1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
4ZOQI 1ST2A 4I0WB 1TM3E 1GA1A 1SUCA 2SECE 2W2MA 3EE6A 3HJRA 3Q40A 4OMCA 5B1DA 3UNXA 2PWBA 4GI3A 4H6VA 4WOBA 3P5BA 3DVQX 1KDYA 3AJ9A 1BH6A 1Y9ZA 3DE3X 1ST3A 1SBNE 5AMXA 3A3NA 1A2QA 1PJ8A 3H42B 3VV3A 3I30X 3LPCA 3VV2A 1T1EA 5FAXA 1WSDA 3I34X 1GA4A 1Y3BE 3BGOS 4OV6B 5FFNA 4AKSA 2WUVA 4LVNA 1AK9A 1GNSA 4Z2AA 1SPBS 3ZXYA 5K7SA 3GCWA 3WQBA 3LPAA 3DVRX 4RYDA 4KG7A 2X8JA 3VTAA 2ID8A 1IAVA 2PWAA 4FONA 1TM7E 3LXUX 1GNVA 5AVKA 5B1EA 1BFUA 1SUPA 1YJCA 3TECE 5ARDA 5JXHA 2E1PA 1PTKA 1SIBE 1PEKE 1YJAA 3EIFA 4C3UA 1AH2A 2X8JB 3VSBA 2DP4E 1KE2A 3GT4A 4YN3A 1TM4E 3BPSA 1EA7A 1EGQA 1S2NA 3QTLA 1WMFA 1GTL1 1SCNE 2GKOA 4DWWA 5ARBA 1TM5E 3VHQA 3A3OA 2XRMA 1ZVJA 1Y34E 1S02A 2SICE 3D9QX 3DVSX 3F7OA 3T41A 3PTLA 1GT91 1SN7A 4NE7A 1C9JA 1BJRE 1SIUA 3WHIA 4DZTA 2SBTA 1DBIA 1GA6A 1SCBA 2ID4A 1SUDA 4ZARA 1R64A 1S01A 1TMGE 1MPTA 4H6WA 1UBNA 1PFGA 1TECE 2P4EA 3SICE 4NE9A 5ARCA 1BE6A 1OYVA 1SIOA 1MEEA 1THMA 1SUBA 3CO0S 2PQ2A 3QMPA 1R6VA 3PRKE 3WIUA 4CFZA 1TK2A 1KDZA 1Y1KE 1C3LA 3VYVA 2DQKA 2HD4A 2TECE 1AU9A 1SBCA 1SH7A 1T1IA 1TO2E 2W2NA 3LPDA 4KPGA 1AF4A 5AQEA 1XF1A 2V8BA 1YJBA 5JMOA 2W2OA 5JXJA 1GTG1 3DE2X 1LW6E 4NMXB 3DE1X 2ZWPA 1KDVA 1VSBA 3GT3A 2Z2YA 2WV7A 1C9NA 1HT3A 2HPZA 1SELA 2PKCA 4DJ5X 2Z57A 1JEAA 4LVOA 1Y33E 1OYOA 4JP8A 3DW3X 3OSZA 2WUWE 3F7MA 5FBZA 3ZXXA 2Z58A 3SQOA 2WWTA 5JXGA 3I37X 1SBIA 1TO1E 1YU6A 1SBTA 1V6CA 3L1KA 2Z2XA 3DE5X 4BWGA 4HX2A 2ST1A 3DE7X 1Y4AE 1Y3DE 2PMWB 3TI7A 1BE8A 4WOCA 3QFHA 1SBHA 2QTWB 2PYZA 1KE1A 3AFGA 1CNMA 1TM1E 2Z30A 2ZRQA 1Y48E 3A3PA 4OMDA 2ZWOA 3I2YX 3Q5GA 5I9SA 1SUEA 3F49S 3DE0X 2B6NA 5JXIA 3D43A 4CFYA 1R0RE 1SCDA 2Z2ZA 5AVJA 3GCXA 1P7VA 2IY9A 4AKTA 1GCIA 1WMDA 1P7WA 4K8RB 5CW1A 1NDQA 1WMEA 2W2QA 3TI9A 1ZVKA 3AJ8A 1OT5A 1WVMA 3DDZX 3WIVA 2W2PA 1DUIA 1SVNA 1C9MA 1NDUA 4CG0A 1CSEE 4M1ZA 1T1GA 1AV7A 4HVLA 1SCJA 1SCAA 4MZDA 2PRKA 3CNQS 2G4VA 1IC6A 3EDYA 3DYBA 4B5LA 1BFKA 2Z56A 1AVTA 4H6XA 1SUAA 1Q5PA 3DE6X 4KB5A 1GTJ1 1Y3CE 1P8JA 5SICE 1AQNA 2DUJA 3DWEX 1NLUA 2IXTA 4J94A 2XTJA 3BX1A 2SNIE 1V5IA 3DW1X 4C3VA 1Y3FE 1Y4DE 3DE4X
chains in the Genus database with same CATH superfamily
1TT5A 4OD0A 4FLMA 2QYHA 3QBDA 4HEA6 4ZI7F 1HV8A 3BL5A 2TMGA 4P83A 2YXDA 5EXEA 5ITWA 1JFSA 4F6CA 4M83A 1E2NA 1EWVA 3ZDQA 2GDZA 2C9ZA 4YCJA 3CSDA 1A5AB 2PLAA 2YDXA 1L2TA 3K7EA 2BFWA 2WZBA 5I4CA 5JNWA 1ML3A 3D31A 3KYJB 5FAXA 4V1CB 1NN5A 2BGJA 1HFJA 4TLLB 2AG5A 4AKSA 3D7KA 4CV3A 5GV8A 1SCIA 4L28A 2NOAA 1NU6A 4N3BA 1ODCA 2E85A 3IO3A 3OLQA 3T7RA 5TQJA 4R0MA 1W4AA 1BVYF 1Z73A 3GH3A 3KDPA 3QBEA 2QLJA 2QRVB 4NCJA 2ADFA 3IR7A 4O25A 2O7NA 1KVSA 1U80A 4HAOA 5AQ1A 4GC9A 3PQFA 5EWLA 1KOFA 4Q9NA 4BLSA 1Y42X 1Q77A 4IIHA 5BWLA 5AW8A 2NTJA 3FGPA 1K9VF 4WK0B 3HZHA 1KQNA 4L6IA 2BEVA 1FFSA 2EX0A 4LOAA 1IUKA 5FWAA 4UATA 3BERA 3FYDA 3FR7A 3IOMA 3MERA 4FJ1A 4RZQA 4C4RA 2BIFA 3EGIA 4N54A 4XPIA 1MJHA 4DRZA 4PLFA 5BW5A 3L4SO 2I4NA 4TYWA 3WKEA 1NFFA 3LRTA 3ZD8A 2JLWA 1C7QA 3GCZA 4MHOA 1TO2E 3ONVA 3OLVA 2K2QB 4HMQA 1OVGA 2XWSA 1ATIA 3JY6A 2GF0A 3PPIA 4OQDA 3U4CA 4ERNA 4FYPA 1VHLA 5TMBA 4GAEA 4B74A 4ENRA 1MAVA 2XB8A 3BMQB 4BDTA 3U4IA 3U3JA 3CUSA 2OMEA 1KRHA 1WW3A 3O4JA 3SC2A 2I2FA 5HM8A 1CV2A 4JOBA 4GZLA 5AJHA 5JE8A 2BI8A 3E8XA 3NYIA 4QT0A 4BB9A 3NM5A 3S4YA 3U5TA 1NUPA 4AG6A 3K5WA 2GO7A 3P0EA 1NXVA 3MWLA 5EE1A 5FR1A 3RWOA 4EMSA 4MA0A 5C7IO 1H5NA 1UJMA 2VAMA 3BHIA 3D6NB 5JXGA 3V2IA 1Z7GA 3F8WA 3ESXA 5ECGC 5JANA 1W85A 2BEKA 2X0DA 3LCRA 2VYNA 4DGQA 4JP1A 621PA 1LDEA 4UNNA 1UQTA 1AKMA 1NR7A 1USGA 2ALJA 1P7ZA 2IE0A 3M4ZA 1U8UA 5K3FA 2XCTB 1NQUA 4MRMA 4FGJA 1J8DA 3I73A 3OTIA 5IULC 3A6FA 3TUJC 1F7VA 3A27A 2PH3A 1HI9A 3VH3A 3P9YA 1ORHA 1P7WA 2B2CA 3GLUA 3IHKA 2F17A 3HFGA 4HN2A 2B0CA 3CH7A 4D6XA 2P77A 4HQNA 3WIVA 3LPNA 3HEAA 3VZCA 4WQMA 1HA3A 3TZBA 1ZGCA 4GNKA 2QUJA 1PGNA 3M3PA 4A0FA 3C7KA 2E4AA 4DR7B 5CHEA 2GM9A 3P0JA 3RFFA 2B69A 1XCBA 4OIMA 3IEPA 2JFBA 5TY0A 1L8LA 4U0KA 4YAWA 3AWDA 4KNYA 2HRQA 4ZOCA 4ZJZA 1DX9A 3L92A 1TCVA 4BX9A 5KOHA 4BLOA 3T3NA 1IIRA 3EMKA 4KR3A 2AEFA 4MR8B 4P3OA 1V16B 4BNYA 1HNXB 1L5HB 4FQ7A 4JELA 4Y2XA 5T4BA 4CMIB 5IJ9A 2VTBB 2AOVA 3TBHA 1M34B 2PA0A 4HDMA 4ZJUA 4FEAA 2GZRA 1EVZA 1OVMA 2WP8J 3NTVA 3L1VA 1XWWA 2C88A 2R60A 2X3UA 1WSDA 3AB8A 3MB8A 4LF6B 2JJQA 3O92A 4IGAA 3RSGA 4N5NA 3S2ZA 1N33B 3O75A 5DHTA 4NI5A 2ONKA 1ZGZA 5IF3A 1J5EB 4ENVA 2G5TA 2DLNA 1SHLA 1D5CA 2OZLB 2PDAA 3B3AA 4MP8A 4O1IA 4ZAVA 3LV8A 5FFFA 3W4KA 1UCFA 1KZ9A 4ER7A 4Q3DA 1GGFA 1OROA 4QARA 4DLZA 4PYIA 3CPHA 2F1JA 4DHWA 1MMFB 3UJ6A 3D5QA 5L7TA 4ARBA 1E9CA 1E61A 1MVNA 1JFRA 1RAHA 1QO9A 4X20A 5DT9A 2OAEA 4HPWA 4MS3A 2JLUA 1F8XA 2I29A 2XEXA 2C03A 4I19A 5HA5A 3TO5A 3P19A 4MQ5A 1A9XB 4RZ2A 3SICE 1OFGA 2CLDX 3CINA 2ZJ1A 4J07A 4XWAA 2EC5A 3BA1A 5A0TA 1K68A 3EGOA 3LUDA 4ICIA 1SUBA 5KNBA 1EFKA 2R79A 4H2DA 1IBKB 1YJXA 3IILA 2FZKA 1CUVA 3BRWD 2WU0A 4LJ5A 3ICEA 3FVQA 1BU8A 2CT8A 3PUXA 1KBOA 3H99A 5A6SB 4UHFA 1I6MA 4JKIA 3RTEA 4JA2A 3C3WA 4KNWA 1PJLA 3R75A 1U2RA 3K5IA 3DC7A 4P32A 1EJ2A 3STWA 2LD4A 3ZGNA 1YL7A 3EZXA 2PRJA 3NBFA 4FN4A 4JI4B 4FDLA 3WLKX 1RXCA 5DTQA 1K4MA 1KQPA 2CCGA 3D7MA 2EFGA 1WS6A 2W2LD 3LS2A 3GLFA 1XZKA 2WTBA 3ROTA 1TZ2A 1C7IA 2XMGA 1YUMA 4I1IA 1KI8A 5B53A 3SZUA 3U2QA 2O8CA 4E1AA 1TJ5A 5G1NA 3DE5X 3HY3A 1RXIA 1WQ1R 4QDOA 2GZ1A 3TAUA 2RAUA 3HZZA 2FMTA 5HK9A 1JAXA 1QYIA 4MLDA 2Q6LA 3MINB 3I4FA 5CT6A 4CZ2A 3NP7A 4GOND 1C2YA 1JLLA 4RK7A 4D7AA 2HSWA 2E3JA 2V3WA 4TZ6A 5GONF 4PZLA 2M6LA 3J80A 1ONOA 1L7NA 1TNDA 1ZIYA 3QE2A 3GHHA 3U19A 3FGOA 3QUSA 4J1QA 1MC8A 3FPBA 2R00A 1T9GS 4EEZA 3VU1A 3AIKA 2WSMA 4NDAA 5DNVA 3PR3A 1H65A 3ROQA 1ZGBA 3LVFO 1P1IA 3AZQA 3FR8A 3A8TA 5CA0A 1T0BA 3EEFA 1V8ZA 2P1RA 5DGIA 5MN6A 1SUAA 4H31A 2W8ZA 1G6OA 1N6NA 1W96A 3LC0A 4Q1AA 2V97A 4R3WA 3NATA 3T5DA 3BSFA 3G3EA 5C4GB 2Q1XA 3LC2O 3QMWA 3MS4A 1ADGA 4A8JC 3J7TA 1WDTA 1W47A 2WG0A 1YBAA 4L5AA 2MIIA 7YASA 1Z2EA 1XN1A 3TWOA 2A0WA 1ZY2A 2QN3A 3ITDA 1QRDA 2EL7A 4QEKA 1JEYB 5KIAA 1M2HA 3WGLA 4YCCA 3OJLA 3WLSA 1Z16A 5B3AA 1VIDA 1T0PA 3CRQA 1NI5A 2NT3A 3NJRA 2GN2A 4GVPA 4B2IA 4B82A 2Y68A 4TVBA 4WKCA 5B58T 1MQAA 1QGOA 5LOVB 4RK4A 3OWOA 3HUFA 2PXCA 1H3NA 1IY0A 4WKOA 3ZXYA 2ZI9A 2ZYIA 1E0KA 1U98A 2R7KA 1WPRA 2JH3A 2G1UA 1ZBQA 4XRRA 4A1OA 2QLMA 5K8TA 1GRVA 4ND7A 2X7XA 1BHJA 3I9OA 2ZTLA 3MEQA 4E6EA 3EQ9A 4A1FA 4FFBB 3F4KA 3VSBA 4R1PA 1SUSA 5KQSA 1R5NA 1JAZA 1ODKA 2PX2A 4FOTA 3G5AA 3K2QA 1QYVA 5AJZA 4BNTA 2I6GA 1W88B 4RV4A 5FPSA 3SDBA 1SQ6A 3W9BA 1RXEA 4E7PA 4ER6A 1X87A 3R6WA 1HKUA 2B78A 1YSCA 4MVCA 1RNLA 1YRBA 1IM2A 1SCBA 2I54A 2ZSJA 5IWAB 3VMFA 2CXNA 3C6XA 5DW3A 2IA5A 1Z7EA 1PCXA 3H5WA 3AIIA 4EAQA 3QVOA 4UU7A 3FOCA 1FRNA 5KYUB 3SF0A 1EFLA 3MZ0A 3PFBA 1LEHA 1NBIA 4TTVA 4YO7A 3KSAC 4P54A 5JUWA 4RCZA 4FFVA 4MWZA 4FMBB 4DJAA 5J2TB 4J3NA 2KBEA 8OHMA 1YQUA 4X8MA 1FK8A 2GN4A 3KVVA 2WU3A 5DM0A 1F06A 3LDHA 3HRHA 1JWLA 2Z57A 1UKBA 2JH8A 1WHTB 1ARZA 3CYFA 4ND8A 4OQMA 3H1EA 3E4CA 5CG2A 4U7GA 4TKZA 3TQOA 4I99A 3K9FC 2ZU0C 5KYKA 1QPBA 3RQSA 4AZ0A 1K08A 2EG5A 3A9WA 2X9GA 5ISMA 1Q2UA 5KNDA 4K9QA 1LD3A 3HYNA 1KEEB 1ISIA 3N7TA 5AK3A 4V0NA 4YP1A 1UPXA 5FBKA 1FFGA 4LHYA 3FUVA 3RUDA 4AJEA 2H5EA 3LPMA 2EKQA 4QFMA 4URFA 4YP0A 1QZTA 2WF9A 1AMOA 1IN1A 1NVBA 3HCEA 3WSVA 1RWPA 2G5GX 4WMLA 1TLTA 2O3RA 4F4DA 4MYCA 5SZIA 2A59A 4OVKA 2OV4A 1NBMD 3GLTA 1J4AA 4IQGA 3ZE1B 1QH1B 3K1AB 5EJAA 5FHQA 3VKFA 1TZJA 2QT0A 2FJPA 4MVJA 2P2ZA 4OHWA 4H6XA 3W2EA 3AM1A 2JZCA 2C1ZA 1KPIA 3WJ2A 3ZWNA 4ZO6A 3LFTA 5JSZA 1DL5A 3EPKA 1NLUA 2C9MA 2JJYA 3IIJA 2FG6C 3B6KA 5KSYA 1N8SA 3M6XA 4UU0A 1WTCA 5FXMA 1OH7A 3ZDEA 1VLZA 1YQEA 4QULA 2AG8A 2D1SA 2VPZA 1RPZA 3EYAA 3AJ9A 1BH6A 4R71A 1RWVA 4UHBA 2R6GA 1OHHA 4ND2A 4LC9A 5M2QA 2J9FA 4Q15A 1HR0B 3QEMA 2H1OA 1AN0A 1IEWA 1WR8A 2M6RA 3M83A 4J4BA 3QX9A 4LNAA 1RHMA 3LZCA 3H1AA 1YGYA 4QBKA 1HY3A 2CNLA 1TCUA 1PR4A 4EB6A 1YVUA 5IBCA 2DECA 2OXFA 2RC5A 2XT0A 4NY1A 1K9SA 3TQIA 1U9YA 4LF7B 3LXUX 3LP5A 4P7BA 2SKEA 4QOHA 4OREX 4S1TA 4AIRA 5C2JB 4ATNA 2GJ8A 2WVGA 3VMMA 2J8ZA 1BJKA 2D4AA 1NI3A 3QOWA 2O54A 2EQBA 3TSWA 1UPAA 1YMUA 4LX8A 2VZEA 3FDXA 5ENZA 3T6KA 2JIRA 3BWYA 1VJGA 4ER5A 3A3OA 1PUXA 2IF2A 3H3XA 3ME5A 5HJ2A 4INAA 5CVJA 1UC9A 3ZWAA 2WKSA 2YFYA 1YMQA 2IYQA 5IBRA 1T4CA 3D0QA 4IZOA 2QL5A 1CIPA 3EA4A 3GX1A 3L77A 4OXQA 5E1OA 1J9GA 4BO0A 2Y3IA 4E21A 3KL4A 4MXDA 1RJWA 1AF7A 1OWOA 3E5RA 3L0ZA 4QG7A 4Y9UA 3ZKWA 1VLHA 3DQQA 1LSSA 3H2YA 4D6YA 3CQ9A 2XDQB 1N6HA 2FMFA 5LOVA 1VBFA 4FYYA 2IHBA 3DWFA 4YRKA 2C1EA 4JK3A 3FI9A 1ZEMA 3QLVC 4CN9A 1HYGA 4CV2A 1C80A 2Q4TA 1TC2A 3IDQA 3PSAA 1K7XB 3DCJA 4BECA 5T3YA 3ZR4B 2I55A 4LYJA 5CEJA 4KGZA 5LMNB 1I0ZA 2C2HA 3D7SA 1BXRA 1VE5A 1VXRA 5HMLA 5TF4A 1J25A 1J1ZA 4C4ZA 3OQ6A 4KXYA 2ASVA 3HPQA 4M0LA 3IP9A 1U0GA 3QEJA 4YP5A 3FDIA 2OWEA 2XZPA 3G7SA 3EVNA 3G2KA 4IMJB 3DF9A 4UFPA 1A82A 3GRVA 1Q0LA 5AI5A 1IOZA 2Z2XA 1EK1A 2UUPA 4Y2TA 4L0DA 2G8LA 3AUKA 4II3A 3GL9A 3ASVA 3NAMA 4YDRA 1WABA 3E8MA 2WHXA 3GDOA 4HNHA 2UUOA 5ALMA 5KWVA 2VP2A 3O1LA 2ZJOA 2Z4SA 1JHAA 1US8B 4O2BF 1SQGA 1Y48E 1E69A 3D4IA 2G08A 1WSWA 1YI0A 4LYDA 4MS4B 2XCLA 3QPVA 4H60A 1P7VA 4M9XA 5AKXA 4QTXA 3ADOA 5CGZA 2B6HA 4OKNA 2IKQA 4GKVA 3U4MA 4AMUA 1NUHA 3BHMA 2ID9A 1RWOA 1OLSB 2ERXA 4W9NC 1V3UA 4GNRA 2XTAA 4BX8A 2APJA 4KFSA 3BWDD 1MOZA 4AKEA 5HQTA 4AY5A 2KJQA 1SULA 2YN0A 3BD9A 2EAUA 1AURA 2D5IA 3LY9A 4OHXA 4R3UC 2BGTA 1GSAA 2FUEA 4UTPA 1UH5A 2GOYA 4AWAA 4E09A 4ZA2A 1E18A 3K0AA 5BWOA 1PTJA 3QEBZ 2G25A 3MGKA 4KPUB 3TFWA 5I7SA 3R6GA 2JGAA 3WO0A 1I4DD 3LDGA 5CFQA 2XQJA 2DUWA 2XWPA 3C4VA 5CA1A 1QRUA 5I7AA 1YQWA 4WOBA 3NOXA 4ZVMA 4B8YA 3KJEA 4BP1A 4EF5A 5DNUA 3THWB 4M1MA 1JDSA 3E1SA 5TB5A 4DDVA 3Q8KA 3UMVA 1NRIA 3O38A 5DN9A 2O50A 4BFYA 3DDSA 1JKXA 1C1DB 1WHSA 3KNZA 4MV9A 5AO9A 1MGPA 4CM9D 5JDIC 1AS0A 3PGVA 5KUTA 1DU4A 4W5NA 3FLAA 3N1UA 3L0SA 1Z18A 1K2VN 4LZOA 3BJIC 2FK8A 3LPAA 3RV4A 3CVXA 5A03A 4EFLA 5F2EA 1Y8QA 2DBZA 1GO2A 4BMYA 4DLUA 2VHTA 3D1VA 4CR8A 2MHCA 1NBOA 3EJWA 5KAMA 1QLWA 4C1NA 2BI4A 4Y1RA 3TCKA 4BVKA 2P5UA 4UD2A 2ZLBA 1DAFA 1GILA 1GGNA 2LNDA 1VPTA 3G0OA 3HJTA 4R98A 5CT5A 4YMTA 3S2UA 1ZUNA 1KYTA 2FR8A 1NNEA 4B3XA 5DMXA 4UOEA 1V9CA 1YS1X 4HTFB 4OOFA 4QHYA 3I09A 2Y0CA 1XF9A 1V11A 2DCMA 4FB4A 2JIBA 2QL6A 3IQFA 2FX5A 4XIFA 2R96A 1NYTA 4WN9B 3U5ZB 1CJBA 1FYFA 3E2PA 1WF6A 3OQIB 4RLSA 4A0RA 4KODA 3T5CA 2R1UA 2ZAYA 3LUCA 3K3PA 3O3OB 5LP6B 4HATA 3LTNC 1DCFA 3RRYA 2ZBDA 3UATA 2M2IA 1T3LA 1YA4A 1KQOA 2V9CA 1BVRA 1QHFA 1WY7A 1Y9JA 2P9YA 3BGWA 4YWHA 2VDWA 4CM3A 5JH7F 4UTVA 3QV1A 1DRVA 2L42A 1K92A 2NSYA 4UW9A 1J90A 3GFVA 3WB2A 4C4OA 4RTPA 1ZRHA 3DL7A 1Y8CA 3GMIA 4GKAA 5KTYA 4DUZB 4E3ZA 1B14A 4NOMA 2W48A 2PBLA 4LA4A 3I6BA 2HWUA 2I76A 4BB0A 2AOUB 3RK0A 3WP1B 4CU2A 4ENQA 2HL6A 5JAUA 2AB0A 4BFZA 3WO1A 1F1BA 1H2EA 4HWKA 3Q0EA 1VSQA 4IGEA 4RD6A 5CPBA 1NRWA 4HC4A 1IWPB 3A4IA 4V38A 5JOQA 3S2FA 3PTZA 4IW3B 3QP9A 3QFHA 4IX1A 1PF7E 2EARA 4IGKA 2NVUB 2WQZA 1HZJA 4OLBA 2V96A 4I08A 4R41A 4A6XA 4EA9A 4C7OB 2I1LA 2JD0A 4HFNA 3L8GA 1M7GA 1ZK0A 1RQLA 3NIDB 4OSPA 2YIDA 3E8SA 3PUZA 4EG7A 5BNFA 1ZNWA 2NZVG 3C74A 5LBTA 1ABBA 3TIVA 2FPOA 1M1UA 5DP1A 3KZXA 3ZVRA 3H3FA 4OQXA 3RVPA 2WT8A 4DA6A 4YMLA 1S2IA 4N7MA 3BMXA 2P4UA 5I48A 2BWJA 4LHVA 2BL4A 4E33A 3KXLA 4GP9A 3VH2A 2GARA 4GWLA 2O2DA 4LDQA 3CSSA 1E9EA 2RB5A 1HSOA 4XIYA 4LE0A 2YXPX 5AOCA 1YJQA 1UUFA 3P2YA 1P1BA 3THSA 3LP8A 5EAIA 3BJZA 4EG6A 5KOYA 4H6VA 1VPDA 3B1VA 2X1HA 1N5MA 4Q1EA 2WF8A 1SXJD 4KAFA 5K3SA 3WL4A 3B6JA 2ENUA 1M0EA 3U3DA 4QUJA 7REQA 1CUZA 1JHXA 1TL7C 4HZGA 4X0EA 3BTOA 5DSXA 5G02A 4E46A 1H8HD 3M33A 3OOWA 3KLMX 4PAGA 1DRKA 1FVXA 3V1UA 1LZLA 4BMPB 5JRDS 1YTUA 3FPKA 3GI1A 1G7CA 1QX3A 4QDUA 3V00A 3TQSA 4WJLA 3ABZA 3WQBA 5AIAA 4TT3A 3JZIA 3UJBA 3ZE2B 1RHJA 4MB2A 3AF3A 3VXKA 1W8DA 3A1WA 2GSWA 5E8JA 3WADA 3PQDA 4EFKA 1DTSA 5DN6A 2DFTA 2R1TB 2IPLA 1NVDA 1RM4A 2DP4E 2ODAA 3H16A 1ENOA 4O63O 4MICA 3T5TA 1U1CA 1QUFA 3ML1A 3KQYA 3NT2A 2ET6A 2JHAA 1L7EA 2I6SA 3NANA 3WGOA 1M2VA 1G9XA 3BMOB 1ECBA 4OK5A 1EPUA 1RU3A 2OGTA 2VLIA 2IYZA 2ERYA 4H7JA 2BZGA 4TKVB 1L5QA 1IQ0A 1R0ZA 1OGJA 4PO1A 1NRJB 3U1TA 3AFNA 3S2YA 3VSEA 2RGRA 3IKJA 1ZZEA 3OI7A 3PI6A 1FU8A 1DKOA 4FYVA 2ZW9A 2FMIA 1UMBB 2ZCJA 3D1JA 2QLLA 1IZ8A 3EJ6A 1TQHA 3TZ6A 3VYVA 5LIPA 1H22A 2UVQA 2HRCA 1CR1A 1LWOA 1VLJA 3K09C 1DTWB 3RPEA 2VT2A 4JHXA 2ZWPA 3V1LA 1CK4A 1R7RA 4KIWA 3JQ7B 1V7ZA 3KCQA 5CVUA 1X1TA 1JR3A 2IPNA 4NYMR 2AK3A 4DVGA 4GR9A 3MQ2A 1EFAA 2ZBVA 2V6IA 1R0BA 4CT4B 1FJXA 2PA3A 2BMVA 2WUWE 3DOEA 3GMSA 5LNK1 2I6QA 2QGNA 4KNVA 3GIWA 3PPWA 1Z39A 3H04A 3IUYA 5F52A 4HGRA 3U7HB 4EP1A 5AM1A 1J00A 4M1SA 4NU8X 5E38A 3R74A 1CW2B 1USWA 2O2ZA 4OQFA 5DB4A 4X6UA 1OFTA 2JJ1A 1S0UA 3FUXA 2ZTHA 1ESNA 1KZ4A 4WW0A 2XT6A 4EHIA 2FN9A 1V7PC 1SHUX 5LQCA 4MDHA 1EJ6A 2X6QA 4M8SA 1M2WA 1P5JA 4BJ1A 4K6HA 2F55A 1MXHA 2AX3A 2CLMB 1WVIA 1DAOA 2OK8A 5DGHA 4QT4A 4FS8A 5GTDA 1R88A 4QX6A 4Q01A 4F0JA 3P5SA 3BMOA 4DIBA 1JXQA 2FPPA 1W75A 1EDEA 4KLNA 1UL1X 2WYWA 5AXBA 1ZKMA 3NBUA 4HYQA 4MA4A 1OA0A 2CLOB 3MRTA 3TX6A 2AN5A 3UMGA 3HB7A 4XQCA 2YWXA 3FUWA 5JY1A 1B7GO 2IHUA 5JZ9A 5EJ2A 2K7ZA 2WJAA 1QWSA 3PL5A 4QHTA 4RHYA 1Z28A 1EDDA 5KU1A 2CV1A 5F35A 4I4IA 3LUPA 1Z5UA 4UHKA 1DKMA 4FDTA 4UXHA 4Y2RA 1ULBA 5J1TB 2X0EA 1Z8DA 1XI2A 2FMHA 1VG9B 2BVNA 4M8LA 4HQRA 4KAJA 1K06A 5C35A 3PC7A 1SKQA 2PL9A 2JAXA 1FIUA 4JODA 2QQGA 3UXYA 2DH6A 3IODA 5TPZA 4KRXA 2JLBA 4O4HA 3UW1A 4NTZA 3TD2A 4DV4B 2WIBA 1SOUA 3MPOA 4M0MA 2VYVA 2FZGA 3T7KA 1J99A 7ABPA 1O2DA 3L0IB 1JBEA 1VYHA 1RAGA 5CAEB 3RHFA 4BNZA 2BI7A 4TWZA 3QPCA 3R0XA 2IZ1A 4EY3A 4IEEA 1K6JA 4J6FA 5IDWA 2XNSA 4BPRA 4R5MA 4GM1A 1F8UA 3K15A 3B5JA 3ZHCA 3EZLA 4P34A 4RDIA 2NPOA 4L9AA 1JHZA 4KE9A 2F1KA 3U9SA 2UYHA 3WV5A 2CD7A 1FBTA 5K9ZA 3DJFA 2EKLA 3D9QX 1BIFA 1SKAA 4Z9YA 1LLQA 3CX6A 1X3SA 3EVBA 2C57A 4Q7LA 4B2PA 3GUHA 3AUYA 1A7AA 5IAEA 4YRIA 1K8RA 3GRUA 1B41A 4KWHA 4HAYA 1QIDA 2BM0A 2BM8A 4AI6A 4EHLA 4KU4A 2QRHA 5DV9A 3VC7A 2DKOA 2IPXA 4PLZA 4BFWA 1EUDA 1L4BA 3UWPA 3B85A 5K8VA 5KWSA 4JOSA 2GI4A 4UKDA 1SBCA 2W2NA 4BEBA 3TMAA 4JOCA 3V7NA 3LLUA 4MI3A 3AEUB 1GTSA 3TKLA 1YZVA 2QAGB 4DLVA 3S1AA 1KMMA 1QOPB 4R0NA 3DEJA 3ED1A 2YL2A 2BJWA 1MB3A 5FOWA 5HZKA 2B5WA 1TW3A 1RQGA 2Q27A 2ZSBA 2I6UA 2Q9CA 2P41A 4YAUA 1WZNA 3SSMA 5KTSA 4ZANA 1YJ5A 1HBJA 4F56A 1L4YA 3F7MA 3KPYA 1APBA 3DOJA 4R31A 1RKVA 2AKYA 2WTNA 1N0WA 1UMKA 3A6ZA 2X14A 4L07A 3RKSA 4EL5A 4AT1A 1NXPA 3A06A 1QU3A 4RV9A 1Z83A 2AFHE 3P9SA 3QEAZ 5TQ0A 3MJFA 4BO5A 2Y0DA 1SBHA 2AW3A 1W1WA 2CNKA 4K9MA 4ZVKA 2IIPA 5A4FS 1H2ZA 4MR9A 3JWPA 4ZYZA 2YV2A 1G5PA 1KQGA 2HBQA 2CUNA 3O9ZA 1WMSA 4CMCA 5SYNA 2CL5A 2HZBA 1OT5A 2JDIA 1GR1A 1M6EX 3M8KA 4LQLA 2I2WA 3ENZA 1JIIA 3MTEA 1UJ5A 1KRXA 4FKMA 3WYGA 4MRAA 4JMLA 5BN4B 4G89A 5K8JB 3RC8A 1NJ5A 2CLSA 4ZT2A 2DFLA 2QQ0A 4A10A 4PBTA 2J41A 3FKQA 3INRA 2UZ4A 1QP7A 1MHTA 3DUFA 2I7CA 4U2KA 1QGDA 1MO3A 2WU1A 3NC4A 3U3OA 4DE5A 3F9CA 1RACA 1FTGA 2R8EA 1I9CA 3NVDA 5F21A 3UJNA 1QDEA 2V6JA 1Y63A 4J0EA 1CQWA 3WQSB 2J87A 4BX3A 4BYMA 1R18A 2DWOA 3H6GA 3JQPA 4G63A 1CJUC 4YJ2F 4JI0B 2XCRB 2NWQA 1YACA 1KKUA 3UOWA 3KTAA 1NT2A 1Z88A 4TRRA 1UZAA 4D8YA 1Z22A 2PVSA 4EW2A 4GDFA 1AQ6A 2YWFA 2W70A 3ZI7A 2C5BA 1G1MA 3A3NA 2I3BA 4BEVA 1LA2A 3PGMA 5KQGA 4IQ0A 4YV1A 3SC4A 2Z5GA 1XQ9A 4LS3A 1XA4A 2D54A 3CNHA 2C92A 4G4IA 2J31A 4PTYA 1YS2X 1RTKA 4OK3A 1H3FA 1KEVA 2O3QA 2XE7A 2G6TA 5CDHA 2XECA 4RSMA 2J85A 1J70A 3IAEA 1WXEA 2DTEA 5JD4A 1W4BA 2UXCB 4RXMA 3V1NA 2Z8YA 4BFUA 4FOPA 4LYAA 1NN1A 3ADDA 3OVMA 1TZCA 1YCFA 2FN4A 1HUQA 2OM6A 3K0FA 3WZMA 1B6TA 4WIAA 2MOKA 3QX3A 5D85A 4JLKA 3TN7A 4YP7A 4ZDIA 2PKYX 3OOYA 4HNRA 2YJ5A 1L4GA 3NBZC 2HWKA 1W87A 1MT3A 2G40A 4PF1A 1SRRA 4IDCA 1EUCA 3CVYA 2FEXA 2ID4A 1XMPA 4QODA 5JEEA 2XKJE 5JWOA 1WBJB 5G4KA 3GPLA 4WLFA 1IY2A 4IILA 1T5IA 2VDVE 1QVWA 3AFIA 2FK7A 3MRXA 2VP9A 4GX2A 3S40A 2ZRIA 3TJMA 1XVIA 3TOCA 3A6HA 5HZHA 2Y77A 1E2LA 1Q84A 1SVIA 4YCBA 2C58A 1LVHA 4GXQA 4KBFA 1ZH6A 1JIVA 3KC2A 4DYHA 4F84A 2OYCA 1JMYA 1K97A 4XTCS 1MO2A 1JAHA 1J23A 2FW0A 2GJ4A 2PKQP 5LLDA 4IRUB 1ZNZA 1HT3A 1CJKC 4L22A 3F78A 1F12A 3LWBA 4AWXA 2O2XA 1ULZA 3OP4A 4KE7A 1BA2A 1LJLA 2AGVA 2EVWX 4QUKA 5LC1A 3PXXA 2ZTMA 1GEEA 1A4XA 2EWVA 1LLUA 2Q3JA 1CY7A 4NSNA 2J6BA 5LP6F 4G1UC 3AK4A 4B9AA 2C20A 4E5YA 4QDZA 3JYLA 1NSTA 2ZIUB 1Y7HA 3RS8A 1CRWG 1HPLA 2PYZA 3IQXA 1TKRA 5KOIA 1BH2A 2SKCA 4FOLA 5MN5A 1KVQA 3AZOA 4JENA 5CNMA 3I2YX 4X92A 3CVUA 5EE0A 3PS9A 1DDGA 4E08A 4ILEA 3JV7A 4I55A 4Q1FA 3TMYA 1FMFA 2ATCA 2ZKLA 1VLVA 4IP0A 4OJTA 1R8SA 4HMOA 1PK9A 3ZCPA 2J1LA 2WJ4A 1RI4A 4I8DA 4R9RA 4ZZ2A 1IQUA 2PJUA 4BBAA 3QVSA 1Q57A 2YJNA 5JQGB 4DB4A 2FKAA 3VYRB 3VH1A 3GJ0A 4X63A 3TW4A 4UBKA 4C22A 4IIJB 1EXWA 4LRWA 4TWIA 4EECA 3ZDCA 2YCBA 3Q0IA 3EUAA 1JDBC 3EF1A 4KN9S 2QX9A 3DZIA 2R44A 2EP5A 5B1HA 1ONSA 4PONA 4RPGA 4IXWA 4U7FA 5AJWA 3SQNA 3FUCA 3HADA 2AQ8A 5IUKC 1G2IA 4POOA 2IODA 1LI4A 1MA3A 4JL8A 4B2YA 1M6VB 1V8FA 2BAGA 1ZIDA 1K2WA 1UMDA 2NNWB 4RKQA 4GH5A 4RCVA 1HNWB 3BK7A 1SB8A 4H7HA 5D84A 2VYQA 1CVIA 1L4LA 1QSGA 1XDDA 3AESA 2Y1GA 3HYRA 3O2NA 4G5QA 2WUVA 3AI3A 3ROGA 3SDSA 3EZYA 2RHHA 4GOJA 4EA7A 2FEWB 5M04A 1KY3A 1ML4A 1J2UA 5JO9A 3H6KA 4D4MA 1Q1AA 4FFBA 3E05A 4NJMA 3C6KA 2HF2A 3OHPA 1GT6A 1SCUA 4Y2HA 3BSWA 2IYLD 2CFRA 1DPFA 4JUAA 4R9VA 4E11A 3QE3A 1BFUA 2BFEB 2WJ6A 2Z2JA 4JB8A 4YROA 3ZI0A 3ZTYA 1G3RA 1CEQA 2H1LA 4UE2A 1MLDA 4W82A 1IPFA 3IQDB 2HJVA 3AFMA 5EPEA 1EA7A 2Q8NA 1R50A 1TUIA 1XN4A 4I14A 3UEOA 3R3VA 4RTLA 4WPGA 1L1FA 2H9IA 3P2KA 1I2AA 2W90A 5EIAA 1TYCA 1VMDA 2R4QA 3TLCA 1BJRE 5FADA 3UAYA 5JHHB 2FZEA 1HG0A 2FDXA 4UAUA 1OF1A 1ZH8A 1ZD1A 4O5AA 1W6RA 2YZKA 3CX7A 3JQEA 2E21A 5DLEA 4H7IA 3AY6A 5EWLB 1PYDA 3BGDA 3NBQA 2GO1A 3T3EA 1N5LA 1VI5A 3HDTA 3QXGA 3D4OA 1RAEA 1RYFA 5KTMA 1A98A 2RGYA 4L1KA 4EKDA 2FPKA 3ITEA 2C4TA 4RE6A 3C7CB 1GZ6A 3TD9A 4RAOA 3ZBTA 4F5DA 2LE0A 1AU9A 2FP4B 3M6IA 4L4ZA 4ZICA 2GAOA 1GGEA 3CKKA 4B4VA 4Q4HB 4JJFA 4FS3A 4YXWD 2IYSA 2CY0A 3UUFA 4OLHA 5K3AA 2PMKA 1VIVA 2Q2WA 3RS5A 2IOYA 4HRAA 2X6RA 1FA9A 2A86A 2AJCA 4XIIA 2XSZD 4KXFB 4UPDA 4CKBA 4V3CA 5FTNA 1KXZA 4F85A 1ZJYA 5MDHA 2BBOA 4NFLA 5A5EA 1N2OA 1YR9A 4JLWA 4ZTZB 1ZHOA 5H5JA 3GARA 1RI2A 1NA5A 3S2IA 4W5HA 4X20B 2CHGA 1D0SA 2HDWA 3I8OA 4HPJB 4BVBA 1PDWA 4CIVA 3HNOA 3DKPA 4JLJA 3W7AA 5I9MA 2E87A 2XNCA 1YU9A 3PU6A 2BTOA 1YR6A 4M49A 3V5NA 1JE1A 4PAOA 1U65A 5IT0A 1TU3A 5L4SA 1JQKA 3SR3A 3HWRA 1ZICA 2QN6A 2XT9A 3TEMA 4P58A 1T5DX 1PG5A 1RBZA 5BSUA 2WSSD 2D0OB 4OGKA 4REMA 4GL4A 3BXZA 4PPFA 4D25A 3RS2A 1N3YA 3DT8A 1IONA 1Q0HA 1THGA 4B3SB 1S6YA 4JYBA 2WICA 1EX7A 2FPSA 2QP4A 3DTYA 3E70C 3EZNA 4MW4A 1IDOA 4O2AA 4P7FA 3W8DA 2FZ4A 2N3ZA 4GPEA 4ZZ3A 3ZTTA 5B6IA 4DR4B 3ID6C 1NJ1A 3AVPA 4FOSA 4QREA 4L8GA 1C1XB 4L95C 4OG2A 2GB4A 2JLSA 1N5KA 2YMLA 3ELYA 1GPH1 1N2BA 3DMPA 4NZMA 4WLEA 4YMIA 2YN4A 3D6FA 3DS8A 4KH1A 3RROA 1G291 3PC6A 2CVOA 5BW8A 4A16A 1RM0A 1KWKA 3LT1A 4K6CA 3RUCA 1LRJA 3L0CA 3H0CA 1N5IA 1UBGA 1XQ1A 3BK1A 3DLPX 4MQLA 3Q40A 1T4DA 1HNZB 3IEXA 3ECAA 2HXGA 4KPUA 4KXUA 1X80A 2IU6A 4BMDA 2WUDA 4FQ5A 4A6PA 1K3UB 3MCAA 1MJNA 5D1HA 1FP4B 1PFVA 1RRCA 3OU7A 5EIBC 3AKDA 4EB6B 2HU5A 3SGLA 3WB0A 3FIJA 3FNFA 4AS1A 2MINB 4RTSA 1L5RA 3C1UA 3W7BA 3AL2A 4YO8A 1MD9A 3ZGVA 2QRVA 3BQ9A 1L3CA 3GAAA 3OM0A 2YYSA 4LXYA 4F5ZA 2HA4A 2ZUUA 2CF5A 3D6TB 3LX5A 1PDVA 2KHZA 4RKFA 5C53B 3DFKA 4OHBA 3SOPA 5KJCA 3NPMA 2X8JB 3VKWA 3OCVA 1E0JA 4F3NA 3UAVA 2G04A 1XOIA 2VL7A 1PT8A 5FJJA 4BVFA 3UCFA 3HXQA 3MSCA 4OM7A 3UWDA 1FXUA 4BNNA 4YRGA 4X7RA 5BV2P 3KQHA 1XXLA 2QJWA 1I4LD 4YCNA 2XNDA 3EW9A 1F17A 2C4WA 4NE7A 5CM9C 4TQUS 5F23A 3B7WA 3LAWA 4HH1A 4UXJA 5AI8A 1H6DA 3ZG6A 1C9EA 1L7BA 5HIAA 4JDPA 4Y2GA 1I8TA 2D0DA 2HMWA 3PXEA 4YH1A 4J1TC 3BFPA 2NAPA 4E5SA 1ENPA 4OBBA 1KO7A 4R2JA 5CNIA 1MJ5A 1PR9A 5CBKA 4LK3A 4RVSA 2OCXA 3A3YA 4ETIA 4KHPB 4J43A 2TECE 5EC8A 3NHSA 3EAGA 5H70A 3HPRA 3RYTC 4FEGA 4LDRA 1YQTA 4B2LA 5HQ3B 1QHGA 4GMFA 2XZLA 3HBFA 1NJFA 5JMOA 3O91A 3C8HA 4NZ9A 1SO8A 2AFRA 2XODA 4QD3A 4D9FA 2B1GA 4D3YA 1FPQA 2IYRA 5I9BA 1U0NA 4ZTBA 3MUFA 1J20A 3PVSA 1CUIA 1N6RA 4BY9E 2WD7B 4ZIRB 4FMCF 3RK1A 3SKVA 3DLTA 1XP5A 1UXHA 3FDZB 4EBFA 4Z4IA 3L7IA 5DNYB 3K4HA 2GF9A 2F3PA 2IHVA 2ZIFA 3BGSA 4IY1A 5U4XA 3V8BA 2H1CA 3NVAA 2C78A 1RPNA 2PL3A 3IDFA 1EFPA 1VDMA 1G8KA 2Q4DA 3OCJA 5M7EA 1TEHA 3OJEA 1E3MA 4C6HA 7ADHA 1G7RA 3H5RA 3MXOA 3MGAA 4M9ZA 2JI6A 4JYZA 4O2AB 2X0RA 3WHKA 4XQEA 3GLRA 1ILWA 4JJAA 3VPBA 2Z2ZA 4TYNA 2QN8A 1QZUA 3O94A 4Y3UA 2I71A 1YTLA 2OGZA 3EVZA 3N59A 1Z0SA 2HF7A 3QYJA 4H0FA 4S2EA 5ERYA 4XWKA 1I6KA 1QVVA 2Z09A 3A1NA 4WFKA 1WVMA 5DKFA 5BYJA 2OMKA 4FZRA 1SVNA 1VECA 4IJKA 2BCGY 5K3OA 1AV7A 1UINA 2LBPA 4OQPA 3A7DA 2F3SA 3D4LA 4LYYA 4PAWA 5IBPA 1DCMA 2C00A 2OVBA 3K1TA 1WPQA 3O3NB 1UBCA 3JRXA 5AI6A 1AHNA 3SBDA 3UMBA 3ZYCA 4TMVA 5JHGB 4HFMA 4WD3A 2H31A 1ZRSA 1L5SA 4LCJA 4UVEA 3VAAA 4C4YA 2C04A 7MHTA 2NXWA 3ANLA 4MCJA 4PSAA 3IB6A 2NSDA 4OM8A 1BXGA 3HJFA 3WNZA 2O0JA 1U3TA 5D5HA 1UF9A 1PNVA 4L8LA 4DQXA 2IZ7A 1NBMA 1A8UA 3WHLA 3UAXA 2UDPA 3KOZA 1F3LA 2Q6OA 1UM9B 2EHJA 1DQSA 4J7XA 4KR0A 3ZWYA 1ZR4A 3ORFA 4QU0A 3X1WA 2HPAA 1GRQA 1I1NA 5E6UA 1EVQA 4FYKA 4UEKA 4QELA 4D43A 3EEOA 3ILXA 1NVUQ 4P38A 4PSVA 4OP1A 5CGQB 2XMBA 3HVRA 1D8AA 4LF8B 2JFXA 3SZ3A 1NXQA 4MUMA 1CE8A 3STXA 3V33A 3MJHA 4FD2A 5CDYA 1L9KA 2CBZA 4N5DA 5H8WA 1NVXQ 4IGIA 3A1CA 1A1SA 1XYGA 2ZTSA 2Q50A 3ODGA 1ZCBA 3ETNA 3F46A 4KN6A 4Z0TA 3TRJA 1MJFA 4QWMA 4B7UA 1D07A 2PGXA 2Y8EA 2J5RA 1T26A 3F90A 4OIFA 1R0CA 4A2WA 2O19A 1Y7IA 3TW0A 4AFNA 1JUDA 4A15A 3O8NA 3ZCRA 1U7PA 4OUDA 4P4SB 1Z0FA 2X1LA 1FB5A 2A1IA 5CM2Z 4HNUA 3SEQA 3QPWA 4FNGA 1KR2A 3C1AA 1QDLB 2K2WA 3JRNA 3RJ5A 3O8QA 1WM1A 2EL9A 3OQIA 3OQNA 2FCRA 1YD7A 4DY6A 1Z56C 3ONNA 2VAWA 4PINA 4BZXA 1NXTA 5ALXA 4CTMA 3ESZA 1GPWB 5BRNA 2OKCA 3U7JA 3VH4A 4QLBA 4LGYA 2WD9A 1XKLA 3QIAA 1U90A 3C8UA 3TIXB 1ZGHA 1XDWA 3GB9A 4EJ2A 2JGEA 1H9CA 1PSZA 3A4MA 3ZC3A 1UOQA 4ASUD 1NPTO 1RM3A 2FOXA 3FWHA 3LYUA 4WGFA 3DZKA 1E99A 2WABA 1YDEA 3MM4A 4JYPA 2Y9PB 3QLJA 5JVDA 2H08A 2AEMA 3G5MA 4K2HA 2QSJA 3L8FA 2FQQA 3SAJA 5BURA 5LQKA 5FPYA 5HILA 5LWQA 1GDTA 4RK6A 4IHAA 2VJLA 1CERA 4K7JA 4HUQB 3IJ5A 1SNYA 3UC5A 3HNRA 1MNAA 1RLOA 3BTSA 4Y7DA 4DBLE 2YNMA 4Z1MA 5BNTA 3A9CA 3R23A 2AD1A 3CW2A 4E4TA 3BD6A 3DR5A 1IBLB 4FC7A 2GLTA 4J76A 1VE3A 3NWBA 5FEMA 2OBMA 4MLCA 3T9BA 2HJGA 3ONFA 4Y2UA 3T3MB 3WTBA 3KEMA 1JQAA 1W29A 3H1FA 2I3ZA 4UE3S 4EATA 5IJ0A 1KS2A 1MQSA 3GCXA 3A0UA 3D6HA 3ICPA 4C08A 2A88A 5A3RA 3WRWA 3HR8A 1YKSA 3K8OE 2ODBA 3LLMA 4AS3A 3MJDA 4Z51A 2O0LA 1COWA 4B40A 1Y5NA 4NNJA 1W0CA 2J3EA 1XK7A 2A92A 3GG9A 3GG2A 3HKCA 4M1ZA 4A91A 1JHRA 1GL3A 2ZPUA 2COKA 2W4MA 4TYYA 3D02A 4NMLA 4OFWA 3KE8A 1E4YA 4RVHA 3NHKA 2QTTA 4TRMA 5L3ZA 1PI3A 1AVTA 1OAOC 3AUJB 1Y1RA 1YAHA 2XCOA 4GMGA 4N7JA 4TL6A 3SOZA 1CTQA 1E32A 4GGMX 3RE1A 4OBWA 4ZT7A 4AB1A 1R9NA 4LI3X 1ISRA 1GQYA 2SNIE 4IICA 1LNZA 3OECA 3RVLA 5IBQA 1JPUA 3VDNB 1VOTA 5J2TA 2ZROA 4D79A 1N0IA 5DM4A 3IEUA 1RRKA 4GSYA 2HJHA 1KA9H 3BIXA 3JSXA 3KWLA 2VNAA 4B3HA 1U0BB 5CFLA 1JJFA 1BN6A 1SC4A 3MCUA 2LCQA 5M34A 3CUTA 4RH1A 4BNXA 1FFHA 1HLDA 2BGRA 3NC0C 2D7DA 3ZLVA 4ARUA 2IYEA 1O96B 2ZQYA 2JAUA 4MB0A 1AZWA 2BELA 3C7TA 3SE7A 3UV7A 3TTVA 4IDAA 4NZOA 1TAGA 6REQA 1JVBA 1MORA 1LK7A 3E3OA 3DEIA 4N7RA 3B1YA 5DISB 3WRVA 1WPXA 2XH8A 3CZCA 4II7A 3OPQA 1JT2A 4HZIA 2W2LA 2VK8A 3LCCA 4G3XA 3HO6A 1T10A 4I5IA 2C9BA 1GN8A 3NTUA 4UM7A 1RBMA 3MMNA 3NWJA 3OPNA 4TQGA 2O1SA 2WWWA 1T29A 2ZSKA 4BTLA 3FPFA 5JG7A 4EPRA 1K8XB 5KB3A 3P9RA 5C8VA 2JRLA 4UM8B 2EWMA 1UJCA 2O5RA 3LGAA 5AKIA 1CDZA 3MRSA 4NWIA 1TF7A 2CLKB 5CBPA 2WQ6A 3R7AA 1RWBA 3VR0A 2H2IA 2Z8YM 1P45A 3QVLA 3KWFA 4BJ5A 3LNTA 2FDRA 1C1DA 4XCVA 3C4JA 3DULA 1E9RA 3KKOA 5AW2A 1LVUA 3ABQB 4X8OA 4ALIA 4EZIA 4UVIA 4EG1A 3H2SA 3PFNA 4W1RA 4O59O 4U7JA 2G4CA 5AKJA 1SKUA 2OXEA 1YI1A 1SUWA 1ZMBA 1EFRA 1KL7A 4W8OA 5IHPA 5LMCA 2H07A 2FUKA 3S8EA 4QUAA 2F64A 2XCUA 1J8VA 3IT0A 3ITNA 4HQ0A 1PQPA 3R0IA 4GPZA 1WD7A 3IPLA 3LXRA 3JPYA 1BX0A 3T7CA 5ENDA 2C99A 4C07A 1IHYA 1R0KA 1MJGA 4TSRA 3SIWA 5IAGA 3GV0A 1E79A 3GO4A 5JU6A 3UYKA 2IIBA 4W1QA 2W2TA 3AI2A 4WVFA 2VRBA 4LOIA 5D1NA 4RETA 1MAAA 1F3OA 3H84A 4BQQA 3IPCA 3FHOA 4R5HA 2WT9A 1JI0A 1G4AE 2YRXA 5B3KA 1ZOIA 4IOMA 4S1WA 3M3DA 1YZKA 4CLRA 4W5RA 3B38A 4MWCA 3F96A 2WHRA 3WLJA 3C7AA 4LJ4A 2ZRHA 1ISPA 3DEFA 1XNJA 2HYDA 3ESAA 5DBEX 3O3MB 3M5WA 5SYMA 1XPUA 4XYLA 1EFPB 3FMVA 3QWHA 3JD2A 1WOMA 2ZTVA 3EZFA 4FKBA 5TJHA 3RDPA 3RU9A 1O7JA 3U7QA 1T2DA 2P6RA 3MTJA 1Z4QA 2BKVA 3B3GA 3T5PA 1TVKA 4LPKA 4LXQA 4ZN6A 1EWRA 3BB3A 4NESA 2Q07A 4EY4A 1J7JA 2ZSDA 1NE2A 4S35A 5LA6B 3LLCA 1M0WA 1JU9A 1CY1A 1R8JA 2AYYA 3HUTA 1KAHA 3IBGA 3PD7A 1NGSA 1JQEA 1REQB 1NC3A 2UVPB 3GLHE 1A4IA 3AIMA 3OZUA 3W0LB 2HCRA 2FTKE 2L2QA 1JEDA 2Q3BA 3HJRA 4HS9A 1XTIA 4W7HA 4JR1A 5M29A 4Q9DA 1G59A 4FBMA 2W8BB 1JFVA 3RHSA 2P7HA 3PNQA 4XWWA 2Q1YA 4UUAA 2GKGA 3CB2A 5KYUA 1G5TA 3TEFA 5K6AC 2QVGA 2JRCA 4ZTUB 1GAJA 2ZM5A 1F2VA 3V4LA 5FV4A 3C0KA 3TDKA 4S04A 1T2VA 2JFHA 4G67A 3N0RA 1GNLA 2OV3A 2R5WA 3PK0A 4GYYA 4PN7A 1QO0A 2CXOA 3WWOA 3PWKA 5LQJA 1CY8A 4MVJH 1HSZA 3GFTA 3H2JA 4KXXA 2FZLA 3CGWA 1BS2A 4KAXA 4POAA 4B3FX 3DLHA 5FF9A 1QP4A 2F6RA 2GYVA 1VHDA 1ZJ4A 2W98A 1E6CA 1FCJA 4B35A 3E3AA 3EVFA 4EJ0A 2QW8A 3MFYA 3V9AA 2YOHA 3QVXA 1YQ9A 3GJ4A 4G1BA 4K05A 3THYB 1DKUA 2OZLA 4A5SA 2RHOA 1BDJA 4ENTA 1XBTA 1FYDA 3GRRA 3H75A 1A72A 4QDTA 4Q39A 2QBYA 2H7XA 2GJAA 2R2GA 4MV7A 1Q7EA 1F0YA 2VQEB 2G4LA 1FLDA 2DX7A 1Q74A 2FR1A 4ZQEA 2QXUA 1KJ8A 5ALZA 4MINA 4ZARA 3ZWWA 1HF3A 4FZ5A 5F7OA 2O1WA 2AMFA 5CW2A 3G5TA 4BMZA 2GK7A 4N0MA 5H68A 4FWTA 4OXIA 3QMPA 4BFVA 5BXQC 4AY4A 5I4KA 3S7ZA 2OO3A 3ZU3A 1OE0A 4GHWA 5L3QB 2R6DA 3BMNB 4KPGA 3IUJA 2NQ2C 1ULTA 3HVHA 4OI4A 4OL0A 5EZ6B 2G1AA 4JSYA 5ESXA 3VYSB 5KINB 2WIJA 1Q0PA 2HBYA 2PGJA 1D1SA 1Z34A 4IGFA 1M7HA 2OHXA 4C76A 1EE1A 1LGYA 2ZOSA 3MNFA 4FCCA 4H7PA 2A0XA 4YV0A 3INGA 4Q7KA 1QE5A 1XZMA 4QPCA 4L5CA 4EVIA 3MT8A 3RU2A 1KOJA 1X7GA 2HBRA 2VF8A 1B16A 2XD4A 2ZJ5A 4BO6A 1XDSA 3AVOA 3ICWA 4GG1A 4DCGA 4NEGA 2YWGA 4JIGA 4D4GA 3JALA 1BCSA 1XZAA 2IEZA 3SDZA 3C5WP 5JS6A 4YAIA 3ZV4A 1XCJA 2D5LA 1RXYA 3VVBA 1NL3A 1XZLA 3NQ41 1O5OA 2OCPA 2XF2A 3IP3A 1D03A 1WDWB 1ADFA 2H4YA 3OP1A 4F8EA 4H1WA 1WNTA 3TK1A 2PE5A 1N1DA 2FE4A 2AS0A 3H8JA 2P27A 3W78A 2P9FA 1AKQA 4A2CA 4C4SA 1R0RE 5TARA 4TV9F 2ZYWX 5FPKA 3NPAA 4X3OA 1FTSA 4DJJA 2QJOA 4AZ3A 2WT4A 1A9QA 3ET4A 3FX2A 4QSMA 4W9NA 5BR4A 1V96A 3GLIE 4BO2A 4DA4A 2MSLA 1E0AA 2F59A 4Z4FA 1G8AA 1PGPA 2WE7A 4HLCA 3RK4A 3SZLA 3C3PA 3H5TA 4YMHA 4M0FA 3NKLA 2W00A 4J9VA 1KEPA 2KE5A 4Q4DA 3NB0A 4WX2B 3U80A 5JTTA 4LTDA 3FTEA 2ZVQX 3NHJA 2GASA 2CE7A 3B9QA 2DPHA 4LXXA 1XMIA 4ILKA 5AJTA 4DA7A 1CYEA 2P65A 3FBWA 4K6FA 4DJ5X 4DR3B 2OO5C 1D04A 3NM6B 3I1IA 2GEUA 2N9UA 3MD0A 4NZPA 1ZCFA 5BQOA 4B3GA 2GXUA 4GLJA 1Y9ZA 5D3QA 3IHWA 2P9GA 3FYUB 4G1EB 1JBQA 2QTGA 3FNHA 3TZHA 3AR7A 2NUAA 2XYHA 5AESA 1PWZA 2I5PO 2PSFA 1KAOA 2GD1O 3GPIA 3OFSA 4FUTA 4TSFD 5C0OE 5JS7A 4X5OA 5E3IA 3GCWA 3F47A 2UZIR 5FLYA 3VPHA 4DANA 1IK6A 4G4JA 5ECWA 5BMVA 4RA6A 1MC1A 3UV6A 4ZAGA 5TQ0B 4XJVA 2BCEA 5HKAA 4JI6B 1YR1A 2EHDA 5HIIA 2Q5IA 2C77A 5JAQA 1OLOA 1ZHFA 2RBEA 4DCTA 1BYUA 2QYOA 4A8JB 1CDOA 2FV8A 4I9FA 3T7SA 2WMYA 1EUCB 3LHFA 9MHTA 5ALNA 1OXSC 4GPAA 3DVSX 5C46F 4B79A 2BFEA 1P0MA 4HYEA 2NUTB 4PC3A 1RCTE 3LXXA 4F6RA 2C5FA 3IUQA 4YREA 3O8OB 4DCPA 2GWRA 3E2IA 2UZ0A 1YRHA 3U0VA 4BV3A 4OTZA 1Z5GA 3HKEA 4H3KB 2B4QA 3FF1A 5FNZA 4E5MA 1O0BA 4U2FA 2O8BA 1RABA 2G9QA 3LL7A 4AK9A 1R37A 3I3SR 3OLZA 4Y2SA 4ZOLA 3HN6A 5BUQA 4KZKA 4DHEA 3JARA 4EPXA 5J58A 4ENSA 4AO8A 4QNMA 3IR5A 2IHYA 2Y6UA 3WKAA 1T8YA 5A71A 2HLHA 1J1UA 2OO5A 3BCHA 4CLXA 4DR2B 5EVJA 1VJDA 2OA0A 4BBPA 3KVRA 4UM9D 3SKYA 2GYUA 5J4LA 2PM8A 3EZGA 3I2IA 2W0SA 3MWEA 4R2LA 1X8JA 4LIPD 4G25A 4YK7A 3Q87B 4UVDA 1NE7A 2OFPA 3YASA 1VQ1A 4Z7OB 3H86A 4D0SA 4N65A 3DCYA 2DB3A 3VUFA 1D4ZA 4QQNA 1DTWA 4E07A 2V7BA 1FRFS 2ECOA 2XXJA 1IBCA 2F7SA 3DD5A 3C8ZA 4CKBB 3TI7A 4D3ZA 5T4HA 1E6EA 4WSOA 4RDCA 2FPGB 5TNXA 3SJZA 1V16A 2EZ4A 2OAQ1 3A9RA 3I42A 4G41A 3URKA 5TT0A 1WQ3A 3A3PA 5KKCA 4RF4A 3QFSA 1J8YF 3U62A 2JGDA 3DE0X 2FPIB 1K89A 1WHSB 2FHPA 2NM0A 3DF7A 3REQB 3LKDA 3RC3A 3QVVA 3HYLA 3LE8A 1QAMA 2P9CA 2GT1A 2OCGA 1VL2A 2ABWA 3K9GA 3SXUB 3H9EO 2FR0A 3CWCA 4KE8A 4Q6WA 2WAYA 4B4WA 4L08A 1Z62A 1NASA 2FF5A 5ECYA 4DDKA 4CM4B 3UMCA 1NMZA 3MCVA 3HWX1 3UGQA 5JC8A 4PLGA 4S24A 2FMUA 2IYWA 4D8VA 1M72A 4OHRA 1EBFA 2GGSA 4X71A 3T4UA 1ORDA 4OK6A 3I53A 3IBSA 2WI8A 4M9UA 2C7QA 5D7NA 4B3BA 1H66A 1Z38A 5I7EA 1S3FA 3EG9A 3O4FA 1K0FA 3V34A 4ZV9A 5J2UF 3PCTA 1VGRA 4ERXA 2WC1A 1GFSA 3NDIA 4I5FA 4GYJA 5K3FB 4LHSA 3PNPA 2ODQA 4Q3LA 3QF7A 5JVDF 4AN0A 2P2LA 1KEZA 1DMRA 2CDRA 3BDVA 3PEVA 1WWKA 5LQRA 2PMBA 3KZOA 4UEJA 4DTIA 4M8NE 4Q0MA 3ICOA 4LXHA 3OOJA 5H9VA 1TPYA 1HDIA 2WWFA 4A3SA 4D4KA 2R6HA 3V48A 4IJWA 2ZXFA 1KAMA 3CISA 3O8CA 3O8DA 3IVMA 1AKEA 1MABB 4YUAA 3PUHA 1II9A 3R0VA 4F1WA 1SFRA 3CZPA 3DHEA 2Q6IA 1GNTA 4MIKA 4E51A 1OYWA 1QMGA 3DXZA 3ZD6A 5F9HA 2BP7B 1EXNA 2I3DA 3G9QA 5CB8A 2HIMA 3KSZO 1M33A 3FPSA 3AYZB 5AJYA 4MAMA 1AZLA 1WXXA 3MAGA 3ZD7A 4TZTA 3RHZA 1I94B 4R2HA 1M74A 1QQ5A 4XCXA 1YRLA 3HFSA 4M38A 1JT9A 3KOYA 1CC1S 2H1FA 5EP1A 1U94A 4YPOA 3TE7A 1QB8A 2H8GA 1CUCA 3D7NA 4HADA 4MW7A 2V7QD 3ACCA 1S3GA 1B2LA 3I2JA 2MYTA 4HBGA 4O4IF 1EKXA 4OJMX 3ZKAA 4ZVOA 1GPLA 1G16A 1UFOA 2VF5X 5LZ5A 5TQ2A 1ABEA 3GRPA 1FU7A 2WWIA 4MQBA 2FLWA 1T2FA 1TK2A 3VZPA 4BKRA 3U09A 1YZ3A 3O73A 3G9TA 3JRWA 2R8PA 5DWQA 4FYXA 5FOTA 1QB7A 4X85A 3DEYX 4HI0E 5AQEA 2P35A 1VCMA 2HXSA 3NNNA 1DQRA 2RJNA 3WMWA 3KJIA 4XX1A 4XM0A 4Z9XA 1Z74A 1GPAA 2YVKA 3EFOA 1ZP6A 4LY3A 1OI2A 1ADBA 3HGMA 4TTJA 5DGCA 3JQCA 3SSOA 3CONA 2CJWB 4LOJA 3RBVA 3EQ7A 1F5SA 3CF4G 1WTAA 1HWYA 4U2DA 3PD1A 3TLAA 3NEAA 4UUQA 1R12A 5CH8A 3U3XA 3WRYC 1Z6XA 4E32A 4FYWA 4RVOA 1U63A 4PFJA 4YUXA 4RVGA 1SBIA 3HU5A 4IO1A 1P1KA 4RMNA 3PT9A 4XGKA 3TS1A 4KOAA 3ETGA 2G0TA 1Q0RA 1OTYA 5EUQB 3EIXA 4MUKA 2ISCA 3DOHA 1W93A 4P98A 4R1SA 1MFZA 3NTXA 2OOSA 2JBHA 4HEQA 4HSEA 1PLLA 1FYWA 3GQBA 4NFHA 2EFDB 4MW2A 1OIWA 4PSDA 1PT9A 1IEXA 1XA0A 2JCYA 2AR0A 2P67A 3ZZNA 5LJLA 3GLGE 2JZNA 2LCFA 4RHTA 5GV7A 3PIDA 3UOGA 2W2QA 1CY0A 3A28A 1Y3IA 2RDMA 3NONA 4IIGA 4H16A 4B33A 5FWYA 3VPCA 5HUQA 1NOIA 2QXTA 4MI9A 5JNUA 2YUTA 3NH6A 4YEDA 1T1GA 1GZSA 2XUZA 4NENB 3MWDB 2JAPA 4I1RA 3TNFA 1QFSA 3KXKA 5DLYA 3D8SA 2H48A 1L0BA 2AJBA 4CG2A 2BKUA 3E82A 4IDNA 2BFCB 2CFCA 2AVNA 2VYVD 3ANTA 2F43B 3BJEA 1N4DA 1T2AA 2XTJA 3A6DA 1AO0A 3QUBA 2Y0PA 4BS9A 3KHSA 1A97A 1BROA 1J0EA 2WYIA 3L07A 2VA8A 4R16A 5IU6A 4HH4A 5DMHA 3H11B 1YQDA 3ZH2A 3UJCA 3F3MA 3HB9A 4OMCA 5TSDA 3KPVA 2C96A 2PWBA 2Y1LA 4REQA 1XTJA 1RC8A 2B5OA 1Y4SA 2C2BA 2FFJA 3LSYA 3WBFA 3PQ8A 4GEGA 5KWEA 1GTRA 1R5BA 5KVVA 3AJEA 3G8AA 1NXOA 1NQWA 4X1YA 1KFEB 3Q6NA 1AGRA 1R6BX 3DMYA 4MO2A 2QN9A 1A2KC 1FMCA 5CA1B 4YGXB 5PNTA 3H4VA 3N0TA 1VI2A 1VL6A 5F4BA 2RHDA 2G5PA 5DT2A 5KCMA 2J9XB 5AW0A 1SK8A 2DTXA 2C7PA 3TLYA 4KQJA 4WH0A 1EBBA 3VR6A 5JR3A 2V7XA 3KT3A 1JG3A 2WIDA 3CNBA 3D3WB 5A9SA 3G2HA 4IIXA 1M2NA 5ED0A 4Z54A 4Y9SA 1T8UA 4LN1A 4Y1GA 1EK5A 3BIJA 3LY7A 3MGCA 4U7DA 1JX6A 3GLQA 2XQVA 4TQ9A 5ARBA 1QLHA 4YJGB 1KZ1A 2XTNA 3RSCA 4EX6A 2OD9A 3EXG1 4Y2YA 4ZQIA 3WOHA 2RGNC 3DPSA 2J4DA 1QAQA 3UAZA 3CN9A 3FCYA 5DM1A 5FL3A 1SZPA 1ND5A 5BSTA 4ZQGA 3ROPA 1L7AA 1UBUS 1V25A 3PQ3A 4JVSB 6ADHA 2ZQ5A 4FGLA 4W6QA 5GADl 3M9LA 4E6PA 1UZUA 2ZB4A 4MPPA 1MB2A 3QIVA 5HG0A 3NOQA 3JVVA 1A5TA 3ES9A 1T1SA 1M8JA 2HD4A 3HL0A 3LUJA 3S0JA 4Q21A 3CEPB 2JKYA 3EWAA 5CLIA 3UVEA 2O2SA 1L8XA 3NJ8A 3IAS6 4PTLA 3ZW8A 3EPRA 5SZKB 1AKRA 3ORRA 3OAAA 2GN6A 2JVJA 1GFIA 2RJ3A 3TPCA 4AZWA 1P2GA 1KK0A 2IH2A 1MZVA 5ALPA 2F3UA 2XBLA 3NAGA 3KKZA 1XRMA 4RPJA 1W0KA 3MLBA 1L4HA 4Z86A 3UMMA 3GEEA 1FU4A 1U3GA 4H18A 3LLSA 1RYZA 4GMXA 3I5XA 1S9HA 1Y33E 4UEWA 2O0MA 5BSGA 4YONB 5HGJA 4ENWA 3OPYA 3AEXA 1ZUD1 5FBZA 1HXHA 1ISHA 1UBSB 1MQ8B 1XP8A 2IYAA 1NTOA 1YU6A 3C3BA 5E3JA 1Q83A 3DBIA 3KQSA 3R8XA 4QFBA 2GEJA 1O54A 5EKXA 1H8ED 4H9GA 2O5EA 5G4LA 2PMWB 4EG8A 1L7RA 3K5HA 3QA3E 2C5HA 2B37A 2EFEB 2QNIA 1E1NA 1FNSA 2J5BA 2R6ZA 3CV3A 1G8GA 1ZD3A 3P9ZA 4J0QA 1XX6A 4ANFA 2LIVA 5C31A 2ZVJA 3OTWA 2COEA 1C4WA 4O2AF 2IHNA 2XBMA 1MA0A 1OXUA 1V9LA 1EFCA 2QMQA 4J3JA 5G53C 1DAMA 3L4JA 3AF6A 4H0NA 1AMNA 1E7SA 3NV7A 1FC0A 4TS3A 4DCUA 5AUQA 3PGJA 1RJDA 1SG6A 1ZIXA 2IXBA 1DFHA 3B3JA 4PCUA 4RW0A 5KX5F 1EK0A 3PQ7A 1WL8A 4BWVA 2N1BA 2DFVA 1NXSA 2GPTA 2QMYA 2QX6A 2XYGA 3IMKA 3OBIA 2PCJA 1U5BB 3VC2A 1AXRA 1U7OA 3B6ZA 1P1CA 4EG4A 4G84A 2VNIA 4H1UA 1Y6JA 3CC8A 1B3BA 3AIOA 3B6MA 3DZCA 5TEVA 1JEJA 5HXAA 3UPUA 2K4MA 1QYCA 3B36A 4IVQA 4JFRA 3DFIA 1G5HA 5D86A 4JOQA 3FNRA 1QIGA 3GC6A 1LFAA 1H2XA 2CXSA 3MFQA 2C9DA 4FOOA 3W2HA 1WW2A 4TMYA 1QFJA 4B48A 4I6JA 3KJFA 5JSHA 2A0UA 1NVGA 4AXBA 1YR7A 3JZFA 3JW8A 3SJ7A 3KYDB 1D2EA 2WSLA 4V3BA 4ZDKA 5C8ZA 1T5TA 1WV0A 1CB0A 2ZRFA 2XLCA 4P5PA 2BBTA 2JKZA 3BK2A 4WN3A 1SQSA 4CM1A 2HA3A 1A95A 3BS4A 2HUPA 3KG2A 4E14A 1LS6A 4J03A 2I4LA 1NMEA 1O8BA 2RH4A 4NMHA 1D1PA 1LRLA 2PUFA 5GMOA 1IVSA 4QUGA 2X4LA 3TR0A 1U9IC 2JLAA 1GQRA 1O77A 3F9IA 1Z37A 5EJ9A 4KRYA 3EVGA 1P0IA 2O57A 1DKNA 1LTKA 1ACLA 1ZH0A 2IZZA 1T6YA 1VCHA 4Q34A 1KZ7B 1OD6A 2Q9UA 1G2OA 1A9YA 3IV6A 5E8RA 3GLHA 3O0TA 3BMCA 3USES 5CXQA 2JIQA 4C7JA 1CP2A 1DBIA 3JZDA 4G2NA 1BCRB 2NVOA 4MGZR 4IH4A 3CR8A 4TKUA 1JFTA 2W37A 4IF4A 5CLQA 4A9AA 3K73O 2VIIA 3UK6A 1ECGA 4LE1A 4DABA 2JLVA 2PQ2A 1S2DA 3T4XA 4PNEA 3A4LA 4NZYA 3U4GA 2FG5A 3RM3A 4BE4A 4DREA 1LV7A 1DZIA 3L6UA 1IXKA 2GFHA 2MU1A 5FHRA 5CVTA 1CIVA 1AD2A 3B2QA 4QFDA 5KREA 2ZWMA 2UV8A 4ER3A 4MQUA 1RJ9B 3DA8A 4M60A 3CLUD 1KDVA 1I3KA 4IRXA 1R8XA 4EABA 5DGTA 4COKA 4ETNA 3WLRA 1RSZA 1ZINA 3TSAA 2CKDA 1UXGA 4H3VA 4MUIA 4G36A 4OU5A 2J3IA 5EA2A 3HB0A 3TLGA 1U0OC 3N2NA 5BPFA 2JATA 4Y6QA 1J22A 2FSIA 5EIFA 4PHTA 4YYEA 1B8PA 4DG9A 2OFXA 3OD1A 2EJWA 1ZRNA 2V55B 3BHNA 5EJIA 3RI3A 1OU0A 2HJWA 3SR4A 5TS3A 2Z6UA 1O6FA 1X39A 1YK1A 1R66A 2PS1A 3CCBA 3JD4A 4Q9JA 2R97A 3WFZA 5AD1A 2ZSAA 4A2QA 2PR7A 4FFOA 1NYQA 1PHPA 2OCBA 3T5AA 1RRGA 3NDJA 4OHMA 1UJ4A 1O08A 3RWMB 4LYGA 3SHFA 4B0OA 4PG8A 4TV8B 4U63A 2MCFA 3L01A 5JFOA 1U9CA 2Y4OA 3A05A 4LFBB 5KX5A 1G21A 1NQAO 2ZITA 4UAGA 1R5OA 3IELA 4HRVA 1Y5LA 5F76A 1QOQB 3BVPA 5DO9A 2B2NA 1ISGA 1WNFA 1O1YA 4AJ1A 4CKEB 4F9GA 2BE7A 3AJDA 1S2OA 4OB6A 1FDIA 2GM3A 1E2QA 5ESWA 3SCZA 4D9EA 4OYLA 3TXAA 1CUAA 1TA9A 4JYMA 3GLGA 4HGYA 1QC5A 5DEOA 3X2EA 3ZN2A 1YIOA 4EAAA 1ZJWA 3QUQA 1PR3A 2RHJA 4GT1A 2IOFA 1GOTA 2C0PA 3A14A 3ECCA 1XRNA 2QU7A 4IXTA 4P81A 4TMFA 2DT8A 5CURA 5EWJB 4M1QA 3UA3A 3DZDA 4GBED 4PRLA 2RB4A 1QTQA 1XZHA 4BRWA 1V5WA 4DSTA 1XHFA 1N3LA 2GZSA 3GJRA 1REQA 2LR0A 1KDYA 3PFHA 3NVMB 1KI6A 3CRMA 1THZA 4DKXA 5KYNA 3DZGA 1E63A 3A31A 3EZ7A 2WVAA 4PXYA 5CLJA 3HY6A 1SUIA 3D0KA 4MQFB 4RKYA 1ZXLA 3EEIA 5E7QA 2WKRA 4I3GA 3HB4X 4WV3A 4JCOA 5B36A 4FJ0A 4ZHQA 1EHCA 1RZ3A 1XU9A 2O5VA 1JVNA 5CFPA 3O4GA 5AVVA 3EX7C 1SZDA 3TFQA 3DV9A 4UC0A 5K01A 3HM9A 1XL0A 3LA8A 2F90A 5FNVB 3UKOA 1TPZA 2IW1A 3KXPA 3UH0A 3K70B 3IHTA 2J5QA 4DIKA 4J2OA 3RREA 3IUMA 2J9RA 3PDHA 4HNTA 1R16A 4E13A 3IB3A 4MV6A 4RU1A 5ARCA 4FJ2A 3ZHYA 1VBMA 2QY9A 3D5TA 3D2LA 4MYTA 4H77A 1NUSA 1WRBA 3CCCA 3KOXA 4Q4HA 3N58A 4G8BA 2KLBA 2VS1A 4C0QC 4XPIB 1NWHA 3C16C 1ZLYA 1YZYA 1B2RA 4UNRA 3ZZMA 1MX1A 4P22A 2O7QA 1IQRA 1DC8A 2NXNA 4ZQBA 5KQLA 4IJVA 1FPMA 1VSBA 2VZ0A 3PFGA 1PSWA 1O95D 2CBXA 1NUTA 1U2SA 3G8CA 3AUUA 1GXSB 4C2TA 2HU2A 3EUFA 1O97C 2IP4A 3RRBA 5J4YA 2RJOA 3K8ZA 1T6XA 2EBUA 1ZUWA 3OF2A 3HL4A 1SHZA 5HF8A 1FVFA 2Y05A 2ZI4A 1UJ2A 3UANA 4C5CA 4F6RB 5IRCD 2YWRA 3GUYA 3AFGA 1S89A 4P7KA 2HFKA 1KMHB 4M7RA 2BFMA 1DAIA 4LVCA 4TMXA 2Q5JA 1SUEA 2WYHA 3GH1A 3ZQ4A 4Y98A 2PBRA 1H2WA 2CJYA 2DSTA 2PL1A 2BKEA 1ZJ6A 3FXAA 1G8JA 1Z13A 4QO7A 5F2OA 5GQSA 3OQ1A 3W90A 4BNIA 2IDZA 4LJ6A 4XUCA 1DBSA 4NZNA 2VJMA 4RKWA 2JIMA 2E5LB 4ZEWA 4PC6A 4PHCA 5DTMA 2I03A 2LKCA 2WKQA 1DAPA 1X1DA 3FSEA 1RLJA 3FJYA 4GE0A 2F3QA 1R2QA 5EE9A 5EKUA 5HE8A 3GLFE 3NM4A 3HVIA 2XVAA 4DN6A 2RFLA 2MSCB 2W4IA 3VUEA 1IUNA 2MMCA 4M9CA 3IRUA 1GLGA 3H9GA 1R1DA 2FXVA 1P5RA 1P4GA 4L7QA 3AB3A 4I1VA 4V2UA 4HGOA 4P53A 4AJHA 3KK0A 3OBBA 1JF8A 5AOVA 4MDYA 1H4VB 2D5AA 3P71T 4DMMA 1UKYA 5KNBH 3FNBA 3LBAA 3D3KA 4J0CA 1M83A 1U2EA 2G06A 2QNBA 4WVLA 1CB7A 2DVMA 3N8NA 4MR8A 4R2XA 3K2EA 3U26A 4KQMA 4FFLA 1J09A 1YB6A 4YWJA 5C1OA 2XIQA 1NDHA 2FPMA 2PWZA 3AQIA 1J0AA 4O2RA 1W4RA 4JC4A 3ZU4A 4IDPA 4JKYA 2H4FA 2MR6A 5E6UB 1XEAA 1FYEA 4M0DA 1XQYA 1UXOA 1QHEA 3AMVA 1PEKE 1A5BB 2HF9A 4YQYA 4ZT6A 1V3QE 3H5AA 2ZXUA 1S5PA 1YZHA 1U3FA 2G80A 1AGPA 1ORVA 2NT4A 3OO1A 3QPBA 4QICA 1A9SA 3U7RA 5BQXA 5LPNA 5BSMA 2HXYA 3LHIA 3DUWA 4OA8A 4RMHA 4Q48A 1VL0A 3GDHA 5GONB 4WCFC 2LGJA 5HKLA 1KZ6A 1ORRA 2PO5A 5A5GA 4ZV4A 3OKAA 5F4ZA 5LYJA 4ZAYA 4JI8B 4CIDA 1U8CB 4M1WA 2C2KA 2VPIA 3PHHA 4HDQB 3CZMA 2MR5A 5HF6A 1GPJA 1LRKA 3WIUA 2DSNA 3MQ4A 4YP9A 3O4IA 1PQYA 3VTZA 1NWCA 2VOJA 2H0AA 3S3TA 2VHZA 3KAQA 4E3WA 3WXMA 4NCBA 3CWZA 1VPLA 3QF4B 4NJMB 2OECA 2RHCA 2W2OA 5TGDA 3S7TA 2IEGA 3FF4A 4AQDA 5DLDA 2DFKB 2OBBA 2P9BA 2Q4EA 4PGHA 4DCSA 4QM6A 3N5CA 3IDAA 4CQLB 3UW3A 1XLWA 1HFWA 3M1IA 4WI1A 5LD2C 1ZC4A 1FFWA 2GPYA 2PVCA 2V7GA 4NP6A 3WNDA 2C94A 4BO4A 1TC1A 4LSMA 2BMAA 2DYKA 4D0RA 1EXVA 4LBWA 4ZCSA 3AKYA 3B7PA 1TO1E 2CEAA 2NAFA 2BJVA 3D64A 3PD0A 1X42A 4QPJC 1UWVA 1YR8A 1VP3A 3R5FA 3IT1A 4MARA 1VE9A 3AP3A 3O6VA 1DLIA 1SJ9A 2G5CA 2VN8A 2W6MA 4NAVA 3IL2A 1L5FA 4E0BA 3ESCA 2GEVA 3KV1A 2W6JA 4IWYA 2RGBA 4JL6A 2HV8A 4MGYR 2ADOA 1T24A 2KBFA 3TMKA 1H8EA 3KPWA 4MVJI 4P0TA 3VZDA 5KSOA 2BDUA 2B4TO 2XSZA 1WMDA 4B80A 5DXFA 3TL3A 4BFLA 2C7RA 1XZCA 2VEDA 1KFCB 1T9HA 2EGGA 4HMPA 4D99A 2XQIA 3NNSA 1J33A 3BULA 1SZJG 3QBJA 4CN8A 4ZGGA 2IS4A 1GCAA 4D81A 1ZL2A 3UQZA 4LTMA 2GETA 2JFZA 4WZBE 5IC5A 4JI1B 4JNCA 1S8NA 3F71A 4TXNA 2NNLD 3QWIA 1M3SA 5JCZA 5F3DA 1TF5A 4ZZIA 4BQIA 2DC1A 4MEAA 1VJ1A 2OT3B 4C3VA 2W83A 1SBYA 4YAGA 3RV3A 1UM9A 1YS9A 3AL0C 1X7XA 3NIGB 3QF4A 4ENUA 4XR4A 2VTEA 3DKIA 1Y6QA 4RHEA 2BF4A 2DF8A 4JBWA 3Q2KA 4YP6A 1C4XA 1KIAA 1PX2A 2BM9A 1DXOA 1XZIA 2QTLA 3K2IA 4WERA 1ISSA 2UUCB 4NBTA 1PJ8A 2IITA 3FRHA 3EUWA 2BC9A 1F51E 2BLNA 2XUOA 1EB8A 1Y1QA 3Q6IA 2PNJA 3W2FA 4AYXA 4K87A 1LSUA 5ADVA 5GZ1A 1T2EA 1OWLA 3Q9SA 2N46A 4UBIA 4RJIA 1N2SA 3AG5A 1LTHR 2AQKA 2JI8A 2O14A 3H5IA 2Y4NA 4J75A 4X95A 4ZOLF 3HG7A 4A23A 1SR8A 3E9ZA 2OP1A 3BFJA 3LH5A 4YDSA 2IS1A 1K75A 4ITVA 1SOWA 5CVDA 3T1OA 5ITVA 4E2WA 5GJBA 2FWJA 4L57A 2BLLA 2ZUEA 1KE2A 4YN3A 1AJEA 2QT1A 1M6HA 2ENWA 1D7AA 2W11A 2WHPB 4H1VA 4HYYA 1T36A 4IUCS 4BP3A 2EW1A 5U9CA 1BFDA 4Q1BA 2NUTA 1Z5VA 2D59A 2VRCA 1Y34E 1NMSA 4YUWA 5K3CA 4N5HX 1A9PA 2O8CB 1JJ7A 1OZHA 3HU2A 2P75A 2E6UX 2ZIXA 2WOJA 3MLAA 3U44A 4B7AA 1W73A 2FN7A 4LSZA 5D2CA 1MPXA 1PNRA 4IIEA 2XMPA 3DBHA 3VTKA 4DADA 2ZJ2A 1IN5A 4YXFA 5KBYA 1MRNA 1B00A 3UJDA 3E7DA 4I3FA 4IS2A 2RH5A 4FTWA 3UT6A 1G18A 5E95A 1N34B 2VSNA 2VP0A 3LO5A 2WWXA 1X7XB 3OZIA 2FQXA 4HH0A 3KQMA 4KX3A 4PGAA 1E4VA 2IEDA 4LJKA 2WV7A 4KP7A 5EMKA 2FLVA 4GS5A 4LEIA 1B15A 4HP8A 4PGFA 1PR0A 1JEAA 4WEQA 3LP6A 4WKBA 2VA9A 4A0SA 3BXFA 5IDYA 4QBTA 3HHPA 2OHIA 3T94A 4U02A 3EPJA 2PSHA 5CDUA 2WWYA 1ZG3A 1RHUA 5K0NA 1WULS 3KR0A 4NV3A 2W2VA 1DCTA 5ICEA 4PPYA 2WPDA 1SXIA 1QV7A 3WGKA 2CFIA 4DQVA 1DAGA 2ISQA 4M4SA 3S55A 3T9EA 3G2NA 2XYRA 3UCXA 2D62A 3EK2A 2C42A 4O4LB 4HTAA 4DV6B 1QHIA 1DO0A 4LHZA 1NF8A 5B6PA 4OEHA 4DIMA 4P0QB 4NS1A 5AJVB 4B46A 3I2HA 2B82A 4JC0A 1EB9A 2ECQA 2F8LA 2GVZC 4GP6A 2GK4A 1PDOA 4N49A 3SX0A 5BPHA 4UHEA 1U0JA 1EHIA 1E3DA 1MO4A 1NF2A 2AC4A 2YFHA 2JAHA 1JQDA 1Q0UA 3CWQA 2WYUA 4G01B 3CX3A 4WDQA 3THOA 5C80A 2JI4A 2V6FA 4FIDA 4YAJA 1TQ2A 3K5PA 2JJ8A 4BHTA 5K8CA 3U49A 3GRFA 3N5KA 3R2JA 4RQAA 5JZMA 3ZLJA 1QTRA 2BKAA 2HNBA 2MJLA 3I05A 2JJ2A 1W9HA 4ND3A 3DMDA 5LFAA 2PRSA 3ZI4A 3QV2A 1GP2A 1DEAA 1OREA 3QELA 1DNPA 2Q6KA 1RRMA 4E5NA 3BREA 4XTRA 4F1KA 1H2HA 2AZDA 3RAJA 4UVHA 3H83A 1T8TA 2B8WA 1RYBA 3VHXB 4KQHA 1A50B 4J0HA 2H54A 4R9UC 4ZGBA 4REQB 1QYXA 3EPPA 1CY6A 2JGFA 2WP0A 4J4HA 1Y3BE 5EGNA 3GJ5A 3IGFA 4HVTA 3SJAA 4DXHA 1OH8A 4O0MA 5E3HA 1YS6A 4OBEA 4IFBA 4AROA 5BV0A 3RUAA 1U0HC 2VHYA 1XAHA 4ZRNA 2YNMD 3MPUA 2AR9A 4Z1MD 3ELDA 3MGBA 3UA4A 3FFAA 3OMXA 2CNWD 4KITB 3LUGA 1M2FA 2OC4A 3H0EA 4IHKA 2ZT7A 5JVDB 2HSGA 4PRKA 1XLVA 1PT6A 2OPBA 4R54A 4B6FA 3RT9A 2JHPA 3QLUC 2WF7A 2RKOA 2DFDA 4PFSA 3NOOA 3MTDA 2VF4X 1KH2A 2CNBA 3KR1A 3QY0A 5DBIA 2WZQA 4HN4B 4JWKA 3T0IA 1Z63A 1R6DA 2HC9A 2Q1SA 4J90A 3KIPA 1DKPA 3VR5H 4FGSA 4MQEA 2DGDA 2VP4A 3BFXA 3GGGA 5EHNA 5L7YA 3R7SA 3G1WA 3OFKA 4IIJF 1J0XO 3GJYA 1D0IA 1Z7BA 1I14A 3D7RA 1R3UA 1SIOA 2B9EA 2FGJA 2H52A 3NBYC 5EINA 1EVJA 1Q92A 4ZHQF 5IN4A 5ALHA 1P7CA 2VNJA 4MCAA 2I8AA 1P9WA 2HSDA 4NK4A 4F46A 2R9VA 4FFRA 4F8YA 4F4JA