 3KT3A 2FR0A 4NJMA 1L5NA 4CFZA 3CT4A 3H18A 4TRJA 3G2HA 2VWQA 2XOXA 4K26A 4E2WA 3NCTA 4EG6A 1AMNA 3FNIA 5IJAA 3L7YA 4KI7A 3EXG1 2NU8B 5B5SA 4NCJA 4ZPJA 5I5GA 3QUCA 2I7XA 3CKKA 4HH0A 4EAQA 1T4DA 2FJPA 4AFNA 3UGQA 3DLHA 5CLQA 1W48A 4IEEA 4OF4A 1GV1A 1DPGA 4HV4A 1PFWA 3IUYA 1WB5A 1WU7A 1XTRA 4MKGA 4TRMA 2BGTA 3HVKA 4KR7A 2EKQA 1Q11A 1LVUA 1BO6A 2JJ2A 1A8PA 1V6CA 3DBVO 4K1LA 1WBDA 3FMVA 2ZYDA 4I5EA 2OHVA 3FJOA 2OWDA 3JVEA 1YJ5A 2X86A 1LV8A 2XWPA 3AL2A 2O3SA 3CVJA 3TCKA 4P32A 3L8HA 2FU5C 4PYRA 4WESA 1W30A 3EEOA 5BQ3A 4RD3A 3EZXA 2QRQA 1UBMS 2Q3EA 3FNEA 5GGYA 3QI7A 1CW2B 2G77B 2JLQA 3E61A 3KYBA 4BN4A 3P4YA 2QORA 3GUZA 3A28A 3K2EA 2G1PA 1ODSA 3IHTA 3EFEA 2J5RA 3Q3HA 4QGSA 5B1DA 3KM0A 1OU4A 2PX4A 3KSDO 5IJZA 5LOVB 3LDAA 2WD8A 2B7CA 2CK3A 3FNRA 4G0UA 3LCJA 1GLVA 4JVSB 5COBA 2FN8A 4HB0A 2R47A 4OKSA 3MNFA 4PNHA 5EYPB 1DC4A 1XTSA 2A9JA 2XUFA 1TPZA 3MD0A 3TFOA 3D4PA 2OORA 4I14A 3KQKA 4BVKA 4DBVO 2VZ0A 3KVVA 4ILEA 4REMA 3UJ6A 3PDIA 5E4FA 4DCPA 4Z4EA 4JJZA 3SF0A 5F76A 1UBTS 3IDQA 5KOHA 5D86A 4DSNA 1C9DB 3A2LA 3D6TB 3GJZA 3RVBA 4ARAA 1D09A 1RAHA 2XVMA 3A9VA 1LF5A 3IEUA 4ZVPA 1PR0A 1I0IA 1FLDA 1KHTA 3C97A 2ZJYA 3HE3A 1JMYA 3KWLA 3UHPA 1C30B 5B36A 3T1TA 3G9ZA 2AS0A 2OO5C 2WZCA 4Z1MA 1YJXA 4MEJA 1Y6JA 3SKYA 3OCYA 2VATA 4RK6A 1MB0A 3BKWA 3HS3A 4DSOA 1JHXA 1U9ZA 2XUDA 5AI6A 3R24A 4TGLA 3ZX5A 4F6RA 2AD5A 1FSZA 3BGOS 2OFFA 1LBIA 3T7EA 1TU4A 5CVEA 2IYZA 4Q16A 3AVVA 1X7GA 1T2CA 5KPDA 3ZDXB 3K1TA 1MLDA 4F5YA 2L18A 1W7AA 1HEIA 5B7NA 3Q87B 4Q3EA 2IKQA 2P0YA 5CHYA 1J07A 5AUOB 4GECA 2C4UA 2G9QA 2PAAA 3KTDA 3S2EA 5ALDA 2OZVA 2FFBA 2G08A 2MYPA 1GCAA 2REQB 3HR4A 2V6GA 3L84A 3L0BA 3Q8LA 4E07A 3BE8A 3D8RA 4GGMX 1XZIA 3WA7A 2JA1A 4QXPA 3U40A 1DQSA 3CA8A 3KKLA 3C3EA 4D1YA 4W99A 1HR0B 1QP7A 1YR7A 3DKPA 1GU7A 4IMPA 3BWCA 2VP3A 3NAQA 4M49A 1C9NA 1FXWA 4KQEA 4ZTBA 1Y1LA 4O1HA 3UZUA 1RHMA 6YASA 5JUWA 2BF4A 2BEUA 2F1JA 3ITEA 4J90A 1GPYA 2AHRA 4DR2B 1N5IA 3GFOA 1QO0D 3GIWA 3IESA 2YIVX 4LNUB 4PG8A 1MIOB 5C5DA 3K5HA 5C8ZA 1TE2A 4FFWA 4NICA 3QU7A 2VTVA 1WMAA 3OZIA 3N2KA 2VRBA 2VUIB 5EXDA 3V1NA 4GVLA 3H4IA 3M33A 4KR2A 4IOKA 2AZTA 1BW9B 1BFUA 1HV8A 3LC2O 3QYFA 4LZNA 3W06A 2GBCA 3DL0A 1DIGA 1JIUA 3K09A 2FPWA 1RLMA 2AG5A 4DT1A 2C42A 4M7OA 4V0KA 5DU2A 1C7FA 1V26A 3MMSA 4Z2YA 1WLYA 2C7BA 3WYCA 3NT5A 4HAXA 3U7EB 4F9FA 1WB9A 2WFAA 1T24A 2BI8A 3SWWA 1C4KA 2DTXA 3RJ9A 1W8IA 2GF0A 2I2FA 3H1FA 1AGRA 1GFZA 3PCRB 4LC1A 4EBBA 1N9GB 2OBXA 1FP2A 2D0DA 3T9DA 1D2CA 5IKEA 4ZEWA 3PQ3A 2W22A 3LQ1A 3NORA 1C4WA 2BMAA 2WWRA 2IU4A 1IZ7A 3DOIA 3HZOA 3JX9A 4TWBA 3RHZA 4FGUA 3AXSA 4F85A 4JI2B 4JLDA 2QTZA 2FPMA 2PGNA 4DN6A 1TA0A 3PNYA 1OAKA 4RVNA 1EP9A 2HPVA 3URKA 1FLNA 4EBFA 1QHHB 3LV8A 4GE3A 1SGWA 4LE2A 4CTKA 4E5SA 4Z3KA 4C4SA 5GGXA 5TJ9A 1AK9A 3QBDA 3IVAA 2P9CA 3EF0A 4YY3B 1L3IA 3DA8A 3HEMA 3D64A 4B17A 4WCFB 1N32B 1SCJA 1CUIA 4X6UA 3W8RA 1NA5A 4DV7B 4TRNA 3TSCA 4EB0A 1ZJ4A 4I08A 1FDIA 1N5RA 1V8DA 3SIXA 2HK7A 3CRMA 4I4IA 3SKVA 2BJVA 4D41A 2ZDGA 1RQLA 5K3DA 5K3FA 2YOGA 2QRGA 1VG1A 3ANLA 2JHFA 2FPIA 3RREA 2X9LA 2ZRDA 3IALA 4WOJA 4GX0A 1ABFA 1CUXA 1CUGA 1KL7A 1UBNA 4QJ4A 3E2IA 4IIXA 4YHHB 2XTAA 4UARA 4ZQIA 1RPJA 3CONA 3KR2A 4BTVA 3AR7A 4TVOA 1TYBE 3IO5A 1O9HA 2OFOA 3OPQA 3EVAA 4L7VA 4Q3NA 2CVHA 2O5CA 1YR2A 4W5JA 2ODNA 2C7OA 5F21A 2FSPA 3B60A 2VYVD 3N07A 4M1ZA 5HKOA 4FE4A 1M0WA 4IXTA 2RI1A 3ZBQA 2WHPA 4FLMA 2J5QA 3DWFA 1UPBA 2C9MA 3MWGA 1ZICA 3R5KA 1GSIA 4R7TA 3T1HB 4UASA 2H18A 3KK0A 5C8DA 2QN1A 4G4GA 4DLKA 4EOGA 4NEGA 1FS5A 1QQBA 3IOCA 1Z63A 1X1DA 1UWKA 2CXPA 2HRBA 4CM6A 2BCGY 2I3BA 3ZXYA 3HDJA 1EX6A 4G26A 3ETGA 4GNRA 4LEIA 1KEEA 1YDGA 3MJEA 2BLLA 1ATZA 1E6CA 1HYBA 1TQ6A 2WFLB 3KQYA 4HDSB 2GTHA 1Q6YA 2CHEA 2QDXA 3SZUA 5IT0A 1THTA 2VQSA 4IYRA 4YRGA 2XMZA 4UBLA 2D00A 3NANA 1XZLA 4GW3A 3NATA 2Z08A 2FXVA 4EHDA 2JW5A 1BS9A 1RI1A 3BORA 5EESA 1Q7GA 2Q4EA 1BRMA 4GZLA 1YKGA 1N2BA 4KO4S 3RVQA 2ZPTX 2GERA 4FKZA 1ZIYA 4R05A 1SG6A 2CGEA 4A1OA 1G6KA 1B0UA 1CERA 1GAWA 2FGKA 2YZGA 4EM6A 2RHDA 2XMGA 3EXG2 2H4YA 2ERCA 3A2NA 2CLCX 3RWBA 1SCNE 3O4RA 4ZTZB 1NVWQ 3C6XA 1KRWA 2IU0A 3ODPA 1N1EA 3VR5H 1A72A 4ZCIA 1U9JA 1YF3A 1GFSA 1WQ3A 1AY0A 1YD7A 2B37A 2FWBA 4I5GA 5E6UA 3W2EA 4AF8A 1UJ6A 3VKVA 4GPIB 4K2HA 9ABPA 1HM5A 1VFPA 3TS1A 3E81A 1U31A 4L6AA 5JVDA 1CY0A 5AOVA 5IARA 5F5NA 3MM4A 3NH6A 1JEEA 4FOTA 4TROA 4W5WA 3WL7A 3V9PA 4X20B 4AO6A 4AZSA 1LLCA 4OP1A 4LRWA 4V0MA 2NU7A 1HBJA 3SXJA 5E6SA 3OSZA 4LA4A 4UNPA 5HQ3B 2R751 2V0NA 3H5IA 3OC0A 3SGLA 2CLMB 3T38A 5KHAA 1KO7A 2VT6A 4WCDA 3ECCA 3PQCA 4WNYA 1PJAA 2DQYA 3G59A 1TC2A 4HPJB 4IFEA 4B0PA 2QBYB 2YRFA 1PNTA 1WXDA 1NL3A 4IRXA 1N5DA 4NARA 4NC9A 4B7AA 1PT8A 3QYJA 3GGPA 4EW2A 2OBBA 3RSLA 1YUBA 2R8ZA 4MGEA 2I78A 3EXHC 4KL8S 1VKJA 3G7NA 1KVSA 1AOXA 3OUUA 3TTVA 1PGQA 2GK4A 2VP2A 1EEXB 2GYUA 3H9UA 2C88A 4OUDA 3VGJA 1Q0HA 3OPXA 4PRKA 1UKBA 3KCNA 3N3BC 2GHTA 3VH2A 3F9RA 4CN8A 4MRNA 2IUUA 2PU7A 2H9IA 2AVNA 2GARA 4KLRA 3UV7A 1P2GA 4QA9A 3G5UA 3RANA 3S1AB 1WW2A 3LDFA 1IM5A 5K0CA 1ODJA 1Y7PA 2KB0A 2P62A 1FTQA 2XI4A 4X6YA 3AKEA 2R86A 4L28A 1I4EB 1H2AS 3BCRA 3CO0S 3MJVA 4GS5A 1FQJA 3AIKA 3VDMA 3OEWA 1ZRNA 3FKQA 4MTLA 2YYZA 2Z1MA 1DKRA 3KO8A 2F67A 4NYMR 3QIAA 3NDPA 5JROA 3KQVA 3Q5DA 1EUDB 1HDCA 4HDCA 4PZEA 4P0TA 1AJEA 2YWBA 4OAOA 4AQDA 5D5QA 2FFRA 1KERA 2B36A 4DJJA 1RLOA 2ZXFA 3MCZA 3MMNA 4R0NA 1K8RA 3RIEA 3TAUA 3FNGA 3CY6A 1T1EA 1YHYA 5KVAA 3JATB 4JJEA 3DFKA 2I34A 3M6UA 1W2HA 3OCXA 2VNJA 5JAPA 4V2IA 1Z3IX 5ALQA 4I66A 2COUA 4X63A 3IJRA 4BNIA 3LNCA 4RLQA 1EK2A 5CTJA 2JI8A 2G67A 3MG9A 1CNEA 5HKKD 4LF6B 2JCXA 3ETDA 3CLUD 1IBLB 4MV8A 1UKYA 1V4BA 2FOIA 5E2BA 3VPBA 2A1UB 2VYND 1YZLA 3U9SA 3CMMA 3UOGA 1C2YA 3KQLA 4H17A 3UOWA 4TQGA 2JJMA 3WBFA 4NECA 1RPAA 3AP3A 2Y9MB 1NP7A 2R1UA 4IV5A 4FN4A 1E9SA 2FWRA 3ZN2A 2OE2A 2PBFA 5EPOA 4ZVRA 2XADA 1Y6FA 1RPNA 4OHWA 1VDMA 1XHEA 4XGIA 5ALZA 2POCA 2QSYA 1BX1A 4XVRA 5L7YA 5K8JB 3GYBA 1GR0A 3K9QO 1JKJA 4JLJA 5D84A 1DAPA 4CHGA 1S1CA 4FIDA 1S7GA 2IHZA 1J2YA 1XGKA 1PL7A 1Z2PX 3FZNA 3I9KA 4GVPA 4KQ2A 3LLSA 1B93A 2IHUA 4RVOA 3WO1A 3UMCA 1NBMD 3OZUA 2YXBA 1ZEMA 4GGPA 2RAUA 3VPGA 4OSOA 1K63A 4O4LA 4GSLA 3GMTA 4U7JA 3HN2A 5KYYB 4G0OA 5C52B 2I03A 1I4OA 3QWBA 4UQOA 3O74A 1XRMA 3I5MA 2NU9B 5KKAA 2AFRA 3FTNA 2C2BA 3R8FA 4D0LB 3SHVA 3HBAA 2IPNA 3D59A 4P3XA 1KJJA 3AERA 1VQ1A 2JLRA 1R00A 1IHOA 1X1AA 2PMKA 4L0QA 4NNPA 3S8YA 3UAZA 1DRUA 4D8VA 5LWQA 1NG9A 3IMGA 3JZDA 4YIKA 2I71A 3GNTA 3NR2A 1M6HA 3NTXA 4PGFA 1RT9A 1FE8A 2HHHB 3UMVA 3FVTA 2BV3A 1Y3AA 9ATCA 1GU1A 4JNCA 2P35A 2QSZA 5F3RA 4IMIB 2CXSA 1Z4JA 4BTEA 1E8NA 4RTQA 2RKWA 1RI3A 3BN3A 4KMRA 4X6LA 4A1FA 1ZK0A 4RK4A 5KNBH 4BNYA 1UL1X 3KTFA 4NV1A 3SIPA 4OFBA 4ZWNA 2PU5A 4AJPA 1SOUA 1P5ZB 1YNOA 2DRIA 3HXKA 1GPH1 2ZR8A 3O4GA 3OO0A 2C96A 3QUSA 1ZR2A 4HWKA 5HGXA 5HOQA 4XWYA 4NG4A 3LX4A 3PPVA 3DEYX 5D7NA 5FI1B 3L6BA 2RK4A 2HBZA 3U3XA 5EZ6B 4IF4A 4OKIA 3ZY4A 1NW3A 2OAEA 4PZCA 1W76A 1PVVA 1ICEA 1DFIA 2ONYA 3F74A 2NGRA 3S3TA 1SCIA 3LA6A 1W94A 2NV2B 1BKSB 2V5VA 2WQZA 3JASA 2HA4A 5A0FA 2PXXA 3D6AA 1N77A 1WMEA 4CV2A 1PFYA 3A1NA 4GSKA 4M8SA 4MZXA 3VAYA 2AIRA 4Q4HA 3BT7A 4XJXA 1XT6A 4TS4A 1CUYA 5K0EA 2FZGA 3BMOA 1X1QA 1SXJD 3A4TA 3ZWQA 5CCEA 2AXQA 1SRRA 2V1UA 1OFIA 4FFRA 3INYA 1QCCA 2FSIA 3MC1A 2Q3LA 3I8OA 3UAWA 2JANA 2REXB 2HY7A 4YBRA 3MMXA 4NS4A 3LW7A 3BHJA 5CFZA 2NSLA 1GPNA 1XTPA 5LOVF 3ROFA 1PJ2A 3HYLA 3RB8A 3CN7A 3FUUA 3VOTA 1EXVA 4PRLA 2G7ZA 3LYLA 3PNSA 3MERA 4I2NA 3N2GA 5EE3A 1DOZA 5K1ZA 1Q12A 3Q2KA 4GPTA 3SD7A 4EEXA 5C1OA 5H4HA 1V3UA 5H3HA 3K31A 4I3HA 1YS7A 3EGEA 4MVJM 1RCFA 3HGQA 1WZNA 3SXUB 3BMCA 1Q0LA 3LDGA 3P5BA 4K9PA 3VA7A 4MVJI 3BULA 2J3KA 1K4KA 3HN7A 1QIFA 1R4ZA 2WD7B 5AOBA 1I7DA 3A6PC 5K3BA 2YJ4A 2DPGA 3HB4X 3QKWA 4JDUA 4JJGA 3STVA 1KOJA 3OZCA 3SC2A 1HRKA 1WDMA 3BE4A 4UM7A 4AW9A 5C8YF 3WADA 1NQVA 2FFJA 3ICPA 5AJZA 3IULA 3RS5A 4CCAA 3OHMA 5AD1A 2BBTA 4LYDA 4PQRA 4YRZA 1BDHA 5E2AA 3ZEIA 3I32A 5CP8A 1I1NA 4ODIA 5TC4A 2FG7C 3IVCA 3LWZA 3T12A 1F4PA 3VR4A 3P9PA 3DEIA 3EZ9A 2I6FA 3O3NB 4LQLA 4NBNA 4D4LA 4HX2A 5CLJA 1EBUA 1QHGA 4L0CA 4KNVA 2BR5A 3L0ZA 4R0MA 2VI5A 2W0MA 4Q39A 5HHTA 3FI9A 4O2RA 1RWKA 2CL6X 2MR6A 3B8HA 4H35A 3GPCA 2ICAA 2ZSFA 2YFYA 4OOEA 3ZHYA 9LDBA 4CKWB 1TAGA 4ERNA 1SVKA 1S8OA 4C22A 2WWXA 1J70A 1T9HA 4KQHA 1O6FA 4O2AA 1M1YE 2O3QA 2O8DA 1D1TA 3BTUA 4A6DA 2IPXA 1ISIA 1E3DA 2JD1A 4P5EA 2O0LA 5FFNA 1JA9A 1O95C 1SD5A 4HLNA 4KSBA 3T34A 2ZWMA 4BNFA 2UUBB 4H31A 5ERXA 4TL7A 4RK7A 4US0R 2GI4A 4PSDA 1GKUB 1R5NA 3WBBA 1LTHR 1T8TA 3A2MA 3SU8A 4C43A 5ALFA 4BNMA 4RQUA 2J3JA 1D2GA 5IVIA 3IQXA 4DNXA 2FDXA 4ZTUB 3X43A 2J45A 3LO8A 3OLCX 4PZ9A 3PIDA 2VP0A 1GZ4A 1OZHA 3L7DA 3GG2A 4F46A 2ABWA 2G3YA 4IUDS 1KMHB 1ILEA 3DBIA 3OOJA 1EFVB 1U4NA 4FINA 5AM4A 4E32A 4YV7A 1RM3A 2AH5A 1G63A 2JD0A 4PWYA 1ZX1A 5HKLA 3ND7A 3TSYA 1G7TA 3DFFA 1ETUA 4BV9A 3AINA 3PPWA 4A4DA 2P27A 4MCIA 1XA3A 1E9EA 3T9FA 3PX2A 2G5TA 4N0PA 4KXNA 4HQNA 4KMOA 1CUZA 3TPCA 1X6VA 1ULTA 2IUFA 5A4MS 3BZUA 3ZKWB 4N8EA 5AKGA 5JRZA 2NYRA 3CB2A 3VVCA 3MJHA 2P3QA 5AVXA 1JBEA 3U7RA 1DAEA 3I83A 1GGVA 2JIZA 4B35A 1WHSA 4CIAA 5IVPA 1EGVB 1GA6A 4HEA1 3L7NA 4XYEA 4Y6QA 3O8RA 3THYB 2XUHA 2XMBA 4AJ1A 3FDJA 1PKEA 3CEHA 1SUBA 2OQIA 4MAMA 3KAKA 4NVRA 1I4DD 1G20A 3RARA 3QXJA 5EWJB 2RE8A 4IHJA 1DBPA 1SA0A 4E94A 1EDEA 3G1UA 2WF8A 3PJFA 2Q6KA 4HCJA 2FEAA 1SWVA 4X71A 5IG2A 5ALOA 1T0JB 4RXTA 5AI9A 1FUYB 1KBOA 5C46F 4N7MA 1GQYA 1TT5A 3C3JA 4LHVA 4XB1A 3V8PA 4CHTA 2EYQA 4BAZA 4ZGWA 1JG3A 4DV6B 1LCIA 1QDLB 2GEFA 4YCAA 4OXIA 3F7MA 3Q0EA 4G9GA 5ALYA 5JTUA 3EPJA 2XTJA 2XXAB 4O0MA 3PG5A 2A4MA 4OLJA 3OI7A 4TUYB 5KYKA 5LIRA 1VE9A 5KJEA 3WDMA 4BQSA 2AN4A 3OBIA 3EPLA 3U5TA 1J7JA 1DRJA 1I7NA 5B2ZA 1T9ZA 4X0EA 1NIJA 3HYRA 2CEKA 3UJ7A 3GXBA 4LF5B 3AY6A 1KEUA 3NNNA 2Q50A 3IAS6 4HY3A 1YJ8A 3RV4A 1SUFA 4JXXA 3VYTB 1Q84A 3BD8A 3HNPA 4N7BA 2ZWVA 4C6TA 5B6JA 1X0XA 1R8JA 3TTTA 3UMJA 4FMCB 1Z07A 1RJ9A 3ZE9A 4R2IA 1PT6A 3DGEC 1OFHA 4L7QA 4A7PA 4AUEA 4B71A 2H31A 3D7KA 1YONA 4P81A 3QLVA 3O3OB 1ZDMA 3K6KA 1NF9A 2ORED 5A3JA 4I4NA 2C29D 1BEEA 3T41A 3KQTA 2LWIA 5HF5A 3WKAA 1NY5A 4DV2B 4DDTA 1XPJA 3KPWA 4LY9A 1JTEA 4HB3A 3IAEA 4I55A 2GEVA 1ZO8A 1IUNA 4YWHA 5CCDA 1QRTA 4QQNA 4QO8A 1L7VC 1OLSB 2X41A 1QGUA 3HJHA 3Q7QA 5ILQA 4IUCS 2ANBA 3HUUA 2ASEA 4HNSA 4NSNA 2J87A 2PT6A 2WPDA 1W6RA 2E4WA 2E5WA 2YQ5A 3KQSA 3PWSA 3MPUA 1GO2A 5CH3A 2NMVA 4FCVA 4MK4A 1T4CB 3EXHB 4CM1A 2AZMA 3SM9A 3RYIA 1GSAA 3CUWA 2BOVA 1Z3CA 2RGCA 3QSGA 2WSBA 4TYPA 3GLHE 4FJ1A 1QGDA 4CM4A 4YS6A 1BXGA 5AK5A 1G19A 3FVVA 4AS3A 3PT9A 3LUDA 1NW6A 4DCCA 1ADFA 2PS3A 4C5AA 2JL1A 2C9YA 2BJWA 3S29A 4PGGA 1QQ6A 1SKAA 1KQ3A 2KMLA 2NYVA 4OM7A 5LDGA 3ABIA 4B9AA 2RSLA 3I9V1 5AQ1A 2XCIA 1JXQA 4A8JA 3C14C 3L4SO 4HDOB 1U8UA 3MOIA 3OIFA 3Q1KA 3RBZA 2D5AA 4FGKA 2UUAB 4TWZA 4EEZA 1E1YA 3EUAA 4OUKX 5I8WA 3K2QA 1JVSA 1GPKA 4WCVA 1SBQA 1U04A 1Q1EA 4ENPA 4UJ3A 2G7MC 5F78A 5HF8A 2FFAA 3BPSA 3GRAA 4IWYA 5GVRA 4CCSA 1DXOA 3T52A 2X0RA 5IM4F 4G4JA 1NN1A 4FD2A 1EJ0A 1Q0QA 1N2IA 1YZVA 1BE0A 3BE5A 1DQPA 3UV3A 1VBKA 5C35A 1QO9A 2ZCJA 4OI1A 3WIBA 4V1CA 2WE8A 1ZCZA 3JPWA 4ZV7A 3PXBA 4Z7OB 3U1BA 4RSMA 1ES9A 2VDLB 4GYKA 2FSVA 4BMOB 5BWBA 2CNWD 1C14A 4D9NA 4QPCA 3QNWA 1E9BA 4CKCA 5C8XA 1ZH2A 4UXIA 4XX1A 1R3DA 5ABPA 2H2GA 3STWA 2H5JA 3IUJA 1X3LA 2VJPA 4TWJA 5KWSA 4C87A 1I2MA 2WB4A 3O1LA 4ZC8A 1JKFA 4GOXA 3X44A 3LKDA 3QWFA 4BBZA 2WJGA 5B55A 5IFLA 2H29A 2HIGA 2QRPA 3U60B 1KE1A 1XEFA 3F6BX 1RYDA 5HYVA 2RAFA 2MMCA 3JQEA 1W29A 4J7AA 2EBWA 4JASB 4KJZA 2EX4A 1GUZA 4CLDA 2P77A 2VOEA 4B6GA 1UODA 4BX8A 1NT2A 3W5HA 1HURA 2HWWA 3KOOA 3GP8A 3PGKA 2QXYA 3AFNA 2JRCA 5CDGA 3DUFA 4RJIA 3KLNA 1QFZA 3D3EA 3KU1A 2AGVA 2QY9A 1F2DA 5LYJA 4OJNA 1TIBA 1ZZEA 1JFVA 2Y1OA 2CNBA 3C3CA 4ZK2A 5IKMA 1XZEA 3U4DA 4WD3A 4MP3A 3RKUA 1AV7A 1GZVA 1SIUA 1DC3A 3IJPA 2ZYVX 2HMTA 3TIXB 1AHIA 1IMOA 1K4YA 1YE5A 1FVFA 4BHTA 3NM6B 2A9VA 4TWAA 3K1AA 3TNLA 3T5BA 4KIJA 3W9BA 4F1JA 5JS6A 2FPXA 4MI3A 2IITA 2VDVE 1ID8A 5BSTA 3HG7A 4C2BA 1DAFA 2PQMA 1DLJA 3GGSA 5HUQA 2OGSA 1LI5A 1VG8A 3T7KA 1FMTA 2CCJA 1A04A 1U6KA 3MTBA 4WLEA 1CQJA 2WSSA 3CWZA 3H3JA 5EXTA 1U8CB 2PX8A 3AQIA 2JHPA 2ZSHA 3OFNA 3DLAA 3X2FA 5F23A 1M6EX 3KBBA 3KQOA 2C03A 1QWOA 3KWFA 4G5RA 1JQ5A 2BFEA 2SKDA 2ZTVA 2AJTA 1JEQA 1NNI1 2P67A 1UC8A 2YFKA 4DQDA 2PWAA 5THKA 5I9IA 1CY6A 1QG2A 3ES9A 2A0FA 4PPQA 3VUEA 1LBHA 4DJEC 3M89A 5EOVA 5HDBB 2VCYA 2WTUA 3M82A 3BWXA 4N49A 4DBLC 3BFPA 1OGIA 1X42A 5AI5A 3OPVA 2UZ0A 2ZE6A 3CINA 3EJWA 1G8AA 4RY8A 5G40A 3U80A 5IF9A 3ILVA 4JI7B 5BQXA 2JVIA 3AUUA 2PX3A 4OXYA 5KQGA 2W6ID 3HJNA 3MCTA 2BRUA 4X3CA 1YB5A 4C89A 4GL2A 2GNPA 3ZTWA 4CZ2A 1WDLA 4RVFA 3F7TA 1EFCA 3ROQA 5A9TA 3EOZA 2ZROA 5KWEA 3ROXA 5DISB 1CLUA 3SHWA 1T8WA 2I1LA 4UBOA 1KH3A 2PR7A 1HE5A 4CDRA 5K0ZA 4Z4IA 4YT2A 2XVAA 5E9AA 3CJTA 2XZOA 2DX7A 3D9QX 5F73A 2EKZA 3RD5A 3UK0A 1SQGA 4J4HA 3GLKA 3DS8A 3FYTA 1S8AA 1E79D 3NV9A 4FC6A 2CXXA 2J6CA 1CEEA 5JJIA 3TQQA 1HETA 1LH0A 1OFUX 1PK9A 3MWDB 3PE3A 4EW6A 2XKAA 4DARA 2Y1GA 1Z68A 3E1GA 2OM2A 3DW1X 5F1YA 4DLNA 3L7IA 2VRCA 2F55A 1IJFA 1SHZA 1FJXA 2Z0MA 3PYXA 1XTVA 3T95A 5JS1A 1E98A 3SDSA 1SN7A 3VO9A 4AYTA 5KTPA 5LZ7A 2PQ6A 4KAXA 4LECA 3FDFA 4FILA 4DF3A 2R84A 1DKOA 3MCVA 1EINA 1C1YA 3M6AA 5JIBA 1WXGA 1WKCA 3V6MA 1W4RA 1GG9A 4LN1A 4LS3A 3OLVA 4QOIA 3IP3A 4U3JA 2VUHB 3TW8A 3WYNA 3H1EA 5EEHA 5BSVA 3P0HA 4E2FA 1RPTA 2BFOA 3EXAA 4DC9A 5LU8A 1Y1RA 4QU9A 4JA0A 4WUVA 1FUKA 4Z6KA 1RHJA 3R5JA 4XD2A 4EGSA 1Z2NX 1BE1A 4RCZA 5DYIA 3U1VA 4RJ2A 1VMDA 3FA2A 1TGYA 1N78A 1IM8A 1KGSA 1ORVA 1QK5A 1Z06A 2HHCA 4RIIA 5BV2P 2OORC 4MS3B 3KSBC 2ISQA 1X7WB 3QKRA 4V0OA 5I9NA 3R76A 1LY1A 1A8SA 2OHFA 1C5KA 2R4QA 4M60A 4YASA 1W75A 3TXAA 2OM6A 4B4WA 5B1IA 3U2QA 4X62B 3CXRA 5IAOA 3LU1A 4B6RA 2C7GA 3VKFA 1QIEA 1XJ5A 2IDMA 4NU5A 1YCGA 3SR4A 3V8EA 4OMCA 4PQEA 2ZS8A 3H9JA 3NVMB 1X2BA 3P9RA 3UO8B 1Z0JA 3FWNA 1XQ9A 2F9LA 2VKTA 1EX1A 2ZI3A 3BZWA 1NWCA 3EVNA 3KEGA 4HYEA 5F2OA 3BRCA 5KOIA 5KSYA 4BO9A 2AOWA 3N2LA 3BWEA 2ORVA 1K6EA 3E7PA 2O2SA 1MDFA 1CDOA 1CS4C 5GZ3A 3DKVA 3CGWA 2BEJA 2ECPA 4ITVA 4QUJA 3O4JA 4BEWA 1JYFA 1XK6A 1VRCA 3PGJA 3T3HA 3GAAA 1Q3KA 4L8WB 1VYHA 3I1FA 5IEBA 1V1RA 1G8KA 4NMMA 5C31A 3NBQA 3G2LA 3WS7A 4TSFD 1WLSA 2R6AA 3RUAA 4JMLA 4C0HA 3RRZA 1L4GA 3BD6A 5J40A 4M1KA 4GG1A 1D7OA 1AQUA 4FCCA 2XE8A 2ZGVA 1NYQA 2I6SA 3GJRA 3B48A 4MNTA 1SEPA 4Q48A 2HXGA 1X7XA 4TRRA 5EZYB 4E3WA 1ZJ5A 5BMOA 2R7AA 2JBAA 3B3AA 2D06A 5JY6A 3OJWA 5K2OA 5FHRA 1G7RA 1PV1A 3H2SA 2VO1A 3ZW9A 1G21E 3K0AA 2AW5A 4XIGS 1IRIA 2YUIA 3B1ZA 2P65A 2PZGA 3C3PA 1V1JA 1P4HA 2DKOA 2MYUA 4RX1A 5EIBD 5KVSA 4DNPA 3U7FB 4Z53A 1N6LA 4JBYA 4LV5B 3UAYA 4C6RA 1RQRA 3C3WA 3HP4A 1EHYA 3H7AA 1QU3A 4BQEA 2BFBA 3W6NA 1JZQA 1J21A 2JB9A 2NSHA 1CUJA 1DFGA 1G9XA 3C7CB 4A6XA 5IHXA 5FL3A 2W43A 4V0QA 1BMFD 2X3FA 4X6XA 3VZPA 4MV7A 4CF6A 4YV2A 4FGSA 1M1UA 4LPSA 4XAQA 4XYMA 1D3AA 4AT1A 4ISCA 1WUTA 2EKDA 1R6AA 3OMXA 3D5QA 4FI3C 1J0BA 5EUMA 2TMKA 3ZJVA 3U4MA 1QLHA 4GP7A 4TM8A 3OX4A 3I37X 2FZVA 1EGAA 1GKLA 1IH8A 2I2AA 2H59A 4HXGA 4K3VA 5EA2A 3KSAC 2VYNA 5NLLA 1E3JA 1WZIA 4JVNA 4EDFA 2RGNA 2ZVDA 1AQLA 1CBUA 3DMYA 1B3BA 1CQZA 1BROA 2ZRJA 4J0QA 4Y2GA 1IXSB 4LK3A 4I5IA 5IDVA 2X6TA 3QWIA 4KU4A 3V80A 3JPYA 3V97A 4F7WA 1PZGA 5T4FA 3HCBA 1F60A 1I2CA 1AA9A 5EXPA 5BNTA 2C1XA 3B7WA 3KZ1E 1BMTA 1C7ZA 3SQOA 3TK1A 4Z3OA 1EZ4A 2X8JB 3P9XA 1MKYA 1YS2X 3E8SA 1N0WA 2X8AA 1NBMA 3B1JA 3PXCX 4R3NA 1UXKA 2AMLA 2QE7D 1JZTA 1KEZA 1ZRSA 2HMAA 4MUHA 1YFKA 1O4WA 1O3YA 1OT5A 4TS3A 3O9ZA 2IW1A 3B7GA 4YGXB 5I4CA 2Z04A 4ALJA 1VSQA 2ZUWA 2RG1A 1WUYA 1CY1A 4V03A 3GJQA 4NZMA 4YRSA 1C50A 3KFVA 1XSEA 2Z2KA 4B73A 2AJLI 3P94A 1QLWA 1LNSA 1Y4AE 3D3KA 2AOVA 4UDXX 1E0KA 2Z1DA 2HMVA 4OAPA 1UEXC 5HMLA 3W9YA 3Q7PA 1INLA 4TMVA 3G89A 1ISFA 3G9XA 4HWSA 1XQWA 4D3ZA 2VP4A 1E7RA 3GFBA 3RC9A 5A1TA 2BIFA 5EHXA 5LQAA 3NHUA 1SUEA 4AJJA 1OILA 2CJPA 1XA0A 2W2LD 4TUYF 4R1PA 1IN6A 3IP8A 1T9BA 3Q9LA 1JDBC 1VZ2A 2BHTA 3PTLA 3HU3A 1R6DA 3SQWA 2NYAA 1WMDA 1CQWA 2VSQA 4B4OA 2REBA 4YJHB 3JSAA 4G0YA 4MXDA 2WT9A 3V8QA 1G42A 3T61A 4YJ3A 3CTMA 1JA1A 4A92A 3MXOA 4KLAA 2GN0A 1FYXA 2I2BA 3EDYA 1TFUA 4Q03A 3UGJA 1SO8A 2HJ9A 2IZ7A 3M6IA 3V4RA 4FMCF 1SURA 4MYCA 3HCWA 2Q5EA 5CU7A 3LLUA 1Y1SA 4CFYA 1NPDA 2BFFB 1JHQA 3VTZA 3IPLA 4QRHA 4E4RA 5KWIA 3U56A 3AO0B 3KV3O 3R3XA 2F1KA 4XFDA 2F90A 2GEKA 2REOA 1FXUA 3IT0A 1LDBA 1KFCB 2F8TA 3O2QB 4Y6PA 8MHTA 1JI0A 4RSHA 1OXVA 2JK1A 3VYSB 2SBTA 1VJGA 2R11A 2BEKA 3TOSA 3ZU2A 1E92A 4L72A 4QU5A 2QRHA 2VPPA 4KE9A 3PFGA 4YRNA 4B3TB 4MSUA 3I0NA 1DTWA 4CLRA 1CVIA 1C8VB 2VQFB 5BVGA 4BJ3A 2DG2A 1DCMA 2DPXA 3IBGA 3LPDA 121PA 3E9CA 4NY1A 2XHEA 2ZSEA 1KMCA 2R1TA 2UDPA 3NHFA 4P93A 3PICA 4Y7CA 5JWHA 1Y8RA 3KKZA 1ODLA 1QYXA 3AOGA 3LHDA 2B92A 1L7PA 1FRNA 2VAVA 2WVJA 2XNHA 4GYWA 4UM9D 1AXEA 1U7DA 1PGJA 2QF7A 3QXSA 4LZJA 1E4EA 4OQZA 5FYQA 2A57A 3NRCA 3M6WA 3RTEA 5LPNA 4LGVA 1U0JA 1QGAA 1UMBB 3QXGA 3JVIA 2Q6VA 4LUCA 1GL7A 1DJQA 4C2AA 5JSZB 5CDYA 2BDTA 3KJIA 1D8AA 2C78A 2GCGA 5LR6A 4R0VA 3NBXX 4OU4A 3CTPA 1C29B 4B2LA 2W70A 2UU9B 1J8YF 3NHLA 5AW8A 5J4LA 3OSUA 3Q9SA 3AU9A 1LFAA 1WD7A 1Y81A 3GH1A 1J8VA 3HBJA 5DCWA 3AP2A 3TE7A 1A9XA 1M8KA 2HPZA 2CNLA 4C0SA 4OHCA 4G4SP 2CMDA 1P2FA 3GROA 4PLFA 4S24A 4UJ5A 1KI1A 4Q7LA 3RKSA 3H6GA 1J6UA 1HDIA 5CITA 4V3CA 1PSZA 5CYFA 2TECE 2B35A 1E6UA 1NRIA 1TW2A 1Z39A 2PMFA 2Q8PA 4IHQA 4Y2RA 5TT1A 3ADCA 3D7MA 1PS8A 5KYWA 3LE8A 2V96A 4DLSA 4XTCS 3I01A 3UCFA 1XL1A 4LVUA 2EJUA 1QQ7A 4C0JA 3E5NA 4A0SA 1XXHA 4EKYA 5EKDA 1Y8ZA 4YRQA 1F38A 1HQYE 2EWWA 5CA1B 1SZCA 4XIIA 1KAOA 1PZXA 3K3PA 3KYCB 2G5GX 1APBA 1ZIDA 2HMWA 4MQUA 5F9HA 3UB2A 2V7UA 2O07A 2PWPA 1O08A 3F5QA 1OI2A 3EGIA 1TQ4A 2ALJA 4DVGA 1JFLA 1Y9DA 3HP1A 1LI4A 3H9CA 4HNHA 2AXEA 5DHQA 2Y71A 2C9CA 2WDPA 2IX3A 1FSGA 2CUKA 1CR0A 1NJGA 4F92B 2IZOA 1DAOA 1JMKC 3IPXA 4EPXA 1I6LA 2RK6A 1UBEA 3VNQA 4N9QA 1J39A 2VQ6A 4DC0A 4BAUA 4YJGB 2P2SA 2BKLA 4LJAA 3PFCA 2PNFA 3LKVA 4H16A 4OK3A 5AM3A 3L49A 1JIVA 1ULUA 2H1RA 3I6QA 1WW8A 1XNQB 2PRSA 4D9KA 1SQFA 2FGJA 3QV2A 3PNBA 3TXXA 2AG6A 4WAUA 4PRYA 4UCWA 4ZCTA 2RJNA 3PS9A 4MDYA 4QBIA 3T94A 2ZYUX 1KVUA 4Q4JA 2QAIA 3IIEA 4JI6B 2GD6A 4RDIA 1MN6A 4QKQA 2YBEA 2IZ5A 3FNQA 2JLCA 4IRMA 3WZLA 4DCGA 2WP0A 1DEAA 3A27A 2E1RA 1J0XO 1Z2OX 1RLTA 1GZ5A 1SY7A 2B4RO 2C84A 4HYTA 3SLGA 3KNZA 3U9LA 2WQ7A 1BDMA 1TJ5A 2QL6A 3WWEA 4GPZA 3O8CA 1C9EA 4GMHA 1ADCA 2FSGA 3DZBA 3WNBA 2PUAA 4KXWA 5IBCA 1PP4A 4J1TA 1NVTA 2C2ZA 3TDNA 2Y77A 5C1DA 5ILOA 2ZSAA 4IS3A 1AKWA 4YMGA 4V38A 5KC9A 2RGXA 3FYUC 3VTFA 2HA7A 1PX0A 4BDTA 4FSDA 2GUWA 4YIHA 2F3RA 2FSFA 1K7FB 2A84A 2QUIA 5E1DA 3GL9A 1LU9A 2JHGA 2VPWA 2DJIA 3QY9A 1DBWA 3IVGA 1RHQA 3AR2A 3ONEA 3B85A 1A3CA 3LX5A 2WJWA 1RC1A 1E89A 1ZH6A 2AJBA 3KOZA 4YRTA 4Z0NA 3U7QA 1XBTA 3TTYA 4AD8A 4AJ4A 1H0HA 3OUZA 2VEDA 1CQXA 4J91A 5DULA 2F8SA 1C4XA 4YCMA 4IINA 4BNHA 3UA4A 4JQYA 4LXHA 3UWKA 4ZHQF 4DIKA 2PRYA 2C4TA 2RH8A 1E2FA 4H7JA 3I64A 2AL7A 1BH6A 3QTBA 1WMBA 3G79A 1GZUA 1RFGE 4PQGA 1VJTA 4F1KA 4RADA 1KF0A 2G5PA 2XUGA 4TVKA 1HLFA 3MWJA 4ZVNA 5IBPA 2ZFUA 4C1BA 2PS1A 3C6YA 1B3RA 1EYZA 3IPAA 4MGYR 4A03A 1D2MA 4YJDA 5AW5A 2XZPA 3B3JA 2AEJA 4G0NA 1U1GA 2F62A 1I24A 2ATXA 3ASZA 4CIYA 1NNEA 1AV6A 2B1GA 1S9HA 1USIA 3GCDA 2B7BA 3BGWA 3RTAA 4DMFA 3V4SA 5FUBA 4E08A 4N3AA 2ID8A 2RDMA 1RLIA 1AHHA 4GI3A 4D43A 4JLPA 3VR3A 3SZOA 2ZJ0A 5GONA 3JVDA 4TKVA 1IXYA 2Y6VA 3ISTA 4YRMA 2GN1A 3QX8A 4JGIA 1KXZA 1XKLA 4H2DA 2CXUA 4N7RA 4PG7A 4QVGA 4U2CA 5IK2A 1ZRMA 2C58A 3E70C 1VSBA 2OXIA 3H3FA 4ARIA 3T6KA 4CV0A 5F7XA 2MDTA 2ZJ1A 3FAZA 3AESA 4QTXA 2R96A 4LY6A 2MSKA 3EZ7A 2Q21A 3OU6A 1T3GA 4F3NA 3D1VA 4DDVA 4OMFG 1E66A 3EZ2A 4Z49A 3ESYA 2OECA 4GNKA 1VIYA 3DMTC 1RP1A 1P3JA 1WM1A 4F4HA 2B0CA 3VAAA 3SJUA 3ROEA 2W11A 3GZNB 1AS0A 3Q6NA 4JLWA 1P17A 2LCQA 1Z62A 3NUQA 4Z2AA 3WLOA 2E55A 1V5EA 5A6VA 4YRCA 3ZV4A 4L8GA 1A9SA 3AB8A 4YRIA 1GZ6A 4AZWA 4NK5A 3RAJA 3N6VA 4O4JA 5LQCA 1TO6A 3IIJA 4NONA 3C7TA 3X1WA 5KI6A 4ZPXA 1TLLA 1G5RA 2HJGA 4PC2A 2WPNA 1PGOA 4KN9S 1NI4B 3NVKI 2LKDA 5FEMA 1BA2A 2QX4A 4PE5B 3VR4H 1YS6A 2YWGA 2CFSA 1BOOA 1PSWA 1YL7A 3PQ8A 4ZO9A 5LZ9A 1M1NA 4NE9A 4OY3A 3H1PA 1OLXB 2AOTB 3WB2A 5AK6A 2QPOA 4HH4A 3ETJA 3FLMA 1QK3A 3FGZA 4QLAA 4ZCSA 2XGSA 3GELA 4TYQA 1JU4A 1KJIA 5KEIA 2EP5A 4NFYA 4QDUA 4AJ2A 2CZGA 3U39A 3REFA 1WB4A 3GPIA 2L0XA 3DL2A 4R1QA 4RTKA 1Y5RA 1EA7A 3WL6A 5CT5A 3ZVNA 4ZAZA 1M1YB 2EFHB 1O97D 5ANRB 1Z47A 1ESMA 3UUWA 4TTJA 5BMVA 4K5QA 5ULLA 1FTWA 1CC1S 1UDWA 5DE3A 2CNWA 1ENZA 2PSEA 2YWEA 1X0VA 2I80A 3G49A 4FIZA 4WXHA 4D9MA 2AA3A 3UJ8A 5K0BA 2BTOA 1ZK1A 3N8IA 3NGLA 5BV1A 4ZYWA 4N47A 3PXAA 3BBLA 1NWHA 1LC3A 5CYOA 1NM5A 1W96A 4LDRA 3G2JA 4M7RA 2E18A 4NAUA 1IRXA 4CL0A 1X7DA 3ET4A 3PUWA 4J2OA 4LHYA 1K7YA 1B6TA 5EZYF 4QDKA 2PX2A 1QQAA 3B36A 2IP1A 4RA6A 3NPMA 3LQQA 3G8DA 3HGTA 4FVTA 4MQLA 1CB7A 1MT3A 5KUTA 1G8SA 1MDBA 2EERA 1N2CA 3L6RA 3VO2A 1GPUA 5EIFA 3N8NA 1MO4A 2GETA 1XLVA 2EZ4A 3FOEC 1H69A 3E6AA 4WJKB 1A77A 3B89A 4MKRA 5F7JA 3WGZA 1E2BA 2O48X 3UJAA 4XQ9A 4Q37A 1JPVA 1YK0A 1J5PA 1GGFA 4MYUA 5EJFA 2CJWA 1PJZA 4PAOA 3LC1O 5UKDA 3DVAA 3CS3A 2VT2A 3RWMB 3T3PB 3DV0B 2NVBA 3GLIA 4RVUA 1C7EA 2IX9A 3Q2OA 4LYYA 3D02A 5DXJA 3EEBA 2IJGX 2Y1EA 2F8LA 2NZUG 3KXPA 4Q4AB 5IJXA 3MGBA 4JYBA 3SZMA 2Q1SA 2PE5A 4IGEA 3I9LA 3HABA 4RH1A 3BFKA 3T1QA 5GINE 3S6JA 1DQYA 4UDOA 4L85A 3D8TA 3K9HA 3L0OA 3T9BA 1JDBB 3B12A 1VKNA 3DVQX 3GCWA 1GQFA 4MLPA 2IXTA 1CY2A 3AMVA 3EMBA 1OHHD 2J1LA 2IEIA 4KXXA 3KFXA 3U81A 2FH5B 4A0HA 4AN0A 2AX3A 4F96A 2QTVB 3MGGA 3O0DA 4KO8A 2GN8A 3A32A 1JDJA 1QLJA 3LPNA 1MNAA 4TTTS 4C7JA 1ZM9A 4LC9A 4ZDKA 5IZ4A 3NFRA 1F20A 1J9ZA 5B64A 4EUSA 3WJ1A 2KW5A 4TN1A 1KEEB 3BF7A 4ZANA 1WS6A 4R1NA 2XVZA 4IJ6A 5JPDA 5AKKA 4NYMQ 2B9VA 4N8SA 2C4HA 1NV8A 2GR9A 1I14A 1MXHA 3MTIA 1IY0A 3BB1A 3QLUC 4PGAA 4ZDJA 3WAGA 1J9EA 2LD4A 4FLEA 3LY8A 4G1BA 5D3QA 2CW5A 5B4VA 5A4KA 5LP6C 1Y6RA 1I94B 3WIOA 3DDNA 4N41A 3K20A 4EG3A 1YC2A 3OZSA 1KH1A 4CIVA 1GXSA 3TI7A 3JTEA 5G0SA 2ZCUA 3UYKA 2AF4C 2JHAA 3EFOB 3HV2A 5HW0A 3Q2IA 1YMUA 1S8FA 5IZCA 3K70C 1FC0A 4QZVA 2J07A 2QHXA 3W3ZB 3ZOZA 3W7AA 2VH5R 1PR5A 3HB5X 1Q95A 4GAEA 4YP7A 1E2NA 1NR7A 2O1WA 4LRXA 4QRIA 4ZYXA 4J2TA 2AB0A 4ARSA 2F59A 4HFMA 3IKMB 1YB6A 4OFZA 4PR3A 2N1BA 3BGDA 3UFXA 3V2IA 2C4KA 4B8ZA 1P44A 4K9MA 3QLVC 4MLDA 2EFEB 4CV1A 5JJLA 1V5FA 4RHCA 4QHTA 2WJ6A 1MPTA 1U5BA 2FPPB 4EAAA 3BTOA 3ADDA 4HX9A 3EE6A 3L7LA 4C0WA 5FF9A 2NZ2A 1L5OA 3ZDZB 4RPLA 1LW7A 2BHNA 2CNNA 3GLHB 1K9VF 3OH8A 4MPDA 3THRA 1UOQA 1RXYA 3P9NA 3ER9A 3JQ7B 4M1TA 2XSZA 1KE2A 5JCXA 5JR3A 3DL7A 4HP8A 3P8ZA 2GB4A 3HB9A 3EHEA 4PANA 4B7XA 5H9VA 5KIAA 1E60A 1ELOA 1RYYA 3S4YA 5JH7A 5JLAA 2BTQB 4RM3A 3U09A 3LM8A 4LZOA 3NI2A 4RHFA 1E1RD 1DKMA 4Y18A 4E11A 5A4JA 5LMNB 1XR3A 1YK1A 4C76A 1IDOA 4POOA 1E3QA 2LW7A 3ULKA 4NQZA 2D2EA 4KH1A 2ZU0C 1U3CA 4ZARA 4HXYA 4NYJR 2DSTA 2W48A 4M46A 1RXCA 2D2XA 3SE7A 3K0SA 5CFQA 3IP5A 5EY5B 1NLZA 2KM1A 2N3ZA 3OFJA 4PTLA 1T2NA 4R7GA 4WN9A 2Q0QA 3QF7A 1QDUA 4DJFC 3HJBA 3IOMA 2WJZB 2XE7A 3DYIA 1RJGA 4MWCA 5T3YA 2BZ0A 1U6IA 3AHIA 1MVOA 1H22A 4MVXA 4TV8B 4XR4A 5BQ5A 5K4HA 2WU8A 3DLBA 3GJ3A 3H2GA 4MLCA 4PIPA 4FMBB 2YS7A 1WPXA 1ZQ1A 2VBIA 1F2TB 3TGPA 4R1TA 3J81A 3T3OA 2J9RA 3RFVA 5BN4A 2LCIA 2NTYC 4L2IA 3SBEA 2Z9BA 3QKUA 1FDWA 1I30A 3EBPA 1E5DA 1EI9A 2K2WA 2YXEA 2VYCA 2FSVC 4RYLA 4ABYA 3WJ2A 2RHGB 4Z86A 3S1LA 4RF4A 1Y7LA 2ZZKA 5LQKA 1DDIA 2XYVA 4M0PA 1L5YA 3TNYA 1J42A 1QX3A 2H4WA 2PQ0A 3L01A 4P1ZA 1EFAA 1EUQA 2PPVA 3LL7A 4QARA 3V4ZA 2QI9C 2FXIA 4JB2A 4A5SA 5CB8A 2GPNA 2BY4A 4NK4A 1A7KA 3EXFB 4YP5A 3PX7A 1J06A 2JIRA 1V7ZA 3JD0A 5E9QA 3PQ6A 3VV2A 5TMPA 2WIJA 1DZ3A 3PHHA 1WABA 1BX3A 1KTVA 1GTL1 1YRHA 1T3LA 2X0NA 5FPQA 1MXFA 2IIPA 2R6JA 4O63O 1CIPA 2IHBA 3D8NA 1DBIA 2O8CA 3N75A 2YN4A 3EH2A 3PT5A 4BO0A 1JKJB 4IX1A 5CA1F 2OV1A 4NX2A 1UT8A 1G98A 2O0MA 3SEAA 4U4AA 5ERYA 1GUYA 5K05A 4DRXA 3UM9A 2EEZA 1EVIA 5GOZA 4GQBA 3ZZUA 5HF9A 3LHKA 3EK2A 4KRGA 4DTIA 3I5XA 3UTDA 3PWTA 4WLUA 2YWHA 3WISA 1P7WA 4JT8A 3TLAA 4L3WA 5FIUA 2FUKA 3FYUB 2PYDA 4YAFA 1SH7A 3HCCA 4KQ1A 4WHMA 1FYVA 1RWOA 1XF1A 5IVDA 3HO1A 4R1UA 4HFRA 3WA6A 3RAEC 2VHQA 5I4KA 1AKRA 2JI7A 3PXDA 4DV4B 3PC8A 4DXDA 2R68A 5KVCA 3LUCA 4U9HS 1XVAA 4C03A 2GPSA 1YVRA 2G6TA 1TM7E 1ZHHA 1BYUA 2GPWA 3EOBI 3ONDA 2E4AA 4G36A 4HQFA 4IVQA 1U3VA 1R4MA 3VXKA 1NSYA 3IOEA 2QAJA 2A0WA 4CF5A 1KQNA 5BSMA 3AYXB 2C5SA 4CLXA 4AKIA 3BAFA 1E1CA 3DZHA 2ZI6A 1CJKC 4B6OA 4CEHA 3USZA 4JUCA 5ITVA 4DEVA 1XU4A 5TNXA 3QUTA 3HLYA 4HNVA 1KZ1A 2P2CA 4DXHA 1M7HA 3VOSA 5FL7D 4Q34A 1A95A 1VI5A 3AU8A 3FRJA 3GAMA 3HVUA 4J4BA 2FV8A 3EZNA 2ENUA 3PIRA 3UFBA 1E62A 2IZ6A 4KPUA 2OGWA 2WR8A 5K8LA 2H06A 3KAQA 4WOBA 4NCXA 2ZBEA 5JS2A 4DV3B 3O9VA 2M9MA 4N6OA 4RPIA 3ZDYB 5DBIA 3U3RA 1ZUNA 5KTTA 2VPYA 1FFYA 2HFKA 2R3SA 2PJRA 1KZGB 3BSFA 3P2IA 2GOYA 3QYAA 4MQ6A 3JYLA 4QFCA 3TNJA 3W6PA 4DFDA 5E1MA 2PQ2A 4DJDC 1AHPA 3WLEA 5LBTA 4U0JA 4ARVA 1HUQA 1RNLA 1WUJS 3B9RA 1J33A 2B20A 4Y6LA 1CUUA 4C4OA 3KQHA 4LFBB 1W5AA 2OTCA 2Q49A 5C7OO 3B6EA 5T7BA 5I9SA 4CBVA 3R5SA 2DYKA 4GOJA 1Y34E 3H2HA 4LXUA 5JAHA 3UG7A 1SAYA 1YQWA 2D5BA 3N5KA 2Q1XA 4Q4HB 3H8VA 1HG0A 2H4FA 1YGPA 1Y3DE 3OZFA 5FT9A 3OQIB 5FJIA 4B79A 3R0ZA 1IXRC 1DKLA 2E48A 1EFDN 2WFZA 3PE6A 3FW1A 3QFTA 1JECA 1TVKA 2P30A 4AP5A 3HJFA 3VPXA 3IPYA 3ZU4A 4M2LA 3TM5A 4OX9B 2NUBA 3NIBA 4K8RB 3HDVA 3KG2A 5FWYA 3GGDA 3NWBA 2RKOA 4WOPA 1OKKA 2PV0A 3OKFA 1F51E 3R3UA 4H3VA 4DLXA 2ZJAA 5ELXA 2VTEA 3JD1A 4FN5A 4C30A 3SQMA 4AP6A 3N2GB 3I2IA 1O77A 2NVOA 1EK5A 3HTXA 4TKLA 3VZRA 5DGXA 4ZVUA 3SYNA 1GPLA 1TCAA 2X6RA 3DTVB 1QAOA 4KV7A 3H5WA 1PG5A 3DCJA 1S3FA 1IJBA 2GBGA 3IEPA 5DX8A 4BE7B 3U4GA 3QEBZ 1TU0A 2DLDA 2ZU6A 1FDRA 3EPPA 4BX9A 1U1EA 2NNWB 3S28A 4KIWA 4AZ0B 4ENQA 2A1TR 1L1EA 3F1LA 3ANXA 1I80A 5EZQA 2WKWA 4FSXA 4KZPA 4PSCA 3QVMA 4BNZA 1E64A 1Z22A 1NNSA 2E87A 3A9UA 3DKIA 3JR7A 3GQBA 5TQ0B 3HU1A 5IDQA 1Q1AA 3HY4A 3B6KA 4TYNA 2XF8A 1DX4A 4XE5A 5I7AA 3GLGE 2HSEA 2RH9B 1DP4A 4TSKA 4ZYZA 3VR6D 2JEZA 1VL1A 2OT3B 1L4BA 5BSEA 2QVCA 3RGGA 3IVMA 3EPKA 4ZHSA 4PONA 1A98A 4E1BA 5TARA 4CI0B 4MS1A 1NF8A 2FPGA 4BGUA 4N4AA 4HUTA 4UOEA 5JI2E 2ZSIA 4UM5A 5FUQA 4PCVA 5LQSA 2L17A 3R1IA 4JSRA 1XVTA 4MB0A 5CK5A 2CCGA 4IG4A 5I7SA 5F7OA 1Z33A 4RHTA 5J3JA 2DR3A 2HREA 3EAQA 1EM8B 3IP6A 1KI2A 4RIHA 3ACCA 1Z6TA 4HRVA 4XD7D 4BVLA 4Y8VA 1YI0A 1TGVA 4MPTA 3DWIA 2X0FA 2PRZA 4JEIA 3SQLA 5ARBA 5L7TA 2GT1A 2LRHA 3BF8A 4M6WB 2A30A 5CB4B 1LW6E 2OG2A 5A1JA 5G53C 4G2NA 3LAWA 3WGKA 1E8MA 2YWCA 4FUQA 4EIWA 3C5EA 4EYKA 3BMXA 5KTOA 4BPBA 4MW1A 1QU2A 2CLDX 5CBKA 5DTIA 2OY0A 4RELA 5BUCA 5AVVA 1S0UA 4RZHA 2IBSA 5TPWB 3FIUA 1GFIA 4IO1A 2W2KB 4CVNA 3BJIC 5A9SB 3FNFA 3GT4A 4RUKA 2HC9A 1Z35A 2WIFA 1FLVA 4MEBA 3OU2A 4DR3B 1G21B 4YT8A 1Z08A 3NTQA 3NGXA 4UCFA 1H66A 1V39A 2D0OB 1Z0UA 2J0EA 4QBFA 2OCKA 2W8ZA 3AF0A 4FI3F 5BR1A 3BH6A 4IGAA 3RSOA 3EXEB 1CUBA 2YIDA 4WXEA 3KXDA 4WZBA 5BRJA 1YU6A 4MB6A 4LZAA 5F9MA 3R6LA 2AKYA 1QORA 1BS2A 3OIDA 3UN1A 5AIAA 1T9GR 1M2OA 5FCDA 4JQOA 2E5LB 3IMFA 5J4VA 1R8XA 1BGXT 4HYQA 1DS6A 4E2YA 3BL8A 3ZK9A 5EMNA 1K6XA 4ZREA 3E23A 1RC8A 4JT4A 5F3WB 3RIMA 1GAJA 1HL7A 2BP7B 4Z0HO 1U1DA 4DLZA 4HGPA 2J9ZB 3M6LA 4IHKA 4LJLA 4O02B 1WXIA 2OSBA 3ZDBA 1K7XB 1JZSA 2WF9A 3E18A 4FR0A 3QOFA 3CUVA 4P9NA 1DO8A 3G2IA 3NWEA 1EVJA 3HDHA 4LG1A 2CUTA 4FUTA 4QULA 2R48A 5E1BA 2VHTA 2XRYA 1XEWX 5LP6B 3K73O 2H1LA 1J1ZA 1JTVA 2A94A 3BVPA 3HO8A 4E12A 3MINA 3IAUA 4AY2A 3KQQA 2R62A 3SX4A 5JLJA 4EW3A 1T5IA 1D7AA 2XX3A 4N6NA 1A96A 5DNAA 4D4IA 2GFIA 5E7IA 3K70B 1Q7CA 2C83A 4HQRA 4BLQA 1T2DA 1PNRA 1ZD1A 3FHLA 4JLMA 3WWDA 1VE6A 3WAKA 1X1CA 1EWVA 4FHGA 1DKPA 1W4LA 2E4XA 3MLEA 3JQ9C 1DAGA 3M6VA 5J1TB 3E7WA 3S7TA 2ZE7A 1ZMTA 2CYAA 2GCIA 2FPLA 4JH0A 3CLTC 4LMPA 4QO7A 5GM1A 1KI9A 4Q1VA 1QH1B 4X1KA 5IDWA 4LXYA 1N6NA 2WZQA 1EUCB 1LQUA 1UBHS 2C8VA 3JSXA 2IT1A 1ISRA 1T2AA 2FZCA 2IZ0A 3P0FA 4KAFA 4P08A 1KETA 5J59A 3UA3A 4PPYA 2PBZA 4RPKA 4NHEA 4OQFA 1Q21A 5LP1A 4OLAA 3A9TA 3C1TA 2AG0A 1NW4A 2C77A 2HT6A 3F71A 1JPNA 1X7YB 3QOWA 1VPDA 2OZEA 4KK4A 4F4UA 3GRFA 2MSEB 4M7PA 4U5XA 2XVYA 4P0QB 3DMNA 1QF6A 3TTWA 2CY0A 3C98A 1RKBA 3ZDAA 5T8KA 2PL9A 3HFJA 2AFIE 3ELBA 1CQIA 4I5FA 3RS2A 1T1RA 2VF8A 3D6NB 3WLHA 2MMGA 2PO5A 3ZKAA 2HNAA 3JYHA 4ZI3A 4AKGA 5JRDS 4LJ5A 2YHIB 3MD9A 5J58A 4ZQHA 1ZQ9A 5EP3A 1MEOA 2Q5JA 1FS6A 1L7QA 4IKOA 2AW3A 4WNCA 4OQYA 2J67A 2ODPA 3R0VA 1A5TA 5F7ZA 4Z3DA 4CMKA 4ZGGA 3BGVA 1G1MA 3ON5A 4OPMA 2QRZA 4Y0NA 5ADWA 2VHVA 1ORWA 2JKVA 4MI6A 2GMWA 5K5EA 1XMOB 3AG6A 4E5PA 3VR1A 3K16A 4F60A 1UC4B 1ZIOA 2FN4A 2XVXA 3Q85A 4URUR 5BYJA 4NAHA 5DNDA 3L7CA 3NH9A 4D4HA 2R8BA 1Z7GA 3ENZA 1J00A 4ZZ2A 3FSRA 2FMIA 2OGTA 1WCIA 4LVNA 4PZDA 1LWOA 4FFBB 1DUVG 4RDHA 1UEJA 1DJLA 1JHYA 1Z28A 2HJWA 5F4ZA 1TJNA 4GLFA 3NEPX 3KUUA 3CLSD 4K81B 4U6NA 5ALGA 1RZRA 4C9BA 5SY6A 5JAOA 1P31A 3FH0A 1QFMA 3G88A 3HA3A 2E21A 3R44A 4ASUD 1LNQA 1U0FA 4OBBA 3ZQ4A 2JJ1D 4IF6A 2A92A 3KV1A 4NPAA 4YMUA 4JX8A 3V6LA 2CDBA 5K8IA 1T43A 3RYHA 4BLVA 2I76A 1KJNA 2Y99A 3KOXA 3MT0A 5B3JA 1IN8A 4I1YA 5ALMA 2GD2A 2Z9DA 2A0KA 4DDMA 2PHZA 3OLQA 1HT1E 1NMSA 1PU2A 3GMIA 4JLUA 4I1SA 4MKHA 4Y6RA 2Y1FA 3FHCB 3GFFA 5H16A 13PKA 3STTA 2V6JA 3SBDA 4MAAA 3P27A 1MRNA 2HKIA 1E7YA 3FG9A 2OB1A 1JALA 5BN3B 1A8IA 2FEOA 4TXMA 3K9FC 3ZE6A 1N34B 1LB1B 3HKDA 1PD1A 1FFGA 4MPPA 2QV0A