1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
3F7OA 3L1KA 4JP8A 1AQNA 3SICE 1V6CA 2ID8A 1Y3BE 1AK9A 1TMGE 1SCDA 4DJ5X 2ZWOA 4NE7A 1WMFA 1C9MA 3A3PA 1SBTA 2Z2ZA 4OMCA 1IAVA 1SBCA 1SUEA 2HD4A 2IY9A 3DW3X 1Y3DE 1GA1A 4HX2A 1KDVA 1AVTA 1GTG1 4M1ZA 3TECE 1WMEA 4KG7A 1LW6E 1TM1E 1UBNA 2PRKA 4ZARA 2WUWE 3EDYA 3DW1X 2Z2XA 4H6WA 3DE1X 1C3LA 1Y1KE 3A3OA 4OV6B 4FONA 3DE3X 5JXIA 1MEEA 2B6NA 2GKOA 3GCWA 1ZVKA 3CNQS 1A2QA 4KPGA 2X8JA 2TECE 3DE4X 3VV2A 1AF4A 5ARBA 3DE2X 5B1DA 1Y4DE 1P7VA 2QTWB 3QFHA 5FBZA 1BFUA 2PMWB 5JXGA 5JXJA 4C3VA 5AMXA 5SICE 1AV7A 1TK2A 1TECE 1PTKA 2SICE 3VV3A 1YU6A 1T1GA 4J94A 1GNVA 4CFZA 2Z30A 1Y3FE 1NDUA 1PFGA 1SUDA 3P5BA 1BH6A 1Q5PA 1XF1A 1HT3A 1T1IA 2Z56A 5JMOA 4I0WB 4Z2AA 1EGQA 1BJRE 1SBNE 3WHIA 1TO2E 2IXTA 4KB5A 4AKSA 2WV7A 3I2YX 1JEAA 2HPZA 3Q40A 2ST1A 3DVQX 2DQKA 1SBIA 1SUPA 2ZRQA 1MPTA 2SNIE 1SCNE 2SBTA 3ZXXA 1SIBE 3BGOS 1YJCA 1SH7A 2PWBA 1T1EA 2W2NA 2W2PA 3GT4A 3LXUX 3A3NA 1IC6A 1P8JA 2W2QA 4H6XA 3T41A 1TM4E 3DE0X 1GA4A 1VSBA 3PTLA 3DE6X 3F7MA 1KE2A 1NLUA 4RYDA 4CG0A 3SQOA 3DWEX 1Y9ZA 1BE8A 3OSZA 4BWGA 2DP4E 3QTLA 1SELA 1SBHA 3GT3A 2W2OA 1PEKE 3EIFA 3I37X 4GI3A 1WSDA 2Z57A 2ZWPA 2XRMA 1R6VA 3DE7X 1R0RE 1GA6A 1OT5A 4C3UA 3D9QX 1WMDA 1SUAA 3WQBA 3TI7A 4LVOA 5FAXA 1CNMA 1CSEE 1GTJ1 5I9SA 4DWWA 3CO0S 2XTJA 1Y48E 3LPCA 2G4VA 3I30X 3AJ9A 3I34X 1GCIA 5ARCA 3VHQA 1KDYA 2PQ2A 2DUJA 2PYZA 2PKCA 4NMXB 3ZXYA 1AU9A 1SIOA 1OYOA 5ARDA 2SECE 4AKTA 1PJ8A 4CFYA 4H6VA 2Z58A 3LPAA 3AFGA 1GTL1 4OMDA 1ZVJA 3VYVA 1DBIA 1TO1E 3DE5X 1S01A 5JXHA 1C9NA 2WWTA 3EE6A 4NE9A 5B1EA 1BE6A 1AH2A 3VSBA 1NDQA 1SPBS 3BPSA 2Z2YA 1SN7A 1ST3A 1C9JA 1Y34E 4YN3A 1SUBA 4K8RB 3D43A 4WOCA 3DVSX 1OYVA 3LPDA 1KE1A 1DUIA 5AVKA 1Y4AE 5K7SA 1R64A 1SVNA 4DZTA 2P4EA 4WOBA 1SCBA 3H42B 1WVMA 3AJ8A 4ZOQI 3WIVA 2W2MA 2WUVA 3DYBA 1SIUA 5AVJA 2E1PA 1GNSA 3DVRX 3WIUA 1BFKA 1GT91 1TM3E 1YJAA 1V5IA 3F49S 3DDZX 4MZDA 1SUCA 1SCJA 1S02A 3QMPA 1TM7E 3TI9A 1S2NA 3PRKE 1KDZA 5AQEA 1ST2A 3BX1A 1Y3CE 2X8JB 4LVNA 3GCXA 1EA7A 2V8BA 3VTAA 2ID4A 3UNXA 1SCAA 1Y33E 1P7WA 5CW1A 3HJRA 1YJBA 2PWAA 3Q5GA 1THMA 5FFNA 4HVLA 1TM5E 4B5LA
chains in the Genus database with same CATH superfamily
2O7VA 1AUPA 2C29D 2P9EA 4RXTA 5EIBD 4YCMA 2E89A 4QUJA 5ALVA 1LTKA 2J46A 3BQNB 5DIZA 2JFUA 1L3IA 4O4HA 3SICE 3IKLA 3EIUA 4DLLA 1D07A 5IM4F 4RV9A 4TTTS 4IQ0A 1SCDA 2O8NA 3OECA 1M5TA 1AHIA 4E32A 4ZK6A 1U2TA 4KR7A 2DHQA 4JENA 1WAMA 3SFZA 3NH9A 2PS0A 4N82A 2A0UA 5BRJA 1SUSA 5EJ8A 1GQRA 5KNDA 2A5LA 2JLRA 4JKOA 1OWMA 4KR3A 2FCAA 2V98A 3KJGA 3PYLA 4OFXA 3T7SA 3TX2A 3MCTA 1JX6A 1ABEA 1QZXA 1E2JA 1U4SA 1XP8A 5TT0A 1O94A 2ANCA 3ND6A 5EJ7A 3IE0A 1E2BA 4A15A 4LOIA 4DLUA 16PKA 1F12A 3ROQA 4MARA 3TZQA 5FA5A 1JU4A 2BSQA 2JJQA 1M6YA 4W99A 5HTKA 3ZDCA 2G6TA 1Y8QA 3ES9A 4MNTA 5REQA 2Q8NA 3I04M 1HEIA 1U7PA 1V71A 4Q00A 2OXEA 5G1OA 3L7OA 1PG0A 4DPLA 3K6SA 4MHOA 3WLIA 2YJNA 5I9BA 3HB4X 1MEOA 3G2OA 2IGTA 3WDSA 1QHGA 1U4NA 3T35A 1HV8A 3IQWA 3IUBA 3QUBA 4WNAA 5ED4A 1Y0BA 2F3PA 4LHEA 4E6EA 1O6CA 1ZIPA 3ED5A 4P0PB 4MGIR 1RI3A 5EIOA 4DM3A 4CL2A 1U04A 2QX4A 3EDYA 1QIJA 3DAYA 3U61B 1KI6B 1RXWA 1FS5A 1B93A 1O9HA 2Z2XA 3BXPA 5HIIA 3R5TA 4CU2A 4PYLA 1ECPA 2A0FA 2BBSA 3B7PA 5I7EA 3ROPA 2XUQA 3I1YA 2JASA 4BIIA 1IN8A 2AFHA 1C3LA 4R1PA 1P1BA 2EGGA 2KYRA 3A3OA 4M6WB 1R0ZA 5IVPA 4WBNB 4A6XA 1A8IA 3A1VA 1J5EB 4NYIQ 4KLRA 3KLNA 3FTQA 3GFSA 2X4LA 5F4BA 4B83A 3NZEA 2RAFA 1UT8A 1H42A 3K9WA 3R7AA 4BFZA 5CA1F 3L6DA 3ME5A 4B4DA 2HGSA 2WAMA 1F7VA 2CMFA 5ICCA 5DRYA 5DYYA 3ACBA 4JCCA 4FCCA 4RFSB 2NP6A 4KQGA 1R6TA 3PK0A 3VYUB 4CLDA 1N2IA 3L1VA 5KKAA 1W5SA 4FB5A 2Q3BA 5EUQB 3Q88A 4DA0A 1JDNA 3AHJA 4GP7A 4B79A 5MGBA 1BCRB 1YONA 4LTNA 4MV1A 2R68A 4Q0MA 4D56A 3EAGA 1EFVA 1SZDA 4HUJA 5ESRA 2HX1A 2ID9A 5H0IA 3KZKA 1OB5A 1KZ4A 1E3IA 1VSUA 2HDOA 2QRMA 4R16A 4X45A 1K8QA 1V8BA 3DC2A 4D9JA 3K1AA 1U2PA 3DPUA 3PRJA 1EK1A 2VCYA 5EQFA 4LE0A 5E9JA 3L8FA 1WKVA 4H59A 1GSOA 4YJ3B 3E5RA 4JLPA 2QTWB 2C7OA 1HKHA 3FZQA 4WZBB 4R6XA 2I71A 1OIWA 2QU8A 3DCYA 1UM8A 5HCIA 2Z2KA 5H02A 1IEVA 4XWTA 2GSDA 3JQCA 2MYTA 5FOSA 3RI3A 4L9SA 3ZWMA 3ZHRA 5DHPA 4Y6SA 5AMXA 1J8DA 5JYDA 1TYAE 4ZYXA 1NI3A 1TK2A 2JZNA 2OCXA 1OV6A 2VAMA 4LOHA 3HL0A 3VM6A 4ZZ2A 2ZJZA 2DTDA 2ECFA 1QRSA 3DMHA 2XBLA 1CHDA 1M5UA 2NPOA 4CFSA 5JRZA 3FBTA 2R8YA 1TVMA 4LRXA 2I5PO 4FWIB 4BZWA 1DAIA 1CY6A 1W9HA 4QPZA 1CYEA 2WJPA 2NQ2C 1XFAA 2AT1A 4BVJA 4DL9A 1R4NB 1B1CA 2AOVA 3LRXA 2EIXA 1CE8A 1L7EA 4KMSA 3TTTA 5PNTA 2CLDX 3V2GA 1LZKA 5KQRA 4I1PA 4QOFA 1AKVA 1M2VA 2SKEA 4X0EA 5EUCA 3M3DA 5C34B 3NM4A 2XWSA 4Q34A 3UJ3X 4D9KA 1WY5A 2Z8XA 3G5UA 1E3EA 1CQIB 4B40A 1MB0A 4LFCB 1XLTC 1S8NA 1F9EA 2B25A 3GUVA 3OCZA 5DX0A 4UE3S 2HRCA 5BQ5A 4FQ7A 4V0LA 1G5IA 3OQVA 1A4IA 2H1OA 3QOFA 1COWD 1A97A 3JATB 1CBUA 1OLXB 1V6AA 2HA5A 1SXJB 2J32A 1DAKA 1T8PA 1IMOA 3OZAA 3S8EA 4COKA 1R0BA 2J0QA 1KVTA 2GXAA 2HDHA 4J4BA 2ZDHA 4HAWA 1TCUA 3FTNA 3WV5A 2H85A 4EPTA 5FAKA 1RPJA 4NSNA 3WIEA 3ZQKA 4F12A 1D0VA 1UBEA 3QU4A 1VLJA 3DDHA 3VZSA 2HPZA 4LAFA 4AS2A 1XELA 2YL2A 5LQRA 2QY9A 2OECA 2C5HA 2ODTX 2OHHA 2VHTA 4Q7EA 4FR0A 1EDOA 3QVWA 2P5YA 3TZBA 3WGZA 1JQLB 3GMTA 4L8YA 4URHA 4DHEA 2IUEA 4P3KA 3KUCA 1UQTA 3X1ZA 3HJHA 4Z7QB 4OFWA 1W581 5CM8B 3O3NB 3NORA 3PHBE 2C4VA 4NFLA 3HXLA 2XCRB 4U7FA 4P4SB 1FDTA 1O2DA 3OZSA 3HFGA 1FYFA 4OMUA 3TKAA 1DAEA 3ZN2A 3AO0B 3C45A 4R9NA 2PV7A 3BGOS 2OV4A 2WIAA 1KKLA 4ICIA 4A8JA 1UWVA 4R9SA 5BW8A 5IAGA 1E2IA 4OI1A 1BH2A 3UBMA 2PZEA 5IWAB 2I2WA 2M2IA 5F7JA 2Y0DA 3PUHA 1C14A 2C4TA 5JQGA 1GKUB 1CEEA 4CLRA 4N9WA 3UGKA 1J2RA 4NHOA 3CVJA 1E1QD 4WINA 1VBFA 1JIQA 1PVDA 2Q7DA 1G6OA 3PJEA 4EB6B 2H1IA 4L2IB 1K88A 1I0LA 1VECA 2Q5JA 1ADBA 2IYPA 2Q9BA 3A3NA 1NKVA 3OU2A 3HQ4O 1K6EA 3K0AA 1O94C 2GCGA 4H6XA 3ZKWA 2YZNA 4PAWA 4M89A 2IZ0A 4EUEA 1U2RA 2XUFA 4JQZA 2QRQA 4RZHA 4ARZA 4MYCA 4EHNA 3PNKA 4QGAA 1VSQA 3TQIA 1ZH0A 2WG1A 2G0NA 3H2HA 1FP6A 4GGMX 3MUEA 1N6HA 1JL3A 4MWSA 3WLRA 2VR1A 4TWBA 4DCGA 3FM9A 1OJLA 4LOLA 2Q5OA 1EIZA 4MW0A 3T3NA 1N9ZA 4A9AA 1RWQA 1XMIA 2ZJ0A 3OSZA 1YA8A 5GWXA 4DYDA 4HV4A 5B7PA 1PJZA 1VHQA 3AL0C 3QTLA 5TPZA 4L5YA 2EOAA 4JBNA 1K9SA 3NHFA 5BR1A 3E22A 1PEKE 2WYWA 3QMMA 4M86A 2NTJA 2CGEA 4S1TA 4M83A 3EUFA 4JI6B 3VR3D 1X94A 5JSKA 4PO1A 3KV1A 2VI5A 1P1IA 3D3EA 1P6QA 4OSOA 1JI0A 5A3VA 1QIFA 5DIFA 2D1RA 4OPMA 2HWKA 5EKDA 2VDQB 1GV1A 1B2RA 1RI5A 2Q1YA 2IELA 2QVZX 4OB6A 5B7QA 3JYLA 3ROKA 4I4NA 5I9LA 1HX7A 1YHNA 3LJKA 1U4OA 3AFOA 4QPNA 1DP4A 1C0EA 4YT4A 3WLKX 4EG8A 1X1RA 1JSCA 1WXEA 3PG5A 1LBHA 5K0SA 1Z4LA 4EPVA 1A4RA 4B3IA 4ZPJA 1ZNWA 1H2FA 1YAHA 2GN1A 3G17A 4LE2A 4BE7B 3MCZA 3WB0A 2IHYA 5ERXA 1NT4A 3K6RA 3PUXA 4G63A 5JZSA 3QE9Y 2DBYA 5AYVA 3SBEA 2UUAB 1HE3A 2O8EA 1JB9A 2H3HA 3L18A 1OXKB 4B8YA 2IY8A 3KYDB 1K7FB 1NWCA 3OZFA 3IUPA 4MW5A 4ER0A 4YCCA 1U80A 1M3SA 1AKYA 2WK1A 1FE8A 4I99A 4JODA 4LXIA 1SRQA 3CG0A 3FJOA 4QTZA 3ZJ4A 4BJ3A 2QJWA 2EATA 3BEDA 4EQ6B 5JNLA 1MZVA 2JA2A 2X23A 2ZXUA 3GLIB 1J7KA 4LXTA 1K89A 2OP1A 6REQB 4H60A 5JANA 3M7IA 1VLLA 1KZ7B 1P31A 1A71A 1NIPA 1KVQA 5DBHX 5HS4A 2Z3ZA 2NSDA 3F8TA 3T34A 1VOTA 4GDFA 1I4TD 1ODJA 4PR0A 1OX4B 1E9VA 2Q9AA 4MUFA 3GA0A 1HSOA 3UAXA 4JI5B 4F1WA 2DY1A 3H1PA 3JQGA 4GD3Q 4F4FA 1OT3A 5KHAA 4BNNA 1JWAB 4EY6A 1T2AA 3KWLA 1PR4A 2WHEA 4M9QA 3FPKA 4TSFD 2I34A 1AU9A 1G20A 4GQBA 3UF0A 1XMVA 4BFLA 2QMEA 2W37A 4PZZA 4OL9A 3AF6A 4HGZA 1USVA 4KE9A 1MTOA 2Z1NA 3UOWA 5JFGA 1YRWA 2VBFA 3P9YA 4TVKA 2CDAA 4JR2A 3W2EA 2ZBQA 2XT9A 4IX9A 1I4EB 3NVKI 1UDBA 1TTHA 1N2OA 1GTL1 4CEIB 3BZWA 5JCOC 1ULHA 2HXSA 5L95A 5GQSA 5JG7A 2VLIA 2V9CA 3MWDA 3X0DA 4ZYVA 1JZSA 3B9PA 4ZK2A 1A9XA 1HYEA 1QIIA 3MGCA 2I3BA 1HC7A 1TGVA 3A8TA 5F5NA 1DC8A 1NNEA 2AOTA 2GZHA 2MJLA 5KYGA 1YQ9A 1ORRA 5IG2A 2IPLA 2PMBA 3A6ZA 3NWEA 2O7QA 4NCIA 1IYZA 4PC2A 3R5FA 5IBRA 4U2GA 2V65A 1H3FA 1Q7CA 1T9AA 3CBGA 1NONA 2H8KA 1RT9A 2HSDA 1GY8A 2F64A 4WLNA 3K9CA 2JHGA 5AT1A 5AVZA 5D7NA 5EVJA 2V97A 4DCCA 2FPIA 2O3SA 5CLIA 5DCLA 3RTBA 2QLFA 4IJMA 4DIBA 2P0YA 1CXZA 1QJ4A 2I2DA 4FDVA 4C04A 3U3XA 1KJNA 1E5TA 3BOSA 3H2GA 1HWYA 1FXWF 1V4NA 3DF9A 4MEAA 5A6SA 3NIGB 4M0LA 4ZCRA 1KORA 4URXR 3LYLA 3D3NA 5FJIA 4DMMA 3O2NA 4LBZA 2MOKA 3DEZA 4J0CA 4A0SA 3GPLA 1SVMA 4URUR 1NVBA 3AFIA 3T0GA 3M2TA 2JHPA 1MFZA 3ZUPA 4KIJA 1V8DA 3JAKB 2HA0A 3ZZUA 5LWHA 4EG0A 2GSWA 3HU3A 5IKOA 3HVKA 5EP1A 4A8JC 1EG2A 1X0VA 1X7YA 1Z2CA 4JVOA 1IN6A 3CLVA 1YI1A 3ODPA 5FLEX 4YRRA 1CRQA 3AVXA 2Q07A 3OQNA 4D74A 4ZOQI 2ZSHA 1B0UA 1U3VA 4NP6A 2NN3C 3QNMA 4MVJA 4C5AA 1VJCA 3ONWA 1IUNA 3QF4B 1CIPA 3EG5A 5FUWA 1E7SA 2FOIA 1ETUA 4LKRA 5A4IS 5CDUA 5KNBH 2DKFA 5KVSA 1XB2A 2HLPA 5AVJA 2AFVA 3QTBA 1Q20A 4OJNA 5I9MA 5BOVA 1OH6A 3RIHA 3PXCX 1KTIA 1LJUA 3DAFA 4GO1A 1T2UA 2UYQA 2JI8A 3G7SA 1NYRA 2AYYA 3B1KA 2J0SA 3PX7A 3JQ7B 1C7EA 1NJ8A 1ZM9A 3OAAA 1P61B 3STVA 4EAQA 4HP8A 5G41A 2J0UA 3HU2A 4OP1A 3KR1A 4CKBB 2REQB 1EM8A 1S02A 1JKMA 1P8AA 1QQ7A 1SQ0A 2WZBA 3KDSE 1IK4A 5SZIA 2MMCA 3B3JA 4E5KA 4EKNB 1QGUA 1OGIA 2JLBA 4KSBA 3TUJC 4F2HA 3IB6A 3SR4A 1T3TA 1RLIA 3NRCA 2XQIA 5T6BA 4PW0A 3V8NA 4AF8A 4C7JA 3WLPA 5BORA 3O1HB 4Z8YA 5F5LA 3BH7A 4Y6QA 3P27A 3QOXA 4DYHA 4Y2TA 1ZVVA 5FR1A 2I55A 3TWOA 1U8UA 1SULA 4PQFA 1QO0D 3FTCA 2LCFA 2X5KO 1HOXA 2YJGA 1Q91A 1I3MA 5BRAA 4MWCA 3EGOA 3DLTA 5L9AA 3NPMA 4C03A 4D96A 3JRXA 2JAWA 2RSLA 3NNDA 1SCAA 4AU1A 4E1VA 3ZDAA 3U7QA 1DEAA 4ZHQB 1ORHA 2WWGA 1CB0A 3EF3A 1SURA 1DS6A 2EC5A 3BRWA 2Z6AA 1GNPA 2WINI 4H0CA 1KHTA 2H1FA 3LMKA 4J7UA 1R0LA 3FAKA 3DMFA 1HTWA 1GGJA 2IUUA 2C5AA 3GRRA 2VP6A 1Z7WA 4JLOA 2R8EA 4CR8A 1D6SA 1FYVA 2VRNA 1C7ZA 2WZQA 5DSTA 3W6OA 5C1PA 4MQFB 3MSXA 1DXOA 3VZDA 3GU3A 3M82A 3P5SA 1S8AA 3O75A 3QWAA 3N7UA 4QBHA 4N5IX 4CKCB 5CR9A 1Z6GA 3OQOA 4MCIA 4CODB 2Q21A 3LPMA 4JP8A 4YRLA 3RG2A 5KAPA 2JIBA 1CV2A 1W46A 4O8ZA 4E21A 5KYVA 5IT5A 2D8AA 3IBFA 5AJXA 2O8BA 2Y93A 2BFEA 2Q2VA 1O7JA 3C3YA 1NW5A 1M6VA 1TMYA 2O2CA 1TVKB 3OH8A 3QRWA 3ROGA 3ONDA 1DTWA 4HDOB 3UN1A 5HGXA 2F55A 1ZD3A 3BMQB 1ZK4A 1X1QA 2RB5A 2XUGA 4L4UA 4Q4HB 1BU8A 1P17A 3HL4A 1MXFA 2DHDA 2JL1A 4EGQA 3EEQA 2UZ3A 3SVZA 1MRNA 3BFVA 4ZVSA 5ITSA 2BBWA 1C9MA 1E3QA 1BC5A 1LDGA 1G60A 2CJPA 2PV0A 1SBTA 2R60A 3A26A 3QI7A 3DEFA 3LZDA 5D6NA 5DLDA 5BQOA 3INNA 5CYGA 2QXUA 3E9YA 2QJRA 4DQDA 1SR8A 1C3EA 2J6BA 3ETGA 4NTZA 5HPYB 1UODA 1FJHA 2YHUA 4CMKA 2XYRA 1Q92A 1PEYA 3I58A 2VXYA 3PGA1 3GA7A 2I9KA 5FNZA 3AHEA 1Y9JA 3CUKA 1I4WA 1Z3CA 2JAHA 3A4MA 3L1HA 2RGEA 3E9MA 3RW9A 2IZ6A 4PCUA 2HF7A 2B2XA 1PV1A 3RS2A 4RIIA 4ZVMA 3EQ8A 1P4RA 3EZXA 3JWIA 3P20A 4KMOA 3NBYC 4DBZA 1JE0A 1Y8AA 1JQJC 1KSJA 4S24A 1KF0A 4V0SA 1RRMA 2EJVA 5DP1A 2H63A 3MJFA 2R6R1 4OLHA 1ZCZA 1PZMA 1E61A 2VTDA 3OTGA 3RIGA 1B3RA 1QYDA 1QYXA 3QNWA 3PEFA 4B6JA 2VNSA 4NENA 5K8UA 1S1CA 1UPXA 3GAMA 3KJFA 3OWXA 5C7IO 2HJSA 4NZOA 5CH5A 1LC3A 1UC5B 3A28A 3L2OB 3T1QA 1KJJA 1OASA 4CV2A 3HO8A 1ECBA 1XZ8A 2XYQA 2CNLA 4RKEA 4Y2XA 5A6VA 1N0WA 4L95C 2BTQA 2XQFA 3W2GA 2W6ID 5IH3A 1P75A 3VR4D 3K6KA 3KAPA 3I28A 4XSHA 4LY9A 2D8MA 4PFKA 1XTIA 1Q7RA 4N3CA 4AWAA 4ZJUA 2AJDA 1BQ3A 2O5VA 3THYB 3TUZC 3W5CA 1UBSB 2BR5A 4MW6A 4RMIA 3LUJA 4TLMB 5LSAA 2XE7A 4MRSA 2N3ZA 3QE0A 1W34A 1VP9A 1AQIA 1WULS 4Y0NA 3JTMA 2R48A 2VF7A 3BB3A 3ZVKA 2J67A 1ZIYA 5B30A 2E4YA 2CCJA 4HNAA 2NU7B 3RCBA 5FQNA 4LJSA 4QQNA 4ZFNA 3Q85A 2CLMB 4F71A 4RFVA 2QAIA 5LYYA 4FQ5A 4IZOA 4XRGA 1W19A 2IZOA 4FN4A 2QMUA 4JA0A 4YJGA 4X95A 3VMMA 1RI4A 3FNQA 3K5HA 5ADUS 3GCGA 1K4KA 2O06A 3BFJA 3DEIA 3P2KA 4GVLA 3SQMA 1GILA 1ONSA 1VSTA 5B2FA 2C2XA 2YMQA 4MB0A 5CHEA 4WPGA 2X8JA 3ANTA 1GV0A 1MAUA 4M8KA 1DEHA 5AHWA 1W44A 2HHLA 1VCNA 4ZEOA 4Q1VA 3G59A 2QM7A 1V47A 5CLGA 4UCWA 4B17A 1MVOA 2HN9A 1QH1A 1VZ3A 3CEHA 3LU1A 3U17A 2AS0A 1L0BA 2GFQA 5IK2A 4ZI2A 5E6SB 4CI0B 1NQWA 1JYEA 3B70A 4D99A 4UVDA 5C8YF 3ST7A 4IIJB 3EPPA 3JVDA 3Q15C 2FPGA 1N7HA 1AV7A 3IEUA 1URPA 1L8AA 4ZVVA 2JIPA 2GEDA 3JVUA 3MWEB 1P1JA 4GL4A 8MHTA 1V48A 3DZBA 1ZWLA 4TV9B 3TVYA 1RRCA 1GNVA 3TYXA 3WMEA 4C88A 4CFZA 3SFVA 4MJ3A 3LCCA 1FNNA 1N57A 3G9ZA 4YJ2F 3SK0A 4ZMSA 1I3OA 3AR7A 1J9GA 1PFGA 2IH2A 1SUDA 1YQUA 1F2DA 4QXPA 2DE0X 4C7MA 5KYUB 3M6UA 4MLZA 2H5IA 3PX3A 4MW9A 5FADA 2FW9A 3NJRA 5IWCA 1Q5PA 2VLBA 3CKLA 1DDOA 1K4MA 1UQUA 2I65A 3PFHA 2R84A 5IH7A 2A86A 1OZGA 3AW8A 3QJGA 4CMAA 2P3LA 4ARVA 2QTAA 1J8QA 1TU4A 2HREA 5HA5A 1P2BA 4KQHA 2R8BA 3AWDA 1J6UA 4HNQA 2Z6QA 1BMFA 3HV0A 4FYYA 4GZ3A 4KO8A 4KWIA 3TR5A 1GTVA 4YV1A 2XMZA 3HPRA 3FUVA 1PFQA 1T9DA 1Y1SA 3GH3A 2BH9A 2BFBB 3KDPA 3E1GA 1Y1LA 2NACA 1C0KA 5FNVF 3DEAA 1PIWA 1T10A 2BLLA 2CFCA 2V9PA 3R6WA 1K4YA 4JJIA 1CNEA 1POWA 3INTA 5L7TA 4M88A 3KHUA 2G6BA 3O9ZA 3EPHA 3S29A 5H8WA 1YDMA 1HE8B 1L4KA 1T5TA 3OZVA 4RESA 1X7GA 2DAPA 1CQPA 2CVPA 5HF5A 3ANMA 3UAZA 3LSYA 3Q7SA 3ITKA 4UHKA 1VMDA 3EAFA 2CJWB 1WV0A 1GAQA 1A7AA 4HMPA 3RKRA 2CXXA 4YXFA 4O59O 1CY8A 2YIVX 4GFDA 4PAMA 3C8HA 4W1RA 5LC1A 1HL7A 1H23A 1JF8A 4IIYA 1ZMRA 4MRMB 4NZ9A 5CVDA 4DG9A 1TOAA 2K6GA 1OYWA 5DV9A 1CJKC 1W7AA 1SC6A 2DHEA 5CIYA 1A9ZA 1GZ5A 2CLIB 2JIQA 2PUVA 3A11A 1CVLA 1PL8A 2CDRA 1YJCA 4PPFA 5EWLB 2B8JA 2FWRA 4IDOA 5KI6A 4NH4A 2H4FA 3RS5A 5AVXA 1KI6A 3V33A 4HLQB 4M1OA 3MS4A 1OFGA 3KT8A 5L4NA 3ZHYA 2WICA 2ZWMA 3AEKB 4M8LA 4G24A 4U6NA 3WWOA 2R6HA 2IS4A 2FR8C 1WCV1 4I9FA 2FKAA 2HYDA 3KKQA 1WS6A 4UNPA 5FYQA 1BDBA 1JHVA 3RS4A 3TH5A 4KL8S 1TJPB 2OO5A 4DB4A 2EBUA 4Q48A 3FLEA 1QVZA 3LXUX 4M6WA 1SKYE 3DFUA 4BGIA 4ENUA 3WK7A 3NEJA 1WMAA 5ALHA 2DERA 4FE3A 2R9VA 1E6EA 5CM9C 2ZUEA 2P0AA 5TMEA 1SUIA 1GU7A 4O4IF 3WA7A 4I1RA 5JH7F 5BMVA 4DOMA 5JZVA 2XKAA 4KODA 1XRQA 4GM4A 4UULA 4ZXFA 3W4JA 2JKYA 2ZI7A 4RFSA 3EEFA 3SSAA 3VPHA 1FC0A 1ZC3A 5CVEA 2QLMA 3SBOA 3SE7A 1N1MA 4HEA6 3UKDA 3BSSA 4WKGA 3F7MA 1BEUB 2NNLD 2X9NA 9MHTA 5FUMA 3GLKA 2N1MA 2BDUA 3OOWA 4XYGA 1BCRA 5J1TB 4TVSA 4HDMB 2BFOA 1O87A 1P0FA 4GGPA 1WUYA 2YR0A 4L02A 1VIMA 1FBNA 3MQ4A 3P45A 3HDTA 5G0SA 3KSBC 2LV8A 1YBHA 5EHGA 3COVA 1CZOA 4KQCA 3PNLA 2IQIA 1IK6A 2NO9A 1R3DA 4I1UA 1ZU4A 4UE6A 2GXQA 3DOJA 4YJ3A 4EDFA 3T38A 4J4TA 3NV7A 3PXAA 5LPNA 3F0TA 3UMRA 1U7DA 4DLWA 4DC1A 2AJCA 3PKZA 4P93A 4HYTA 1JPUA 1R0RE 2BZ1A 1X8KA 3DBHB 1E7MA 3IQGX 4PHFA 3S3TA 4X7MA 1NBEA 1Z16A 4QXAA 4AXXA 1E59A 2HIHA 1E2PA 3JQRA 1OLUB 1J07A 4EKGA 3PD1A 2EG5A 4KDRA 4F92B 1UJBA 2BDEA 4HDKB 4NBVA 2C84A 4R3NA 3KZNA 3WQBA 4PE5B 5CIWA 5FOTA 6CHYA 1DBQA 2BFNA 3W4KA 3HKEA 3DUFA 3TI7A 4G5YA 4F3CA 5K9ZA 3EZNA 1IZ0A 1R4NA 1AF7A 3HCRA 4XVHA 3AH8A 3K9GA 1P29A 1P33A 1Q2UA 2EKLA 2HQRA 2X8LA 1GQOA 1RZRD 2QN9A 1KZYC 3B89A 1WL8A 4CLHA 5FWYB 2CVFA 4BMDA 3L8DA 4U0JA 5ABPA 3KUXA 2LNDA 4UW9A 3ZQJA 1IVNA 5BSEA 4V03A 3BWEA 4L4SA 1EVJA 1PQWA 2FDRA 3PUKA 4TL7A 2Y1GA 4CT5A 4JUFA 1P1KA 3LNTA 2XB8A 2QW8A 3IV9A 4MROA 3AFHA 3VU3A 1RP1A 2VHWA 1JHYA 1SXJA 3VAZA 1M2GA 1OWLA 3Q9LA 2NVBA 2CXUA 1YVPA 1IU9A 2YTZA 3AUKA 5BSTA 4LCBA 1OJ7A 4XGQA 1ZHHA 4KO4S 4C2BA 1M10A 1FNSA 3HYLA 3TZ6A 4YX9A 5JCXA 1AY0A 1RM5A 2A5GA 3LWDA 1YR2A 4N0MA 3VYWA 4DXHA 3LQ2A 2BT4A 1YB2A 2GYYA 2BMFA 2BGTA 3NP7A 5AO9A 1OYOA 2V55B 3KQMA 1D2RA 1U9ZA 3QUAA 4BS9A 3HRHA 3WGIA 2OBYA 2YXLA 3R77A 2WD7B 1DIRA 3LCMA 1EFUA 3IELA 2A5FA 4P3OA 3HNPA 3PJGA 2AUTA 5TJ9A 2P11A 3OPYB 1H93A 2G8LA 1XU7A 4P4SA 1C3VA 4MVXA 4X8MA 5HG0A 4MA5A 3AFGA 3RJ9A 1K5GA 4DWVA 4ASUD 2EYQA 2C1XA 3ZK7A 1Y8RB 1OZHA 4P0QB 2A3RA 3KQOA 2XECA 5AJZA 2FG5A 4FILA 4BKQA 4D81A 3O4JA 1CQJB 3BJMA 1ZNXA 5A5GA 2OFPA 3DNMA 5DP2A 3QLEA 5KNCD 4BYMA 4I1OA 2JGAA 2H1HA 2W98A 3OZCA 3VKUA 4NFHA 1G8MA 1H0HA 2OVFA 1X15A 1UBTS 1WCXA 2WZDA 1EVYA 2WWTA 2ECPA 2DPGA 1XD2B 2QI9F 4LYYA 1XNJA 4TKVB 2LGJA 2OAEA 3M6AA 2A1UB 2COKA 1T24A 2J3MA 3QWHA 4BJ1A 1U7UA 1LU9A 1RM3A 2PLRA 2PXHA 4PX2A 4BTLA 4EB6A 1WBDA 5A4MS 3E82A 4MR8B 4G0QA 1SY7A 1RAIA 3E70C 5EGNA 1G5RA 1A2OA 1E6LA 2XUZA 4UC0A 2IQ5A 2VYND 4CUJA 3DR5A 4JBYA 5IT9A 4DA8A 1Y9AA 3N86A 1E2EA 3TE7A 1VKHA 3MLEA 4LWZA 2AYXA 3QF7A 4QVGA 4ZDJA 2NVOA 3HCOA 4I5EA 3TAXA 1OXUA 5CA1B 1XDDA 3HBAA 4KN9S 1NQVA 5JCJD 1RJEA 1XIVA 5TR9A 4PYKA 3DMYA 4KGDA 2FPLA 4QXRA 1TTPB 3HA3A 5CX1B 2QTRA 1C80A 2B61A 1YKFA 4M0KA 2QNRA 4ZYZA 4OU4A 1LLDA 1A7UA 2RC6A 3AEUB 4OJQA 3CUSA 3TIVA 3LE8A 4B1FA 3ERCA 4OK6A 2FDXA 2OFOA 4MO9A 3SSMA 4D9HA 3R4VA 1JIKA 3R24A 3EXG1 2X0IA 3ANYB 1QLJA 1F8YA 3GRVA 5KTOA 1Z7BA 2WBLC 4G56A 1K98A 1L1EA 1RHUA 5DCUA 3ILHA 3LGXA 1RTTA 3ROEA 4M0FA 2DZDA 4EHIA 5CA0F 1NZJA 2XMGA 3O31A 3I2KA 3WDLA 1ONPA 5EFZA 1TYDE 1V3UA 1UEJA 3FB4A 3I9OA 2OO5C 3NAQA 1GCAA 5K4AA 3SEZA 2DTEA 2IZ5A 2MSKA 3PI6A 2G88A 3MTGA 4CTKA 3ZLBA 3FFBA 1ZPDA 2C31A 1YGPA 1EWVA 3IXQA 4YUZA 5K0JA 2G5PA 5MFPA 1UJNA 1TO6A 2AUNA 1IXSB 5CNJA 4WX2B 3TDNA 3G6WA 4DC0A 1D1QA 1JEDA 5KC8A 5FPSA 3ANNA 4UM8B 1SZPA 4E7PA 5LYJB 3CVXA 4RDCA 3MSCA 3CMCO 2BOVA 3GZ4A 1XEFA 2GYVA 2PGXA 1NHGA 1CG6A 1GL3A 1KJ9A 1SK8A 2F90A 2PTHA 2VHXA 3BMOB 1FX1A 2UKDA 4RTSA 4AL4A 4J7CA 3DDZX 4F5YA 1Z88A 1Y7LA 2GILA 3GFFA 3H0KA 3A7DA 4A0GA 4B2IA 2KBFA 2AX3A 2C3UA 3OZGA 2UZIR 4JXXA 2Q99A 5A05A 4AW9A 3I09A 1P18A 1OU4A 3VSDA 2OV3A 5JISA 4M7OA 2E4UA 5C81A 2J0VA 3DXZA 4OXRA 4EQ6A 1NFRA 4MV6A 4DDHA 1IULA 1R5OA 3I9MA 4C7OB 1ZXXA 3D5TA 1V0JA 2OVBA 1I1QB 2ATVA 2PZFA 3IPAA 3GLIA 1H1DA 3HE3A 1XLVA 3SE0A 4RVDA 2VTEA 2ZJ5A 1O58A 1RQXA 4KI0A 2FRXA 3AP2A 4ZC1A 3N07A 2YN2A 4KWHA 4UHCA 2ID4A 4QDTA 5F73A 4GWKA 3TQFA 1K7EB 4K7JA 2HY7A 4GVPA 5DHAA 3T0IA 3KQKA 1RZVA 1QV7A 2J45A 1P7WA 2IC5A 2GD2A 4R2IA 1FUEA 1QQ6A 5AM3A 3QX9A 4ESVA 4YY3B 1SCQA 2QYOA 2WUGA 1T4BA 3ILYA 3L05A 1PDOA 3VZRA 4PO8A 4PZ0A 4BQQA 1AKUA 3GZTB 4MV4A 4B80A 1JH8A 2IXGA 4R8MA 1FPQA 2YY5A 5IC4A 1KIMA 1DBVO 1XRMA 3SEQA 4C87A 4CIWA 1J09A 4CEIA 3BDVA 3SIPA 4DN6A 1W29A 4M0EA 4EEKA 2O14A 3T52A 4DR7B 2OWDA 1EDEA 2BEWB 2XA9A 2EKQA 2WG2A 2BFDB 3PD0A 1A88A 1V39A 4BNKA 4M22A 2V5VA 2BI4A 3VHRA 1XP5A 5L51A 3AF3A 1CEYA 3H2IA 5DGHA 4F21A 1T13A 4LZWA 5A1TA 5HDQA 3TG8A 1UOQA 5BV0A 2PX3A 4NFSA 4NAVA 3DAGA 2XNKA 2RK4A 1XZPA 2XZPA 1JKJB 1QGAA 1SXJC 3B6ZA 2ZB3A 3DUWA 1O5OA 5FX2A 4NU0A 5DB4A 3QEBZ 2PD6A 3CVWA 2HK6A 1L5ZA 1Y4UA 5BW4A 3EPLA 8ABPA 1GGHA 2MU1A 1M74A 4O29A 2J33A 1BMQA 3D4OA 4MRAA 4B84A 5J2UF 2I1VB 3O7WA 4Z51A 2GWRA 1ZH2A 1THTA 2RKOA 4EHKA 1EA5A 4DR4B 4CMEA 1H2EA 1LW7A 3DW3X 4HWKA 4QOJA 1NN0A 2NO6A 3OJXA 3CHYA 4ZI7F 2IOYA 4HB4A 3C8ZA 3QK7A 2Q5EA 2QLBA 4OQZA 1GTG1 4E09A 1S96A 1E89A 1RCUA 1ZYUA 1HFWA 3B36A 3C6XA 1DQYA 2I8CA 3NHKA 4TMVA 4NOLA 2WF9A 1T4MA 5C1DA 2ZUVA 2BE7A 4JLSA 2HEIA 1RXIA 3JAKA 5DE3A 2RI0A 3EOBI 4TLBA 2X0FA 4C29A 2P75A 3PC4A 1UBHS 2WJ4A 4LRWA 4MOWA 4EL5A 1A8UA 5CEFA 1L2TA 1I9GA 1O77A 4OGGA 1QK3A 4QU8A 3R7LA 3DAHA 4U2EA 1JAXA 2VFAA 5KNLA 4BMXA 4UM5A 4REQB 3KKLA 4YMWA 1AUQA 3OOSA 4Q19A 3VO2A 1B8OA 1VGVA 1KK0A 1Y1TA 2WWWA 4PFSA 1A7KA 3IDAA 4FOPA 5HE8A 4IIXA 2P4QA 4BLSA 1QU2A 4H4EA 3V8BA 3NVMB 3QF4A 2YMPA 4J1TA 3EJ6A 4M9ZA 4YONB 2PNJA 3ZU5A 3FF4A 1I33A 4FKBA 1JG7A 3CY6A 3W8DA 4BRSA 3N6RA 1BX0A 1SOVA 3VDRA 4JYMA 2INGX 3TN7A 1RC0A 4D3YA 2ZBUA 5EMJA 4IYRA 1F8FA 4DMUB 2D0OB 4RA6B 4Y1FA 4HJXA 3ZU6A 3JQ7A 4LYHA 1CUWA 3PUZA 2IYUA 2YJTD 1J1IA 4G1VA 1NUHA 5T4BA 4CKBA 4WACA 5J47A 1HE5A 3B1WA 2I62A 4BUCA 4AY2A 2REQA 3O8OB 3ZH9B 2PJDA 2Q41A 2JJ1A 1M2HA 3ETJA 1YL5A 3RBZA 3VPFA 3GCWA 2FRDA 2B6HA 4YLYA 4JI1B 3MB5A 4RQTA 4TMZA 4L28A 1KPHA 2QMZA 3BE4A 4HN2A 2IXDA 2IP1A 3NIBA 2JLUA 2YDYA 5EXSA 5BSVA 5BNFA 1JJAA 1JDBC 4JHLA 4Z7NB 4XVQA 4YJKA 3DE4X 2VRCA 4KNVA 2LUOA 3TOCA 2JIOA 4LDAA 1A76A 3HCPA 2M1XA 4HGPA 2R6FA 5M2QA 5FXMA 2RH9B 4BBAA 5KSZA 3AR4A 3PFKA 3HM9A 4IXDA 3BJIC 3OC0A 4GPBA 4RDIA 5FBZA 2Y0BA 2AN1A 3IIMA 3WRWA 4PEVA 2VO1A 2FW7A 2XMQA 5C5IA 3WGOA 1G42A 4EMTA 3EF1A 4DNQA 4JI8B 4LMRA 5JAIA 1CUUA 4BVAA 1GVNB 1VC2A 3GGSA 4P36A 5P8WA 3VU0A 4AO8A 1E1DA 1G2OA 2RBKA 4Z1OA 2VTBB 3Q9NA 1G4AE 1U8YA 2IKQA 2C2MA 3BK2A 3KYBA 2UXBB 3G1TA 3TINA 3UFXB 5JAPA 2DR2A 4Q9NA 5CVCA 2H9YA 3G8CA 4F1KA 2X5JO 1KI1A 4MQFA 1E98A 2Z30A 4B8WA 3K05A 2JD0A 4NU6A 3WGLA 4QGGA 3RVQA 4CKCA 4YAFA 2GOYA 4IUCS 4YT8A 2AOUB 2BGLA 3FVQA 3UWPA 4IHQA 2WFMA 1XVAA 4ZDWA 4AY5A 3BDAA 4HB0A 3W77A 1PR5A 1RIFA 2GAFA 3HYTA 3O94A 2GN4A 3H4IA 3BMQA 3L8EA 2JW5A 1VL1A 3OD5A 4Q4HA 2Z3WA 4X3OA 1KWGA 1A1VA 1N2EA 1XC7A 3RUAA 4LQDA 3QPVA 4BRWA 1EGQA 2VATA 3TDMA 4X1OA 3K9HA 4XCVA 3G9XA 4J4HA 2C3YA 2ZE5A 2QD5A 3FCYA 4EJSA 5KVVA 1O97D 3N5KA 4KACA 1V7CA 2W42A 4K6OA 5FCDA 2VSXA 2CBGA 5AVOA 2DT8A 2GUWA 4UKDA 3SX4A 1T1SA 4LXYA 1DKQA 2AMJA 4C9BA 3AJDA 4LJ9A 4PG6A 3X43A 1KEZA 1FRFS 1TAHA 4BMNA 4IXMA 1B41A 2B4QA 1PWHA 3DLCA 1OBFO 4XI9A 1EX6A 1KYVA 3UXYA 2GN8A 3IVXA 4WY2A 2JBAB 4OI2A 5FWNA 2GCEA 4YCNA 4TLLB 3EB9A 4B09A 4FYPA 5K8LA 2GLUA 3G9UA 3WYFA 3OZRA 5LL6P 3A1WA 4CG1A 2D4AA 4EELA 1MLDA 4Y1RB 2RHRA 1P9RA 1VI2A 1TTTA 2WMOB 4FNAA 3Q3CA 4AFNA 2QGNA 1XZCA 2JFXA 3EC1A 2FEOA 3VC3A 4LHVA 4ZMRA 1GLVA 5DHQA 3GBSA 4EWLA 5FWXB 1NMXA 5DNEA 4LHXA 3VSEA 1T0HB 4RH0A 2QTZA 1DFGA 1KFBB 4B3SB 2XGJA 1QFJA 1PR1A 4J16A 3LCVB 1JMVA 4E1AA 1CY2A 1Q0RA 4MAAA 3MWYW 5DW0A 2YXDA 2X2OA 5A7FA 1HBJA 3DTVB 1KZ6A 3TL3A 1G38A 4JROA 4MGEA 2VF5X 5IHXA 2KMLA 3GJ3A 1YVUA 1YR8A 3NHRA 5G2OA 3WISA 1EX9A 1FMJA 1MT0A 3RLFA 5LJIA 2RK6A 3KJNA 2OPHA 5EJ9A 1UOEA 2PUGA 2WM8A 4UM7A 1J0CA 1HE1C 1Y6JA 3A10A 1HM5A 4TWIA 3WIBA 1CYDA 4RQUA 3LYHA 1J0BA 3TMYA 3TPCA 3LKZA 1YDFA 3LSTA 5GINE 2VP9A 4UEOA 4PZYA 3UWDA 3L7NA 1WM1A 4MVWA 3DOUA 5L7WA 3W5UA 4W8OA 3V55A 3BHJA 2WLSA 3ZDBA 2M6SA 1P77A 3DE0X 3DBOB 2NU7A 3OEWA 4BLUA 2Z4TA 4HG2A 3H9CA 1VSBA 2PXAA 1FNCA 1NHWA 4LJ4A 1WZNA 4WK4B 4ZC8A 1L1FA 5A3QA 4BFWA 4AX4A 4LQCA 2H16A 3KQSA 4L72A 1J06A 4QA9A 1IUOA 3FZEA 5E0KB 3EIQA 4UTZA 1UMCB 1BE8A 1DMSA 2G9ZA 3B2QA 4WZAE 3BJZA 3E05A 4BWFB 1KU6A 5BN1A 2Z43A 3LBIA 4YJFA 4TT3D 4BX3A 1GFWA 5TNXA 1K6XA 9ABPA 1SELA 3H5IA 3C70A 1E1MA 4JR0A 4XLLA 2DHRA 4NJEA 4FB4A 2LCIA 3EIFA 4X8OA 5A0VA 1AKTA 3WLMA 4DVJA 2Z57A 4ZOEA 4RGBA 2WFLB 2JZOA 3A1UA 3TTYA 2ASVA 5G0UA 1BTOA 3KQVA 1DJOA 2JFWA 3E58A 1NMSA 4P35A 5E6SA 5TT1A 1IL0A 5GJBA 3WSTA 4I9UA 4IIJA 4J1TC 2N9UA 5DYTA 1WCYA 4X6UA 2H1CA 2IXAA 4C3UA 5JJBA 3D9QX 2C57A 1GGVA 5AHRA 4P33A 2DGDA 3GHHA 4Q03A 1WBBA 3W5BA 3AV0B 3DQPA 2HMSA 3MWEA 5EE3A 1CTQA 4TV9A 5CYOA 4F56A 3LY8A 4CQLB 1CUHA 4H7IA 5TDHA 5AIAA 1GUAA 4OSEA 4IDGA 1XZIA 3TD9A 5J2TF 3AVWA 1B16A 1CDEA 4P5DA 3FNRA 1CNMA 4OH7A 2RE8A 8AT1A 3R6TA 3W3ZB 4U3JB 4QUEA 2Q49A 3QP9A 5KYUA 1GLNA 1H8HD 2NTVA 2BSAA 3RQSA 5FV7A 1IHXA 3RUFA 4LXQA 1WF6A 2W00A 5BOSB 5L45A 2QLTA 1C7RA 2J3KA 3IAAA 4HYYA 4QQFA 3DQZA 2H59A 1DTEA 1SZCA 2P2DA 1BFDA 1S9HA 4LTMA 3TBFA 1KXZA 2JLSA 1I30A 3UMGA 2PL5A 4FKMA 3UAGA 2W6NA 3OQ1A 2A33A 2CK3A 1EXWA 3O3OB 3TIXB 1QP8A 4L4XA 4C2AA 2RHTA 4RJTA 1JW9B 1U8XX 1XQ1A 4PZAA 4CTJA 2Q1UA 7REQB 3R0VA 3KS9A 2BFBA 3VHQA 3W5AA 3RSLA 3UXHA 5LYJF 4DE5A 4D0RA 1YU9A 1N5IA 3PT5A 3L6BA 2XMBA 3KKMA 5HIJA 4RXUA 4W8GA 2W71A 4PAOA 4F9EA 1E63A 1FRZA 3P0FA 3CEAA 4BQOA 4GEKA 4D0LB 2IEZA 2MSEB 4FM9A 1YMUA 4OX9Y 4II7A 1M1UA 2WOJA 3QPAA 4BC1A 1ELOA 1LI7A 1VKJA 3OCWA 4PXSA 3F3KA 5ARDA 4UPEA 3WLNA 2X7JA 1NUAA 1VB3A 1KK3A 1XALA 3GRPA 3BREA 2KX7A 1LI5A 5IKMA 3NBAA 4HWGA 4EG3A 2P9GA 3NTOA 1HE2A 4N0PA 1DOHA 2JI9A 2VHZA 2I3AA 3L7KA 3BKWA 3FBWA 4KH0A 5E4TA 5K8JB 2ZI9A 3U4GA 3MGAA 2Q4EA 3A4VA 3HN7A 3COJA 4EDHA 5CG1A 1RRKA 2QTGA 5EWLA 4R1SA 1ZVJA 2HOQA 2XIQA 3B5EA 4MI9A 1WOYA 2XCOA 3ETHA 5E8JA 3S2IA 3UWSA 5I45A 4UUNA 1OXBB 1G8GA 4K46A 2VSNA 3VKWA 5A06A 5FTLA 3AEKA 1BROA 4ESHA 4KR9A 3A9WA 3KV3O 3N8DA 1DSSG 3B3FA 3BCRA 4A8HA 1I7SB 2YV1A 2DWQA 2FK8A 5IP5A 4HF7A 3KWFA 1GPH1 1K7SN 2BHSA 3BPSA 2BI7A 3NKLA 3LUHA 4LBVA 3ZEAA 4EJSC 4CIAA 3DKVA 1GFSA 1L7RA 4ZVPA 3NTVA 2XLBA 3I3SR 2I4IA 1Z2EA 1UKAA 2MDTA 3COZA 4P98A 4ZOAA 4OD0A 4QDJA 3C97A 1KA9H 1TUEA 2ZTUA 5CDHA 5FWDA 5KTMA 2X9QA 3Q0IA 4RNCA 3ZCTA 3NT4A 4AYTA 5BWCA 3QVUA 4MPRA 2C2GA 4N47A 4G89A 3EA5A 4IIDA 3K3PA 4RF3A 5LQAA 5ANRB 5EZYF 2QTFA 1R9NA 4OB8A 2ODNA 1OYVA 2G5TA 4AZTA 2LE0A 2EARA 4G09A 1QK5A 1DG3A 4OX9B 3TBHA 4I46A 1KE1A 1PK8A 3GPIA 3BWCA 2IYTA 4QYWA 5ALDA 4LDZA 3IODA 2MTBA 2D5IA 4OF4A 1HRDA 3JYHA 4IMIB 4RIHA 1THGA 1Z6PA 4J16C 4ZODA 4O5AA 1NXOA 2FWMX 2N42A 2QT9A 4ARUA 1EEHA 3N2ZB 3ULKA 3U5TA 3DO5A 3AF0A 3O4IA 4O2AF 3DBHA 4KKVA 4XUDA 4DY4A 4IRUB 4UD6A 4UPDA 2I2CA 2PNFA 2Y1CA 4FJ2A 2H4YA 2AHOA 3PHLA 3FYTA 4DRXB 4RCVA 4ARSA 5JDIA 2Y0EA 4HDKA 2X22A 2QX6A 1TLTA 5JRDS 5FL7D 1BVYF 1N1GA 3ZKAA 5C8YB 5T64A 4Z53A 4E2ZA 2YVLA 5CX4A 1XTJA 2F17A 1XWIA 1U81A 3EVEA 3WG9A 1H1TA 4RZIA 4YALA 3O8DA 3EUWA 4G9EA 3C1AA 4CUZA 3GQBB 4EI7A 4FI3C 2N47A 2WG0A 1H6AA 1YJAA 3E5HA 3SYTA 4GVXA 3QFCA 2GNPA 3R5KA 2ZR8A 4QNMA 4KDCA 2XNDD 4ZICA 4MXDA 2ZWAA 4CMJA 3NBMA 1MC1A 4PYIA 3RAJA 4PO3X 3IIEA 4YJ2B 5JARA 3NOXA 1Z0SA 3BE5A 1QYRA 1DINA 4HD8A 4W7HA 4LYEA 2X9GA 1LDYA 2HMTA 4YWJA 3X2EA 5LVAA 1KJIA 2HA6A 3FOCA 3C6ZA 3IQHX 4DLNA 3EFBA 4YXWD 4HTFB 4JI2B 1EQUA 4RPJA 2IWRA 5DBGA 3CEJA 5IM4A 1SM4A 4EEZA 3HKCB 3UJBA 4QBKA 3GCXA 5CDYA 1OIXA 4PHTA 2RAPA 2G82A 1WKBA 1L5NA 1SC1A 1BX3A 3IILA 5CB6A 3DFZA 5C8XA 1NN5A 4LTDA 4DBLE 3EHDA 1P44A 1WX1A 4A5OA 1QHHB 3PR2B 1TADA 1FRQA 2JKVA 2J30A 2XEXA 2Z8ZA 3KVOA 1G5PA 4G8BA 4KK4A 5FNVB 3C3BA 5LZ5A 3RSSA 1PT7A 3VNSA 4J3JA 4NDAA 1JEJA 3K71B 2FXVA 4DNPA 1H8ED 2WD7A 3DOCA 3SKXA 2FW6A 5HKAA 1U5BB 1ZM2A 3EHEA 2HCRA 1YZNA 3OPYA 5AK5A 4EYQA 2HMWA 3ESAA 5JNTA 1NVDA 3PRHA 1IHYA 1XJ5A 1CS0B 4FNOA 4G97A 4EFDA 5KQPA 4D92A 1THMA 1KH1A 4TSRA 2MCFA 1WO8A 2FQQA 4CI9A 2W2VA 4H1UA 4HQFA 2GK7A 4JEMA 5DHFA 2F3QA 3JQBA 3LQFA 4M0UA 5BQPA 4RD2A 5P21A 5JD6A 1ARZA 1A8SA 3SYKA 1XAGA 4HL6A 3FFAA 2L2QA 3L92A 2I3ZA 1O1YA 3T5TA 1QPGA 1XD2A 2ID8A 4TKVA 5HFJA 4X6YA 3ZJTA 2GM3A 4NNPA 3RC1A 3EDQA 4WFJA 2XT6A 1RXYA 1QVWA 3KZXA 2AB0A 2QW0X 1NM5A 1VBMA 3AF1A 3PCTA 4Z49A 5LB2A 1T8RA 1W35A 1X9IA 3N7TA 4FHGA 1BXKA 2CXOA 1DQSA 1PLJA 3JWGA 2FGJA 1KR2A 3R09A 1BEEA 3D02A 3ZJVA 4KXNA 2HIAA 4PGFA 1B15A 1KKUA 2NW6A 4C05A 4F6CA 3RFTA 1QBGA 2J5QA 4K87A 5HJ5A 4FYIA 3PQ3A 3TQSA 3WBJA 2AD5A 4O4IB 4WMLA 3LIPA 4R1QA 4LMBA 3VH3A 2GBFA 5AI8A 3LDFA 3SM9A 5CX1A 2FLVA 3I2JA 3NX4A 3RK0A 4YJHB 4TYWA 2ORYA 1SKMA 5NLLA 2ZYSA 3AEUA 1WVGA 2UZAA 3G89A 2P2SA 5GGYA 1I24A 1L6RA 3F74A 4KG7A 3KTFA 2OHFA 2CB0A 4L85A 3D4NA 2IDZA 4RS4A 5FUQA 3TJMA 4WASA 5HHTA 3WWEA 1LSUA 2WIGA 2NZWA 3Q9UA 1D9ZA 2VDKB 4W9MC 4KR2A 3VKHA 1YOVA 1QKJA 2NXEA 2XUJA 1I2ZA 5L3SB 3IQZA 1VG9B 2VA8A 1SQ6A 4WERA 4YCSA 4GHWA 4G86A 4WFKA 2I80A 4HXYA 4HWPA 3ISVA 3MIZA 4JLMA 1G4UR 2BFPA 3AYZB 1QFZA 3JZIA 4XYEA 4Y2PA 3P1JA 1JFRA 1EUCB 1GCUA 3E7WA 5CT4A 4B87A 2GAAA 2KJQA 4FFNA 3ICQB 4AUKA 1C30A 2P68A 4GX0A 5ALJA 3WY9A 3KP1A 2H7XA 3NUQA 1Y89A 2ZUWA 4M0DA 1MGPA 2XV1A 3AGQA 1PGOA 4LXHA 3Q2KA 1O5IA 2XRFA 5D01A 3NANA 2C92A 4FONA 4KQJA 3WLLA 3UPUA 1S3IA 3R0JA 3DGFC 4PS1A 1JKIA 2GJAA 4D8UA 2R8ZA 1IQPA 3AUAA 1P2DA 2B37A 4KE6A 4O25A 4RAOA 4TX1A 4Z9YA 5IDVA 1TXGA 1CJSA 1FVHA 3ZCRA 3F1LA 5JXIA 2FPOA 3S6JA 2B6NA 1VG1A 3LWNA 5IW8A 1O8CA 1H65A 2P6PA 2M6LA 1U0RA 3MC1A 5LDDC 3AESB 5EMNA 4A6PA 1DUVG 4LWPA 1R8SA 1IQUA 1JHPA 4MKGA 2WR8A 1DIAA 1N6OA 3HMQA 1N7GA 5GP1A 1I3KA 5LXTA 3THXB 1FIUA 3M6LA 3E2MA 1LFDB 1O5TA 2WU1A 4M54A 2NU6B 4Y2SA 1NXTA 3USES 4TMWA 3VV2A 4ZCTA 2X6TA 4BNYA 5D5PA 1CP3A 1NBIA 2HADA 3DKIA 1ZBQA 3QQPA 3QVKA 1KC1A 4JD5A 4MQBA 1T6YA 5GIPE 4DLVA 3GMIA 4BBPA 1JH9A 1ZK3A 5E7IA 1P73A 4R4JA 1P7YA 2ZRPA 3R20A 4F04A 2QP3A 2OHVA 2C5BA 2PQ6A 2VNIA 3GUYA 5JDIC 2O2JA 3HUTA 1OPRA 2XEDA 1KI4A 3MM4A 1Y4ZA 3MLAA 1R9GA 3T5DA 2XDWA 1IIRA 1LPNA 3V80A 3TMKA 3GC6A 2RGDA 3KTDA 2O8DB 2NZVG 1YU6A 2QM3A 5LKRA 4A16A 4G5GA 5HP4A 3IC5A 1AZWA 3K8ZA 2IXFA 3HRIA 3CR7A 3OBIA 2TMYA 4PFQA 1NN3A 2AXPA 2G0AA 2ONKA 4D5EA 2NTEA 4I55F 4LI0A 1F3LA 3VR0A 4N03A 4GZMA 4JLWA 1HH4A 5AKYA 1JT9A 4L5IA 4NZMA 2R5WA 2C5FA 2BEWA 1RKBA 1K8YB 5EJMA 2BFDA 1BE1A 4GMFA 5JTTA 1K7YA 1QZUA 4GWLA 3BRQA 2GF9A 1FYXA 1IFXA 1FMTA 4IQFA 2YWEA 2KSQA 2E3JA 2IS1A 1QYIA 1J0XO 1N75A 4FS8A 3TR6A 2WMYA 1JKJA 2BHLA 5B57C 3G2PA 3MT8A 3Q7EA 2P9HA 2FW8A 5DHTA 2EJTA 1HYGA 1OE0A 3KJZA 4XPIB 5C32A 5I47A 3U3ZA 2CDCA 1YNOA 1H9CA 3LOQA 1QE0A 3IBGA 5LA6F 1KQFA 3WHIA 5JNVA 2W4QA 2ZW9A 1UBLS 2H51A 1A9SA 4YUYA 3A6FA 4FHFA 1T34A 1G6KA 1HURA 4DNOA 3H7AA 1F4PA 5SZKB 4R3UC 3OZIA 4JLAA 4W5QA 6LDHA 1ECCA 3CX8A 2ZR9A 5ULLA 4FEEA 5DYGA 3WMGA 5EESA 3KD2A 2CFTA 1J25A 1RXVA 4KXQA 1PG2A 1U98A 4F4HA 1SBIA 1SVKA 4PZCA 5I4CA 2WT8A 1T9BA 3ZE2B 4D6XA 1FYDA 2GM9A 2ZP1A 3WRVA 4F2WA 5GVSA 2IOHA 1SXPA 4G5FA 5LUBA 5I7VA 3JQBC 4HC4A 2JHCA 3Q3GE 2Q6VA 3HGMA 1MQ8B 1G4HA 1RWVA 2R44A 3UK1A 1UDRA 2WQ6A 2GM4A 2HZBA 2E4ZA 2J3DA 3MOSA 3RV3A 2O9JA 1SH7A 2H9IA 3PFBA 4NBWA 1C2TA 4QATA 2RH4A 4REQA 5BSFA 3DYIA 5C4MA 1WW3A 4Q4DA 2AC7A 3VOBA 2Z04A 1XU9A 3X1KA 4B6RA 4ZEWA 3CISA 4IJ6A 3L77A 1C2YA 1M8GA 3AIOA 1HSZA 3NFYA 3TLMA 3PEWA 1NM5C 3PHIA 4BLWA 4LDJA 4A0QA 5CA0B 2W6QA 4UM9D 1N6RA 3NRBA 4LFBB 2B4RO 1Z5WA 2G0TA 4CM8B 3H2BA 2Z09A 3RJMA 4BQSA 3LO8A 4X71A 5A9SB 3HY6A 1PT5A 1DWUA 4PZLA 4OHBA 5D86A 1JU3A 1YRYE 3GGJA 2F59A 5AICA 1HT1E 4RA6A 2GUGA 5F1YA 1H0SA 1GPUA 3KKKA 1I0IA 4ODIA 4OG2A 4KPFC 1LLUA 1P91A 2QG4A 3BXOA 1QORA 2FSVA 3HJCA 2H18A 5E8RA 3VBCA 3CW9A 1BDHA 4L08A 1COWA 5AW9A 4XFJA 2PGAA 3O8OA 3IERA 4ROSA 2VK8A 2QR5A 3ELDA 1NLUA 4GYYA 2V8OA 3A32A 3IS3A 4IDCA 4A1OA 5JSFA 2GDJA 4H16A 5F7XA 2P35A 2R85A 2OXFA 2WTXA 3QG1A 2P9BA 3BXXA 4JP3A 3I72A 1ML4A 3GJZA 2XX3A 3WOHA 2C4KA 2BHNA 3D1JA 5IS2A 4NLLA 3H4MA 4IX1A 2G72A 3K70D 3EQ2A 2GNOA 5AKHA 4UVIA 1WSDA 3R3SA 4E5DA 1S1MA 3RYFB 4HDSA 4DY6A 4OQYA 4P38A 4CJXA 4L78A 2ZWPA 1BXZA 3HWWA 4L9RA 4UEJA 3L7CA 3RC9A 1CR0A 1TUGA 3BAFA 3DE7X 1ORDA 3VKVA 2XF8A 2IH5A 3PQ5A 1Q44A 1AKNA 4LSMA 5EIBC 5CW2A 1KZ9A 5CTAA 3VPDA 2C61A 2ZT8A 4J1SA 4LY3A 4Q4AB 4CQJA 5BR8B 2VTBA 1DQZA 3VR2D 3WADA 3RS3A 1OI4A 1GHTA 2XGSA 4B6EA 2R87A 4M8SA 1R6DA 3TW8B 3UFXA 3IE1A 1V1JA 4LPSA 3OT1A 4CR7A 2PVSA 3SM3A 2IF0A 1DNPA 4BUJA 3ZXUB 5EA2A 1E1QA 3SR3A 3T61A 2R4TA 3U4CA 1GVHA 2SKDA 3OFSA 5CFRA 3JZFA 3LPCA 1K8XB 2AOUA 3DDNA 3NS7A 4JQYA 4MUIA 4UHBA 2CKDA 1D2GA 2HA4A 3EFEA 1UXHA 2G4VA 2W7TA 4Y2QA 2E7ZA 3I9NA 1YZFA 3GG9A 3KZVA 4HLCA 4ZXPA 1JDUA 1JJIA 1UJCA 1W0KA 2EZTA 2P3QA 2PZJA 3CT6A 2YVAA 3Q3VA 3FUCA 2HI0A 1GPYA 4N65A 3KLOA 4LHYA 1Q0LA 1R4ZA 2QT1A 3SF8A 3AJ9A 4CT0A 4ZDKA 1TD9A 2QLJA 3C3JA 4KEAA 1T9KA 4RY0A 4E46A 1CZLA 4I4TF 2B5VA 1VCIA 3Q12A 4WBXC 4Z86A 3ZE0B 5HRAA 5MHTA 3TM4A 3AI2A 1KAHA 4OM7A 4EHDA 5DPMA 3WGNA 5TS2A 2EF1A 2EWMA 2ATCA 2PYZA 1YBFA 1KPGA 1FUUA 2WF5A 3ETEA 3D64A 1S9DA 3DMTA 4YGXB 2O5EA 1RJWA 2PDAA 2GCOB 1KI7A 1IUKA 3EA0A 3E3NA 4YB8A 3SYNA 1DC4A 4KMRA 4PSKA 4YC7A 3MCVA 2GF0A 2K2WA 4U5QA 1IIBA 5DTJA 3IFSA 5J2UB 3F5FA 5LMNB 1KK1A 4KV7A 5C51B 3H9EO 3V32A 3VR3A 2SHKA 2VP5A 2H2IA 5LQDA 1GPKA 1FXWA 3IT3A 3P2EA 4UUOA 4ZI7B 2AK2A 4X65B 4PRZA 2CXTA 3IBYA 2QF7A 3OHMA 4QG7A 4RSMA 3HVJA 3KOYA 3LA6A 4Y1RA 4OAPA 1QYCA 1HRKA 1RACA 3O5AA 4IEFB 5JO0A 4R84A 4UUBA 3QZUA 2ZCVA 4YMGA 5FWXA 4KPEC 5CHYA 3WL7A 4MVJE 3OCVA 4BX2A 2PLWA 2DWCA 2YBEA 1FP7A 2QTCA 1PJSA 2L19A 4FBMA 5HQ3B 2XHEA 4UU7A 3O2JA 2WAXA 3U3KA 2C5GA 2QYSA 3IJPA 3RD5A 5IT4A 1T0PA 3BIFA 5IULC 1PV4A 1TAUA 1XZLA 4CM9D 3FR8A 4QGBA 3MAJA 5C1OA 1C1HA 1N6KA 1AN0A 4NE9A 3RVPA 1JVSA 3TD2A 2WWYA 1YA6A 3ZD6A 4BN4A 1GZ3A 4UTXA 3T3IA 1CD5A 2HSJA 3F90A 1B6TA 5ILOA 2GAJA 1HGXA 1M7HA 1TFUA 2LP4Y 3L0SA 3O6VA 4BC0A 2QYHA 3CLTD 3GP3A 2D0DA 2Q7XA 3N8GA 1R5NA 1THZA 4G1CA 4XM2A 5LQSA 5C35A 2JHAA 3A31A 2C00A 1T0JB 3DL4A 4V2UA 4RTQA 4KR6A 4RC9A 1B3BA 3ZY5A 3TJRA 5JROA 1G291 2XWJI 3L7MA 2FDCA 3E81A 3M81A 3AHHA 5TPWB 2YZGA 3AM5A 3HUFA 3IXLA 1FW6A 1EXMA 3FX2A 1FLAA 2I7TA 3K0HA 4B6PA 3N8NA 1GEEA 3BB1A 3WGYA 1ZGJA 3T9FA 1QS0B 2GPWA 1YULA 1BXGB 3ZGOA 3L9WA 1E1RD 4C4TA 4F8YA 5EN4A 1WB4A 3DVSX 3DDCA 4LRUA 4MQUA 3TFQA 4CE6A 1C7JA 1JPVA 2SKCA 2UVPA 3WBFA 4XZ3A 4UTVA 1RFLA 1YUBA 1Y7IA 1PZHA 4MLDA 2BEUB 4HKTA 4PC6A 4YP1A 3TRKA 3EIEA 1R64A 1SVNA 3H1AA 4OI4A 1UXJA 2P9JA 3N3BC 2WFLA 3KR9A 3NBQA 2QE6A 3S2GA 5AM4A 1LX7A 3GEHA 1PZNA 2WUFA 4UMDA 4XASA 3PVCA 3ZE8A 1UZAA 5AOVA 4RGVA 2WWVD 4KC0A 4F5DA 4FCVA 3T4PA 1F6BA 2FYTA 5AM1A 4L6AA 2ZRCA 3HDJA 1SVWA 1AKQA 1YCGA 2YVUA 3C85A 4X93A 5I01A 3O2SB 1SIUA 5FPKA 4FMDF 3AVPA 4F3KA 4IILA 2EU8A 1TGYA 5BVHB 1TEHA 4CQLA 2WHYA 3W4IA 5H3HA 4V02A 2AQHA 3CR8A 3PUIA 2FSVC 1PFWA 3HJTA 3GJSA 3DVRX 4LA4A 1YB1A 3LT4A 5ICGA 2ODBA 4E5NA 2Y1DA 3GDHA 2CKMA 1SHTX 3WWPA 2HF9A 3EWSA 1XYVA 5AFSA 3V1KA 4MZDA 3VOSA 1ZH6A 5BOSA 3MTIA 2Z4SA 3I3OA 3H11B 4GI7A 2PO5A 5E1MA 1CK4A 2J07A 5LLTA 3EXEB 2AC2A 2FMHA 4J75A 1JILA 3B1VA 3C24A 5AQEA 3HR8A 4MV8A 4BVEA 4CHTA 5IMSA 1KKMA 2ZBFA 4A8TA 1Y1PA 3AHFA 3L02A 4N5DA 5ILQA 7REQA 1WCIB 2GZ3A 3FY4A 1BVHA 1CRWG 2O6LA 1Z7EA 2QR2A 3VTAA 4F3RA 5I7UA 2VC2B 2XITA 2FWBA 2XAUA 4DSTA 1VFPA 1VJDA 3INYA 2E4VA 3FCAA 3R6DA 1KMCA 2V7VA 2I6FA 2X4IA 3ISJA 3TLYA 1G3MA 4H35A 2C4NA 2XYHA 4NAHA 4QYXA 2I6GA 1A98A 3B2NA 4HNRA 1QG2A 4DSOA 4AMZA 5ALKA 2FSIA 3HZOA 4MIKA 4Q9DA 2JLYA 2R6AA 4G37A 4CGZA 1QONA 4J0FA 4AN1A 1K6MA 3PGMA 4BQFA 3F3SA 3TZEA 4MYTA 1PWEA 2EFEB 1JJVA 3KE9A 1QQTA 4FDAA 4JMPA 3BTSA 4P2BA 1VLHA 1C5KA 5JD5A 2RHBA 3HABA 3U4DA 3S2SA 2DULA 1B73A 3ZLTA 3E48A 4PYRA 3HI4A 3WLJA 5EOVA 3IA2A 1AQNA 3G6KA 4L8LA 4QREA 4BZXA 4RVFA 2O8FB 3HYNA 1QIEA 3CMMA 3OZBA 1PJAA 1PX2A 5BV7A 4QWMA 4N01A 3I0MA 1C3JA 5ALRA 1AK9A 2FFJA 1L7NA 2W6MA 2H0RA 2QD4A 3HADA 1Z4PX 5KNCH 4FBLA 3KT6A 3Q8XB 1AQLA 4B5KA 3H5TA 4DTCA 5C8ZA 2AYZA 8ADHA 1IJEA 3CLRC 3A6LA 3QW4B 3WP0A 3JX9A 3FHLA 3N75A 2OD7A 3DMTC 2I87A 4RTLA 2ZVPX 1GXSB 3ZDXB 1GSAA 1QTQA 2VH5R 3PFCA 5HFAA 2Z2ZA 1K5DA 5I7FA 1YXMA 3O93A 5GJWC 4MV9A 1NBHA 2PKYX 2GASA 3A9CA 3KOWA 3WLHA 1QK4A 1AS2A 5CK5A 2X1VA 1WIWA 4G8JA 4HB2A 1QO0A 1KBQA 4MITA 2G7ZA 3NM5A 4U7PB 5TC4A 4CQNA 2Y76A 4IIFA 3PDHA 2ODWA 3TECE 2GBPA 4QFBA 1M72A 4K9QA 4QYMA 1H1LB 4Y6RA 2PUEA 2NUPB 1E6CA 1Z0FA 3UICA 4QARA 2ZRFA 1A5SB 1QUFA 2QIOA 3MCWA 3T7JA 4C5CA 3TG2A 3WAKA 4OUKX 2PMDA 1XZDA 2D2IA 3K0KA 4MKRA 4QJ3A 4RPCA 4EUNA 3GDGA 1AS3A 3WFJA 2BD0A 3HWX1 2E6UX 3OFVA 1VL2A 2NXWA 2ODAA 3NKVA 2DUNA 4A73A 3CF6R 3O3CA 1Z13A 4HAYA 1MW9X 2J3EA 2FF7A 3T3PB 1E60A 4IY1A 3UJ7A 1LK5A 2ZR0A 3GARA 3L9XA 4DRXA 3DT6A 3ACDA 3NJ8A 5THKA 5H59A 2WKWA 1JQKA 2ZUBA 3R3YA 1YDHA 2E49A 4W6ZA 4N48A 1K06A 5C8YA 3MHTA 2V1XA 4R68A 2J7PD 1P1CA 2RGRA 3UANA 3G0IA 1KPIA 3HDQA 5CNIA 3GQBA 3G8YA 5B1SA 3I01M 5LU8A 4AMUA 4F8JA 5G1PA 3RVLA 4JGGA 4DYVA 2AIRA 1Q1NA 1PWZA 2I29A 2C77A 3AJEA 3HI6A 4TTJA 5C52B 4JT4A 4EVSA 4PG4A 4ESOA 1SXQA 1LLFA 5K3FB 5J2TB 4GNRA 2P9FA 2VSYA 1OXTA 1LQTA 2VRWA 5DJ5A 3FG9A 5GV7A 4N7MA 3OPVA 4CN8A 3WV4A 4M7PA 3VRHA 1OWNA 1VI6A 4CGYA 8ATCA 3I4FA 5CMLA 5IARA 1DRJA 2IPMA 2LIVA 4JC4A 1ZK2A 3VH1A 4EOGA 3HKCA 3CZQA 5DT9A 1II8B 2PR2A 2Q4BA 1AF4A 1H9BA 1KI2A 2BGJA 3BSFA 1ZD8A 4QQKA 3BE6A 1HO3A 5EIWA 4DSNA 1TCVA 2PX4A 2O19A 1T5BA 2VQEB 4Z0HO 2PMWB 2EEZA 4N1AA 2XTMA 1QHHA 2WVAA 2W4IA 4H31A 2Q3FA 2W11A 4HMOA 3CBQA 4R69A 2A9PA 3I5AA 3KKZA 3RRYA 4ZPXA 4J0IA 3FTPA 1Z63A 5FNVA 3JW8A 1NY6A 1HETA 3LQYA 2J5KA 4R2HA 4BY9E 2ZJOA 2QP4A 3TOVA 3JQAD 3E7PA 2PKQO 5D8DA 4XYLA 2R2GA 5JEDA 4D4MA 4EB3A 1JEYB 4CV1A 1NMQA 5DXFA 2P9QA 2G80A 4HWSA 4AP5A 1GG5A 1S3SA 3D3QA 4ER6A 5JVDF 2EZUA 4NWIA 4RCZA 3RVMA 1A2KC 2FQWA 5D84A 1CS0A 3WGVA 2OAGA 2JB9A 5CDSA 1KRHA 1BKYA 3JQ6A 3HRKA 5C80A 4A3SA 4RTMA 2W6IA 3K5WA 3VR4A 1NDUA 3T9AA 3HS3A 2V7WA 3CSUA 3ZY2A 3BL5A 3AC0A 4ARIA 1GGKA 4KWEA 5KUTA 3II6X 4YDHB 4NFYA 4KQEA 2AQ8A 4NEHB 4LJ5A 1KO5A 3ER6A 3V8MA 2VHJA 1Q22A 2JFZA 2NO0A 3OKAA 4FNMA 4GRIA 3ZCXA 1HDZA 2HDNB 3MOGA 4GDMA 2YQZA 4LV8B 4QSHA 5F1PA 1ZUNB 1P2GA 4FFBB 1E9BA 2VL7A 1N5RA 3AL3A 3LA8A 4B47A 4MEJA 3ZZTA 3MRTA 1XJWA 3NH6A 3ZW9A 2CC2A 4BMZA 3EZYA 1DCKA 1GGEA 1VKRA 2PX0A 2TMGA 3L4EA 2PUFA 1X8LA 3O8BA 4GS5A 5KWEA 2Q0SA 3WFZA 1JAHA 3E1KA 1FJ2A 2G5GX 4XE5A 1L4MA 1Y82A 2W8BB 4QJBA 3UAWA 5ER9A 3U3MA 2D6FA 3QXSA 5JH7A 4U6QA 2XQJA 1P9OA 4M1SA 3RBVA 3HEMA 1T9GR 3OBBA 2QK4A 1JJFA 3OTIA 2LIPA 4LOAA 4FMPA 4S3MA 4MVYA 4WKCA 4XQGA 4YJHA 4X1KA 3UUGA 1N77A 4BKPA 3TQHA 3SC6A 5IJWA 4HR7A 2VF8A 4FIDA 1ODFA 5KU7A 2IYOA 1L7OA 5F12A 1Q0QA 3JSXA 4H1TA 1N78A 1XPRA 5EZYB 2PZGA 3G23A 3H6HA 3P19A 2XMSA 4EATA 3VR6H 5L3SA 2C1ZA 4RTNA 4L6IA 5JMPA 1YVRA 4HRAA 4Q47A 1LC0A 1NL3A 4BPRA 3ZGXA 2I66A 1N3LA 2WY2D 3CS3A 4NCJA 1BA2A 4AP9A 2PX5A 3DLPX 1G64A 1YHYA 4KXLA 1WUIS 4DV0B 1FMFA 1EUCA 3GD5A 3HCBA 4FSXA 3QVSA 4JKYA 1ZJ5A 1DT5A 4EY7A 1N8TA 2R4UA 1UP7A 3JQ9A 3L43A 4QRDA 1SO8A 3A1NA 3I61A 1QAQA 4I9HA 4TYPA 2Z2IA 1EVIA 3QVLA 3SMVA 1SNYA 3T8YA 3TGLA 4IYJA 2AL7A 2HA3A 2MMGA 3GCZA 1CJVC 3I8XA 1DRWA 3VVMA 4HQLA 4C0QC 4B48A 1N3IA 3JPYA 3P32A 4CLXA 2XBMA 1JG4A 5EHXA 2DC1A 2Q5CA 4ZO6A 3U4QB 5L3VA 2A0XA 3N76A 3GCDA 4YRZA 1UOOA 2RARA 1R1DA 1DO2A 2YCBA 3C6QA 5TQ2B 4Z3KA 5PGMA 1JFFB 1FFHA 3EIOA 2DG2A 3BD7A 1M33A 1NU6A 2Y67A 1Y3HA 2QGZA 4K0RA 3DE6X 4PHGA 4UU0A 4A91A 5I51A 1TM2A 1J2TA 2Q29A 3AESA 3O38A 2VJQA 2B7BA 1XJCA 3A2KA 1S7GA 4Y2UA 4A26A 1CR4A 5GV8A 4YMTA 3OP4A 1GAXA 3TZKA 2YIDA 4CKZA 2AEEA 4P3YA 2OHGA 1MNQA 1RI1A 4BWGA 7ABPA 5G0TA 4UUQA 5A04A 3THXA 4N7JA 3AHIA 3UMYA 3G2KA 4MYUA 2IV2X 2CNKA 2NU6A 4Q02A 3D2BA 4F38A 3KVNA 4GRAA 4N5MA 4RVOA 3SJAA 4F7WA 5JPCA 1UDAA 4I3FA 1TKAA 1B6SA 2PXXA 2UAGA 2WABA 4W82A 4Y6LA 4UVGA 3OU6A 5DM4A 1YK1A 1FYWA 3UJNA 3RBAA 3H5AA 2C03A 1PTJA 2HMYB 2YXBA 3S70A 3OCYA 4YCLA 3O9MA 5AK6A 2QSZA 1A50B 1M2FA 1JHDA 1HG1A 2QY6A 1CULC 1SB8A 2R6ZA 3LC7O 4GLOA 4QUBA 1TEVA 4B7ZA 4B76A 4YRBA 4F4IA 5JD4A 2O8DA 1R8YA 4ML3A 4ZI5A 3LX8A 2AH5A 4M21A 3Q41A 3CH4B 5DM70 2XADA 2J4DA 1GQQA 1RIIA 3PNVA 1V8PA 2HMVA 3BG5A 3OJCA 3H8VA 1NBAA 2YFKA 1PK9A 1RBMA 2JBWA 2A4MA 3TCKA 5M34A 3OPXA 4RULA 1NY5A 1R9JA 2CF5A 1JJBA 2A5DA 4XUGB 1DXHA 2HO5A 4G0PA 4YFYA 5K0NA 3U81A 5BYAA 1X3LA 4MUAA 1XZJA 4XGKA 2QMHA 4K26A 3NYQA 4OXYA 1MN6A 4PSDA 3TIFA 2DPXA 3UYLA 3ABSB 1VSVA 4G67A 1LK7A 2GHIA 3TVDA 2JFPA 3EY4A 1VPWA 1USKA 2FQYA 1EWTA 3UATA 1R3UA 1C1XB 1D8AA 1Z4NA 2OPBA 1YRAA 5THXA 3O1LA 4XPIA 1Z7YA 2QQGA 1NBME 4RO0A 4JB8A 1F5SA 4P7FA 3BILA 5FFFA 3ORRA 1QHYA 5E2AA 1FTQA 1RWXA 4B81A 1UXKA 3WC4A 1TZBA 1D5WA 3TS1A 3PKIA 2D1FA 3TIGA 2YVQA 1Q19A 3R3UA 3CKYA 4ND1A 5FO1A 3F97A 2GH1A 1SBZA 2NPFA 2GPYA 4HQRA 4CL0A 4TRJA 2DPYA 3GZNA 3WNQA 5FR2A 3FDJA 2XQGA 3AERB 1JIJA 4XD7D 2ATXA 2OB2A 2YASA 4TWJA 2H07A 1GZ6A 1E9RA 1KY3A 3QEMB 4Q3EA 5JCPA 3TJZA 2GZ1A 1QHIA 3BMCB 4ID3A 4YO7A 1N5JA 1UKYA 5DNAA 3FMGA 3PR3A 1MAHA 1F0PA 2C1EA 3LPAA 3Q5EA 4BJHB 4QYIB 1U02A 1U8EA 1Z0UA 2DPLA 4LK3A 1VL5A 2HU5A 3ZE7A 4DG8A 4E6PA 5B5SA 1YF3A 2J6CA 1JA9A 2A67A 4DCVA 5TGDA 2QRVB 2ZGVA 3PC2A 3DCJA 4PZPA 4X24A 1F4LA 1N2CA 3E7DA 3NXSA 3NRJA 2W43A 3ZX5A 1Z6QA 3QXCA 2GCIA 3FWHA 1HA3A 1GKYA 5TE9A 3FHCB 5BSGA 4U7DA 4DIMA 2ZJYA 5BRNA 1Z12A 1B4DA 4KAXA 2GZAA 2WF7A 5CA0A 5JNWA 4U2DA 4URYR 2ZT5A 4ZOCA 1NVKA 1YWGO 1SHZA 5DGDA 4CM8A 1P9WA 3SBXA 1QG6A 1RZRA 1JHOA 2ZEJA 1L7XA 4BFSA 3OOJA 4JC5A 4YJDA 5A9SA 4N0EA 2H6EA 1XK6A 4MAMA 2GRJA 2R86A 1OLSB 4ZAWA 3U4MA 4HNHA 1E3LA 2JGKA 2BMVA 2D00A 2WWRA 2A92A 4QVIA 3TFOA 1Z5OA 1KSFX 3FDXA 3IDSA 4Q7JB 3UGJA 2ACEA 3J7AC 3Q4GA 2ZXEA 4XCXA 2HUNA 1YIDA 2A1IA 1WXQA 3SNHA 5ICMA 4FYWA 3IIIA 1E2QA 2NX2A 4KREA 1B8PA 1HNNA 2AXEA 2Z5LA 1B43A 2FH5B 1M7GA 3PLNA 4WOCA 1WTCA 3EZ2A 2BR3A 1NXVA 1K08A 1QYWA 4CVNA 4U39A 1J0AA 3S8MA 2OCKA 1L1RA 5AVKA 4KQIA 2HBRA 2KWIA 4PLGA 4DGQA 1P4SA 1P9LA 2QG9A 3JARB 2F00A 1NSTA 3RYFA 3TZCA 2OFFA 3CE9A 4DZTA 1OAOA 2QN3A 2YZKA 4R83A 3PLAE 5K2MA 2V0CA 2GHTA 4M9RA 1L5SA 5K6TA 4BP3A 4BE4A 2DSNA 2Q6OA 3ZGZA 1QAOA 3C16C 1E1CB 2HWUA 1G19A 2H2GA 3JQ9C 3D3JA 4TS1A 3G2HA 4Q4AA 5F35A 4ADSG 1SK9A 4IEEA 1OH8A 3P2IA 4PYNA 2HJVA 4MO2A 4UHFA 5FA8A 4EUHA 3D7NA 2RGUA 4KNYA 1QVVA 4L1KA 1E2HA 5KNCA 1ONBA 2PXCA 4GPD1 1X39A 2EQBA 3D6TB 5JLAA 4KO2S 2FN8A 4GPZA 1R16A 1JDPA 4RX1A 2AN9A 5DXJA 5JIBA 5IXSA 3C7TA 2DLNA 4GE0A 5DX8A 1LSJA 3CUUA 4H1HA 5AW5A 3ZLUA 3IMKA 3DDSA 5LUAA 1YMQA 2RI1A 2OOSA 1MVLA 1R7RA 3OIGA 2I6TA 4DDKA 5KSOA 2AFRA 3E8XA 1W2HA 2FZGA 3CZ5A 5H1YA 4AJEA 4MGKR 1MOZA 1DJMA 2GWHA 4I55B 1OBCA 2WHQA 3CZCA 3T06B 2HWXA 3O4HA 1MRZA 2VYNA 3MBKA 5F64A 4ACBA 2P1ZA 1T5SA 3JVEA 4AP6A 4ZYTA 3PT9A 4LHZA 4O1IA 3VYSB 3LBAA 4KN8A 4PNPA 1QU3A 1JKFA 3IAHA 3RSFA 4HBZA 5DNYB 1ST2A 3EDCA 3HDGA 1NC1A 5JCJA 2ZZNA 1H22A 3FRIA 4LVNA 1VRVA 3CJQA 2ZPTX 4PZ9A 1JV2B 1QSGA 2RBEA 5CVTA 2VUUA 2QSJA 2ZPAA 3WL3A 1FPMA 1UJ6A 2A7XA 3H5VA 5DGXA 1L4GA 3R44A 2PCLA 1L9XA 2PBRA 4D1YA 5A62A 4IH1A 5B58C 4D9CA 3H6GA 5LA6B 1T9HA 2EBHX 4QXOA 2X58A 3GEIA 5J2UA 2RONA 4Y0VA 3ZCQA 1IQRA 1W75A 1GUBA 1S2LA 2QPLA 4FNGA 4QQ8A 5LN1A 3AV3A 3DEKA 1AKRA 1K5PA 3OT5A 3VPCA 2QVLA 1F8UA 4R1MA 5A4FS 5I6DA 2JHFA 4ITRC 2YC4C 1PJTA 3KD3A 1XYGA 3MGGA 4L5BA 3V00A 4BO2A 5L3ZA 2KM1A 4FTWA 1KYTA 2VCEA 1S0UA 1ZLXA 5ILGA 3RE1A 4BNMA 3LPLA 1M2NA 2OHXA 3A4NA 2JFFA 4QRIA 2YJ4A 3JRWA 5DFAA 1YR3A 2EL9A 3C8UA 1ZU5A 2BHTA 3KCQA 3STXA 3H2KA 5HQ3A 1PU2A 5BSMA 3IP7A 4MR9B 3BCHA 4FZVA 4KX5A 4M99A 3BXFA 3G5AA 1RQRA 1N6PA 3KB1A 4QHSA 5EMHA 3WE7A 3WKAA 1EZ4A