1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
1DUIA 3AJ8A 2PQ2A 3HJRA 1SBNE 2SNIE 3PTLA 1GTL1 4CG0A 5AMXA 4H6XA 4ZARA 1NDUA 1R6VA 3BGOS 3LPCA 3AFGA 4B5LA 1BJRE 1V5IA 1MEEA 1R0RE 2PKCA 1KE1A 1SUBA 3OSZA 3DYBA 3CNQS 4GI3A 4HX2A 1KE2A 2X8JB 1AH2A 4AKSA 3VYVA 1TMGE 2PYZA 2GKOA 1SCNE 3P5BA 2PMWB 1P7VA 1XF1A 1SUDA 1SUEA 2ST1A 4ZOQI 1DBIA 3T41A 1AQNA 1GA1A 1P8JA 1BE6A 5JXHA 1SUPA 1C9JA 3F49S 1YJBA 4Z2AA 2DQKA 2B6NA 3WIVA 1GNVA 1SUAA 1GCIA 3A3PA 1SCJA 1PJ8A 1Q5PA 3DW3X 1WMDA 3QTLA 3UNXA 1Y3CE 2X8JA 2HD4A 5B1DA 1ZVKA 3PRKE 1KDZA 1YJCA 1GNSA 3WHIA 1GA6A 3BX1A 2W2OA 4MZDA 2Z2YA 1OT5A 2V8BA 4DJ5X 2ZWPA 1WMEA 4KG7A 3Q5GA 3DE0X 4WOCA 1TM4E 3DE7X 4DWWA 1OYOA 3WIUA 2SICE 4JP8A 2Z56A 3L1KA 1GT91 1PTKA 3DVQX 3WQBA 3H42B 4J94A 3VSBA 1OYVA 1BH6A 2TECE 1SCBA 2E1PA 2P4EA 1THMA 1V6CA 3LPAA 3I2YX 1AF4A 3I34X 1TO1E 2DUJA 1S2NA 3DVRX 1PFGA 4LVOA 5ARBA 1WSDA 3GCWA 4M1ZA 1GTJ1 3AJ9A 1TM7E 2WWTA 1R64A 1WVMA 3F7MA 1EGQA 3DE6X 1NDQA 4LVNA 1T1EA 1ST2A 3SQOA 2W2PA 1SCDA 2W2NA 3DWEX 2IXTA 1SIOA 1YJAA 4OMCA 1C9MA 1NLUA 1HT3A 2DP4E 3DDZX 4H6WA 3DE5X 4KB5A 1VSBA 4BWGA 3VV3A 2HPZA 1AV7A 5CW1A 1SBIA 2PWBA 4OV6B 1A2QA 3VTAA 1Y48E 3ZXYA 1Y9ZA 4H6VA 4CFZA 5FBZA 1Y4DE 1TM5E 4HVLA 1SIBE 1SIUA 5JXJA 1MPTA 1TECE 5JMOA 4C3VA 5FAXA 2XTJA 4YN3A 3TECE 3A3OA 3DE4X 3BPSA 1SCAA 3TI9A 1Y1KE 5SICE 2G4VA 2QTWB 5JXIA 4K8RB 1TM1E 3QFHA 1TK2A 2W2MA 3ZXXA 1BE8A 1UBNA 2Z57A 1T1GA 1KDVA 4KPGA 1BFUA 4NE7A 1SELA 2ID4A 1AK9A 4CFYA 3CO0S 3A3NA 3D43A 4NMXB 1Y34E 1C3LA 1SUCA 4NE9A 5ARCA 2SECE 5FFNA 3DVSX 2WV7A 3QMPA 1BFKA 1LW6E 2Z2XA 2PRKA 1SBTA 4I0WB 2W2QA 3EIFA 2XRMA 3GCXA 1GA4A 2ZRQA 1S02A 1C9NA 3I37X 2IY9A 2Z2ZA 5AQEA 1SBCA 3DE2X 4DZTA 1EA7A 3GT4A 1Y3FE 1PEKE 1SPBS 4RYDA 1ST3A 1CNMA 1YU6A 1P7WA 3DE1X 1WMFA 1SBHA 1TM3E 3EE6A 1TO2E 1SN7A 3SICE 2SBTA 5JXGA 3GT3A 1SH7A 1Y33E 3DE3X 1T1IA 3F7OA 1KDYA 1IAVA 5ARDA 1GTG1 1S01A 5AVKA 2ID8A 1IC6A 3I30X 4AKTA 3LPDA 2Z30A 2Z58A 1SVNA 2PWAA 4WOBA 5K7SA 3LXUX 1Y3BE 3Q40A 3DW1X 1CSEE 4C3UA 1Y4AE 1JEAA 1ZVJA 2WUWE 3EDYA 2ZWOA 1AVTA 1AU9A 5I9SA 1Y3DE 2WUVA 3D9QX 4FONA 5AVJA 3VHQA 5B1EA 3TI7A 3VV2A 4OMDA
chains in the Genus database with same CATH superfamily
4BXOB 4H7FA 4RDHA 2G88A 1PO7A 4CCWA 2OZKA 1EK6A 3ZV3A 3URKA 1TEXA 4Z9YA 3WYFA 4DMMA 1W6RA 2V5UA 3FAKA 4QOSA 3ICQB 1W5BA 2I99A 2RHLA 1G20E 2FOXA 2VAWA 5K5EA 2FF7A 4DDUA 2J9FB 1V2HE 5CCBA 3LFUA 2XA2A 1GUDA 3E22A 1GTL1 2BI8A 3SEFA 3GLIB 1LVGA 1QFSA 2YRFA 4MWEA 4DAOA 1PT5A 1T36A 2ECPA 4G5OA 1PLLA 5AVOA 2Y0CA 4UBLA 3BGDA 1OLUB 4D74A 3FFAA 3INRA 1V9CA 5HEKA 3BB1A 5IDVA 2O0LA 5FT9A 3B1ZA 4R2LA 2Y99A 3EZ9A 4WVFA 3V7NA 4YAIA 4EHLA 2G3YA 3EXHB 3R7SA 3RRNA 2QJWA 2AW5A 2NZJA 3EFOB 1O96A 3G5MA 3IJRA 1TB4A 1FRFS 3W5CA 5JS1A 3A14A 4IIJB 3A6KA 3WLKX 3WB0A 4MARA 1CDDA 3CS3A 2BN4A 4EI7A 2ODWA 2IZOA 1JHXA 4GBMA 4GP9A 4F3CA 4JOSA 1U9YA 1YQQA 4CUZA 5JJCA 1UK6A 2X15A 4WUTA 4MV4A 3EFEA 3GRPA 5EEHA 3RS0A 4DBLE 1MXFA 2YHIA 3C7KA 4DB2A 2O8CA 1K6IA 4UHFA 3ZDBA 4OQMA 1QGZA 2ZBGA 1ZK4A 4XGRA 4OOEA 3Q4GA 4Y2JA 3QF4A 2A88A 5EXTA 3H8WA 3VU3A 1X86B 4DMKA 5J4HA 1ZVQA 1GSHA 4CU2A 1TMGE 4W1QA 5K3FB 2D1YA 3ESCA 3GCDA 4KVGA 3L6DA 4C1BA 2AG5A 2BCJQ 2K6GA 4YASA 1X1DA 5COQA 4G5HA 1PFQA 4MR9B 4F72A 4LMRA 3ROGA 2HA0A 4I1OA 2Q3HA 3E23A 5JO9A 2INGX 4BGUA 4KV9A 5K3EA 1IBRA 1VE3A 2I0FA 2HYDA 2KWIA 2GZ3A 1XOIA 4FBLA 1Q20A 1RXCA 1YA8A 1UJ4A 4LPKA 4RJLA 4ND5A 2B25A 4PV7A 3HABA 2YJ6A 3DAGA 4HADA 3OZFA 4M54A 3WQSB 1M0SA 1S6YA 2HRQA 3CTPA 3KKEA 4RWEA 2WWHA 4TM8A 5DRTA 5BQXA 1U0GA 4EJSB 2YNMC 2Z9DA 4OJYA 1RCUA 5HKLA 1OTHA 1TVKB 3PXGA 4Q4DA 3G8DA 4KXYA 2I2WA 1XJ0A 4GT1A 1Z5WA 2NTEA 2ZSIA 3GFRA 4KDFA 2VDJA 1GCIA 3FZNA 3M5PA 1ZIDA 4AMYA 1V95A 4BLUA 2ZUWA 3IT3A 4WXEA 3PFBA 3QVJA 1Q5PA 1L7VC 4P98A 1RQ2A 5L3RA 2VKTA 3B7WA 4EQ6B 4EJ6A 2OHFA 1BU8A 2YC2C 5B1DA 4PANA 1EZ4A 1Z5VA 3KSRA 1OXUA 1SKYB 5CLLA 5IS2A 2EGGA 5CFZA 5HKKD 4CEIB 3CGWA 3ZVMA 4J0IA 4MS4A 5AWFC 4N39A 2GPJA 3ZD8A 1LJLA 1GA6A 4QXRA 4W5RA 2QTBA 5J63A 3B5IA 1CZHA 4G5SA 1AZWA 4G63A 3NNNA 2WZBA 1QF9A 3SJZA 5CFQA 5KX5A 1P4SA 2C20A 3E84A 1MOPA 4QFMA 4D8XA 2FSHA 4PAWA 1Y5RA 2ATVA 1VLZA 3I8XA 4X20A 3U4CA 3QUCA 1H9AA 2K2WA 4DHWA 3WRVA 2JGAA 5TEVA 1CR4A 2XA1A 1N5OX 3DE0X 4JVSB 3NORA 3JQGB 3NHBA 4Z1OA 1WXWA 4ITUA 3DLTA 5H83A 4C7JA 2IZ6A 5CK5A 1V11A 3N2NA 5H5JA 1M5RA 5A0VA 2Y77A 2GPWA 1CJSA 2Z1NA 3ZZ0A 2NAFA 3M9LA 4MYSA 1V8BA 4XLTA 1EIZA 1MX1A 4AXBA 3HV0A 1HLGA 3VSCA 4QOGA 3BA6A 3SDSA 1KS2A 1I3OA 1U1GA 1GT91 3ETNA 4HLQB 3ZUPA 2VDNB 1Q74A 1ULTA 2LDXA 4GZ5A 2OYCA 2RHBA 5C80A 5JPCA 1LV7A 2Y4OA 1OY1A 1TCUA 2R97A 1P31A 3NV7A 3KQUA 5CNJA 3ZY3A 3ZDCA 5ICFA 4PM4A 1J9GA 3V7UA 5E1DA 1P9LA 3LC0A 3PL5A 1B3BA 1R9MA 3BMXA 4OYHA 2PS9A 2E1PA 3H9CA 5LYJB 2FZGA 4CM4B 2F3TA 5HF9A 2OC4A 1G59A 2ZIUB 2QGNA 4PSDA 2ODQA 2EYQA 2P0YA 2JCBA 4FYPA 4IHAA 4ZKDA 4YACA 2YRXA 3KZMA 4PZPA 1Y3AA 2ONCA 2PV0A 5FOSA 3RS2A 1NVVQ 1BXRB 2P77A 3FPGA 3R0XA 3U17A 1KJ8A 4RJKA 4IO1A 2GGSA 4GEKA 1L5MA 4AY5A 3B6MA 3UUEA 4F2PA 4EA7A 1F14A 1BMQA 2BAGA 3OCYA 3LQYA 3W6NA 1R4NB 3QKIA 4NF2A 4U63A 1UMBB 1QP7A 4LXHA 2QU7A 1RU3A 2CJPA 4BQOA 2OMKA 1ZGAA 2PYDA 4JLAA 4PZ0A 2JFHA 3GCWA 4MIOA 3CW2A 1KQNA 2SCUB 4E5DA 3VJKA 5J4VA 1JALA 1H8HA 2QVXX 2QD5A 3O4JA 4FZJA 3IURA 3MRVA 4J0CA 4P4NA 3LBIA 4FMDB 4TT8A 4WRRA 2UYGA 1NDHA 4QOIA 4RD2A 1VMEA 3D6TB 4AUMA 4L16A 3HO8A 2XI4A 1H2HA 3AR8A 1SQSA 2E87A 1THTA 1JSCA 2W48A 3LT4A 4BNYA 2IS1A 1Y1LA 3NBZC 5B57C 1T10A 4KQIA 1SXPA 1NNSA 3MS2A 3NYWA 1XTTA 1NBMA 3LT1A 1VL6A 3BTOA 2FWIA 4JLBA 1G7CA 2H7YA 4LJ5A 3V8RA 5LWQA 2J6BA 1RPJA 1T1EA 3L6RA 1MOQA 5AW5A 1CQJA 1QVWA 1ST2A 5HDQA 2VI5A 3R3XA 3TR6A 1UQTA 2LUOA 2OBMA 2YYSA 3A9RA 4BNTA 1C3JA 4EFDA 1BEEA 3WZLA 5M34A 1HEYA 3HDQA 3WGNA 4YMUA 3MAGA 3BERA 1KQ3A 1RWWA 2PQ0A 2W00A 4GFDA 4US2R 1G21B 3ILVA 3K7EA 4HQOA 4WN9B 2HB6A 3NIDB 1W94A 4BNNA 3T3DA 1W76A 4MRPA 2J0UA 1QV9A 1X1BA 2LCIA 3I53A 5LDDC 4IRMA 4GGOA 3DDZX 2E18A 3TVYA 2X19A 2XMGA 1TZKA 2XD9A 2XQGA 3SS7X 1TW3A 4ERXA 3IAS1 4N6OA 3PPVA 2XV1A 2L17A 3L8MA 5K1ZA 2XMRA 1DCKA 3TLAA 3ZWAA 1Y9DA 3R7NA 3UY4A 1XF9A 4ZANA 1Q0TA 3U3KA 4ZYYA 2BTQA 3IDQA 3SM9A 2G71A 1OXTA 4N7BA 4NJOA 3SQWA 1FYFA 1XC7A 4BZWA 1U1IA 2YXPX 3BIOA 3AXSA 1M72A 3DM5A 4HMQA 3RJ5A 4DVJA 4EPXA 1YBAA 2WFLA 1PS0A 3Q0TA 5B53A 2PUEA 1Z7EA 2B9VA 2IYXA 4IX1A 4UKDA 4ZCPA 5JD3A 3ZDRA 4HT3B 5BORA 1EUQA 1W49A 2VDPB 5E4YA 1DCFA 4RTJA 2PX4A 2V4UA 3F6CA 4LJSA 3T3NA 2BHSA 5F3WB 5I6DA 1D03A 1F6BA 2VJCA 4DYVA 1KJ9A 4POAA 5J1TB 2UVPB 5GM1A 3NDJA 2JGKA 3IKVA 4MUAA 3IKJA 3SNKA 3TEFA 1H2BA 2AF3C 1CE8A 1W46A 3RCBA 2QE7D 2P2LA 1HV8A 1R6TA 1RRKA 2FDRA 3BL6A 3ZK9A 4BV3A 5CAEA 3K35A 4HVLA 1N0IA 3W2HA 4DNFA 4EG8A 1SQ6A 2CLIB 5H7XA 1DB3A 4R1NA 4EY3A 1S2GA 3VGPA 1L5ZA 3C7CB 4GP7A 4ZFNA 1JVBA 4JUAA 4BLWA 4TLDA 3OX2A 1J2RA 1QFMA 1M2VA 3UMCA 3WE7A 1E2DA 1JLMA 2VH1A 5CYOA 5BWOA 3H2IA 4UHKA 5F33A 4TLEA 4ZZ3A 4I14A 5KJFA 5BY2A 3Q87B 2VYVD 1NQWA 2B2NA 4OQ4A 3SR3A 3VR6H 2O23A 4QYIA 5T3YA 1W34A 5TQ0A 3BPSA 1SCAA 2Y1CA 4F6CA 1OBOA 1QIEA 4EGCB 3B1KA 3TTXA 1H0KA 1TQDA 1QHFA 3P2YA 1D4ZA 3AP3A 3P52A 3EIUA 4IV5A 2P5UA 3W3AD 2JJMA 4O5OA 1XAJA 5AVQA 1WDTA 2IDMA 4RIHA 5CD9A 4CETA 5BR1A 4G41A 4TL9A 3TR5A 3UV6A 3QX3A 3PEYA 4CTJA 2V8OA 1KBOA 2B8EA 3H2GA 2R1ZA 4UOZA 4MRRA 3VMMA 1RHRA 1LTQA 1W44A 3ND5A 4BNXA 4N5IX 3WB9A 4GI1A 1BU5A 2PVPA 3C74A 1VPTA 3Q7PA 4H6PA 1U9JA 2EKZA 2NM0A 1KI1A 2Z57A 1CVLA 1MB0A 1U7OA 2DQSA 3DXXA 1P45A 3OEHA 4KPGA 4E2ZA 2R0QC 3OIVA 3N7TA 4KHZA 1X1CA 5EJ7A 4B3RB 3DAHA 1PV1A 3L06A 1EE1A 2EDCA 2R6FA 4DN6A 2HLDA 5LPNA 4NS4A 1IYZA 4LV8B 1EJBA 4PLTA 4V3CA 4HDKA 4CI9A 1U04A 1JQEA 4FU0A 3PP8A 4B46A 4JX9A 1FFDA 4GYWA 5GGXA 4FHDA 3ZBQA 1SU6A 4ENPA 4U0JA 1WAMA 4FMBB 1QNFA 5ETJA 1E2KA 4M2LA 1YCDA 5H1YA 1G55A 5LDHA 4XJSA 2JFFA 1M5UA 1RXIA 2X0IA 2EP7A 5B58C 1C3OA 1FSGA 2FVYA 2IODA 1BFKA 4AZ0B 1HL3A 4GPAA 5FTLA 3B8HA 4V0ME 5KSWB 4NHOA 1ODJA 1BJTA 2JZNA 1XZKA 5K0TA 2C0QA 4WK6A 5I5EA 2LKDA 3M9WA 3ZVRA 1SBTA 1RI1A 1X1QA 3CUTA 1ZD9A 5FV7A 4ARZA 1PT6A 3TTYA 4DCJA 2OYSA 1YB7A 2QVZX 5A2GA 2E6UX 4BZXA 2XRMA 2FW8A 1D3AA 3FPSA 2F3SA 5K4HA 3CVYA 4UATA 1SUWA 1ORIA 1VKOA 3Q5DA 1GA4A 3HEBA 4NU5A 2R8EA 3DO8A 3QPBA 1I2CA 1T1SA 4RZXA 2ZTSA 4ZO6A 2QM0A 3H1EA 4EAQA 1D1TA 2OT3B 3KHTA 4CGZA 1QIHA 2WIBA 1Q7CA 3ANSA 3GPDG 1F2TB 2ZVQX 1XRPA 5CX1A 3RJTA 4B3HA 4RSRA 2FPWA 2OQIA 4DZTA 3E3LA 1H1LB 2P6UA 4QO8A 9LDTA 1JBEA 2BF4A 1PEKE 3D6HA 1M7BA 4R2MA 1BD4A 5PGMA 4HEJA 2JCSA 3LRTA 4Z9XA 3CZRA 3ZHSA 1AUQA 3PYLA 3AVVA 4D44A 3QW4B 3PE3A 4TOIA 2CJWA 3H5WA 1GZ4A 4F4JA 3QVGA 2X58A 2C3PA 4A2QA 4WZAB 4C5AA 3GGDA 1JT9A 3RC7A 3FWNA 4EB6A 1EJ6A 2AEMA 2NU9A 4FJ2A 4HDNB 2WM8A 4J1QA 1WQ4A 3EG5A 2C9BA 2YUIA 3IKMB 3LBFA 3QA3E 3ECSA 4IEFB 1Z25A 4LV6A 2DTDA 1XE3A 3EB9A 3RBXA 2QLNA 3UHJA 3WZMA 4BKMA 1TCCA 4PRLA 2SBTA 5DTEA 5BXYA 2NO7A 2WDPA 3O1IC 4X85A 4RV4A 8AT1A 5HUJA 4B34A 3GO4A 4E46A 3R3SA 2ZBVA 4LDNA 4R1LA 4BVAA 3E4CA 4RQAA 2J9XB 2X5XA 4KWEA 5CCDA 5IDYA 1PV2A 3TF5A 2JLYA 3MLEA 2QB5A 1NQVA 2VAXA 2P1ZA 4JJGA 3LTNC 1ID8A 4GMDA 3DYIA 4YUAA 1S1MA 3RVKA 4PN7A 2ZAOA 4D2IA 3HEMA 1TM2A 1EM6A 4RHYA 4KSBA 2WE8A 1CUWA 1TLTA 4QDUA 3ZE7A 3HE3A 4PCAA 2B20A 5BMVA 5KNCD 1HRDA 2RKOA 3ER9A 1QIMA 3WNQA 1I1OA 3Q3VA 5DBOA 1EVZA 1QTNA 3ONEA 2YY7A 2Z58A 3UAZA 2ZRCA 2XNSA 1EP2B 4WOBA 4DABA 2GHTA 1FFXB 4NCKA 2ZYAA 4TTSA 3DW1X 3I9NA 4KQ1A 2XMQA 4YXWD 2V03A 1P29A 3DAOA 4IMJB 1D1PA 1H2FA 1I4EB 2OM6A 3PGKA 5DTIA 4NYJR 3S2YA 4GRIA 3N9IA 4ZZ2A 4ZCTA 5H3HA 5HSGA 3E9RA 2FPIB 1RAHA 2XRZA 1I6MA 4OXKA 3RO7A 1UPFA 1AMNA 3AKCA 4MP3A 4P31A 5LQRA 2GXSA 5AVZA 5DGTA 2OWDA 3RC9A 4UDXX 5T41A 3K9NA 3FYUA 1G3UA 2FWPA 1WV1A 3BA1A 2I6SA 4DA0A 5ALOA 1JR3E 1P3JA 3KYDA 4KR6A 1HUQA 3FNFA 4PR0A 3RIHA 4RF2A 2AI3A 4XIFA 4RMGA 2GJKA 4F9GA 3U7QB 4AKGA 2JHFA 3DR5A 4JSRA 3M34A 1N5IA 1XQ1A 3LGXA 2POQX 4YFVA 4Q3OA 3QLVC 1A4XA 2IE0A 3EVGA 1YI1A 2I78A 2IW3A 5DNWA 3I5MA 1YS7A 4X97A 1LI7A 5B1YA 1SA0A 2SHKA 1MB4A 3U13A 3H0KA 5DI9A 2W6MA 4DLBA 1RJWA 5KYKA 1XN1A 4TV8F 1D1QA 3L8ZA 4YAEA 4BO7A 2EOAA 4JXJA 3GJSA 1EP3B 2WJJA 3U4GA 3CY6A 2ZZMA 1S7GA 1C7FA 3I4LA 4LVCA 4RLSA 1ADGA 3UGTA 1VDZA 2IPLA 2ZJAA 3HJBA 2OZPA 2JK1A 3JATA 2SNIE 4BE7B 2QTTA 3LLCA 3FMFA 4C7KA 5A0FA 1ZWKA 4IIVA 1VCHA 1MG0A 2J9YB 4HGOA 3OFKA 4PO8A 1Q16A 3WR5A 1W0JA 2QUZA 5AMXA 5JECA 1P7YA 5TSDA 1AT1A 2ZRFA 1ABEA 3PF9A 4MDYA 3RUPA 3TYXA 4F12A 2RHOA 2ZRLA 1TYEB 1ISIA 3AOEC 3FR8A 1P5JA 5FEUA 1VLHA 1JHPA 4KO8A 2PX2A 1MPXA 4JOQA 4MB6A 2IYLD 1V5IA 2P3LA 2QTCA 1FJ2A 1YASA 2WP8J 3E18A 5LA6A 1YB4A 1SU7A 2CEAA 3L4EA 3UPUA 1GQQA 1T8YA 3FMOB 1M2FA 2GUGA 2QM7A 2QYOA 1BIFA 4JI3B 3ZWBA 1YAJA 2VJMB 3L8FA 3OSZA 4XVCA 3VZQA 1DIOB 4DJAA 3NBFA 4GI3A 3G0CA 4IAOA 3K0KA 3UXMA 3VUFA 2D8AA 2RH8A 1XDWA 2AYZA 4MKHA 2O0JA 3DONA 3FPJA 1NF2A 5D85A 3GAAA 2IGTA 2GWHA 5KSOA 4CXMA 1SHLA 4PO1A 3ZW8A 3JQEA 3KNZA 4XWOA 1NN0A 4AS1A 1CF2O 1FXUA 3LHKA 3OQIA 4A16A 2YXNA 3AFMA 3KT8A 1Y9JA 5IT9A 4DQDA 4RJ2A 2JRLA 3JXEA 4H7DA 3F96A 1IK6A 3EEQA 3LQFA 2XW6A 4DA8A 4KUHA 5TIIA 3K2BA 3KR1A 3ZI0A 2PH1A 4Q12A 2IVFA 1RXVA 1M0WA 4RA9B 3K3PA 1JEDA 3P32A 5ALJA 3OZGA 2O7SA 2Y9PB 4CMAA 5ALEA 3KKNA 1RWNA 1ZA2A 5JJIA 3BQMB 2IIQA 3FRIA 1AQNA 1L5LA 1KC3A 1YS4A 4EAAA 1WVIA 3KYBA 4C6SA 1S3IA 3ME5A 1JHUA 3H4IA 3WWCA 4I1YA 4JI1B 4AZ3B 4BVBA 1YJBA 2RHDA 4DC9A 3A0UA 3KFLA 2QTRA 4JVOA 1QQ7A 5CVJA 1SHTX 1JEQA 3T1NA 2B6NA 3SMVA 2HEIA 4DR7B 4FBGA 2P8SA 2PNJA 2JLRA 1NGSA 1QKJA 4G37A 4MHTA 2R6JA 4MWZA 3EEOA 2IPAB 2CHFA 2IU3A 1DEKA 1KEWA 1TAQA 2PMCA 1OC2A 1NTRA 3ZE2B 1FYXA 1VPWA 1XP5A 4KEAA 4MV6A 1JEJA 3GQBA 3HZRA 2I62A 3LK6A 3SJ7A 3ZX4A 4CUKA 1JDUA 2PGIA 3MCWA 3RYTC 2QA5A 5HS6A 1YJQA 2Y1XA 2N0SA 2QLMA 4HTFB 5IN5A 3OZUA 5AM1A 2ODPA 4TUYF 3RAPR 5HMLA 2XCRB 1PG5A 4E5MA 5EE5B 2OYRA 2CJXA 3AIOA 3GUCA 4OXQA 4OIFA 5FX2A 5FPQA 3V4SA 3BDVA 4TVKA 5JAOA 1A4UA 5IAKA 2P2NA 4HLNA 1VG1A 3BX1A 2SKEA 1A27A 3RTBA 3VOAA 2IRWA 2IHBA 3KQWA 4CIDA 4L8YA 1XCMA 4MA5A 1J8MF 2QV0A 4B6SA 2PY6A 1JMVA 2G70A 2HC9A 1MIOB 3KSMA 4MS3A 4MHSA 3SIPA 3UAYA 1JT2A 4BN0A 4IJ6A 4B1FA 5BV7A 4REQA 1UADA 2J67A 3D64A 5B1IA 6GPBA 3NANA 2V3CC 1LX6A 3WX0A 1PZEA 1CY4A 2QVCA 2Z3VA 3PXEA 4DNQA 1BEZA 1LH0A 1Y1QA 1HQYE 1T8PA 3NHLA 4GD3Q 2BONA 4ALJA 2DQZA 1K4YA 2X8AA 4B4WA 3CEAA 1N2XA 5LP6A 4F93B 2RGDA 4PYOA 4P93A 4POOA 1Y89A 2HFKA 2O8CB 4N0QA 2O8DA 3KVRA 5I9BA 3W3AH 4KUGA 3T5GA 3NU1A 1ADCA 1GNLA 2OAEA 4OM8A 3PX7A 3QE0A 1T15A 1UC4B 2H1CA 3EEFA 1ZMOA 3EXFA 1DJNA 2CMGA 1KY2A 3DVQX 2J1LA 1G5TA 2YJZA 3F6BX 4NCHA 5AI0A 4Z9AA 3SK0A 4DLRA 3IEMA 3GROA 2HOQA 1RBYA 2B78A 3C4JA 1JHYA 4HLUA 4RMHA 4WX2B 3I9V6 5JSKA 3SQNA 4M83A 3LDFA 5CM2Z 1B8PA 1A4IA 2XGOA 1AKYA 3PHLA 1SXJE 3TFWA 1L4EA 2K7ZA 1R0CA 2C8KA 3V5NA 1T4DA 3HB1A 1UP7A 1JMYA 2RGUA 1TRHA 1PYDA 2BJHA 3G49A 1A5ZA 1O94D 4C3OB 4LRQA 2JFNA 4X7MA 5JV5A 2E0IA 4F85A 3V8NA 4H3SA 3KELA 3L0ZA 1DX9A 4FSXA 4QDKA 2XTMA 3HLKA 2D1SA 2HMYB 3PEVA 5LMCA 2CK3A 5A02A 1PZMA 3MWGA 1YHZA 2YHSA 3SM3A 3V2HA 3GT0A 4ETNA 1P2VA 1QR2A 1Z36A 5IP5A 1E7RA 4Z5XA 5ERGB 5DNDA 1CJMA 1BVHA 4GMKA 4ZAFA 1GDTA 2ODBA 2RAPA 1A8IA 3UGJA 4YI5A 3DV0B 1KI7A 3I61A 4Q7KA 1GRQA 3LPMA 4JP5A 4OL0A 4XDYA 2VJQA 1EK2A 3IP9A 1G7TA 5E7JA 4NJEB 4LVOA 5ARBA 1R6XA 1W59A 2VAMA 2JHCA 3E2PA 5DM4A 3SJAA 5BUSA 5KQPA 3ZV7A 4JS0A 1C8LA 4QDZA 5INTA 1YI8A 4OOFA 3UJDA 1U1EA 3DPIA 5LQNA 3D3EA 3PNPA 1QG6A 2KBEA 2O05A 2P1DA 3PA8A 4QRIA 1XROA 2BGMA 3CR8A 1JLSA 4QNMA 5T8KA 1GGJA 1KZHA 2EZ8A 3ZWOA 4YCMA 4MMXB 2B99A 3MT0A 1ZJJA 3GIDA 4AM8A 2Q49A 3UA3A 1AURA 5K20A 1A9QA 4E51A 4FCTA 3IIKA 2QTZA 1RI5A 3STYA 3TJRA 3NC4A 2F1IA 3NG1A 4MQ6A 4MVCA 4WXMA 4U4AA 1ZOSA 3H1AA 3C6QA 3EARA 3WLTA 3FIUA 1XLWA 3P1JA 2J59A 5HJ7A 1BRMA 4G67A 1ABFA 3B85A 3G82C 3C3AA 3GEGA 5KWIA 4JYBA 3A36A 3HVIA 2H7VA 3M1IA 1LDNA 3OA2A 2WK1A 2Q62A 3GBPA 4QTYA 4JENA 1BHO1 2R9VA 2FPLA 1FP7A 1U4OA 4V2IA 2VJYA 3L04A 4YH1A 1L7XA 2C2BA 2PX6A 2XJ9A 2PD3A 1F1JA 3A10A 4FFSA 1C9MA 4X1IB 3ZUGA 3GAFA 1SXQA 1P0MA 1A97A 4TS4A 4D0NA 2FPGB 2GI4A 3K9GA 3EAFA 1E4EA 3ETGA 5K0CA 5LLTA 2WNIA 3H5IA 1EBUA 4BKQA 2JCXA 1SUFA 1E9FA 1KYYA 2ZJOA 3KE8A 4KB5A 4Q21A 4TLCA 2M1ZA 3FKQA 4N82A 5FUXA 1IWOA 3PV0A 4R0NA 3ZWPA 2VJNA 3COJA 4G0PA 4RDXA 3MRXA 4RZQA 4TKVB 2UZAA 3GMSA 1GPAA 1DOZA 1UK7A 3IUMA 2GPSA 2Q4OA 2AX3A 3PDHA 3SYNA 2QN6A 3B48A 3IO5A 3M6AA 1NYTA 2FPUA 4HATA 5EIFA 2C3YA 3A1UA 4BP9A 3ZCPA 4IQ4A 3OE7A 1OU4A 3L7DA 4P8RA 3PQEA 5LOVB 4QDOA 2OKGA 4PLVA 3IMEA 2ORVA 2VRCD 2WPNA 4ZJPA 2IP2A 4C20A 3Q3IA 1DXOA 3BDIA 1Y48E 2BP7B 3NH9A 5TS3A 1RRMA 1XMSA 1YIDA 3AU8A 1NG1A 4G1MB 2BLNA 4LFAB 2G0TA 4M3NA 3PKZA 3G89A 5LUAA 4D98A 1G5FA 3IT0A 2F2TA 1ZSVA 4NPCA 4TMYA 3TBKA 2XXBA 1X92A 4LDRA 4AKEA 1W5TA 1P0FA 5K3CA 1U3GA 3VHXB 1AS2A 5BSMA 1VXRA 5KCMA 1N0VC 2BSQA 2BFFA 4IW3B 3OIFA 1C4KA 3WWZA 1J9EA 2ZR7A 3OSUA 5D6OA 3C39A 1BX3A 3QBJA 4HS9A 4WZBA 1PX0A 4A0QA 2MYUA 3Q8LA 4RVSA 1L4NA 3GWGA 3N87A 2FN7A 1EU1A 1WU7A 4KX5A 5CUQA 4EJSC 4JLJA 1Z37A 1IHXA 3V1MA 4DWOA 2IITA 4W9NA 5BN5B 2FUEA 3BGWA 1G6Q1 1NV9A 1JLHA 3K8QA 4O0MA 5JAHA 4JXXA 1KH1A 4ZYUA 1JAHA 2VP5A 3Q2OA 4M1TA 5LFAA 2Z5GA 2ZBPA 3RI3A 1O94C 2MJLA 1X7XB 1POXA 3CNNA 3L0OA 2OWEA 4HEQA 4PPYA 1O1YA 1KRHA 2QRGA 4FIDA 1E94E 1G8KA 2DF8A 2Z1DA 2W11A 3AUSA 1J2UA 1EP1B 1US8B 4HEA1 5DBHX 2CF6A 4XQGA 4UM9B 1MT0A 1ZIPA 5FQNA 4N8SA 4B85A 2XEDA 5DNEA 4EFLA 3A25A 4M60A 5LKAA 1V0JA 4ND4A 3UH1A 1FMCA 1I6WA 3CE6A 2IX3A 4NE7A 3LNCA 1D1SA 3P9XA 2AXNA 2CNKA 1IG3A 1BHJA 1NE7A 4P84A 4QFBA 1AK9A 1C4XA 5IDWA 3P2IA 2PAAA 4FFMA 1K4MA 3OZVA 4QU9A 5LU8A 2XUOA 1A5BB 3CR3C 2XD4A 2CKMA 3LG2A 4MWGA 4YJGB 1FPQA 3D5TA 4AU1A 3RKUA 3C1TA 2ECOA 2PUTA 2K4MA 5ALNA 2X2OA 4LNAA 1SKAA 2BSAA 2YY6A 1KAOA 3IA7A 1KJWA 4Q0MA 5KHAA 4YAGA 3T95A 4ZEWA 4F96A 2EARA 2SECE 3MCZA 2IYOA 2NP6A 1QE3A 4PIVA 4HY3A 3UQYS 4HO1X 4I7EA 3A2MA 4QHTA 4US0R 2HHHB 1X15A 4I8IA 4J2OA 1Z06A 1CIVA 1M2OB 4IILA 4C43A 2PFGA 1U3FA 2ZCJA 1JSLA 1OV4A 3RANA 3DCJA 3WFJA 1I7QB 3N8IA 4KYIB 4LHYA 1FNNA 4OCZA 4BCDA 5I4KA 4UFOA 1DPFA 1DHRA 3NTVA 3QPVA 3W5VA 1SURA 1S9HA 4H16A 3EIFA 4TMWA 4NH0A 4ESVA 2QM8A 5AJTA 2I6UA 3RW9A 3GLFA 2IPXA 1IXSB 4BBPA 4DLVA 1R16A 2R8BA 2R6DA 2AKAB 3I37X 4P3YA 5FLKA 3T06B 3X0DA 5IZ4A 2Y6VA 4RY8A 1TIKA 1ACMA 3KKPA 1Z74A 1XVTA 3RC3A 1A9SA 1G8JA 1R88A 4IV8A 5GY7A 3WJ7A 3WV5A 4IDCA 4TVSA 1G19A 1WPRA 1XPRA 4FHCA 4GW3A 4XX0B 5A6SA 2UUBB 3T3PB 3L2OB 4G89A 5HCNA 4XWWA 3DMRA 3DOIA 4OXRA 4ND1A 1EEXB 2G5TA 2AI1A 2YNMA 1LQUA 2OGUA 2VATA 3HSSA 4MB0A 1RZRA 3IV9A 5J2TF 3BD6A 3EAQA 2JI9A 2QZ9A 4O4IB 2OV6A 5FOUA 3Q6IA 3NTLA 1C9YA 5DHAA 1G5HA 4OHKA 5KNBA 5BT9A 1VCNA 2XWSA 5LNK1 3A32A 1WXXA 2XDQB 4KFRA 1BW9A 2PBFA 4EW6A 1IOZA 3CIFA 1KQFA 3HHPA 2OEPA 4NOMA 4G4SP 1PJ3A 2IT1A 2DFPA 3RSZA 3GWZA 4IIDA 1G18A 3TD2A 1QKKA 3KYIB 2CCKA 4TTJA 2FY8A 4B8WA 1DKLA 1RI4A 1Q3TA 2BJVA 2GBIA 2Y1LA 1VSUA 2XHZA 3PD7A 1XXHA 3BDAA 5B7QA 5JEEA 1LLQA 2VBGA 1CIJA 1FL9A 1LC0A 2PM8A 4G0OA 4I1UA 5GMOA 3RYHA 3M89A 4BNZA 3ABRB 2Q6OA 4OO3A 4RHTA 1FX0A 1A0OA 1HM5A 3FOWA 1ZNQO 1UWLA 1II8A 4KDEA 4MKGA 1CQWA 2GCNA 4YJFA 4ZDJA 4QUDA 2FH5B 1VKJA 2XTNA 4J7AA 3DBOB 4IOLA 4L5BA 2W93A 4F0JA 1V35A 2A5DA 1IQRA 3WLAA 3QX9A 1VL0A 4IH1A 5JQGA 4LHZA 5HCIA 3OEEA 5FULA 1IULA 4AS2A 4Z7OB 5AUPB 4WUVA 5IZCC 3LYHA 2AFHE 3SYLA 1Y3BE 3KWLA 4LYAA 3CHYA 3JQAA 1FNMA 3DXZA 4L78A 5A04A 1S96A 2I8LA 1DX6A 5DKFA 3F47A 4OQXA 1HDCA 1JILA 2CC2A 3IXMA 4XUCA 3IAM6 4A92A 5L6LB 5AHKA 1OFUA 2OP0A 1JFVA 1AUVA 4KFUA 4KNYA 1E6EA 3DOOA 4JNKA 4RLQA 1L4HA 2PUAA 3IUEA 1RKUA 3QVLA 4MCHA 2FUKA 1ZUNB 2BF7A 4C4YA 4D3SA 4DCSA 4QJ3A 4HX9A 1VHQA 2VJLA 1VRWA 4B79A 1Q1GA 5AFSA 1FP4A 3KSAC 3D3WB 3AVOA 1XTIA 2R79A 4QA9A 2ZDHA 4X1OA 3FD8A 3GEPA 2E4AA 2E85A 2J7PA 4IO0A 1QOQB 1TPZA 2FUG1 3TB4A 1KI3A 4YQFA 4AY6A 2ZKLA 5B1EA 5FWDA 1Q7GA 1KK2A 3ESRA 3IOCA 4J4BA 2JHPA 4ZVNA 3RYIB 3SDBA 2D6FA 4WJZA 2W6CX 1WMSA 3QVWA 1MVNA 3CZ9A 1FTQA 4BKPA 1D9XA 1E1CA 4PWZA 1QZZA 5HX7A 2FMTA 1DQRA 4C2UA 2ZJ5A 2C97A 3NOXA 4GLBA 4R41A 4A2PA 1J8YF 4ACBA 3D3KA 1N2HA 4LE2A 4BMZA 3W06A 4YCBA 3WRWA 5JS7A 1T43A 1VDMA 4KR7A 3BMQB 2RHWA 1ZGJA 1D7OA 2JIOA 3E7WA 4FYHA 1AK1A 1LXCA 2QTFA 1JP7A 2HK7A 5COBA 5ULLA 5LU9A 4U02A 1EI9A 1ZD5A 3B3JA 1EP9A 2GCIA 3NC1C 3BILA 1SCUA 3QVKA 5HF5A 4LRXA 4R2JA 3WHKA 2IU6A 1YONA 2CYBA 2I9PA 4BO4A 4UFPA 3TZ6A 3OMWA 1Z6GA 3DOFA 3T5TA 1ORTA 1U0RA 1KMHB 2V9PA 4N7MA 1D8TA 1MQAA 1JVNA 1XA0A 2AC2A 1JIVA 4N01A 3LUCA 3PNKA 2TS1A 2YUTA 1WIWA 2HHAA 1O4WA 4DREA 4RTSA 1JJFA 1NOIA 2VDUE 2WFAA 3PNOA 3RWMB 3AERB 3I2KA 3S2UA 3VYVA 3CX7A 1E1DA 2PYZA 1XX6A 4URZR 4FFRA 5DK4A 3KX2A 3C8UA 1H9CA 4CFSA 1ZN8A 4RD1A 2ONZA 2VZ9A 4IKEA 4F46A 3C70A 1MU0A 3CN9A 3OLXA 3FLMA 4XJTA 1SUDA 3VYRB 2QUBA 4MR8A 2WTAA 2QN7A 1Z7BA 3CFYA 1TF5A 1MXHA 1TVMA 3D4LA 1ZN2A 4MUGA 2JC3A 1F17A 3SPXA 3T3MB 2MSNA 3DBVO 1LX7A 1ZESA 2XCSB 4C4SA 1E3DA 4PYMA 5GADl 3WNBA 1VG0B 3IERA 3M33A 1Z18A 2ERXA 4JJFA 3OFND 2DQYA 1G4HA 5KBYA 5IMBA 2IUSA 3V48A 1D2MA 1XTPA 3L3BA 3HRKA 1STOA 1OX4A 4WNIA 2IELA 2EVWX 3K0FA 4X8LA 4NZNA 2YR0A 5HKKA 1ZONA 3ZDXB 2JAQA 4J1SA 1FDVA 1PUJA 2OBYA 2QUJA 4KQ9A 4MYCA 6REQB 4E6EA 3INGA 2IYTA 3IVRA 1XIVA 4DG5A 4IP0A 2HK6A 2M98A 5H16A 2BKVA 1S2LA 4KMMA 1YBMA 1SCJA 1ZUWA 3EPPA 4X6YA 2IUUA 4CG1A 4PYIA 5CFOA 2JVKA 3OCVA 2JGRA 1N0HA 1WMDA 2X6QA 3D6VA 4ZOLF 3M3DA 1KJYA 3V2UA 3T7TA 2HXGA 2ERYA 5IAJA 4BV9A 2H7XA 2HD4A 5KOJA 4DR5B 3AWDA 1EYZA 1ZOPA 3KR0A 3JAMA 1Q7TA 3D8UA 5IM5A 4OI1A 2RCNA 2ZVDA 4TXNA 4ETWA 2FZCA 3A6JA 2O7VA 1F0KA 2A67A 2QZ4A 4PGGA 1ZUHA 2O52A 3K4QA 2GN9A 1NG9A 1EFLA 3QPCA 3EGDB 2W2XA 1SWWA 2JA1A 3FY4A 2WFMA 2ZW9A 1TKBA 3P4XA 1N6LA 4K3VA 4C6RA 2LV8A 3A9CA 5DM60 4EI8A 1WOYA 2EKPA 4FFVA 4KVZA 4RDIA 4ZT3A 3QFFA 4BRSA 1Z4NA 6Q21A 5AW0A 1IOWA 4J0FA 2F8LA 2P7HA 4HAOA 2OZLA 3NBQA 2DFKB 2X13A 3DR3A 3FUWA 2AJBA 4FWIB 4HB0A 1LTKA 5A5DA 3W6PA 1CHNA 2ZQ5A 4BE9A 4BX8A 4LJRA 5EJMA 3K09C 1PRYA 1NW9B 2ZWMA 4G8DA 5LD2B 2X8LA 1XLVA 4Z7NB 2YV4A 4K6KA 4DMLA 5C5CA 4QD3A 2ZJ6A 1OXSC 3ELBA 3F4BA 4M6WB 2PRZA 4B7AA 2X76A 4QTXA 1BKDR 4QTTB 5CNIA 3FZGA 2J5QA 4H2DA 2YH2A 1PFKA 2HXYA 2KM1A 2X6TA 3EVAA 3GNQA 4JROA 5DGIA 3U4AA 5A6VA 5KYYB 2JGDA 2WG2A 3GMIA 4ARIA 1N7GA 5LQSA 4NU0A 4YBRA 3NHRA 2X14A 1O95C 1GARA 3REOA 1Q1ZA 4HXGA 3T9CA 1KEEB 3I1FA 3ZGLA 1MP0A 2JEYA 4JLKA 3UJ3X 3IP7A 4FC6A 4D8TA 5CA1A 4Q82A 3SC3A 4R54A 4AUKA 1QZXA 1HYEA 2ZI5A 3L02A 3P94A 3KQKA 4MKRA 4OI0A 3BMOA 2SKCA 2WJHA 2ZJYA 4IXTA 4RVGA 4RZUA 4UEKA 4BZQA 4RTQA 4ANFA 3OO0A 4NCBA 3FOFC 2RHTA 1H9BA 2HMSA 1SU8A 1ZW6A 2MHCA 3ZWQA 2VP4A 2WTEA 3CKYA 5CLHA 3AFNA 4LY3A 3ST7A 3ZJ5A 2YX1A 2VBIA 1C9DB 2ZRBA 1CIPA 5D3MA 5K3OA 1FZTA 5C53B 3V42A 2WU4A 4NAVA 3VPCA 1YL7A 4KTTE 1B7GO 4MUIA 2ORYA 4TTPA 1JR4A 2C2OA 4CLOB 1W4RA 1I13A 4M1OA 3F71A 1T8UA 3H84A 5K0SA 1NBWB 2AMYA 2CL0X 2FG6C 3C98A 4D3FA 4A8HA 1W88B 3TJZA 1ZY2A 2KQUA 4KE8A 1BGXT 3QU2A 2VSXA 1B15A 2PVCA 3ONWA 4IYJA 3WK6A 3OY7A 5HK9A 1JLLB 2Z8ZA 3MNFA 4CQNA 2JBWA 1DC6A 3KQTA 4BFLA 1VPEA 4RDCA 4DQLA 5FDFA 3L01A 1GPKA 3GJYA 4KYVA 2BEJA 1DPGA 1AC5A 2YCBA 3WBJA 3SQMA 1CZKA 4IDDA 4G8CA 9ATCA 3FNBA 4WLFA 4CN8A 3DOHA 3VDRA 2J6CA 1O6ZA 4C6TB 3SYTA 1T5IA 3KBOA 4U2BA 4Y67A 3CVXA 2AOTB 3F7MA 4Y1EA 1ZDMA 2GM5A 5ALUA 3I62A 5F51A 4IIEA 3N2KA 1HKHA 4NBNA 3HN6A 4EJMA 2BOVA 3CE9A 4QNNA 3VJLA 3T1HB 5HOQA 2PGXA 4KQXA 1NZJA 1RWQA 1NJGA 4TT3D 1U9ZA 1T0BA 2FOIA 4O2RA 4AN1A 4LAFA 1YNSA 1PR9A 2QPOA 1NYQA 1XRLA 3KPVA 4LZJA 3TNLA 3MOGA 1KYQA 1MKYA 3OD5A 3ND7A 2FMFA 4KIFA 5ALRA 1L4MA 4FT2A 2EKQA 4RPKA 3ROPA 4HYYA 3GEMA 3KJFA 3FOZA 1J0AA 1V41E 4FDUA 3ICEA 4DJFC 1PQ4A 2H65A 2OG2A 4N4AA 1COWD 1WXGA 2BFCB 3AEKA 4O4JB 5DU2A 4YONB 2ZS9A 3UK6A 2IDZA 5IH7A 4KDCA 1VYUA 1GSOA 4C05A 3EEBA 2IV7A 3PWSA 3BWBA 5B37A 1DAFA 3I5AA 3SY8A 4HDRA 1DOAA 1N0WA 4KH0A 5EJ9A 2IE8A 1SKMA 3BFPA 2EJVA 4CF3A 1EGHA 2N1BA 3HKDA 3D4IA 5DP2A 4ZCLA 1UJBA 1VCMA 2QZZA 4KLRA 1WABA 1A9TA 2ZCUA 3QF7A 4IDHA 1IHPA 4MPDA 5JD5A 4J3NA 2JANA 3GLHA 1YZKA 3E81A 3QPAA 1Z0AA 1UJ5A 4II3A 4ZVKA 3I6YA 3JRNA 2QI9C 3N86A 4NATA 2WIFA 4RVDA 1WUKS 4BCBA 1WO8A 1YXMA 2IOHA 4X1YA 1UBCA 5DLEA 3DEZA 4JC4A 4OP3A 1YZHA 3TRKA 1CQIA 2CHEA 2WICA 3ICVA 3I04M 5THQA 2Z04A 4HRXA 2V7QD 3D8TA 2PWBA 3AFIA 2GB4A 3OKCA 4A0RA 5FJIA 4OLAA 1HF3A 3FPCA 2PWYA 2PUGA 1B23P 3QBTA 3IMKA 3WLFA 1EHYA 4DIMA 2HRCA 1HZZC 1FYDA 3OX1A 3VC1A 2IBTA 3A0RB 2C2ZA 2NZUG 4O2AB 4D3XA 4AN0A 3AETA 4A1OA 3LF2A 1HQKA 3TOCA 1O8CA 4TYNA 2ZZNA 3LLSA 1WMAA 2XCIA 2PANA 4WJLA 5JCXA 4JLMA 3UN1A 3KG2A 1I3NA 1ZX1A 2VRBA 2Z09A 4K0RA 1OIXA 1C2TA 1RI2A 2CDAA 1DARA 2VSQA 3LKVA 1QWSA 2P67A 3I2JA 3HY3A 3MB8A 3AONB 4F3KA 2NZXA 3C14C 2ZIGA 4LKOA 5EIWA 3H16A 3MAAC 1R9JA 3NOVA 4IIBA 4F04A 4BV2A 2AG0A 4MV0A 4YJHA 4LJKA 1FPMA 4K9LA 5HF8A 4A5SA 4Q3EA 5CD1A 3I09A 3VGJA 5JE8A 1PUXA 3G2MA 5ELMA 1CRQA 3IESA 5JS8A 1EG7A 3V4RA 3R5SA 3CZ4A 4MVJD 1XVIA 4PXSA 4YLGA 3QLVA 3R8CA 3WYNA 4BFCA 5C52B 4KXLA 2AVDA 2C82A 3F5SA 3ZV5A 2VVTA 3HGTA 1WJGA 3IBCA 4HB2A 2RHMA 3FZEA 3GFQA 5LXTA 1XNRB 3IQIX 1PQUA 1SXHA 5TGDA 2NXWA 3RWOA 3GFGA 5FTNA 5LZ8A 1CP2A 4R8RA 2VH2A 4HH0A 5P8WA 4ZTBA 4NR0A 4BRUA 1QWOA 3P9SA 1TK2A 2P3QA 3PZBA 3DO6A 2BBSA 4K6CA 4MTLA 1NLMA 4XFJA 3IL2A 1YUMA 2IXAA 2XB4A 3EJ6A 1T9BA 2PGLA 1L5QA 1SELA 1VRVA 4YRDA 4B43A 5A3QA 3OCXA 5FHQA 1R15A 5T64A 1YTUA 5FWAA 5JSYA 4Q3LA 2AUMA 1LK5A 3Q7QA 2PA3A 2AC4A 3AOEA 3K8YA 5EC8A 3I5UA 1RE0A 4X3CA 1WXFA 4YMVA 1NW8A 2FMIA 4FXOA 1FS5A 2QL6A 4CTOA 4S04A 1H65A 1AD2A 3FJOA 2IBSA 2Q1YA 1LLFA 1SUCA 5I7UA 2O07A 3OIWA 1P2UA 3JVUA 5FUYA 5AI6A 2PX3A 4ZC1A 5I7VA 1A5SB 3DV9A 2FN4A 4LY0A 4JHXA 2HM7A 3HWWA 3JQQA 1TJNA 4S1WA 3RIYA 1EQUA 1LY1A 4DPLA 1ZMTA 1LW6E 5CFMA 4NL4H 1I51A 5TQ2B 2L69A 1BA2A 1T5DX 4K6HA 2QRLA 3PNYA 2EAUA 1O58A 5FD8A 3MWEB 2DTEA 5I8PA 4OQFA 2F3QA 3EZFA 2HREA 3S1AA 4MJ3A 1W8IA 2AOUA 1NLYA 1W9HA 1YBVA 1ETUA 2P3SA 1E20A 2OBLA 4HYTA 2I4OA 5DMXA 1KMMA 2YRWA 1ITZA 2BV3A 5L3SB 1KZ7B 4I9HA 4D4HA 2BHTA 4JLVA 5CA0A 2IHYA 2H06A 3H1TA 3DD5A 3H0CA 1FVFA 3MINB 3TAUA 1MAWA 1GZUA 5JAIA 4GR9A 1NLZA 4G8JA 5AJWA 3WLMA 4PIPA 2C88A 3EXHC 5DNAA 1ORDA 3O4IA 4JZYA 5AQEA 3WLNA 1B41A 2A9JA 1KHTA 4HUJA 4RADA 3VTFA 3C5VA 3HB7A 4YNBA 2W6NA 2IUTA 3BRWD 1KYVA 3O26A 3R5FA 4JHLA 2Q7DA 4ZHSA 2V58A 2WVHA 4EX7A 2XUFA 4GBJA 1N6KA 1QC5B 4UM9D 2WA2A 4I6EA 1BROA 1E1NA 5MGNA 1MHPA 2P9TA 3WJ2A 4BQEA 1QBKC 2UXBB 1E2BA 4YQZA 1L7DA 2QJOA 2PUJA 1J22A 3BQ9A 1N2IA 1LJ8A 1A8QA 3JQ9C 3HB9A 4WZZA 4L5IA 3I5XA 2FFAA 3P5SA 4YB8A 4XJXA 1H22A 2XA9A 5J5VA 5CVVA 2FQQA 2R60A 4GH5A 3BJRA 2GH1A 4XWTA 2EQBA 1ANKA 1E3EA 1KY3A 1NJ2A 1NI4B 1OGYA 1EMDA 3WGJA 4CM8A 5JHHB 5KNCA 2A92A 3HKBB 1C1XA 3UB2A 3NALA 4ER3A 2J46A 2Q3JA 3MSCA 7MDHA 3K0EA 4IDPA 3UK0A 1KDYA 3BTUA 5FUWA 5ARDA 4O4HB 4YXWA 1GTG1 1H6DA 2V7PA 3KR2A 3QFTA 3ZWDA 1DDOA 3LM8A 3H9BA 4JP1A 4BLQA 4PEVA 3FCSB 5F7OA 2F4VB 4URHA 4DNPA 1NOKA 4OK5A 5DGCA 3QOYA 1E62A 4FXPA 5JBIA 2GJ4A 2QTHA 1HNXB 2PXCA 4BZZA 2JFBA 1N5LA 4C7MA 1SD5A 2ZIVB 3QEKA 4X24A 1QHIA 2R8RA 3NHKA 1PSWA 3H4VA 4ITRC 4R2IA 5HQJA 2WSSA 3PPWA 1GTRA 1EUDB 4GHWA 1FXWA 1JPNA 3KLPX 3Q40A 4IQFA 2KX7A 3D7NA 3KTAA 3T7CA 4E09A 4YAJA 5DULA 4NTZA 1K6XA 5EZYF 5I9TA 1MC5A 2XUGA 1T6ZA 2F8SA 1G98A 5ECWA 5LYYA 2XNKA 4UEJA 2LWIA 4CJXA 2O20A 5BWLA 1CUEA 4AMGA 1F48A 3T1VA 3BEDA 3F3YA 1QGOA 5K03A 2FUNB 5DM70 5THXA 3ASVA 3MJDA 4B32A 2IGBA 1WDMA 4L8GA 4U3JB 4LOLA 4AWBA 4G3XA 3KLMX 5IXJA 5MFPA 1V16B 3A7EA 5HQ3A 3LW8A 3HDHA 2J6IA 2KHZA 1V1RB 3FH0A 2NOAA 4NNJA 1RWOA 2Z6AA 3W9BA 3T61A 1PJTA 3GEBA 4FC7A 4E5UA 3FKJA 5T6BA 1NP3A 4ARAA 4BDTA 2IUEA 3E8SA 3VZBA 2DKNA 3ESXA 4WE3A 2P75A 2ZU0C 3IMGA 3TI7A 1P4AA 3VV2A 1CLEA 1X70A 2DT8A 5F1YA 2FEAA 3Q2KA 3QG1A 4BEVA 2ATCA 4JASB 1A8UA 3B3FA 1JJBA 1ZBDA 1L5FA 3MZ0A 1WQ3A 2CJFA 3AY3A 1JV2B 3KDAA 2JRCA 3LDGA 2I1WA 4Q02A 3ZGOA 2FEOA 3COPA 4OXNA 4Z3DA 5JFTA 4JQSA 5HS4A 1KZ6A 3FLAA 3BAFA 4LOIA 3CB2A 3O2JA 1UT5A 1QGYA 4JI4B 4OX9Y 3VBCA 4QGGA 4LY9A 2XBUA 5EE0A 4BLOA 2G04A 3NVKI 1D9ZA 3FSEA 3QUAA 1KPIA 3FLEA 3OC0A 3WVNA 1QS0B 2GM9A 2WA1A 3PXDA 4GICA 4RABA 4DTCA 3CQ9A 4G81A 4OLHA 1MA0A 3WLIA 3TKYA 2BFOA 4WXPA 1D6SA 1IBSA 2WJPA 4L8FA 5K4AA 3U62A 5DNCA 4AKHA 1FRZA 3DUWA 4HRAA 4O2BF 2FZ4A 1X1AA 4JFAA 2FPPB 4ESEA 1KWKA 2NNWB 4Q48A 1MEEA 4CIYA 4KRFA 2JH3A 3E05A 3IOMA 4OQDA 2GCEA 2UYYA 4TLMB 4WK2B 1W1UA 5EIAA 3S2EA 3EQZA 1E3WA 1R5OA 4ZEVA 3N28A 3RG2A 4NK4A 3DT9A 3R0QA 3ZGXA 3QJYA 1U3UA 2C9OA 2BZ1A 1AG9A 5CVDA 3WP0A 4S2EA 1JKMA 4UTRA 4HRVA 1JIJA 4BMXA 5L7TA 3RKRA 3TZEA 3QKRB 1RKQA 3UA4A 1JDVA 4HR7A 3RFFA 4LXUA 2I1QA 3RT9A 4RK6A 3RVPA 3CNHA 3S2IA 4IVPA 4AG3A 4BXOA 3F9CA 2NUAB 1L7OA 3H6HA 1J8DA 2JF0A 4KO2S 3DWFA 1P7ZA 5HFNA 1VP3A 4B5LA 2IH2A 1EVYA 4WESB 4OBBA 3NATA 1GPNA 4GPBA 1P7VA 1FJXA 2GEDA 3KV1A 2C4HA 3TXAA 1N5KA 3CVVA 2J9FA 5GONF 4AMUA 1MX9A 1XVUA 1NBME 3JVVA 3HKEB 5JEDA 4YT4A 3GLIA 1EXMA 3KTDA 3L7OA 3IT1A 4WK4B 2VF8A 1V7QA 721PA 1C1DB 4HI0E 4LCBA 2C5FA 2J3EA 4W8OA 3TW8B 1UKAA 5J2TB 1JA0A 1U2DC 2YVQA 2JHAA 3PLAE 4JK3A 1OLUA 1R1DA 1GKUB 1UBOS 2Y1KA 4AJLA 4EYOA 5BMVF 4Y2PA 4Q4JB 2HJ9A 3EXIB 3TLKA 1KI6B 3WAGA 2A7XA 3EFOA 2PX5A 3FNHA 5F35A 2EJTA 2QE6A 1ULBA 5GGYA 1OWNA 4GM1A 2ZQYA 3TOSA 2JKVA 2PLAA 4A8JB 4NJMB 1N2GA 5CRIA 4Q93A 1F2UA 1M1UA 4ABTA 3KSDO 1K75A 4F1JA 4P3OA 2VP2A 4RKWA 3HR7A 1BQEA 3ROTA 3NP9A 4F5EA 2ZROA 4XYMA 4RXTA 3SHQA 5AVTA 3RVQA 4A23A 1QYCA 3WL7A 5DGXA 1L4FA 2OHJA 3T5BA 4LWOA 4AF7A 3PRKE 3PDCA 3QWHA 4G4GA 3HXKA 3NHWA 4NDZA 4YX9A 5I9IA 1KA9H 3CH7A 5FQOA 1U2RA 3BL5A 3O1HB 5B64A 3SC2B 3UHAA 1IUOA 3UT5A 5JAMA 2BBOA 2R7KA 4MR9A 3PIDA 2JL1A 3LT5A 4LBVA 3UH0A 1VIYA 4ZMRA 2HSJA 1ZK1A 1V4NA 2Q3FA 4M88A 2ZYWX 3I58A 3UM9A 4XVUA 2ZT5A 3ZQJA 1AHHA 3CLRC 4R9NA 3VPXA 5J2UF 2NXJA 3NAQA 2BFEA 3BXOA 3KVYA 3A37A 3DDOA 3QELB 1NUSA 3ELUA 4B2LA 2FRVA 1WTAA 2VDVE 4KH1A 2UVQA 3Q5GA 1Y6GA 3UATA 1W581 3TUJC 2LXNA 2ZRAA 3WL8A 4DQKA 3QXGA 2XH8A 4EJSA 3E15A 2X0KA 3AVPA 3EZLA 1FRNA 1TVKA 1XMJA 4BZPA 2QVLA 4DWWA 1G0NA 5EVCA 4L5CA 1T34A 3W04A 3IRVA 2B4RO 1K7CA 2X42A 1GGVA 1O94A 2Y1DA 1Q57A 3T1QA 1H2YA 3BCRA 4KYUA 3KAPA 1DC7A 3BTVA 3QXCA 3MLAA 2PMDA 3OT4A 2Q9AA 3ZH2A 3T99A 3UGQA 3ESBA 1UIMA 2JDID 3DWIA 4CM9D 3WQBA 4UU1A 3N5KA 3MJ4A 2EP8A 2ZTMA 1WEHA 4DG8A 3QMVA 2WSYB 5LA6F 2NU8B 1IPHA 4CEIA 3AVYA 1DT5A 5C1BA 1V4VA 1YHYA 4HEHA 3RBAA 2Q9UA 1ZOOA 1ZRSA 2WJAA 3BHJA 1B16A 2P4EA 3CZCA 3KB8A 3YASA 2ZE8A 2AD1A 1EK0A 2RONA 3IUSA 2XNDA 3WKAA 3OWXA 5TLSA 1CUBA 1SZCA 2BFWA 1FMTA 5ESRA 4YRMA 1P2BA 3A4TA 4QBKA 1P1FA 1KY4A 4JGBA 4A7PA 5BV8A 2O8NA 4EL5A 4EHJA 4Y0NA 4AP5A 3LQKA 1HE8B 1UPXA 3BIFA 4C1NA 4F8JA 2XT6A 1YR6A 1GN8A 1JPVA 1R8SA 3IOYA 2J3QA 3AR3A 5KJCA 2R1VB 3JQGA 4GU5A 4A6PA 2HGSA 3U16A 1QH8B 1BMFD 1SM4A 2QYSA 4L27A 1V39A 2DFLA 4GDFA 1PFUA 5H68A 1FVXA 1YQDA 1GV1A 4XTRA 2O5VA 1Y37A 3OJCA 4K2HA 3R7FA 4A1FA 4BFUA 5KOIA 2N1MA 3TLEA 1MN6A 2ZK7A 1ESNA 5FTKA 2WM2A 4LDJA 5KKAA 2F3UA 3SOZA 1NBOA 1UZAA 1B1AA 2WWTA 3AF1A 1A7UA 1VOTA 4CKBA 1KYIA 1VHJA 1GTVA 3D59A 4AY2A 2R66A 2DBZA 2QORA 3RC1A 2Q8NA 5ADUS 3I4FA 5ITZB 3PTAA 2VSOA 3HK2A 2QX7A 3RNOA 2HV8A 1X74A 3EMDA 4R9VA 4DBZA 2I4MA 2VYFA 3B1YA 2CY0A 4OUDB 5HGJA 5LCXA 3EUWA 1TC1A 4B40A 4CM4A 1I7DA 4U7GA 3JD4A 5PNTA 3GGSA 3OIYA 5DXAA 2IYWA 3SSNA 3PFWO 3ADKA 4Z0PA 5FUMA 4AKIA 1U4NA 5A0TA 2OGWA 2PL3A 3ANMA 3RJ9A 3WL4A 4PX3A 2UZ1A 3FUTA 1E5LA 2HU5A 1CUVA 1E5QA 1GILA 3VX4A 3DZHA 2W2PA 1K08A 5ES4B 2W2LD 4EJ2A 1BXRA 4HQNA 3ZWYA 4YMHA 2C2YA 3O8CA 3QOFA 4FEYA 4OB8A 4RETA 1EH5A 4O29A 3X1XA 2VPPA 1JIXA 4OYLA 2F9FA 3WK9A 1KVQA 3KQQA 3UENA 2GEJA 1QHEA 1FDIA 3HC7A 3RFXA 2ATXA 1JX6A 2JEZA 4CMJA 4GWLA 2SCUA 2WKRA 3D8BA 4MYTA 4MVJP 3L43A 2FR8A 4PNZA 1QHHA 3LIPA 4ZYVA 4Q3BA 4XCXA 1OHHD 2JCYA 2EFGA 2YHBA 1D0IA 1R6BX 2VRCA 3HGMA 2GT1A 3HXPA 3HZZA 4LNUB 1VSBA 3SF0A 1WB6A 5DLPA 5IG2A 1T3GA 4GRDA 2C8JA 4P34A 5ENZA 3PC7A 5LZ7A 3QI2A 3ZIDA 3RV4A 1ULZA 3OM9A 3U3MA 4H0CA 1S8FA 2X0NA 3HS3A 3H13A 1Z5NA 2H54A 4UCFA 3GDHA 1DV2A 3EHDA 4X93A 1OBHA 5CJPA 3D8RA 3IEIA 1JVSA 5ITWA 3V4OA 5DTMA 1VL8A 5G02A 5IZCA 5IASA 1Z3CA 3E27A 5FEMA 3DB1A 3E3MA 4OV6B 1N0UA 1SC1A 4P3XA 3OLZA 1G8SA 2J30A 1HZJA 2IXDA 3VOTA 4FCCA 3ZGNA 2BMVA 4ZHQF 2BGRA 1YZ3A 4Z1MD 1EGMB 3ANNA 3OOYA 4M9RA 4V0OA 4C78A 3QJ5A 4ZT5A 2DWCA 4XDGA 1YQUA 2BHRA 3UBTA 4KXQA 1GPBA 5EMMA 1RXYA 1XKTA 4EW1A 2WIDA 4WN9A 4MQUA 3QVSA 3D7LA 2YDXA 3DGEC 4YRCA 2IFTA 2IS2A 4B84A 1NN1A 5BMOA 2WTNA 3LY9A 1VP9A 2K87A 2GNOA 3TH5A 4C3VA 2EF0A 2ZSUA 2J4DA 4HAXA 3UMVA 4ZDKA 4TVOA 5DB4A 4I8XA 1HDGO 1KGDA 2G17A 421PA 4ENUA 3H9GA 1NVXQ 3WLJA 1W36D 1IQPA 2AJDA 2P2DA 2YMMA 2ZJBA 5IYZA 5D1NA 1C4WA 4BBZA 4B3TB 2FFQA 3ZLJA 1H0RA 1K8YB 5KNDD 3L6BA 4PWYA 3CF4G 1DDGA 2OXCA 4LBZA 1SIWA 3TXXA 2HZ7A 1RWMA 2GBPA 3PDIA 4GBGA 1KR5A 5I7SA 3SI7A 3MC1A 3S8YA 2GEFA 4FFLA 4IRUB 3QU4A 4R98A 4MDFA 4RPJA 1NW3A 4J2HA 4B3MB 2G63A 3FGZA 3AR7A 3F98A 3IX7A 1RCTE 3PGVA 4J2TA 1MJGA 4J76A 4P9NA 3SDZA 5BV1A 2UVPA 2XMDA 5BWNA 5HRAA 1QLWA 3HKCB 4B6FA 2HT1A 4L5YA 4G26A 5BVGB 1IN4A 3Q9UA 2V6FA 1GL9B 2OCBA 2CHGA 2QT9A 5DOVA 4Q15A 1HLFA 2ADFA 3B78A 4NCIA 1ADFA 2ZS8A 3EBLA 1E2JA 5LBIA 4D4JA 3B2NA 4RTLA 1R3DA 3SYKA 1V47A 2ZULA 3Q0EA 5DHSA 4MICA 1AMOA 1T2CA 4N65A 1PKEA 1E92A 3FE2A 3WYDA 3OPNA 1PT9A 1AKTA 2F6RA 1E8DA 3FDZB 3TTVA 1C9KA 2OO5C 4NICA 3PPIA 4ZQEA 1U7PA 4P22A 4GEGA 1OKKD 1YE8A 4L73A 4OJNA 2YWHA 4KXFB 2NVUB 4CV3A 5B12A 3RJZA 1ZM9A 3VDQA 2C29D 4BQPA 1N9KA 2BFPA 2HA5A 3NDBB 4C9BA 3P19A 4N40A 2OOKA 3R4VA 4MYDA 2AI2A 2AR9A 2VYCA 3OTQA 3P7MA 3RRMA 3R74A 3BXHA 3TINA 4QOEA 1MW8X 1USGA 4NU8X 3G8BA 4CEJB 1M1YB 1BCRB 3KQLA 2AXPA 1XWFA 1SEVA 1HQDA 1T6YA 5GP1A 4QSMA 1PI3A 2JJQA 3N6VA 1M8PA 1W4CA 2J08A 1HMYA 1CRLA 2IDJA 4Y1RA 4AF6A 2R4QA 3NLLA 1G64A 3LWNA 4DIBA 1IY8A 2P65A 1NASA 1KMCA 2YFYA 4UUPA 3ES9A 2GN6A 1GNTA 1IEXA 3NHSA 1QB7A 4DLKA 4QTZA 2ZUSA 1YVRA 1E89A 2FLKA 1OXBB 3E0XA 4BBJA 4PPGA 1OTXA 2PCLA 2BUCA 1ZNXA 2PMFA 4UEOA 1SPBS 2OHGA 1UK8A 3B8EA 4PSKA 3RS3A 3RUDA 2LNDA 13PKA 3LJKA 2F4NA 1E1MA 1FDSA 1YRLA 2I71A 3WBFA 4ES6A 1OFTA 1P7WA 1X8LA 2QX6A 3ABIA 3HQ4O 4KL8S 2VHYA 3E0QA 4F71A 5AW1A 5KU7A 1AKQA 3K8OE 3C3JA 3NUQA 3KYCB 1DKMA 4AZ0A 1NVTA 3TVTA 2GZHA 2FWMX 2KBFA 1SN7A 3LVQE 3PEUA 1DAOA 1EXWA 4PR3A 1FX1A 4PXAA 4TS3A 2JK0A 1LFAA 2PX8A 3GT3A 1JQAA 3HJNA 2DWUA 1KO5A 3FN4A 3SXJA 2PZBA 4OBXA 4N18A 3HI6A 7ABPA 2BFBA 5DLDA 1EVIA 4XEHA 3L7AA 4UMEA 3FRJA 4PG8A 4KPFC 1A3CA 4CKWB 2H5LA 1J99A 3WAJA 5DGHA 3JQBC 3WKEA 3IIIA 3CCFA 2GAAA 4BKUA 4RMNA 2FXIA 3FYHA 4PE5B 1XU4A 3L5OA 2IJGX 3IS3A 1PS8A 3RUFA 2Q4BA 3ZS9A 3CX4A 5KYGA 5JPDA 4YT5A 1LI4A 1FS4A 4DEYA 1F2TA 1PZNA 1U28C 1UKVY 1XO1A 3KT3A 1H5QA 2CE2X 1H1LA 1CUCA 3OOJA 1JAIA 2Q5JA 2NXNA 5A4AA 4ALNA 3RODA 1SVNA 4W8GA 1EFPB 1XP8A 2Q3EA 3K09A 4FHGA 4MPPA 2O59A 3W6ZA 4BDSA 3D4NA 1CSEE 3WHPA 4RACA 1L5HB 1ZOLA 2X1HA 2YV3A 3MQ2A 1Y4AE 1U0EA 1E98A 2WT8A 3NEYA 4WZAA 2G25A 1CY7A 1RLOA 3C1OA 5C4GB 1WUTA 2QVBA 4BX3A 4HDNA 4D9KA 4HFMA 5HOEA 5H8WA 4KYTA 1Q14A 1B8OA 2O1XA 5DCUA 3AI3A 2VR1A 3ESAA 3S40A 1Q0RA 1YIAA 1ZJWA 5B7PA 5A9SB 5AJXA 1Z4IA 4UVIA 3OOSA 1O95A 3QUSA 3Q8WA 3L8YA 3V8MA 1G41A 2JLSA 2Z3ZA 3E7XA 5AI9A 3I72A 4BFZA 3EDQA 1JQDA 1Y3DE 4S0XA 4HJRA 5BT8A 4YFYA 3RFCA 3MCTA 4R7TA 4HWTA 4E6PA 2WKQA 1Z5ZA 2Q1TA 2J3HA 3QGMA 4EF6A 1J8QA 1FC0A 1WY5A 3JAKB 1RFGE 2GERA 4QHSA 1AIPA 1Y6JA 3GZNB 1FFHA 1OD6A 4A2CA 1AE1A 1D5CA 4H3VA 4J07A 4D8UA 3MCVA 1DUIA 3H0EA 2PZMA 4DCPA 4DIEA 5FPKA 4GPZA 4WNYA 3DDCA 1CJBA 3QFCA 2AK2A 2TMDA 5L3QB 4LQ4A 2EBFX 2Z4RA 1I5EA 3QEOA 4UBNA 4EO9A 2BKXA 2DSNA 2C5GA 5DXJA 5CFNA 3H3FA 5HUHA 5LM3A 3O1LA 5KYUA 3SAJA 1I2MA 3UAOA 2GK4A 1FFXA 3H2JA 4G23A 1CUUA 5C1OA 3GNLA 3LXMA 2HTEA 4O6VA 3D1VA 2OQVA 4RKEA 1KBQA 2H2FA 4EFNA 5C35A 1UBKS 1R8QA 4ZARA 1QGUB 3ONNA 2XMZA 4P4TA 4FOLA 1U6KA 2ZUDA 2B82A 2FPIA 3OUUA 4MIKA 3WG9A 4LCEA 2PBLA 1R6VA 3STXA 2NZYA 3U4IA 1KAEA 4DV2B 2P2CA 3TJMA 3KXLA 4C0HA 1ESCA 1DRJA 4B6RA 3WA7A 3HWRA 1D8AA 2QPAA 1A69A 3K96A 1U2SA 4MA0A 4ZT6A 2VHEA 2PL5A 5CGZA 3CRVA 2Q2NA 1VB3A 3OPMA 4RJIA 4CLDA 5HXAA 3LC2O 1XNGA 4IOKA 1SEPA 2Q5OA 4IJWA 2Q4TA 4FS8A 4DFDA 3U7QA 3H17A 3WJ1A 4FR0A 4PZDA 4NCAA 4E11A 3C97A 3CNQS 3V3KA 2X8JB 4K9DA 3E35A 3F6SA 3OTGA 4B48A 4MWTA 2WWWA 1M6HA 4D96A 3L6CA 4MINA 5HWSA 1MJNA 3TUZC 5IBQA 2QP9X 2GD1O 4JLUA 1CY1A 2CT8A 3FB4A 4AG5A 1WF3A 3ZU6A 1ENOA 4TTAA 2X0FA 2VYND 3P2JA 2MSEB 2YIMA 2DE0X 4H7PA 4EF4A 1LSOA 2R5FA 1DX4A 3W1VA 4D3ZA 4OHYA 2FN3A 1QCYA 2JJ8A 3UK1A 2JLCA 2PZLA 3EZNA 2NQ8A 5JXHA 1KZYC 1HSOA 3D6JA 4LSWA 2LIVA 4X3OA 5JQGF 5DLQC 1PT8A 2ISSD 1N3BA 1B6GA 3OOWA 3FPFA 3VX3A 3VJRA 2P4UA 1JRLA 3CONA 4RMIA 5IFKA 4Q4LA 2QYTA 1IM8A 3G2PA 4O33A 2OFPA 7GPBA 1WG8A 1U81A 2YN4A 3GH3A 5IDXA 1H3EA 2FRXA 1RAGA 4U5QA 1P5RA 1AXGA 3O9ZA 3PUVA 4KITB 3I01M 2PLNA 1G63A 2VJMA 2VNIA 2XDWA 5AT1A 1W96A 4RPIA 1I7SB 1N6RA 1XVVA 4RQUA 1Q83A 1X7DA 3VC7A 3ZBPA 4CTMA 3NTXA 2D3TA 2ZXFA 1HZZA 2HW8A 3L07A 1N8NA 4ZYLA 3FHOA 3D6UA 5L53A 3TNDA 3K9QO 3WHIA 4C88A 4D9HA 5CFLA 1CJUC 1M6YA 2D5AA 2E21A 2Q2VA 3H5RA 2PKQO 1N2EA 3WYGA 1VHTA 5JVDF 4KW7A 1TCAA 2K7FA 1NFQA 1U8XX 2DECA 2YWDA 1WOMA 1XZNA 1AZLA 3HG7A 3M81A 3NRBA 2L42A 4MRSA 4RA9A 2QSZA 3M6WA 3FETA 4IXWA 2ZXEA 3AJDA 3HU2A 4GI5A 1BJKA 1EFKA 2W42A 2O7NA 4BVGA 2D2IA 1CP3A 5GOZA 1Z33A 2ZWPA 1OREA 3CZMA 4PYRA 4EABA 4F60A 1XELA 3K4HA 3NOOA 4G1UC 1PDWA 4CDRA 3ZG6A 4ALLA 3IQHX 3GLKA 4R1TA 4AZ3A 1XD2A 1QYWA 5CHEA 2EATA 4PHCA 1E3MA 2OXTA 4ODIA 4ZC8A 2D3WA 1P1CA 2HQ1A 1G1MA 3OZIA 2DOKA 4XB6B 4EB0A 2CZCA 3OZWA 4JYZA 5KOYA 3MTBA 821PA 4JI7B 1Y80A 3CZ5A 4RE6A 4UTPA 1HO3A 5BWMA 4WZBE 2QRPA 2BFNA 3AIMA 4E15A 4FDAA 1A5TA 2EFHB 1LB1B 3KJGA 3HVKA 3Q3EA 4FQ5A 3TQOA 3WLEA 5L40A 2WIGA 3KZCA 4HTFA 4PAMA 4GSLA 3C7DB 3TWOA 3AKYA 3NB0A 5HP4A 1CY0A 3CN7A 3GBVA 4B9AA 1QAQA 7REQA 3LUPA 1E6WA 1MJHA 2Q9BA 4BN5A 4Y2QA 2OFFA 1I33A 1PK9A 2ZTHA 3PUJA 2YKGA 1ADBA 4FZ5A 3ZDZB 1V6CA 3M4JA 1E2GA 3VYSB 4WFQA 2DVMA 1GRRA 4R51A 3TCNA 4D9BA 6PFKA 2V4MA 1Y9AA 1PEAA 4CQJA 4TTIA 4QQKA 3N5CA 1MIOA 4JR2A 4QODA 4B4KA 3LKBA 4TV9F 4HDMB 1USUA 4QQ8A 4LI0A 1Q0UA 4KXWA 3OX3A 3D3JA 3PNVA 4I36A 1GOTA 5BN3B 4AJHA 4PCLA 1UPAA 5FCDA 3H1FA 1S2NA 2X5JO 4IIFA 1FK8A 1W5AA 3V4ZA 1SO8A 2CMFA 4CNBA 4YUWA 2CWDA 2GFIA 4NZ9A 4CTKA 5EVJA 3TNJA 5IMSA 1FP1D 1ODCA 3G3EA 3IULA 1WSDA 4O2BB 5A2QA 2CV2A 2R2AA 3KUKA 1CVRA 3ORHA 4LRTB 3GOQA 1DQZA 4RF4A 5EUQB 4UARA 2X22A 2GF2A 2C2XA 5HM6A 3D2AA 2QN8A 2YJGA 2PZKA 3O5AA 3GK3A 4OMFG 4UVDA 1GPYA 3Q88A 3HXTA 4YP5A 4KV7A 1JLKA 2IY7A 1JEOA 4AWAA 3THXA 4IJQA 4NMLA 3WTBA 2VHTA 3OPVA 3X1YA 1NIJA 4YMGA 4MDHA 1GGKA 3M70A 3B2EA 1FA9A 1Z4QA 1COWA 4OSEA 4RS4A 4UM5A 3W0LB 4D3YA 4ZO8A 1CR6A 1IUPA 2ZB8A 3AFHA 1YRHA 1XTJA 1NW5A 2WRZA 5CR9A 4AJ4A 4F97A 3DFZA 1SULA 1X3SA 4X84A 1KVTA 3IAUA 3TAXA 4QE3A 4XVHA 4PXYA 1TE2A 1JGTA 3AF2A 4HSEA 5GONB 1R5JA 3GLFE 2FDCA 4HWSA 1ZM2A 3TNYA 4FZ3A 1GCOA 1ZNYA 3C45A 1XA3A 2YVKA 2ZSJA 3PI6A 1B8UA 3PVZA 4WVLA 5DZSA 3SQOA 1OTYA 1ENZA 3JYLA 4IHJB 1EHCA 4ZV9A 4EO7A 4ZQBA 4LXTA 1P81A 1U2QA 4CMCA 4M76B 5ALDA 3KPYA 2ZIXB 2NYUA 2A8YA 3D8NA 3JQ9A 4UUQA 4GMFA 1Q0QA 1A04A 3Q0IA 2A5GA 4NZZA 2VHZA 2POCA 4XARA 4RTPA 2IZZA 4NJEA 3FLBA 2GJ9A 1FU4A 4KJZA 5JI3E 4UVEA 3VPFA 2QTMA 3FTDA 4M9XA 5J59A 4MXDA 1LRJA 4BHTA 4XIYA 1M8JA 3H5NA 2D4HA 4MMYB 5K4GA 4EKEA 2JKYA 3BGIA 1O9HA 4H6WA 4IL5A 4R83A 3RRXA 3G13A 3IBTA 4W5TA 2CSUA 1UDXA 1JWBB 2OHOA 2RBKA 2A0KA 3V7YA 1AV7A 3ZE9A 2FSUA 2IOFK 3VHRA 2NIPA 1UZMA 4P2BA 2Q27A 4P6VF 2NYRA 1G4UR 1XZPA 1JFFB 2XGSA 1XXHE 2DKFA 3DLPX 3GJRA 4IEIA 3TM4A 3UJAA 3NDIA 3UV3A 3W8FA 3ZDQA 1XJQA 1YA4A 4MR7B 3WOHA 1NYLA 1GO2A 1P7PA 1C1YA 5KQRA 3ED1A 5FL7D 4BP3A 3II6X 4L4SA 4MYRA 4D0GA 2BL4A 4HDAA 5CA1F 4WBNB 5TGZA 1EA5A 1RYDA 1YNOA 3K4PA 3S81A 2G6BA 2WIJA 3KUCA 3QLUC 3ZU3A 4FK8A 1UIRA 1NIPA 2QYHA 4CE6A 4MVJA 2ANBA 2E4XA 3LFHA 3E9YA 2I3BA 2FJ0A 5G0TA 3AHGA 2C94A 5JQWA 5AR1A 1K88A 1KIAA 2X8WA 1H5UA 4XE5A 1E7SA 1FUEA 2V97A 4WY5A 1M34B 2Y0BA 3BUSA 2H1OA 1LPSA 2FPGA 4QGHA 4I55B 5DFAA 1TECE 4JEHA 4GC5A 5IVPA 1Q1QA 2JGJA 3UZUA 1P6UA 3DMDA 5FPSA 1C8KA 5CGQB 5FAXA 5T4BA 1CQZA 3TECE 1J2EA 2B3DA 4D42A 2Y68A 5C8YB 3K94A 3IBFA 4EPTA 5H3LA 5TNXA 1VIDA 1GXSB 5I9LA 2A9QA 1XCLA 4I3GA 1FP2A 1D2AA 2I8AA 1XHFA 1XK7A 2NU7B 2G4VA 4NC9A 5EXDA 2GFHA 2AWNA 5F5NA 4A8JC 4TKVA 1ISGA 1SBYA 3WNDA 3L77A 4ECAA 4AYTA 1MJ5A 1ZJ6A 2I4LA 2PIDA 4FCVA 2OORC 2HF8A 4HKTA 4P7BA 3KSZO 4KBYA 2X40A 1TT5B 3I6MA 4R3NA 5TGTA 4ZPJA 3HZOA 3NDPA 2EJBA 2P9EA 3TGPA 3I2FA 4BB5A 1NRXA 3LIIA 3SX2A 1L8OA 2DQ4A 1JNXX 5EMNA 2RJNA 2YJ4A 2ZYTX 3UVEA 4ZMBA 5LOVA 3W9SA 2VT6A 4DV0B 5MN5A 2BP7A 4YAFA 1Y8AA 3K1TA 4OY3A 1CLUA 1OX5A 2R6CA 3GV0A 5L3ZA 5A7FA 1S2MA 1X7YB 1XEXB 3MMNA 3BSSA 4M8IA 4QUBA 5LUBA 1MAHA 1OE0A 1OQAA 2DBVO 5C31A 3RUHA 3R20A 4CL2A 1LPMA 2GCOB 1CERA 3CUWA 4P1ZA 2CXQA 2XVZA 3TEMA 3RS7A 1RYHA 3NHAA 3KAQA 3VHXA 5LQJA 1OJLA 1RYZA 1PYGA 2P5TB 2OCGA 4RL6A 4I50B 4UD2A 4YEDA 1G5PA 2HHCA 3AF0A 4J03A 3DAYA 3PB3A 2JFOA 3ZX5A 1FMFA 5MFZA 2ZR8A 3U61B 2EFYA 2G1KA 3DEAA 3MG9A 5DHTA 5IVIA 4HC4A 4QGFA 1HE2A 1JIIA 4I5EA 3FUXA 5KYNA 2Y92A 5DBFA 1H94A 2JFYA 3CUUA 4KVAA 4V0MA 1OR8A 1OXXK 4KN5A 5BN5A 5JAUA 2H4YA 1ONOA 2WTBA 1SVWA 4QOFA 2Z08A 3IR5A 3EFBA 1G2OA 4EG7A 2ATIA 2P9GA 2RH9B 4LC9A 3HY4A 3BRWA 4PTZA 2AS0A 3PK0A 1BS9A 1RBQA 1Y8RA 2W2QA 2YWEA 3FOAA 1US8A 5LQKA 2H17A 2WJYA 4TTQA 2HCTA 2ICAA 3PNLA 3BH7A 1U0NA 2QW1A 2V74B 3O8LA 2IA5A 1VE5A 3RSSA 3R3ZA 3GI1A 1C9NA 4YRLA 4YRSA 2HUPA 2X7XA 1RWBA 3OBIA 5LZ5A 1D09A 2X7JA 3K9HA 5KPJA 2QNRA 1Y7TA 3MWKA 3Q10A 5J5CA 2Y1GA 4W7IA 1U2DA 5A9TA 4J9UE 221PA 4ZOBA 1SJ9A 2RMKA 4OFWA 5F9MA 4HB4A 2H1LA 1W2HA 4DKXA 3EH2A 2AHOA 3GT4A 5EWLA 3U7JA 4CKYA 1FVHA 4NONA 3DEJA 3EVNA 1BXZA 3L6OO 4IPTA 3C3KA 1AGNA 1ST3A 1QVVA 1Y5LA 1NC1A 4XYBA 4UHHA 5DBGA 3M6VA 3SHWA 4CG3A 2A9KA 3LX6A 1EUCA 2OD9A 1JEYB 4YJKA 1NFFA 1KYXA 2Q8QA 3DE1X 1YGPA 1WMFA 2QQ0A 4PC6A 2YFQA 4EBFA 2O3UA 4CMIB 1WTCA 1Y4ZA 2CUNA 1CU1A 4LCJA 1O54A 1IY2A 4LBWA 3C3PA 4UM7A 5J3JA 3QOXA 4N54A 3K1JA 2XCTB 4YP1A 1M2OA 5CFPA 5JXGA 3KQPA 3GD5A 2BVNA 2ZLBA 3X43A 5AVUA 1SHZA 3H4TA 3BKXA 3QKSB 1LD3A 2P11A 2B1RA 1PS9A 3RROA 5B55A 1MORA 1BN7A 1ZVMA 3L1IA 2V7VA 4H15A 4RO0A 4C0WA 2IP1A 4DXAA 5K8JB 5BURA 2OGTA 1XHEA 2X5KO 2QHXA 2HO4A 2X4DA 2C1XA 2NV2B 4ML3A 1P33A 2O0HA 4NDNE 4ZQIA 4Y0AA 5TQVA 2PXAA 3IHWA 3FIJA 2OECA 2SKDA 3WL6A 3CLKA 3NTQA 3AH8A 1ZD1A 5BR4A 5FLYA 3AY0A 3CWQA 3H2YA 1JFTA 1XR3A 4XX0A 1NAHA 4JB0A 1B8VA 4BAZA 1IN6A 3AKZA 1ZWLA 4QO7A 2Q0XA 1DC5A 2FW1A 1J0DA 1O0CA 1P6XA 3DVLA 4DWJA 2FWBA 3P97A 5AICA 4EARA 1PDVA 2LGJA 3NBUA 4JLSA 1RKBA 4JSYA 1U2PA 4RHEA 2PDAA 4E31A 4RTRA 3L49A 2BTOA 4TMVA 3VO2A 3KQVA 3F6RA 4RK7A 2VSNA 3UYLA 3ZWWA 4LF6B 1NU8A 3BRSA 9ABPA 1MJFA 5IBPA 3DDWA 3W5AA 2PGAA 5CH3A 4CM7A 4D79A 1QF6A 1N9ZA 2E48A 4DC1A 1NQUA 3V80A 5HZMA 1EE9A 3ZZTA 3HM2A 3RK4A 2BZSA 3PYXA 3JWJA 2FI1A 3HB5X 4L3VA 4XOUA 3UEOA 3KOZA 4I4IA 4Y3UA 4IR7A 1AUPA 4NYIQ 1ZNWA 3NBYC 4NCNA 3R1IA 1QCZA 2GK3A 1EGVB