4DM3A

Crystal structure of human pnmt in complex adohcy, resorcinol and imidazole
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Missing fragments: detecting cooperative binding in fragment-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dm3A00
4EK9A 1X1AA 4HGZA 3UJ9A 5KYGA 1SUIA 1P39A 3UJAA 2NP7A 2EX4A 3FTCA 1G38A 3E7PA 5E9WA 4XUEA 5D1NA 3EVCA 4DF3A 3AWIA 3KQVA 3OU6A 1YZ3A 1UFKA 3UJ6A 1P1CA 1VQ1A 4HH4A 1T43A 1WXWA 3NDIA 2PLWA 3ANXA 3G2OA 3SSNA 3QOWA 4PCAA 3KQYA 1BKYA 3MAGA 4M37A 3G2PA 4R6XA 3FPEA 2FHPA 3QOXA 2YUIA 3KHKA 3UFBA 3E23A 5HIJA 2PX8A 2G71A 2QYOA 3G8AA 5EMJA 2AOVA 2K4MA 3C6MA 4HTFA 1Y8CA 4R8SA 3TKYA 5F2KA 3OCJA 4MIKA 5CVUA 3SVZA 3LBYA 5GIOE 2P8JA 4RTSA 1I4WA 3SGLA 3HCDA 4PYJA 5CM2Z 4RTMA 4HSGA 3B3FA 3ELYA 3GJYA 5EKUA 1Q0SA 3CBGA 3LGAA 2PX4A 1X19A 4E30A 2IH5A 4GOMD 2AVDA 3LSTA 1RI1A 1O54A 5EQJB 5ICFA 2FPOA 4QTUB 1QAQA 5E1DA 4EMSA 4X1OA 1XDSA 1KXZA 3FUUA 4RTKA 2XYVA 4KRGA 5FQOA 3FPJA 4CKEA 2IDKA 4A6DA 4X41A 5K0EA 2Z6UA 3DUWA 5C1IA 5E8JA 3OPNA 3M6WA 4DA4A 1JQDA 1MHTA 3LDGA 2HR1A 4ATNA 4E2WA 2O05A 5EMKA 8MHTA 1SQGA 4RX1A 3M33A 5DM2A 2PJDA 9MHTA 5DLYA 1MJFA 4XUDA 3G88A 3TQSA 3LCCA 5EKXA 5LQNA 4RTPA 3PLAE 2N47A 4E2XA 2YTZA 1KPGA 1FJXA 2R3SA 2JJQA 1UWVA 2ZBQA 4E70A 5LQUA 5MHTA 2PT6A 3EVDA 4FT4A 5LQRA 3DXYA 2I9KA 4X61A 2BZGA 1D2HA 2E5WA 3ID6C 3DR5A 4PYLA 1XCJA 2H1RA 3D2LA 2ONYA 4GEKA 3BZBA 3KQQA 5HIIA 1YZHA 3X0DA 1M0EA 2O0LA 2ZWVA 3THRA 5FHQA 3RODA 2ESRA 5E1OA 3TPZA 3KPWA 3THSA 4PGGA 4C05A 2OY0A 1D2GA 2JHAA 3EGIA 3DP7A 1VBFA 5BXYA 2QRVA 2PKWA 4O29A 5LSAA 2XVAA 1AF7A 3A7EA 4AZTA 1JQEA 4DQ0A 5BP7A 1JG1A 3GRYA 5EHIA 1NV8A 5GM1A 3SXJA 4RYLA 5FADA 5DM1A 2GA9A 4L7VA 5FULA 4OA8A 1RI3A 5K8VA 4GC9A 3CC8A 2OB2A 3MTIA 3I9FA 5EEHA 2Z6QA 3EVFA 1TPYA 1NT2A 1RJGA 5M5BA 3RIEA 1KP9A 1PJZA 1XXLA 5EIWA 5T64A 5EGSA 3LECA 1O9HA 3BXOA 4QTTB 5DPMA 2ERCA 3WSTA 2IH2A 5FHRA 3NTVA 2A14A 3KQOA 4GOLD 4OBXA 2V7EA 3MCZA 3KPJA 5HIMA 1L3IA 3O7WA 4YUVA 4PGHA 3EMDA 3AXSA 3OZTA 1DL5A 3HEMA 5GM2A 3UWPA 5KQSA 3UBTA 4GOND 3EVEA 3FUVA 3BGDA 3BKWA 3HCFA 4FS8A 3LDFA 3VYWA 4CTKA 4CWAA 1G60A 1OR8A 4G56A 2KW5A 2YXEA 3GRUA 4UOEA 1D2CA 1L9KA 1RI2A 1SUSA 4YUYA 1ZGAA 3MGGA 3GGDA 2XVMA 5DSTA 4BP1A 5K0GA 5E8RA 1P1BA 2PVCA 3EGVA 3OZRA 3KPVA 3EVAA 3GCZA 3HVHA 4FT2A 4PYQA 4WVLA 4POOA 5F2NA 5GINE 3TOSA 5K01A 5C0OE 3P9NA 4PNEA 2P3LA 2BR3A 1IY9A 3HVIA 1BC5A 5DTMA 5EPEA 1XJ5A 3JWIA 3C3YA 1HNNA 5EZSA 4ER6A 1RJEA 3G2QA 2AOTA 1HMYA 4R6WA 1VE3A 4PWYA 1BOOA 4XUCA 2NXEA 1NBHA 3KR0A 5FQNA 4RTNA 3PFHA 4BLVA 2PWYA 2ORED 3DMFA 4DM3A 4YV1A 1WG8A 1KYZA 3KPUA 3HA5A 1H1DA 2G8NA 3C0KA 4LECA 2PXAA 3P71T 3B7PA 4OA5A 2QE6A 5HEKA 1L3BA 3SSOA 3UA4A 3HM2A 4AZSA 2XYQA 3DH0A 2AOUB 3UJBA 5K09A 5LQJA 4HTFB 1L1EA 1EJ6A 4E2YA 5ICEA 4RV9A 4P7JA 4ER7A 3DMHA 1F3LA 5KS2A 5LQAA 4M36A 3NJRA 4OBWA 4OX9Y 1EQAA 3A27A 3Q7EA 3P9CA 2NNWB 2NXJA 3P9KA 3OFKA 3UJ8A 3FRIA 1I9GA 2ZBPA 3Q87B 4RVDA 3TM4A 3R6TA 3O31A 5ICGA 3I53A 3HP7A 3MHTA 1NW6A 3DMGA 3MTEA 3P2EA 1YUBA 1KPIA 3JWGA 4RVFA 3SMQA 4A6EA 5EZQA 3PB3A 5E9JA 5FWAA 3DXXA 4DKJA 1VIDA 1YFJA 3LKDA 2C7QA 1VP3A 3FUXA 2VS1A 2XBMA 3TM5A 3FPFA 4NECA 3NWBA 5EC8A 4R05A 1JG3A 2B9EA 4LWOA 2EJTA 4R8RA 2G1PA 2Z6AA 1XTPA 3CKKA 3ER8A 1JG4A 3ME5A 1P91A 1RI4A 5H02A 2IPXA 3M6VA 3LL7A 4AUKA 4EKGA 1N7JA 1U2ZA 2IGTA 3CJRA 3GU3A 2UYQA 3EVZA 4PIMA 5E9QA 2AVNA 1WY7A 3C6KA 1WZNA 4BLWA 3OZSA 3GNLA 2JG3A 5K05A 2P7IA 2JHPA 4CXMA 4Z2YA 3R0QA 5JUWA 5E1MA 1QAOA 3NMUF 1SG9A 1UIRA 1G55A 2C7PA 2AN5A 1ORIA 5B1SA 4P58A 3EVBA 5KVAA 2QRVB 2EFJA 4V0QA 2G70A 3GDHA 3BWYA 4GUAA 2P1DA 4C04A 2JHCA 4DCGA 3F4KA 3IHTA 5K0JA 5CCBA 4YUWA 3R3HA 4C08A 1X1BA 3K6RA 4QPNA 2BM9A 4F86A 1G8AA 4YMHA 2GB4A 3G5TA 4M38A 3MB5A 4RVGA 4AX8A 4HC4A 3KQPA 5EG5A 3EEOA 4P7GA 3C3PA 4RVHA 4BP3A 3GRRA 5BW5A 2VZ9A 2JH8A 4YMGA 3H2BA 3PVCA 1X1DA 3LCVB 2IP2A 3IYLW 4GQBA 3UZUA 2HV9A 3AXTA 4OQDA 4FZVA 4C4AA 2IIPA 2YVLA 4E33A 3LHDA 1JSXA 2PBFA 3G8BA 4FP9A 4KWCA 5DTRA 1VP9A 3PTAA 5DRYA 2Y1XA 2PV0A 3BGIA 4X63A 5CUQA 4RTQA 3DULA 3R24A 4KDCA 4QQNA 5K0NA 4RTJA 4RTOA 2IBSA 1FBNA 3O4FA 4KIFA 5T6BA 2ZIFA 2NXNA 3FPGA 5FA5A 4RTLA 3CGGA 3KPYA 3QV2A 3PFGA 3PX3A 5KQRA 3MERA 1YFLA 3FTEA 1O9GA 4V0RA 3VSEA 2HTEA 2NXCA 5CCXA 2P40A 1JQ3A 5BW4A 4FSDA 5E1BA 2VDUE 1V39A 3HVKA 4E2ZA 4YUZA 2BH2A 4KIGA 3ELUA 2BR5A 2ZIEA 4F85A 5EMLA 5F2OA 3SM3A 5CVDA 2AS0A 3E8SA 4AZWA 2B25A 3A26A 4EVIA 1VLMA 4F84A 3FPHA 5ERGB 3FZGA 2AR0A 4IV0A 2QM3A 1Z3CA 4C07A 4CKCA 4GBED 5K0FA 2EJUA 3V97A 4MTLA 2I7CA 2H11A 3T7SA 5IKMA 5K0CA 2AOTB 2OB1A 3TR6A 3EGEA 2GLUA 2I62A 1F38A 3LDUA 5G02A 5U4XA 3FTDA 5FTWA 3A7DA 5K0LA 2PT9A 3SR4A 2OBFA 4K6MA 1XCLA 3TKAA 4U7TB 4C03A 4EKIA 2VDWA 5EVJA 3TMAA 4ISCA 3OE4A 5E2BA 1R6AA 4B17A 4PYNA 3BGVA 1JTEA 1PRYA 1FP2A 1ZHFA 1ZQ9A 4U7PB 3HCBA 3ER9A 3U81A 1ZG3A 1ZGJA 1EAMA 2P3QA 2YQZA 2ZSUA 3OU2A 5FWDA 4CTJA 4YV2A 1DUSA 4E32A 4KVZA 2ZULA 2C7OA 1NV9A 2WA1A 3NVKI 4LWPA 1N7IA 5DX8A 2IDJA 2AOXA 2V74B 1AQIA 2AN3A 1XDUA 5DX0A 5CVEA 2WK1A 2DULA 2BR4A 1SKMA 2ZZNA 4PINA 3EVGA 2OO3A 2YR0A 3T7TA 3K0BA 3CVOA 5K03A 3HTXA 3KR9A 3VC1A 4Y30A 2NP6A 3CJQA 1NE2A 4PONA 2C7RA 1R00A 5LR6A 1XDZA 5GIPE 3P8ZA 2CMHA 3P9IA 3PX2A 5D1HA 1RJFA 2CKDA 2ONZA 2ZVJA 3LCUA 3G2MA 1VPTA 3HVJA 2CL5A 3FUWA 1KPHA 3DLIA 3GXOA 3HCCA 2B2CA 2P35A 3S68A 5T67A 3OE5A 3MQ2A 4RSRA 4ER0A 2ZLBA 3FYCA 2LD4A 4KW7A 5HFJA 1M6YA 1ORHA 4HG2A 3VC2A 3UJCA 2GS9A 1KHHA 2CWWA 3KR2A 3M6XA 5EHGA 5EIFA 5DTQA 5DRTA 3SX0A 2UYCA 2ZZMA 4IV8A 10MHA 3NWEA 1AV6A 3BWBA 2IH4A 2PY6A 1EIZA 1KR5A 3R9XB 2I6GA 3GWZA 4QDJA 2PX2A 4LG1A 2GPYA 1NW5A 2P7HA 4QDKA 5FUBA 2AOUA 3HA3A 1R74A 3EPPA 4PYOA 1SVUA 1JG2A 5C9ZA 2CMGA 2P3OA 1IM8A 2PWPA 3KR1A 4QVKA 2ZWAA 2OKCA 5K0BA 3AJDA 5P8WA 2YXLA 3M6UA 3FYDA 4HRAA 5ICCA 2AOWA 5JR3A 3HNRA 1DCTA 2BM8A 5FA8A 1Q0TA 3TLJA 2JH9A 2OZVA 1JTFA 3G89A 4QPPA 3V8VA 3REOA 3SSMA 3I5UA 1NW7A 4M7RA 2PGXA 5DM0A 2GAFA 3MCTA 3NVMB 3A25A 1IXKA 1RJDA 2VDVE 2ZTHA 2O06A 3M4XA 4KDRA 3DTNA 3OFJA 4PCLA 3ORHA 2R6ZA 4GF5A 4EQZA 4RTRA 3DXZA 2UZ4A 3P2IA 4QQKA 2B78A 2FYTA 3GO4A 3G5LA 2ZCJA 2Y1WA 3NDJA 3M70A 5LQKA 4PYMA 2HMYB 3FTFA 3E05A 5HOQA 2PXXA 3UA3A 2O57A 2ZIGA 2G72A 4PYIA 2NYUA 1QAMA 1EJ0A 4FR0A 1G6Q1 1RI5A 3LX6A 4IKPA 4MQ4A 4XCXA 5DSXA 4OQEA 5DX1A 4ZTBA 1R8XA 3UJDA 5DT2A 2P41A 3HCEA 4DCMA 4MWZA 2EG5A 2O07A 5DM4A 3T0IA 4AZVA 3KQTA 2VP3A 3BKXA 5CVJA 3HCAA 1WS6A 3KU1A 2FCAA 3BWCA 4BY9E 3G7UA 1BHJA 3A4TA 2AZTA 1R18A 1I1NA 3LPMA 5GP1A 2XYRA 3PT9A 5LQCA 2ZFUA 3GRVA 3IEIA 2B3TA 5IH3A 5CVVA 2ZW9A 1XVAA 3CCFA 5DXAA 3LBFA 1B42A 3B3JA 4JXJA 4QVGA 5EMMA 1AQJA 1R8YA 3I64A 5EOVA 2QY6A 3FUTA 4IWNA 1FPQA 1QZZA 1TW3A 4YUXA 3DLCA 3JWJA 4GOOD 2YXDA 2Q41A 4RWZA 5DWQA 3KKZA 5CIYA 3GRZA 2FRXA 3HA7A 4H0NA 4Y2HA 1WXXA 3DOUA 2HNKA 2F8LA 3KQSA 3OU7A 5FCDA 1QANA 1G8SA 2H00A 1KIAA 5GWXA 2PXCA 1ZKDA 3EMBA 3ERCA 5HILA 4WXHA 1QYRA 3CJTA 3B3GA 1VL5A 3P97A 2UYOA 1JR4A 3IV6A 4PYKA 4FGZA 1M6EX 2AN4A 1L3CA 2UYHA 3T7RA 3BWMA 1KYWA 5HZMA 2OXTA 5HIKA 1EG2A 1FP1D 1NBIA 3RW9A 3TRKA 7MHTA 3BUSA 2FK7A 2ZZKA 2PSSA 2YX1A 2IBTA 1NKVA 4BLUA 3ELDA 2ADMA 3I58A 4CKBA 3JWHA 1NW3A 4DZRA 5CD1A 2OYRA 2HWKA 2DPMA 5DXJA 5EEGA 1X1CA 2IFTA 1YB2A 1YF3A 4ER5A 2ZBRA 2PX5A 2OPBA 1TW2A 4GC5A 4MHTA 4DMGA 2WA2A 3ELWA 3KQWA 3L8DA 3B89A 3PS9A 4X60A 4C06A 4YV0A 3KQMA 3EEYA 1NW8A 4E31A 1N2XA 3BT7A 4P7KA 4PIPA 4ER3A 3P2KA 3FRHA 5GOZA 1JSZA 1INLA 5E2AA 3GIWA 4P7FA 3TFWA 3AY0A 3UJ7A 2GH1A 3LKZA 4HGYA 2FK8A 4FSXA 3NW9A 3B5IA 1SQFA
chains in the Genus database with same CATH superfamily
3W79A 5KVSA 5BURA 5AM5A 4CL3A 2PRKA 1RCFA 1KBZA 1J42A 3LC1O 3FTCA 2EW2A 4IIVA 4D3DA 4AB1A 3IUBA 4QU0A 5CT6A 1QVAA 4KCGA 1G2IA 7AT1A 1CVIA 3DAOA 4Q4HB 1DQNA 5KTSA 5DISB 4EAAA 1P1CA 3FXAA 3RUCA 1U1FA 1D6JA 1OX4A 1E2IA 1T43A 1WXWA 3OPYI 4MVCA 5AKJA 4ND8B 3U13A 3SSNA 4JYBA 3TRJA 4IOKA 4FMDF 1R0BA 1TM1E 2BE9A 3U7IA 4URWR 2OOSA 1UF9A 2IHUA 3UY4A 3TKYA 4R69A 1S3SA 4BAGA 2OC4A 4D8UA 2WINI 2YHIA 2CV2A 4MJXA 2HJHA 1A2QA 1X87A 2QROA 5TJ9A 5FWXB 4RTMA 4BO1A 3LGAA 3F78A 1NIPA 3C2QA 4RIEA 1P1FA 1QKJA 2FPOA 2GPJA 3RFTA 4QOFA 4JA2A 3IAFA 1GNSA 1AKTA 3E9EA 2XYVA 4J2OA 3ZWYA 3GPLA 2DVMA 1F6BA 4NHEA 3L0BA 1QIHA 2K5UA 4A6DA 4EHAA 5K0EA 3M6WA 3G0IA 4TVSA 4HDOB 4R5HA 1A88A 2OBYA 3JX9A 5HE8A 1MB9A 3V7YA 3WJ1A 1G4UR 4G0OA 5TT1A 1CK4A 1CY1A 2WWWA 5I9LA 5IW8A 5T4EA 2IXDA 1D2NA 2PH5A 4ILKA 5EMNA 4UTOA 3ZWOA 5LQNA 1Q0UA 1JAZA 1Q15A 2HXSA 2BRUA 5CD9A 3IPLA 4HQOA 3TLGA 5IHXA 4ILEA 1ILWA 1NYQA 2CUNA 1DOAA 4GI1A 1JILA 2FEAA 1NWHA 3A1UA 4X61A 2OC9A 4GKJB 1ODKA 4Q4AB 4Y6GB 2FPIB 2OV3A 1B8VA 3S5UA 5C52B 1MJGA 5EZYF 1XTKA 5JJBA 2BWJA 2JGKA 5B1IA 1N0UA 3THRA 3WTCA 1QPGA 2PLAA 2DP4E 4IYJA 3WWZA 2QTBA 5IF3A 3F98A 2Z4TA 4PGGA 4OF4A 4U02A 3WLPA 4LRTB 1UBRS 5EE9A 3T15A 2NGRA 3UCEA 5HBGA 5LSAA 2XVAA 2AQ8A 4EWLA 3WLIA 3TTTA 3TINA 3WWCA 3F5FA 5DJ5A 2FFBA 4XYMA 4KYIB 3T1YB 4WA7A 1SGWA 2G9ZA 3N0WA 2H1VA 4Q3OA 1EUDB 4OA8A 5KNCH 1DRVA 1XWWA 4IYRA 4QT4A 4DS3A 3PPYA 2CCGA 3TB6A 4ETIA 5BWCA 4UVIA 3V4ZA 4GP7A 3RVJA 1YDEA 1XALA 2H65A 1HE5A 2PWAA 1YR2A 1B0PA 3D9QX 1WLYA 2YNMD 4HH3C 1DX6A 3WK4A 4AD8A 3N2KB 3LQQA 1RSZA 3CLVA 3WB9A 5A3RA 4M7WA 2ONJA 5IARA 4LHWA 2RE8A 2GNOA 2VHXA 3D5EA 1Z2NX 4CEHB 2DR3A 3LLSA 4M87A 3MCZA 3EY9A 4L8FA 1JIKA 5AMXA 1CUAA 5FORA 3SIXA 4RULA 1XV5A 3IDQA 3K9GA 3T9AA 1Y3FE 4RZXA 4GOND 3EVEA 3PFNA 3HCFA 5JD5A 4FDAA 3LT2A 3NT2A 4D80A 1OR8A 2OFPA 2YXEA 2P8SA 3G17A 5JNRA 3TSWA 1YI1A 4BNHA 1ZGAA 1SHKA 3AILA 5DSTA 1EWRA 1WZEA 2V1UA 4Q93A 3KPVA 3HLYA 3HVHA 2LPMA 3PXXA 2B99A 5C0OE 1WQ3A 2O52A 1YUNA 1ZYUA 2HRZA 1ZI6A 4K26A 5FAXA 2R47A 3RRNA 3I1IA 3T4XA 3VYVA 1BS9A 2EZ4A 3C74A 1DKNA 1HXHA 1NQAO 1HNNA 1C8VB 5LYYA 3V42A 4EZEA 5B6IA 5ARCA 3RHSA 4BMPB 2JGMA 1U2DA 1MB4A 1CJUC 3F90A 1LZLA 2YWBA 3W5SA 4B3BA 2X0IA 1GSAA 4RTNA 1RZRD 2IU3A 1PDOA 3CNQS 3DMFA 4IOJA 1KY5A 5HRAA 5BV8A 3C4QA 4URZR 3GMDA 1KRWA 5IT0A 2IS4A 1W59A 1NJFA 3EVNA 2R6DA 4A0HA 4CU5A 4INOA 2IPAB 3P71T 3B7PA 5HEKA 1HDGO 3ET5A 4PG8A 4YXWD 1TKAA 4R1MA 4UPEA 4K9RA 4WZBA 2OHVA 3WIVA 1F2TA 4LZLA 2O2SA 2K87A 3ND7A 3FYUB 2JGDA 2VWGA 4LHSA 3BBLA 5DGCA 4JQOA 1XX6A 2O3UA 4EQ6A 4LF7B 3DE6X 3VNBA 3BICA 3EFOA 4E5NA 3NR2A 5ELXA 3OEHA 1OH6A 4OX9Y 2CNDA 3A58B 3NHMA 1X6VA 3V9PA 3LZDA 1MC1A 2QW8A 4NJEA 2BFBA 5DYTA 4GDFA 2QENA 3HXKA 1TQ8A 1FC0A 2OORC 3FVRA 3I53A 4P54A 5E6SB 2ZUEA 2WWXA 1DZIA 1TJNA 4HP8A 2BSXA 1A7UA 1E59A 1UJBA 1ODSA 3S7ZA 3VV2A 4KR0A 1R4ZA 1VXRA 3JARB 4AY2A 3IL2A 4DAOA 1HETA 4IMIB 4WWHA 1UMBB 3P5SA 3IEKA 1KO8A 2WJZB 3W8EA 1PBTA 3AGPA 1XTPA 1UJ4A 4BNGA 2XZLA 3WIEA 1Q19A 4YALA 2X8BA 2EYUA 2HC9A 4YI5A 1E5VA 1LX6A 3ESCA 1Z36A 3RTAA 5T8KC 4NEQA 4KDEA 4UU8A 4IEIA 1N2CA 4KXNA 3OPVA 3V4OA 2H08A 4LRQA 4Q48A 5DNVA 5JALA 1YRLA 3C3DA 5JDCC 1NUQA 1QGED 1XZJA 2I1LA 2QTZA 2O1EA 2Z8XA 2E48A 1KJIA 3FMGA 1QHFA 5E3JA 1WMSA 2BFNA 2RBKA 3EIHA 2BMVA 2H59A 3NANA 2X14A 1FDVA 1ZVMA 3T1HB 3SHOA 3CB2A 2JL1A 2PMBA 1RU3A 3H2GA 4GMKA 1KWGA 1UWKA 5CM8B 4AURA 4A23A 5TIIA 1DEOA 2G67A 2X13A 1JLSA 4Z7JA 2R87A 4TXJA 4HX9A 4LQCA 4DV3B 4PQYA 3NAZA 4XEHA 1GQYA 4NBSA 4F60A 5A7HA 2XGGA 4HI0E 1R66A 3ZI0A 3HA2A 2OXFA 4Q3KA 3SBXA 1JB9A 3ZUPA 4E12A 1Y1QA 5A3JA 2NO4A 2HBRA 3O0TA 4YYZA 4IKOA 2HMVA 3FZNA 4X94A 3B48A 4F86A 2X6TA 3QLUA 4OQFA 5H9VA 4C6RA 2FWPA 2XMZA 1QPBA 3ZZ1A 3RS5A 4HC4A 2GRAA 1ATIA 1EVLA 1RC0A 4TSRA 5F73A 5LA6F 4AQ7A 3VPAA 1X80A 4DY6A 5JSKA 1R27A 1F2UA 4NQZA 2M6KA 1RHKA 3ZI7A 2GLXA 2XUAA 2F67A 2P30A 4JBXA 4OL9A 1AU9A 1UM8A 3G8BA 2XUFA 1GL7A 2GZ2A 1JEQA 2O1WA 4MCIA 4ODIA 5DTRA 1ZOLA 2BIFA 3DDZX 2FV8A 4MGKR 5LA6A 4BDTA 5AK6A 2Y0EA 3HUEA 4RTOA 1L8XA 1G3UA 4R2MA 2C00A 4Y9SA 3N75A 3OJ0A 3R0XA 3VPGA 2QRNA 1M1ZA 1TLTA 2VNAA 2RB4A 3DC7A 3PFGA 3PNQA 5JPIA 1O6ZA 3R9KA 3SPXA 3CCBA 2HA0A 1KOJA 4DE5A 1SHJA 1Z6GA 3EIOA 1TQ6A 1ISJA 1WP9A 1OTYA 4EEXA 1GTG1 4NBKA 4RF4A 5JMPA 5EJ5A 1AKVA 1Z3IX 1Q77A 2PS9A 3T7IA 2JFXA 3N70A 3AH8A 3HADA 3BRSA 4WKCA 1BH6A 1SRQA 4JKYA 2JJ1D 3VA7A 1PSDA 2P0YA 2R8YA 1P2TA 4FHCA 4KBFA 5CB0A 2LUOA 4NCAA 1C0EA 1J70A 2N3ZA 2NLOA 4F8JA 4ZIRA 1CS4C 2GBLC 5ALPA 4NG4A 1P7CA 1W0CA 2F4NA 3DF9A 2B2XA 3JXEA 1GYPA 4EO9A 3GW8A 2Q4OA 1XJ0A 4KDFA 4R1LA 3GV0A 1OGJA 4X3OA 1P7WA 3RRJA 4EJSA 2RGRA 2PT9A 3B12A 4K6MA 5K3SA 4W6QA 2O5EA 3ADPA 2G5CA 4RO0A 1XL0A 2OHOA 3NEJA 4OMFG 4JR2A 1R4MB 3T3GA 3PUWA 1YC2A 3NHRA 1Q2XA 2JFNA 1VJ1A 2BJWA 1ML4A 1JQKA 2Q1UA 3UT5A 4ASUA 4JYZA 3NZEA 3A1WA 4M0LA 3WLSA 3BHIA 3RH0A 3O8NA 4E5VA 3HNPA 2RFLA 3SYKA 4YV2A 4FN4A 4Q9IA 5I3CA 3GEIA 2RIRA 2YC4C 3EUEA 1NNUA 1CUXA 1NI4A 1W6RA 3GEDA 3AF3A 2EBWA 1Q3TA 4JWKA 4UEJA 1CQJA 1ZJYA 3BD6A 3JWEA 1MR3F 3OE1A 1X9HA 3C16C 5H82A 1R9JA 4F2PA 2HREA 1L8OA 2HT1A 2Y0CA 3ZV4A 2NADA 2YHIB 3HGTA 1R00A 4RKWA 1GDTA 4Q34A 2P9HA 2CMHA 5CYGA 1UINA 2E49A 5TMDA 5TS3A 1LW7A 1U9IC 1ZEMA 5AVKA 4FSHA 2H4ZA 1RP1A 3HPRA 3S28A 2WWRA 2B34A 2CL5A 3DA8A 3FPCA 1KPHA 2DQSA 5EG5A 4FIDA 3KZCA 3Q12A 4RSRA 4J2HA 1V1JA 1H8EA 3KBOA 2R6GA 3GX1A 5SZKB 4DBLC 2ACKA 3M6XA 2OSVA 4Q82A 3CUEF 1YMQA 2PUHA 1MX1A 3IAM1 4Q18A 4QBHA 3N0TA 4GPAA 3RWOA 1ZOIA 3DCNA 3QYJA 4RSMA 2RHTA 1ISHA 2P0AA 1NW5A 1NJ2A 5TMEA 2GPWA 3WK5A 4CIVA 5KTYA 4HRYA 4B4VA 4BFZA 4YCSA 1GT91 4OJTA 3VZQA 4HV4A 1T2VA 2WNIA 2BP7A 1Z0DA 5LUAA 4GAEA 2YZMA 1G291 3AUTA 1YH3A 1ZZEA 3UENA 8ATCA 4DLBA 5FI0B 3FDFA 3R7DA 2Z2XA 1VPLA 2HZBA 4GP9A 1PI3A 1VKJA 3I4CA 4TXMA 5BYBA 3L3BA 4A1FA 4D82A 3VKGA 1MXHA 4G8CA 3OPQA 1PO7A 4WOKA 4M7RA 3NVDA 5DM0A 1NXWA 4FTWA 1N34B 1UM9B 2HPZA 4WY8A 3M4XA 3N8DA 4RLQA 3BMXA 2WIBA 3KB8A 2YXPX 2NZVG 1QDUA 4ZRMA 3RV3A 3T4EA 3NHSA 2WYUA 1H3EA 3M2PA 3HEAA 1ONPA 4QAQA 1RBYA 1U2QA 3Q7IA 4JGIA 1BE0A 1HLDA 4RK5A 3HK2A 2HH9A 1WXGA 2XQFA 1R64A 3GF4A 1D2EA 5KYYB 2I6TA 3N87A 2C2XA 3FAZA 2HD4A 1IULA 1L5HB 2FOLA 4NNJA 4TRMA 1LLUA 1PL8A 2EG5A 2O07A 5K3AA 3BKXA 1TQDA 2M1XA 3B7GA 1CKEA 4IW3B 2NUPB 4YRZA 5HKBA 2PYZA 2CXPA 4YRDA 4LNUA 2C3YA 1QQ7A 3EG5A 5GP1A 2XYRA 2YHUA 3PT9A 4GXRA 3RJ9A 3LYUA 5JYBA 3CMMA 4URUR 4URFA 3S2YA 4FDLA 5DBFA 1UWCA 4C5BA 1N7GA 4UBLA 4ITUA 4EG1A 2VF4X 3VU3A 3FF1A 4BAZA 4ZGGA 1IAQA 1AQUA 1AGNA 4BB0A 3RBXA 1RPAA 3GQBA 5KWVA 1X7ZA 2ZJ1A 3FOWA 2OHGA 4M6WA 2FFAA 4UFNA 4MV9A 3F3MA 4XIFA 3FCUB 5J4HA 3ZLJA 2JGRA 2ZBGA 5EWLA 2CD9A 2GZAA 3H11B 4RCYA 3UAOA 4NBTA 2DEUA 3NBAA 1EX6A 2Y3IA 3WQRA 3HA7A 4H0NA 1G7CA 4S05A 2ZIWB 1JAHA 4W1RA 5JCXA 4D02A 3USCS 1Y4DE 1TVEA 1NRWA 4WXHA 1UPBA 4YH1A 3QJYA 1H4TA 5EQTA 2HDHA 4BLPA 3DTTA 4CKYA 1I6WA 1NONA 2FWBA 4WW0A 1V1RA 2V4UA 3F0TA 4QODA 4P5DA 4ZOLA 1OFIA 2X1MA 2XKKA 3DL7A 3OOSA 3A6PC 1RAGA 2FK7A 2X8AA 1NVBA 3U3KA 2XDYA 2JBWA 2YX1A 3DBLA 3ORSA 1YVPA 3RGGA 1Q7BA 2MIIA 4WZBB 3PNLA 4PY2A 4N7RA 1F2TB 1B1AA 4IQ8A 2ZYHA 3SDBA 1IONA 1KIFA 2HWKA 3WFZA 2ZRBA 3NRCA 3CQ9A 2B8TA 2QX4A 3PC6A 3BGWA 1QKIA 4LKRA 1TW2A 3EFOB 2ZT7A 3JQFC 3C3MA 2JGLA 5SZIA 3U6KA 1ZI9A 4J6EA 4GX1A 3EAGA 2X23A 1UJCA 4M1YA 3BL8A 4L6AA 2D0OB 3D6UA 1LSOA 1NBMD 4Q3AA 2HV8A 4D41A 3MELA 3B2EA 2WICA 4QJ4A 4DLKA 5HWSA 1B8PA 2DHQA 3DAFA 4ID3A 4JOQA 1HR0B 1W4RA 2VVTA 1GADO 3GIWA 4DSUA 3QX9A 4HN4B 4NDAA 3RTCA 5JNSA 4U2CA 1KK1A 1BW9A 1TTHA 2H17A 3CG4A 3HRHA 4BMDA 1OLOA 3P0FA 4XLZA 3CNBA 2R7NA 1RR6A 2ZEJA 4OHBA 3K0SA 3PRYA 2IGBA 2AEJA 4YECA 1NHWA 1O95A 4MUKA 3NHUA 1YZ3A 3ED1A 5DMHA 4Z9BA 4IQ0A 4MQUA 4DCNA 4M8IA 5LL6P 4KR6A 4CT4B 3VZCA 3CUSA 1E96A 3ICEA 3ANXA 1YIOA 1RRVA 2L42A 1UK8A 5ER9A 3QBEA 2J5KA 2XUJA 1EU1A 4AI6A 5FWNA 2IEAA 1N0VC 3GJXC 3KKEA 4A8HA 4MGHA 5B7NA 1AA9A 2Z83A 3W2EA 1Y81A 1PFGA 1PWXA 4MGZR 1OZGA 2FEXA 2IZ6A 2QTRA 1Z0UA 5EYPB 5J2TA 1K98A 3OCJA 4F93B 5F7ZA 1GGEA 3ZJ5A 4L16A 5DM60 4MV7A 2SICE 2HOQA 3QVGA 4R2KA 4EY8A 3DZKA 3D0OA 2QBYB 1CUBA 1WQ1R 3TCXB 3WJAA 4QTUB 5IK2D 2HYIC 1O97C 1I2AA 2EBHX 2QJRA 3NPMA 2GASA 4KRGA 4EY6A 5MFPA 1EJ2A 2OGTA 3MFQA 4LYEA 1G21E 4K88A 5JZ9A 1QZUA 1WUKS 3GDOA 4Q7KA 5C1IA 2CLIB 4L07A 2O0KA 1ENOA 3LDGA 1F2UB 1GLGA 2IYFA 2Q7XA 3WL3A 4CN9A 1HZZC 4ZI7F 5KHOC 4D9MA 2KE5A 4ZAXA 3IEMA 4KO1S 5CDSA 1G16A 4AJLA 3HDHA 3CWZA 1C3EA 4XUDA 3UQYS 3LQYA 5B36A 1GUZA 3AHDA 5HF8A 5EJIA 4KTVE 1GCOA 2IHZA 3FAKA 1B15A 3B1JA 1ULUA 2A0UA 2QHXA 3BHJA 3IVRA 5JVDA 4OXIA 2I9KA 2B1RA 3D3JA 1NUAA 3G02A 2D0IA 2H31A 1SC4A 2X3UA 4IM7A 2OWDA 4IGKA 3T1OA 2QQEA 5I4IA 1PDWA 4P84A 2BKUA 4NSNA 4K6KA 4CIAA 1SJ9A 3FOFC 4GECA 4XFKA 1G5PA 4IRUB 3ZWCA 4BFLA 4Y0VA 1D2GA 1J06A 2QQFA 2Z0MA 4X20A 4AMGA 4GM1A 1GZUA 1IWOA 1XHFA 2V5UA 3K1JA 4G26A 4KWHA 2A8YA 3TLXA 3TZEA 4BQPA 4D74A 2GJSA 3ROKA 2FX5A 1IPFA 1Y7TA 3F6BX 3QUBA 2OLEA 3WKEA 2VYFA 2YV4A 4M9RA 3O1HB 2DWOA 3O26A 3UM9A 3AUYA 1P4RA 1V6AA 2QIOA 3BA1A 4EJSB 4EJ2A 1PFWA 3CC8A 1E9SA 1BGWA 1DIAA 1TYAE 1UEIA 3D7MA 5K8LA 3NHJA 1JPUA 3SZMA 4TKUB 4AF8A 1IQPA 1VFPA 4DSAA 1ISIA 4LYYA 1E69A 5JD6A 5M5BA 4RJJA 3TSAA 4DCPA 2CNWD 1NF2A 2CT8A 1FSZA 3F4LA 2O59A 1IXRC 1C41A 1OX6A 3WV5A 3DZCA 5A9SA 5KHLB 1S3FA 3DQQA 3NXKA 1K66A 1PFKA 3WSTA 3VOTA 1Y6GA 3AV0B 4FKBA 1FRZA 3UC9A 1KEZA 4CCWA 3N3AC 1XBTA 6ABPA 4GS5A 1Y5MA 2LCIA 5J63A 1L3IA 4G1UC 1L4UA 3ZK9A 2XE4A 3JYNA 5GM2A 2LIPA 4LHVA 4P4TA 1BYUA 4P2GA 1C30B 1OPRA 4JJGA 2ZB8A 2KW5A 1DFIA 1E1RA 2YRFA 2R1TB 3O3MB 4FYJA 3HWX1 4FYXA 4G65A 4TRNA 4LFCB 1IZZA 3OOJA 2AG6A 1Q1BA 2PVCA 3QI7A 1MO5A 4TOIA 3EVAA 1GRRA 4QA9A 2ECQA 2A7XA 3B52X 2WJVA 3TLMA 3CY6A 5EJGA 3BH6A 2B69A 4OHPA 2F2TA 3PWKA 5EPEA 2IYLD 1O8BA 5G4LA 3CXUA 4M22A 4UJ3A 5EJEA 2OQVA 1XZHA 4LF5B 4QNNA 1LX7A 4MUFA 2SKCA 5JSHA 4A8PA 5LMUB 4Y6SA 4XUCA 1QNFA 3HRIA 1NVAA 4C0XA 3WLHA 4IMRA 1NT4A 1VGQA 2I78A 2HJ9A 5DHTA 2QE7D 3HACA 4EVQA 4RHXA 2QE6A 1BEZA 4WCDA 2DBRA 4RLHA 5DNYB 1DHTA 1ADJA 2CGEA 3RUIA 3TQIA 2C7BA 3SBOA 1R5BA 1A04A 2HSDA 1B2LA 4FFLA 1GQQA 2BP7B 3RGWS 4R40A 2VEOA 2V0CA 1A8QA 1JKFA 3QYFA 1JR2A 5FTLA 3DEKA 1MOQA 3L5OA 3L9XA 1CT9A 3P9CA 2PQ6A 3HGQA 1V7ZA 1HE2A 3BA6A 1G1MA 1LLCA 2DUNA 3C24A 3FCEA 2O5CA 2ZTUA 4EUFA 4B74A 2VJMA 1DGQA 1NX9A 1Y6JA 1FFHA 3D2BA 3ECSA 4JI8B 3MTEA 2P9ZA 2KWIA 4DV2B 2ZROA 3ETHA 3VVCA 1U1IA 3E5NA 1YFJA 4I1OA 3OPYB 3CISA 2IXEA 1U5BA 2VHWA 3HJGA 3GH3A 3IKLA 4KNVA 5DGHA 5K4AA 4EDHA 4GBJA 4YPVA 1EK6A 2GAIA 1YR6A 3I83A 1GYRA 2XUQA 3AP1A 2WU3A 1MZPA 2EKPA 5FV7A 1SXJC 4HX5A 3WGYA 1ULHA 3DBVO 1CJSA 3P7MA 1H2FA 4H7DA 1E1QA 2XY4A 1S2MA 4E4RA 2AE2A 2L69A 2P67A 3CEHA 3ROPA 2RARA 4C1NA 1SU6A 3E15A 1KYTA 3VI4B 5E9QA 1F4VA 3ZW7A 5FOUA 1WY7A 4ZZIA 5L4SA 4EI8A 2CHUA 3R9WA 3TLEA 4CMAA 4AMUA 2X0RA 4BO5A 1BD3A 2PKXA 3R0QA 5F64A 3SXUB 1TYCA 4WOCA 4M99A 3COZA 2Y1EA 3NIGB 5C4GB 6REQB 1NXTA 4DMKA 4DJTA 1QTRA 3SWWA 1XJCA 1XPRA 4C6HA 3IT2A 1ZR4A 4J1QA 4INAA 4PGMA 4V0QA 1YQEA 2GEKA 2QDKA 1JAYA 1NUTA 3A04A 4XYGA 1BWSA 1NF9A 1JKMA 4W4TA 1KP2A 1I1QB 1ZRSA 3DNFA 3GQBB 5HW0A 3QU7A 2WTMA 5AJYA 3B9BA 3EQ8A 4IG4A 1KS9A 3H2IA 4ZOAA 2P2CA 1F1JA 3QXGA 3K5IA 1I32A 3I5AA 3PLRA 2EHJA 1CUEA 4OFWA 1E1NA 4M38A 5AI9A 5EWLB 4J94A 4OQQA 3KQPA 1ISGA 1XTJA 5TPWB 2XOXA 4HPJB 3ZXUB 1G9XA 2VZ9A 4XEUA 4BO2A 4MWDA 3W2FA 4DHEA 2YWFA 1X1DA 3C45A 4GQBA 5E2IA 2H4WA 5C1DA 4PTYA 4N41A 3VI3B 4IVPA 5JSZA 2KLHA 1X94A 2ATEA 1XWFA 4G5SA 1UKCA 3W4JA 3C1AA 4DQUA 3PFWO 1V1RB 4OG2A 2GTPA 4ZQGA 1KSGA 1FBNA 1P2VA 1YQDA 4X5OA 2IYYA 2YWRA 1C9MA 2GEJA 3M5PA 2NNLD 3MF4A 3NHZA 2JATA 3R40A 3GT3A 3NG1A 2ZRGA 1YULA 4YMWA 2FHSA 1RWBA 3NM4A 3OQHA 1RYHA 4BNDA 2P40A 4IP0A 4IDPA 5I8PA 2QT9A 4S1WA 2NN3C 4P4SB 1V39A 2ZSIA 3VHLB 1QQTA 1PV2A 2HRBA 3ELUA 3G59A 1ESNA 1JDBB 3SM3A 3BHMA 3ST7A 2XEDA 1RAAA 1VSVA 2QV7A 1BU8A 1GGJA 3F5MA 4EARA 1M66A 3W5AA 1JKXA 3SZUA 3B5JA 4QXRA 4U0JA 1H1TA 3S6JA 5CG1A 3MG9A 4PC2A 3Q3EA 4HFNA 2ZG6A 4PR0A 5FEMA 5K0FA 2Q21A 2ETVA 2QN8A 3HUDA 2VNSA 3ILXA 1QK5A 1EK1A 2Q6IA 4A8JB 5K0CA 1NY6A 4RMIA 2W8BA 1VE1A 3I6QA 4QNMA 1T35A 2R8PA 2RGUA 3BM5A 1Z07A 2CLDX 1S3GA 2WSSD 4GLLA 3O38A 2HLHA 2FR1A 3L40A 5CNJA 3LUBA 4BZXA 1FU4A 3T3IA 3LRTA 4BBZA 7REQB 3HXQA 2GYVA 1CG6A 4ZVSA 2J3IA 3V3TA 1JFVA 4DLZA 4KOAA 4BZPA 2JHFA 4U7PB 3GT0A 4UJ5A 2J0UA 1A8PA 2IZ1A 3GQVA 1KKMA 3JS5A 1RAFA 4FYKA 4HWKA 2MMCA 3LUGA 5FOXA 5TNXA 2D3WA 4KQEA 5TVKA 1KQNA 3SYMA 3LOPA 3NEPX 4F9EA 4DR4B 5H0IA 1M1YB 4B4WA 1AQIA 4FNOA 1RADA 1N8NA 3HKDA 5LZ2A 2X9VA 3Q85A 3MJSA 2BCJQ 4TV8B 2CL0X 5LJLA 1DQPA 4BYGA 2AX4A 3Q9UA 3RARA 3NFYA 3EDMA 3U56A 1H4QA 5J2TB 4PPQA 4OHWA 4R83A 2QVZX 1FFEA 1H2RS 1P3JA 3PUVA 4RHCA 4G2NA 4PLVA 2ZM5A 2Y4NA 5SZJA 3FHLA 4ROTA 2PTGA 1HLFA 1JTVA 1UPUA 4FI3C 1GZDA 1IBCA 1QC5B 1V16A 2Z98A 3IUYA 4KRFA 3NP7A 3LCUA 1P7VA 3G2MA 3OQVA 5JFTA 5FUVA 2HQRA 1A8IA 5THKA 2CNKA 1G9TA 1KAEA 1OAKA 3G1UA 2ZPUA 1TYZA 5ALKA 4DMLA 2VJDA 4REQA 1OWPA 2AWNA 2JRCA 3KSBC 4CFZA 1QP7A 5TSDA 3MGCA 3X2EA 2QJOA 1A72A 1ADGA 4GW3A 5BV7A 1NAHA 5B2EA 4RBNA 2UZ1A 1JBQA 3T5CA 2BZ0A 3NAQA 3NWEA 1EGAA 3QKSA 1FVXA 2GX6A 4F9TA 3KM0A 2XNJA 3I4FA 2WIJA 1UDXA 3FNRA 4MZXA 4OFZA 1S1CA 3MS4A 2LDXA 4K0KB 2VP4A 4PSAA 3UJPA 1NATA 1JECA 1D4FA 4C5AA 1SVUA 1UPTA 4JGBA 3TDNA 5JVDB 5AM4A 4JIGA 4BZWA 3PF9A 2DPXA 1EYZA 1WKBA 2ARKA 4J1TC 3I5YA 4A26A 4IXMA 1EH5A 4EP1A 4IEFB 4CLRB 4EFLA 4YY3B 4I55A 5E4TA 1G8HA 5BT8A 3CG0A 3S55A 1QG0A 4CL2A 2A58A 1R88A 4PLPA 1Z2AA 3KYCB 1QS0A 3DV2A 2V7QD 5JHHB 3AR4A 4X20B 4BB6A 3SSMA 4K81B 3KQUA 5ABPA 3LP5A 1MGOA 3FB1A 3A25A 1IXKA 3AJ8A 4CLOA 4OUDA 5CURA 5LZ5A 3SP1A 3OFJA 3HWWA 4AJJA 5A5VA 4QQKA 3PEUA 3PIIA 4AVYA 5ENZA 3PXEA 1CR1A 2EBUA 4MR7A 2R1ZA 3FTFA 1A9SA 5JS6A 2C2OA 2EX1A 4Z4QA 4X84A 5GZ6A 2IYAA 2XMQA 4GM4A 1B2RA 1UT5A 3P4XA 4DQDA 1C1DA 1QKKA 1THTA 3A9RA 1GTL1 4WXYB 1M10A 2ZIXA 3C7TA 3HV2A 4NH4A 2P41A 3CZRA 3KT6A 3ESRA 3TEFA 1F8XA 4XYLA 2ZB3A 1E2PA 4DVJA 3N8HA 5KYXA 2A4KA 1PDVA 3LPNA 2CZCA 4UBIA 2ZSAA 2P6RA 2C2WA 4DL9A 4BY9E 1R16A 1R0KA 3GFGA 4RFLA 4B7AA 5CXSA 3L8ZA 5HPYB 5IEBA 4PXSA 2Z5GA 2OV2A 5HJEA 2OXRA 1R6XA 3LPCA 3KVNA 1ZVVA 1HNXB 3QEAZ 4D9JA 3QM1A 3GLKA 4TYPA 2O5VA 3KJEA 3KL4A 4V3BA 3LC0A 3E1SA 1RM0A 1A7JA 1NSFA 3L6CA 3N07A 5F4BA 1Z4OA 4TWRA 3TEMA 5IM5A 1DJQA 2GXAA 1OCEA 3L1JA 4YRIA 4MITA 4D9NA 1KO7A 1EBUA 1DE0A 1WXXA 2FE4A 1OZAA 3KQSA 3O92A 4PNHA 1IFXA 4PS0A 4RVOA 2Z57A 4F96A 1DJMA 2ADFA 2G9UA 1J1IA 1DMSA 2I3AA 2XI4A 3ERCA 3UAVA 3M81A 1OH7A 2VYQA 3NOOA 1OFUA 3VKVA 1XB2A 1U6IA 1FNMA 1G3IA 4PC6A 5JV5A 3RYHA 5IS2A 5DOZA 3IV6A 3K5HA 2XSZA 2YFQA 4O2LA 4Y1EA 4YYEA 2QRZA 1SC1A 3H9JA 3BWMA 2NZJA 4L5YA 3U9TA 2BMAA 4L57A 5HZMA 3R3JA 1K5DA 2AFRA 2W0SA 4MCAA 1T9AA 1CXZA 2R8ZA 5HE9A 2XNKA 4TQGA 1QQBA 2PZAA 4FBMA 1VA4A 3ELDA 2A1TR 2CFSA 3JWHA 4MKFA 2B4YA 4ZDJA 4WDRA 1KORA 1D04A 2XA2A 3TUZC 4GIBA 4O5OA 3VTFA 2QRLA 1XN1A 2ZUWA 2JLRA 5ARDA 1W29A 3HUTA 4OI4A 2CV0A 3AHFA 2XT6A 4PGAA 1MABA 3PX7A 4MHTA 4NFLA 3RLFA 4NS4A 4XWAA 3L8DA 4KHPB 3PQ6A 3TRDA 3ZQKA 2JGJA 2GZMA 1YQXA 1K27A 3ZIDA 5HF5A 4M53A 2F3PA 3WMRA 5TGDA 3T7EA 4KGDA 1MN6A 2VXBA 2XUPA 3E81A 4JP5A 4MQEA 1JSZA 2GK7A 5AO9A 5L7YA 1OD6A 3AY0A 1CR6A 4FNMA 3WZ2A 2A7QA 4L6IA 5C1BA 3T5GA 3R4VA 4X66B 6CHYA 1YQTA 1HF3A 4KUHA 3ZNOA 2NTNA 1CETA 3GRCA 3O8RA 1PFVA 4HYQA 2YY7A 1XE3A 4JA0A 1D5CA 4EL0A 5G1PA 2NZ2A 1FU8A 2ACWA 2C4TA 1UFKA 5AJXA 2BDUA 1NLMA 4CM5A 3CW9A 1VQ1A 4BXOB 1Y9DA 2FZWA 4YRTA 4CF7A 4S04A 3G2OA 1YONA 2HU2A 5KNDD 2RHJA 2IY7A 4M1QA 4YT8A 9LDTA 1HDRA 1DC6A 1Q20A 1TM2A 3EGOA 3G8DA 3BULA 3P20A 3TZHA 4LF4B 1CUHA 3N8IA 1OB5A 3UVEA 4CTMA 5HR5A 3HO6A 4W6ZA 5IANA 4EZBA 4K6FA 2G1UA 3OIYA 2JKVA 2VYND 4CM4A 4FFWA 4GR9A 3R3SA 2I4TA 2XBUA 5B2ZA 1CERA 5CVUA 3RWMB 4AYWA 4HGQA 1KZYC 3K94A 5AKKA 4HBGA 2B1GA 3CBGA 2FSIA 1RI1A 1MDFA 3ND8A 4US1R 5JO0A 1ZL0A 3HH8A 1W8IA 3PI7A 2PSDA 2YW9A 4QGFA 3CONA 4BGVA 4CG2A 4O2AB 1T4CB 4MWTA 2BISA 1SHTX 1Z5GA 2W5UA 4CMHA 5A9RA 2G4LA 1MEOA 1Z38A 1Z6XA 3FNEA 1EEHA 3OX4A 4OXNA 5INTA 1E2FA 5K8IA 2WZDA 2O05A 2PH1A 5ADUS 1SQGA 2JD2A 5JSZB 5BW8A 1FTGA 1U3TA 5TLSA 1E7SA 1MJFA 2AZMA 3G88A 3K7EA 4RM2A 4YWHA 4WXMA 4XXHA 5JNTA 2N47A 2R68A 3VDNB 3QWFA 4JBIA 4KPGA 1VIYA 2BV3A 4QDZA 3GFRA 3ED5A 4DW8A 4XJXA 3COSA 2BD0A 3QKTA 4PG6A 5ALIA 3GLUA 3PEWA 3ZD6A 5ALQA 1T24A 4ZT2A 4C6SA 4PAWA 2OCDA 3LYAA 3IR7A 4LC0A 5AI8A 4MVJD 3SKXA 3U37A 2ZWVA 2VJLA 3BILA 3EARA 4N3NA 3NFRA 4XPIB 4ZVQA 3H6GA 5U1PA 4RNCA 1BXRA 2NOAA 4LZJA 2W2LA 4ZVUA 1ZD4A 2OY0A 1E3QA 2J9RA 3DBHA 3KAPA 2HMAA 2IY8A 1ZLYA 4KLNA 2DTEA 1A9RA 2PKWA 4XPZA 3FB4A 3ICOA 1DBSA 4MYRA 5IZCA 1DZ3A 3FFXA 4BCCA 2DETA 1PHPA 4OB7A 3HCRA 5KX5A 3K31A 1DFHA 5EP1A 1HA3A 3IOMA 1V11A 2I8LA 4CV3A 1AUPA 4BWYA 4N54A 4M86A 4DHWA 4I14A 4Q9KA 1GKUB 3FPSA 3K0FB 2ZUFA 4JLWA 2AKYA 5AFSA 3ZTWA 3M3HA 3L0IB 3KKNA 1WUJS 1GTJ1 1UFOA 3I1YA 4Y6OA 1U2GA 2QMOA 3KWMA 2CLFB 1DAKA 2C9DA 1CULC 3O75A 4HQ6A 4Y6PA 3NTVA 3NH9A 1U1CA 1IQ0A 1X39A 2Z04A 5A4FS 4Z9YA 2C4NA 4OIMA 4DG8A 2V6MA 3QLVC 5HIMA 4BCDA 1ZM7A 2Q28A 4U6NA 1GPLA 3CHYA 3HKDB 5HJ2A 3RJ5A 3CTPA 2NVUA 1EVYA 2JK0A 2P6UA 4G0ZA 1BWQA 4ZCMA 2ID7A 3G85A 1MU0A 3K3PA 4IEEA 2APJA 3BKWA 5JEDA 4OUKX 4P3XA 4GXNA 3EDCA 3QV1A 4QXQA 5J5AA 1M1UA 4FNAA 3W5JA 1PTKA 2HX1A 2PSHA 4LZZA 4OEHA 5F2EA 3SZOA 5IFLA 3GH1A 5KTRA 3WGUA 3B9RA 3OTHA 3QXJA 1RC8A 2X7JA 5BOSA 2G5PA 4GFDA 4PYQA 2Q9CA 3IV9A 4NTZA 4NV3A 5K01A 2JLWA 2R62A 3AP3A 4AJ1A 1C8KA 3STUA 4UASA 2QTWB 2ZGVA 3BK2A 1WUTA 5TQ0A 3VKUA 3S40A 1TEZA 3SBEA 4JJEA 3ANNA 3KT8A 3KR0A 1NBHA 1FVOA 3K9LA 3WXBA 1J4AA 2D00A 2TMGA 4BO9A 2RI6A 3PGVA 3UK1A 5JAHA 1QV7A 5JXIA 1YJXA 3QKSB 4PICA 1UDRA 3HJAA 3CH5A 3QUCA 5DLDA 4Y9RA 1C2TA 1KHTA 4ZOBA 4IDOA 3R1IA 3DH0A 3J81k 5HYVA 1XG5A 3NOVA 3R0ZA 4ML3A 7MDHA 3KTDA 3THWA 3O21A 1EFUA 3RREA 2AFHE 2OECA 3IB3A 5ICEA 5KU7A 1PK9A 3S2ZA 3SEFA 1Q44A 4WJLA 3QIVA 4MI3A 1BQ3A 1ENPA 5JS8A 2QPLA 1XFAA 4JL5A 1C3VA 2WDPA 1Q2UA 2BZSA 2NXJA 3P9XA 4JLVA 3U0BA 5CT4A 5ALVA 1VHJA 3GLGA 2ZBPA 2JI8A 4RVDA 5ICGA 5T4FA 1TFRA 4C78A 4IJQA 3ICCA 2B1QA 1T36A 2PBLA 3CEJA 1HY3A 2R7MA 4MP8A 2HPHA 1PZFA 1J20A 1ZESA 2GPSA 4OGGA 2NZXA 4YLEA 2C3OA 4ZT6A 4EPXA 4Z2AA 4ZCTA 3O2NA 4OUDB 3LKDA 1JB1A 5AW7A 4RD3A 2WVHA 4KSYA 2F4VB 1IHPA 2ZIAA 4R9UC 1E6CA 1KNQA 3LMKA 4MR7B 3G5MA 1XRNA 2JFUA 2VJNA 3N3BC 2AV6A 3OJLA 1J8FA 4N03A 3D8SA 3U49A 5LWQA 3N86A 1SH7A 4UTRA 3LL7A 2GAOA 3P5BA 1C1DB 1NDQA 4O25A 3H1EA 1UBEA 3EGXB 3FLAA 3K1TA 2ZIXB 5DNAA 4C29A 2N75A 4EKYA 3Q4GA 1U0BB 2QZZA 3DL2A 3EIWA 3PNVA 4CQMA 4DXDA 3D4OA 4ZV7A 3K0CA 1YJ8A 2WF7A 3KHUA 2W2KA 3L4SO 4W1SA 3FWNA 1OIWA 1IQUA 4EVRA 1RD4A 4CXMA 1P2BA 1MRNA 3BF8A 2HSWA 2RHMA 2CXHA 2ZSKA 1O87A 5FDFA 5J4KA 4Z3OA 1HT2E 1EUQA 4WBXC 1H9BA 3I9V1 2XGOA 1X38A 1KU0A 1J8QA 2COKA 1TU3A 2G1JA 3EE6A 3N1UA 1V9LA 1DBVO 4JBYA 4MAMA 4TRRA 4YGXB 3S1AB 3D4BA 2GAJA 3LDAA 1XZKA 1E1MA 2WG2A 4S2UA 4F5ZA 4C08A 1ID1A 1W6UA 2G4CA 2PRIA 2RGDA 1P2SA 1VOTA 4FQ7A 4HLDA 4GH5A 3CUTA 3KXDA 3UK7A 2W6PA 3KJQA 3ET4A 3TQQA 3WOVA 4WESB 3NU1A 4IHQA 4AX8A 4D8WA 1BXZA 2ZSDA 5ITZA 1ESZA 4MSUA 5D3ZA 5CAEB 2OG1A 3LPAA 1MO3A 4MS3A 1YNSA 2GFQA 2QAJA 1J2UA 3QA3E 4H4DA 4MYSA 5KYVA 3FNGA 3VBEA 2IIPA 4DA4A 4KVGA 5HGJA 2DWUA 5IVIA 1UZAA 3RYHB 3AEYA 2FQ1A 5EHXA 4ZMSA 4YUAA 3LY7A 4Q00A 4K5QA 2R85A 2RAVA 3QV2A 1LPBB 4C3UA 3DD5A 5LLDA 4KWTA 3WBFA 3R3UA 3LF2A 4FYVA 4LZOA 3TQCA 1QU3A 3AU9A 3HBMA 1NXXA 2JI9A 4MAFA 4TTJA 5AVZA 5FBKA 1RXVA 3NEYA 5DHQA 1QFXA 2CL6X 4X7MA 3VDRA 1Q1QA 2FLWA 3JAKA 1YRHA 3NETA 2V9PA 1U5CA 1VJGA 4E5YA 1GPMA 1T4MA 2JGFA 3EEIA 1GZ3A 4F1WA 2CC2A 2JLYA 3S8EA 2B25A 3A26A 5DYNA 4MQMA 2ZXUA 3EISA 4NZ9A 4QREA 3LVFO 1LF5A 2VPQA 4GBED 3SLGA 4MTLA 1YJBA 5CFOA 5IKMA 5DO9A 3C8ZA 2AOTB 3PIRA 3CX7A 2E4VA 1QO7A 3QEKA 4AG6A 3WS7A 3X1YA 1P45A 1POWA 1B6TA 3LDUA 1J7KA 4N5HX 4QRHA 2PVSA 3RFVA 1FNBA 1Y0BA 2IYPA 3SR4A 1UZLA 1G8KA 3IH5A 5EIBD 2EGUA 2Y68A 2VKQA 2GR9A 3L82B 3WFIA 4NJOA 3QK7A 4B3CA 3CR3C 1NAIA 1FP2A 2VDOB 2DWCA 1IXSB 1T3GA 2H2FA 3DWEX 3HZHA 4WNAB 3U81A 3FTQA 3ER9A 5MN5A 3K96A 3S2FA 3WGOA 3ZX5A 3VDMA 1Z63A 1CTQA 3Q8WA 3QHPA 2OYCA 2AD5A 3EIXA 4GXQA 4CLHA 1HE1C 2F62A 3OCCA 4EY7A 5LOVA 2Q3JA 2AOXA 3FHTA 4OV6B 2ZSFA 4ZVKA 3D1JA 3ND9A 1VBNA 1A9QA 1QVWA 5AWFC 1CHDA 1JDJA 3V80A 3NDRA 1COWA 1GIAA 2L82A 1S8NA 2Z8YA 3VC1A 1XK6A 4RA9A 2DPHA 2RGWA 2UV8A 2WJAA 2HMUA 5B6JA 1PJTA 4F4JA 5JC8A 4NE2A 3U4AA 7GPBA 4GE0A 4R9NA 3Q15C 3DTVD 3L9WA 2DC1A 1REQA 4ZA2A 5J23A 4KH0A 1AS2A 2GWRA 2G40A 2ID8A 2OK8A 3HU5A 2QX6A 3H9QA 1B0ZA 1C5KA 4HD8A 4PRZA 5JARA 1PYGA 4N0PA 1SHLA 4J3NA 3OEYA 1XEWY 5HFJA 3S27A 3UW3A 2CK3D 2QD4A 5F4ZA 2CMDA 1MOPA 3UAYA 1KHHA 2QW1A 5DTQA 5A2GA 4CJXA 3SJCA 3JPWA 3BWBA 1L9XA 5EP2A 1RE0A 3B1VA 4GX5A 4BVBA 1D2MA 2KBFA 3L05A 2XECA 1GM5A 5HUHA 1MD9A 1TTPB 1O4VA 5ILQA 2HA5A 1WXFA 2BLNA 3X1JA 1KH3A 2C9OA 5F98A 2PAFA 4C0SA 3ZZTA 4G1CA 3URKA 1JHOA 5P8WA 1MMFB 2ZJOA 4I08A 3PU6A 1A9XA 4XJVA 2QORA 4Z4EA 5FFMA 4MDFA 3FYDA 5DNEA 4EGFA 2H2GA 3K1AA 3EQZA 1HYQA 1OTXA 1GXSA 1KJNA 1E79D 4G97A 3RF6A 3L7JA 5TJHA 4MUGA 4G1BA 2QWXA 4KODA 1K2VN 2VH2A 3TKLA 2IXGA 3VR0A 4MRVA 3R74A 4OJQA 5TGZA 4ZT3A 5T3UA 1E9BA 1WPXA 1H6CA 5ALOA 2ZE7A 3D1VA 4RTRA 3DXZA 2JCSA 3SN6A 5HK9A 1H9AA 1MO2A 1YRAA 3ZGNA 1CU1A 2SCUA 4JB2A 3A1TA 3Q2OA 2CNNA 1C7ZA 1KY2A 1QZTA 1RQRA 1GGHA 1Z15A 4RIGA 3DJYA 2NZ8A 4QELA 1CDOA 3CNOA 4N0EA 4XVHA 1Z5UA 2WF8A 3LX6A 1XTUA 2C0PA 3L41A 2VJCA 2WHYA 1KK0A 2PFGA 2MINA 4DWJA 4IZIA 3STVA 4DN6A 4MWZA 5LLTA 5DM4A 3U19A 1J90A 3GCGA 1E66A 2AW3A 5JCZA 1ARZA 3VJLA 2X9NA 4FILA 1ZA1A 4R2XA 1I1NA 5CBKA 2VPWA 4P32A 3ZCSA 1RHUA 4LMBA 3LC7O 5CCDA 4BFYA 5AVYA 4IDGA 1A98A 1VCNA 3W5IA 4JSTA 5D01A 1TEHA 1PG0A 5FBQB 5L3SA 2OEPA 5EP3A 4JAVC 3V7UA 5ILGA 3V4RA 4U5XA 3CWQA 1NOJA 5HG0A 4JLPA 3WB2A 5CFPA 4YMVA 4B81A 1QDLB 3UAZA 4DPKA 2ZXEA 3TX6A 4Z3KA 2PZFA 1ZN8A 3FSRA 3DLCA 5WRFA 2B4RO 3RKUA 1T5TA 1FLVA 2FPMA 5DBHX 3T5AA 1W30A 2AG0A 2CYCA 1AA6A 4AKGA 1QFYA 1WW8A 4WZAA 1YGYA 3AM3A 3KJZA 4W9MC 3HXPA 2RGBA 1SUWA 1ZKDA 5TQ0B 4TYNA 4W5RA 2VT2A 5U4QA 3MWFA 2B36A 4IIUA 1U6KA 5BSGA 1O94D 4CF6A 3UHOA 1YA8A 1WTAA 1PIWA 2HKIA 4O4LA 1NGSA 2GT1A 3SE0A 4D25A 1ZH6A 4AY3A 2XT9A 3A31A 3DQZA 1WW3A 3RPEA 3QEMA 5I9IA 4JKOA 2VP9A 4ZCPA 4FFOA 3GLTA 4CTOA 4IV5A 1MG0A 3T3NA 2JH3A 2O8DB 3OE7D 4N01A 2BMDA 1TA0A 1FNDA 1VKHA 3MSCA 5DI3B 2WY2D 1T6YA 3IDAA 5KWSA 3RHTA 3K8OE 2C92A 4Z0TA 1Y48E 3BIFA 3K0AA 3F3KA 1P7YA 2GMWA 4H16A 4QQRA 3GT7A 2FMFA 3FGPA 1ZP6A 3PUXA 3ELWA 3PS9A 4L08A 3B89A 4O5AA 3WLOA 3D4IA 2GXSA 1MDBA 3RQSA 3C3WA 4M9XA 1JR6A 1M74A 2ILTA 1T2EA 4K46A 4EG0A 3IBFA 2J4FA 3PV0A 1II0A 4P3YA 4U9IS 5K2MA 3WQQA 1QHXA 2E85A 1LTKA 2BF7A 3IVAA 3RC7A 1B76A 1RXCA 1SOMA 3SHTA 1JFLA 3H18A 3LKZA 2JKYA 1O1YA 3PEEA 2TMKA 2WHQA 1FRVA 3MUNA 4UUMA 3I5MA 5GVSA 1RMTA 2DQZA 4UVEA 4HGZA 4IDNA 3AFHA 1F6WA 2UU9B 1QTQA 2JZNA 2YMQA 1EESA 1Q6YA 2C3UA 5G3YA 5BNIA 2A0YA 4YGYA 3BFXA 3PGKA 3BE5A 4KACA 5C5DA 5KKCA 2HN9A 5IABA 2J08A 4XSVA 1P2GA 3RFUA 1GAQA 2VTEA 4F06A 3MBIA 1MZVA 2W2KB 4XM1A 5IASA 1EWQA 1QHHA 2DUMA 3P4UA 4EEZA 3AR9A 3CUUA 2WYHA 2G71A 1PFUA 2FWMX 4RF5A 3ESYA 3GPIA 3LQ2A 1M2OB 1FSSA 1QF9A 3HXTA 4HYTA 4TLBA 1CE8A 2WU0A 3B1WA 2H29A 3QWBA 1FFSA 1J8VA 4E5DA 1VLQA 1U94A 1N3LA 1MF7A 4DVGA 3ICPA 4H0CA 1VL6A 2PUTA 3X43A 4U2FA 3L0OA 2VPYA 5JSFA 5K3OA 4HDMA 1N3YA 1OLXA 5CPBA 1GPJA 4QBKA 4OQPA 2EHDA 2QVYX 2XUOA 2SKEA 2O2ZA 3GJ6A 4HQLA 3S3TA 2XQKA 2HXGA 3RS2A 1Q7TA 2VH1A 5E8JA 2Z2YA 4G9BA 3LQ4A 5H5JA 1Y4SA 2QA5A 1IY0A 1JEEA 3MB8A 4D96A 4ZYXA 2WQZA 5F1OA 2Q5EA 1R1DA 2XKAA 4U3JA 4BVGA 1AUOA 3SJBA 1PT6A 3L7LA 1RM3A 2OGZA 1AD2A 4JC8A 1YASA 2RCNA 2Q5CA 4KE6A 1SB9A 3ZDFA 1QH8A 3D8TA 3ZDAA 3AVXA 4OO3A 3PLAE 2LCQA 4C7OB 2A9JA 1MEEA 1EM8A 1QTNA 5FT9A 3ZGOA 4UM9B 1GAEO 3EVDA 4AN1A 4JXZA 1DO8A 7ADHA 1WOMA 2QT1A 1OXKB 3L7OA 1ZM3A 4KIJA 3VAZA 1F12A 3HI6A 1EXMA 3ID6C 4QXMA 1OVMA 4R71A 1FE8A 1TX4B 5JCOC 2FJ0A 1SU8A 1RLOA 1P1HA 3V1YA 1Z6QA 3EBPA 2B4AA 3WOHA 1RHMA 4R1QA 4V0MA 5FHQA 1Y5LA 3P0JA 4PO8A 4YJGA 1UMCA 2C95A 1YIDA 4FQ8A 3GBVA 3MNFA 3V2HA 1IJFA 1AF7A 2NZUG 4HNRA 4PCVA 4R16A 4C7MA 5A05A 2XYPA 3QP9A 2GJKA 2OFOA 3STHA 1P6QA 4HNHA 4MIEA 2AFVA 5BV0A 1ZCAA 4GLOA 3CS3A 3SXJA 4E4TA 3UTCA 5AJWA 4NP6A 2VAXA 2OGUA 1L5YA 4N3AA 1GRVA 1YQ9A 2CJWB 2ORIA 4W8HA 5FPKA 2LGJA 4H1UA 5HKLA 2PUVA 3TE6A 2PSJA 2VAPA 4N8DA 4CKBB 1XVUA 3FYUC 3S2IA 4B73A 4DBZA 3K2IA 2IYTA 3VGPA 4OB6A 3UATA 2A14A 5ENDA 3IR5A 1EZ4A 5AIAA 5K0SA 4IDDA 1E2HA 2OCKA 4O4IF 3RIMA 2UYYA 5FAKA 2FAXA 2BCEA 2VHQA 3L8EA 3TAXA 5KDLA 3CVYA 1FZQA 4LY6A 5JJCA 1NPTO 4UW9A 3UPTA 1H2HA 4CIWA 2VHVA 1M3SA 3AXSA 2OWEA 3DKVA 5KMGB 2FPPB 5DW3A 4NWIA 1IJEA 3ANTA 3U4CA 2NT3A 2AA3A 3QMMA 1VL1A 4P0QB 5BWLA 5MN6A 2E5LB 1JR3E 2C5HA 4BLOA 1WZ2A 1I3LA 3K70B 1WCV1 4Q1CA 5K0GA 3GGDA 3R7SA 3TJMA 4BN5A 1YB4A 1V3TA 4QUHA 1UQRA 2UDPA 1Z25A 1ODLA 2VHYA 3ABRB 3GCZA 3C8MA 3PQEA 5F35A 4F92B 2HCFA 2YNMA 5AESA 1QFSA 4NMWA 1FYEA 5DTMA 5G0TA 2RGNA 5AICA 1KZ9A 3KKQA 4G4SP 3W8FA 3M6AA 4PSDA 4DDVA 3TDKA 3MAJA 2PNFA 3R7NA 1EIWA 2ZVDA 1ODTC 3K5PA 1R0SA 2XCQA 3KRTA 4OGFA 2JIOA 3LP8A 3TZLA 1JJFA 2AK2A 4J4TA 1KYZA 1H1DA 4IUCS 4W5TA 3HNOA 4IX9A 3QKWA 3E3NA 4HK4A 1OFGA 5FUYA 3HM2A 4NOLA 3AVPA 3PQ5A 2GSDA 3E53A 2QUAA 2WAXA 3I2HA 4QYIA 3UJBA 3HMKA 4WNCA 421PA 5MDHA 1CUZA 1FJHA 1FY2A 5BQ5A 1P1RA 1RTTA 1SCDA 4OHCA 4W8GA 3ZG6A 4AULA 1ZSYA 3E84A 4PPNA 1W4ZA 5K4HA 1GUAA 1I1HA 3OLXA 3ILYA 4M36A 2OHIA 4UAGA 4BCBA 3AJEA 1A9XB 3R5JA 1YHNA 1Y6RA 3OFKA 3K1AB 4OL0A 2ODAA 4U7FA 4S1OA 3JYHA 4BN0A 5I7OA 1E3IA 5LP6B 3GLIE 2WUEA 5DBIA 2H1HA 1EA5A 1Q83A 2I65A 5F1PA 4DEYA 4E07A 4HAOA 2UUPA 1NN1A 1IZYA 4WIAA 1X8XA 3A0UA 5IJ0A 5BMOA 1E3EA 1GFIA 1RXIA 3P52A 5TQVA 5A5DA 2OO7A 2RB5A 1RLUA 3IBCA 4KE7A 1Y7LA 4RC9A 4TLAA 1N2IA 4BB5A 4BQRA 9ATCA 3A4IA 1IDN1 2CDAA 2CVPA 3FSGD 4YXWA 4WBNF 1DXYA 1YDFA 2SCUB 3NHKA 4L3OA 5LZ7A 1CRPA 1IY8A 2P9YA 3DO5A 1U9ZA 1T1SA 2E2WA 5EWJA 4F4FA 1DKOA 4AUKA 2IPXA 4EYQA 4GRAA 4KN8A 5FPHA 4AWAA 2R1UA 1I2ZA 1D4OA 1U98A 2HMTA 4Q21A 3WYNA 1AK9A 1GEGA 3U39A 3HU2A 1IVYA 1MPXA 4UDOA 1I33A 2FGKA 4DUPA 3FBTA 3HFRA 3LBIA 1ECLA 3C6KA 2ZVQX 3JYLA 2BVNA 4I1RA 4OSPA 2FU5C 4HRVA 4K40A 3JQ6A 3LA6A 4X54A 3DZBA 3DLTA 4E7OA 1FX1A 2VYCA 4PHCA 4ESVA 3E58A 2FPWA 1IK6A 5DCLA 3SIPA 1A1VA 3NXSA 5JQGB 4EPTA 4ZCQA 4MICA 3RS7A 3PNKA 3WRXA 1DDOA 3B6ZA 3HLKA 1TEVA 1Z22A 1ZEJA 3DFIA 3OZCA 3R3YA 4Y7CA 4OYRA 5EJ8A 2BMFA 1GA6A 2WB2A 2XNHA 1VHDA 4RVGA 1OGIA 4PLCA 1YL6A 2E89A 1XA3A 1Y89A 2PO7A 4WZAB 2AMFA 1GSHA 3MT7A 3QJ5A 1MAWA 3JQ7A 4JBWA 3V1NA 1UOEA 1DB3A 1VRWA 2FPUA 2YKGA 5HS6A 5ALEA 2WIAA 1ZZGA 2RAFA 3QVWA 3Q0EA 2NSYA 1G5FA 4HADA 5A5GA 1E4VA 5BW6B 2BEJA 4EEKA 5E6RA 2DHRA 4GR4A 1E5QA 2V3WA 3FLEA 4CU2A 2IBSA 4KIFA 1RHQA 4LY0A 4OPMA 3OSUA 4I4IA 3V8RA 4DJAA 1E0AA 3P4YA 5KPJA 4RCZA 3QE4A 4C7BA 3A4MA 4V0RA 1G1AA 3UB4A 3WIBA 1B73A 1TOAA 2X2PA 3MMXA 3UMCA 3H83A 1P2FA 3I6BA 4JBGA 4W7SA 5LM3A 1A4RA 5F2OA 1VGVA 1W9MA 5AK5A 3KFVA 3EGCA 4CEIB 2HTFA 2KJQA 2ZJ6A 3PPXA 4PX3A 2FW6A 3EOAI 4K9MA 3MQ4A 5ERGB 1J0BA 3H0EA 2OXEA 4N39A 1OC4A 5TMPA 3IELA 3DLPX 3V97A 3BXXA 3OIFA 3OA2A 1MA3A 2ISSD 2R25B 1J21A 3ADOA 3L18A 3N5KA 4RA6A 5F7JA 3M4JA 3LA8A 4Y6LA 3UYKA 2HIMA 2I62A 1CUGA 1E77A 5B3AA 4EKDA 2VT3A 3U16A 5C51B 4YFVA 4M76B 4Y9UA 3EZ9A 3E2PA 3FCOA 3E3LA 1FFYA 1V37A 2VDWA 4R54A 1V25A 4IFBA 4M0MA 3TMAA 1AUXA 4N4AA 1MV8A 5KSZA 2CUTA 1A4IA 2P3SA 2ZCVA 5DBOA 4ZOQI 2W83A 2ZSEA 1PRYA 2C58A 1IMJA 1J2TA 2Y71A 2J3QA 3AFOA 5BN3A 4FGUA 3WK8A 4NENA 2H2AA 1SUFA 4I4NA 4E1BA 2A3RA 3WYDA 2IDJA 3FZYA 3SQNA 1IDOA 2ANBA 1BKSB 1E6KA 3UXEA 4JS0A 1OBCA 5GJBA 2DR0A 3PDWA 4BKMA 3MS2A 4PINA 3CH6A 1FDTA 4J0QA 1HFWA 4I7EA 3CTMA 1CE8B 1G63A 1M8JA 1PQ4A 2QUZA 1OI3A 2WABA 2XF8A 2ZANA 2ZKLA 1VJ5A 3AC0A 4ETWA 1XDZA 5JYCA 4A0RA 4PBRA 3MW8A 4ZZ2A 1KI4A 1QJCA 2HCRA 4TTIA 5IVHA 5D3KA 1RJFA 1U7XA 2HY7A 2ONZA 3L07A 3NBXX 4ZOLF 1OLXB 3GR6A 3WSWA 5KSYA 1LSSA 1UDBA 3OIDA 4J91A 4X65B 2DECA 4X1KB 3DDWA 1UBSB 3K8YA 1OV6A 1M1NA 1NZFA 2JHGA 1YVDA 2O8CA 3H17A 4GX2A 3WDMA 1HFKA 4U7WA 1N2HA 3AUAA 4XLLA 1A9ZA 5L7WA 5L6LB 4UMVA 1WCXA 2J45A 4IINA 2WUGA 2WZQA 4U3JB 4BVJA 3HU1A 2AIRA 1J07A 2XHEA 4CL0A 3SJZA 4FLFA 4I4TB 3I45A 3LO8A 2AF4C 3KELA 4FGSA 3ZCPA 2BFEA 4UHDA 1AQLA 1B43A 4BMVA 1TJPB 4QDJA 2NMVA 1YI0A 2GPYA 2GUWA 3JZFA 4LK3A 1EM8B 5C8DA 1KE2A 5KKAA 1JW9B 4KC0A 2IJGX 4M49A 4ALIA 3VC7A 1EFTA 1KGDA 2P3OA 3V4SA 4JT4A 3W5HA 1V7CA 1WVGA 4M98A 5C1OA 4B44A 4IHJA 3M6UA 1L7QA 1SIOA 5DHAA 4QLBA 1Z0KA 3TUJC 2I2DA 4RS4A 1JIXA 2YZKA 1Q17A 2Q4EA 3Q2IA 1B4DA 2BUCA 1ESDA 2PMCA 3BD8A 1XRMA 1P9NA 2II6A 4PPYA 2GAFA 2IDZA 4OMUA 4XB2A 4J0GA 4MUJA 2IEZA 4RIFA 1QOPB 1YBAA 2CMFA 1KJJA 3PPIA 3AOEA 2D2FA 3UMMA 1PTJA 3NDJA 5IN5A 2JFQA 1SK9A 4DV0B 2AQKA 3E05A 2G9RA 9GPBA 2BFMA 1YZFA 4FW8A 5AW6A 2ZIGA 4JCOA 1RZVA 2YVUA 3O84A 4PYIA 1TTTA 2Q6KA 1EE2A 1KVQA 1XCPA 2P1RA 3LXUX 4DM7A 2HMWA 4TLMB 2IEBA 1Z12A 3QWAA 4R9VA 4H6VA 1VI6A 4RD4A 4ICIA 1NIJA 2KHZA 3KSUA 2FN4A 4H7FA 5K3DA 2I4IA 1DMRA 1JIJA 2XTZA 5FPTA 4JL6A 3AUJB 1QHYA 2HSEA 4GG1A 2VOEA 5I7WA 3JV7A 3JR7A 4EW6A 3OFND 3KETA 3NORA 3OOYA 4GI2A 1XOIA 2R8XA 3KZOA 1G5IA 5DYIA 3TIIA 3WLNA 1O97D 3WVNA 1XJQA 3B7WA 3GGCA 1ETHA 3VHQA 5AW1A 1MIHA 1M5UA 1MUUA 5LZ4A 4X85A 3TG8A 3W5CA 3NATA 2QLMA 4UEQA 1U3CA 4TVOA 1GOTA 3UF0A 4JEIA 5EOVA 3HN6A 1BWRA 1MIOB 1NYLA 4PZZA 4UEWA 2R11A 3N2LA 1TMYA 4A92A 5BNZA 1MKYA 2F64A 2QUIA 1NNLA 4G4JA 1I2CA 1TUIA 4EIWA 1YWGO 3ZE2B 3FOBA 4A8TA 2OAGA 4BX0A 1Z4PX 3IP7A 3ZD9A 3KD2A 2NM0A 3MRTA 3RT1A 3H4VA 4P22A 1W34A 1SQ0A 2NQTA 5DDIP 4ZU1X 1J49A 3PL1A 2DPYA 3R3VA 5JTTA 5E38A 2I3ZA 4JUBA 1DELA 4DIFA 1JSCA 1I7PA 2V6GA 3CPSA 4MRAA 5D7BA 6GPBA 1FLDA 1N5MA 2PIAA 3W06A 3RVQA 3KFXA 3VU9B 1W4BA 1Z7EA 3I2KA 1C4XA 2AN4A 1Z0IA 2NYRA 1KYWA 3GGPA 3OZIA 1ENZA 2H51A 3A10A 3ZIAD 1QXSA 1RXWA 2R84A 3Q7RA 4MUIA 3D7SA 3KLMX 5BYKA 3LYHA 2YVKA 2DWPA 5H81A 4BLUA 4EITA 3Q9NA 2O8VA 4D8XA 2OCXA 3GRFA 4QYIB 2XUDA 2Z2ZA 3CLRC 4NULA 4YBRA 2H2WA 4Z0HO 1EDEA 1R8SA 1PD0A 2H5EA 4Q12A 5EEGA 4D99A 5U9CA 1HO3A 4PNZA 2BUAA 4Q47A 1C3XA 2GKOA 1U9YA 1F2VA 1VE7A 4E46A 3JASA 2C5GA 2OMKA 3WL8A 3CRMA 2RKWA 3DFZA 3GK3A 5DHPA 1USKA 1WU7A 3HSKA 4DDMA 3U5TA 3IHWA 4JOBA 3QLUC 3U4QB 2R9VA 3QTLA 3OZ7A 4BEVA 4DCVA 2IEGA 2H3HA 4QGBA 4ZHSA 3FTPA 5IJ0B 3WIDA 1QVVA 1QIIA 4X90A 4JVNA 1ZGZA 4MPPA 1VL0A 4FC6A 4HGYA 4OHOA 3PWTA 4FSXA 5K6RA 1GKIA 3F71A 4LXUA 5TF0A 5A2QA 4JIMA 5F5LA 3VR3A 4PZCA 1KQPA 2YFKA 3ORYA 1DAIA 3OO0A 5FOTA 1G3RA 3AR3A 4OXQA 3UJ9A 1PZNA 2EX4A 3IQEA 3W2HA 4E5MA 3UB2A 1WW2A 2N0SA 5A62A 3GRAA 4TN1A 1TZJA 5E9WA 4B2PA 2WQ7A 3U3MA 3OU6A 4MGEA 3OUUA 2WWVD 3IUEA 1LNQA 4JJ8A 3VYRB 3KO8A 1MQ9A 4E51A 2XB9A 2H57A 1NBMA 4L8LA 1ACJA 4S0XA 2QTHA 3QOWA 1BCSA 4AJEA 3KSZO 4WMLA 3TW0A 2J0VA 2PD6A 1PG5A 3UFBA 3NTOA 1SRRA 1K7SN 2NV6A 4BKUA 3HM9A 1SXJE 3AUXA 4BVLA 5AVOA 4C7JA 4RHTA 1LPSA 4HJXA 4IIJF 4AROA 1FUUA 3JZDA 4I9NA 6PFKA 1KIMA 4EFKA 1DJOA 3LBYA 1T6BY 3A70A 3TNJA 4C01A 4KO4S 4XE5A 5EKUA 5IDVA 2PX4A 4KX3A 3VC3A 1I01A 5EZYA 1ENYA 3HZRA 4ZN6A 1Y8QB 2I54A 3T5MA 4BTLA 1M2FA 4RTKA 1KKLA 2H2DA 4KFSA 1AOXA 1N5IA 4LJSA 3BBPA 4HNTA 3F47A 2ZRIA 1AY0A 3MCWA 1TZCA 2XEXA 3HR7A 5G3ZA 1NN5A 1PNQA 4MEJA 2VDQB 2GM9A 3QVTA 5THXA 1H3FA 3ADDA 1ESMA 3JQ7B 3B1ZA 3M5DA 3QITA 4TWIA 3VJMA 4ATNA 1V4VA 3M33A 5LNK6 5I9TA 4RWEA 2V7PA 2ACEA 1OFVA 4RD6A 1MJHA 4ARZB 4ESHA 5TE9A 1UFVA 2CJYA 2FMUA 4J1SA 3ZYCA 1QYCA 2WW8A 4MRRA 3RWBA 4LJ5A 5CGQB 5MHTA 3U4IA 3JALA 1W75A 4EB6B 1NNSA 1P1KA 3FWZA 4K28A 2RBEA 3IGFA 2AXEA 4R3NA 3VXKA 5IK2A 5I7EA 3JD0A 5DSZA 1VKRA 3C7DB 4HLQB 3I6ZA 2ZJ7A 4ALKA 1M2HA 3PSAA 2GDZA 3KQQA 5A5FA 3FNIA 3V8MA 1XAJA 3PYXA 5EMHA 4RF2A 1XEXB 5E1OA 2CZQA 1VCHA 3G9QA 4UHHA 4YCJA 3ZD8A 1KMQA 1AXGA 4DLAA 3GZJA 1MA0A 1VBFA 2CBGA 2PA3A 1AX9A 3A1NA 4QULA 4IDCA 2KMLA 4LHZA 4B31A 3KOXA 4NR0A 4KQ2A 5C53B 2WZBA 4MOWA 2MSDB 3DAGA 4ZARA 5DLQC 2ZE8A 2PWZA 2L18A 1YIAA 5D87A 1NUUA 3LI2A 1Z6AA 1SA0A 1WVMA 5K8VA 2OB2A 4O8CA 4CLEA 3WMXA 1SBHA 1PJZA 1ZUNA 2C5FA 2GM5A 1W88B 2NG1A 3L0YA 3I1JA 2H1LA 3PBKA 4MWCA 4TYMA 4UUPA 2UVQA 1NASA 5E0KB 1ZR2A 3CBQA 2EQAA 3R5TA 3MHPA 1OT5A 2QLJA 1YK1A 3DFKA 3I9V6 3TR0A 1Y9EA 3FKQA 3T35A 4F6RB 1ZVJA 3LFTA 3U1VA 2ZK7A 4NENB 1WAMA 4IFEA 3GFVA 3DYVA 1L5GB 2CF5A 4YAGA 5B57C 5F9FA 4M1TA 4OQYA 4DUGD 4PQRA 2I34A 2JGNA 3ETJA 1Q91A 4U63A 3L7AA 1UQUA 1U2EA 4UM8B 5SYNA 4NPCA 3TVYA 3ROTA 3LG2A 3UWPA 4LK2A 3CEPB 4BASA 3QXXA 4CTKA 4H9GA 4V0LA 4GMXA 1DC7A 1M6VA 2ZAGA 4LV8B 4N7JA 3VHRA 4CQLA 2CL7X 3SQXA 1LQTA 4D4MA 5LN1A 2WJPA 1EBBA 4LI0A 1M72A 3MGKA 4D4IA 3Q3VA 1CUDA 4L8VA 2D7CA 3G3EA 4HWSA 3TOSA 4Q7QA 5FNVA 2F3QA 4DTIA 2AMJA 3NX4A 4DANA 2DAPA 2HDNB 1RJ9B 3QUQA 5H3CA 4JLDA 5KNDH 4PHHA 4Q1DA 4PLZA 1JZTA 1YJAA 3B60A 4TTSA 4MPRA 4S12A 1SD2A 3FFTA 2YJGA 1LSJA 3I4LA 3KVYA 1SQ6A 2NVBA 2FFHA 2XTMA 3ZVMA 1XQXA 1H8ED 2AYXA 2R4TA 3KVOA 2QVGA 2Y1OA 2BFEB 2REBA 1W1IA 3HA5A 1OYWA 2KYRA 4RVNA 4LECA 1QF7A 1L8QA 1P81A 3PNBA 3SSOA 4EL5A 1Q0TA 1H5NA 3QU2A 5PGMA 3GVHA 3HUUA 1RLTA 3PR3A 3EXG2 3WL7A 4E6PA 5K09A 4AY6A 2O6LA 3PFCA 8ABPA 3RC8A 1Z68A 2C9ZA 3S5JA 2UYGA 1EJ6A 3EIQA 3F5SA 4IWXA 4PCUA 4I6EA 1ZCJA 2IRWA 1NXQA 3EF1A 1MAAA 3NJRA 5DFAA 1C1HA 4D46A 1V5WA 4AF7A 2QX8A 2NNWB 3EPRA 4UMEA 1XKQA 2O2DA 3G5UA 5DLPA 4LOLA 2J30A 2R7KA 1L5WA 1E3WB 3TM4A 4QLAA 2C2YA 1ABEA 1SBYA 2QP4A 3PXGA 3WJ7A 4QJIA 1JHXA 2O2JA 3BCRA 3DMGA 1BN7A 3LK7A 1QM5A 2ZI7A 4GNKA 4XB6B 1FTNA 5A3VA 1QRDA 2ZJ5A 4XTCS 5FWAA 4DKJA 3VISA 3OEWA 1U8XX 5GJVC 3RG8A 2G9VA