1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
1Y33E 2G4VA 3PRKE 3CNQS 1BH6A 1DBIA 1IC6A 1P7WA 3DE3X 3BX1A 1DUIA 1TK2A 2Z58A 1V5IA 3T41A 4YN3A 1BE8A 3H42B 3A3PA 1GNVA 2ZRQA 1SCJA 5AVKA 1TM7E 1MPTA 3Q40A 1AV7A 1SUPA 3D9QX 1YJAA 2PKCA 4M1ZA 1S2NA 2XTJA 1SCAA 4HX2A 1VSBA 3VTAA 3LPAA 2ID4A 1HT3A 1SUEA 1SPBS 4I0WB 1R6VA 3LPDA 4CFZA 4CG0A 1TO2E 3DE6X 1AVTA 5JXHA 3DE5X 5FFNA 1PTKA 2SECE 4ZOQI 3VYVA 4NMXB 1P8JA 2TECE 1GNSA 3VHQA 2WV7A 1NLUA 2Z2YA 2PWAA 1SH7A 1A2QA 1BE6A 1SELA 3DVRX 3EE6A 4J94A 1AU9A 1SBTA 1GTG1 2P4EA 1KDYA 2XRMA 3LXUX 1CSEE 3I30X 1AQNA 2HD4A 4H6VA 1AH2A 1Y1KE 4FONA 4NE7A 3P5BA 1GTL1 3DE2X 4NE9A 4OV6B 2Z2XA 1WMEA 3HJRA 4BWGA 1ZVJA 3VV3A 2QTWB 2ID8A 1JEAA 3BPSA 2PQ2A 5CW1A 3TECE 1GT91 1OYOA 1T1IA 1ZVKA 3ZXYA 3GT4A 1S01A 5B1EA 1T1EA 1SIOA 1MEEA 5B1DA 3DWEX 4AKSA 3I34X 1KDVA 5AQEA 2W2MA 2SNIE 3LPCA 1NDQA 1PJ8A 1SCNE 1ST2A 1YJCA 4MZDA 3EDYA 4K8RB 3I37X 1IAVA 4H6WA 1SIBE 3DDZX 1Y4AE 3GCXA 1V6CA 3F49S 3AJ9A 1SUDA 5ARBA 5FAXA 1SBHA 2SBTA 2PRKA 2IXTA 4CFYA 2V8BA 3DE1X 2Z30A 4KB5A 3DW1X 1UBNA 3DW3X 1TECE 2X8JB 1KDZA 1GA4A 1THMA 1TM1E 3TI9A 1SUAA 3DE4X 1Y34E 2WUVA 1C3LA 2ST1A 3BGOS 4WOCA 3VV2A 1OT5A 2DQKA 3EIFA 1C9MA 4RYDA 5K7SA 2IY9A 3AFGA 2W2OA 4DWWA 1YU6A 1C9JA 2PYZA 1GA1A 1TO1E 5JXJA 4LVOA 1AF4A 3QFHA 3F7MA 3CO0S 1Y3DE 4LVNA 1OYVA 4OMDA 4AKTA 1PEKE 4C3UA 2DUJA 1YJBA 3PTLA 1Y3FE 2W2QA 1Y48E 5JXIA 1GCIA 1PFGA 5AVJA 1T1GA 5SICE 2PMWB 3OSZA 1SUCA 2SICE 4HVLA 2WWTA 3VSBA 4B5LA 3DYBA 1NDUA 1ST3A 3GCWA 4GI3A 1EGQA 1R64A 1SUBA 4KG7A 3QMPA 2Z56A 1Y3CE 1WMDA 3A3NA 3WQBA 2GKOA 2ZWPA 1P7VA 2HPZA 4DZTA 1TM3E 3WIVA 2Z2ZA 4H6XA 1WMFA 1BFUA 1SCBA 1WSDA 4ZARA 2B6NA 1SIUA 1TM5E 3L1KA 1Y3BE 3WIUA 5I9SA 3DVQX 3WHIA 2PWBA 1SBIA 1LW6E 1BJRE 3F7OA 1EA7A 3DE7X 4KPGA 1BFKA 1KE1A 3TI7A 2WUWE 3SQOA 1AK9A 3AJ8A 1TMGE 2X8JA 3QTLA 4Z2AA 5ARCA 1SBNE 3A3OA 3Q5GA 1GA6A 1KE2A 3DE0X 2E1PA 2Z57A 2ZWOA 1S02A 1CNMA 4WOBA 4JP8A 5AMXA 5FBZA 2W2PA 1SN7A 1TM4E 5ARDA 1SVNA 1SCDA 2DP4E 1Y4DE 3SICE 3UNXA 1Y9ZA 3DVSX 1Q5PA 5JXGA 3I2YX 1WVMA 4DJ5X 3ZXXA 3GT3A 1R0RE 2W2NA 4C3VA 1GTJ1 3D43A 1SBCA 4OMCA 1C9NA 1XF1A 5JMOA
chains in the Genus database with same CATH superfamily
3IGFA 2NO4A 2AYXA 3FUTA 2PMFA 1UM8A 2PO5A 2O2SA 4GLFA 5BN3A 1TYCA 2BZSA 1MNAA 1L2TA 1WOYA 2I80A 1SPXA 5GJBA 1RAGA 2VAVA 4PSAA 1EHYA 2WU3A 1WEKA 5DCYA 3HB1A 4B74A 2VDUE 4H4EA 4E2ZA 2DX7A 2CXXA 2Q45A 2QMYA 3HXTA 2AOWA 2PQMA 4IZIA 1QIDA 4FDTA 4B2YA 3MJCA 4X8LA 3JAKA 3VZDA 3X1YA 1JX6A 2DHCA 1AHHA 3H87A 1AJEA 5E6RA 1OI2A 4TYMA 2HMYB 3HSKA 4YHBA 3G2OA 1VP3A 1A88A 1XCJA 1E2GA 3K0CA 1RI5A 5BN4A 2FMTA 1TI7A 2H2IA 2R8ZA 1ZGJA 2VRCD 3T3IA 4EI2A 1H4TA 3GDOA 3N3AC 5JAZA 1LK0A 3E58A 2CBGA 3BHMA 1XQXA 2BKEA 2ZTVA 3E3OA 4IBOA 3WB1A 5TGZA 2C59A 2ZU6A 1JA1A 3FJ1A 5IS2A 3MRVA 3DZCA 1Z68A 5AESA 5C7LO 4PLWA 3WLRA 5T57A 4GI7A 1ZBDA 2Q27A 2VJMB 3W9YA 1GADO 2HK9A 5D3QA 2FDXA 5DTMA 3I0ZA 2I29A 4BWFB 5TPZD 2JFVA 2Q1TA 1SUFA 2BM0A 3C1UA 4WBNA 1X15A 1YACA 3PC2A 2RGEA 2YFQA 3MQ2A 3IURA 2QD1A 2YIMA 1NXTA 3AR3A 4Z9BA 2FFJA 4QPNA 1YRQA 1GU7A 4RPKA 1PHPA 4M0LA 1B1CA 3FNQA 4Q9LA 2W2XA 1NNI1 4RNDB 3PC4A 3STWA 3FIUA 3F90A 5FI1B 4Y1RB 4AJLA 3KAKA 2IX3A 4Q1FA 2CYCA 4AY3A 4KXXA 1QG2A 3OCYA 2D1YA 2QX4A 1CUUA 2ZBVA 4L27A 4B17A 4YRAA 1P5HA 3X1ZA 5BMVB 3DFUA 4WKNA 3UGTA 4YCAA 2X3FA 3T0IA 3IHTA 4F85A 5I8PA 2WJYA 9ABPA 2WFZA 1IK4A 1SCAA 3QPUA 5D2CA 3VNQA 3VYRB 1Y9AA 4AIRA 1M74A 2Q5FA 2AC2A 4KWEA 2I87A 3AEUB 1JXAA 1VSBA 3ZDBA 2OBFA 1Y8RB 2ZIFA 1GCAA 1U99A 2QY9A 1YA8A 4H4CA 3HKEB 4RJLA 3GP8A 1XPJA 1ZHOA 4OKSA 2R7AA 5COBA 3T7DA 1EFLA 3G2MA 2PPLA 4XDHA 5CMLA 3ZWAA 5A7GA 4PYKA 3RTDA 5J2UA 4JVSB 2CNBA 2PUCA 1WL8A 4MW1A 2ODTX 4CG0A 1TO2E 4HDNB 1WXIA 2IW3A 2VYNA 3RFVA 1TZJA 3D2BA 1A72A 2OHGA 3GAAA 3JQ7A 2QV0A 2Y6UA 3KEOA 4MEBA 1YB7A 3CUSA 4BO5A 4DBLC 3U7FB 5DLEA 4OFWA 1Y6ZA 2V5UA 5F5NA 1W8DA 1EQ2A 2QTVB 1U3WA 4GX1A 5LA6F 3ER6A 1E0KA 4PFJA 3REOA 4AQDA 4AAYA 2XB9A 1ZA2A 2PZJA 2QVXX 4V24A 4L9SA 3K6SB 1U8CB 2C3PA 2OHJA 1KOGA 1QS0A 1NVGA 4UXHA 4B4VA 3ZE1B 5HYVA 4P93A 2GHQA 3ZNNA 4WXHA 2ZZKA 1EWYA 4JSTA 5JJKA 4URVR 4PLZA 4BL5A 5KYXB 2OUKA 1P74A 5FOUA 1X3SA 2JLVA 3ISJA 3VZCA 4B5KA 4X7MA 4EAAA 3DMFA 1W1IA 4P0TA 4P4TA 1KOLA 4PF1A 2L2QA 1NPYA 1GSHA 1C9EA 1U3TA 1UBHS 2NPFA 4RUKA 5CG2A 1JAHA 2YS7A 3L9WA 4A5OA 3LWZA 1GM5A 3TJRA 1O3YA 4HX5A 1VKRA 2HM7A 3AL3A 3NBQA 3GG9A 4DGSA 2FMHA 3G8DA 4Q7KA 4LFAB 5A0VA 4KXYA 5DX8A 1ACJA 3N07A 1XVVA 4Z3DA 4XM1A 3EAQA 3Q3CA 2JFGA 4EARA 1KO4A 4OXQA 1GQFA 4CL2A 4M53A 1NHGA 3OD5A 5IKMA 5CB4F 3EA4A 1OFIA 1KEEA 1KMIY 1Y9JA 1NXXA 1VYHA 4FMPA 5BSTA 3WK5A 1FRNA 1VRVA 2RARA 3A70A 4KTVE 3VTKA 5K6AC 3HKDB 4YRDA 2HSZA 1UBLS 3EXHB 2VYVA 4ZV7A 4MWOA 5IBRA 1POWA 2ABWA 4RD4A 1GTL1 1KORA 2A1UB 1XQ9A 3BDAA 3O82A 3A26A 4PFQA 4W6ZA 3OG9A 3RK4A 1XZJA 7REQB 2MR6A 4ZA2A 3B3QA 1DAEA 2HMAA 2ECOA 4XWKA 1NBWB 3CFYA 3U3OA 2MYUA 1V95A 3LSYA 4G2NA 4X92A 2W2LD 2JC3A 1KYWA 5BYJA 4GOLD 1TZMA 2ZIWB 2OO5A 1RHUA 2XSZD 5ALTA 3BJZA 1KPHA 4X1IB 5EVJA 2FCRA 1WPRA 3OQJA 2OCIA 1CZOA 1IWOA 1GRQA 4M37A 4CM6A 1U80A 2J3DA 3KU1A 5CW1A 9LDTA 3TNYA 1EM6A 2YRWA 4CM9D 4UHBA 4AY6A 3PUXA 4IG9A 2ZI6A 1U3GA 2KPOA 4D46A 2ZAOA 2QVBA 1CY7A 3I9JA 1VLQA 4ENPA 3D6MA 5K3OA 4GG1A 4HMPA 5A1TA 4CM4B 2H5IA 2FKNA 2R7MA 4QXQA 5CXSA 1DBRA 5DWVA 5JHHB 4ISCA 1O97C 4RWZA 3CJTA 1YHYA 2VJBA 2VHEA 1VBNA 3KX2A 2W2MA 5I48A 4G1BA 3PB3A 6NULA 1R0CA 2HUPA 1I4WA 1W19A 3HY3A 1AS2A 4QAJA 4RBNA 4AI6A 4DPMA 4CXMA 3O4RA 2P7IA 1UZLA 4ZHSA 4E12A 1SCNE 2GB4A 1P0IA 3IODA 3O95A 1GGVA 3NDJA 3CLUC 3ZH9B 3AJEA 2FRXA 1RFLA 4KXNA 3RHFA 5ALZA 5KS2A 5FPHA 3FJOA 3N2LA 2ZOSA 4IINA 1UPFA 5BRNA 3AHHA 2Q28A 3AKYA 3L6BA 4K8RB 5CLLA 4DIOA 5LMNB 1ZH6A 2NMVA 5KCMA 5ENDA 2AH5A 5GV7A 4XB2A 1YDEA 1EIZA 2XVXA 4RVDA 3UHPA 7AT1A 3HV2A 1SIBE 5IT5A 5JFGA 3V8PA 2ERXA 4KQ1A 3RI3A 3O7WA 5FUQA 3RFCA 5SZKB 3LBIA 2CW5A 2X0KA 3HSSA 4XDYA 2WHEA 5C8DA 2KB0A 3B1YA 3HO6A 3NZEA 4MRSA 2EFJA 3JPWA 3O38A 1X8JA 4DIEA 1MB0A 1N7HA 2WSIA 5ARBA 2JLUA 3VDMA 4DV4B 3S2ZA 4I9FA 3RQIA 2Z98A 2PZFA 1GPJA 1X70A 2IIQA 1G8SA 4QOEA 2GA9A 3K9NA 3N58A 3PCRB 3R5FA 5I7HA 2L0XA 3OCVA 4FINA 4M8IA 4QIHA 3VMMA 1Q83A 1SMKA 3L04A 3K8QA 4DZZA 1KSJA 4TLDA 1XTZA 2HWUA 5A4IS 3C5WP 1RZVA 1ZIPA 3HGMA 1JEDA 1ECJA 2W6IA 2EWVA 2CL0X 4MUNA 1VJ0A 2LCQA 3GGGA 4F91B 1J1IA 3EPPA 4ITVA 1PBNA 2A4MA 3OTHA 3FVQA 4Q0MA 2FPIB 4GW3A 2ZI5A 4QT0A 1CDDA 2LXNA 4RABA 3OCJA 4UEKA 3TI9A 3OETA 3QE0A 4ZT5A 1N2HA 1CUEA 3Q2IA 1GNRA 3ZTYA 5DLYA 3PFKA 5J4VA 2FMUA 4ND6A 4NEHB 1XEXB 3E9MA 3QKUA 4KAJA 5IZCA 2F64A 4WXEA 2IPAB 3EZ7A 3MT0A 1ORHA 4Z0PA 3K53A 1Q0LA 2G88A 2QPLA 2XOKA 3JVVA 1XZNA 3DTNA 1VP9A 2HLDA 4JX8A 1VE3A 2JFNA 2JFUA 4RYDA 4QBKA 1QTNA 2A9FA 3NAGA 4DWWA 3G9ZA 4EK9A 4S1NA 2NZWA 2HV9A 4B3SB 2XDQA 3KUXA 3PQFA 4P3KA 1XP5A 2F1HA 3MOIA 3TW6A 4B44A 5IH7A 5LQRA 5MHTA 2NT4A 5B1SA 2P1ZA 5BQ5A 1J8DA 5FWDA 4YY3B 2R1VB 2B21A 1QH1A 1X38A 2QN3A 1R4AA 2RH9B 3D0KA 3L7YA 5D84A 5EEGA 5HTKA 3QKRA 1TK3A 5BWLA 4ECEA 3KPUA 1Z62A 3L0BA 1UODA 3OAAD 1SXGA 1P4HA 2QP4A 4XKJA 5C7OO 4H7DA 2VJNA 4AKTA 4Z4IA 5E6UA 1JHVA 3C4QA 3HFGA 1KGDA 3AI7A 4NV0A 1D2MA 1TT5B 3Q8XB 5BORA 4CIWA 4PLGA 5EIXA 3FBGA 1ORDA 1XTSA 3NVKI 2JCYA 1I33A 1Q92A 3MC1A 1VDMA 3RT7A 5ITVA 2X58A 4RGVA 2IRWA 1N25A 1UKCA 5E1BA 3LM8A 5GGXA 5JTTA 4D97A 2ZYRA 3USES 4C2TA 4HWPA 3WK6A 2C9DA 1SWVA 3ROKA 2Q62A 2QUKA 1R0WA 2C5SA 2Y1DA 3DMHA 2O3QA 3G0OA 3NYRA 4NICA 3ZYCA 3UB4A 1TRKA 3HE3A 3NDPA 2LNDA 3W5HA 1JZTA 4ETIA 1GUZA 1HE5A 3GIWA 1RWXA 3NNSA 3HI4A 4MJ7A 3STHA 1GRNA 4UBJA 2Z1MA 1QHIA 4R9UC 3UFBA 5JLAA 2V7EA 1Y98A 3IYLW 2DLCX 1PWHA 2B61A 5FYDA 1GQ2A 1CC1S 1PEDA 2MT9A 1BWQA 2G6BA 2VPYA 3VPSA 2IZZA 4RGBA 2A5GA 1EGQA 4KNVA 3DOEA 4KG7A 4B87A 4E2XA 3BDIA 4YRSA 3DBVO 3FW1A 1SQ0A 3H8VA 3IKJA 3UJ9A 3KQQA 4UM7A 1N9GB 4HLCA 3RVSA 2O2ZA 3IIJA 4QULA 5E8JA 3SZMA 4AZ0A 4BO3A 4DLAA 2QVCA 4EI8A 3LP5A 4BLPA 1BROA 2E7ZA 2J3KA 5D1NA 2B6HA 3F78A 4LRSB 1LW7A 5CFPA 3SKVA 2HPZA 3EPJA 1DX9A 2P4HX 2JEYA 4LRXA 4OSPA 3IL2A 1I5EA 2ZKIA 3D3QA 2DHDA 3ZU3A 4XB6B 1FDSA 1HZZA 4M7WA 1MAHA 3GJ8A 1YDMA 2ZREA 3KSRA 1NUUA 4M1EA 3O4JA 5IYZF 4ER3A 4N0QA 3SEQA 3V1TC 3TGPA 2JIZA 4IQGA 1A9PA 2XT6A 5JFTA 3TJZA 2P41A 1I4LD 2WT9A 3ELYA 3HYTA 2ZIVB 3W5IA 3KTOA 1UADA 4K86A 4QBFA 3CGWA 4YV7A 1A1VA 5CB6A 2IYPA 1LRLA 1NI4A 2DLDA 5I9SA 1N77A 5FA6A 4N49A 5HRCA 1H3EA 3HEMA 3LECA 3S44A 5ESRA 1N8SA 4ACAA 4PYJA 1CUCA 2I0FA 3JQRA 1E2DA 3MQ4A 3JV7A 1T36A 2PQ0A 5TT0A 4MICA 3DAHA 3KR9A 3JD1A 5ECWA 4TQGA 2X2PA 5IXSA 4PX9A 1EXMA 1H4VB 1MC5A 3O5AA 4IPTA 4JGGA 1JIIA 2YVAA 5LNK1 2HJRA 3LUFA 1WR8A 3N87A 3ORRA 4B6QA 1KZ4A 2H1OA 1T8WA 4M87A 3S1LA 4QU5A 1MVOA 3L5OA 4KV7A 3N7TA 2WUWE 5LUBA 3DBRB 3SR3A 2IXAA 3NIBA 4LTDA 3VOTA 3ROGA 1G8FA 3IO3A 2ZBRA 3VHRA 3LH5A 1RAAA 2TMYA 4XVQA 3M6WA 1Q84A 2FSVA 4O5OA 1RAFA 3TWOA 1QGYA 1CEEA 3UAXA 4Q3CA 3CVJA 3WRYA 2DWOA 1E99A 3E2PA 1L7AA 3U37A 4B3TB 1MIOB 4B3DA 4JA0A 4MI3A 2V7BA 2G9UA 4WY2A 4LJ4A 1E66A 4YECA 3RHTA 5B4UA 1MB9A 3ICCA 1FW6A 3P97A 3DE0X 3OZIA 1PD1A 4QECA 2F3PA 5DZSA 2OXTA 3QX7A 3S40A 1F5SA 1TF5A 4R3UC 4F38A 1HETA 1FP7A 2CJPA 1U02A 3H4IA 4N0EA 1I7PA 4O4HF 4RH1A 5DSTA 2PSFA 4Q1CA 3W6OA 1X94A 4JP8A 4OBWA 2R79A 1M34E 1N6OA 3E53A 1GQOA 1NFFA 4WHMA 2WQZA 2Z09A 3BBLA 2ZI4A 3BZBA 2YXLA 1WCIA 1K2WA 3WQRA 3RS9A 3T3GA 3V8BA 3OLXA 5KTTA 5G4KB 2B4RO 2GBPA 2OWDA 4PNEA 3BFJA 2ZUUA 4OK6A 1NDHA 5IHPA 2Q6TA 4AU1A 1HE3A 2MINB 2J7KA 2VDVE 1DCFA 2C1EA 2H2AA 4FYVA 2HIGA 3BB4A 3TQOA 1I6LA 3UY4A 4K9MA 5IJAA 1SCUB 2AMJA 5G02A 1MB2A 5BYAA 3U4QA 5KDLA 3I2YX 1FW8A 2I8AA 1BWRA 1DAMA 3PX3A 4ZGGA 3HXQA 3BT7A 4P83A 4V38A 3L7OA 3HCBA 3QYPA 1C8VB 1Z4MA 3IC5A 3CV3A 3L4BC 1L7NA 4L4RA 4OI4A 1NT2A 3KAQA 2RB5A 1PL0A 2TSYB 5JDIC 4LFBB 1E79A 3B2NA 3ESQA 3MINB 4D0LB 1JR6A 2IWRA 2PZEA 3AEQB 4UUQA 5K3CA 2YKGA 4FFMA 4YIHA 2HHHB 3CEPB 5HJ2A 4Q9NA 4A82A 5LXTF 4Q4HA 1I36A 1ZIXA 3GNSA 1XA4A 4L1KA 2ADMA 4LY6A 4PY2A 1W36D 4UU1A 2JATA 1XU7A 2ZB2A 2O07A 4TTPA 4EVSA 4ALKA 3U3KA 3THXB 3LFHA 3B1FA 4MO2A 5EMHA 3ZDEA 4YASA 2HEGA 4ZYYA 3IUQA 5BSGA 1H69A 2Z8YM 3AWDA 2JGLA 2OV1A 1BW9A 1K4KA 3FNFA 3M4YA 1UJ6A 3I8XA 3Q8WA 3DF7A 3DL2A 3IA2A 3GGSA 4ESHA 4QLBA 4ILKA 1EIWA 2GJAA 3B6MA 4XVCA 5JJBA 1T29A 4QRIA 1KJZA 2BFFB 4DRXA 1QP4A 4RZ2A 3VDRA 4JV5B 1IC6A 3TEJA 1G9TA 5F1OA 1QGAA 2RGNA 4DLVA 1PR4A 4OY3A 2PL1A 3DQZA 1SD1A 5CHYA 1DARA 1L5MA 3KE8A 3UQYS 3U49A 1PK8A 4BKQA 3MJ4A 2VQ3A 2RI6A 3N2KA 4X61A 4FK8A 1PN3A 3PIRA 1O96B 5F1YA 4C4PA 1PJ3A 4FMDB 3GGDA 4JB3A 4KITB 2ZVJA 3FE2A 4RMIA 1GZUA 2N3ZA 1EWQA 1INLA 3GLFA 2PZLA 3ZHYA 1DCTA 4ENUA 1YJ8A 4ESOA 4H1HA 4Q4JB 1T6YA 4TXMA 1ZX1A 3PNSA 1TCCA 2A0FA 4GSLA 4PRZA 1E2JA 1QJCA 2DKOA 2R6DA 1TM7E 1ZWKA 2O7QA 4R6WA 5H7XA 3PNPA 1E0AA 3FZNA 4FQ8A 2NPIA 4Z9AA 2D00A 4RM3A 5CK4A 4DBVO 4JYZA 4OEHA 1NVWQ 4C7JA 5AW4A 2D62A 2PJUA 5EWJB 5CR9A 2WF8A 4DJAA 1P2TA 4TKLA 4BZWA 3PX2A 1Z7GA 2Q6IA 1I2MA 4BC0A 3T4UA 5DNUA 2YQ5A 1C2YA 4Q03A 5T4HA 1V45E 3SZ3A 1DX6A 3V2HA 1ML3A 4JB8A 1GAWA 1HNXB 3DBLA 3CRMA 1T9BA 2ODAA 4IVNA 2FJ0A 1XAGA 2G8LA 4HFRA 4C6TB 4G8BA 3G5UA 1D6JA 3OIFA 1IUPA 2HK7A 3HUUA 4LJKA 5LYYA 4BLUA 5LQKA 1PNVA 1LDEA 4EDHA 3IXQA 3M5CA 4JC0A 3OKCA 1QU3A 2HDHA 2WAXA 5KI6A 3EGEA 4M1WA 4J75A 3HLTA 1S4QA 4YJDA 4UMEA 3NHPA 2UVPA 2XUPA 1UBGA 5FI3A 2IBSA 2BTQA 1GU0A 4CTKA 1G4UR 2FF7A 2OGTA 4Y1EA 3TIGA 5KBYA 1GAJA 2XE4A 4YR7A 2QD3A 3RSSA 3TZHA 2VYVD 4GEKA 2F3UA 3FFXA 4UUMA 1A9XA 2V3VA 2Y92A 5SYNA 4MVJA 2GLUA 2Y0CA 4DLSA 3Q1KA 1BCSA 3R4VA 1P4AA 4O1MA 2PUAA 3DWGA 5I47A 2KQUA 4E21A 3GCZA 1TZCA 4AO8A 1WEHA 1NBMA 2OEPA 1NXQA 3CUKA 3NM4A 4LJ5A 5D00A 1H6DA 1UWKA 1E5QA 4IGKA 1E2PA 3GA7A 3GJXC 3OKAA 4YJFB 3N76A 5ALHA 4ZPJA 4A8JC 4L7VA 5L3VA 2XTAA 3DB1A 4JQZA 4ARVA 3MCZA 5E3IA 5F1KA 4M1QA 1Q0RA 2J3LA 4GPEA 4RCZA 1WKVA 4OQEA 4J1TA 5GWXA 3WYDA 3ZV4A 1O7JA 1MRZA 3G49A 3WYFA 5I7VA 1NF2A 2GT1A 4BRZA 2R0QC 4DCPA 2IK8A 4HWGA 2IXDA 4BB5A 1XCBA 1W25A 1XEAA 1N0UA 3AG5A 3GEEA 2O2GA 4ZOAA 1L5LA 1E9AA 1EHCA 1U2GC 4QA9A 1KY2A 2V1XA 3NJ8A 2J31A 2X3YA 3X43A 3D8BA 1DIBA 5DP1A 2BSAA 3D3NA 2GK4A 4PZCA 1SXJB 1ADJA 1OH7A 4LOIA 1SBTA 3GLRA 1Z0FA 2P9QA 5BWCA 3C39A 2BHNA 4LCJA 5EWLB 5FPYA 3HNRA 1JI3A 2QMQA 1AIPA 1Z0SA 4DMLA 1E32A 2H31A 2XRMA 2AXNA 4RZXA 3ZBTA 2JKVA 5L3QB 1WB4A 4IH9A 4WN9A 3PCXA 3E23A 3H5NA 1UJBA 2G07A 4GEGA 1TJ3A 3CVOA 1C3OA 2HJVA 4MIOA 5CVEA 5H0IA 1GRRA 3C8UA 3OFJA 4NE7A 4ZRNA 3CN7A 3HCAA 4Q05A 4EX6A 2A9VA 5KDOA 3I42A 1Q1EA 1UKBA 3WC4A 4JDUA 4MQ4A 2KS6A 3PZRA 1J09A 3L6CA 5JQGB 2Z6QA 4RHUA 3IQXA 4PZLA 4FYWA 1IJBA 2ODQA 3O47A 1J2RA 2GPAA 1JF8A 4L8VA 4EHJA 4D5EA 4IV0A 2WG2A 3RUFA 4YAEA 1E20A 1ZUHA 3H5RA 3KPWA 4CKEA 2ZPTX 3QNMA 4U1RA 3SEZA 3VDNB 3IVMA 2YFKA 5KINB 1IULA 2NTJA 2QW1A 1G5IA 4F9FA 1V11B 1KPIA 1BX0A 2B98A 3MERA 3THYA 2ZJAA 4JDPA 3WGGA 5B7NA 1U8AA 3IRVA 2GHRA 5CJ2A 4OX9B 1UPTA 2D1RA 1G63A 2PT7A 2V4MA 1J7JA 1WKBA 3GNLA 4AJNA 5JNWA 1X7WA 1NVMB 3HYNA 4GSYA 4QPDA 4XR4A 5K51A 4RZQA 3WKEA 5CB4A 1II0A 2NXJA 1JDBB 4DIUA 1G3MA 4ESEA 1N6KA 5G4LA 3T1QA 4G65A 2BCJQ 4F8YA 2W6ID 3LFUA 1Y82A 2G09A 4BQSA 1AKTA 3DEZA 1Y42X 3R9IA 4G1VA 3AERB 5JZBA 1RRKA 1ISRA 3FSRA 3AYZB 3EYWA 5KSPA 4B3JA 3FY4A 1KI6B 1V5WA 2GFIA 2R2AA 1LFAA 2GZSA 1FBTA 2JGDB 3DO6A 3SFVA 1IVNA 2AEFA 3T1VA 2BYTA 2WKQA 3P71T 2VSQA 4V02A 2IYYA 3COVA 1PKEA 4EKIA 4K6HA 4O59O 3T4EA 4FNGA 1NMYA 3S68A 1T8RA 3PA8A 3FPBA 4M1SA 3TLYA 1JRLA 2H6EA 4MIYA 4GI1A 1S2IA 2K5UA 5JTUA 3WLFA 5COAA 3U60B 3WB2A 4F6CA 4NTZA 1MABA 3CGGA 5IM4A 4A16A 3PA6A 3KJZA 1W8IA 2HGSA 3N28A 1ADCA 2GAAA 5E4FA 1U9IC 2QJWA 3OPXA 4UAJA 4U3JB 3Q3JB 1NXSA 2I7XA 4HNQA 1A7KA 4QYTA 3TJMA 3BRWA 2H63A 4I5IA 4LHYA 5JPIA 2JFYA 3CX3A 4K28A 3ZK7A 2FK8A 1QYIA 3W9BA 3MMSA 4WKPA 2EFYA 4RIFA 4FTWA 4F1JA 2B4QA 4POAA 2YH2A 4CU2A 1LQUA 1O58A 1O8BA 3ZQ4A 1LJUA 3HFSA 3CSUA 2A94A 1TJYA 2R8EA 5AQ1A 1AT1A 5CYGA 2QN9A 4AS1A 5TQJA 1E89A 5FB3A 1Y6JA 1U94A 3I76A 5CCXA 3DONA 3DW1X 1BOFA 1V4BA 2YWHA 3D2CA 3IHWA 4IDCA 4EGFA 5CB8A 4B6OA 1V3QE 3CLHA 4XWWA 4ABYA 3ER9A 2CUTA 1FFHA 3N7AA 3PLNA 4N7MA 1B23P 3VA7A 4JEHA 3ZCQA 3WGIA 5KZMB 1TYZA 4E30A 2XUKA 3JQDA 3KYJB 1R3UA 4OA5A 4QHYA 4KO8A 1EDDA 2AFIB 4QDZA 4W9NC 5B1YA 5HJEA 4LF4B 1D04A 2PUTA 3FYHA 3DPIA 1VMEA 3WRWA 3RS8A 4L0CA 5L7YA 3KJIA 3FCEA 4IGIA 4TWJA 1SC6A 5U4QA 4HRAA 4CUKA 4D4JA 5HBRA 5CA1A 1XZFA 1TJPB 3PDUA 2UVQA 4HQRA 4J2OA 2W2OA 1CS4C 1AKEA 2C99A 3C48A 1T43A 1MX5A 2KYRA 4AK9A 5BYKA 5IDWA 1WA5A 1GA1A 3HHEA 4KVFA 3OM0A 5JADA 1OH5A 3W5BA 4JKYA 2A0KA 1H2YA 2R4QA 3TL2A 1M1XB 5ERGB 3QFFA 1AF4A 1FMJA 1QHNA 4MB6A 3IALA 4YUVA 3UXMA 1TC1A 3S3TA 4O8CA 4A73A 2YIVX 1L6IA 2PO7A 2JJ8A 4PYMA 1I3KA 4IDQA 4IV5A 4GPAA 4C3UA 1QONA 5CT5A 1RMYA 3EGDB 2F3TA 1H42A 4IHJB 3B52X 4DAOA 3KVVA 3JZDA 2HXYA 4QC2A 4HATA 4QQRA 1GGNA 5FFMA 4EW1A 5DF1A 4BNYA 3K0KA 5EMMA 3DZJA 1FX0A 3VPCA 3ACCA 1IBLB 1GZ7A 3FNBA 2PTHA 3DBIA 3PTLA 4TLAA 4RH3A 5BQOA 4M89A 1H23A 1EWRA 5IXJA 1T2AA 1OFUX 5A05A 1PFGA 2QPOA 5BSHA 2F43B 5BV8A 3ZLTA 2BH2A 4PS0A 4ZVNA 4F56A 4Q1DA 5ECGC 3NOVA 2GN8A 3GZTB 421PA 1M6VB 3CLKA 5G1OA 1WZCA 3W1VA 3R8FA 2BSQA 4UTVA 3BOSA 1JECA 1KRWA 4JUAA 4D98A 4PHFA 1P6QA 3QEAZ 2ZYWX 1XO1A 4G09A 1IYZA 1ESDA 1P5FA 4C07A 5KOJA 3U3RA 2Z8ZA 3K0CC 1JWBB 3UH0A 1ATIA 6PFKA 1EUCA 1T1JA 2AN1A 3BHNA 4GMFA 5I9BA 4B5LA 1KI9A 3W77A 4PSKA 3T7KA 3O3OB 4LZZA 1JEEA 3M6AA 3GCWA 4IUDS 4GI3A 2IP4A 3QKTA 2OXRA 2YWEA 1A71A 1PL8A 3PE3A 4HYEA 4NARA 4RKRA 2ZT6A 1P2DA 4XX0B 5BMOA 4B3RB 3P96A 1LPMA 1F06A 4ZYWA 1RRCA 5KNDH 2H2GA 3CE6A 1J0EA 2VXCA 4YAIA 4X6YA 3LO5A 2IUUA 3GLUA 3IBFA 3H05A 1LBIA 1HDGO 2A58A 4XLLA 3DMTA 1N7GA 1OBFO 1H6CA 4KVZA 3MT8A 4ZVUA 1MAVA 2IEBA 4XWYA 2R85A 2NU7B 4KYIB 3TQHA 1F6WA 2AEEA 5G41A 3TIIA 2AB0A 1W36C 2CLOB 1DO0A 2RHCA 1N1GA 3FCSB 1U0OC 4ZZIA 1BVUA 1ZONA 2R6ZA 3BWVA 5I7EA 5MN4A 1K3FA 4ONEA 5KWJA 5LN1A 4HB4A 4M9ZA 2GRAA 4PYIA 3L02A 4DNQA 4AUMA 1IBMB 1XDUA 2P3LA 4NR0A 2I2FA 2DTDA 5EYPA 2M1XA 1NZDA 4E4YA 2BUCA 3SHTA 1FFAA 4BJ3A 2HTEA 4TWBA 3WLMA 2B8NA 2AFHB 3W4JA 1Y7PA 1W5AA 1F2UA 1RIFA 3B8HA 1F9EA 4HQLA 1X7YA 1A8SA 3WWYA 2CNOA 5JWHA 1KOJA 1T24A 2GCNA 2XWSA 3SJUA 3U48A 4OM8A 4IIUA 3UMCA 4PNPA 1L9XA 10MHA 2V6FA 4WIAA 4K9RA 3CF4A 2WIAA 1QHXA 4Q93A 2ZUVA 4M1TA 1ZQ9A 1LW6E 2M9MA 4FMCB 4I66A 5BSRA 3TZEA 3TFOA 1IN1A 1O6GA 4EKDA 2P6OA 5CFLA 4TM8A 3DE7X 3A58B 5FH9A 2RJOA 1GXSB 5DBIA 1VMIA 2QQ5A 5IC4A 5ICSA 1UT8A 4HB2A 4LGVA 1XD2A 4Y2SA 3U17A 5BW4A 2IE0A 4FS8A 4DR2B 2EDCA 2VK8A 1T9DA 2FZCA 3RTBA 2WBLC 1QR6A 1NRJB 2GKSA 2ZE5A 4GPD1 4UNPA 3U80A 1IK6A 3BTOA 1N6RA 2QSJA 1FDIA 1CUYA 4JROA 2V98A 4JU8A 5D1HA 5K05A 1QRTA 4Z51A 1QBKC 2ALJA 4UQPA 3MLAA 3T1NA 3FMIA 2QTHA 4IY1A 3LL4A 2Q6VA 5C8XA 5IP5A 2R8BA 1ZCFA 3RSFA 1GYRA 1E79D 2LCIA 2Q5IA 1K63A 3GLHE 3L0PA 1E6UA 3U4AA 3J7TA 4RK6A 4ZAVA 2O0JA 2PS1A 3QPBA 3ZZUA 3O8DA 1QWOA 2O7RA 1JUDA 1LTHR 1NX6A 2VWHA 3DMGA 4MWDA 4RQTA 4WVLA 1I1OA 1JLSA 3DVLA 4II2A 4ATNA 4D4IA 5C9ZA 1DLJA 3CWCA 1YR7A 5I5GA 3S2YA 4IDHA 4MSUA 3E1SA 1G7CA 3L0CA 3SXPA 4FLFA 4AKEA 4LJ7A 3HCEA 1YL7A 1ZN7A 3JVEA 1WPGA 3BMCA 3MWYW 4A0RA 3OIVA 6YASA 4BO2A 4UBLA 3R4CA 3DVAB 3DZHA 2ZEJA 2WA1A 2EGUA 1F9AA 3F6YA 3N5KA 5LJLA 3L41A 4JMLA 3ZZ1A 1EZZA 1CQJB 3CCBA 1FFWA 5L3ZA 3UK2A 1N2CB 2NU9A 3FN4A 5FD8A 1VIYA 2ID9A 1GGKA 3CN9A 1VSTA 4RACA 3SNKA 3UHOA 2H48A 5A9SB 3KQHA 3OFKA 4OB6A 2BFMA 3T1OA 1NW9B 2A35A 3V4LA 1I5RA 3ONEA 1YD7A 1WVMA 5E4TA 2WJWA 3W6NA 3DLBA 3ADPA 2OCDA 3ZXXA 1TA0A 1BHQ1 1N75A 1E1MA 1U0JA 3SS8A 4AJEA 1H22A 1IE3A 1QYCA 3PUVA 1V2GA 4FFNA 3FFBA 2B9VA 2QXTA 3V1UA 2IS2A 3K5IA 2QRVB 5JI3E 4DMUB 1F51E 3F8SA 3GUZA 3INRA 3M6UA 3NBAA 3RKUA 1K7YA 2W58A 4KDCA 4E5MA 1Z5OA 3K9FC 2GTPA 4DR3B 4O4IF 1FDTA 5ES3A 5K03A 2BDTA 1PJLA 1PYOA 2Q0XA 2WD7B 3DD5A 3PRKE 4IIJA 3MTGA 1TCVA 3EWNA 5FOTA 1O9BA 4YJ2A 5JPCA 1SA0B 3AR8A 3FGPA 4KAAA 1FYVA 2Q5QA 2LP4Y 3THSA 4TM7A 4G81A 1P1CA 1U11A 1Y1SA 2BKAA 2Q3HA 3KL4A 2R00A 4PSCA 5HEKA 3TRJA 3FYSA 1VTKA 4JC4A 1U8TA 1HSOA 1D4ZA 1MH1A 2COEA 5EMKA 3OZEA 1WB5A 2G83A 4KNYA 2B8TA 2O3SA 1TVKB 1XWWA 4BVEA 1SHZA 1V16A 2M6LA 1C5KA 4F04A 1NQ5A 4TKUA 1C9DB 4AF7A 4B73A 4DCGA 1KQ3A 3QELB 1IHOA 3KKLA 3DHVA 5KMGB 1EDOA 4FNOA 2QT9A 4TZKA 4ECAA 1WXGA 1TVCA 3JQPA 3OLYA 3OZCA 4HR7A 3GJZA 3TTVA 2CV0A 4PXYA 4JYAB 4WADA 3T15A 3QBJA 1OXTA 3BC1A 1V1MB 1JIUA 1YRWA 3GZNA 3OIGA 4B81A 4DEVA 1B0PA 4P2GA 2BGTA 3KQNA 1CY1A 3RC3A 1DQRA 1Z4KA 1NVFA 3H9BA 4EW6A 3COJA 4LXTA 4IQFA 4YN3A 4WK0B 1BE8A 2JLQA 3MAAC 1KMCA 5IH3A 3I2HA 1DZIA 1MPTA 1H2EA 4I1YA 4EG3A 3OX1A 3A4TA 1NBMD 1KR2A 2BM9A 3A36A 3CR3C 3DV0B 1MXHA 3LDGA 3OESA 4INPA 2XKJE 4NENB 2RAPA 4TS3A 5DLPA 1C8LA 4EGCB 5KVCA 2GRJA 4CQMD 4TYNA 1OMOA 3M6FA 4MV5A 4HEA6 2G1UA 4GWLA 1LQ2A 4RLSA 5DM60 4I2NA 1NY5A 1OFTA 3LW8A 3DTTA 3QE4A 2L69A 3RRMA 3KLMX 5KYUA 4BNJA 1RS0A 1XTKA 3AINA 1H2RS 3M89A 4DLNA 4ZI2A 3H0CA 2R97A 3AL0C 1ORIA 2CUKA 2J4CA 1WUHS 1XRPA 1YCHA 2J59A 2O6LA 3L1VA 4NE2A 2JLRA 3ESXA 1IXYA 1JZSA 3Q6NA 4WKGA 1PQWA 1PJBA 3CKMA 1W44A 4MWBA 3ELWA 3V4RA 1CJKC 1NL3A 3B7PA 2ZIAA 3F1KA 3RYIB 1FNSA 3OPYA 1ONBA 2WTEA 4X41A 2Z2JA 3ILYA 1JE0A 1ZKMA 4OBXA 3TPCA 3W2GA 2VPPA 5CT6A 4DC1A 3OT5A 1WB6A 4PHTA 1MKYA 2PUFA 1VYUA 2WD8A 3C6BA 2ZUSA 4E3ZA 2IHBA 2J3MA 3L8EA 2JARA 3RROA 3UMSA 4C06A 5IZCC 3WIOA 5ICGA 3BHIA 4L4XA 2I6SA 2XZTA 4BMXA 2OLJA 1HTWA 1OXKB 2CCJA 4K9OA 2YCBA 2NSHA 2MYPA 5MN6A 3KELA 3F6SA 1K3UB 1KO1A 2B94A 2OP1A 4OK3A 1Q0QA 1E62A 1T8UA 4J49A 2ZGVA 3DKPA 4BE7B 4CMKA 5BSEA 4X62B 4JXXA 2E2WA 4M49A 2BC9A 5TQ0B 1N2XA 3E5RA 3GEGA 4WXRA 4A03A 4YDQA 3VR2A 2GDJA 1GAEO 1GKLA 3RJMA 4URHA 3RYCB 1U0LA 1O6ZA 1J70A 1JU4A 1VHDA 5K3SA 3H3FA 5ICCA 2C9CA 3FOCA 4IIBA 3R7FA 3G0DA 2XD4A 2X0EA 5HS4A 1OSNA 4C0LA 1RQNA 1GNSA 4JZKA 3QZUA 4R1SA 1OXXK 1P3Y1 1Q95A 1R5JA 2H1HA 3CUUA 3RSOA 3EG9A 2JHAA 4QM6A 5GJCA 2HB6A 5FXMA 2JGEA 4LQLA 2Z2YA 4E15A 5A62A 5HRAA 4IH4A 1VSUA 2JCXA 4MS1A 4QUDA 1A8HA 3B78A 5AHOA 3VR4A 3I9LA 4HZIA 5F7OA 2NQ8A 3N0RA 1ZVVA 1VA4A 4DDVA 1BE6A 3H0KA 4RKWA 4CR8A 1GFZA 1C81A 1DIGA 4S0ZA 4ZAYA 3K72B 5CDHA 2EJTA 3N0XA 1AU9A 4ZXPA 3PDWA 3HY4A 3CRVA 4YJHA 5HRUA 1E5DA 1WD5A 3W3AH 4ZI7B 3TLKA 3BCHA 2CSUA 2ZT8A 4BAUA 1E7RA 1TJNA 4I46A 4C08A 1XOIA 2YXNA 3OT4A 3BWMA 3LCVB 3P4UA 3THWA 1F0PA 2WQ7A 1Y1KE 4TL6A 4WK2B 4ZOLF 4JLSA 2GEFA 5DNCA 5IAOA 2B1IA 2B35A 3VNUA 4XASA 3KFVA 1H6BA 3OZTA 4XXHA 1YO6A 2GBGA 2Z43A 1AS3A 2FWJA 4JI7B 3S1AA 2VFAA 4TT8A 3FPEA 1N5IA 1U0EA 2HHJA 5TEVA 4UPEA 1MZVA 5AJXA 4R1LA 5DT2A 4EPRA 4RF5A 1ZOLA 4RULA 1Z6TA 2OP0A 1GGEA 4K6MA 2YVLA 3PUHA 4M1MA 3H3XA 2KJQA 5AXCA 2TMKA 3BRWD 4IFBA 4X1YB 1GZ3A 4NKRA 3ROQA 2J0SA 4LF7B 3GPIA 1BN6A 4FDMA 4IWXA 3ROEA 4QJBA 3SBXA 2QA5A 5ALLA 1QP0A 3SC2A 3QVVA 1A8PA 2HHAA 3ZVRA 3O91A 2ZAIA 4M7PA 3V80A 5K4HA 2HNKA 4B7CA 5BUSA 3GT4A 4QRHA 1R74A 4XWAA 1RVV1 1JJFA 5KYWA 4Z9YA 3HS3A 5D6NA 1T13A 3W04A 4EENA 1N5MA 1ZRHA 2XPCA 2WKWA 4IEEA 1LVGA 3OMXA 3R7SA 2ZKLA 2NVOA 2GOYA 3RB8A 5KNDA 3UJAA 3HFRA 1UP4A 2AVDA 2QORA 4EVQA 3D8TA 3DCNA 3I2GA 3ANMA 4Y6PA 3FPSA 1QVVA 3RVPA 1N7JA 3N0WA 4MZDA 3R7DA 1T0IA 4HDMA 4KLCA 3JALB 3AP2A 2P6MA 2HKIA 1V8FA 4XGQA 2JJQA 3DUFB 3PG5A 3W7AA 1Y4UA 4H4DA 5A4DA 5HJ7A 4UEOA 4CLEA 3AM1A 1XTJA 4X9XA 5EMNA 1O08A 1PW5A 4Y9DA 2AEJA 1GILA 1OBOA 1P19A 5FLEX 3O8LA 5TMPA 1RE1A 4JI0B 1L7QA 3OICA 1F4LA 3EOBI 4OHFA 5J43A 5G1PA 5LU8A 1E0JA 3NC1C 4Y98A 3I9KA 2GBIA 3AJ9A 1AB6A 3P9IA 2VK2A 4PC7A 4QHTA 4ZCQA 5TMEA 5KREA 1SWWA 1XN4A 4B7AA 4ZQBA 3V33A 4IMRA 5JH7F 2CVPA 5KSWB 4FEYA 3H7AA 5F4BA 2XGGA 3LVBA 2ZIGA 4PU0A 5CURA 3KTAB 2FQ1A 3TBFA 3WRYC 3SSOA 4RGQA 4DR7B 1LSSA 2VDLB 4JOCA 4RPCA 4X20A 1ZGCA 1SCQA 2VJKA 4FJ1A 4WCDA 3TH5A 3WKDA 3IX7A 2GQ0A 1AK2A 2IVZA 2PBFA 2ZSUA 3T7AA 4J4HA 3QXXA 1KAQA 2AR7A 3BH7A 4O1HA 3LX4A 4MARA 1Q7GA 4MUKA 2PUVA 2FP4B 2TMGA 4CTJA 5GJWC 3PXUA 4F92B 1AN0A 3ITKA 5C8YA 4BEJA 2GHTA 1TECE 4MS3B 4BNXA 5ETJA 1GEEA 1R6BX 1UPAA 2IYRA 3K0HA 2IEAA 1G3IA 3GC6A 4FZRA 4MA4A 4NCNA 3REQB 3WRXA 5DOZA 5B37A 1U0SY 2O2CA 1MJGM 1LXCA 1ZXLA 2VP2A 1N5KA 1XK7A 2J30A 2PANA 4IQ4A 4B34A 3KOWA 4IRMA 2C2BA 4EEKA 2XE6A 2CFIA 4FYHA 3KUDA 3USZA 1MC1A 1R5OA 1GPDG 2X7JA 4UE6A 1E1CB 4HDSB 4G8JA 4OHKA 5B36A 1QANA 5FBWB 5A5FA 1N3BA 2OFOA 4XQGA 2OV4A 1Q1BA 3WXMA 3QWIA 5M29A 4I08A 1AGYA 2EF1A 2R8PA 1Y63A 3ORSA 2Z2IA 5T4BA 4JZYA 2IOQA 1AMUA 1XRQA 5KAPA 4PRKA 1W87A 3AHEA 5TNXA 4RY0A 2OD9A 1T5SA 1WDKA 2BFEA 4OYRA 3DFMA 3UOWA 1CY8A 5C51B 4P0QB 1UMDB 2JGFA 2II6A 1LCIA 2DC1A 4RKFA 1T5DX 1YONA 2IHZA 2XGSA 1MCZA 1VG0B 2YJ3A 4MPDA 3DPSA 4I5DA 4YRJA 3T52A 5BT8A 2QRZA 5F7XA 4R1MA 2WABA 2O19A 1J1ZA 2NUPA 3LP6A 3B1JA 4KCGA 5HFNA 2ODWA 1JHDA 3IULA 5LB4A 4JNKA 2PS3A 1U1GA 1GY8A 2ATCA 3H2ZA 1FLNA 1QTIA 1J4AA 4DUGA 5LP6A 2Y76A 1ORRA 3HC7A 3JQ6A 4CMEA 2PUBA 5B7PA 3W5DA 1U5BA 1Z2EA 4DT1A 2JAQA 3DEIA 4Q3KA 2FVXA 4ZHQA 5JCPA 5JNTA 3O90A 1CY0A 2CNDA 2JAOA 4OUKX 4BB0A 4C30A 4C5AA 2XXAB 1K92A 5AK3A 2AX3A 3HWSA 2AFRA 2CLEB 1DC5A 2P6NA 4XVUA 1GCIA 2QM3A 3V1KA 1WUYA 2V7QD 3M81A 5AVJA 1NLZA 1I0IA 3BCRA 1EUDA 3G82C 2V3WA 3NHSA 4F7WA 2E6UX 4QUIA 1I4OA 3GP5A 5LA6B 2IKSA 4UXIA 2P27A 4HDRB 4L8FA 5DM0A 3RYHB 1KO8A 4DCNA 4JLBA 1V8PA 1VBKA 4D0SA 3C5HA 3E9RA 1KMHA 3AY6A 2RGNC 3NJRA 2Q7XA 2QN2A 3KXLA 4WAUA 2NO7A 2NUAA 4ZYUA 2W8BB 1QLJA 2X15A 3JCZA 3EVAA 3GFGA 3C3WA 4KVGA 2NZVG 4RVCA 8ATCA 4KVAA 5LU9A 3K1TA 4KXVA 3CYFA 2L19A 3K3PA 1YRYE 3KEQA 3QMPA 4OYHA 2I33A 4OHMA 4WA8A 4X44A 4G5OA 2NO6A 4ZCPA 2BI7A 4RVNA 3ETGA 4RKEA 2ZRGA 4OQYA 3HL0A 1VPTA 5HGXA 1T6NA 3WOHA 2Q99A 1GQSA 1AE1A 2VCYA 4GMHA 1E6MA 2DG2A 5E9JA 4ARSA 1HYBA 5FL3A 1N9ZA 3NEYA 2PY6A 1MQ8B 5BSKA 3UMVA 4D3ZA 4M21A 5ILQA 4L16A 1XBTA 4RK1A 3NVAA 2JHGA 3I23A 4P4SA 1OIXA 3MGGA 4LNAA 2WK1A 4CMJA 5BVGA 3M6LA 4UE2A 2ONKA 3JQCA 3L7MA 4FGLA 4PYNA 1CD5A 3MTQA 4B6SA 4DA4A 3DOIA 4B47A 4J0DA 5KNBA 4F4JA 3KZXA 3IV6A 1QRRA 3RWOA 1QQ5A 3ZWXA 1E6LA 1SHTX 1WABA 3RSQA 2J6BA 2KX7A 4JP1A 3R75A 1YIOA 3QVSA 3P9YA 2X5NA 4R0NA 1XJCA 4CF7A 1TE2A 3EK2A 2NYVA 1PK9A 4KIGA 4KQCA 4AFNA 2E3JA 3GOQA 3O2QB 4H77A 2FPUA 1VKOA 1YRBA 2FEMA 1FDVA 2IC5A 1JHUA 1PFKA 1RC1A 3A06A 3II6X 1UZUA 3I04A 4HLNA 4ISBA 1IQPA 2JH9A 5H82A 1P5ZB 3C3EA 1JEQB 1MENA 5CYOA 4MUFA 2EWMA 3LWDA 2IEGA 3NHWA 3TSWA 3UUFA 4ZJUA 2ICAA 4HDAA 2AOUB 4NATA 5FTWA 4KMOA 4LWOA 1M73E 4EATA 4BLVA 4NCJA 4B8YA 3U3JA 1RW4A 1AKRA 1EJ6A 5DXAA 4K0RA 2V6BA 3TI7A 4D4GA 5DHFA 1P0PA 1QPZA 1P39A 2OZLA 2K7FA 2BGIA 3ZQ6A 4ZI5A 3EEIA 4RPLA 1R4NB 3N05A 3VZPA 5I9LA 5B5SA 5M7EA 2OZPA 4HAIA 1B8PA 1AN9A 4OQMA 3FZEA 3AJ8A 2UYHA 2ZRBA 1MX1A 1V6AA 3P0RA 3FWNA 4DUPA 5HK9A 1XNGA 2V0GA 3CNHA 2GAOA 1JDPA 3I1IA 2FF5A 3JWEA 1D5WA 5A7HA 1RSZA 3VDXA 1XZQA 2ENWA 2OFFA 1G55A 4GAEA 4IJWA 4TRMA 4M0UA 4UNIA 3LT0A 2P8SA 4M54A 1P73A 1VKZA 3PQ6A 4J1TC 1VE1A 4PTZA 4BGVA 2YOHA 3K1YA 5FUWA 2A84A 1M8KA 2DRIA 1LWOA 3OPNA 4MULA 4UREA 5FWAA 1KAMA 2Z1DA 3KPJA 2R1TA 4MQFA 1TUEA 2C4NA 3BIWA 5FLYA 5CCDA 2EU8A 4F5ZA 2VXYA 1C1XB 1LBTA 2VJCA 4ZDKA 1ZJ6A 5AHKA 6CHYA 1O4VA 5AMXA 1C7JA 1MO3A 3LX5A 3PDIA 4CL0A 4OSOA 2G7MC 3WR5A 4MYRA 1G7TA 3IJPA 3LUAA 2EX0A 4DQVA 2V0NA 1HLDA 3ZGNA 3ETEA 4D3DA 2ZIXB 4IAOA 5KWVA 2C82A 3HACA 3KB6A 5LD2B 1B15A 4EJ6A 1BFDA 1C0IA 1XROA 3BGWA 4EMBA 3EQ9A 3CRQA 3GPCA 2ZYIA 2BI8A 4YT5A 4YMUA 4XM0A 1WTCA 2V9ZA 2DAPA 3AYXB 4QHSA 1K9SA 4U5XA 1EK6A 2XUHA 3KS9A 5AW9A 2IS6A 2QSUA 2F8TA 2YV5A 4XIGS 4GLOA 5FAKA 2R84A 2BL4A 2HDOA 3EMKA 4MYHA 4XSVA 4NCAA 3OZDA 1QM5A 3UHFA 2WM2A 3TDNA 3L4KA 3K05A 4DR1B 1JQKA 3VVCA 2EFGA 3CNOA 4NBKA 1SHJA 1X6VA 3O31A 2AN5A 1W4CA 2OYSA 3ASUA 3MWJA 4CE6A 2Z5VA 2VNSA 3W3AA 2E4XA 1KAEA 4G2TA 4GM1A 1ULTA 1PL7A 4DQDA 1SBCA 3B9PA 1U3DA 5F33A 4L6AA 3AHFA 4LBYA 4XD7A 5JV5A 1AV6A 1ADBA 2R7NA 3HXLA 5DTQA 1Q22A 3D0RA 5JAMA 1YK1A 1KDTA 4KXUA 2JD1A 4HFJA 2IYEA 2PZGA 1RI4A 2Q8QA 3EIXA 4PIMA 4F5EA 1JT2A 4FHEA 4Y0VA 3WAKA 1KMMA 4YAKA 5C1IA 2HT1A 5K01A 4CEIB 4MH0R 3LMKA 4MCAA 3F7TA 4JP5A 3KQTA 1T1RA 5CPFA 4H59A 3Q9SA 1G4HA 1RM5A 2CMDA 3IUSA 5HUQA 1F7VA 1RZRA 5JOQA 5I45A 5FL7A 1SKYE 5EPEA 3CH7A 1M5TA 3JD3A 3PXBA 5E4JA 3RM3A 3TNJA 3EEOA 4PG6A 4I6JA 1L5NA 3RO7A 1DBIA 5JC1A 2PD6A 4W8GA 1WHTA 3EZNA 5JE8A 3ZX4A 3CZ9A 4WZAB 4GVLA 4CODB 4P34A 4TROA 4LXYA 5DM2A 4S12A 1N9KA 3VVMA 4N3CA 1L5QA 3DF9A 2L82A 3OWOA 3WGHA 4QXMA 3EGIA 3E1GA 4IZOA 4MUHA 3SYKA 2XJ4A 2NNLD 4JBXA 3V3KA 3WGOA 3CVWA 1Z63A 1LNZA 3L6EA 1W34A 1Z13A 2E37A 3Q2KA 4MV3A 1BCRB 5CNKA 1N6NA 3WL8A 1JJBA 1ZNWA 4LTMA 2ZSHA 2YZGA 3ECCA 1DS6A 4KE8A 3HDQA 5F78A 3NHRA 3V2GA 2BCEA 4YI5A 3VJMA 1IZYA 2A59A 4ZAGA 3CTMA 4UHKA 2QU8A 5CP8A 1N5OX 3JARB 2Q49A 3HZZA 2X0JA 2XRYA 4TTQA 5AVKA 3WBBA 4PHCA 1KARA 4GMGA 4RS3A 4D9IA 4E7OA 3GBSA 2I2XB 2DFNA 2JHFA 3A6JA 3BHJA 4PZUA 1O89A 4BS9A 2JDID 2ENUA 4RDHA 1KU0A 4WCFB 1NUTA 1H05A 2C4HA 1VGVA 3LIPA 3T9EA 3TXAA 4TL7A 1RE0A 1ABFA 4U2EA 3CUWA 4GO1A 4LGYA 3JAWA 3EDQA 3FNEA 3VISA 3FYTA 2ZJBA 4DJDC 2H4YA 3EPHA 2OQ2A 3M5DA 1X2BA 4TYWA 4C7XA 2RHHA 3HUEA 2J41A 4M1ZA 1N36B 1I7QB 5EN4A 4AJOA 1TAUA 4MJXA 1SOUA 3Q7IA 4RF3A 4YT8A 1H0RA 1RU3A 3NOQA 2IHUA 1E1QA 4Q4AA 4YA6A 5EZ6B 4EG0A 4ES6A 1PSDA 2Q0SA 4YRRA 3B70A 3RU3A 4CDNA 3AM4A 3Q15C 2ID4A 4WGGA 3JYQA 1XCOA 1W4ZA 3K96A 4TTIA 1XL1A 2GTHA 4EOGA 5F21A 1Q14A 1OBHA 1TKRA 1GT6A 2EKPA 2ZUCA 5BSUA 1E6EA 2FEPA 3FPAA 3K16A 5LQSA 4TSKA 3DNFA 2DHRA 2EP7A 1U8UA 4WLNA 3GFBA 4JVOA 4P86A 2ETXA 1N2IA 2CCKA 4L02A 3CTPA 4KE7A 2A3RA 5C4GB 1NPTO 1CF9A 3DLAA 3SQWA 2IUEA 1Z0AA 2ISQA 4XM2A 4MCJA 1QOZA 5TR9A 2FUG1 2P4SA 5IYZB 2P0EA 1BXKA 4G56A 1GRVA 2GK3A 4H3VA 2BEVB 1AKYA 1G3QA 3MGAA 4K2HA 3WV4A 1GARA 4BMNA 2P6UA 4XCVA 4DR5B 1Z12A 1IHYA 2PJDA 5CM8B 1SNYA 5FWXB 2IBMA 2XTZA 1CUHA 3LHDA 4HXYA 3IE1A 3BE4A 4Z3OA 3TLBA 2BZGA 2BFOA 3CIFA 1XCMA 1ZVMA 2C3OA 4UM8B 3A4NA 3FG9A 1FRQA 1NVUQ 1V39A 1ZGZA 2JFHA 4KSBA 5IKEA 2X5JO 4PSUA 1ND5A 1B2LA 3UFXA 1X7HA 4N41A 2I6UA 4GT1A 4D3SA 1KZ7B 3IAAA 1X39A 3PPYA 4ZYVA 3DOCA 3GBPA 4BFUA 1K7SN 3TOZA 1OB2A 2FFHA 1HTTA 1W88A 4MGEA 1PFWA 2HA5A 1FUEA 2XADA 3NTLA 4FSXA 2WHRA 4D3XA 1VXOA 4FB4A 2RGWA 4XPIB 2F6RA 1AHNA 3BMNB 3ELDA 3MVEA 1G2PA 2PEYA 3MTDA 1DDGA 2PZ8A 1IJEA 2BJHA 3FMPB 3UMRA 1X7XB 2AKEA 2WPDD 1R7RA 1XZDA 5AM5A 5KNDD 1D8TA 4OM7A 3OFNA 2H1SA 3DCJA 3HUFA 3NNNA 4NJMA 3FLBA 4NP6A 3IAM6 4X94A 2JLWA 3BWBA 3KHSA 2MCFA 4BECA 3QQ5A 1M83A 4MITA 1TC2A 5LZ5A 4DB2A 1F38A 3H1PA 3EDOA 3SZUA 3TLCA 4E31A 5C81A 4CIAA 1T9AA 5KSOA 1AKUA 3ACBA 5EHIA 5IBPA 3EOZA 2H2FA 5H9VA 2C5GA 4D8YA 1S7GA 4HP8A 4Z49A 5BSFA 2XKKA 2Z2XA 3KYCA 4MV8A 2IYAA 2Y67A 1YASA 3VYWA 1W47A 1WQ3A 1Q21A 5JAIA 4WOJA 1Z25A 1N8NA 2ZBQA 5F7ZA 4AWBA 3HTXA 1RDFA 2ID8A 3OIDA 3GFOA 2Y2UA 3IE2A 3EVTA 1ZNXA 4EA7A 2HADA 5HM8A 3E1KA 3MMXA 1G21E 3FCAA 2B4KA 4I4IA 4KP7A 3U0VA 4NBWA 2EIXA 4J9UE 2YXPX 3S5JA 3SEFA 4M36A 2BHLA 1XYVA 2X0NA 3DL7A 5FNZA 1EEXB 4NK4A 2PXHA 3L6DA 3U31A 4C4AA 1FQKA 2ZS8A 1IRXA 3I05A 3RC1A 3ETLA 4FPXA 4RW0A 2E5LB 1QYXA 4NNOA 3UQZA 4KGXA 4C01A 2Z9CA 2EC5A 4YONB 1QK4A 2I65A 2ZCUA 4DREA 3A4YA 1RHQA 1NXWA 1OC2A 1CR2A 3E61A 4I9HA 5AQEA 1E3IA 4HPJB 1QTRA 3DV9A 1DAIA 1GPMA 2J09A 2VCHA 2YBDA 2F1KA 3KXKA 3D7LA 3GLHA 3I9NA 1P9RA 3IQEA 5KNLA 3AUXA 4X97A 3EDMA 4GXNA 1TD9A 2ZYVX 1JR4A 4LXQA 3AUKA 3ZD7A 2Q4DA 4UQOA 4JSRA 3EDYA 3WMGA 4EDFA 5HKBA 2XCQA 3Q7EA 5FNVA 2GPYA 5LXTB 1NN1A 2QZZA 1USUA 1I4TD 5DOVA 4H6WA 4WLOA 3D6AA 3ZNQA 3OPQA 4AG6A 3C6ZA 3ICPA 3NAQA 1EFPB 4IJMA 4UVIA 4F9TA 1OUMA 4IL5A 3SI7A 3UEOA 1NF3A 3KAJA 2RI0A 3DPUA 3QPAA 4DJJA 4W9MC 1KFBB 2C8VA 2VOEA 2Y27A 4GX0A 4KKVA 2YOGA 2PT5A 2DY0A 4QOIA 1SUDA 3HR4A 2PD4A 1US8A 4YFVA 4GPZA 3C8ZA 3E9EA 1A2KC 3LC1O 4NU8X 4U8GA 5F9MA 3HMKA 4GH5A 2R62A 1GG8A 3EWSA 1ODCA 2FW6A 1XMOB 3H11A 5DFAA 5GM2A 4XAQA 4P7KA 1C3JA 3AVOA 3KZMA 4CEHB 1TQ8A 3IPCA 4WNAB 5NLLA 3Q7PA 1EM8A 3JATB 4HGZA 1DJPA 1X87A 5F12A 2XZDA 3KOUA 2P4QA 3LYUA 2CB9A 5J2TF 2HW8A 4ZCRA 1Q0UA 2V7WA 1ABEA 4A2QA 4KHPB 5T6MA 2C2GA 2FPGA 2VTBB 2AC4A 4NXMB 5JJLA 4CM8A 1K8YB 1DHTA 2ILVA 4H9GA 1MV5A 4CLRA 1DOZA 3DTVD 2GBCA 3W6UA 4XRRA 1DAOA 4IS2A 4MUGA 4MW0A 4S1WA 1E8DA 1XMSA 3FSGA 2C2HA 2UZ1B 3CLSD 5LOVB 2FOXA 1DAKA 3FYUA 2GXAA 3NETA 5DGIA 4REOA 5DU2A 3IJEB 3TW4A 2FP3A 3HRIA 4LAFA 3FOZA 1G7SA 3QPCA 1SOMA 1WVIA 3NATA 4E07A 5ABPA 1DTWB 2DR2A 2DB3A 3GUCA 4ZD6A 4NXNB 2DQKA 1NYRA 1UFVA 2E89A 3B1KA 3HJGA 3K92A 2ERCA 2HFJA 3C3AA 1IY2A 2IY9A 2JRLA 5JH7A 1E2BA 3DBOB 3W78A 1LLDA 2P91A 1P9OA 1Z37A 4OHBA 1G291 1JHOA 3GBVA 2BSXA 3N2GA 5EKXA 4BKRA 4C4YA 1H0HA 3R7AA 2AUMA 1I30A 3C45A 4L0QA 4MV4A 3H1EA 4A8JB 2GRUA 1H85A 4X0EA 1VHQA 4PINA 1FL9A 3DT8A 2JCSA 2DJIA 2JBAA 4QSMA 4XVHA 1ZKDA 4WZBA 1WULS 4CDMA 1Y3DE 1P4RA 3D5QA 4CQLA 1UMBA 2QMHA 1II8B 2VRWA 3HDJA 3OVMA 4NECA 4DC9A 4LYGA 4WUVA 1BA2A 1EAMA 1SOVA 3IOEA 4QFDA 3JY6A 4PM4A 2XMZA 2PLNA 3GNTA 1R2QA 5D5QA 4HNVA 2GFHA 2FFRA 4LDAA 1ECCA 1W76A 4IG4A 4OAQA 1JLKA 3PUKA 3P9PA 5AVWA 3D02A 1EQUA 3CPHA 2LE0A 4O3FA 1JXMA 1KEPA 3RBVA 1XP8A 5J4YA 4JI2B 3RTGA 4CTNA 1Y7HA 4M9SA 1F5NA 4UQLA 3DKKA 1RYZA 1F8UA 1Y48E 1KYIA 5G40A 2R86A 3KSMA 4Y18A 3A6LA 3IPXA 1FJXA 2BGWA 2R00C 1U3CA 2F8LA 1J8MF 4GXQA 4RVFA 1C7FA 2W6MA 2ZJYA 5DK6A 3AF6A 2FWMX 5CFRA 3I5MA 1TGYA 3O83A 4QEKA 4EUEA 4JJGA 2IX9A 4FZJA 1PUIA 3KHTA 2WE7A 1YXMA 3AESB 1WLYA 4FX5A 5BQFA 1V5GA 5CX4A 3VSBA 4RO0A 3SLKA 3ZLJA 3K15A 1P2BA 1QIIA 2QVZX 2Z0MA 4J03A 2C8KA 1M75A 3OT1B 5L4SA 1NJ8A 4H3HB 5EQFA 1NI3A 1PGOA 3TMKA 3GLGA 3TUZC 3DDSA 2WM9B 2QEQA 1SUBA 3FZQA 2ZWMA 4GU5A 4RGYA 3CZQA 3SE0A 3CZPA 4G0NA 3BIJA 3KZOA 1XPRA 3PJEA 1FSZA 4WOKA 4IP0A 2FOIA 3O8QA 4H0CA 1F6DA 5JNLA 5LQUA 2O8BA 2AF4C 3G3EA 1NKVA 2FX2A 3ADKA 3LPLA 3K71B 4EGJA 1XALA 4ALNA 5HKAA 3OHMA 3WLOA 2DHEA 1XZEA 4CM3A 2K6GA 3JQAA 1JSCA 4HRYA 3W2IA 4OGLA 3KP1A 1JPUA 4R1TA 3T7EA 4BC1A 4NVRA 1Q0ZA 2PGJA 4XFKA 1C4OA 4DLKA 1BU5A 2O8CB 3M3DA 3BD6A 3DKRA 1DXOA 1ZMXA 4YX9A 3E22B 3SVLA 2IE8A 1QIEA 3N6XA 3KL2A 4J3FA 3ETDA 3JQ8A 5AI0A 3R6DA 3GRFA 4LMBA 5BVHB 2X4DA 1J07A 4I4LA 2O48X 4TTJA 4Y6RA 3N8NA 1SXPA 3QP9A 2F8MA 4O4LF 5A9TA 1PWZA 2JB9A 3B6EA 3TQRA 4EW3A 3DD1A 5ECYA 3RBAA 4G0MA 3RT1A 4Z4EA 2W0MA 4B3CA 4B8WA 3ENWA 1GPLA 1ZEJA 4V0LA 4BV9A 1TD1A 4YRMA 3L43A 2RHLA 2UUOA 5IDYA 1CE8B 2Q6KA 4ZIRB 3PE6A 4JLKA 4GNRA 4QNNA 4YEDA 3O1JC 3G85A 3HCRA 2FW8A 2G80A 2WAYA 4O2LA 5K4GA 1U6KA 4Q39A 1OI7A 2HSEA 3D3WA 5DLDA 3RVBA 3ZHRA 2AQIA 3KLNA 5DNAA 2IQIA 3ODPA 3MELA 5KHOC 1C2TA 1QH8B 3OC0A 1G6OA 1OJ7A 4NMWA 1KXJA 2CLMB 2WY2D 3NW9A 2A9QA 4CN8A 3WGLA 3DL4A 2ZRAA 4DXAA 1T0HB 4BLQA 4JR1A 2DJ5A 4YT4A 1DKPA 4ID3A 1PR2A 3UMJA 3WLTA 5HPYB 4Y8VA 1JA9A 1PF7E 1AK9A 2HFKA 2QD2A 4JJ7A 1UPBA 5AJTA 2QBYA 3EQ6A 3ZI4A 2VUIB 4BGEA 1IN6A 1KY3A 1BVRA 1DVRA 1NVBA 4UBNA 3WL7A 2ZYAA 4II3A 4Z7OB 1H1LA 4EJ2A 5I7UA 3QUTA 3PD1A 1BGXT 3GRCA 4ARIA 4GOJA 4RVSA 4B6GA 4YLYA 1Z35A 2OCGA 2PYDA 1NVAA 1PJTA 2REOA 1K5DA 4M1KA 4PAGA 4RMNA 1CR4A 1BMDA 4WFIA 5EUQB 4ADSG 1VCOA 3BMXA 5F3RA 5K8VA 1WB9A 4YJ3B 1P1BA 2FSHA 3AJAA 3JRNA 2QLNA 4OMFG 1Z9BA 4N5NA 3KFLA 4H35A 1EEHA 2X9GA 4BYMA 2H29A 3O3NB 1EFTA 4U7PB 1PR0A 1FSFA 2W2KA 4JEIA 3D6VA 3DP7A 4BJHB 1CXZA 1JQLB 4EPWA 2JLCA 4W1QA 3C4VA 1XHFA 3PX7A 4K3UA 3T38A 1WG8A 5EZYF 3F73A 5K6RA 3BIXA 2X1MA 4P31A 4YRQA 2H4JA 3P9CA 3RS4A 5EJ4A 2NO5A 5IKPA 5ARDA 4HNRA 5KQPA 3VAAA 3RU2A 4QGSA 1NWHA 1U0RA 2WIDA 3BVPA 3FSEA 4MCIA 4DILA 1H5QA 5HE8A 4PO1A 3HKBA 4K6GA 4TTSA 3GLVA 4TRJA 4KW7A 5DGCA 4RFVA 2H06A 5BN5A 3PVZA 2XGMA 4JI4B 3QE3A 3GN1A 1I7LA 1TIKA 1YRAA 1NUHA 3TEFA 3LLMA 4F9EA 1L6RA 3ABSB 1J7KA 2GWRA 2J87A 3DT6A 2GD2A 2ORVA 3MPUA 3SZRA 2ZJ0A 3VH3A 3F5SA 1RCFA 2V9CA 4U00A 4E08A 1CF4A 4AY5A 2WPNA 4JC5A 1VYTA 3JASA 2PVCA 2R3SA 4P5PA 3VOSA 2OILA 1OLSB 2YZ2A 4Y2TA 3ZG6A 2G71A 2QMZA 3U5TA 1R6UA 2UUPA 3KG2A 4QDOA 5I9MA 2AOTA 2C3YA 3VR3D 4CKWA 1QAQA 4UTOA 5JMOA 4IQ8A 4XOUA 1BYIA 821PA 1VE7A 5CX1A 3GLQA 3RFUA 2HRCA 1TAHA 2QVYX 3QTBA 3FI0A 1V6SA 3W2FA 4AG3A 4D9KA 4ER5A 2UV8A 4IHAA 5CAEA 4ND4A 4IIXA 5EJ8A 1WTAA 5E6RB 1Z6ZA 1IBKB 3JQGB 4I7EA 5CFOA 1XJQA 2PBZA 2KMLA 2WJ4A 1VCMA 2I3DA 2OAQ1 3L6RA 4F8EA 1YFJA 1RAHA 1L5OA 2OORC 1XGKA 1ZNZA 2AG1A 5LLTA 1ZOIA 1BMQA 4EZBA 2RIPA 4C43A 5DYYA 2VQFB 2VP9A 2PNJA 1GLGA 1TJ4A 3OQIA 4H27A 1DP4A 1XKQA 4GPIB 3JU3A 4OJYA 2QROA 1Y80A 4E70A 3ETJA 3DNMA 1TQ4A 1YBFA 1O0SA 3T34A 1Y8CA 2A92A 1THTA 3IDSA 1U2DA 3TB6A 1DXQA 1KI3A 1ILEA 4WBNB 3BB1A 4FHCA 1TK2A 2D1FA 3I01M 2FYTA 4R84A 5IVPA 1CR0A 2JAXA 1RHMA 2VN8A 3EWAA 3JVIA 3T41A 4LHWA 1KDOA 3K9QO 4EUHA 1WCWA 2YC2C 2HUNA 3K1AB 2SHKA 3PRHA 5H83A 3HVHA 3NHFA 1SVMA 1U2QA 1FXWA 1HLFA 1G9XA 4OGFA 2OXEA 5JVDA 3Q2OA 1W36B 1FDWA 4QJ4A 1Z5WA 1M2OB 1ISFA 2AJTA 4CI0B 1VJDA 2XAAA 3G6KA 2GFQA 1MA3A 3ESAA 3JRXA 3M5PA 4FFBA 1KJWA 5FA8A 1SUPA 1YJAA 2GPJA 3FH0A 5CNJA 2IOFA 2GJ9A 3S2FA 4DL9A 3ULKA 2BTEA 4WJLA 2KHZA 4MWGA 2WZDA 1SRRA 3VC1A 1B76A 2PKCA 1IIRA 1RHKA 2YUIA 3MWEB 4NS1A 4W1SA 3R9XA 1MG5A 2PYIA 4NBTA 4W8HA 1W93A 1Z7YA 4J1SA 3UOGA 3M5WA 1NURA 3O6VA 3V00A 4KO1S 1YS4A 4OGWA 3WRXC 3ZIUA 1JQEA 3CH6A 1JAIA 3AIMA 2WLSA 4UVDA 2J9FA 3HBAA 1P0CA 3K9BA 1SPBS 3ITEA 3R3XA 3VC2A 5CG1A 4MW2A 3QTTA 1YHNA 4S1PA 1AZWA 1IWBB 2I78A 3LFTA 3RU7A 2O0LA 2AT1A 1UBJS 1NVVR 4A1FA 3AU9A 4WASA 2CHEA 3D7RA 3AVQA 4PQFA 2IS1A 3MCUA 2RHOA 1IQRA 1PWYE 2ZS7A 3DE6X 4YMGA 1MR3F 5TPWB 1XAJA 4EUKA 4NBRA 2OA0A 4ZO4A 4XW2A 3PNQA 1HDIA 2DT5A 2G08A 3O26A 4K9SA 1XI2A 1ZCZA 3F6PA 3PVSA 4XYBA 3TLGA 1JDTA 4HLUA 5SYAA 1Z5GA 2WJPA 2G1AA 2GA8A 3MTBA 3IUNA 1ISMA 2UYOA 1S5PA 4JOBA 3A04A 2BJVA 4M1OA 5JBQA 4MMYB 2ZB8A 5T8KC 2J9XB 4TL8A 3VKFA 3KSBC 3SXUA 3HDGA 2V45A 3A6KA 1R9GA 2QYTA 4E46A 3ERCA 3CEAA 3VHQA 3OD1A 3DGEC 4FJ2A 5D3KA 3B7WA 3WX0A 2P2SA 2GZ1A 3BXFA 4R4JA 3MTJA 3OZSA 1ODLA 3A9CA 4FUTA 1SGWA 1P1IA 4MEJA 4PTLA 1HX7A 4P3YA 4BRUA 4CTOA 5GIPE 1IEVA 3VM6A 1CUDA 2I5PO 3EDRA 4QG3A 1KQGA 5EKUA 2QKYA 2VG8A 2EKBA 4B48A 5CDYA 4O4JA 1MAWA 1Z8DA 5HF5A 3ZW9A 3GDWA 3QU2A 5B12A 3CLSC 2ZTUA 3IQWA 3LKZA 5B3LA 3D5TA 4ARZA 2J8ZA 3TTXA 4HNGA 3BRQA 1H6AA 3GAFA 1IH8A 2G6TA 3L9XA 4QXOA 4IFIA 4Y3UA 5FTMA 5EZQA 4GVXA 3SLGA 4AF6A 4CMAA 1NU8A 2DMRA 2HRQA 1YQGA 2EERA 3H4MA 5IU6A 3AM5A 3GA0A 4L0MA 2WT4A 2UZ3A 2ATXA 3KPYA 1YJ5A 1E4YA 3A4MA 4L9AA 2X41A 3OM1A 3QYJA 5EE9A 4XJVA 2O7VA 2TMDA 4JJAA 5SYMA 4ZYZA 1U90A 4WDRA 1LI4A 2YASA 1YB2A 3GYBA 4FR0A 2E4VA 3HP1A 3PNMA 1T0UA 5HF8A 1U65A 1C3XA 3ROPA 3N2EA 4EHNA 3NEPX 5JROA 3H99A 1E7WA 4ZVSA 1XSEA 1UBUS 3A1SA 4GECA 2VBCA 3EOAI 3V1YA 3B6KA 3VC3A 2G77B 1ODFA 3IE0A 5EXXA 2HXGA 3AUJB 3Q87B 4KX3A 3IHKA 4ZTBA 4Q4CA 2XMBA 4UDOA 2FPOA 4M8SA 2R9VA 4YQYA 4ZAWA 1Q20A 2BR5A 5H1YA 5I7WA 5BMVF 2W6NA 2BEWA 3B6IA 1U1FA 3QE9Y 5U9CA 3EA0A 1SXQA 1UXHA 4P5EA 3WLIA 1MEEA 2G4CA 1GD1O 3UF0A 2PFSA 2R65A 2ADOA 5H3HA 5HKKD 3I34X 3H2KA 3IDFA 1UFRA 3ROZA 2PJZA 3P9SA 4BFVA 2C5EA 3L7BA 4NH0A 3CR8A 3VOBA 3FFTA 2C5FA 1IUKA 3EWIA 3OSUA 4DY4A 2IVFA 4PR0A 4HMOA 3FSGD 4Z7NB 1FZTA 5BNTA 1A4UA 3GVCA 4HNTA 1N6IA 3WLLA 3IMKA 3UJCA 5CBPB 2BMJA 1W30A 3DHEA 4QSHA 3D0OA 3N8HA 3R0IA 4FLMA 4O4IB 3ZWKA 5J58A 3I37X 1Y6GA 3H84A 3I2JA 2CT8A 2G5PA 4QUJA 3L7IA 1USIA 4N0MA 3IFSA 5JYEA 1UXIA 4AZVA 2DEUA 2BM1A 5CU7A 3HWWA 3GLKA 3K20A 1YQQA 2I2AA 2VAXA 3FCUB 3SWWA 1PTJA 1H8EA 4FQ5A 3DDCA 3SC4A 3EPKA 1M66A 4RIGA 1DKQA 3GQBA 4GX5A 3QV2A 3PWTA 1OV4A 2AD5A 4XGIA 2HLNA 4MRNA 1H1TA 5EGNA 3DLTA 1AB5A 4MJLA 3UK7A 4D1YA 3GGOA 1E1NA 3ASZA 5G0TA 1AKVA 2G28A 5GONA 4H16A 2XUDA 2O8DB 2GZ2A 3EH2A 3P9KA 2XB8A 3QBTA 4Y9RA 2O0MA 1T6BY 4DJEC 4WT7A 4NFYA 1KI7A 1KYYA 2AI3A 2FR0A 3F5MA 2O8NA 5DO9A 1HDXA 1TW2A 3ANNA 5INTA 3ESZA 3GW8A 1Z18A 1GP2A 4QLAA 1FP2A 4IICA 1J5PA 3TZCA 1OVGA 1RXUA 3HCOA 5LPNA 2CJWB 1LI5A 1X1AA 4B45A 1YKFA 2XCIA 3PL5A 4I19A 3FYCA 3KD3A 4LZLA 2YJNA 1NNUA 1MNQA 2E21A 2WUFA 3F3YA 3PPWA 1G19A 4LDQA 1CLUA 5AK4A 3N1UA 4Z7JA 2NYAA 5JSZB 2WUVA 1FOEB 2LUOA 4KR7A 2ZANA 2PK3A 2O2DA 4OJQA 2VK1A 5CNMA 5FLXA 2CWWA 5CVCA 5HCUA 3ZKWA 3LL7A 2FK7A 3IP3A 1M8FA 1YDWA 4TUYA 4LY0A 2PG3A 5AHWA 4YMSA 3U7JA 4GGOA 1PFUA 2ZAYA 2E6KA 2FVYA 4MB2A 4FDUA 5P21A 1G20B 1FPQA 3AVVA 1JDVA 2PZKA 5C5EA 1XTRA 4PAMA 5E4YA 1UOQA 3UPTA 4DV2B 4LVOA 2OFPA 3QX9A 3EA5A 1I2CA 3IBYA 1WNTA 2Y8EA 4BYGA 5A5GA 1P5JA 4FD3A 3NPMA 1QDUA 3TF5A 3F7MA 2CV2A 4F11A 4PHHA 5KNCH 1VB5A 2A5YB 1FA9A 3UB3A 4P3OA 3I6QA 3DEJA 1DC3A 1YBHA 2HY7A 4IVRA 2RI1A 5CBKA 2ECKA 3NHLA 1P60A 4UD6A 5EXTA 2QD5A 3K9CA 1ACLA 1X80A 4YR9A 5ICMA 1RWNA 3P4XA 1VLJA 4AZTA 4EHIA 4CFSA 3KYDA 2WJ6A 2GCPA 4YREA 1CVLA 1ONPA 1K8XB 1L4GA 2W2QA 1DDIA 3G2KA 1IHXA 1XWIA 3I2IA 1LH0A 4GLLA 1J9ZA 3RK1A 1VG8A 3ORYA 2V03A 4MOWA 4FFLA 2WWXA 2VSNA 4K0KB 2P9BA 4MUIA 4UU8A 4F96A 4UZSA 2XUGA 3RSHA 1XCLA 3PU6A 1MB3A 3BDVA 2JIMA 3BA1A 1Z3CA 2F1RA 2HA0A 2CBXA 1P3DA 1YE3A 3A3KA 3K0EA 4XPZA 2IYTA 5F35A 4F6RB 3PQ4A 5C35A 1FUIA 1TU0A 3RUAA 4HNHA 4PQGA 2ONJA 2GCEA 3G9XA 2PU5A 1AMOA 3LUCA 1FU7A 5H59A 1BWSA 3JYHA 2AG5A 3EJWA 3L07A 4FYKA 2D5LA 3FGNA 4A0HA 1X9GA 3SQNA 5L7WA 5T64A 1ZNYA 2IT1A 5BRJA 1Q12A 5EIOA 4KOEC 3RJTA 3I5AA 1DRKA 3HU2A 3IPLA 1IOZA 4FEAA 1KSHA 4PPGA 2BMVA 3A0UA 1JDSA 1K88A 5EQJB 1WMDA 3RD5A 2HEIA 4LNUB 3T9BA 4DA9A 1T91A 1JTVA 4KMMA 3BERA 1UF9A 2A0UA 1DLIA 3BXOA 2AZ4A 5LKAA 4A1OA 2AMVA 1RYFA 4R41A 2IHVA 3UM9A 2B4TO 4KIWA 3T1TA 2OD2A 1K5HA 2JIPA 2QLLA 4QDJA 3AB3A 4MROA 3KUUA 5EA2A 2FPKA 4DA7A 4ZVMA 5JI2E 1OA1A 4MZXA 3PJDA 4ZOLB 2W6OA 3A31A 4DYHA 2QYHA 2ONYA 1FF9A 3PFGA 4H0FA 3S8MA 5AJZA 3WWCA 4PN3A 4H6XA 1Z5UA 4BEBA 4U7FA 4EFNA 3PNOA 4B40A 3MWLA 5CLHA 4O8ZA 4KODA 5A0FA 2HOQA 1P17A 4BCBA 2YDXA 3B3GA 1QF7A 3L1UA 4JUIA 1GN9A 3TLJA 5JCJA 2H4ZA 4FDAA 4PS1A 3NFRA 4JJ4A 1QC5A 4NZPA 4LHEA 3AV0B 2CUZA 4NZOA 4JWTA 4D80A 3W8NA 4LKOA 2GEUA 3BH6A 4BQPA 4R2HA 3WK8A 4ENRA 3PUWA 3CKKA 4ZVRA 1EUZA 3DMDA 1BHSA 1U98A 2J0UA 5FBHA 5FP0A 2QDKA 3GARA 2VATA 4QPJC 2EJVA 3FDZB 2QL9A 5KWIA 1AXEA 1EA7A 1RI3A 3FMGA 5IT4A 1OR8A 1YRLA 2NXNA 4ZVPA 3D4BA 2PGNA 1JKMA 2P9TA 1UWLA 1YZYA 2RGDA 2W5UA 2HWXA 1ECFA 2PLWA 1R12A 4YALA 3W7BA 1WY5A 4DLRA 4HQ6A 1AHPA 1JLLA 1KDRA 4LRUA 1VPWA 4BTVA 2I8CA 1L3IA 4I4TA 3PVCA 1Z6PA 4UOZA 4WSOA 2E55A 3SJBA 3KV3O 4KSCA 2LV8A 1FMFA 1NLYA 4Z4FA 3VGPA 4RK4A 4C14A 1BKYA 1MC4A 4RS4A 1LRKA 4AL4A 2H9IA 5AYVA 5DI3A 1OH8A 1KP3A 5EOVA 1EMDA 2PUHA 4LY3A 2NZJA 2ZYSA 5F23A 4FUQA 2DQ4A 3NH6A 3Q5GA 1T1SA 2A1IA 1GA6A 1PQUA 2GM9A 4FIZA 1TDJA 4BV8A 5T3YA 5A1JA 3AI2A 1Z2NX 1KHHA 3O74A 2AEMA 2GR9A 2ACWA 3WYCA 5FWNA 3P2YA 2A4KA 3LGSA 3HPQA 2QP3A 2JFOA 5EKDA 2JZOA 1L4YA 3KC2A 3KQVA 3QOFA 1GTVA 4AJ9A 1PZHA 1S8OA 3EBOA 4N76A 1I80A 3BTVA 1DRUA 4HDCA 3JZIA 2E1RA 4Y2YA 4TWIA 1YFLA 8GPBA 2UUBB 5J63A 4AKIA 4CKCB 1P0QA 4N3NA 1VKHA 4NMHA 3FCOA 1OZ0A 3EFOB 1YB1A 5C31A 1YFKA 3J81k 2ZSEA 5BPFA 4M0KA 3U4QB 4AUNA 3NHAA 2RD2A 2W93A 1OE0A 4IGEA 3MS7A 1UBRS 3TX2A 1A9QA 1IG0A 4RQUA 3W2TA 1EJ2A 4YRKA 5IWAB 1WIWA 3I83A 2P3OA 4OB8A 1UBSB 1V5EA 2GI4A 3MJVA 4L76A 2J07A 5IAGA 2IOHA 2BMAA 3ZHSA 3IAHA 3MRSA 3T4PA 2VOJA 2QE7A 3OOJA 3X3HA 3KLOA 3RFXA 2DTXA 3CCCA 4HTAA 2VWGA 1UUFA 1KDPA 3OZAA 2Q9AA 4QXAA 4AF8A 2XHEA 3D31A 1X14A