4DM3A

Crystal structure of human pnmt in complex adohcy, resorcinol and imidazole
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Missing fragments: detecting cooperative binding in fragment-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dm3A00
3E23A 1G8AA 2Z6UA 2HMYB 1JQDA 4DM3A 3BWYA 1SKMA 4EKGA 5ERGB 1G55A 3CVOA 4IV0A 4PONA 2EJUA 2OYRA 4QDKA 4DCMA 4C03A 2IH2A 4GQBA 1JSXA 2P40A 4E32A 3GRUA 4MIKA 3UA3A 4PNEA 3LL7A 1I4WA 1QAQA 3AWIA 3ER8A 4BLVA 2VP3A 4PYIA 1RI3A 2B25A 2AOTB 3HCDA 1B42A 2OB2A 3VYWA 4YMHA 2NP6A 3L8DA 2ZWAA 7MHTA 1VQ1A 2NXCA 3HVJA 4KWCA 2VDUE 1XTPA 4IWNA 4CKBA 4YV2A 5LQJA 3UBTA 2ONZA 1ZQ9A 3EVBA 5EZQA 3DLCA 3I53A 4RTSA 4R8RA 4ER0A 2AOTA 3O7WA 2EX4A 3HCBA 2AN3A 2ZZKA 5D1NA 5EZSA 5T67A 2PWPA 4ER3A 2NXEA 3OFKA 3EMDA 5DSXA 5LR6A 4RTJA 3ANXA 3HA7A 3LCVB 3UWPA 2FK8A 3FTDA 4XUEA 2GB4A 2PVCA 2IH5A 5F2OA 3UJ9A 1TW2A 4HGZA 3FUWA 3GO4A 3I64A 3OU6A 3P9CA 5CCBA 4MHTA 1JG2A 1JG4A 3DTNA 1N2XA 2HV9A 2ZWVA 1ZGJA 2ADMA 3G7UA 8MHTA 2OY0A 2PXCA 4RVFA 1N7JA 4PWYA 3FUVA 5DPMA 5EEGA 3H2BA 3KR2A 5EOVA 2FRXA 2IBTA 3UJAA 1V39A 2G72A 3C3YA 1JR4A 2B78A 2JHPA 4QDJA 5DTQA 4E30A 3BT7A 3UJ7A 3R3HA 3IEIA 5P8WA 3G88A 5BP7A 4E2ZA 2B9EA 2B2CA 3UJBA 3BWCA 2OO3A 3C6MA 1SQGA 4E2WA 3GRRA 3SMQA 4XUDA 1VP3A 4X1OA 5H02A 3Q87B 2ZIEA 4U7TB 3QOWA 4GUAA 3FTEA 3HA3A 3OE5A 3HVIA 4L7VA 5EHIA 1P91A 3IV6A 3G89A 2ZBPA 1I9GA 1RI5A 3I5UA 3PFGA 4DF3A 4C04A 3B3FA 2FCAA 2VDVE 2QY6A 3LECA 4OA8A 2DPMA 1WZNA 4HTFB 5E1OA 2PX4A 4E2XA 3EVAA 3HEMA 5ICFA 1KXZA 2Q41A 4RTRA 3LSTA 3KU1A 3TFWA 1NT2A 4QPNA 4X41A 3FUXA 5DRTA 4B17A 3RIEA 1G60A 2NXJA 3CCFA 3P2IA 4AX8A 1KYWA 5LQCA 1PJZA 2BR3A 4HTFA 4EVIA 2R3SA 1Y8CA 1NW8A 1SQFA 5K0EA 3M6XA 2YX1A 4OX9Y 3EVEA 3EVGA 3G5TA 5E1MA 3SX0A 5LQKA 2JJQA 1O54A 1X1AA 3I9FA 3KQQA 4GOLD 4V0QA 2KW5A 5FA5A 3UJ6A 2AN5A 2PXXA 4C4AA 2P7IA 3HCAA 2XVMA 2QYOA 1U2ZA 2AZTA 3BUSA 3HVKA 4FGZA 3O4FA 4P7KA 5DTRA 5T64A 2PSSA 5ICEA 3CC8A 4YUZA 5HIMA 2QM3A 2OB1A 3UZUA 2BM9A 3G2OA 1DL5A 1RI2A 4OBXA 4PYKA 4RTMA 5E1BA 1KR5A 3NWEA 3HVHA 3T0IA 3B3JA 2NXNA 4KDCA 1EG2A 3DULA 3IHTA 3ME5A 3R24A 3BGVA 4NECA 2PJDA 3FYCA 4U7PB 4LG1A 5DM0A 3SSOA 3AXTA 2ZZNA 4OQDA 4RTPA 4HRAA 3CJRA 4KVZA 5GIPE 5C0OE 1L3CA 3KQVA 2BZGA 3C0KA 5E8JA 5FWAA 3QOXA 2O07A 4P58A 3BKXA 3CJQA 1INLA 2YXLA 5T6BA 4CWAA 4X60A 1MHTA 4QQKA 3MCTA 5K05A 4ISCA 3JWIA 5EKXA 3GRYA 5FUBA 1WXXA 3V97A 3ELDA 2WK1A 4PCLA 2P3OA 2XYRA 4FP9A 2PT9A 2V7EA 3PX3A 5CVUA 5EMLA 2VDWA 1NW5A 2XVAA 3KR0A 5K0NA 1I1NA 2BM8A 5EPEA 5FCDA 5LQAA 3KQWA 2WA2A 2G71A 3LPMA 2ZTHA 1X1BA 4DA4A 1IM8A 2P1DA 3FPGA 3KQSA 4PCAA 3SM3A 3NVKI 5DXAA 2O06A 5E2BA 5E9JA 2IGTA 2C7RA 1YFLA 4RTLA 5EKUA 3A27A 4H0NA 5FHQA 4P7FA 3TPZA 5DTMA 4EK9A 1D2CA 3CBGA 1SVUA 3P71T 4HSGA 4OBWA 5IH3A 3SVZA 4ER6A 2A14A 4RV9A 3SR4A 5CM2Z 1D2HA 4R05A 3P9KA 3G2QA 1VE3A 5DX8A 5EHGA 2IDKA 5DX1A 3EVZA 1NW6A 1FJXA 3HM2A 5FWDA 3PB3A 3REOA 2CWWA 1ZG3A 3CGGA 3DXZA 1XXLA 4CTJA 3FUUA 1F3LA 3LGAA 1XCJA 3TOSA 1T43A 5KS2A 3DMHA 3EMBA 3EGIA 1YUBA 3B3GA 1VLMA 3P9IA 3A7EA 3K6RA 5DM2A 3Q7EA 5GWXA 4PIPA 3EEOA 2O57A 3MHTA 5GP1A 3KPVA 1FPQA 5K01A 5K0GA 1QYRA 3GGDA 2PX5A 5K0CA 2JHCA 2GLUA 2I6GA 3P8ZA 5CD1A 2PGXA 2NYUA 3TM4A 2PXAA 5DRYA 1JSZA 4GF5A 3HNRA 1KPGA 4AUKA 3NVMB 4DKJA 3GXOA 1SUSA 3IYLW 1JTEA 4PYQA 1EIZA 3PX2A 4R6XA 5BW5A 1XJ5A 2P3QA 2AOVA 1R18A 3HP7A 3BGIA 3KKZA 4M37A 5KQRA 4WXHA 5GIOE 5K09A 1KP9A 2JH9A 3QV2A 1HMYA 2PT6A 4YUXA 5CIYA 3P9NA 1AF7A 2I9KA 2EFJA 3X0DA 1G38A 3KQYA 1IXKA 4RSRA 1R00A 2HNKA 3DOUA 3MGGA 5JR3A 3M33A 5U4XA 4BLWA 3DXXA 5FULA 2OPBA 2E5WA 1YZ3A 4CKEA 4R6WA 1QAOA 2GS9A 3EGVA 3OU2A 4QTTB 3JWGA 4R8SA 5LQUA 4RTOA 2Z6QA 3SSMA 1RI4A 1YZHA 3ER9A 1KIAA 2BR5A 4AZVA 4KDRA 4HC4A 5ICCA 1JQ3A 4DZRA 3S68A 2UYHA 2ZW9A 4RVHA 5FTWA 5C9ZA 4YUYA 5G02A 1X19A 4KRGA 3B7PA 3KPUA 5EC8A 3TLJA 3DMGA 4A6DA 4Y30A 2G8NA 3EVCA 5EG5A 1ZGAA 5EEHA 2BR4A 3E8SA 4F86A 3BWBA 1YF3A 1SUIA 2AVDA 4LWOA 4QTUB 4QQNA 5F2NA 5K0JA 1NKVA 3E7PA 2UYQA 3FPJA 3C6KA 4YV1A 1FBNA 3FPEA 4IKPA 1JG1A 5DWQA 3MQ2A 3THRA 4FSXA 4JXJA 2GPYA 3P2KA 3VC1A 3A4TA 4PGGA 2ZFUA 3EEYA 3M6VA 4Z2YA 4OQEA 3LCUA 2Z6AA 2HWKA 4QVKA 3GWZA 4PYNA 5CVDA 5FQOA 4BP1A 1G6Q1 4E2YA 5KYGA 5E8RA 1M0EA 1AQJA 5EMJA 5HIIA 5E9QA 2R6ZA 2IPXA 1N7IA 4EQZA 3SXJA 3MTEA 1ZKDA 5K0LA 3LCCA 5FQNA 5ICGA 3VC2A 3C3PA 1ZHFA 3EGEA 3GRZA 4LECA 3TRKA 3LX6A 5HOQA 1JG3A 3MCZA 2PV0A 2O0LA 3OPNA 3KR9A 4M36A 2CMHA 4E31A 4PINA 1BOOA 3NW9A 5GM2A 1PRYA 2H1RA 1EAMA 3DLIA 1P1BA 3KHKA 3BGDA 1H1DA 1WG8A 2P8JA 3LDGA 5KQSA 1R8XA 1P39A 3GDHA 3PFHA 4X63A 5EQJB 2G70A 3RODA 4EKIA 3UFBA 2PX8A 1DCTA 2P41A 3MTIA 4V0RA 3FTCA 2ONYA 5DM1A 1QANA 3A26A 2NNWB 3UJ8A 2AR0A 3NDIA 3OCJA 2I7CA 3OZRA 2PLWA 4PYLA 2QE6A 2CL5A 4BY9E 1R8YA 4YV0A 3M6UA 1NV9A 1RJFA 1VP9A 2XYVA 4MTLA 2Y1WA 4FS8A 4P7GA 4CKCA 1KPIA 2H11A 2VZ9A 3KQPA 3PS9A 1SG9A 1XVAA 1DUSA 1RI1A 2PKWA 3A25A 3OFJA 2JG3A 3M70A 3ERCA 3ELUA 1UFKA 3M6WA 3UJDA 5HZMA 1NW7A 4RX1A 3B5IA 3F4KA 5LQNA 2ZBQA 5DLYA 5M5BA 2GH1A 3OU7A 2IDJA 5FA8A 3DMFA 3NTVA 4KW7A 4WVLA 4AZWA 4E70A 5BXYA 2ZBRA 1XCLA 3MAGA 3JWJA 2IP2A 2P3LA 3O31A 4FSDA 4HGYA 3FPFA 1FP2A 3T7TA 4POOA 2YXEA 3KPYA 4PYMA 5CCXA 2YR0A 2YXDA 5FHRA 2JHAA 4RVDA 3HCEA 5HIKA 2C7OA 2GAFA 3KPWA 4GC9A 3FTFA 3GIWA 3K0BA 1ORHA 3FYDA 3GJYA 4CXMA 3P2EA 1VL5A 3R9XB 3HCCA 3KR1A 2DULA 5EGSA 5BW4A 1KHHA 4P7JA 1O9GA 4X61A 5EIFA 3LKZA 4KIGA 3TMAA 4DQ0A 3AXSA 3U81A 2PBFA 3FUTA 3LHDA 3TM5A 3BWMA 3ID6C 3G2PA 1Q0TA 2UYOA 5FADA 1BKYA 2K4MA 3G5LA 3PT9A 4IV8A 1RJDA 4QVGA 5HEKA 1KYZA 2FYTA 2EJTA 1M6EX 4BLUA 3CKKA 2CMGA 4G56A 3THSA 2UYCA 1KPHA 1L9KA 1QZZA 1FP1D 3UJCA 5DSTA 2UZ4A 4XCXA 3E05A 4XUCA 3PVCA 3WSTA 4KIFA 4C07A 3SSNA 1Q0SA 4RTKA 1D2GA 4GC5A 5LQRA 5EVJA 5D1HA 4C05A 5K03A 4OA5A 5DM4A 2FHPA 4GOND 3I58A 1UIRA 3EVFA 3TKYA 5CVJA 1VPTA 1EJ6A 3FRIA 1EQAA 3BZBA 3ELWA 3DXYA 3EPPA 2AVNA 5HFJA 5C1IA 5GINE 3MERA 2PX2A 1AV6A 2AOUB 4FZVA 9MHTA 2IH4A 4YMGA 4DCGA 2AS0A 2JH8A 1L3IA 1ORIA 2GA9A 2OZVA 1HNNA 4PIMA 4RYLA 2IBSA 1MJFA 4ZTBA 3KQMA 4A6EA 3VSEA 4HH4A 3MB5A 2AOUA 2ZIGA 3KQOA 2BH2A 1TW3A 3V8VA 5E9WA 2XBMA 3BKWA 1NE2A 2HTEA 4DMGA 5K8VA 3AY0A 4PYJA 2O05A 5HILA 1L1EA 4GBED 3ORHA 4GEKA 3DR5A 1XDSA 2YVLA 1EJ0A 1WXWA 2N47A 2PWYA 1NW3A 2ZULA 4GOOD 5DXJA 3LKDA 1NBIA 1NBHA 4BP3A 3CJTA 3OZSA 3R0QA 2P35A 4M7RA 2EG5A 3AJDA 2C7QA 2I62A 2V74B 2ZIFA 3T7SA 10MHA 4ATNA 4AZTA 1R74A 3G8AA 4RVGA 3TKAA 3KPJA 3HA5A 3LDUA 3TR6A 1BC5A 2YUIA 3OE4A 5E2AA 4M38A 4MWZA 1XDUA 1JQEA 5IKMA 1X1CA 3KQTA 4FT2A 2QRVB 3NJRA 1X1DA 4K6MA 4PYOA 3FPHA 3SGLA 4F85A 5JUWA 5MHTA 3G8BA 3GRVA 4CTKA 3PTAA 2ZCJA 1TPYA 2VS1A 2ZSUA 1O9HA 3DP7A 4F84A 2ERCA 2YQZA 3DUWA 5E1DA 2H00A 5B1SA 2XYQA 1QAMA 5DX0A 1OR8A 1P1CA 2IFTA 3NMUF 2QRVA 2Y1XA 5GOZA 1L3BA 3LBFA 1NV8A 3FRHA 4UOEA 3M4XA 4RTQA 3D2LA 1Z3CA 5HIJA 4GOMD 4ER5A 2HR1A 3RW9A 3GCZA 2CKDA 4YUWA 4FT4A 2OKCA 5CVEA 3R6TA 5GM1A 2FPOA 3NDJA 1VBFA 1G8SA 4AZSA 2ZVJA 3HCFA 2AOXA 5EMMA 1IY9A 2AOWA 2LD4A 2PY6A 4RWZA 4QPPA 1RJEA 3TQSA 3NWBA 3T7RA 5EIWA 2OBFA 2OXTA 2C7PA 3PLAE 4Y2HA 3LDFA 2YTZA 1AQIA 1YB2A 4FR0A 2AN4A 4YUVA 5K0BA 1VIDA 4C08A 3FZGA 3JWHA 5CVVA 5F2KA 4C06A 2ZZMA 1XDZA 4O29A 1WS6A 2F8LA 2FK7A 3ELYA 2P7HA 5CUQA 1YFJA 3EVDA 3UA4A 3HTXA 1RJGA 1WY7A 5EMKA 3GU3A 1R6AA 4RTNA 1JTFA 5KVAA 2NP7A 4LWPA 4HG2A 4ER7A 4E33A 5K0FA 2ZLBA 2IIPA 3LBYA 1M6YA 3G2MA 4PGHA 2ESRA 2ORED 3A7DA 1F38A 3BXOA 3P97A 5LSAA 2B3TA 5DT2A 4MQ4A 3DH0A 3OZTA 2WA1A 1BHJA 2G1PA 1UWVA 3B89A 3GNLA 4EMSA
chains in the Genus database with same CATH superfamily
1A9XA 3WQBA 4FW8A 1VYUA 2HMYB 2E82A 4BVLA 1L8OA 3GRFA 1H9AA 4YS6A 4IIEA 4ACBA 2Q6TA 2V0NA 1AXEA 1KNXA 3PEVA 2AX4A 1PFQA 1GNVA 2H0AA 3E5MA 2PHZA 3O8DA 4RIEA 1P7ZA 3K8QA 4TWZA 4KHPB 1PWZA 1RYYA 2F1RA 1Q3TA 4E32A 4K0KB 3F73A 3NHKA 3EGOA 2GAOA 2WUEA 4LOAA 1WHTB 3IR7A 3SC2B 1DKLA 4Z51A 5KYYA 1Z16A 4RMGA 5EIAA 2Q3BA 1L5ZA 1BJRE 1NLZA 2PYDA 3QUSA 4GPIB 4WNAB 5DO9A 2NPFA 4AKTA 4IWNA 1ISRA 2ONZA 2XKKA 2YWHA 4C4OA 3LT4A 3H5WA 3ND5A 4KV9A 5FPTA 1UKEA 2QZ4A 1GRCA 3EEBA 3I30X 3DLCA 4EYKA 4ER0A 2I1QA 1AKNA 5T4FA 5LBUA 1CUYA 4CEJA 4L76A 2C9YA 5DMXA 1QP8A 1XWIA 1RMTA 3C4VA 3LQYA 1YZGA 4TLBA 1ZGHA 4ZYUA 1IJKA 5LNK1 5K1ZA 3WL7A 2NW6A 2X5XA 1T2CA 2FJUA 2CL6X 4YJ3F 3T0FA 4ETIA 3KJNA 1JLSA 1GKUB 1FU4A 2GWRA 4TV9F 1ZRMA 4QT0A 5E0OA 1CUJA 2E5FA 2CUNA 2OCPA 4IILA 4ISBA 4LXQA 3RS0A 1S8FA 1RWMA 3NYWA 4P82A 3N2GA 2CMFA 1L8AA 4IQ8A 1T5TA 2ROQA 5EJMA 4IUBS 4MXDA 1S1CA 1RYHA 3R75A 1KU0A 2HV9A 1P5JA 2R25B 1UPXA 1RWVA 1QK3A 3C3JA 4IKEA 4Q9JA 1NLFA 3M1YA 5DTIA 3JTEA 3O95A 1Z6XA 3I39X 3K6KA 5FWNA 1QF7A 1C8BA 2W8BA 1GPUA 3GGSA 1MIHA 2PD3A 2W00A 3ODPA 3QENA 1KVQA 2Z1NA 4WKGA 5BP7A 1N5JA 1ULHA 1QRDA 2AN1A 4KQ9A 3HUDA 3GH1A 2EFDB 3IHLA 2F1OA 3G9UA 5J23A 2JW5A 2C4WA 3NM4A 1MENA 4F1JA 4ZHSA 1A0OA 4ARZB 4GNRA 1G21B 5KTKA 4KRFA 4HFNA 3R7WB 3SICE 4E4RA 2CNWD 3HNOA 4RS3A 2J3LA 3Q9LA 3IV6A 1UMDB 1KF0A 1RI5A 4DF3A 3HL0A 3IBYA 3TH5A 1T3HA 2WLTA 4OA8A 3A6FA 3RU3A 2WE7A 4D9BA 5BQXA 4ERXA 4IVQA 1NVFA 1YS1X 1BCRB 2V55B 3X1DA 5JMWA 5FYQA 1W73A 3DV0A 3HBJA 4N54A 1J42A 3BE4A 3KZCA 1GITA 3QFCA 3T3HA 5A5DA 4R2MA 4X1YB 5EUMA 1PQ4A 1GYQA 1MBZA 3OBIA 1W52X 1XLUA 1T34A 4MVJI 1X86B 5JNLA 2AC2A 1U6KA 4YJDA 1DOHA 1XAJA 2PEYA 1ULZA 4NY1A 2BFAA 5AKHA 3EWSA 4PU0A 1G2PA 3WXMA 3I6MA 1KQGA 1PLLA 1SIBE 3AB7A 3BB1A 2DQYA 2W0MA 2Y3IA 4DT1B 4E12A 4OG2A 5KX5A 2ZETA 3GBPA 5BUQA 3MMSA 1MFZA 1YRQA 2ANCA 2FPUA 2QYOA 2QRMA 3JYOA 3MRTA 3NXKA 4OHCA 4V3BA 2Y4NA 1W88A 5DTRA 5DFAA 4BASA 2V6IA 4G8JA 5K6AC 5LZ4A 2G3YA 5KUTA 4BEBA 3F49S 4KMOA 1N6IA 3H2HA 4PYKA 3PNMA 4X1KA 7REQB 3DVRX 2D2EA 4KDCA 3PDWA 2QUKA 3RRMA 3S2UA 3TVYA 1JP7A 4ZREA 4LG1A 1E6MA 1MVNA 1S02A 1XVIA 4DDWA 2P9GA 4RULA 3IXMA 1AKQA 1YTLA 1BKDR 2QENA 3HXPA 2X86A 1G5PA 3BIJA 2ZXEA 4QA9A 4R7ZA 1PN3A 3GA0A 3GHYA 1NMSA 3LQRA 4UE6A 3JAKA 4GQAA 5AWFC 3NBXX 3AI7A 2VZ8A 2NU9A 3H3XA 4F4IA 3MA0A 3EIOA 3QWFA 1N2IA 3VNBA 4MZXA 4RA9A 3LLVA 1D1QA 3I37X 4XGNA 5E7IA 4YRJA 3CY6A 3WHLA 3KSRA 1MAAA 1SOAA 3FJOA 2Q3HA 3M6FA 4IRUB 4QIHA 3PJRA 3HXKA 4BFSA 1R7RA 2MSWA 3W5SA 3VAAA 3GK3A 1A9RA 4PAWA 1C3EA 4LPSA 4XDYA 1ZBDA 5G0TA 2A5DA 3T9BA 4W9RA 3EIEA 5ITSA 2ZR9A 1CJSA 2EX0A 4QGFA 2ZE6A 1KMIY 1JZSA 4CGZA 2WD7A 2X40A 3L0IB 4OAPA 4QU8A 4H7EA 5KNDH 4YY3B 2HLDA 2IPMA 2W6NA 2R0QC 2JAXA 2P75A 1H2YA 2Y9MB 3PR2B 5GGXA 3DO8A 3G7NA 5F7OA 4PQRA 2GD6A 3PXEA 1RLMA 3R5JA 4RANA 3VPXA 1Y4UA 4PZYA 2O8BA 2SKCA 4JQZA 4A0SA 1V1MB 4D98A 1RWNA 3EFOB 9LDBA 1RTTA 1T1SA 1O94C 1D2HA 2LDXA 4YWJA 4B3HA 5C1BA 1W7AA 4K9KA 1VE3A 5EHGA 1VKJA 1BQEA 3A1DA 4IRXA 1Q74A 4O02B 4QFMA 1R10A 1TIKA 4WA8A 2H4ZA 4UAJA 3DMNA 4GICA 1TTHA 1MB4A 3SYTA 1SOVA 3JALA 3I9MA 4KKXB 5AJYA 4EMUA 4YT8A 3W2IA 4FN5A 2O4CA 4I3FA 4BOYA 4YGXB 1K86A 5A3QA 4KR0A 2A1TS 1Z2PX 5DM2A 3QWHA 4HNHA 5IM5A 1YR3A 1DI0A 2MYUA 3MHTA 3A6LA 1E3LA 1A5ZA 4AS3A 3OEEA 3Q5EA 4XYLA 1UBKS 1PV2A 3HZHA 5FI5A 3B12A 3P8ZA 4R9RA 3UPTA 1MW8X 1E7SA 5KI6A 1EDZA 2ZYTX 1NX6A 2APJA 3WAGA 3IA7A 1JKJA 5BW5A 1EA5A 3GF4A 1E3WB 2FV8A 2E49A 2P3QA 1BS2A 4IIXA 1GGFA 4JX8A 2Q7XA 5AK3A 1FX0B 4ZEWA 3DPSA 4C78A 4ZN6A 3OX1A 4PSUA 2F6RA 1L5KA 3CRQA 2HRRA 3BOSA 2V5VA 3F3YA 1K92A 4KXXA 4K9MA 2PUCA 1SCAA 2YNMD 2B82A 4AO8A 3PEYA 3L79A 4Y0VA 5F9MA 4NZ9A 4V0ME 1UBEA 1OILA 1SCKA 1P0QA 1Z74A 4IEEA 4QGGA 4D92A 1KVSA 3GG9A 2NQ2C 1N6RA 3JWGA 4NATA 4F0JA 2V7VA 3U3RA 4F3NA 3TSYA 2NACA 5FB3A 3ZD7A 2YZ7A 4IFTA 1E1QD 4FMCF 1G4HA 2H4HA 4NARA 2Z56A 3DZDA 3PPYA 3PUWA 3BDIA 1YJAA 4YUYA 2CLSA 1E9DA 2EOAA 2O1SA 3DVAA 3EOBI 4AICA 4F4CA 4IG9A 3OTQA 2YL2A 5ESRA 2GARA 2XUDA 1NVXQ 4LDNA 3K9NA 1R5JA 721PA 2G0AA 1YKFA 2IDZA 3VH4A 3AM4A 4B6RA 3FPJA 1Z7BA 3O8QB 3PIRA 1JG1A 1AGPA 2AG0A 2EW2A 2XQVA 3H17A 1UM9B 3P2KA 1FMJA 4R68A 2VPYA 2F67A 4PGGA 5ERYA 3M6VA 1WHSB 1F6DA 1IMOA 1DLIA 4V0NA 2PJRA 1LF0A 2SBTA 4AM8A 2ZAMA 1UJBA 4CLDA 5HZHA 5I6DA 3R7AA 4NBUA 3K0SA 2AZDA 5EUQB 3TNJA 5AOCA 4WVFA 4XSGA 1GDHA 3AY7A 4GKBA 1UDCA 4AZ0A 4PZZA 2WHPA 5ILOA 1ZHFA 2OMEA 4NG4A 1RXUA 1SD2A 4URWR 4X8MA 2GYWA 1Z4PX 1OYVA 5T5QA 2FPRA 1NBMA 3CPHA 2ORWA 4Q16A 2X42A 3VDNB 3V4LA 2CMHA 3ZI7A 4E31A 3GLIB 3NEPX 3I34X 1IBMB 3WMFA 2QX6A 1WZCA 1Q22A 4LVOA 3WO0A 3HP1A 4BLSA 1JHRA 1H1DA 1JR2A 1RHQA 2Q2QA 1E2UA 1ZX1A 3RYHA 3OLYA 3I5XA 4IS2A 2ZRPA 4M0FA 4NOKA 3K0AA 4V0RA 1AY0A 1BVRA 3ZZUA 4YV7A 4DR2B 2ZRLA 3WFJA 4BV9A 4PYLA 1B8VA 1DC5A 3EF1A 3L7NA 4FFSA 4KSYA 4Q1BA 4BY9E 3W1WA 4BFZA 3GDFA 3WLOA 4YV0A 4MUMA 1VP9A 2XYVA 5JG7A 2HK9A 1N33B 2LDBA 4TM8A 5I7VA 4J29A 1YASA 4GP7A 3M70A 1T1JA 4REQB 4UEOA 3UAOA 5A6SB 2VPTA 1TKBA 4QU9A 1LBHA 3WIVA 4GBJA 3CX4A 3ZHVA 4KGXA 1I1QB 5FEMA 1GKLA 1QRTA 1BXKA 2XWJI 2MT9A 2W2XA 1A76A 2ISQA 3OSZA 4XIJA 4CEIA 4N0DA 2ZBRA 5CW1A 1BAPA 2DWPA 5IANA 4L5BA 1SM4A 4FSDA 3P2JA 1RWWA 1Y3DE 5TEVA 3IR5A 2YXEA 4LWZA 3T6KA 1ETUA 1RRMA 2AQ8A 2HIAA 2I9PA 1NQTA 3O93A 4CVNA 3KKOA 1GRNA 3LQ2A 3BAFA 1CZLA 5SYMA 2J0SA 4D0GA 1XX6A 5GQSA 3BFJA 1XYVA 4CM8A 5IN4A 2DULA 5DN9A 3CE6A 1EH5A 1I1OA 2O2DA 4OXIA 4AD8A 3BTVA 4H18A 3DE3X 5D7BA 2J67A 4M1YA 1ABBA 2ZYWX 3NGLA 2C96A 2QIOA 3WO1A 1SZCA 2QTFA 3TL2A 3S2EA 4FDMA 4MK4A 1BKYA 3OQ6A 5FADA 5IYZF 2VOJA 4W7SA 2FOXA 1OLSA 3N5CA 5H80A 3X2EA 5C8VA 5KPJA 2OHXA 4YMSA 3QFRA 4P4SB 4JI8B 4DNXA 3T5GA 5ALLA 3RASA 1P7VA 2H65A 3OPMA 1JKFA 2PSEA 3K0FB 1CRWG 4U6QA 4EG8A 4NCKA 3ZGZA 4HH1A 3IT3A 3SHQA 2WU1A 3IEPA 4JSRA 4M0CA 3WQQA 5EE9A 3NLLA 5DLQC 3GLHE 2IU6A 1NSYA 2FFHA 4PY2A 4R01A 5A3VA 3H2GA 1XDGA 2QLBA 3B9RA 2YXPX 4IX9A 4NH0A 3TO5A 5CGQB 3TIGA 4D3ZA 3KSAC 1IXZA 1X7ZA 3G85A 4LHYA 5DM4A 3SNKA 1HFJA 1C0EA 1DWOA 2H1VA 1AKTA 2VCYA 4OVKA 1TUBB 3CLTC 1WCXA 3FRIA 2VI5A 2Y4OA 3N8DA 1I8TA 2X0FA 5CEFA 5J4HA 3MW8A 1XQ1A 1HA3A 5LD2C 1RYZA 4HFMA 3BE8A 3JQBA 3HBFA 1MGPA 3AR7A 3CVYA 4RF3A 4C1BA 1QU3A 2RAFA 3WLNA 4IBOA 3O7MA 1RXYA 3O4IA 5DISB 3RVKA 2DERA 3UPUA 1IHYA 2J9RA 3K32A 1WWKA 1NG1A 2FWAA 2Q29A 1VZ3A 3A8TA 3I9KA 3BKWA 1A82A 1T4CB 4HI0E 3T15A 2ZT5A 1F0YA 1ZI6A 3JAMA 1F4PA 3FNBA 4UU7A 1V0JA 2IWHA 3WWDA 1NW3A 1F0PA 2NSHA 2P5TB 3U4AA 3U4DA 3TNLA 4HN9A 3HEBA 4UTOA 3H6KA 4M0DA 3QX9A 4GT1A 2PQ6A 1LRKA 1ISGA 1VHDA 4W63A 4GAEA 3NGMA 4LSZA 2GBIA 1ISFA 421PA 4FFLA 3AJRA 4HS4A 2VLBA 2XPCA 4EGSA 4ZYVA 1KI8A 1HZZC 1DFHA 1VE5A 4I1IA 3ZC3A 1XZDA 3H11B 4BYMA 1KVUA 3JWEA 3WDMA 3W5CA 2JI8A 2H48A 3QBVA 3SDZA 5BWMA 6REQA 1XHEA 1FJ2A 3PTAA 4HAZA 2VDNB 5FFNA 1FOEB 1NU8A 4X92A 4KB5A 3QXXA 4ZV7A 3STXA 3ANMA 4X97A 3I52A 2ZUDA 1FXUA 4GH5A 2P4UA 3BS4A 1C0KA 1E8MA 3F6CA 4WJKB 1XEAA 2GJ4A 1CZNA 3TK1A 4TT3A 3T06B 3VM6A 2O8VA 4WBSA 3K9CA 2O0HA 3M4XA 1E20A 1YFKA 1M1YB 4EEXA 3FTNA 5FOWA 3UG7A 3ZNNA 2AWOA 5C8DA 5E6SB 5HUJA 4YCNA 4CU5A 2PQ0A 1EP9A 1F12A 1OX4B 2R6DA 4L15A 2OESA 1YB4A 2FQYA 5CDFA 3ULKA 1FIUA 1F0NA 4OEHA 4DGQA 2YHBA 1WM1A 2QTAA 3NWBA 1THZA 3LM8A 4JBGA 4P5EA 2Q46A 2OXTA 3BORA 3NEJA 4Y2HA 3QFTA 2P5SA 5FEUA 2C92A 3CLKA 3DLTA 3TS1A 2J9YB 3QKSB 4NZOA 1P9RA 1ESMA 3IP7A 4P1ZA 4RY9A 3QVTA 1N2OA 1FZTA 3KLMX 3GLVA 2K7FA 1USIA 2I4MA 3DOCA 4BRWA 4YJ3B 2ZZMA 2H2GA 5CA1A 1I4DD 2G67A 2F8LA 4TV9B 3II6X 1QM5A 5KKCA 1VM6A 5KVAA 1Z5OA 3U56A 1AUVA 3ZZTA 2FY8A 4KITB 3ZY5A 5LNK6 3QPBA 1NP6A 4EEZA 4XOUA 5FAXA 4NMLA 4DUYB 3C6YA 5F1YA 5BW8A 1Y8RB 1ZITA 2G83A 4K9QA 1M67A 5KDLA 2B3TA 5KKAA 1R4MA 1JFFB 4A27A 4BMNA 3BHNA 1QNLA 5KNDA 2Z2XA 2RGDA 3B89A 3V6MA 2ZIXA 1R4AA 5COQA 4AY6A 3HCNA 2R87A 2GO1A 2D2VA 3QTLA 1J2JA 1EFRD 5TSDA 4U7HA 2B4TO 2XR1A 1X9GA 1Y3IA 1FDWA 3D7LA 1WUHS 2PUEA 2FFQA 2V9PA 4FR2A 4CKYA 2GF9A 5IKPA 4E5DA 3KIPA 3V42A 2CLFB 4YTEA 3LBNA 1AK1A 3BHJA 2WJZB 3T3GA 4E15A 5BSVA 3NBUA 1II0A 1Z5GA 4KWCA 3COWA 1R0WA 3T3NA 2VDUE 4NU6A 3ENQA 3NM6B 5FBZA 2C2MA 3HCRA 4Q21A 2PMFA 3X44A 3SDBA 3DF9A 1C30A 1VL1A 2PGNA 3VKGA 2W6MA 2MCFA 2PRJA 3EIXA 2EX4A 2CDAA 4ECEA 5TDHA 3FKJA 4LJ6A 1ESNA 3BDVA 2GTIA 1ZONA 4G65A 1BHSA 1T2FA 4XX0A 4LTNA 4C2BA 3PNLA 1HT1E 1QLHA 3IXLA 3QRWA 4K7JA 1L5LA 3USES 5ALWA 5CJJA 2B7BA 2GBFA 1ATZA 2P2ZA 4GE3A 3VVLA 1Y4ZA 4DMCA 1PL6A 1PNQA 3BBPA 2XBUA 2CDBA 1ZYUA 1EBUA 2LNDA 1FLDA 3I64A 4W5HA 3ZOKA 1M8JA 4PO9A 3V2UA 1BWPA 2N75A 3AKEA 4JSYA 5FUWA 1K9VF 2Q6OA 2BKXA 4B6OA 4F5YA 2WUWE 4U9UA 4J6EA 4L51A 5LIPA 1DBSA 1I36A 1OAOA 2RHLA 1NJGA 3HDGA 1RQ2A 4BLQA 2C3MA 4EENA 4FKBA 4I9FA 2HGSA 3MN1A 4PG4A 1JU3A 3C3YA 3E1SA 4QDJA 1JMYA 2C4HA 2PQ2A 4QOSA 1P6XA 2X9LA 1NRIA 3T9EA 4CBVA 1BYIA 3AVUA 2ZM5A 3D8TA 4U5XA 1ZU4A 4LMPA 2PRKA 4JI4B 2XNSA 3A4VA 2OO3A 4B46A 2Q8PA 1G3QA 2O4UX 3T0GA 3WICA 1TB4A 4RE6A 3UWSA 1W46A 3ENVA 4ZYZA 4US0R 2WFAA 4MP6A 1QHYA 4C43A 3A31A 4R2IA 4DTCA 4G41A 3UC5A 5I9TA 4GMXA 2QTMA 4JC5A 3LYLA 1VYTA 3QV1A 4FFBA 4MDEA 4EGQA 4AJEA 4UZFA 5EXEA 2Q41A 1SUAA 2G8LA 4C6RA 1PO7A 3PYMA 4PLYA 4HO1X 2VHVA 4QPNA 1KDYA 4U8HA 3UHOA 2MHCA 2QV0A 3V33A 2XRFA 3AEZA 4GOJA 4UMEA 3CG4A 3ZD6A 3DW1X 2FP4B 5DHRA 5A9SB 3EGDB 5H81A 5U4QA 5AK6A 2VHUA 3SZOA 5HK8A 2G5TA 5AD1A 1MB9A 1C9DB 3VBEA 3O8OB 1EE9A 3FPBA 1X80A 1M8FA 3KQQA 4TRNA 3SXUB 2WI8A 2AN5A 3OOEA 1K06A 1E1CA 4WJZA 1Y42X 3WI7A 5K0ZA 4UARA 3SS7X 4DIKA 5IASA 3VFDA 3HVKA 5EMNA 3R76A 2B1IA 4C20A 3DB2A 1WNTA 4UEKA 5BYAA 4AECA 1QH1B 2OB1A 3RM3A 3DBRB 5IJWA 5FBVB 1H0KA 2EV9A 3F4BA 1WXDA 3R0XA 1KR5A 1JZTA 3I9NA 4QOJA 5TGZA 4DSUA 3FVTA 4JFAA 3HB0A 1C4WA 3EH1A 4B8YA 3ZH2A 3AUTA 3OM0A 1E3JA 1RQ7A 3SSOA 2FW9A 3NALA 1NBAA 4G07A 2H92A 5AJZA 2ETVA 4XLLA 1PUJA 1TQ8A 121PA 2BTOA 2Z2ZA 5MN4A 1AZTA 3VJMA 3MOGA 5ALPA 1HE8B 1FVXA 2OFWA 1I3KA 1NAIA 3DR3A 3I04M 4NH4A 1RQLA 5DBGA 1L3CA 5FPYA 1XMXA 2FMIA 4LY9A 4D8VA 2PD4A 2ZR8A 5CYPA 1DXYA 4G1CA 3WK7A 3QOXA 4OMDA 3V1KA 1UXOA 1S3FA 3QLJA 3URMA 1QQ7A 1N6OA 4ISCA 1BE8A 2CJWA 1O6CA 3RJMA 3IQGX 4IDEA 4Z3OA 5EMLA 3TLKA 1TFUA 4GZ3A 2O8DA 1QIHA 2ZS7A 1RHKA 3HDHA 5DNAA 2YDYA 2XGMA 5AICA 2PMBA 4CKWB 3GDWA 1I7SB 2CZQA 5AHOA 1M2VA 1U3CA 2II6A 3RC7A 5K9ZA 5LQAA 2H5EA 5GPBA 4AQDA 1AV7A 2B94A 2J3QA 4R2KA 2G9UA 1TAGA 3RBVA 1NZJA 3ZTWA 3VU0A 4ZTZB 3KU4A 3ITDA 5MN6A 4PPGA 3L4JA 4YMUA 4ZPXA 3TPZA 1B73A 4F56A 2H1OA 5IC6A 3PDHA 4FMCB 6LDHA 2ZIUB 1PWHA 4H6WA 5E0KB 3WGOA 3AT1A 2VBGA 4B4KA 3P71T 5KTSA 3T7DA 1Z8NA 5HRUA 5J1SB 4JLPA 2PGLA 4D96A 2SHKA 3LHSA 1GARA 3AP3A 1EX6A 3EULA 5DX8A 3RC9A 4UD6A 2WWFA 3FFWA 4KH1A 3GVXA 3C74A 2VSYA 4BLPA 3IUYA 4CTJA 2QX8A 1PJQA 1XZCA 1F3LA 1QGZA 2BV3A 4TRRA 1XPUA 3L0YA 2HQBA 3MCAA 4EPVA 2JVKA 3EWNA 4IF4A 1COWA 3G8YA 4K6HA 4US1R 1ZUIA 5AI4A 4I4TA 2O57A 1SHTX 2PSJA 3HB5X 2GUWA 3ESDA 5ALRA 3RLIA 2AXPA 3N2KA 4ZT2A 2QMUA 1TKRA 4DIMA 4B6EA 5CD1A 2GK3A 1T3ZA 4QHSA 1RLUA 3D3WB 1UBNA 2XOEA 3NVMB 3UMRA 1ZC3A 3GXOA 4LJ5A 1L1FA 4WXPA 3TRDA 2BEVA 1BXZA 5DB4A 4D9GA 1R18A 5D85A 1GG2A 5M2QA 3JAWB 1FYXA 4RIIA 2HOQA 1XHLA 1THTA 2RKWA 5KTTA 2XRMA 4BEVA 3B51X 4EYOA 2HT1A 3QKWA 4IX1A 1J97A 1CP2A 4ZAYA 4MWCA 4KR3A 4P98A 4AWBA 1CJUC 4HN4B 5U4XA 2GNAA 2OCXA 2D7JA 3EGVA 5D87A 5FUVA 3N8NA 5L53A 3IP6A 4JOQA 5IFLA 5LB4A 3A4IA 1Y34E 4X8OA 1U3DA 2NWQA 3QX8A 1W2GA 3VR4A 2BEJA 4BNVA 1IUOA 5ICCA 4PFKA 4WA7A 3W77A 2UYHA 2W2VA 1ONSA 4L08A 3ZCPA 3NH6A 4PLGA 1UOEA 3EDRA 4R2HA 2G5GX 4JOBA 1LPOA 4JY7A 4KIJA 3AVQA 4ABTA 1QGUA 2J48A 4HGNA 4J0EA 5AKEA 4E0BA 4YCMA 3HJFA 2HFJA 5EEHA 3UQZA 2W93A 3BWBA 2R48A 4EB6A 2EQAA 2VF7A 3HWSA 5G1NA 3TE7A 1N5KA 2I65A 1PR4A 2ETXA 1ETHA 1T6NA 2EZ8A 3IVCA 4N7RA 3ZCUA 4Z53A 3NRCA 4DQUA 5JRJA 3CX3A 2REQA 3THRA 4HVAA 1NXXA 3ZCTA 4NPAA 4WESA 2YHSA 3W0LB 3MLAA 1B41A 2ZQ5A 4F2DA 5CVDA 3M6LA 1G6Q1 4X6UA 4G97A 1Z17A 3VU1A 1I2CA 1ZM2A 3IPCA 1ZWKA 4BE7B 2ZEJA 3Q8WA 1V3TA 2YY5A 3IIKA 4EQZA 4H7DA 2VZEA 1M2JA 3I28A 3HYTA 3KCNA 1AKMA 3D31A 3DHEA 5CH5A 5A4FS 3NBYC 4GO1A 3IALA 3CZMA 3CZRA 4JA2A 4CG2A 4RNDB 4GRAA 1KOFA 2RI1A 1TL7C 3L49A 3R5TA 4NENA 2YCLA 4DCTA 5JLJA 5KTNA 4M36A 3RUAA 5IYZB 2FPSA 1X7GA 4RMJA 2PAFA 2L82A 5IH7A 3F47A 4TS3A 4EMSA 4ZHQA 1H2BA 1MABA 4LMAA 2W6PA 3PI6A 2WWTA 4IDPA 3UJ8A 4O63O 5IJ9B 3DAHA 3C4JA 4D46A 2Q0XA 1YU9A 2H3HA 1M5RA 2HUNA 2GSDA 3N8IA 2DHCA 3ZIAD 4DA9A 3RS3A 3JARA 2IXDA 2HTFA 4GUAA 3AFGA 1YL6A 4DG5A 3R5KA 1DUSA 2HLDD 2ZI7A 3KM0A 3JXEA 4G5FA 4C6TB 5B4UA 1JEAA 3CT4A 1ZFNA 4M7PA 1YV9A 4RF2A 3HRKA 2Q49A 3B5IA 3OUZA 4UMDA 3TSZA 3F4KA 1TJ5A 2R7LA 4HFJA 2AJCA 4O8CA 2RMKA 2NADA 4G9BA 4LNUA 1QORA 4HQ6A 4MS4A 4EYEA 3GP3A 4QOIA 4D4LA 3A6PC 4PXYA 3H99A 3MTBA 4MS3A 5EHZA 4CTOA 4KN6A 5LA6A 4MGZR 4FYXA 4O4JA 2IV3A 3ZIDA 4EI9A 2DB3A 2ANBA 2ODAA 4PFSA 1U6IA 5FL7A 5B2EA 1QQAA 4I46A 1KYXA 1XXHE 2IHUA 3REFA 2H2AA 1KI1A 3HCEA 4J90A 4DJAA 4AKEA 1S9HA 3A36A 3QZUA 1XMVA 4YJFA 4L4RA 1JEEA 3CVVA 4JX9A 5K3BA 5HP4A 2QSZA 3OEED 1KHHA 2PWBA 4TVBA 2Q4TA 4CI9A 3ISTA 2DPYA 1DU4A 2NUPA 2O2IA 2NU6A 5DWDA 4ZPJA 3G5LA 5L3RA 2AF3C 4JOCA 3ESXA 4YJ2F 2EHJA 2Y9PB 1WMAA 4TWBA 2UYCA 3HU2A 2CXXA 2DECA 2DPLA 1FK8A 4L75A 1KPHA 4UD2A 4XLTA 3WLKX 4A5SA 4I5EA 4AKHA 4BZZA 1M6VA 2UZ4A 4WADA 2J3HA 1I5RA 4OHKA 1O6BA 2J5XA 4TYWA 1R4ZA 1QXSA 4IUDS 3SC3A 2HJ9A 3WSTA 2EKQA 3PQ6A 1NY6A 2Z83A 2I1WA 1XRPA 4GGMX 2RGYA 2VPIA 4C05A 1AUPA 5AH0A 1LBIA 3CEMA 3HXQA 1VHJA 4MPDA 2GRAA 3FKSA 4M8KA 3CWCA 3AU9A 1YZYA 2H2WA 2VH1A 5ITZB 3L4KA 5E7JA 2O3RA 3CH7A 2X5JO 3KYCA 1JLLA 2AVNA 1IVYA 2XQFA 3ENNA 5GINE 1I0IA 3OBBA 3T4XA 2AOUB 2X77A 1IAQA 2AHRA 3CUKA 3GOHA 3PZBA 4NEQA 2ZGVA 4DCGA 4X95A 2Q7OE 2JH8A 2OZVA 3PUHA 1EZ1A 1NUQA 3CT6A 1N3LA 5HJ5A 2WR8A 2YOFA 3E5NA 4BXOA 5ECDA 1QX4A 1UC8A 2OSVA 2QN7A 1F6BA 2I8AA 2IXAA 3MB5A 2ZIGA 3FM9A 3KQOA 3G6WA 1J21A 4A2PA 3T1TA 1JLRA 3WLFA 1FSZA 3MINA 1G64A 2YWXA 1CUUA 4QBFA 4B9EA 4HP8A 5LBTA 1DE0A 4GBED 4BN4A 1LTQA 4O33A 3TI7A 2G06A 5JD3A 2EJWA 1XZAA 2HDHA 4TTTS 3R8FA 1EFLA 4MUGA 2R5FA 3CEJA 3OZSA 1BJTA 1VG9B 2YJTD 2EG5A 2Z4SA 1IXYA 2CLEB 1WSBA 4AQ7A 3NBFA 3ACBA 1VGQA 2AFIB 4QUHA 3QE4A 5FUQA 1ZH6A 1KO1A 2HXYA 2VN8A 3HA5A 3KPJA 5E2AA 4Y1RB 4IGAA 1ZMOA 4JLKA 4KDEA 4FHFA 3ZU2A 5LDHA 2QJOA 1B7GO 2VF8A 3WOVA 4UTRA 1VSVA 3FCSB 1N9GA 1IWOA 3GL9A 4LN1A 1N2JA 1NR1A 2H00A 2YCBA 4DARA 2OG2A 1QAMA 2CXNA 5DX0A 1OR8A 1P1CA 3ZI4A 4F04A 1P18A 1U99A 3KUXA 5DZSA 2P4EA 2H4WA 4FYKA 1ZNWA 4EY7A 4Z7OB 5KJ6A 2BISA 3AVOA 3Q72A 2A4KA 2VXOA 2H85A 1SEVA 3AI1A 3FOWA 4LA4A 1A7AA 4B3JA 4ZI7F 5MDHA 1G8SA 2QG9A 2P6PA 1A7KA 2QRZA 1HE5A 1XA4A 3DKRA 3HCFA 5AW0A 4OXQA 2BFBA 2AOWA 3AQ4A 4LI0A 4GXQA 1A9PA 4NZZA 2LWIA 4LC0A 2B83A 3IAXA 1OLUA 3CKLA 1QGED 3AWDA 1K6EA 1D07A 1NL3A 1MQ9A 2HQ1A 2Q3LA 1GZ3A 2QRJA 2C0PA 1NXSA 2L2QA 1Y82A 2YTZA 2Z1DA 4WDRA 3DWIA 5BMVF 2P6UA 5K3AA 3ZE8A 2R8XA 3BH7A 2V4ZA 5DP1A 1HRKA 4RJ2A 2JIQA 2R1TA 4IVNA 2C5AA 2PIAA 1Y9ZA 3S7ZA 3LQFA 2VQEB 4N0MA 4B34A 5AP9A 5TGDA 1PAUA 3JCZA 2TMYA 5CVTA 3BSFA 3SIPA 5CA0A 1CUHA 2CD7A 4K3UA 2JGEA 5ISMA 4D4JA 2C0CA 2ZUEA 2X5KO 4FDAA 4KAAA 1ZI9A 1U0JA 2G09A 1OFTA 1KR2A 2PYIA 4BEJA 3KB8A 1KH2A 4MGHA 3UICA 4S24A 5BOSA 1G18A 1FDRA 1YBHA 3H87A 3PC6A 1QCYA 4TN5A 5EKDA 4JXXA 3KB6A 1NC1A 4PBTA 3PFBA 2RH9B 1E3DA 5KYYB 3IEMA 3CVOA 4F8EA 4PONA 1YI8A 3H5IA 1C80A 3R1IA 2FPKA 3TNDA 2IU3A 4Q93A 3EQ6A 2IH2A 4PNEA 3AV0B 4NQRA 1AQLA 3LHFA 3P9SA 4R3UC 2PFGA 4XDGA 2EW8A 4NDNE 3H2IA 1XE3A 4HUTA 1GUAA 3DZKA 3IBGA 2B92A 1TIPA 2PU5A 3C5CA 4WZAA 3DYBA 5AKYA 4DIDA 4HX2A 3K4QA 2V8OA 3CUWA 2E2WA 2R65A 4FCTA 1ZK0A 1HL3A 3IQIX 5ALXA 1MFPA 3VX3A 5BWBA 3QU2A 5KYVA 5FKJA 4B09A 3LLUA 1TC1A 1FFBA 5L7WA 2PGOA 1N78A 4RLSA 2ZYGA 5IAOA 3N8KA 2VUTA 3N2GB 4ZO7A 1GZ6A 1KI6A 4WFIA 1KKUA 4LK3A 4A91A 1XNRB 1AF4A 2PRZA 4UM8B 1Z28A 3WNCA 2XNJA 4Q3EA 3G49A 5ED0A 4F8JA 1VOTA 3NT4A 4RFVA 2BKLA 1CYEA 1FYVA 2EJCA 3RV4A 2J07A 2IH5A 2FZGA 1TW2A 1Z13A 4HGZA 4PLFA 2PFSA 4YRPA 1A7UA 1PDWA 2VYFA 3Q9SA 4WXMA 2BELA 1P74A 4QASA 2HHCA 1TJPB 1HLFA 4IGKA 2DBQA 4A1FA 4QYSA 2PA3A 2ZWVA 3I9V1 1U2EA 2P2DA 3G7UA 4JR0A 4NS1A 1TF2A 4RIHA 3T1VA 3UB2A 2ECQA 1K4YA 1E5TA 4WD3A 5EOVA 3NKLA 1FMTA 3GB9A 3SHTA 2OBBA 2IBTA 1M1NB 2QI9C 2VKTA 3VSDA 2BDEA 1YVDA 6ADHA 1A7JA 2NO6A 4E1BA 3S8EA 5JARA 3UCFA 1OH6A 4PAOA 2XDQA 4FS3A 2XE7A 3UJBA 3W2EA 2KS6A 3MM4A 3EY4A 4X1OA 2D8AA 1NOJA 3FD8A 3AG5A 3VPGA 5AM4A 4XYGA 4MKZA 5DJ5A 4L7VA 1CUSA 1OREA 4DDKA 1ND5A 1E89A 2W4MA 2ZBPA 5TQVA 5AVTA 1ZXBA 2Q0SA 1RKXA 3NTOA 2FR0A 2RKBA 3IC5A 3LWNA 5K3CA 1V25A 4RTRA 1BDMA 1BXRB 2JLSA 1YZVA 1P9OA 4AY3A 3QLUA 4M89A 4MI1A 1YDMA 2Q9UA 4PR3A 5DRTA 4ARVA 2LP4Y 4EZEA 1WXQA 3G1UA 5L40A 1J1UA 4S1PA 2OUIA 1KYWA 1T4BA 4NDZA 1DC6A 3AF4A 3JQFC 3U7QA 5FR1A 3JQPA 1U3UA 2WFZA 3IRVA 2NV0A 4A8PA 1SQFA 3KEQA 4TV8F 5LU9A 3EVGA 3EE6A 2NUAA 4H7KA 3WGZA 1N0VC 4YECA 5BT9A 1EM6A 1DRJA 1X1AA 1QGDA 2TSYB 1CLEA 1EGQA 3F6YA 4XM0A 1F20A 3RF6A 2B1QA 3ZDEA 4ZT3A 4B7ZA 1YO6A 5CDSA 3QY0A 4HTAA 4F06A 4JXZA 4FJ1A 1IN4A 3UF0A 4FGZA 4P86A 2R4TA 3FVVA 4Z9XA 3COZA 5T64A 3H3JA 1MNAA 1X1QA 2BLLA 2FDRA 2X7HA 1BVYF 2QPAA 1XNJA 3EFBA 1JQBA 4JHLA 4R5HA 2ID4A 3GQBA 4EO4A 1EK5A 3SI7A 2BM0A 4BX8A 3W5DA 4TGLA 4TKMA 2E4YA 5H83A 4C4PA 2OBMA 3GJSA 2ZVPX 4XAQA 4XTRA 5C37A 3IERA 3X1MA 1U1EA 3GVCA 3KKMA 3NT5A 4OD0A 5DEIA 3K1TA 2NU9B 1RJ9B 3QSYA 3OIYA 5KU7A 2FKNA 3B2EA 4HRAA 4ZO8A 1AB5A 3ADPA 4MPTA 5DTEA 4ZV4A 1RWOA 2PH3A 2NYVA 4LHWA 4L4YA 2B2NA 5BRNA 1YJ5A 3AI2A 4ZYLA 3PQ7A 2WWGA 2UZ0A 5ITWA 1EB8A 4FOTA 3BE6A 3LK7A 5KNDD 1MHTA 2C7GA 4K8OA 3B3AA 3GMDA 2HSZA 2CV0A 4FDLA 5B30A 2PS1A 3PQCA 1RE1A 2JGFA 2XIQA 3KKEA 4RU1A 4F4JA 1AH2A 1Y9AA 5CVUA 3ZY2A 1UIMA 3KR0A 1KZ9A 3VTFA 2YWFA 3MVEA 3KQHA 3NTRA 2OCLA 3P45A 2QMYA 1LF5A 2R8EA 1UK8A 1ZNXA 2REXB 1DBVO 2ECFA 3KQWA 4CL8A 4UVDA 1KY2A 3KVRA 1E2KA 1FEZA 2CKMA 2VVTA 2MYPA 2BHNA 2QUAA 3E9YA 5DXAA 1TM1E 2XITA 3KK0A 4EB3A 2MSKA 3QUCA 3HU1A 3SOZA 2PCJA 5AW3A 3QE3A 3RNOA 4N40A 1C1DA 3ONNA 1M34B 1ULAA 1EJ2A 1ODSA 1D2CA 4PLZA 4UNQA 1YQ9A 1M2WA 2CXUA 1N4AA 3KJQA 5CFRA 1KQOA 3HBAA 3SVZA 4GMDA 3DNMA 3AVVA 4IYJA 3JALB 3OTHA 1PWYE 1OBFO 2WDZA 4TTAA 1I2MA 1DG9A 1YMUA 4XB2A 4XEHA 2ON6A 2VOEA 4PRKA 3NORA 1AUQA 1CNFA 1X1RA 3JATA 2HJGA 3KLOA 4NHOA 1I5EA 1TJ4A 5AJUA 5IEBA 3D1JA 4AT1A 2E4XA 1BDBA 1QVAA 2V7GA 1IZ8A 3KBOA 4MVJM 3F2VA 3TOSA 2A1IA 2CUZA 1CZHA 3G82C 4BPBA 4G8CA 4ZMSA 1XYYA 2IC5A 3P9IA 3A7EA 1OSNA 1Z4JA 1FVHA 3PR3A 1DRVA 1FRFS 4DL9A 1LJLA 2WSMA 3EZYA 4P32A 3CZ4A 3ZN2A 2I7VA 3IVGA 1CHNA 3O8NA 4YMWA 2BP7A 3ZD9A 3QPWA 4CIDA 1WMFA 1EDEA 3C45A 3RFUA 1CD5A 1JSZA 2QT9A 2OC4A 3AFHA 3D0OA 1EHIA 3IDSA 4CM9D 4DMFA 1EIZA 1TJ3A 3WRXC 2O7RA 3HDQA 4GGOA 2VRCD 3UNXA 4B76A 1IY2A 3PXUA 4Q1FA 2GYUA 4UNRA 1UEJA 5CM9C 1NXVA 2AJLI 3V1TC 1T1RA 1FRNA 1CU1A 1DAOA 1Q1GA 3CGWA 2HNKA 1JA9A 3REGA 2BSQA 3DLAA 1DIAA 1UBRS 5DMHA 2I6SA 4D25A 1V95A 3DVAB 1YZ3A 4R7GA 4I1PA 2Z6QA 1PQYA 4H4EA 1FNCA 1Q1BA 3VZCA 4K88A 3JQ9A 3T5MA 5DBOA 4N5DA 5HXAA 2UAGA 4C2TA 4XUGB 3OT4A 4KTTE 1N3BA 3PUKA 1X19A 2DTXA 2QTTA 3U4MA 1EU1A 4AS1A 4Z99A 1U3WA 3T7KA 4C0AC 1GRQA 1G8KA 3EVCA 5AUNB 1UKZA 1ZGAA 3WGKA 4ZYYA 4JMLA 5CBKA 4Q4AA 1TU3A 4I4TF 1ANKA 2XUIA 3INNA 2O8EA 2D06A 1X13A 1XEXA 1W4ZA 2GN4A 2NVWA 3L1IA 3FPEA 3RJTA 1U9YA 1JHYA 2X22A 4E07A 2HHJA 3ROZA 2CV1A 2O5RA 2CFOA 1E6LA 4PWZA 4AZ0B 1L4LA 1M2OA 2NTVA 3EZFA 1I0ZA 4HH0A 2WHPB 4BTEA 1VCHA 2WTMA 5DNYB 1XIVA 2H4YA 1GG5A 1CNMA 1TADA 3WLLA 2DPXA 3EXFB 4V38A 1A9YA 3IUNA 5DULA 4B3SB 3JVVA 4P4TA 2IPXA 5KYWA 2GN1A 3WZLA 1YVUA 3AO0B 5D3MB 3R40A 1MDBA 5SY9A 2XZLA 3HKCA 2WFLA 1MEEA 2QTBA 1U1DA 1X6VA 3EGEA 1PJLA 3RARA 5IDXA 1WW3A 3ESAA 1Y1TA 2K7ZA 1NUTA 3WWPA 4ZJYA 3RYHB 3TLAA 5JFGA 1ZXXA 2PKXA 1S9DA 3KR9A 2F43A 4QNNA 4PINA 2WQ6A 4MWTA 2VTBB 2H1RA 3AINA 3L7CA 1P1BA 2ACWA 2WTAA 2PO5A 4CJXA 4IEIA 4RLHA 3AESA 4DQKA 1BWRA 3PFHA 2CSUA 3TTVA 1W5TA 3UB3A 821PA 1KO5A 2GT1A 1JH9A 3SYNA 2HLNA 2PKEA 1NN0A 1QANA 1LH0A 2VHQA 5K5EA 3WRYA 1F5NA 3ND7A 3DBVO 4YRLA 4LXHA 2FG5A 3MTGA 1E3SA 1D0VA 1QCZA 4W1SA 3CF4A 3BJRA 2JIRA 4W1RA 1Z33A 4MQFB 4Y67A 4Z9FA 4EA9A 3U3ZA 3IR6A 8GPBA 1AA6A 3BTOA 2OBLA 3VR6D 5FA8A 2IDJA 3JASA 2ISCA 4RXMA 4TLLB 2Y92A 2ZPUA 1I7QB 5PGMA 3GLUA 1XQ9A 1GPLA 3SE0A 4RENA 4CM8B 1G3RA 2HWXA 3A2KA 3TDKA 1U2QA 2WBLC 3QVOA 4L0CA 4U3JA 3K9GA 5CCXA 2F3PA 1BFDA 3CLSC 2HN9A 4UDYX 4MVCA 1KOLA 1CNEA 3DDWA 1RZUA 3FTFA 2VP5A 1COWD 3IB3A 5CPFA 2A8YA 8ABPA 5KQMA 4HQRA 3ZWXA 4ZMBA 1O0SA 2GBLA 1E96A 3LNTA 3UJNA 2FEPA 1NVKA 4BNKA 1PJ8A 4FU0A 1SC9A 4PZLA 5KQPA 4KR2A 1GKKA 1ISPA 3AXSA 3KOYA 5A7FA 4QATA 2HAEA 1OZAA 5CW2A 3B9BA 1NMZA 1TTQB 3F9IA 2BY4A 2OV2A 1MD9A 1L4HA 2YVUA 3FCYA 1E5QA 4XVQA 2EARA 3R7BA 2ZSIA 1OXSC 4BE4A 5JZOA 2EKPA 4LPKA 5CGZA 4UBIA 4G56A 1XEWY 2IYUA 3VVBA 1X7ZB 1RPNA 1G8HA 2FG6C 1UXKA 5P21A 4WUTA 4R3WA 1BD4A 3CEAA 3LUAA 1Z4IA 2FAXA 4LX8A 4WOCA 3LK6A 2ZANA 2NO9A 4Q4CA 5JROA 3E7XA 2I34A 3KOUA 4JYZA 2WJIA 3NBZC 5E4FA 4Y98A 3H16A 2Y71A 1K2WA 2BFFA 2D1YA 3W9SA 2ISSD 4C5AA 3QMVA 3VR4D 3S1AA 4UJ3A 1TGYA 3DONA 1Q1NA 4FDUA 3JYHA 2O3JA 4JYMA 3PGXA 3WDLA 4B48A 4ZI7B 3T5PA 1IN7A 3U1VA 5CXQA 4INAA 1WBDA 5EJ6A 4MQLA 2IBSA 3HSYA 4KPFC 3NOVA 3KQMA 4FYYA 2RHOA 3GYBA 2ZDHA 4X7PA 4I3HA 4RZ3A 3ZV6A 4KLZA 2GQ0A 2NV6A 1EFPA 1RAAA 1RIIA 1VYHA 3OOSA 3CLHA 1Q7GA 3ZQUA 3ZZMA 5BMVB 2VAXA 3AP2A 1NE2A 4M0EA 2PZBA 3LW8A 2QTVA 3PNBA 1WABA 1BNCA 2MU1A 4W5QA 3H9UA 3QW4B 1IRIA 3OQ1A 4P93A 4QJIA 3RUHA 3GLIE 3MAJA 4IPTA 1VBKA 1YE3A 4X44A 5T4EA 5AQEA 3W5BA 3ZGYA 3R0QA 3CR8A 4Q9IA 3UT0A 4AWXA 5K2MA 3JZFA 4LOLA 3HL4A 1XPRA 1U5BA 1VPVA 4NONA 3UK0A 4PSCA 4YP5A 2JD2A 3AHJA 4HN2A 2UVPA 5L8VA 1NF2A 4NLLA 3SU8A 3LXRA 5IKMA 4FT2A 4LF9B 2YMLA 4KXUA 3ZVMA 1LGYA 4GKJB 3OO1A 1KSJA 5J1TB 1KXJA 4CTKA 1NJ8A 3PQ4A 1COZA 1V8FA 3CONA 3H84A 2BDUA 3ZHYA 5JXGA 1QVZA 4H3KB 3LW7A 4IJ5A 4KQWA 2D6FA 1DKQA 1WUIS 1UWKA 2QRVA 1RQRA 1F2TB 1K7EB 1P3DA 3KJXA 4JVLA 1TI7A 4LC9A 2JEOA 5C34B 4B6GA 3EX7C 4LF4B 4PSAA 2WAXA 3GXBA 2B61A 3EIWA 4MMYB 4Y9SA 2A1TR 5EMHA 4CLOB 6YASA 3U7FB 5IS2A 3JQ9C 1YAHA 1FTWA 2P4SA 2ALJA 3DNFA 4KIUA 1OFVA 2VH2A 3MOSA 2QAGB 5GJWC 4D9KA 1VBFA 2ZVJA 3OD5A 1Y6JA 4TS4A 1N0IA 2OHHA 2V97A 3Q3JB 3RU7A 1F1JA 4QPPA 5LOVA 2HI0A 2PTGA 2R8RA 3AHFA 3F5DA 1GFZA 4IL5A 5CNJA 3IAFA 5EIWA 5IK2D 3WGGA 3K0EA 4RMNA 4W8GA 1FNMA 5FA6A 3SBEA 3U09A 2WB2A 4E21A 1KWGA 4R1MA 3WLSA 2X58A 4GMKA 4M0PA 3KOMA 2E89A 2DVMA 3GR6A 4NPCA 2J31A 1YR9A 3L5OA 3ZY3A 4OHYA 4HB0A 3U0VA 3LCMA 3KV3O 1LPAB 3P4XA 2A5JA 2RGRA 2CLLB 4H6VA 1ZEMA 3UJHA 5FL7D 1I4EB 4JENA 2FK7A 4PAMA 2WTUA 4DV3B 1I30A 4AJJA 5EJEA 5I7SA 2KM1A 3PC8A 5A06A 2ID8A 4MYSA 2J0UB 4JR1A 3IOMA 1XZKA 3VR3A 3EISA 1TVEA 1MHPA 1D1PA 2EFCB 2EBFX 2ZIXB 3QVMA 2D59A 1S2OA 2ZIAA 1D9ZA 5TQ0A 2AR7A 1T4MA 1JXOA 4LCJA 3HJBA 1UJMA 5C7LO 3NWJA 4U39A 1HFWA 4JGGA 4Z3KA 3GNLA 5BWLA 1DKUA 1QQ5A 1TFRA 2V4MA 3AEUB 3I9V6 5C3UA 3R74A 1T5HX 5ELLA 3VRHA 4FYPA 1SKMA 4FFWA 4MROA 1W85A 1M2NA 1K88A 4F5DA 5CAEB 1M1ZA 3EASA 2EWWA 4ND2A 1YZQA 2OYRA 4QDKA 1PJSA 3O3MB 4BZQA 1RYEA 1JWLA 1AM4D 3QHQA 1EUCA 1ZS9A 4HX9A 3ER6A 1R9NA 5CLJA 2IGBA 2GN0A 2UVQA 1SCUB 3IMFA 5TF4A 1XQWA 2YH2A 3JD0A 3ZU3A 3ZCQA 2OYSA 2UKDA 4K9NA 5J4KA 1N77A 2QM7A 1Y89A 4LDZA 4LDPA 1RXIA 2G6TA 2IEIA 3VPFA 1SJ9A 3FKSD 2O8NA 3OZFA 3Q0EA 1JQ5A 3PHGA 4XX0B 4CM4A 3QYJA 2AQHA 1AC5A 4KL8S 5IKXA 3E9MA 3FHJA 4X9XA 4B3FX 4P6VF 1RU3A 5F7JA 4ZEOA 2AOTA 3O7WA 1T2AA 4KQ6A 3HCBA 5EY5B 4RWEA 2WSIA 3OCVA 2WZQA 2P2NA 2VBCA 3JQ7B 4TV8B 4D1YA 1C9NA 3U4CA 3EMDA 4LVNA 1J8FA 3PC3A 4DFDA 4QLAA 1RZVA 1YUNA 2CCJA 3LCVB 2I80A 4K26A 5A7GA 4L85A 4ZAZA 4TVOA 2FEMA 2IEZA 2WSLA 3OIGA 3ZHBA 4JB0A 2RK4A 2B99A 1IPEA 2VPXA 3JQ8A 1P7YA 1VSQA 3IAAA 3FUWA 2C5HA 3S2FA 4F4UA 2BFOA 3DKIA 1TO6A 3AQIA 2DY1A 2G80A 3UMJA 4JUDX 5FX2A 5HA5A 1YA6A 2O59A 3WJ2A 3GUVA 4YJHB 3FFBA 4LHVA 1IOZA 2AE2A 4PBRA 1XL1A 1HEIA 2AUNA 2GBLC 1GZ4A 5BVHA 1OH8A 1OZ0A 3LSYA 4RVFA 3ZTYA 3DEHA 4IGEA 3D1VA 5FJJA 1U8TA 5K3SA 4BFYA 3KO8A 2R00A 3N8GA 4CL3A 3U4HA 1CQJB 1P4SA 3QTBA 1X7DA 2IOFK 3HWRA 4GYJA 4KQKA 2YY6A 3TCXB 4DIOA 5BSUA 1SAYA 1VFPA 4IM7A 3UXYA 4BHTA 2YJ3A 4BB5A 2PGIA 3PQEA 4FZRA 4E2WA 3GRRA 3MTQA 3ECCA 1PHPA 3PPWA 3VR1A 3ZJUA 1VSTA 3HA3A 1L7RA 1R6VA 3DOHA 2VSNA 4AUEA 2JS7A 3H4IA 2IEBA 1KK0A 4Q7JB 5ALHA 2QQ0A 4QRDA 3V32A 3WGVA 4CCAA 5CB4A 4I5FA 1GQFA 3OZGA 4OQQA 5E1OA 2JLZA 1YACA 4MTCA 2IF0A 1KHTA 1II9A 1KXZA 1LXCA 3DWEX 4RXTA 5ESXA 2A30A 2H54A 2R96A 3JPYA 4RZHA 3TFWA 4OGLA 1L5MA 3BMNA 4IAOA 3C4QA 2I3BA 1X80B 3HJUA 1G60A 4TKZA 1X2EA 1EFUA 4UEWA 4YLGA 3N0VA 4CCYA 3BXXA 4HTFA 4XD7D 4EVIA 3GLHA 3UGQA 3EZ6A 3MGBA 3THXA 1OOEA 2VF4X 2ZQZA 3LBAA 3WBFA 5J47A 5LJLA 4UXHA 1FUYB 3CG0A 2O8FA 1TK9A 3H3FA 1NATA 3MMZA 2VK1A 4IHAA 5FNVF 3L7BA 3GBSA 4KDFA 2ATEA 3CMMA 3DDHA 3DB1A 4MGKR 5HF6A 5KPDA 5T4HA 3ZR4B 3PF8A 4BO3A 3GP8A 1TVKB 1PWXA 2OFOA 5CR9A 1GDTA 1GPBA 4OXXA 3LAWA 2XA1A 2JAPA 2QM3A 3UZUA 1VPDA 5BORA 1M75A 4F60A 3IQZA 1GNLA 3EXHC 4OBXA 3KJFA 1ZJYA 1E7RA 1R0CA 3Q7IA 4RORA 3GEMA 4OREX 1E69A 1CF9A 5EQFA 1MAUA 4BMOB 3S7TA 1CRQA 4N0EA 2ERYA 1R0SA 2OHGA 3BRCA 4OQDA 1ZIPA 2JIMA 3W8NA 1U7WA 4CRWB 1MQSA 4BV8A 2CVQA 4NEGA 4B4DA 1VHLA 1PNTA 1G1AA 3FOBA 4Q9AA 1RBMA 4EEKA 2HNAA 2RG1A 4M3NA 1C1XB 1LTHR 2R7AA 1UH5A 2R84A 3QYAA 4H7FA 2LKCA 1B0ZA 2GEFA 3N76A 4MA5A 2TMGA 4NYIR 4PBSA 4X60A 1W4RA 2BMWA 3EWAA 6AT1A 3PEFA 1FNDA 2A92A 4JLSA 4M9UA 1DBIA 4D9EA 1XZQA 4CMEA 4UTNA 3EW9A 1HORA 1CUBA 3DMYA 4CQMA 4BVEA 2F9MA 2PZKA 2AC4A 3ZCXA 1W35A 1E1DA 3C43A 1KAHA 3HKDA 4PX3A 4RQUA 4XWWA 5JS1A 5C8ZA 1XTBA 1X1BA 1J00A 3HO8A 3O2QB 4OGKA 5FOSA 1ZVJA 1ADCA 1BMFD 3NOQA 1L7EA 3G5UA 3OHPA 7ABPA 1YFLA 2QQEA 1AHHA 2XOXA 4Y6LA 1KAEA 4BUZA 4EK9A 1NVGA 2KJQA 3PV0A 3ZXXA 2XYPA 2RDMA 3P4YA 1GP2A 1VJ5A 3UHAA 4BO5A 1U0OC 2BKEA 2JFHA 1FUEA 3A4YA 4EJ6A 1AD2A 1WY5A 3P9KA 3U0BA 2XMZA 1ZW6A 4HYEA 3C3WA 3MBIA 4CIVA 1TMKA 2X6RA 4CMJA 4DLSA 1AO0A 3R2JA 4I4TB 5M04A 1NVDA 4UAGA 1GZSA 1QCCA 1QR6A 3DXZA 3FWNA 4A82A 3GJ0A 3AB8A 2VJLA 3ILHA 5FO1A 3PC8C 4PCUA 1T43A 1RYNA 3N87A 3MWFA 4UASA 1NVVR 4W7HA 3EMBA 2PA0A 2MSNA 3SHWA 3AF5A 2WWHA 2VXCA 1MB3A 1DIRA 2W4IA 1MX9A 3FCEA 5AKZA 2HXSA 1YSCA 4NP6A 5JYDA 1LSJA 3DEZA 4QWWA 2FZEA 2BEVB 2E4VA 1A8PA 1CQXA 3T41A 1MCZA 2CNNA 2HRDA 2V6MA 2E4UA 3AFNA 4IOJA 4XRRA 1NIJA 3INTA 4A6XA 5I7OA 3AEXA 4CTNA 4P3OA 3EQZA 5LQKA 5ALKA 2OAP1 1C8VB 1PR1A 3QP9A 2WMYA 5DHQA 5DRYA 1BGXT 2ZJ3A 4XIIA 4LBWA 5A1JA 3NETA 5JD4A 1BCSB 4WECA 3JYPA 3SAJA 1NA5A 3HB7A 2WIBA 5C7IO 3OOYA 3DUFA 3IPAA 4WOBA 2P69A 3THOA 1RLTA 2NZVG 2NUTA 4J4HA 5IVPA 4BTVA 1IXKA 3FDXA 2Z8YM 3IQXA 1W9HA 3PE3A 3Q7PA 4ZANA 1NLYA 2PVPA 1Z88A 1UP7A 1YQGA 5DU2A 4K1XA 5AXBA 1C5KA 3A9SA 4BNIA 4I1YA 3VJLA 1QIIA 4TWAA 2DETA 2GM3A 5JAPA 1XLWA 2LGJA 1RTKA 3GMSA 4FC7A 4EB6B 1FP7A 3NYRA 4BC1A 4JI6B 5DHAA 2ZW9A 4MMXB 4AXBA 1XZBA 2ZRAA 2R47A 4NYIQ 5AM2A 3TLJA 1SRQA 3RAEC 5B3JC 5FWXA 3KDSE 4NJOA 4WESB 3VNSA 2G40A 4WCFA 2JFPA 2HA3A 1U28C 2EGHA 2FQ1A 2OP1A 3SJ7A 3W04A 1T36B 1HNXB 4HVTA 3WSWA 4BO6A 1B8NA 4KR9A 3RAFC 3MQ2A 1HE3A 4RY0A 3L8ZA 3ZV7A 3AIMA 2NGRA 2PZGA 2I67A 2ZFUA 4MKXA 4A0QA 1XLTC 1EHYA 1X0XA 1ZCJA 2JCXA 2FR8A 3BSYA 1HK7A 3FSRA 3C87A 3LQ1A 4CN9A 3CLSD 3N75A 2CFCA 4URVR 3QOYA 3LP6A 1GEGA 2OWDA 4XOIA 4BVBA 1NSTA 1RC1A 2WIDA 5EMJA 5AK4A 3WHIA 5GV8A 5I4KA 5JDIA 3EA0A 1P81A 4HGQA 1U8UA 1ZKDA 2R00C 2I66A 4DLKA 1YDHA 4EP1A 3C3PA 1HY3A 5IBPA 4KO4S 2Z9CA 4ZHQB 5ALVA 1RABA 2NTJA 1MABB 1F8XA 3E3LA 2DH5A 2DEUA 1EBBA 3KAQA 3RF7A 2PZJA 4O5OA 3EQ8A 2OXRA 3H1TA 4QYIA 2M32A 1X7YA 4MIEA 4UM7A 4BDSA 1U9CA 1LBEA 3HYLA 4RC9A 1KOGA 5DYYA 5H7XA 1T9GR 1QK4A 4JVSB 4RF4A 1MOPA 2Z43A 4EKIA 1FP4B 5J4VA 1CERA 1L1RA 4KE9A 4Q01A 3UFBA 1NVVQ 5BOVA 3LH5A 4G1FA 5JV5A 2E4ZA 3FHCB 1E3IA 3AEQA 1PCXA 2H7VA 3LVQE 2I7CA 4NOMA 4PNPA 2VG8A 2VWQA 1SN7A 2Y1LA 1LEHA 1N8SA 1XZNA 2WFMA 5AXCA 4F2GA 5BQ5A 1A69A 3PJDA 1Q1QA 2ZIVB 3H5NA 4P7GA 3HXLA 3KV1A 1VE1A 3KJZA 4DADA 1EWQA 1ZOLA 5LB2A 2VNAA 5LQMA 3TQIA 3I8XA 2XHZA 4G37A 4KRYA 1F6WA 1MKYA 2EQ5A 2FA9A 1PUXA 3LC7O 3OPYA 5JISA 3U37A 2CXPA 2IU0A 1D5CA 2DPGA 3A0UA 3QIVA 5FOUA 3TLCA 1T6YA 4B4VA 2GH1A 4IIFA 1PVVA 4S1VA 4LJLA 4K46A 3OT1A 3IAS1 3LT1A 2PANA 3HM9A 3EA4A 4WUVA 1BN6A 3U4QB 4EH1A 3VPHA 4LDQA 3EGWA 4RVCA 4POOA 1H3NA 5B3KA 1WLYA 2OBNA 3QI2A 3B1YA 3F46A 3NO4A 3PFWO 4TKVB 4URHA 1QG2A 3VPBA 4E5UA 2LKDA 4ECAA 1X3LA 1LDGA 1IIRA 2CVOA 5BYKA 3UK2A 2NUPB 4QKQA 1A72A 5C51B 4S04A 3GJYA 3FI0A 4J49A 3BFXA 1VJGA 2Y1OA 1DAKA 1E1LA 4LK2A 1EX9A 1PZEA 3R0IA 1S2LA 4OLHA 4DQ0A 4KXVA 1C8KA 2WRZA 4KQEA 1XN1A 2YZNA 1LTKA 3BWMA 3D54D 3IOBA 2PM8A 2IHNA 1ML4A 1DMRA 3INYA 4MH0R 2LTAA 3I62A 3GLRA 3WB1A 3OCCA 2GGSA 4QVGA 4KWHA 1AN0A 2FYTA 2ZI5A 3L9XA 3H86A 3N1UA 4TUYA 2WM8A 1T3LA 1KQNA 5HKKD 5LPNA 1BHQ1 3T3MB 3AYXB 3ZX4A 5H82A 2WMOB 1UBHS 1Q7RA 4MIYA 4P36A 1NW9B 5DSTA 2B4YA 1ORDA 3QWBA 3IO3A 3MIZA 4X7RA 1RHRA 2RGUA 1BXGA 2X15A 3I1FA 4UE3S 4NYJR 4AKSA 1Z83A 3LA8A 4C4ZA 2PG3A 3KYCB 1JLLB 1HLPA 2H7CA 4DR7B 1YZUA 1MPTA 4AJNA 4DIBA 4EM6A 4P4NA 4OHMA 2FHPA 1Z4MA 4MVJG 2KHZA 3PXBA 1MXFA 1GSHA 2J32A 4LZWA 2H2IA 4PLVA 1VPTA 2Y67A 5JSYA 3VSCA 3WYCA 3ZGVA 4EECA 3JRWA 5HFJA 4HWPA 1VIAA 3RVPA 1IQPA 4OL0A 1ZY2A 3CH6A 3ZLUA 4MW0A 4EY5A 5IJZA 4XARA 4B74A 1N4DA 3FFTA 3KZVA 1I3OA 2HGZA 4BKUA 4LE1A 2GA9A 3RUDA 1QIGA 2JJYA 4M9RA 3L0SA 4PFJA 4ZAFA 3UXEA 1PZMA 2D62A 2HWWA 3EIFA 3FFXA 4ESOA 3S8YA 2FGJA 3D4LA 4HH4A 1GD1O 2FSGA 3VSEA 3VZQA 1BH2A 3VZBA 4L74A 4R81A 3GJ7A 3F9CA 4X7BA 4BBPA 1EVKA 5DVZA 3V8VA 1VRCA 1I32A 4GOXA 5G4KA 1N1EA 3GUCA 1Z0UA 3UH1A 4ZKDA 1ESDA 3TCNA 2H9YA 1YXMA 5GONA 1UBMS 3K8OE 2BEUA 1MZPA 1PZFA 1KZHA 1WXWA 2HFKA 2GERA 3OHSX 2C31A 3HSSA 2GPTA 2QGNA 4UC0A 5IFKA 4HDQB 4NICA 1T1GA 4Y0NA 2AR9A 3NV7A 4WKOA 2C7QA 2I2DA 4IXNA 1N9ZA 4EY4A 3NRJA 4J7UA 4ZXPA 1N9GB 3IIMA 1ILWA 1EB9A 4M87A 3TKAA 3TQHA 3X3HA 1RR6A 2AE1A 4UXJA 3F74A 2BL4A 2A5FA 3V1NA 5G3ZA 2B6NA 1WZEA 4WZBE 1KK1A 4NVRA 4Y6RA 5PNTA 3UMCA 3ZV3A 1E2BA 5MHTA 4J0GA 2DCMA 1QQ6A 2ZCJA 1Q0UA 1UR5A 2VZ0A 3PRYA 1E2IA 2GETA 1BA3A 1DDGA 3NHJA 3TQCA 1PFGA 4DCOA 2B34A 3KKNA 5B1SA 1W9MA 2OGTA 1U11A 1N2CE 3FLEA 3KT0A 3ONFA 2IFTA 4M99A 4NV0A 3ZS8A 4B6QA 4BS9A 1E2QA 3J7AC 1PLJA 1RQXA 2C7BA 2ZJ2A 4KRXA 2BUAA 4AXXA 4GOMD 3X1ZA 1W1WA 1SVWA 1OLUB 2NO7A 3CNOA 4P3PA 2FF7A 4XVRA 1GOTA 3L77A 4EY3A 1QMGA 4DA7A 1LBQA 2M98A 2JCYA 1QIEA 1RJEA 4FPXA 4ZQBA 3DA8A 4RW0A 3LDFA 2WV7A 4M0MA 2SECE 1Y3HA 2Y0EA 3B8EA 2GOYA 2OHFA 3I3SR 3IESA 2AN4A 1SBHA 2O0JA 1A1SA 1B93A 3OPQA 2OZLA 4P4LA 2Q5JA 3FZGA 4U2CA 4NYJQ 4PM4A 4QX6A 4QPJC 4WH0A 5CA0B 2V3CC 1JHZA 2OG1A 2PRYA 4GLLA 4Z0PA 2JIZA 4ANFA 5JO0A 4L9RA 4MB6A 1ST2A 3IJEB 3E9ZA 2ZYUX 4HDMA 3PDIB 3WKDA 2FR8C 5GMOA 3NDBB 2P7HA 4QBGB 2PNJA 5DTJA 3RCBA 4C7OA 1A4IA 1R6AA 1P0CA 4PRLA 4AJ9A 3HZRA 3ZWQA 3L8FA 5JDIC 5LN1A 3KAKA 2PH1A 5JDCC 2D3TA 2C20A 1MPXA 4X7MA 2FW6A 3A3YA 1P17A 4PQYA 5D5PA 1TZBA 2DHDA 3WWCA 3C3KA 3D0RA 2QAGC 5A3SA 1R27A 3D6AA 2PCLA 1P8JA 3TVTA 1I2ZA 3GJTA 1GAXA 1ZISA 1E77A 4Q05A 5FWAA 3ZHQA 5C5DA 2HU5A 1QYIA 3N3BC 1Q19A 2JEYA 1V7CA 2BONA 3JPWA 2IY7A 4RPIA 3OFNA 1BD3A 4KN8A 3E2PA 3KB1A 3BYZA 4FINA 4N6NA 1VPWA 2PUAA 5FPSA 1HYGA 2H6EA 1D03A 3DLPX 3ZDDA 5U9CA 3DOEA 5IPFA 5HOEA 4MP8A 3L84A 3OETA 3R9XA 2XECA 3QBDA 5FXMA 4N5IX 2OV8A 4B81A 1XU4A 3C7DB 3TFOA 4OY3A 2JI7A 1EX7A 1XWFA 4DR3B 1AZLA 3L8DA 3OLXA 2O8CA 2F9FA 2WJJA 3I6ZA 4UBNA 4RD2A 2BKUA 4PZEA 1SHJA 5G0WA 2COKA 1A1VA 3ONVA 5THKA 5LL6P 5IBQA 1NUSA 1RCFA 1VJTA 2B5VA 5BR8B 1Z63A 1JEYB 1UT5A 3FOCA 3H5TA 3HS3A 4KAFA 1KU6A 3BMXA 4PPQA 4NFLA 4OOEA 5AI8A 4YFVA 3WDKA 4B33A 3OOJA 4GDMA 5FBLB 4JLMA 4UU1A 1O4WA 2VH5R 4HZIA 1JV2B 2V03A 1CE8A 1XOIA 2WVHA 5FNVB 3WQHA 4G5SA 4NMHA 2OECA 3UJ9A 4OFBA 3JYNA 1VJDA 4C01A 3T1YB 1G59A 3OU6A 3P9CA 2YIVX 4DEXA 4RPLA 4PAGA 1Z47A 1CUXA 2QB5A 4NU8X 4OCZA 3U4GA 4P3XA 4BV3A 2VTKA 2J59A 4BMZA 2QLNA 5DNCA 2IS6A 1DOAA 1KH3A 2QWXA 5EQTA 3K6SA 2YBDA 3EC2A 3GCWA 5T8KA 3G0GA 4IMRA 1X8KA 3KHSA 1S3GA 4JJZA 2ILVA 5IXJA 2DBZA 5FH9A 2G72A 5F35A 4BIIA 5DTQA 2JHPA 2CF6A 4XPIA 1H0HA 1XXHA 4YRQA 3GFFA 4F4DA 1W59A 2FCRA 3TJRA 5AM1A 4KLRA 1CG6A 2PXHA 2IKQA 3K2QA 5IWCA 4IGIA 3OKCA 1OZHA 1Q84A 3D6UA 5BN3B 1VP3A 3GDOA 4K6OA 5H02A 2ZIEA 1P2BA 3ZDBA 4HDOB 1CIPA 4MKRA 1YB1A 1SBQA 2CUTA 4I0WB 3PFKA 3ZXYA 3C5HA 1XKQA 1JYEA 1O95A 4UULA 4JJIA 3IUQA 1PJAA 1TAHA 3ZIUA 2ZPTX 5B1YA 3HEMA 1WU8A 1XZEA 5EWLA 4OJYA 1GAWA 1FTSA 1IOLA 1Z08A 2JAQA 3WL6A 2XXBA 5SYNA 2V9CA 3LC0A 3VH1A 1GPDG 3AEYA 2JK0A 4MYCA 1M66A 1RPJA 1QZUA 4NFYA 1C7RA 3VYSB 3LJKA 5ICSA 5A5EA 1PGNA 4OX9Y 2D3WA 1KEWA 5F9HA 3A06A 3UENA 3ZS9A 2P79A 3HK2A 1E5XA 4V0QA 3GQBB 1YZKA 3E0XA 2JJMA 4CF5A 4FM9A 1HR0B 4D56A 1OWOA 4A1OA 3DCNA 3O4FA 1ZDMA 3NRBA 2F9LA 4TMKA 2XUFA 2YFYA 4KC0A 2HJVA 4JUAA 1S8OA 1PEYA 1ZMXA 2XT6A 4DWVA 5L4NA 2Z2JA 4H0CA 3W34A 3NASA 2HR1A 3R24A 1R0BA 3QG1A 3VR3D 1XTUA 1OFGA 1Y6GA 2VPPA 1KIFA 2IV2X 1X7XA 1Z5PA 3D2AA 4DB2A 1SOUA 2GAAA 1EA7A 2JFQA 1SHLA 1JEQA 4JB3A 3UHFA 3AERA 3RH0A 4EATA 1M0TA 3EZ7A 4XDHA 3LUBA 1P62B 1CVIA 5LCXA 3HB9A 3WGTA 1TO1E 1HQCA 4CIBA 1DX6A 4CWAA 3LIIA 3PVZA 1KK3A 1M54A 1HYQA 1AS3A 1REQA 1T8YA 2VNHA 4PS1A 2GJSA 1IVNA 1KMNA 1SBZA 1NBOA 4HGRA 2GZDA 1P4HA 3PUIA 4LQ4A 5K0NA 5LU8A 2XVAA 4IYRA 4EG3A 5HE9A 4AP9A 2YVKA 1G20A 2CXHA 4GM1A 1JS1X 5IN5A 1AUOA 4RKRA 1Q21A 3LPMA 5AFSA 2Q4OA 3L7KA 3QA9A 5HRAA 2ZTHA 1H4TA 4RQTA 4UBJA 3C5WP 3U7IA 4DANA 5LBIA 4EPYA 3PITA 2JZNA 4WV3A 2A9OA 4G1EB 2KBFA 2QJRA 2WT4A 1JLMA 2QVYX 3OWOA 2DM6A 4IIJA 3TLGA 2W2KA 3FDZA 3AFMA 1T8WA 4NC9A 3JATB 3L4SO 1PD0A 1B2LA 2TRSB