1WHTA

Structure of the complex of l-benzylsuccinate with wheat serine carboxypeptidase ii at 2.0 angstroms resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
GHAADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine carboxypeptidase
molecule keywords SERINE CARBOXYPEPTIDASE II
publication title Structure of the complex of L-benzylsuccinate with wheat serine carboxypeptidase II at 2.0-A resolution.
pubmed doi rcsb
source organism Triticum aestivum
total genus 82
structure length 256
sequence length 256
ec nomenclature ec 3.4.16.6: Carboxypeptidase D.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1whtA00
3BDVA 1AX9A 2Z5GA 2ZYHA 5LZ9A 2C58A 1FFAA 3U0VA 2J4CA 3VVMA 3C8DA 2WTNA 1MX9A 3PFCA 2QR5A 4BCCA 4N8SA 1VE7A 4BC1A 1UOOA 1DQYA 5EIAA 4BYMA 5DWDA 5D3KA 4D9JA 4ROTA 4F21A 2RI6A 4K6HA 4IQ4A 4W1RA 3VVLA 4UHFA 1E8DA 1QFMA 4MEBA 4ITVA 1GPLA 3C87A 2HA4A 3OC0A 1ETHA 4JYPA 1G5FA 4KAJA 4LYEA 4UBLA 5E2IA 4MQMA 5T4BA 4DNPA 4Y2SA 2XMDA 1H23A 1B6GA 5BWBA 3BF8A 3VDXA 1UK6A 4B6GA 1RP1A 2PSEA 1ODTC 3PE6A 2OGSA 2OCIA 1Q0ZA 3HJUA 5ALKA 1EDBA 4B9AA 1SCKA 1MJ5A 3C5VA 1LNSA 1SOMA 3FYUC 3ICVA 3UUFA 5FPPA 3BE8A 3HABA 4B9EA 1P0QA 2RHTA 3QPDA 1EH5A 4W1PA 3LLCA 2QS9A 2JF0A 3EQ8A 1LPPA 2OGZA 3SK0A 5ALFA 4NZZA 1XZIA 3LIPA 1MN6A 3GROA 4Q1VA 5T4EA 1XLVA 3I6ZA 2AJ8A 1QE3A 2RIPA 1USWA 5IVHA 3SC2A 2XUOA 2BKLA 2X5XA 1EDDA 1CUBA 3FVTA 4JEIA 4M0MA 2RAUA 2H7XA 3DS8A 1LBTA 2ZYRA 4MYSA 3WL8A 5CH5A 4I3FA 4X85A 3A2NA 5ALSA 1AQLA 1XQYA 1UFOA 3Q0TA 5EFZA 1W75A 3ZV7A 1OXMA 2WSLA 2XUAA 1JKMA 3I2FA 2BJHA 5K5EA 4NVRA 5DYTA 2XUDA 1XRLA 1XRRA 1F0PA 2AJBA 3WWEA 3R40A 4KEAA 3PDCA 5JAHA 4U2DA 1F8UA 3ANSA 4BAZA 1CUDA 2ZJ7A 4Q34A 1FFEA 4X95A 4KR0A 3H2IA 4PNZA 4QWWA 3S8YA 2HA2A 2EEPA 2B20A 2DQZA 2ZVDA 5AKIA 3FYUA 2PSHA 3ESDA 1VE6A 1TRHA 2WIDA 5DTJA 1XRMA 3G8YA 1QIDA 4H7HA 1K63A 2WJ6A 2XMGA 4UHEA 2C0PA 3C43A 1R88A 1ZGCA 3DL4A 5FPQA 1A7UA 3QITA 1O6FA 5BWCA 1QIFA 4GWLA 2R11A 1XZBA 1E66A 4C89A 3RARA 3W2TA 4AO6A 3EF3A 4Q82A 3I2HA 1A8QA 1GQSA 5T4HA 2QRUA 3PI6A 3DQZA 1MX5A 2Y6UA 1JMKC 1AC5A 4AZ3A 4G8CA 1UKBA 4HRYA 5FUMA 2WUFA 1C7IA 3WI7A 2DHDA 5CT6A 2XUJA 3R3YA 4GHWA 3VKFA 3W9UA 3C70A 3I6YA 5ALRA 5I8PA 4QA9A 3HACA 4Z49A 2ES4A 1ZI6A 4J0IA 5A7HA 3CCBA 4KACA 3KOOA 1H2YA 5DLPA 1TQHA 3STXA 1QLWA 2JGFA 3MUOA 1YA4A 5HKBA 4H7DA 1MAHA 1H22A 4YASA 3W04A 5DNWA 5HF9A 3F98A 5AK3A 4ZXFA 1UZAA 4GEGA 5ALJA 4EY7A 5EHZA 5KBYA 1E8MA 2HU8A 2WU4A 3JYHA 5JADA 5A2GA 4PW0A 2B61A 4WDRA 5AKEA 3I1YA 2WFLA 1HDEA 2XUQA 2PUJA 3G0IA 3D4LA 2H9YA 1YS2X 4UFOA 4QLAA 1K5PA 3TGLA 1R3DA 2O2GA 2G4LA 4UUQA 2W22A 4G5XA 2C4HA 3QH4A 4WFJA 3T4UA 1N1MA 4JYMA 3H18A 1KU0A 4CG1A 2VJDA 1L7AA 1XLWA 1TCBA 1U65A 4B0PA 1CFJA 3H2JA 1XRNA 1CQWA 4V2IA 4W1QA 1QGED 3ESCA 3ANTA 2GBFA 1MTZA 2WTMA 1DX6A 3PICA 2XQGA 5A62A 3O9VA 3QVMA 3IB3A 1F0NA 5YASA 4A16A 4AO7A 5K3AA 2GBCA 5FV4A 5E4JA 1IZ8A 4MEAA 3AFIA 4FTWA 1VLQA 4HXFB 4AN1A 1A88A 1LPNA 1SCIA 4I4CA 1LPBB 1VA5A 1TCCA 5K3CA 1A8SA 5AJHA 3ICWA 1LPOA 1VOTA 1X70A 3O0DA 2XUPA 4QWMA 5EGNA 1XRPA 1MPXA 5LLSA 3AZQA 3CN9A 4H77A 1VJ5A 4HXEB 2HFJA 5FP0A 1EK2A 3VJLA 4DTCA 4Y9SA 3OURA 2WFMA 4GLBA 1MU0A 5EIEA 3U1TA 2WG0A 3DYVA 4EUSA 2DQYA 5AM3A 2CBGA 2I03A 1R4ZA 5FRDA 3IBTA 2HM7A 2AJDA 5CT5A 3E3AA 2ONCA 3WIOA 3GBSA 4GECA 5KWJA 3QMWA 1AZWA 5HF8A 3DCNA 4G4IA 1AUOA 4FLMA 3D2BA 4GW3A 2WG2A 1CUXA 5J3JA 3FCYA 1J1IA 5LKAA 2I3ZA 1S8OA 4P92A 2FJ0A 3N0TA 1LLFA 1WHTA 1ACLA 3K9BA 2GBGA 4J0GA 5K3BA 3WJ2A 1GZ7A 2XLBA 3I6MA 4FNGA 5D3ZA 4YK7A 1GQRA 3R41A 2HRRA 3BL8A 1CUYA 4L72A 3B5EA 5LP1A 4P93A 1O6GA 1MO2A 2BAGA 4E14A 1PV1A 1SCQA 1QONA 3EQ7A 2EDCA 5C8VA 3FVRA 2H7CA 5AIBA 5IKXA 4KE6A 4JH0A 2QXUA 2W6CX 2Y2UA 1EX9A 1CQZA 1ZOIA 3K6KA 4BBZA 2PSDA 3DKKA 3DNMA 3BJMA 5IH7A 3D0KA 3MGAA 1DWQA 5ALZA 2OGTA 3O4GA 2WQZA 4TVKA 5CH8A 4BB0A 2XB6A 3OPMA 4CIAA 4FFWA 5H3HA 5DNVA 2QJRA 3A6ZA 1FFCA 3WMRA 4G9GA 1J2EA 1XZHA 3IULA 3QBJA 2VQ6A 2WIKA 2VATA 4OYYA 2G5TA 3IIIA 5DYYA 4TGLA 4CCYB 5HQ3A 4GI1A 4N8EA 3STWA 1YB7A 3WL5A 1Y7IA 3HSSA 4J0KA 1LBSA 2ZJ6A 3WZMA 3G0DA 4UBNA 3HXKA 2OCGA 3F97A 4C01A 5CMLA 1XQWA 4PSCA 2BCEA 5JAPA 3WYDA 4A23A 1L7QA 4OD0A 2BGRA 3R0VA 5LZ7A 1XFDA 4ZV9A 2XUIA 5A7FA 1R1DA 5ALPA 2QJWA 5K3FB 5LYYA 4HZGA 3R3VA 3R3XA 4UHDA 4C4XA 1YB6A 3K2IA 5JYCA 4BZZA 1WB6A 1UK9A 1QO7A 4MYDA 1CUCA 1ZI9A 2JGJA 1X2BA 1BS9A 4RNCA 3D59A 5F4ZA 4L0CA 4QDOA 4KE7A 1P0IA 1P0MA 3QZUA 2WFZA 1WPRA 1WPXA 1HL7A 1E5TA 3WKCA 4IH1A 4M0EA 3O4HA 3G02A 3AILA 4PSDA 1XZMA 4J03A 4Y2PA 3L1IA 3RK4A 2O2IA 1EVQA 1YA8A 5CURA 1W1IA 5T4FA 4NS4A 4KJXA 5AHXA 4PV7A 4AO8A 4CI9A 3HZOA 4DSAA 2WJ3A 1IUNA 3IUJA 4CG3A 2O7VA 2XT0A 3ZLUA 4U2CA 4AMZA 4C88A 3DDUA 4J7AA 5AIAA 2VJCA 5AICA 2CZQA 1GXSA 3WKDA 3DL7A 3G0GA 4RGYA 1QIMA 3B12A 2PU7A 1IZ7A 3G0CA 4X90A 4J0JA 2YXPX 5AI4A 2XMQA 4FDMA 1QJ4A 4BE9A 3RKSA 4YX9A 5JIBA 3BXPA 3S2ZA 3GUUA 2JGIA 1VZ2A 3FWHA 3UMJA 2XMBA 4WY5A 1P0PA 2PSFA 3F8SA 3PF9A 2J3DA 2GYUA 4FMPA 2VJBA 2ACEA 1R9NA 3WK7A 2XUFA 1E3QA 4EBBA 1VKHA 5CT4A 4JUIA 3M3DA 5AM1A 1XZCA 4B80A 4OU4A 1NU6A 2PPLA 4UBJA 2AJCA 1VXOA 5CT9A 2XMSA 1GPKA 4OYLA 3W06A 4KE8A 2H1IA 1PJAA 4B85A 3WWDA 5HFAA 5A6VA 2Z3WA 1N5MA 2WUGA 2WUDA 2BUCA 2E3JA 3PUIA 5HK9A 1BROA 5E4YA 1CUFA 1B41A 3C6BA 4DSZA 1CUJA 2J4FA 2Y6VA 2VJAA 3RLIA 1W4LA 2VT6A 5I7UA 2B9VA 3PF8A 3O95A 1XKLA 3WL6A 2VA9A 5CXUA 2XQKA 3G9XA 1X2EA 1SC9A 2Z8ZA 4B81A 4H18A 3RM3A 1K6EA 1CUZA 4BVLA 3FYUB 3H2KA 3C6ZA 1ZIYA 4WJLA 3CN7A 3HEAA 3N2ZB 2C7BA 3C8HA 1EVEA 2WLSA 5ALUA 3EIOA 3KDAA 4XIIA 3AIKA 3VJKA 3FSGA 3ILSA 4ZREA 5DJ5A 5CTAA 4G4GA 1XZDA 3L1HA 4IHAA 1J07A 3X3HA 4DNFA 4Y2UA 5D6OA 4BATA 4OB6A 3DJYA 4LYDA 2YYSA 4DM7A 5ALNA 2Z8XA 3WK9A 3GELA 2DCMA 3HRHA 3WIBA 2PM8A 2X76A 3ZWQA 1XROA 1WHSA 2Y2VA 2DHEA 1ZI8A 5AH0A 4BZWA 1PFQA 5ALHA 1QTRA 3WJ1A 3O4JA 4K6KA 1C4XA 3FYTA 3G9UA 2QKYA 3HI4A 1EXWA 2PL5A 5ALQA 4BRSA 2QT9A 4X6YA 3FLEA 5JASA 2JGKA 1JT2A 4MQLA 4X97A 5LZ2A 1GKLA 2C5FA 1TK3A 1QIIA 3DD5A 1AURA 2XDWA 3IUNA 5AK6A 1XQVA 4PO3X 4WDQA 4MWSA 3GFFA 5EIHA 1JJBA 2I78A 3DKRA 2WFLB 3H04A 4WY8A 5JZ9A 3OG9A 1F6WA 3BDIA 2WILA 5D7BA 3SX4A 1CUEA 3T52A 4FLEA 3O9MA 2OQIA 1ZD4A 3Q8WA 4BE4A 4DGQA 5HF5A 5AI6A 3WQHA 5LZ5A 5BV7A 2VSQA 3M83A 4CIBA 3QYJA 3C5WP 1BCRA 4L9AA 1UWCA 1CVLA 1DWOA 6YASA 1TCAA 1Q84A 2ZJFA 5LIPA 4IH9A 1G42A 3STTA 3AUKA 4U2FA 5AK5A 3TJMA 4W9RA 5LKRA 2JBWA 4AN0A 4K5QA 4N5HX 4J0DA 1YASA 3E4DA 3V1NA 1HBJA 4W1SA 3H1BA 2V9ZA 5HCUA 4LIPD 3QM1A 2PUHA 4XJVA 1QO9A 1CUVA 2RHWA 4N5IX 4KRXA 3F96A 3H1AA 1W52X 4ARAA 3YASA 1UK8A 1CUUA 4DMHA 2PU5A 1DINA 4K6GA 4Y7DA 2PVSA 2XLCA 4AMYA 4HVTA 2FJPA 1A8UA 4LXHA 4XWGA 4INZA 4X6UA 2HA0A 4C87A 2HU5A 4LHEA 1H2XA 5JATA 1CUSA 4FKBA 3E1GA 5HZGA 3KXPA 2HA7A 1TIBA 1W6RA 1EI9A 4P9NA 1GGVA 1NX9A 3I1IA 1JJIA 1DT5A 4IH4A 5ALDA 3QMVA 2CKMA 2OCLA 1AGYA 1LGYA 2JGMA 3FBWA 4B83A 4AXBA 5LZ8A 4G4JA 5JARA 4QE3A 4F5ZA 5HK8A 3A70A 3C6YA 1BCSA 1LPSA 4PF1A 3WWOA 4OUKX 4DNQA 1ISPA 4FFVA 4EB0A 3HYSA 2XUKA 1Q0RA 1YAJA 1EK1A 5EHQA 1QIKA 3ED1A 4JNCA 4O08A 3F9CA 4PSUA 5C81A 3IDAA 2J3QA 1ZICA 2QM0A 1DX4A 2XQFA 2BFNA 4Y2RA 2D0DA 4BDSA 5CBKA 1E89A 1CIJA 2Z3ZA 4AB1A 2OCKA 3WKAA 3WK6A 3P2MA 3KD2A 4BAGA 5ALVA 2VAXA 1BRTA 4Y2JA 3WLAA 4H7EA 5EHNA 4MJ3A 1DTEA 2WHPA 1QOZA 5AKHA 3FLAA 5DNUA 1WCYA 1M33A 1HLGA 4WCVA 5ALXA 5CRIA 4BP8A 2QXTA 1FFDA 3DEAA 3OOSA 4OB7A 3D3NA 2XI4A 4BCBA 1I6WA 4X93A 3L1JA 2QMQA 2VAVA 4X92A 2O2HA 4CCWA 4Y2XA 5JAOA 2DR0A 4I19A 2PBLA 1R50A 1THTA 2HHAA 2P8SA 2CB9A 2WHQA 3CXUA 4Y2TA 5HQ3B 4UBOA 3G0BA 5ALOA 1ZIXA 5DTIA 5AM5A 3CCCA 1BN7A 1EA5A 5AKKA 4F60A 2AJLI 3OTQA 4U2EA 3WK4A 4FBMA 2HA6A 1HPLA 3AZPA 1OILA 4X94A 5SYMA 1WB4A 4DLNA 5C8XA 5CH3A 1ORVA 2CUTA 5AKLA 3LP5A 2ROQA 1RYYA 2WUEA 5JD6A 1U4NA 1EB8A 4KAAA 5AK4A 4X00A 1XQXA 4ZWNA 2V96A 5HKAA 5BOVA 1BEEA 1LZKA 5FXMA 3PUHA 5C8ZA 4Q3OA 3KWJA 4KYVA 2R8BA 4J3JA 1K4YA 2DSNA 2PSJA 3JW8A 1XZJA 2QZPA 4DMCA 3I2KA 3BIWA 3FSGD 5E4TA 1RWQA 3I2IA 4GBGA 4UBIA 1ZD3A 2OPHA 3NWOA 4H7IA 3VXKA 3BF7A 2QTBA 2VF2A 2JGEA 2CMFA 3OM8A 3WWCA 1TKRA 3BIXA 1CRLA 4U2BA 5KREA 1G66A 2X8BA 1XZKA 1UXOA 5AKZA 5EHXA 2XUHA 1MNAA 4QNNA 1L7RA 1VZ3A 4MXDA 1JMYA 4Y2YA 4E15A 1BN6A 1TAHA 1SFRA 3AJAA 2YH2A 1Y37A 4HS9A 3LIIA 5AP9A 5SYNA 4DYHA 4X6XA 3WWPA 2IIVA 1CUWA 2ZSIA 1EHYA 3G9TA 4RE6A 4LXGA 4RPCA 3GA7A 4ZGBA 2ECFA 5AM2A 3C45A 1XZLA 2I3DA 4F0JA 3FOBA 3ZLTA 1T2NA 2RONA 1BE0A 5K3DA 1DT3A 3H0CA 2QUAA 2G5PA 1VXRA 1C7JA 2JGLA 4Y2VA 5AOCA 2GZRA 5AOBA 3TRDA 1JFRA 2ZSHA 1JI3A 4UPDA 2DFPA 4Q3LA 1KEZA 2XUGA 5CXXA 1ORWA 3WKBA 5I9IA 1IMJA 4U2GA 2WJ4A 3A2MA 2CJPA 2V98A 1QIHA 1QIJA 4H35A 3MVEA 4B0OA 1D07A 4B7ZA 2HU7A 4H0CA 2VT7A 4UFNA 1IVYA 2WM2A 1Q83A 4EHBA 1THGA 1FFBA 1YS1X 4J0CA 1H2ZA 3NUZA 2OXEA 3IURA 1J06A 1N8SA 4UBMA 3BJRA 4BVJA 5ALTA 5C7YA 3H17A 3QPCA 4DIUA 1U2EA 3DLTA 1T4MA 3H2HA 1GPNA 3I2JA 3VISA 2OQVA 3H19A 2QVBA 5ALLA 3R3UA 2Y1KA 2C5GA 3WA7A 3HLKA 4K2AA 1UKCA 5AI0A 2WU3A 4QDXA 3STVA 4X91A 1CPYA 1WM1A 5AKGA 4G9EA 4CFSA 1JU3A 1ZD5A 4KE9A 4OPMA 1DQZA 5FLKA 4ZRDA 2WKWA 3D2CA 2PX6A 4GDMA 5JD4A 3FLBA 1YCDA 4H7KA 2ZYIA 3NGMA 3JWEA 5AKXA 4EY8A 1IUPA 4BC0A 3V1KA 4FNMA 4FWBA 1XZEA 5ALMA 5IVDA 3V1LA 4UHCA 4UHBA 4QZVA 5K3EA 4EZIA 2EDAA 4QDTA 1WOMA 1WB5A 3HC7A 4HXGA 4HTAA 1GT6A 5AI8A 1XRQA 2FX5A 3ESAA 2RGUA 3V1MA 3DOHA 5DYWA 2JIDA 4G1FA 5JZBA 2WHRA 1AMNA 3MUNA 1CLEA 2OAEA 4DMKA 1HQDA 5KWIA 1OCEA 2JEZA 2VEOA 2ZYSA 3KWFA 4Y2QA 2G63A 1EB9A 2FUKA 4EY5A 1XLUA 4IO0A 3GZJA 1QIEA 5AM4A 3WL7A 4FHZA 4EY6A 3SWWA 1NU8A 3H2GA 3TEJA 7YASA 3V9AA 1BU8A 2WIFA 2XE4A 4S0XA 1W76A 5ALEA 4ZI5A 1Y7HA 3UUEA 1MT3A 4X71A 4X3CA 4ETWA 2DHCA 3LS2A 2GBIA 2ACKA 5IVIA 4H7JA 2BGNA 5EI5A 4WFIA 5AOAA 2HL6A 5ALYA 1MAAA 2LIPA 5CT8A 3STYA 2ORYA 1U8EA 4BTLA 1UOQA 2OLEA 1FJ2A 4QLOA 4KRYA 3WYNA 4MWTA 5JAUA 4J0HA 4E46A 4Q3KA 1XKTA 4WFKA 4ARBA 3AZOA 1ODCA 1UK7A 2GYWA 5AKJA 2JEYA 1CEXA 3ZI7A 3WK5A 2AXEA 1JU4A 2CEKA 1QFSA 2K2QB 4BTVA 3D7RA 3I2GA 2YASA 1CUGA 2XMCA 4AX4A 4YPVA 4N8DA 3PFBA 2HA5A 3ESBA 2QOEA 4CG2A 3KSRA 1UKAA 3R3ZA 1KU6A 4DNOA 2HA3A 4BDTA 1N5RA 2XQJA 3B3QA 3E0XA 3EBLA 1QTIA 2XMRA 4A5SA 3NOXA 4GXNA 3I28A 1ZD2P 5AKYA 1ACJA 2VTVA 3O4IA 3ZPXA 2C0QA 4OU5A 4UBKA 5AO9A 4B82A 1G4HA 3WKEA 1XZGA 5FOQA 4HRXA 2B4KA 5ISMA 3FAKA 5HF6A 5ALWA 3W05A 2GZSA 3DOIA 3BWXA 3D2AA 4OCZA 4BVKA 5LZ4A 2V97A 5JD5A 1JJFA 5AI9A 2HFKA 3IA2A 1ZGBA 4W63A 4QDZA 5IVKA 4FBLA 3C6XA 3VJMA 4B84A 4QDUA 2D5LA 2IITA 3IVMA 3AIOA 1CUHA 2OG1A 2GYVA 1CR6A 5FDFA 1BEZA 4QEKA 1IUOA 4UHHA 5CW2A 3QMMA 2XMZA 3M82A 4BP9A 3STUA 3V48A 2UZ0A 3F67A 4TPKA 4H7FA 5ALGA 3AIMA 2HRQA 2OAGA 4NMWA 1DWPA 2BUBA 4AQDA 5ALIA 2Q0XA 1YR2A 1EINA 4RE5A 3W9BA 2IX9A 4EY4A 3A2LA 4C6HA 4G8BA 1VA4A 2NW6A 2WHPB 4LKOA 1QIGA 3QPAA 3WK8A 4UFPA 3G7NA 2WIGA 3ZLVA 5JZSA 5JANA 1AKNA 4LXIA 1E8NA 1K8QA 2WG1A 5HFNA 4BRZA 4DMFA 4AZ0A 1UOPA 4C4YA 4Q05A 4OB8A 5AM0A 1H2WA 1FSSA 4XX1A 2HDWA 3WZLA 1CUIA 5AI5A 4ZV7A 4OSEA 1MNQA 1LPAB 3EQ9A 1XZFA 4M0FA 4L3WA 5FKJA 2WIJA 4FLFA 3IUMA 1ZJ5A 2HADA 1QZ3A 4FOLA 4PQEA 3FCXA 4E11A 4BCDA 3M81A 3LCRA 3DYIA 5A7GA 3D5EA 4C4ZA 1CV2A 4KAFA 1DU4A 2H7YA 4CCYA 3IUQA 5ESRA 3WA6A 4X7BA 1LPMA 4BAUA 1YSCA 1Z68A 4EA6A 2HIHA 1ZJ4A 2XQIA 1CUAA 1R9MA 3G9ZA 1EDEA 1MX1A 4G8DA 5A71A 2QUBA 4HAIA 2O7RA 1ODSA 1HKHA 5JALA 1GKKA 3AINA 1YAHA 3FNBA 1LZLA 2PKYX 4P08A 1XZAA 2BUAA 5K3FA 3R3WA 1UT6A 4XVCA
chains in the Genus database with same CATH superfamily
3BDVA 2Y1OA 3LG2A 3OFKA 4YLGA 3WSWA 1AX9A 1ZK3A 2B0CA 2Z5GA 2ZYHA 4QX6A 3OJEA 4ZALA 2V4MA 3CLSC 1M6VA 1L4MA 3GEDA 4B6QA 2GM3A 1U3GA 4PAGA 3Q7EA 2O3SA 1U3WA 2J4CA 1R9GA 2AG6A 2GDZA 2HBQA 2UZAA 4YT8A 4RULA 3NOQA 5E6SA 5EXDA 4F93B 4PTLA 1JR3A 4P0PB 2QR5A 3DD1A 2VEDA 4MR8B 4BC1A 1GZ4A 5P8WA 1TJ3A 2WA2A 4EECA 3EZ2A 1HURA 2C3PA 2X2FA 1P8JA 4P98A 4A6EA 4CKCA 4CU2A 3MQ4A 1YUBA 2VFAA 2MHCA 3PPYA 4IDPA 4CFZA 4D9JA 3U7HB 4B3RB 1ORRA 1FNBA 4TVOA 3BMQB 3F7OA 5JO0A 1SVUA 2Z8YA 2C8VA 2OHVA 4IQ4A 1U5AA 4RY0A 4A8HA 1REQA 3HHPA 1FSFA 2PGNA 3HKEB 1G1MA 2P9JA 4TS3A 4RK6A 1GPLA 4JSYA 2GAJA 2YHSA 2PZ8A 1GR0A 2AFHB 2AXNA 3CFYA 2CXRA 1ETHA 1L7XA 1CS4C 4KAJA 4LYEA 1BW9A 1O3YA 1N6PA 3EH1A 3IDFA 4KUGA 2C9OA 1UMCB 1YVUA 5AQ1A 4J6EA 1SBYA 4FHEA 3QVLA 4D98A 3DULA 2M6LA 3OFJA 4DNPA 2REQA 1DTWA 4HH0A 4J75A 4Q4AA 2BN4A 2G28A 3W5JA 3BF8A 1I10A 3E2MA 2FPSA 5KYNA 1JHQA 3VDXA 3MD9A 4ND4A 5HA5A 3S2UA 5CK4A 4MUIA 1D8TA 2PSEA 1QK3A 4IFTA 3MMSA 1FY2A 1ODTC 1V4BA 2OBXA 3BJEA 3IMGA 3KQQA 5FB3A 2OGSA 2QBYB 4YAJA 2PH3A 3ZR4B 2J6HA 1DAFA 2P65A 1B93A 4FKZA 1FXWA 4U6QA 1WDKA 3HJUA 3VM6A 5EWLB 4Y1RA 3Q8MA 3BMOA 1CSEE 5EP1A 3TCXB 3NM6B 4J16A 1O95D 2OD9A 3BRWA 2X8WA 4J07A 3AOEC 4XSGA 5IDYA 4XIJA 2MSCB 1NKTA 4LEIA 4RH1A 3Q72A 2MYPA 3FPCA 2Z2ZA 2B2CA 2P2YA 3FYUC 4JBXA 4X3PA 1AF7A 1T6BY 2H1VA 3JWIA 3CNNA 3ZE8A 4EW2A 3BE8A 2WTAA 2E4ZA 3HABA 5JSKA 3REFA 2AUMA 1M1ZA 3CXRA 2WTUA 1DRKA 4IZOA 4ZIRA 1Y8CA 2I29A 2NXCA 3TW8B 4P86A 1XQ6A 4E07A 4L7QA 4Y1FA 5DGCA 4D97A 4JV5B 3DE5X 4R9UC 1MV5A 1IN5A 1QLHA 2WE8A 1JALA 1U2DA 1ELOA 4HNAB 4I2VA 4JLUA 5ELLA 2NT4A 3ZW8A 3ZJ5A 4BMDA 3E2IA 4AMGA 1PDVA 5AW3A 4CM6A 1SXPA 4F7WA 2HWUA 3L7AA 1DO2A 2GPYA 2ONKA 1XMOB 4IS3A 2YHIA 1V1RA 1MN6A 3QE3A 1OT5A 2BFWA 2NU7B 4YACA 3J81k 1WNFA 1P31A 2PCLA 3MN1A 1QHYA 5F73A 5K0GA 3NDPA 1NM5A 1XA3A 4PZEA 1DQRA 1GPMA 1RHKA 1XL1A 2P9BA 1G2QA 4GMXA 4HDAA 1Z37A 4I9FA 5CJPA 3L0SA 3W1VA 4BB9A 1UXGA 5ERXA 4DT1B 3MTBA 4AXXA 3QUBA 5ECGC 4CEJB 4H1UA 1QE3A 2RIPA 3BZWA 4CKEB 1XNRB 1CXZA 1WDMA 3O91A 2PKXA 4OY3A 3CM0A 4BU1A 4F5DA 5AJHA 3ZNQA 2JGAA 4JEMA 3SC2A 4X63A 3RTGA 2OV8A 3GGPA 2BKLA 4JSTA 10MHA 1GPBA 2GPSA 1EDDA 1CUBA 1DAOA 5CA1A 1U9IA 1F4VA 3FVTA 3KK0A 5IJ9B 1ZIPA 4EJ2A 2GVNA 3SJBA 5A9SB 2NO9A 4LDAA 4M0MA 5FL7A 4M1ZA 3RUFA 1G8GA 1I0ZA 2BRUC 4KBGA 4Q5IA 3A6KA 1GR1A 3ENZA 2AR9A 3IQWA 3RSZA 3X1XA 2IT1A 3SNHA 5JS1A 3FCSB 4MYSA 3VPDA 5CX1B 1US8A 1LLDA 1Y98A 3WL8A 1S2LA 2R4TA 2ZJ5A 1RQ7A 4X85A 1FYDA 1KL7A 5J58A 3BRCA 3D6NB 2XCTB 2JFVA 3OH8A 2HQOA 2O2JA 4GKJB 4ICIA 1XQYA 2R1UA 5HX7A 3VR4A 3D81A 3J7AC 4TLDA 1QQ6A 3Q0TA 1LBIA 5FTWA 2XECA 1OXMA 2YC2C 3KYCA 1RLOA 3QFRA 3DZBA 4OHMA 4OQPA 1NFQA 4HQ6A 4UZEA 5EWMB 1TEVA 4EB6B 3ZE6A 3IBGA 3IQZA 3VAZA 4DCUA 1DEHA 4KK4A 1Z62A 5EE9A 3OT4A 4YN3A 2R6AA 2WNIA 2WK1A 1NUUA 4JGGA 5AJUA 5UKDA 3CEJA 3V00A 2BJHA 5BNWA 3HLYA 3GLIB 4C3OB 3D8HA 4NVRA 5F7ZA 5BN5A 3T5GA 1G8JA 1FXWF 5HUHA 4DDMA 1F0PA 3CO0S 2YKGA 3R40A 2ZSKA 3FG9A 5JAHA 5HXAA 1NF8A 1DKRA 1IBSA 1F8UA 3Q3HA 1UBEA 1WBJB 4J76A 1SA0A 3L6DA 4MVJP 1J0XO 3TZCA 4BAZA 2EL9A 3UGJA 3AKCA 1FFEA 3D5TA 1E20A 1RHUA 4OJTA 1UOEA 3WHLA 5G2OA 4X95A 4KQCA 5IMSA 5FUBA 1UPBA 3G17A 2M98A 1JZSA 1KYWA 1E5XA 1JQDA 3GLKA 3WSVA 2NYVA 5KO2A 1NY5A 2BGUA 2Q2VA 4RGQA 5I01A 1RBZA 3NV7A 2G09A 2L82A 3I32A 3B20A 4U5XA 2XDAA 1S3IA 3BDAA 1JEQA 5JG7A 4LNUB 3LBFA 4BKOA 3GGJA 5E9QA 4DR2B 2G0TA 4M0KA 2ADFA 4BNLA 1OB2A 1GTSA 3EUWA 4HBGA 4BLPA 2C2MA 2Q07A 3O3OB 4HQRA 1GNTA 2X0KA 5K0CA 3ZHOA 4OM7A 3RCBA 5HKKD 3AKZA 4D4HA 1QIDA 4OMFG 3KZOA 5HIJA 3GVPA 3SKXA 1K63A 5IF9A 2WABA 3O2QB 1WUYA 3IAM1 4PX9A 3UVEA 1PJZA 2YVUA 4XPIA 3C43A 1YZVA 2FW9A 1G9XA 5DHUA 2RGAA 4BIMA 4D43A 2CLMB 3VKUA 5JJIA 1XZNA 1EE1A 3DL4A 4CLDA 3W3AA 4H16A 3LXXA 5JHHB 2R11A 2W4IA 1YUNA 4OSOA 5SZKB 4YRMA 1DIRA 2BZ0A 1E66A 3NJ8A 3VZPA 3EEOA 1IQRA 2CUZA 4P3OA 3G2OA 2W42A 4JHXA 4AO6A 2FNAA 4G0VA 5CA1F 4WESB 4BQQA 2NPFA 2BF4A 1K6MA 1Y1PA 1W4BA 1Y4UA 3I2HA 5TF0A 3ZVMA 2X8AA 1J39A 3DFKA 1DCFA 3NLLA 5FBQB 4W5JA 3TIXB 4F4FA 4IG9A 2JLUA 4BB6A 1Q1EA 3VPAA 1USIA 3DQZA 4GI2A 1X7ZB 2EQ5A 2Q3FA 1X8KA 3GHYA 3W6UA 2Y6UA 3AM1A 2A14A 2VN8A 1R6DA 1EE2A 1U8XX 4HRYA 2CHVA 2WUFA 3CUUA 1P9RA 1NI4B 4Z3OA 1AO0A 5JQGA 5CT6A 1RAAA 5J5CA 1JR4A 2XUJA 1WVMA 2IIQA 2MU1A 1LQUA 5TQ0A 5GWXA 1BXGA 5AJVB 1OREA 1Y6GA 4FYHA 2F4VB 1HTWA 2W11A 3QENA 4QNRA 4UD6A 3C70A 4I1YA 4IUCS 4XDHA 2B8JA 2IYXA 4PYMA 1QH1B 4E2ZA 4HWRA 3M3PA 5ALRA 1EX7A 4Q3AA 3RWMB 4JXKA 1U63A 3UWOA 4Z49A 5IJWA 3MFYA 1MT0A 4UAUA 3ZU6A 5A4IS 2DHQA 1FFXB 3KOXA 4J0IA 4V03A 1YE8A 3U4AA 1M6YA 4PFJA 4TWZA 2NV6A 2VTBB 3CCBA 3WHKA 4B7XA 1S1CA 2JJ1D 4R7GA 4AAYA 2X41A 4RK1A 3STXA 3IPAA 3KVRA 5FH9A 1XPUA 1JILA 1SBQA 1Z5NA 4C4SA 2ZRBA 1HV8A 1U3DA 2XEDA 5AJWA 4EL5A 5JMPA 2JGFA 5HYVA 2FUEA 1SPBS 3K0BA 1NOIA 5JMOA 5LBTA 2AH5A 1NFFA 1U2GA 1Z45A 2O7QA 3RIHA 1YA4A 4FOOA 1H0HA 3O7WA 1MAHA 1I33A 4HGOA 3NONA 5K7SA 2JIZD 1LS1A 3BMNA 4E32A 2P7IA 3FDZA 3W04A 4A0QA 1RRCA 4C0SA 1P6QA 3ZDRA 5HF9A 3DMGA 3MSXA 2QXYA 4PIMA 5IYZB 1W85A 3PIIA 1V25A 3C5HA 1PJCA 3RC7A 5JBIA 4YJGA 3IP3A 2Q5FA 3UEOA 4EKNB 3COYA 1NVTA 3I8OA 3COSA 1SOWA 4EY7A 3TR6A 2YFQA 2O2EA 2HU8A 3HCWA 5KNDD 4ZT5A 4L51A 5A2GA 4LNAA 2B61A 3HJCA 4F45A 1VE9A 4PZLA 1ZISA 1I4LD 2VLBA 2VYCA 2IPNA 3FZEA 3K32A 1NZDA 5AKEA 4E5MA 5K8TA 5F78A 2QPOA 1A69A 5IKPA 4NYIQ 3SXJA 1JFSA 1GLVA 1Y6RA 2PUJA 1EP1B 2GZ3A 1JVSA 4CQLB 3AUUA 5I7AA 3MTIA 3ZKAA 2H9YA 1E5QA 2RGNA 4EI2A 3I0MA 2XYRA 3EZGA 3GQVA 4MMZB 3OPVA 3SEZA 3IALA 1LTQA 1U7TA 1YXMA 2BEUA 3HDJA 2PT6A 3JR3A 2H29A 4ZT6A 5JSYA 4GOND 4JJIA 4ZOAA 1K5PA 2I5PO 3TGLA 1W5EA 1R3DA 4ZEVA 2O2GA 1PZFA 1YZHA 1JHUA 2FDXA 3EIUA 3FUWA 2C4HA 3HFRA 3QH4A 1Z07A 2WWIA 3OCCA 3OD1A 2G9RA 1LTHR 4BNXA 4TT8A 1PG0A 1OI2A 3SYLA 1EWQA 2CLIB 2CXNA 2XGOA 3DUWA 4NBSA 3EGXB 1L7AA 3K92A 1X7DA 5TQ2B 5CDSA 1P81A 1TCBA 2R5WA 5EGSA 1P0FA 4IHQA 2ZSBA 5JQGF 5LLTA 1WAMA 1VFPA 3H2JA 3MJHA 1PK8A 1E1DA 1SUFA 1DIAA 4AWBA 3VU9B 4NBTA 3RAGA 2GBPA 3L7KA 3IIKA 1JXMA 2ZSFA 2CLLB 4EVSA 5K4GA 4ARIA 4RA6B 1NUAA 2PPVA 4N6NA 2DFKB 2PKEA 2WTMA 2O5EA 2O2CA 3T9BA 1O4VA 2VJLA 4EK9A 1NBMA 2A9QA 4IDGA 2XQGA 3OCXA 2IVZA 3KYIB 3A28A 3HB5X 3JARB 1L5QA 1THZA 1A3CA 1JFVA 4R1UA 3KM0A 1CE8B 4V38A 5A1TA 3VSBA 1KO7A 5ECDA 3I9NA 3ZJUA 1C9KA 2V7QA 3IB3A 1W0KD 1SVLA 1E4EA 4XGIA 2FGKA 2FOXA 4P3NA 3TR5A 4A16A 1B6RA 3PQ7A 5FV4A 3LSYA 1SHZA 2QAGB 5CCDA 3SHVA 4FFPA 2VZ9A 4WXMA 4FTWA 2C5LA 2UYHA 1VLQA 4ZU1X 3OP4A 2XYGA 4HNSA 1WNTA 3AVOA 1QQAA 1GGKA 1SCIA 1CJCA 2OBLA 1D09A 1A8SA 2J85A 4OAOA 5KJ6A 3RYIB 3GH1A 4ZRMA 4O29A 3ICWA 4LTNA 1OFHA 1ZJJA 3C3XA 3QX7A 2NZJA 4MS4A 2QTZA 4EYGA 3TLZA 5LXTB 2XZPA 4XDGA 3U9TA 2NYAA 4Z9AA 3WTCA 3LRTA 2YZNA 3CH6A 4WIAA 5EGNA 3LJKA 3FROA 2DFVA 4XVHA 2L19A 3T3GA 3AZQA 3ABQB 5FJIA 1KBZA 1NJ5A 1RZVA 1A9PA 2L2QA 3CN9A 3CZAA 3K5IA 4PSKA 1ZMBA 3UN1A 3UXMA 5JH7B 2PEYA 2Y66A 2UUCB 4QJ3A 5KHLB 2QSYA 4F38A 1IY9A 3KEGA 4HXEB 5DOZA 4ZCPA 3D6FA 3GUZA 3HYNA 4DTCA 1YKFA 1D0VA 4GZ3A 4EO9A 1PJ2A 1T36B 1DFHA 1DKNA 1U2QA 2NV0A 2ZIUB 3EF1A 1V5WA 1E79D 3HV2A 4REMA 3UW3A 2GJ9A 2VP9A 2VPIA 2DLCX 2B5OA 2GGSA 4INJA 3E3MA 3H5AA 1TM3E 3SS9X 1JKFA 1N57A 5KKAA 3TFWA 4EUSA 5AM3A 1OASA 1OKKA 5KSOA 1EFRA 2EAUA 3P9NA 1R4ZA 2E4WA 4MQEA 2P6RA 3CF4A 4J1TA 3SMQA 1V2HE 1AKRA 5LFAA 3CW9A 4RQTA 2AJDA 1MIHA 3MSCA 4D57A 1P1HA 2KQUA 4WNYA 3NM4A 3ZQ4A 3H87A 4NOKA 5CT5A 4YQYA 3GRUA 2ONCA 4F6RA 2ZXUA 4ND3A 2PJUA 2PBFA 3PQ4A 1G55A 4DM4A 3FD8A 1B14A 1TEHA 2ERXA 1PSZA 4OL0A 1PR2A 2NO6A 3BB4A 2GN8A 2VBFA 3F7NA 2K5UA 4H08A 4B7CA 4D99A 4R3NA 3SR0A 3IDSA 4ER6A 8ABPA 5JR3A 1IYZA 4L5IA 4EHJA 4CM9D 3SZGA 2FMHA 2AN3A 3LW8A 4Z9BA 3LGSA 4LZOA 4FLMA 2JATA 4IKPA 5IKOA 3K70B 4U7TB 2W6JA 1TVMA 1GTZA 1CUXA 3G7UA 5D5QA 3EIHA 3N53A 2P9CA 4H60A 1J1IA 4RD6A 1S89A 2WTXA 4UVIA 5LKAA 1AGPA 3EB9A 3NHBA 3OA2A 3DZFA 4EG4A 1TJPB 4I55B 3EEFA 1EM8A 1E1LA 4IDBA 2B1JA 1WHTA 1T29A 3RQIA 1IBMB 3WB1A 3PGJA 1SPXA 1UFVA 2GZ1A 4AZTA 1OU0A 4NJMA 3I2YX 5BWOA 2FPIB 2VC2B 3JQGA 5TEWA 1ZD1A 2FUG6 4I1PA 1FW6A 5H70A 2HHHB 2BEWB 3GJYA 2XH8A 3V42A 3GW8A 3R3SA 1DXHA 1QF7A 1IU9A 4RDIA 4RZHA 5AJTA 4TLCA 4R2XA 1HH4A 2A9VA 3R41A 4OF4A 3OZ7A 2AGVA 3BL8A 4CKWA 2X4GA 2O8EB 1BG6A 2EKPA 1CUYA 3HBNA 3TM5A 1JG4A 1TFRA 4A2QA 1M7HA 2X0IA 5DGTA 4AWAA 4UQPA 2TS1A 1A27A 4FI3F 2WJJA 3PPVA 5BURA 1TZKA 2DH6A 1RQ2A 4RY2A 4X1KB 5KYUA 5E3JA 2BAGA 3LUCA 5TC4A 2FDCA 1AD2A 4RELA 1CP2A 2RGYA 5KZMB 2QRKA 1N2GA 1K5GA 1Z8HA 2IYWA 2O6LA 3NDIA 3LXMA 1NX6A 1RI2A 1RHJA 1ISGA 1NXOA 3HKBA 1UZMA 1ULAA 2EDCA 2VYVA 3EQ7A 3TPFA 3V1YA 1Y5MA 4OHFA 2QIOA 2XNCA 2CVFA 3FVRA 1VI5A 5IM4A 2H7CA 1JQAA 1H2FA 3N2GB 2BDTA 2WJVA 3Q0IA 3WFJA 4CIVA 1PWZA 3PDJA 4I1RA 2Y2UA 3IXQA 5K0NA 2NSHA 5KTOA 4TKUB 3ZVKA 1FNCA 3NFRA 1CQZA 4TQ9A 5JE8A 2R8ZA 2NSDA 3OPYB 2PSDA 4MRMA 4M9SA 2ISCA 2IWRA 3ZWPA 5JJ5A 2C2XA 4RTQA 1TIPA 2FP4A 3DNMA 4ETNA 1L8QA 3BJMA 3DB1A 3FRIA 3ROZA 3W5SA 5IH7A 3BAZA 1UF9A 3D0KA 1ZSYA 3MGAA 4ID3A 4QG3A 3M6MD 3QLUA 4GVPA 3WYAA 1G8FA 2J9RA 1UAGA 3KPUA 3PBKA 4V0MA 1KI8A 5U1PA 2BFFA 1ECGA 2BFCB 3DMFA 4FFWA 5DNVA 1AH2A 4NG5A 2X42A 3K6SA 1Q14A 3JATA 3UF0A 3I8SA 1XJ5A 4G9GA 3L04A 1SXJA 2QT1A 2IPOA 2XB9A 3MIIA 1NQAO 3D3WB 2AOXA 2CHEA 3EY4A 4FE4A 1WZNA 1XZHA 2IHBA 3DFFA 3NPAA 4PPQA 3ZY3A 1U5CA 1Z08A 3FPBA 3IULA 3KB2A 4BB0A 4C6TA 1YS4A 1S3FA 4L78A 1JLMA 4DAEA 2ZFUA 3CLSD 5ICSA 1BHSA 2H1SA 4HZUA 4Z3DA 3LUHA 1VHQA 2E5LB 2IUUA 1WP9A 5FPKA 5IXJA 1RZ3A 1NZJA 2A88A 3L05A 4ONEA 2IYTA 3OETA 5J4HA 1J0BA 4JI5B 4BNDA 4AKHA 1UBHS 2GHIA 4MQBA 1JHMA 3E9NA 4MUYA 1C7EA 2W6MA 4WVLA 4E2XA 2POQX 3ZQUA 2W8BA 3EH2A 3K05A 3L9XA 4N8EA 1CS0B 3QRWA 2OZPA 3C5EA 4KQJA 3OCVA 2YV1A 1RI1A 2F9MA 3JASB 4G25A 4PPNA 1YR6A 4TKVB 3MPUA 4BFYA 3OOWA 3R4VA 4Y6LA 5FD8A 4EJFA 5MFPA 2WU8A 2PGIA 2RHBA 3AB7A 3MBIA 4HDNA 4OMCA 1MX3A 1BNCA 3DAPA 3L43A 3RGWS 4EJSB 1KIMA 2C7RA 1QF9A 4Y9UA 3SJUA 4ZQEA 1TUGA 1ADYA 3RODA 1T2EA 2OCGA 3W8DA 1W8IA 5IAEA 2Q1YA 1PR0A 4QVGA 1EDZA 2OHHA 1TPZA 2B9EA 4KIWA 4PSCA 1WLYA 2ECPA 3NJRA 3WIUA 1O6ZA 2QZ9A 2GK6A 3M6IA 1E69A 5I4KA 4OD0A 3PJRA 2A0UA 1BXRB 1Q1NA 1Q7EA 1G9SA 1H66A 1V4NA 2BGRA 3DCJA 3OO1A 5H80A 2Q5EA 4HFNA 4AG3A 2JKVA 3H9UA 2YBEA 1EWRA 3R0VA 4YAUA 1NIJA 1OLOA 2H2AA 2R44A 1XFDA 3LBAA 3ZDFA 4CJXA 2C4VA 2GA9A 1E7MA 1R1DA 2K87A 1CR1A 1UODA 2ZATA 3CLHA 4JLVA 2JI6A 5ALPA 5IARA 4JMPA 3W2FA 2TMKA 4G5YA 4PHHA 5K3FB 1L1FA 1UBUS 1TT5A 3OIVA 4Q3NA 5L6LB 3O8NA 1L7DA 3R0JA 3PRYA 4P3XA 4UHDA 4FNAA 5FLEX 4G2NA 4US0R 1JE0A 4N9QA 4WRRA 1LVHA 4FCTA 4ZKDA 1CULC 1XN4A 3K2IA 3CR8A 5TMDA 2CGEA 1IG0A 4QQ8A 1FRVA 1Y4DE 2O50A 3V2IA 2WT4A 3GV0A 1ML3A 1KFCB 2GASA 2DYKA 2F43A 2GF2A 1JAHA 4L8VA 4TS4A 1WB6A 4V0NA 3ZIDA 1IN6A 3ZH9B 1QO7A 5DHAA 4L4UA 1JVBA 3ODPA 3TFOA 5CLGA 2XGMA 1RQPA 1ZI9A 3A26A 1X2BA 3NJ4A 4C0JA 1SJ9A 2PQ0A 4NE9A 3ZUPA 1B26A 3BK1A 2XCOA 2AW3A 3AF5A 4JEHA 5E6UA 1HDOA 2X86A 5C3MA 5L40A 1N77A 2E49A 3LVFO 1P0IA 4KE7A 2WUWE 4NX2A 1ZMXA 2WFZA 3VYWA 4NNJA 4KJZA 5MDHA 1NR5A 3PS9A 2J7KA 4OJMX 3RABA 1AXRA 5IC5A 5G3YA 3A0UA 3IEVA 4FMDB 5D3MA 1OFUA 4ZI3A 3Q1KA 4JP2A 1Q0HA 3WO0A 2FGJA 5KPJA 3K8OE 4TS9A 2Q50A 2CMKA 2H2IA 4KQIA 3L1IA 1Z34A 2C20A 1FNNA 2E21A 2O2IA 4KODA 1I51A 2HNKA 2WU1A 1YA8A 2I8LA 1F2TA 4RF5A 4XEUA 1DELA 5CURA 2QA5A 1ZLYA 5T4FA 5DEIA 3ZHCA 4ZEXA 2Q99A 1Q0QA 3SIWA 4PV7A 1GUFA 5T67A 1Z7GA 2RH5A 3ROMA 2ODEA 4BZPA 5BWMA 3DT9A 2JAWA 1I1HA 3QU7A 2YW2A 4GI3A 2YRFA 2WJ3A 4KIJA 3CG4A 2DT5A 3N0XA 2O7VA 2HBRA 5HQJA 3EARA 3G59A 4OMDA 4AMZA 4F56A 2FVXA 2ST1A 2J67A 5B7NA 1Z4QA 2NZXA 2V3VA 2PIDA 4GMKA 4ITRC 1OI7A 4DCGA 4E5DA 1EUCA 4BWYA 1K2WA 4I1OA 3DDUA 2VSNA 3V33A 1NXQA 4JVSB 2AG1A 1CJKC 1QS0B 4MW9A 4YA6A 3QBDA 4E7PA 4K6OA 2M9MA 1LH0A 5EE3A 1QU3A 3FUXA 4R1QA 5AICA 1ZBDA 2WIBA 4RM2A 1LTKA 4MH0R 5KYGA 4MUGA 3ZWAA 3QWFA 1J0AA 4F2DA 2WZCA 4F96A 5GP1A 1G7CA 2NV2B 1UBNA 1X8JA 2AEJA 1PV2A 3ANNA 2FKNA 1OJLA 3EUEA 3IX7A 3C7DB 1YS7A 5HCIA 1QIMA 4EH1A 1Y6ZA 2OY0A 4OKSA 4ZVOA 4PGFA 1OGIA 2C29D 1GARA 3V4OA 2DH5A 1IZ7A 2H54A 2NVBA 3BSWA 4N3CA 3G23A 4X90A 2J32A 3MW8A 3OQIA 5IZCC 3KOWA 3SS8A 3U62A 1OU4A 3K9CA 3RVSA 3QG1A 3B9QA 5EPOA 4FMBB 4HH4A 1JNXX 1Z15A 3L8ZA 1YB2A 4HXYA 4KFUA 3FDJA 5AI4A 1YR3A 5FR1A 5HTKA 4QOFA 4BUJA 1QVWA 4YX9A 3KQYA 4BVAA 3GLGE 1L5KA 4QHTA 4X20B 5AR1A 4N65A 3ZWNA 1X94A 2ZT6A 3AP1A 1KZ7B 1XHEA 3KNZA 4LW8A 3U16A 2XZDA 3K5WA 5JMTA 1YF3A 1BGVA 4EQZA 4BQPA 2EGGA 1M0EA 4LXYA 1VZ2A 1I14A 3W7VA 2V7VA 2O59A 3AONB 2XMBA 4RVSA 3EWNA 5EA2A 1BJRE 1E7SA 2VWPA 3HYLA 2FZLA 1YJBA 1SC6A 3QLTA 3GEGA 3F8SA 3TD6A 2JZNA 1NTOA 2DZDA 2WJHA 2WVJA 1JKJB 2LKCA 2VSXA 4P4SB 1RYHA 4W8GA 3RC2A 4O5AA 3NYIA 2QU8A 3HU1A 4RJJA 2VJBA 4A8JC 2ACEA 5KNCD 2TRSB 1BD3A 1G8AA 3W0LB 4O4IB 4B3JA 1VLJA 3OMXA 3WGZA 4YAKA 3AG5A 4LZWA 1CT9A 3GT0A 1VKHA 1PVDA 3H83A 1PT6A 1TJ5A 1ZCFA 5B1YA 1VKJA 4JUIA 5HJ2A 1X1SA 4MW2A 1MPTA 2W00A 1JHRA 3T3IA 1NU6A 4JJFA 4NK4A 5J40A 1TM5E 2XKAA 4NICA 4P7KA 4K0KB 4JIMA 3FR7A 2AJCA 2P3LA 3EZ6A 1BVUA 1VP3A 4BRUA 1GPKA 3B8EA 2NTVA 3OAAA 1SZDA 3QWHA 3DDCA 1P9LA 2DTXA 4TUYA 1FUKA 3ZZMA 5HP4A 5IS2A 2BH2A 3PR2B 5BPFA 1UDWA 3ENNA 4N7BA 3WNVA 2GAIA 4WASA 1G60A 4AC9A 3ER9A 3QEBZ 3H7IA 3EZLA 3M6AA 1FYXA 4QVIA 3K9QO 3DDZX 4DLPA 3EFEA 2Z3WA 2ZG6A 1ANKA 1ZM3A 1O03A 2RGDA 4J0EA 1IHPA 5AQEA 3WJ7A 1Q6YA 2VIIA 2WUDA 5A4AA 5AW5A 1CJMA 2E3JA 4ZMRA 3OE1A 5K3OA 1U04A 1UQRA 3PUIA 3QEAZ 4QXPA 3CEMA 3CJRA 1BROA 4WPGA 1WXXA 3H2YA 4N5LA 5E4YA 1RJDA 7GPBA 2DG2A 3KC2A 3OP1A 2HHLA 3WYCA 4ZVNA 5JCOA 3I6IA 4ADSG 5BPHA 2OUIA 2J4FA 2ZJ3A 2WR8A 2W43A 1TNDA 3GFVA 3RHFA 1F2DA 3E22A 1W4LA 3IT3A 1NVFA 3O95A 5FAKA 1SUEA 2W2LA 4LHVA 4LC1A 1XKLA 2I34A 5DM4A 3WL6A 1U7DA 2H4YA 4CHGA 2JH9A 2Y76A 3IMEA 5M29A 1N75A 4DARA 2X0JA 3TLCA 1X2EA 1BQ4A 2EBHX 2YRWA 4FC6A 4AKTA 1N3IA 1OXUA 4FHFA 3RM3A 2J0UB 2ACVA 4CQMB 1GAJA 2WKRA 4CLRB 3U44B 1OWMA 2V3WA 4GP6A 4BMPB 4E3WA 1B43A 3IPLA 3QX8A 2FFQA 4FWTA 1OLSA 1MABB 1NKVA 5BN4B 3MBOA 4NSNA 3VC3A 5A5DA 3L6CA 1PHRA 5JSQA 1FUIA 1L0BA 3FOCA 3HEAA 3KLOA 4O2AB 4OHVA 4KDEA 4RORA 1CJSA 3FGNA 4TZTA 4BX9A 2C7BA 4X1YB 2ERCA 4CM8A 1MGPA 1EVEA 4TMTA 1RXSA 4ZDIA 1OV6A 2ZCVA 1IL0A 3W5UA 2I4MA 1H8ED 4DLYA 3B1YA 2REOA 3ZW9A 1C8KA 2PNFA 3TM4A 3IQIX 4B46A 1ILEA 3O2NA 2UVPA 1DQPA 3KFLA 2PYIA 3OCWA 4R0MA 1O96B 3BL5A 4YREA 3M4JA 4E33A 4YDQA 4UKDA 3KKEA 2PLWA 2B8EA 3FSGA 3C85A 2CDCA 4DMUB 5B4VA 3WY9A 3DO6A 2TMDA 4KITB 1W0JA 5B57C 3K1AA 4MROA 1FSZA 1K4KA 1FFSA 3PNSA 2X5OA 3X3HA 3NOOA 1G5RA 1OXTA 3F6PA 3HDHA 3IBSA 5EIWA 3RT9A 4Z54A 4G0UA 2D6FA 5C53B 3HUTA 1COWD 2O7NA 2A5JA 1MEOA 1OF1A 1XE3A 3M6LA 2QTVA 4LMBA 2CJYA 2H9IA 1T9GS 1EUZA 3D31A 2VF8A 4F1KA 4NH0A 3SBDA 2E4YA 3B53X 4R71A 1EXMA 5IU6A 2UZIR 3AEKA 3IUEA 1JRLA 2PCJA 5I8ZA 1KI6A 3WK9A 3SVLA 2QL6A 1MDBA 1T10A 2DCMA 1NW3A 5EE1A 3C2QA 1J2YA 4G0XA 4HAUA 3WIBA 2ZR7A 4TUYF 1TAGA 1O6CA 4UJ5A 3UC9A 3ENVA 1PNTA 3NBAA 4A73A 3KJNA 4HWSA 5LN1A 3INGA 2OV6A 5JPCA 1YFLA 3IP8A 3OFNA 4OUDA 4R7TA 3ZK7A 4MPPA 1QTRA 3PD7A 1T0IA 4L9WA 2NUTB 3V2UA 1JAYA 1H3FA 2AE1A 4E09A 2OC4A 4ZV4A 1JHAA 3QVGA 3LWBA 4R1SA 4EHNA 4TLEA 3PHHA 5C8YB 3BTVA 3FYTA 4KQMA 4NU8X 3FBTA 2QKYA 1EYZA 1BMTA 5JVDB 4I8XA 3GRRA 2J7PD 4LV8B 2Y99A 4PZAA 4Z5XA 2PL5A 2DLDA 5KCZA 3A9UA 3OTOB 3EGDB 3GEMA 3LPDA 3TBFA 1DZIA 2PYDA 3VC1A 3U56A 3I5XA 4KV9A 4ER5A 1J8QA 1JT2A 2FMFA 2SNIE 3B48A 3PR1A 3WTBA 2AG0A 4NZYA 3H2BA 3ZCVA 1ORDA 5BRNA 5LZ2A 3RYCA 3L8CA 2BC9A 1QWOA 3F2IA 2NX2A 2E85A 3IXLA 4XQ0A 1O1YA 3O94A 2XWQA 3P94A 2O23A 1J70A 2EF0A 3C1UA 3NWJA 3PIDA 4CM5A 4CKBA 3PC6A 1D03A 4MS3B 3S2FA 3HXQA 1N5OX 3WLOA 3BXGA 1XQVA 2P9GA 5GONA 5J2TB 3LOQA 5FI0B 1Y1LA 3UC5A 2QVXX 2QMUA 4ER7A 3T1YB 2I66A 2OZKA 2DQKA 2J46A 2I78A 4CE6A 4I5EA 5CM9C 4WY8A 1OUMA 2TMYA 3OG9A 4MB2A 4RANA 2A59A 1EZ1A 1RRGA 2W8ZA 3RU7A 3ZIAA 3EQ6A 5LUAA 1YL7A 1M10A 3ELWA 3GCXA 1IBCA 4BNTA 1UWLA 3GPCA 4HLNA 1MJFA 3VX3A 2BSAA 1GHTA 4FLEA 3GK3A 3OQ1A 1RAGA 1JDZA 1JTVA 4XTCS 5LCXA 4KXMA 1N4AA 4EPYA 5JDCA 1PLJA 1TKBA 3RUHA 5CW1A 1UDXA 3IDQA 4JGIA 4BE4A 5HCNA 5LOVB 4JITA 5HF5A 5AI6A 5FAXA 2OXRA 1PFKA 2JIPA 3GLHA 5LZ5A 3WQHA 3SF8A 5B2ZA 4OX9Y 1R0KA 1KPGA 1XMJA 2DEUA 5DTEA 2I9KA 4G85A 5KU1A 3PCRB 1Z18A 2RHJA 5ESXA 3UA3A 3RADC 2Q3LA 4WKBA 3KXDA 2PS3A 1V43A 2Q4DA 2CZGA 1GJRA 3F46A 3LXUX 2PANA 1N2XA 3VA7A 3FIUA 2BT4A 1LI7A 1TYZA 2XT6A 3W2HA 1E0DA 1F2VA 1C7RA 3FYCA 2AZMA 4IH9A 1YT5A 3QPWA 4IEFB 4WKGA 4L3VA 1UMDB 3AUKA 2YJGA 1EGMB 1NQ5A 1V3VA 2QROA 1HK7A 3PVCA 4W9RA 5LJLA 1KF0A 3RAPR 1YTUA 3D0RA 4GZ5A 2C4NA 3IQEA 1P3JA 1AQJA 4XM0A 2IA5A 3RU9A 2BFBA 2D4AA 3SDBA 3DZ8A 3DFIA 4NABA 3H9BA 5G40A 4J0DA 4CKYA 4KFTA 1ZRSA 3L5OA 4K9LA 4MVJA 3CIOA 3P26A 4WNAB 4RIHA 3V1NA 4BQRA 4M1QA 3EAGA 1UFKA 3A58B 2JVIA 2O06A 1BWRA 2B98A 4PE5B 4ZN6A 1NLYA 1AMUA 3D6JA 3H1BA 3BCRA 1JBEA 1P2FA 3A1DA 1JL3A 1GPH1 4B2LA 4HGQA 4KQXA 3THXB 2PUHA 5CFQA 1CUVA 1PG5A 3KFXA 3MEQA 5FORA 4KRXA 2DU8A 3KZCA 3H1AA 4S04A 2XZLA 1XXHA 1JQBA 4CRWB 4WFQA 1NJ6A 5TMPA 5LU8A 4NESA 1Z2NX 2YWCA 3IPCA 4QFCA 3FCAA 3LT1A 1YQDA 5KSPA 1WMEA 3SXUA 2KLBA 2PU5A 4EG5A 5B6JA 2Y9MB 2PVSA 2QMYA 6LDHA 3C7AA 4AMYA 1TGYA 3PDWA 1P1KA 1V5GA 3HDGA 5GONF 5IANA 4HH3C 4R1LA 4PBRA 3Q6IA 2HA0A 2CC2A 2GVDC 4C87A 3TQHA 2X3UA 1R27A 3B60A 3AR6A 3JAKB 4HEA6 1H2XA 4E2WA 3RJ9A 5DT9A 1EFDN 1K5HA 3CZ5A 3KB6A 2YWEA 3EEYA 3ILVA 5FA5A 3OSUA 4RS3A 3V5NA 3VNAA 1N0WA 1NN1A 3OT5A 4OXNA 3B7GA 3DT6A 4X54A 4F2PA 5HZGA 1KFKB 1F7VA 2ZI7A 3PWKA 3OWHA 1VMIA 5HE9A 2HA7A 3MWEB 5BVHB 5C7OO 1HL3A 4HDRA 3MJRA 3K8QA 2R60A 4QATA 4XEHA 5K8IA 3M6FA 2X5KO 2HF7A 1PQ4A 3I1IA 3BSFA 4Q4LA 1Z0IA 2RHOA 3QW4B 1F9EA 1XR3A 1DT5A 1POXA 2I80A 5ALDA 2QPAA 3D4BA 1XMPA 2CKMA 2X4DA 1A98A 3UA4A 3WGMA 1YZGA 2ID9A 1AGYA 2FE1A 2Y0CA 3A4MA 4P7BA 1ZGAA 2PS0A 5EJ5A 4IGIA 2JGMA 4XGKA 2WB4A 1MC5A 3FPGA 4GX1A 2WP0A 3T7AA 3ZDQA 4CR8A 1YI0A 4ENUA 5K8JB 2D5BA 2N0SA 3W5CA 2G4VA 5LZ8A 2Z9DA 4LE0A 5BV2P 4E12A 5TE9A 2OSBA 4D6YA 4PLWA 2WHXA 1XGKA 4QE3A 3JALA 2AOWA 2QUZA 5HM8A 1RJ9B 4IOJA 4TM7A 4LSMA 3NHMA 3RFVA 2X6RA 5H4HA 3W2GA 4BFWA 3AQIA 2H59A 2MSLA 3UCFA 2OKGA 4GL4A 1I4TD 5JS6A 4R9NA 1GUYA 4WOJA 4OVKA 5JS2A 5C7LO 3ETJA 3FH0A 4GX5A 4LJ8A 3WLEA 2BHTA 2XSZA 2Z4TA 2JRLA 3LV8A 1EWTA 2ZIAA 3KJFA 4F71A 2VT3A 4ZVMA 2PQ2A 2C9CA 2PAFA 1I5RA 1UINA 1XVLA 1Y5NA 1G3QA 4MVJF 3TNJA 1TC2A 4C07A 3F9CA 1AZLA 4J9UE 4ZHQB 3ZHZA 4NU0A 2FPWA 2FP3A 4YMHA 4YUXA 4G0WA 5K6TA 1RYNA 4Y0AA 2HRCA 4GSLA 2FFHA 5GZ6A 1RKVA 2QM0A 2VXYA 5TQVA 2FF5A 3CX6A 3PA6A 3CF2A 5EMKA 2QENA 2XQFA 1VHTA 1SQSA 2LBPA 3GCGA 4LOAA 1J42A 2D0DA 1P3Y1 4ZKEA 4PLTA 1E89A 1VIDA 2BFOA 4DS3A 4MR7B 3GDFA 3R20A 2DKOA 4JLJA 4BEVA 5H68A 1WCIB 5HILA 2I1LA 5GM1A 3VPFA 2W2TA 4CT0A 1SHUX 2IV7A 3WQSB 1DP4A 3VR6D 4DL9A 3K1TA 3GP5A 3KEOA 4YP0A 4YWHA 4LXQA 4TV9B 2HAEA 1DIBA 2H2HA 2WSIA 2A84A 1TVCA 3I05A 3P2MA 4LHZA 1NNEA 4QUKA 3WX0A 4X8LA 4BAGA 2AYXA 1IQPA 1S2NA 2G88A 4RF2A 3DE6X 4AJHA 4MAAA 3B2QA 3WLAA 4RETA 5DP1A 3G2NA 3QKSA 4H7EA 4P80A 1UM9A 4QARA 2ZUDA 2J9GA 3EGEA 3T5CA 3UWMA 1HNZB 4D9CA 1U3TA 2QUHA 4EF6A 2WHPA 3PXGA 2Z30A 4FOTA 3K31A 1ZUNA 1OV4A 3MHPA 3LU1A 3QLVC 4I66A 4NOMA 4ZO8A 4DG8A 3MZ0A 1R5BA 2HQBA 3AWIA 4MKXA 2EERA 4AJNA 2W4QA 4FCCA 1X1QA 3P20A 5JCJA 1HLGA 2BMFA 5LQJA 1RKQA 1XA4A 1T3TA 2H5LA 4HGNA 2QYHA 3L07A 2FZGA 1QZZA 3CRVA 2GZ2A 4BP8A 2W2PA 5AVVA 4JLPA 4BMYA 2IV3A 3OOSA 1Q77A 3TL6A 3DVAB 4LRQA 5A3QA 4BXOA 2BGIA 3REOA 1MLDA 5K45A 1S7GA 3CKKA 2GEVA 4L07A 5ENZA 3EZYA 2V1XA 3L1JA 1EBFA 3SFVA 2ZTLA 3GAZA 1H8HA 2C4UA 3KT6A 2ORWA 2YFKA 1CK4A 3TAUA 5B7QA 3DAFA 1EXVA 2VT2A 2VDMB 2RH9B 2DR0A 1Y9DA 1RRMA 3IRUA 2PBLA 1R50A 4I19A 4PLHA 5JNLA 2JCSA 1VG9B 3LP6A 4FS3A 1SNYA 1XYVA 4JWKA 3ZDZB 4ZT7A 4O3FA 3AFOA 5G0TA 1CQIB 1P4RA 1U9JA 2HJGA 3GJ6A 1UDBA 4I1UA 1EQAA 1C8VB 1ENOA 4FGUA 4UBOA 2CSXA 2WD7B 2BL4A 2I6FA 2KI5A 2XT9A 2IS2A 1TVKA 2XWBF 5ALOA 3BE5A 1NYRA 1OOEA 1U8TA 4YRBA 1LLQA 4JJEA 3IP7A 5DTIA 2O2SA 3I92A 4JYBA 1BQEA 3C41J 1WU8A 3FPHA 1E3EA 1OH7A 3UAXA 1KHTA 4DHEA 4KGDA 1ULSA 3P0FA 3SKVA 1R5NA 3AR3A 3FGOA 3VNQA 4DQVA 4F60A 1QX3A 5JT1A 4JXXA 3RUPA 2J3IA 3BHJA 4HQOA 1U81A 4IOMA 3N2NA 3LGAA 2ZI5A 5EAIA 5DX1A 3STUA 1UMKA 2XDQA 4D6PA 2NP7A 4D45A 2GFIA 1FS6A 4JKYA 3ZXUB 4IIGA 2JASA 5C8XA 4LYJA 3RIGA 1GFIA 3I53A 4FYXA 3ZEAA 1ORVA 4R16A 2CUTA 3NUQA 4PCVA 1O9BA 2F64A 2ROQA 3QE0A 1PHPA 2CLSA 1YBFA 1VSQA 1D1QA 2A67A 1ZOPA 4Z1MA 2GPJA 4WZ6A 1NRIA 2P0YA 1OZFA 2OPBA 2B5WA 4QUGA 2HCBA 2CEAA 2VHZA 2WF7A 2UYQA 1L8OA 1N2BA 3SF0A 2O0MA 1ZUD1 4NEHB 5IBQA 3UPTA 4X00A 3NEPX 4M8SA 1TEZA 4Z9FA 2G76A 3N6VA 4ZWNA 1RSZA 4IJ5A 1GTMA 4FR0A 3HR8A 4G6ZA 1XC7A 1S9DA 4KTVE 5T64A 1BEEA 3R9IA 1P2BA 4JA2A 4NMHA 3PUHA 2NAFA 5B1HA 4BUZA 2FG5A 5CFOA 2ENUA 3VKVA 3PFHA 4KYVA 13PKA 4MWDA 5EVJA 3UHFA 5CFZA 3TH5A 3QNUA 4HMQA 1JJVA 3THYB 3A6DA 3NEYA 1UPAA 2PSJA 2JZCA 1NP6A 1J8FA 1PK9A 3AY0A 3LHFA 4EMTA 4IIJB 3SP1A 4GOKA 4NLLA 1RRVA 5JZOA 3LT0A 4FJ1A 4P58A 1QM5A 1XI2A 3EEIA 3GWZA 4AP5A 4C6SA 3C8UA 4LOLA 2E4AA 2ZXEA 3O8CA 4A15A 2UYCA 4BWVA 5E4TA 4O2BB 3BWDD 2YYZA 5AT1A 5B6IA 3F49S 3RKRA 5HWSA 2PX8A 1K1EA 1AK9A 1L5YA 2CN1A 3L7NA 4CETA 3R8FA 3QP9A 3TF5A 1R6UA 5KPDA 2OHJA 1GRCA 2BM8A 3PHLA 3RK0A 1JW9B 4Z4EA 1KMHB 2H07A 1U1CA 3PUWA 3PDIB 4LJAA 3ZNOA 2P27A 4DR4B 3RHSA 1ZD3A 4HJXA 4FYKA 4MV5A 1V8OA 1RQGA 2YZ2A 4O8CA 5G0WA 5JNVA 3QPUA 4ISBA 3OZSA 4RGVA 4GNKA 1UBGA 3C7TA 1CNMA 3AF6A 2PZEA 3P9XA 3R77A 3SQOA 3D8BA 1BFDA 3BF7A 2VF2A 1V47A 3DG9A 1A8HA 2JIRA 2NO7A 2JGEA 3A8TA 2ZTMA 3N2LA 3PTZA 4H2DA 4J4BA 3Q6NA 3ASVA 4TLAA 4DCVA 1P7WA 3MJCA 1LLUA 3GLFA 3U1VA 5U4XA 2HX1A 2J5QA 4U2BA 4CL3A 1ZH0A 5A3VA 2D54A 4G0NA 3SKYA 1DG3A 5BSFA 1F38A 3NI2A 5EMJA 1VLLA 4DIEA 4JWTA 1MRNA 4NPAA 3KKQA 2KW5A 5ICCA 1ZH6A 2B21A 4J90A 1R6XA 4Z86A 2J3LA 3GZ4A 4DPMA 1HT3A 3D7KA 4F1JA 4GQBA 2EBFX 3ICEA 3FI9A 2XUHA 2IXGA 4JUDX 4K9OA 1QF6A 2BIFA 5WRFA 1L9KA 1MNAA 1IHYA 3QFFA 1WSDA 1LDMA 1W49A 1RZRD 5DM0A 3GI1A 4ENQA 2RK3A 1M2JA 2L42A 4Y2YA 4AJLA 2FMIA 2PMFA 2D7DA 3B3FA 1TAHA 1HEYA 4KBFA 3PPIA 1N5KA 2E0IA 1K7XB 3ABIA 3HMQA 3HN2A 4MYRA 5F4BA 3DLBA 1Y8QA 3DXXA 4FOPA 1AZTA 2ABWA 4MIYA 3KOZA 4HFRA 3C74A 4DEVA 1SFRA 3AJAA 2P75A 2VNKA 3PNVA 2UAGA 6REQB 5KOHA 3H8JA 4HS9A 1Q7RA 1TM7E 5K6AC 5FWNA 2XADA 2IYVA 5FOUA 3WZ2A 4BLQA 2OV1A 3LIIA 1L5SA 2JK1A 3LLSA 4R1MA 5SYNA 2IYQA 4BFCA 1XEWX 1QVVA 4X6XA 2OM2A 4FFMA 2I33A 3FJ1A 5H81A 3NYWA 2VK1A 2DWQA 3X43A 1EHYA 2CXOA 2P62A 3Q2IA 1L5HB 1OBOA 3MQ2A 4RJTA 3VR5H 4ZGWA 2IOQA 1XDGA 3HADA 3KSMA 5EJIA 3GA7A 5HW0A 1LK5A 2DPGA 3KXKA 3AG6A 1TTHA 3T94A 5JY6A 2JI4A 5JAIA 3OJCA 1M75A 2GPAA 3ZGZA 1LRJA 3V80A 3RU2A 2C4MA 2PMEA 1SO8A 1T2NA 4OHCA 3ZTWA 1BE0A 2ZJ2A 2YFHA 3AIIA 3CINA 1J1ZA 3KTAB 1GLGA 1EIZA 2HSZA 2P9FA 4B3HA 4BX0A 4W5QA 2EJBA 2XIJA 2G5PA 4PYKA 4KO1S 1YGYA 4JLDA 1TAUA 3T8YA 3TO5A 1RIFA 3OE4A 5CCXA 2IPAB 2JGLA 3T3MB 3ZX4A 2IUTA 5AOCA 2GZRA 3R6GA 2PVCA 4LQ4A 3RH0A 4UTZA 1SG6A 5LMZA 1JFRA 3K0FA 5EZSA 1X7GA 1ZEJA 1YDHA 5FBVB 2A9FA 1YRWA 3B2EA 1JI3A 3HJHA 4LDNA 3BEOA 4A8TA 4KN8A 3S81A 3MJ4A 3PNOA 2JIOA 4Q3LA 1Z75A 2V8OA 1SURA 5CBPB 3AL0C 1M2OB 3OBIA 4TL7A 3T3EA 4B45A 4PYIA 3VHXB 4QOSA 4U2GA 2EQAA 3QW2A 4RV5A 1E58A 2V98A 4ER0A 5DPMA 5CFMA 4AI6A 2C8LA 3DBVO 4H35A 1TJ4A 2Y4NA 2ATVA 1WU7A 1JYSA 5FTMA 3KEFA 1MFZA 3O8RA 5FQOA 2HU7A 4NIMA 4NBRA 5FNZA 3CUTA 4AJ1A 2PEZA 4H0CA 3HA3A 2IF2A 2XE7A 2WZBA 2MTBA 4M38A 4R54A 3F8TA 3GY0A 1R15A 3O2SB 2WM2A 4EP1A 4J49A 2FETA 4EL0A 3CKYA 4EHBA 3JQ7B 3V8RA 3LCJA 4EENA 2B4TO 3LW7A 1FFBA 1QH8B 1KSHA 1R64A 1SCNE 2FWIA 1YS1X 2R97A 1A04A 2XNDD 1CC1S 3MJVA 3UMBA 3AUTA 3ETLA 4PYLA 1SUBA 1T2VA 1QV7A 4LZJA 1ZS9A 3NPMA 3NU1A 3KKNA 3CRRA 1H2ZA 3FE2A 4BMZA 4E5PA 4IQ0A 4D9NA 4QPCA 2BDEA 4IHJB 1WIWA 2OXEA 1QYVA 3HBLA 3IURA 1N8SA 2F8SA 1TGVA 4FE7A 2HXSA 1SHJA 4BVJA 4KH0A 4YLEA 5JRZA 1KFBB 2FG7C 2AFIE 1WD7A 4RL6A 3I9LA 3TLYA 3N3AC 1WL8A 1QG2A 1B0ZA 1E1QD 3IT0A 4N54A 4EGSA 4AJ9A 5C7YA 5JNSA 1ECJA 3VDRA 3W5BA 2O8FA 4CNBA 1OBVA 4LOJA 3H2HA 2JI8A 3CUVA 2PFSA 3HV0A 4L4XA 2VP2A 3IFSA 1IY2A 2FSIA 2QTMA 4NXMB 4PNEA 2JDID 4KGZA 1JSZA 3TSCA 1YCFA 4XIGS 3GEPA 2Y1KA 1QX4A 3KUUA 1IXSB 5IZCA 1NE7A 3QTLA 3ROPA 1UH5A 4JT2A 5TMBA 1NVEA 3T5MA 3B9RA 1GV1A 2QNRA 2XOKA 4K2AA 3N2YA 4K9PA 4YALA 5FLXA 2HSJA 4G0OA 4AW9A 5C1PA 1P44A 4KWIA 5HZHA 2IHTA 4BQFA 1TLTA 4B2YA 4C2BA 1LQTA 2F90A 4L4ZA 5G0UA 3GLQA 2QRVA 2AZ4A 4WXRA 3GLGB 2ATEA 1CR2A 421PA 2XVAA 5CVJA 3P9QA 4ME6A 1ULZA 1L6IA 1Z0FA 4RIEA 3O73A 4OPMA 5EHIA 4H6XA 4HX9A 4FN4A 4EATA 2CD9A 2XE8A 3DPSA 3NCTA 4A8JA 2QB5A 4KQ9A 2C9ZA 5TMEA 1A5ZA 1LDGA 1NA5A 1WXFA 2H5JA 1YCDA 2AN5A 3HSYA 4H7KA 1SXQA 3NGMA 4EY8A 3F9RA 1ZRMA 1GNQA 1WHSB 2O0HA 4HI0E 4S1OA 2JANA 1C80A 4FWBA 4G67A 5ALMA 4MA5A 1NVKA 4UHBA 3LE8A 4E5SA 3KIPA 3Q3IA 4D3DA 4ZDKA 1C3EA 2QHXA 1Q0PA 2WJIA 2YMPA 2O48X 3ND7A 4I5IA 1T8SA 2XOEA 4M0LA 3RFCA 5JOQA 3E05A 1M67A 4QDTA 1P5HA 4MVJI 4RH0A 2Z08A 4O1IA 5BUQA 2A9PA 3O3NB 1WXQA 3B6EA 4NZNA 5E95A 2DWOA 3IVXA 3HC7A 5G1PA 4PLVA 3RS7A 4HTAA 1GT6A 3IO5A 2AUNA 2IUYA 3EZFA 4MV4A 4HATA 2ZBQA 5TR9A 1YVDA 3LFTA 5FPTA 2W6ID 2YCLA 3B7WA 5L8VA 1XRQA 4R6XA 2X9GA 4I4NA 3FOEC 1JG6A 4QEZA 3KALA 2GUWA 1GD1O 1J09A 3IRVA 4YHHB 1JMVA 4M9XA 3RWBA 1TA0A 4V0OA 1JV2B 3RC1A 3ZHQA 5A9RA 1PV4A 1NLUA 2ZYGA 4KRGA 2X4LA 1T26A 4XZ3A 1YRQA 2OAEA 1A5AB 4BL5A 4I4TB 1V9SA 3VH2A 2O0LA 1YFKA 4JLAA 2JEZA 1RM4A 5MN6A 1E1RA 2ZYSA 1NPDA 4D81A 4DA6A 5LIRA 5L53A 1NC1A 5EY5B 5BR4A 4QD3A 1IY1A 3HK2A 4IJVA 2FUKA 1YNOA 2PO7A 3I58A 1GZ3A 2FSHA 4X1IA 4XUEA 5FTJA 3VGPA 2IYEA 4EY5A 1S6YA 1ADCA 3Q7QA 4DCJA 2WDPA 3OZRA 4H6VA 4JN6B 4XLLA 2GK7A 5DBOA 5HBRA 3RC9A 3P97A 3TQFA 2QIPA 4C4PA 4O0MA 1X39A 1AT1A 3IESA 1N3YA 1U5BB 4FHZA 1OHHD 3PE3A 2DPYA 5EQDA 1Y6FA 4ZEOA 1G64A 3E82A 4K9RA 2A4KA 3BCHA 1UBOS 3FWZA 4IFEA 1RR6A 2QSJA 4RLQA 4I36A 5I5GA 1FP4A 2DQ4A 3H2GA 4PC2A 1BYUA 1YZNA 2VTDA 1Z06A 1YE3A 1R6TA 3HO8A 4KVAA 4U7PB 3B7PA 2BTQA 3NVAA 1N6IA 2LE0A 1MXFA 2OFPA 5EP2A 4BGVA 4L7VA 5IAGA 4NI5A 3LGXA 5ALEA 4ZI5A 4RGBA 3UUEA 4TT3A 4HLCA 3S1AA 2HKIA 2FUNB 5HNKA 4BO8A 4WN9A 3A05A 4Z7JA 2WNHA 3SG0A 2RIRA 1IN7A 1EK5A 2DHCA 4OXQA 3WIVA 5GZ3A 5BR7A 2C03A 4O4JB 2FPRA 3OQ6A 5CHEA 1K7CA 1RWMA 4KAXA 2ACKA 2ID8A 5LQSA 5TX7A 1U6JA 5CMLA 3WYGA 4CDNA 1FUEA 2NXJA 2VRBA 3KLPX 5C2JB 5AOAA 1Z83A 2V45A 1YFZA 3PEYA 5FL3A 5ALYA 4OQLA 1DRWA 5E6RA 3LUGA 2OFFA 3WYEA 5CT8A 3KRTA 2XRFA 1QRAA 2ZRPA 1PEKE 3VHLB 3QBTA 4EO4A 1IMOA 4KLNA 2W0SA 1RJWA 2WSSA 3IAHA 5FBWB 3KG2A 4M1TA 4QLOA 1PKXA 1Q50A 1QBGA 2VSFA 3OBBA 3PGLA 3WYNA 3U3ZA 1P19A 2GDJA 5IZ4A 1ZXLA 4CLOA 4ZAYA 1JHVA 3A1SA 1ADGA 2H5IA 4Q3KA 4KSCA 4WFKA 2RGXA 4MKZA 1A9XA 4PS1A 4EEXA 1Y9ZA 1GIAA 1PFGA 1WSAA 1CEXA 2QL7A 3BTUA 4HQKA 3FNFA 4LZPA 8OHMA 4KR7A 3CUEF 1E2HA 5TPWB 5F12A 3ONWA 5DWQA 2ZE8A 1JIJA 4XVRA 4IL5A 2RGCA 5DYIA 1V16B 3EYWA 1QFSA 1JIUA 1OAOA 4BTVA 4RD3A 2PKQP 1W1UA 3CKMA 1II8A 5HDQA 2RAFA 3TR0A 5J43A 2QX7A 2QRMA 1I7NA 3D7RA 4AP9A 1VE5A 2FRDA 2XB8A 3I2GA 3P1JA 2YASA 4TXHA 2ODPA 1GGEA 3Q2OA 3P9RA 4ZQFA 4AX4A 3LF2A 4DCTA 3IKLA 3ECAA 1UMBB 3LFUA 1H1DA 3GUVA 2A78A 4UOZA 5CD9A 2G1PA 2QOEA 1F2UB 2EBWA 2F00A 3KSRA 2E55A 4GOOD 5KTYA 4X24A 4XYBA 1BVRA 2YWRA 4ED9A 1TTQB 1OBHA 4RSMA 1VSBA 2Q7DA 3WMXA 5ITSA 1O0BA 1SXIA 2P1DA 2WVAA 3LQQA 4URHA 3EVBA 4B4VA 2HA3A 5H02A 4PX5A 1MJGM 2XQJA 3B3QA 1NVXQ 4M7WA 1QRUA 3EBLA 1KEEB 4ZYXA 5A0FA 3R2JA 2WIAA 3NOXA 3EXAA 2GH1A 2IYRA 3OIGA 2YJ3A 4TV8B 1EG7A 2Y0PA 1UJCA 1VYVA 2FZEA 1ODIA 4PQYA 2XE6A 2Z83A 3F6BX 2IYSA 3LHSA 3FHTA 3ZPXA 1I80A 2GHQA 3NATA 2GBLC 2CY0A 1O7JA 4B82A 2NACA 2H3HA 2YY6A 3IV6A 1PE0A 4GBED 4OATA 3SX2A 3WKEA 1XZGA 5LP6C 2GPBA 3RTAA 5FOQA 4IDQA 1E1CB 2YY5A 4OP2A 5ISMA 4G1BA 3RTEA 5HF6A 3EPRA 5AW6A 3OI7A 4K40A 5ALWA 4BO5A 5ITZA 4MRRA 1HQCA 3K0SA 4KVFA 2GZSA 4QXOA 1CY8A 2Y1WA 3IEKA 1PR9A 1SRQA 2FPMA 3TOSA 1J99A 1I3CA 4ZOLB 3N8DA 1EPUA 1P2DA 3ZXYA 4BO7A 4LI3X 1W35A 2HV9A 2CCJA 4DZZA 5JD5A 5DSZA 1JLHA 4I9HA 3ZVLA 2AOTB 3W7AA 3GLIE 2K6GA 3OVMA 2HFKA 3P19A 4N6GA 4EHDA 2ZBFA 3PX3A 3K9FC 2OBFA 3L7LA 3Q12A 1BCSB 3FKSA 4QO7A 1K6IA 3UG7A 4QYSA 2XCIA 3A27A 3NIBA 3V1UA 4UTNA 3R5FA 1SCUB 2CFTA 2O07A 3FCCA 1Z6GA 4CIDA 1CYDA 2JI7A 1F8XA 1XEWY 4J7UA 1U3VA 4QPDA 4IVRA 4LJ7A 4M89A 1E6CA 1U9YA 3IE0A 1ZGJA 4WCDA 3ZV3A 1X92A 2X7XA 4BIIA 2VPXA 1IOVA 1CUHA 1V8BA 1G21E 4RL4A 5IAAA 4RIFA 4IWYA 4HMOA 4RLFA 1LF0A 2KMLA 5REQA 3HVUA 2A35A 1C1XB 2GYVA 3AHGA 4W7SA 2EWMA 3F47A 5FDFA 3IEUA 1PI3A 1E60A 2R66A 3UPUA 3NZEA 4XLZA 1OX5A 4BP9A 1W4RA 2PS9A 4YDRA 1N9ZA 4M8KA 4LF9B 1DDGA 2BEKA 2H17A 1AGXA 1VGVA 2VOEA 3EXEA 3MD0A 2UZ0A 3MRVA 2HNAA 2PWZA 3GQBB 3V48A 3WB9A 4IIBA 4AJEA 3OZBA 3WJAA 1X1DA 4JUAA 4CDMA 1NF3A 1RABA 3JQ8B 2LCQA 5B58C 1G6Q1 4H7FA 3W9SA 2I99A 2A92A 1A8PA 4MVYA 4C6RA 2PGLA 4TWRA 2O4CA 1WEKA 3IIEA 1LBQA 2UZ1B 4FFLA 3G2PA 4LSWA 3PUZA 4JQYA 4AQDA 1K4MA 3QVWA 1HFKA 4RMGA 2Q0XA 1I8TA 1OWLA 1Q92A 1T5SA 1VL0A 4IIDA 2OENG 2RHGB 1H0KA 1XJCA 4C2AA 3DQPA 4MKRA 1JR3E 1WKBA 3PUYA 4EY4A 3OPNA 3F7MA 1WTAA 3OU2A 4BVFA 1HGXA 3HSKA 2ETXA 4EYSA 1C9JA 1KEUA 3RYHA 2R2AA 5B4TA 1GYQA 5EUCA 5BW8A 3ICOA 1V4VA 2AX4A 4XQGA 4QYMA 2ZI9A 1ZNZA 4UM9B 3OZFA 3R7BA 4Y30A 2YL2A 2VVTA 4Q3DA 2EX1A 1JIVA 1ABFA 4X41A 1DPGA 4ASUA 1CDDA 3WK8A 2X4IA 4BX2A 2Z4RA 2WIGA 5DVZA 1WY7A 2W6PA 2XJ4A 3WLIA 5JZSA 1Z38A 1G38A 1R4NA 1CKEA 2HF8A 1E8NA 1Z82A 4HRVA 4LXIA 4BRZA 3R6WA 4DMFA 4UVEA 4GGMX 5ICMA 1R0BA 3CWZA 4GP7A 3UOAB 4BMVA 4OK6A 2B36A 5F7JA 1SUWA 4RYLA 1CQJA 2IP4A 3BK2A 5TB5A 3LO5A 4FHCA 2XRYA 4TYWA 4Y9RA 4WHMA 2IKSA 5IXSA 1GRRA 1M7GA 2BR4A 2FR1A 1ZVVA 1UC4B 1KGDA 2XYQA 4HEJA 1YHYA 4DV6B 1F7UA 2YINC 1MNQA 1TK9A 3FAZA 2OLKA 3K9WA 3NC0C 3UMRA 4BLRA 5F5LA 4NCBA 4UVDA 3G82C 3ETGA 4X0EA 4FINA 1SUIA 3GZNB 4E2FA 2OO3A 1KNQA 1DXOA 1XK6A 4L8LA 2HYIC 4U6SA 4L3WA 2A1TR 2FWRA 4WJZA 1LJUA 5FKJA 3W2IA 2WIJA 3WB2A 2B4AA 4FLFA 2Q4EA 1JG7A 3UWPA 6CHYA 1I1NA 3DXYA 1PLLA 3OZVA 4KXVA 5KCMA 3X1KA 2PGAA 3S1SA 2NU8A 3KT8A 1RKUA 1SZPA 2VJQA 3JWGA 4KK3A 1QZ3A 4PQEA 2GFQA 2VPPA 1MG0A 2ZETA 3LC2O 5I7RA 2OK8A 4QUBA 1CNEA 2QUIA 1CDZA 4GOXA 5C31A 1TZCA 2BF7A 3N2KA 5C4GB 2R6FA 4HDCA 1PEAA 5A7GA 3D5EA 2ZTUA 3NM5A 3KQNA 2PBRA