3DLCA

Crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
GMSENKKKFDKKGAKNMDEISKTLFAPIYPIIAENIINRFGITAGTCIDIGSGPGALSIALAKQSDFSIRALDFSKHMNEIALKNIADANLNDRIQIVQGDVHNIPIEDNYADLIVSRGSVFFWEDVATAFREIYRILKSGGKTYIGGGFGNKELRDSISAEMIRKNPDWKEFNRKNISQENVERFQNVLDEIGISSYEIILGDEGFWIIISKTDQEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative S-adenosyl-L-methionine-dependent Methyltransferase (NP_988299.1) from Methanococcus maripaludis JJ (DSM 2067) at 1.15 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Transferase
molecule keywords Putative S-adenosyl-L-methionine-dependent Methyltransferase
total genus 84
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dlcA00
3ELYA 3HTXA 3MQ2A 1AQIA 7MHTA 1JQDA 1VL5A 4FSDA 4ER0A 2PV0A 3FPGA 3A4TA 2BM9A 2ZZKA 5DXJA 2H00A 3AXTA 4RV9A 4F84A 3P9NA 3T0IA 3EGEA 1L3BA 3LPMA 5DX8A 4QPPA 3Q87B 2CKDA 4Z2YA 5DM4A 5LQUA 1SQGA 1VLMA 2OO3A 4RVHA 4M7RA 2ZBQA 4OBWA 4XCXA 1R18A 5HIIA 2WK1A 3CVOA 3C0KA 4AX8A 3HCFA 4PGHA 5GP1A 2IH2A 1I4WA 4FT4A 3TM5A 5LQRA 2JHCA 2B25A 1SVUA 3LGAA 1WXWA 3DULA 3L8DA 4KIFA 4K6MA 3ELWA 3HCEA 3X0DA 4EQZA 2PX8A 4C06A 1PRYA 4WVLA 4ER5A 4OX9Y 3GGDA 2OPBA 2I6GA 3B5IA 1RI2A 2QE6A 3HA7A 2G70A 3T7SA 3EVDA 3NVMB 2Y1XA 2GB4A 5CVJA 4POOA 5G02A 3NMUF 5EIWA 5HFJA 1ZGJA 3BKWA 1HMYA 4MQ4A 3TKAA 5FQOA 3NWBA 4PONA 5BXYA 1KPGA 3GRVA 3O4FA 3U81A 4R8SA 2ERCA 2P8JA 3KHKA 3GRRA 1UFKA 4UOEA 4RYLA 3UJBA 5EKXA 4YMHA 4C03A 1KYZA 3FUWA 5FHRA 1SUSA 2P35A 3LDUA 1QAOA 1O9HA 2GLUA 3PS9A 4FGZA 2OXTA 5JUWA 4C08A 5LQAA 4DCGA 5FTWA 2P7HA 1ZGAA 1P1CA 3CC8A 3FUTA 3HCCA 3IEIA 3SGLA 3MERA 1YFLA 2NP6A 2B3TA 9MHTA 1L9KA 4CKBA 5LQNA 2P7IA 4MHTA 3E7PA 1SKMA 3DR5A 1RI4A 4PYOA 5HIJA 2AR0A 2I62A 3M6WA 3PT9A 4ZTBA 2IBSA 4HG2A 4QDJA 4RSRA 3AWIA 3PB3A 3PTAA 5K03A 2XYVA 3A27A 5HIKA 1N7IA 2PT9A 3DXXA 1V39A 3P71T 1FJXA 4FZVA 5LQJA 1EG2A 3P2IA 2OB1A 3G2OA 1WXXA 3OZSA 5K01A 5ICEA 2IGTA 2PX4A 1KIAA 3VSEA 4GF5A 5BW4A 3FPEA 4OA5A 1G55A 4YUWA 1D2HA 5E1BA 5ICGA 3HCDA 2BZGA 5T67A 5K0EA 1INLA 2BR3A 2G72A 4FR0A 4E31A 2JG3A 4R05A 4YUXA 4HRAA 3P2EA 5EMMA 2G8NA 3CJTA 3FTDA 4EK9A 3I64A 1H1DA 1XVAA 2JHPA 1JG2A 2ONZA 1Z3CA 4HC4A 5D1NA 1R6AA 2NXJA 3FPHA 1KXZA 4KWCA 1MHTA 2CWWA 2YQZA 5FQNA 4M36A 3R0QA 3THSA 3LCUA 3LKZA 3DLIA 5F2OA 3SSMA 2VDVE 4C05A 4RTRA 2B9EA 3DMHA 5E2BA 1XDUA 3BGVA 5FADA 4BLUA 4C07A 2ZW9A 3K6RA 3LDFA 1G38A 4PCAA 4A6EA 3DLCA 3O7WA 2UYQA 5DX0A 2Y1WA 4HGZA 5EEHA 1FPQA 2AVDA 2OBFA 2PVCA 5EOVA 3UA4A 3FUUA 5T64A 1JTEA 4RTOA 1NKVA 3NDIA 1X1AA 5EIFA 3TR6A 5E9WA 3UJ6A 2AN3A 3VC2A 3THRA 2P1DA 2ADMA 4YUVA 1I9GA 3HCBA 1EIZA 5ICCA 2PGXA 1F3LA 2B2CA 2NXEA 2PJDA 3GWZA 2R3SA 2R6ZA 1G6Q1 2EG5A 3ELUA 3KPVA 3LCCA 3NTVA 4IWNA 2G1PA 3OCJA 3D2LA 1NW5A 3KPYA 3UJ9A 1VE3A 2XVAA 2DULA 5KS2A 1RJFA 2IDKA 2O57A 3UFBA 2FYTA 3QV2A 4V0RA 4LECA 3HNRA 4DA4A 3GO4A 3TM4A 2PXAA 4GC9A 4LWOA 3HVKA 4YV1A 2ZCJA 5GIPE 1HNNA 5EMLA 4EMSA 3LSTA 5K8VA 4DCMA 2NNWB 1KPHA 3DP7A 5C9ZA 5BP7A 3AY0A 3CGGA 3RIEA 1ZHFA 3P8ZA 4GUAA 5KQSA 3KQOA 5FCDA 5T6BA 2XVMA 3KU1A 4QVKA 4C4AA 3ERCA 4V0QA 2IP2A 4CKEA 1JSXA 5KQRA 5F2KA 5GOZA 4RX1A 4CTKA 2ZZMA 2PT6A 2QRVA 5DTMA 5BW5A 1DL5A 4NECA 2HTEA 2Q41A 5E1MA 3SMQA 2XYQA 1M0EA 2Z6QA 3PX3A 2GPYA 4B17A 2V74B 4ATNA 4PYIA 2AOTB 4Y2HA 3GNLA 4QPNA 4RTJA 3GJYA 2GA9A 4FS8A 5GIOE 2N47A 1JG3A 2ZVJA 3ELDA 2QRVB 3KQYA 5E1DA 3BGDA 5CIYA 1R00A 3S68A 5K0CA 3R9XB 2H1RA 5K0JA 5CVVA 1YF3A 2YUIA 2I9KA 1KYWA 3B7PA 3TQSA 2C7RA 4E30A 4MWZA 2AS0A 5K0BA 4P58A 2AOVA 3KQQA 3P9CA 2JH8A 3RODA 3OZTA 5DWQA 5M5BA 1RJDA 1SG9A 2ZBPA 1NBIA 2XYRA 5FA5A 5DSTA 10MHA 3ID6C 3BGIA 5CVUA 3FRHA 5DRYA 4QTTB 1VQ1A 3LDGA 3UA3A 4OA8A 5EVJA 4QQKA 2ZFUA 3A25A 4G56A 1RI5A 3SSOA 3TKYA 5IKMA 3G2QA 1YFJA 3I9FA 2QY6A 5CUQA 5JR3A 4KRGA 2BM8A 1VIDA 3GU3A 3PX2A 1KPIA 2YR0A 4PYLA 4MTLA 4A6DA 4E2ZA 4ER6A 5K05A 4HGYA 1OR8A 5E2AA 2HNKA 3EVCA 2OYRA 2QM3A 3FUXA 2JJQA 3CBGA 2FRXA 1IXKA 2PX5A 4WXHA 3P9IA 1NBHA 1XCJA 4KW7A 4RTNA 4GBED 4EKIA 3KQMA 3GXOA 1X19A 3H2BA 5HILA 4AZSA 4AZVA 4PIMA 1NE2A 1RJEA 3IHTA 4PGGA 1KHHA 2PWYA 2FPOA 1AF7A 5DPMA 4E2YA 5LQCA 1RI3A 1O54A 4PYNA 4AZTA 4OQDA 3HP7A 5DM0A 3B3JA 1JG4A 2FHPA 2HV9A 3DTNA 3BWMA 2AOTA 3GRYA 3OPNA 4KDRA 2ONYA 4PIPA 5E9JA 3PFHA 1P1BA 1DUSA 2FK8A 3EVEA 3TFWA 1O9GA 5IH3A 1JG1A 2P41A 2E5WA 2PKWA 4E2XA 1YB2A 4QVGA 3B89A 3MTIA 4GOMD 4QQNA 1JR4A 2C7PA 3GRUA 3SX0A 1JQ3A 2PLWA 2VZ9A 3C3YA 5EQJB 4CWAA 3LHDA 2O07A 3VC1A 4FT2A 4PYMA 3NW9A 1TW3A 4MIKA 3HA3A 4DZRA 4GQBA 3F4KA 3KPUA 5C1IA 4Y30A 5DTRA 3LECA 3LCVB 1QAQA 4H0NA 4ISCA 5CCBA 2GH1A 2GS9A 3G7UA 1ZG3A 3DH0A 2PX2A 4X61A 5EGSA 2IH5A 1YZ3A 3MB5A 4IV0A 4CXMA 3HA5A 1X1CA 1ZKDA 4GEKA 2WA1A 3P2KA 2AN4A 1WG8A 2A14A 4YV0A 3QOXA 3M4XA 3HEMA 4BLVA 2P40A 1YUBA 2F8LA 3ORHA 1DCTA 4LG1A 4RTMA 3A26A 3KR9A 3EGVA 1UIRA 4RTPA 4PYKA 1SQFA 5ERGB 4R6WA 1XTPA 3A7EA 5GWXA 3V97A 1RJGA 3G8BA 2AOXA 2ZTHA 2NYUA 3GIWA 3EVBA 1N7JA 3BT7A 1KP9A 3UJAA 2PWPA 3CKKA 2AN5A 3R6TA 3ME5A 4GOLD 5K09A 3GCZA 2PY6A 2ZBRA 2H11A 1Y8CA 5EZQA 2Z6UA 1G60A 2JHAA 2ZIFA 3BXOA 5DM1A 3G2MA 3DOUA 4F86A 4YV2A 2WA2A 4P7JA 1XDSA 4RTQA 3LX6A 3JWHA 4DKJA 3GDHA 3FYCA 2OB2A 3SVZA 3KQSA 5FULA 3B3FA 2Z6AA 3ER8A 4KIGA 1YZHA 2PXXA 5H02A 3KQWA 3HVJA 3OZRA 4EVIA 2IIPA 3HVIA 3REOA 3FTCA 3JWJA 3MCTA 1UWVA 1XCLA 2AZTA 1QAMA 5HOQA 4BLWA 3SSNA 4X1OA 5B1SA 2ZSUA 1R74A 4XUDA 1NW8A 2BH2A 5KYGA 4C04A 2XBMA 4P7GA 2ZLBA 2QYOA 4DMGA 3GRZA 1ORIA 2HMYB 1NV8A 1NW6A 1X1BA 2YX1A 4XUCA 2ZWAA 2IH4A 3FRIA 1FBNA 1QYRA 3G5TA 3KPJA 4ER3A 5CD1A 5EMKA 2VDWA 2NXNA 5GM1A 3ER9A 2I7CA 4PINA 1WY7A 5FA8A 3SXJA 4GOOD 2BR5A 5EKUA 3TPZA 3UWPA 3KR1A 5DTQA 3BWBA 1EAMA 1NV9A 3KKZA 4LWPA 5MHTA 2EFJA 3TOSA 4RTKA 3LKDA 3NWEA 3KPWA 5FWAA 2G71A 4JXJA 3UBTA 2C7QA 1MJFA 5E9QA 4HTFB 2BR4A 3MAGA 5E1OA 1Q0TA 3RW9A 2HR1A 3C3PA 4RVDA 4AZWA 1VP3A 5DT2A 1XDZA 2IPXA 5C0OE 4E70A 5DX1A 4XUEA 3TLJA 4YUZA 1QZZA 4YMGA 3AJDA 3EMBA 3M6VA 4DF3A 1NW7A 3T7TA 5EC8A 2IBTA 3P97A 5HIMA 4HTFA 1G8SA 4FP9A 5EHGA 2VP3A 4L7VA 1AV6A 5GM2A 5LR6A 3BZBA 3EEYA 3TMAA 2AOUB 4X63A 3G5LA 2OZVA 3SM3A 4CTJA 1EJ0A 2FCAA 4X60A 2C7OA 1G8AA 3FZGA 1VPTA 1SUIA 1NT2A 2IFTA 2ZIGA 3KQTA 1U2ZA 3B3GA 4U7PB 5EG5A 3G88A 1EJ6A 4PNEA 3NVKI 1D2GA 1N2XA 5K0FA 3CJQA 4PCLA 2OY0A 3ANXA 5EPEA 3MCZA 1D2CA 3MTEA 4P7FA 5D1HA 5P8WA 1FP2A 4FSXA 2AOWA 4P7KA 4RVFA 3LBFA 4U7TB 4F85A 3UJDA 4HH4A 1VP9A 2VS1A 3CJRA 4RVGA 3OE4A 3M70A 1ZQ9A 1P39A 4DQ0A 5FUBA 3KQPA 1VBFA 5LQKA 2UYCA 3DMGA 1ORHA 5U4XA 3UJCA 3OFJA 3C6KA 4BP3A 2ZZNA 4E2WA 3I58A 1B42A 3HCAA 4CKCA 5HZMA 4RTSA 1T43A 5EZSA 2P3LA 1L3CA 3UJ7A 3DXYA 3G2PA 3Q7EA 2IDJA 2CMGA 4HSGA 3BWCA 4X41A 3PFGA 5HEKA 1QANA 1X1DA 3UJ8A 3IYLW 5K0LA 2UZ4A 1TPYA 4QTUB 5EHIA 4M37A 5DSXA 5LSAA 3E23A 3NDJA 5FHQA 4BY9E 2PXCA 3R24A 3FUVA 3VYWA 5GINE 2LD4A 3FPFA 2OKCA 5KVAA 4BP1A 3M6XA 5EEGA 4AUKA 4DM3A 1I1NA 2O05A 4IKPA 1L1EA 3EVGA 2YTZA 2PSSA 3UZUA 2JH9A 3KQVA 2K4MA 3LL7A 3IV6A 2AOUA 3DXZA 2EJUA 2ORED 4OBXA 5EMJA 4RWZA 2EX4A 1IY9A 3I5UA 3EEOA 3MHTA 4RTLA 2YXEA 2NP7A 4QDKA 1WZNA 1M6YA 1L3IA 4R6XA 4E32A 4KDCA 3P9KA 1M6EX 1AQJA 3EVAA 4E33A 1BHJA 2VDUE 3E8SA 3EGIA 4O29A 5F2NA 2KW5A 3JWIA 1R8XA 4EKGA 3NJRA 4GOND 5E8RA 3CCFA 4PWYA 3QOWA 5CM2Z 2V7EA 3OE5A 1KR5A 3R3HA 1EQAA 1JQEA 4M38A 3OU2A 2EJTA 2P3OA 5FWDA 2P3QA 1BKYA 2HWKA 2ZULA 2YVLA 3BUSA 3OU7A 1IM8A 2NXCA 4PYJA 4R8RA 3DUWA 3PVCA 4KVZA 3MGGA 3LBYA 3OU6A 1BC5A 5DRTA 5E8JA 3PLAE 2O0LA 4OQEA 1PJZA 5CVEA 5CCXA 1XXLA 2FK7A 4IV8A 5CVDA 3K0BA 1JSZA 2YXLA 3JWGA 5K0NA 3WSTA 3KR0A 3E05A 2DPMA 3DMFA 3C6MA 3BWYA 2PBFA 5DM2A 3EMDA 4GC5A 1Q0SA 3FTFA 3EVZA 3G89A 3OFKA 2CMHA 4PYQA 1WS6A 3FTEA 5K0GA 8MHTA 2UYOA 1F38A 2AVNA 1TW2A 2CL5A 3KR2A 5DXAA 1JTFA 3I53A 3M33A 3V8VA 2B78A 2YXDA 3FPJA 3HM2A 2ESRA 4ER7A 3AXSA 2ZWVA 3TRKA 1NW3A 2UYHA 1BOOA 3T7RA 2GAFA 1P91A 1XJ5A 3FYDA 3G8AA 3O31A 3A7DA 5DLYA 3EVFA 4YUYA 2O06A 1R8YA 1FP1D 1RI1A 5ICFA 3SR4A 3BKXA 3EPPA 2ZIEA 3HVHA 3M6UA
chains in the Genus database with same CATH superfamily
4HAYA 4R3WA 2O52A 3C1TA 3CVVA 1V1RB 1ZN2A 1Z4IA 2IY8A 3KJGA 2QRKA 3PKIA 1T0IA 3MNFA 1UP6A 4DCCA 4DQKA 2OK8A 3Q2OA 4GWGA 2AD1A 3SZRA 5I7SA 3UJHA 4IFBA 2ETXA 5DX8A 2OZLA 1RPNA 3RVSA 3UKJA 2OAGA 3PJRA 4ARSA 3L8ZA 3KWJA 4XCXA 2C9BA 4YT4A 3EZGA 3KYCB 3OJCA 1JT9A 2XXJA 3WGLA 1X7HA 2MYUA 3QFFA 3GROA 4N1AA 1BMTA 3UWOA 2RB5A 3RD5A 3A05A 3A1NA 5TQ0B 3VBCA 2DBZA 1KOJA 4WEQA 3PCXA 4AQDA 3ZE6A 4NF2A 1LLCA 3D9QX 3HZRA 5D7BA 1H3NA 4O25A 2HZBA 5GGXA 5DASA 1W48A 4LJKA 3QOYA 1PJSA 1JEJA 2FDRA 3L1IA 4J0QA 3HUUA 2YV3A 4RD0A 4LE2A 5K6AC 5ICMA 3NGMA 5DGXA 3AJ9A 1WMEA 2CXQA 1QUFA 1NIJA 2WWFA 3O4FA 4O59O 3WGJA 1GAXA 2IEYA 4G5FA 4IFEA 3TIVA 1UFKA 2CJWA 1QCYA 1KYZA 1XBTA 4M1TA 2NU7A 2P35A 3DUFA 1QAOA 4MIYA 2XZDA 3PS9A 2GCPA 1FNMA 4MLCA 3LWNA 2Q1WA 5FOWA 2A67A 4F5DA 4H6PA 5KNBH 3FMGA 2H9AA 2R8YA 3QBEA 3K0KA 4CR6A 1PEDA 5TPZD 1M75A 1TEXA 1TLTA 4WK0B 4Y6QA 4NP6A 3DR5A 3JCZA 2EW2A 5IVKA 4JLNA 4UBIA 1YR6A 2LW7A 2V4ZA 2H1CA 2VJLA 5DF1A 4KR9A 3T41A 4AZ0B 4NCHA 3QX7A 4O08A 4IYJA 2XYVA 1NRXA 4OQMA 2JLRA 5MN4A 1ZLXA 2I3GA 7ABPA 1JW9B 2JLQA 3BXGA 3QBVA 1SD5A 1A9PA 4JENA 5JNTA 1MEOA 4B5LA 3BGWA 3G2OA 3PR2B 2YJ6A 3TLEA 2XQIA 2NADA 3GVHA 2FP4A 3PXDA 1IQUA 4BNUA 1FSPA 1RJWA 2WU0A 2VHQA 1LNQA 4UFPA 1JLHA 2G28A 4LISA 1U65A 5T8KC 2G72A 1R12A 3TUIC 1URPA 3DOIA 3U19A 4LVNA 1LF0A 4GVXA 3PHBE 4IOKA 3E9YA 1JR3D 2BY4A 4J49A 4EK9A 1FFGA 4G01B 3RC9A 1PSDA 3T3IA 3A8TA 1DKPA 5T4HA 2IF2A 2D8AA 3HR4A 3KJIA 3W4JA 3NCHA 1ZONA 4XSVA 5FQNA 4NBKA 3ZGYA 3LCUA 4U1RA 2ON6A 1KFCB 1IL0A 1TTQB 4QGHA 3ZHXA 3B48A 4A1OA 1N6RA 3MUOA 4E4TA 5JARA 5ILOA 4RA6A 4G5RA 1AQLA 1Z0KA 2J3LA 3OCVA 2R4TA 2QTGA 4RLFA 4R9NA 2LCQA 4EYEA 4AL4A 4BLUA 1OB2A 4OQPA 3O7WA 1E1DA 1JTVA 2MINB 4M1ZA 4XJTA 2KM1A 2XOKA 1IFXA 3RS5A 2JKZA 2VRWA 4R1NA 2F4NA 5BMOA 1LTHR 2NLOA 2QIOA 2Z58A 3VC2A 1W76A 1NN1A 1PBNA 3O90A 5GOTA 5H80A 2XQJA 2ZBUA 1T5BA 3FF1A 1YGPA 3QLVC 1T13A 3D4OA 3B7GA 3KAKA 4RK4A 5FPYA 3RFCA 3ZI7A 5JAHA 2WT9A 3PQFA 2ZUSA 3D2LA 3K0EA 4RC9A 4GI3A 3M8KA 1PIWA 1ZSNA 4M49A 4AO6A 3ZD6A 2X76A 3K31A 3UFBA 2VRBA 3K9GA 3QV2A 1QWSA 4A27A 4WI1A 1T5LA 5I7AA 1OD6A 2CDRA 1IQRA 1WPXA 2R65A 3OPYB 1HNNA 3V4OA 5AUPB 1Z5PA 2V97A 2FSGA 4DCMA 2QBYA 2BFPA 1BGXT 1UJBA 3FSRA 3RIEA 3UGJA 1OAKA 1JIQA 4DV5B 1S7GA 2J6BA 1J42A 3OF3A 1T9HA 4HAWA 4RBNA 2GKGA 4TYNA 2R0QC 3T6KA 5KVSA 1ZCZA 3UK0A 1ODLA 5JJBA 4I4TF 1SURA 3KSDO 1ZGZA 1Q1QA 3SY8A 3H0CA 3K1JA 3R5FA 2LDBA 2QBYB 1Z08A 4LF9B 4CL3A 3E22B 5EIBC 5GAJA 3UJPA 4O2AA 4KMOA 2FSUA 5LD2C 4YONB 2AOTB 1IM2A 2IXBA 4Y2HA 4HQ0A 3SZMA 3VR2D 3WLHA 4C88A 5A3JA 5CFZA 4AY2A 1NVUQ 1T9GR 2H9IA 1N2IA 3CLHA 3CUWA 3ISJA 4UDOA 4CM9A 4F46A 3AL0C 5GJCA 1WW2A 4MWCA 1ZNZA 3H7AA 2QRVB 2WPDA 3D02A 1JPJA 4TRMA 5LP6C 4BVKA 5KNBD 4EUSA 2QAGA 4B80A 5DXFA 1SHZA 5KSYA 2VVTA 1G4UR 1ISRA 1SBHA 3KLOA 4MQFA 1R9GA 2FE1A 3L2OB 1K06A 3UFXB 4E30A 3C3BA 4NG5A 2P62A 1IY8A 4J0JA 2WTAA 3CX8A 3EQZA 4PN3A 1LEHA 1G98A 2WDPA 1W30A 4F06A 1NC3A 3CVJA 4P0QB 3HFJA 1GSOA 3KLMX 3UGTA 2EZUA 2EP5A 1CDEA 3PJEA 5DYWA 3EPJA 4B2LA 3FOFC 2RKBA 5EVJA 2HA3A 2KSQA 1Q0ZA 1JPNA 3T34A 4MQFB 4M8KA 1U4SA 1JAIA 2IZZA 2P6PA 1R64A 2WUVA 1AQUA 3P27A 2BMEA 2C8VA 2W8BB 4FK8A 3UMBA 4XM1A 5JJLA 1SCIA 3EJ6A 2MSKA 3IBYA 3LY9A 3QM1A 2W83A 3TEMA 2HWUA 4JD5A 5E2AA 1L7EA 1NJSA 3ZGVA 2I3BA 1W2HA 1NJ8A 3QPDA 5CB8A 4EVRA 2XHZA 2ZUVA 3KXLA 5CU7A 4WXHA 5B58C 5AP9A 1NBHA 1Z4MA 2YZ2A 1EVYA 1OX4A 1DO2A 1ZU4A 4R2MA 5AVOA 3HO8A 4ZGGA 2HW8A 3O0TA 4TQ9A 1AVTA 3HEAA 4MVJP 1LXCA 1VKRA 2G4LA 2NG1A 2YWFA 3O82A 5LQCA 1GFWA 1YH3A 4D4LA 3NKVA 4ZOLB 4QJ3A 2CNOA 3NHPA 5F7ZA 5H3CA 2W5UA 4CQMB 3B3JA 4FXPA 2FHPA 5C7OO 1E66A 3GRYA 4MH0R 2AG0A 2ZYSA 4UMFA 1TKRA 1NYLA 1LVGA 3LUBA 4KU4A 3VVMA 1BW9A 3TFWA 1JHRA 2BMFA 2VR1A 2YIVX 3W5CA 3WLIA 1RTKA 3D81A 1MT0A 4MGIR 1GSHA 4BE4A 5DM70 3CH4B 1U2QA 1JR4A 2Q2OA 5BYBA 3TW4A 3ZVRA 1T0UA 3SJAA 2ZRJA 1B2RA 1SVWA 3C3YA 4X84A 2IS6A 1S2DA 5JEDA 2QX7A 3LHDA 2I6XA 2O07A 2DUNA 1LBTA 2VDPB 5EFZA 4WBNB 5G0TA 4QAJA 1SFRA 1R15A 1FUYB 1RLIA 1RRGA 2WFAA 1K66A 5E3JA 3RIMA 2HV8A 3F4KA 3LCVB 5KHLB 4COKA 4TV8A 2NQTA 5FNVF 1C9MA 4AFNA 2AYXA 5KWJA 4HQFA 3PXGA 3AF6A 1YZ3A 1PS9A 1W6RA 2A88A 3NXSA 4F56A 1X1CA 3FM9A 4KDFA 1WG8A 4BATA 4XFJA 5HX7A 2PFGA 3RAEC 1FP6A 2R62A 4JELA 4NDZA 3FNGA 4H7IA 5CEEA 2J9RA 4B2IA 2WU1A 4LG1A 3MTBA 2NUPA 1XF1A 1ZUIA 3AL3A 3M1AA 1K89A 2BTQB 1HSZA 3PQ2A 4LC9A 4KIUA 4MV6A 1O8CA 1JFFA 4LXHA 4KE7A 2HUPA 1GRCA 4XOIA 3GFVA 5C8YA 4C0QC 3LHKA 2B37A 4YP1A 4JFAA 3ROEA 3ROTA 721PA 5HZKA 1E89A 1HR0B 3H84A 1XFAA 4LJ8A 3AZOA 4MRMB 3JU3A 2ZBRA 1EM8B 1N6NA 4OFWA 2H11A 4FGKA 4GECA 2YHBA 3GPLA 3LYAA 1PLJA 2NZXA 4G0PA 4P0TA 4TGLA 1G9TA 1ODFA 2G8LA 4GQAA 4ITVA 1KJWA 3GVCA 4MYUA 1QQAA 3O2JA 1SOMA 2IIBA 4DLNA 4BWGA 4HUJA 2QQ5A 1A5SB 1G20E 1PV1A 4NFYA 4IHKA 1EM8A 1E4OA 3UOAB 2HT1A 3W0LB 1MENA 1E3LA 1QHXA 3V80A 4MS1A 5KKCA 5MDHA 4ZAYA 4CKWA 5FTNA 2QD3A 5J47A 2C2MA 2ZSUA 1W73A 1XCBA 2GBCA 3GNSA 4GYJA 4J0FA 3SNKA 2J07A 5KYGA 1V4BA 1ISJA 4OY3A 4XKJA 3V4VB 1CJUC 3QELA 4FBGA 3EY9A 4JLPA 1UWLA 1N2CA 5AO9A 4BFZA 3HFRA 3OZFA 2BISA 2YX1A 2D5LA 4IHAA 4MKGA 5FBZA 5FWXA 1Q1NA 4O6VA 4Q47A 1ZCAA 1YR1A 2E6UX 2QRNA 3AUKA 4NABA 5IC4A 3AHIA 3G5TA 2I4RA 3NONA 3T1HB 4JEHA 1K7XB 2EJBA 3RWMB 3ENNA 4Z54A 4P31A 3Q9NA 3ENWA 3A4VA 3H1FA 4B3DA 3LQYA 4RM2A 2FETA 3C70A 4ZV7A 5B7GA 2B21A 1MXHA 5MHTA 4JJ4A 4EPTA 3QUBA 3THWB 2WMOB 4OSEA 3UG6A 3TRFA 1DTWB 1OYVA 1MJFA 4FBMA 2R87A 1X2BA 4BU0A 4IJUA 3IUSA 5TSDA 1P29A 4C76A 3ZJTA 1TQ6A 2HR1A 1TFRA 3C3PA 4YJGB 3FNBA 2P2CA 4J6FA 2TMKA 3CUYA 1RQ2A 3QVUA 4M0CA 4FGWA 1XRQA 2FFJA 4I3GA 4KQ1A 4WLOA 4HR7A 3BMCA 3J7TA 4O5AA 2EVWX 3IHWA 5IK2A 3SF8A 4W1RA 3U56A 5KYWA 1IH8A 5EIXA 1LDMA 5FBVB 3W8NA 1II9A 1LPOA 2PSFA 2WSMA 3GFSA 5H9WA 4J8PA 5LR6A 2A8YA 1F6BA 4S12A 3UB2A 1RAFA 1E2PA 1WVMA 4BQPA 2EYUA 4RZIA 5CFRA 5JMOA 3DV9A 3KWFA 1ZEJA 3OTIA 1KTVA 1BEZA 5DT9A 2C3YA 4BQQA 3W05A 2HF9A 4FR2A 5ADWA 3K2EA 1SUCA 2WUDA 1S5PA 1T8YA 1XB2A 4OFZA 1RAIA 4FIDA 4BCBA 4KREA 5EKDA 1U7HA 4P80A 1EDOA 3E3AA 2W6JD 1A95A 4ZYLA 3UW3A 3LBFA 4OK6A 1KL7A 4D2IA 4TMXA 5HNKA 4RD6A 5L7WA 2GAIA 4PQRA 1PFGA 4H4EA 1T36A 3EUFA 2JLSA 4L0MA 5DULA 1F2VA 1PF7E 3LUDA 5AXAA 2JLZA 1GLNA 4L5JA 4D3SA 3HUFA 3OJFA 1W4ZA 1FP4B 1WTCA 3ESAA 2ATVA 3ORYA 4RF4A 4TKUB 1ZLYA 3GUZA 4QDTA 2BKUA 4NJEB 1FRZA 2PLNA 1DRKA 1HE8B 1APBA 1GN8A 2GJSA 2ID9A 3TZKA 1E0AA 1TD1A 4FHEA 4UCXA 2QTLA 1QPZA 1O95C 2AG8A 2AYZA 3HGTA 3PC8A 2H4JA 2HDWA 4YQYA 1W34A 3G8CA 2P9FA 4A6XA 1CB0A 4OM8A 5ALGA 4DZTA 2G3YA 4GZ6A 4U7GA 1Z6GA 3KDPA 4G26A 1JJAA 3VR5H 5JD4A 3QVGB 3VYWA 1E7YA 3FPFA 4IJ6A 1NW9B 1J09A 3VZBA 5K8JB 2C96A 1EDDA 1SCKA 4I81A 4WLNA 5BNFA 4RK5A 4O1MA 3ZNNA 1H5UA 2OZPA 2L17A 3FH0A 2Z4RA 1Q0RA 3HEBA 4LZWA 1WB5A 3X1XA 3R8FA 1YXMA 4CNBA 3KCNA 3A9CA 4UTVA 4QDKA 4EPYA 3JZAA 5LQSA 2GILA 2GXAA 5TRTA 3G0IA 4E33A 4FI3F 1LD3A 2YJTD 3PDIA 2H63A 1J24A 1EXDA 4GOND 3MJFA 5CX1B 2H1HA 3L01A 1DJOA 4OEHA 4PWYA 4MCAA 3VPSA 5CT5A 3Q6MA 1SUFA 3KWLA 4GP7A 4DQVA 2FWJA 5KX5F 2P3OA 1VLLA 3HDHA 4L3VA 5KSZA 1XCGB 4RLSA 1U9ZA 3LI2A 3GLTA 4PYJA 3PVCA 2O5EA 4JI0B 5IBQA 1MO4A 3OU6A 1BC5A 3M9LA 5IWCA 2HCFA 4KQGA 1IOVA 3NOXA 3TVTA 1LDGA 3K1YA 2M6LA 2YHUA 521PA 4A0HA 5DCYA 5HF5A 4CR8A 4X7BA 1T8UA 4MA0A 2PQ6A 5DM2A 1EB9A 1M73E 3DBHB 1HURA 1K8ZB 4NYJR 1EBFA 4UNQA 2BE7A 4B85A 4BMNA 4EH1A 4KQEA 3FTEA 1U7OA 2RK6A 2JBAA 1TVCA 2EWMA 2Q3FA 1S3GA 2W0SA 3I23A 1X8JA 2XIJA 2B78A 3QP9A 1NP7A 1Q44A 2R1VA 3BB1A 3H2HA 3C43A 3PI6A 4TUYB 3ZI4A 4YJ2A 1IJEA 4I4IA 3C7TA 2XCIA 3LVFO 4FSHA 4HNAA 1D2MA 1D6MA 3J7AC 3IEMA 3VTFA 2VF7A 3BZWA 3CSDA 1A5TA 3FGNA 2H8GA 3MQ2A 2KMLA 4V0OA 4HAXA 4JHXA 3TXYA 1W52X 2CD9A 1NY6A 1Q12A 1YQXA 3INTA 3O8OB 2VF8A 3OMLA 2CKDA 3QLEA 3WNZA 4ZYXA 5JXGA 1M5RA 4TTIA 3BMQA 4NMWA 2L18A 4NOJA 4TWBA 1CJSA 2A9QA 5T3YA 1N8KA 1QIJA 3I9JA 5GP1A 2W7TA 5ALRA 4J1SA 3TM5A 4P5DA 2IUTA 3ETNA 4UHJA 5EJ6A 2GUWA 4KIFA 2X14A 4X66B 1CTQA 3CNBA 2OGSA 3HBAA 4UZFA 4YRGA 3PA6A 4ZCIA 5ICSA 2PX8A 2B4QA 2GPJA 1Y5NA 3PC8C 3RF6A 4D45A 4D98A 1CRZA 2D1TA 3JVDA 4M60A 4RZ2A 3S2GA 1MRNA 2QSUA 1IWPB 1JDPA 5I9SA 1UBSB 3KJEA 5JC8A 3KJHA 3RRNA 2EIXA 2HFJA 2ADOA 3NBKA 3WG9A 2VCHA 2MR6A 3PICA 2B35A 2V6BA 4D9FA 3ZZ0A 1GYRA 1QFXA 2FMUA 3CISA 5E0OA 2SECE 2OSVA 1CJBA 3ET4A 3PZBA 4I5GA 4YGYA 1DUIA 3S2ZA 2TECE 5DOVA 3SHFA 4F8EA 3H65A 5HFAA 9GPBA 1EB8A 4Q21A 1DFGA 1US8A 3AU9A 4LN1A 2QT9A 1MMFB 3EZXA 4HEHA 2IKSA 4JMLA 4RVUA 4C0JA 4DDVA 1YL6A 1BH2A 4X6YA 3HUTA 1AQYA 3NHKA 3U3OA 3P19A 4II7A 3CNEA 2ZK7A 1A2KC 2WAXA 1OZFA 2H0RA 2RGYA 3NH9A 1U0OC 2YZ7A 1V26A 1JSCA 5K3DA 1D2NA 1R9MA 1KK3A 4FFDA 1C1XB 4U63A 1JBEA 4JBIA 4MKRA 4BNLA 1FJXA 3ZV7A 3DW3X 5BR7A 1NZDA 1GRNA 4FD2A 4CMEC 3U6BA 2WJVA 4AB1A 2V3WA 3OZSA 4TXLA 1WHTA 3DOHA 4HFMA 1JFTA 3LKVA 1ZIPA 3FCOA 5C4MA 1G55A 1TB4A 2OBYA 3QENA 4DPKA 1V47A 1UBUS 4XIGS 1ZUNB 1T25A 1Y81A 5J40A 1XTZA 1Y80A 4CM9D 2D06A 1E99A 4RLQA 3LHSA 4HRAA 5F7OA 4URFA 1YR7A 2O0KA 5F5NA 1N6HA 1C7FA 3LLUA 4G89A 5AJXA 5CXUA 2BFWA 4FLEA 3VYUB 2C3PA 2V5UA 2ONZA 1ENOA 4A0RA 3GP8A 2NXJA 1OWLA 2IPLA 2OILA 2YQZA 3NHRA 3WB1A 3DQQA 3PQ4A 3QU4A 4QXRA 4YRNA 1L7RA 2WSLA 1TAQA 4FOLA 4BQEA 1E7WA 1W25A 1BJTA 2R5WA 3A1EA 2DJIA 1OASA 4RTRA 2CK3D 3C6XA 1SVMA 1Y89A 1XDUA 3TJZA 1KOGA 3FWKA 1R37A 4ALLA 4CEJA 1IN4A 4PCAA 3WDSA 2UYQA 3BEOA 4JP3A 2R8ZA 1DUVG 4G8CA 4MSUA 1EWQA 1U7UA 5DNWA 1G4AE 2H2WA 2ZATA 3PXCX 3ZDFA 3KJXA 3WKAA 1QH1B 2ZSDA 3N5CA 3H83A 1QU3A 4S35A 4R2HA 3F6PA 2E6KA 1T1EA 3KPVA 3DE3X 5EXEA 4F5ZA 1IN1A 1ZA1A 1Y63A 4E12A 1N34B 4G0UA 2DP4E 3HRHA 1SC1A 2I80A 5TS3A 1E7QA 1XYGA 3GRFA 3I2HA 3L0PA 4N3AA 5FPQA 3RVOA 5LZ9A 2PGJA 2ZSIA 3L7OA 3N2ZB 4J29A 1WZEA 1QH1A 2W8BA 1M67A 5IPFA 3P0IA 4OMDA 2NW6A 4N0DA 4WJKB 5AJYA 4IZ6A 3SQMA 5EHXA 5GIPE 2XDQB 4JL5A 4OM7A 1JHAA 3DP7A 3QE3A 4H7JA 1H4TA 4BOYA 5BP7A 4AKIA 1P5FA 3JXEA 3L6EA 1ZHFA 2WLSA 3R5SA 5FCDA 5KQSA 2G09A 2ONCA 2ZYTX 3C2QA 3F71A 2AQ8A 4JYCA 4OF4A 3SBDA 4C0LA 1C3EA 1S8OA 3L6CA 4LTDA 3G2JA 4M0FA 2C7GA 1K3FA 1U02A 3DB2A 4CKEA 1N32B 2GGSA 2PD4A 4WZAB 3ZE0B 4RX1A 4BO0A 2OXIA 4ZEVA 1FSZA 3D6UA 4PCVA 2GK6A 4D02A 4JI4B 5LZ7A 1B8UA 1DIAA 2NX2A 4TX1A 1XDGA 1UEJA 3O2NA 2CHVA 2WVJA 2PBRA 3TD9A 3PFCA 1QRSA 1SHKA 1Q15A 1VGQA 4R1SA 3PNLA 5BSEA 1D09A 1OI4A 3D4NA 2BF4A 2FR0A 4JJZA 4JXXA 3JYPA 2N47A 2OK7A 4L75A 3S3TA 1C8KA 4DBLE 1CEYA 1V6AA 3PKZA 4UW9A 5AH0A 1GEEA 1KYTA 5CVVA 3I04M 1U3GA 1USIA 3EW7A 2FEOA 4ROTA 3W2TA 4D4JA 1SUEA 1Z74A 1NAIA 2QKYA 1ULUA 3Q5DA 3K71B 4BNWA 2GD2A 2Z2JA 1A3CA 2HD4A 2VLBA 1RJDA 2Q45A 1PVVA 4XPZA 5K45A 1VGVA 3I34X 4O63O 1BQEA 1LGYA 1P4SA 2BOVA 2CXRA 2YWCA 4OKSA 4WRRA 3UMGA 1NBAA 2Y1EA 3ONWA 3QVJA 2FPKA 1SBYA 3VSCA 5ALZA 4L0DA 5DVZA 1PEAA 1AKNA 1PN3A 3T7CA 3K9QO 3L0ZA 2OG2A 5C80A 1CF9A 3LQ2A 4HDKB 1E32A 5FOVA 1X9HA 6ADHA 1NQOA 4EARA 5C8VA 1NRJB 1U80A 3FHCB 4LRWA 3OF5A 4H4DA 3ITDA 4CCYB 4K6OA 2NU9B 1V8FA 1CIVA 2G0AA 3MUFA 2VEDA 3NU1A 5AVWA 2YWRA 4BBZA 2HSGA 4DJDC 1N2EA 2OV8A 4PZLA 2ZETA 4R0MA 5BT9A 1GJRA 1XTQA 5JSKA 3QV1A 1R88A 2ILVA 4HADA 5TQVA 2IQIA 5T3UA 5TPZA 3BXFA 3IOMA 2ZJ3A 4ETNA 1J9EA 1FFEA 1SCDA 3PD0A 1DXQA 5FPHA 4DR1B 5GQSA 4OUKX 1GRRA 4NSNA 1UDRA 3QE2A 4X95A 2VBFA 2EKQA 5JH7B 4LZAA 4BAUA 4EENA 2G5CA 2Z83A 2FPLA 4XWYA 2H2HA 2QW8A 3V7YA 4F12A 2BSQA 2HU7A 3JVVA 5K3AA 3PHHA 3RE1A 5F33A 4M9QA 5B2FA 3ZQJA 3TQTA 2CVZA 1MABA 2PKWA 1TJYA 4EO4A 4BV2A 1KJJA 1UZAA 2GSDA 3H1AA 3JQEA 2I6UA 4CKZA 2P6MA 2J0UB 2PMCA 2RMKA 2PLWA 3AUUA 1V25A 3NAGA 3QPUA 5EQJB 5IS2A 2CV1A 4KR0A 4AO8A 4Q12A 3PIIA 5B57C 1FY2A 2YS6A 2EF1A 2F1KA 1L7NA 3CRMA 1SIOA 3MK31 1BN6A 5A0VA 2BFMA 1QX4A 2AZMA 4A16A 1M83A 3MPOA 1RP1A 1Y9AA 3NWPA 3OSZA 4HH1A 4NZMA 4ARIA 2KLBA 2XD9A 1FMCA 2W6ID 2GBLA 1U1FA 3LQ1A 4ZODA 3QMWA 5JS6A 3V8BA 4P86A 3T4EA 4X71A 4GGPA 1H0SA 3A32A 3BN3A 4JSRA 4ZAVA 4DG9A 4YV0A 5NULA 4W63A 1PFKA 1V5EA 1QG4A 2OOKA 4IKOA 1GPWB 3BE4A 2BE9A 1X2EA 3GLKA 3IBSA 3NYIA 2JZOA 3FVVA 1EUCA 4XLLA 4X20B 3SEZA 4FFOA 4Q6WA 3KU4A 4R6WA 4N0QA 1CY2A 3L77A 3G79A 3IEUA 1DPFA 1FSFA 1RVV1 3WJ1A 2AOXA 2AC2A 1J2JA 2Q28A 1SBIA 2XUPA 3F47A 4RHYA 2PX3A 2XGMA 2GZ1A 4UU7A 3F9IA 4MGYR 2BP7A 1FSSA 4BNXA 3DEYX 4OHZA 2XUQA 3CHYA 4Z4EA 3CRVA 2WJIA 3AZPA 2K2QB 2E4YA 4JKYA 3GUYA 3HBNA 4RADA 4NJMB 1DKNA 1T26A 2B69A 1Z5ZA 3BXOA 3EYAA 3KBBA 3EXAA 5KU1A 1AGPA 1ZM7A 4K81B 5ER6A 3AHHA 5TJHA 1SR8A 2C8LA 2HMUA 1QKJA 2ZUUA 4WD3A 3GRPA 4DW8A 3HK2A 2P79A 4TTTS 2IEIA 1EP3B 2UU9B 2BL4A 4RS3A 4WX2B 1YZHA 3L02A 1ZJ4A 4AKSA 3IODA 2XVXA 5IASA 1GTG1 2DKFA 3R76A 1JBKA 1HKUA 2CBXA 4EVIA 4F9FA 3SYLA 4DN6A 4ZJYA 1U2EA 1I4DD 3GA0A 3JWJA 3P20A 2OBLA 2VK1A 3FYHA 4HH3C 4DSOA 4DXDA 1KEEA 3R77A 3DL2A 5DISB 2H1VA 5H3LA 1Y3FE 1AZSC 4YT5A 3H3JA 4V02A 1NVTA 3LLMA 4G5YA 4H3KB 4UU1A 1TVEA 2BGIA 4CIYA 3K0AB 4PZUA 3CEJA 1PFUA 3VYRB 5E7JA 1GQSA 1KNXA 3H1GA 3NVDA 4BFVA 1TJ4A 3EQ6A 4NBWA 2K87A 3IP1A 3V4SA 2MSLA 3SQLA 4QTYA 1Z4JA 4DUZB 1QU2A 4OQXA 5DW0A 2V6GA 3A1TA 3ADCA 1WB9A 1I80A 3EE6A 4AMYA 1N2JA 4ICIA 2C94A 2V45A 3KKZA 3HZHA 1R4AA 3GX1A 2O50A 4IDAA 1WLSA 4UBJA 1LF5A 1Z5GA 2PZFA 4RD1A 5IKPA 5EJGA 3R3VA 3G8DA 1X7YA 1YB6A 3DAHA 3HJNA 4N9QA 4NVRA 5C52B 2WKQA 2BR4A 1OBHA 5L3RA 1Z2CA 2BI8A 1EE2A 3U7JA 4AMZA 4RVDA 1K7CA 1AJEA 4BS9A 4MW7A 4RNDB 4BNNA 3VO1A 1QH8B 3QPBA 1LPAB 2QLNA 5CFNA 4AS1A 4LBWA 4KMSA 3GT0A 4I3FA 1ZXLA 4A2PA 7MDHA 5I3CA 1J0EA 1T3GA 4PBSA 4Q4LA 1Z37A 4UEKA 4C4RA 1AC5A 1ZIYA 4HTFA 2ONKA 4QBIA 4X45A 1MOQA 1C9DB 1GV1A 2X77A 3CRNA 3CTMA 3NIGB 2PQMA 3O03A 4O4HB 1TF2A 5H70A 1U0BB 2O8DB 3G5MA 3TMAA 4BGUA 3S81A 1MOZA 2Z3WA 4CTJA 1POWA 2AI2A 4X60A 1QFYA 4LE1A 4XVCA 4ZK2A 1E63A 4GMXA 1EGAA 1FU8A 2CLHB 4QECA 2C9DA 2Q07A 2ZRKA 4JB3A 1ZICA 3TI7A 3PFBA 4GLJA 2VTDA 1K1EA 2PKYX 2WUWE 3MTEA 4IXMA 4XE5A 3KOUA 1EVLA 3S1SA 5JO9A 1U7WA 4D46A 1TM3E 3IAS1 3SCZA 2A2ZA 4XB2A 1NJ1A 5MFZA 1YJ8A 1SOVA 3CJRA 4ZOQI 3HPQA 4ZPJA 3UWSA 3RK1A 5B5SA 3SIPA 3AW9A 3UQYS 1NVVR 4L57A 5KU7A 3S5JA 5KTNA 2ODWA 1AQ6A 1ABBA 3LG2A 5L7TA 1DFIA 1ORHA 4F9GA 3EG9B 4XLTA 5JNWA 2OO5C 1DC4A 1DQSA 1TJNA 5FV7A 5FBWB 1U3TA 2IYQA 2JLUA 2PCJA 1ITZA 1QYVA 1Y1KE 3KHUA 3QZUA 1KKUA 2JPDA 2A1TS 1QIDA 2D0IA 4IMRA 4DVJA 3WAJA 3AEUB 3GIDA 2IHUA 1WKVA 3LFTA 1ZZEA 4QU9A 1ULTA 3L8HA 4ZMBA 2XMSA 3CF4A 3GJRA 4HFRA 5LXTF 4D8YA 2IYFA 4U2DA 5I7UA 2AKAB 3FYUA 1ZCJA 2O3SA 1P74A 2ISSD 3AZQA 3L1HA 1QUEA 2PG3A 1CJTC 3MWDA 4Q1BA 2CFSA 4Q3LA 4GPTA 2OGZA 1Q57A 1WOMA 5DTIA 3AJRA 4WL0A 3UMCA 4DCNA 2CSUA 3M5DA 4L95C 1M2NA 2BUCA 3C85A 3G85A 3ZS9A 5FUMA 2CXXA 2K4MA 5CA1A 1KQPA 3B6MA 2EJUA 4OQ4A 3GNQA 1M8JA 1XAHA 1M5TA 1XTBA 2EV9A 2EX4A 4UVGA 3E84A 1ZSYA 4JLWA 5BNIA 2X8BA 2A0KA 2NP7A 4PG7A 1L3IA 4IXDA 4Q3KA 4KDCA 5E4JA 4NV0A 2NPFA 1P7CA 3CG0A 4Z4GA 5EUBA 2XNKA 1O6BA 2O0MA 3DV0A 5IF9A 2QUJA 1AHNA 2KYRA 5E8RA 5F5LA 1U1EA 2OCAA 3RBVA 3OE5A 2DAPA 2OWEA 3DPIA 3R3HA 5KOIA 1PO7A 2V6IA 4OI1A 3UQZA 2VDNB 3MWEA 5FWDA 3WIEA 2O4UX 3M49A 4DY4A 3DUWA 1T8SA 4YO8A 5CLJA 3STHA 3KG2A 1N5OX 1ZM9A 2HJ9A 1EFVB 2ZI4A 3M2TA 4U9IS 1VXOA 2WZBA 4DVGA 3PYXA 1CUGA 4ADSG 1L1RA 4HGOA 4EDFA 1FXWF 4A2CA 2EWWA 1JA9A 2XDAA 5L4NA 3BFKA 1BCSA 5HW0A 4FYYA 1YS6A 2EFDB 2F6RA 4JBHA 1JA1A 2GMWA 4GC5A 3WGMA 4QBKA 4BBPA 3UV7A 1PV2A 1X7ZB 1SXJC 1K75A 3QOFA 3WRYA 1M0WA 1QG0A 1Y4UA 4HGRA 2EBUA 2PIAA 1RRFA 3M83A 3P9XA 5JBQA 5L95A 3SQWA 3U3RA 4ACBA 1MFZA 1OLSA 3LPDA 3LT4A 1BVHA 4A8JB 2ESRA 1KZ1A 3FBWA 3K35A 4D9HA 1U9YA 3K7EA 5H0IA 3VI3B 2VJKA 3KOWA 1NVBA 3SE0A 4OXKA 5K3EA 3PG5A 5HF6A 2O06A 1EWVA 1CS4C 1ZJ5A 1H2WA 1MU0A 4Y9SA 4Z9BA 4PHGA 2NU9A 1W4RA 2JGLA 2Z30A 3F6BX 2RK3A 4M0UA 2XKAA 1JQDA 1QJ4A 2HF8A 4FSDA 1OLSB 4OLJA 5DHAA 3FPGA 3ACBA 1QO0A 3H5OA 1T6ZA 4DSAA 1UJ4A 1OX4B 2AJBA 3QWBA 2IS2A 1QGAA 2JLBA 3G1WA 4YS6A 4JVSB 2FI1A 1SPXA 3Q87B 3SG0A 1ST3A 4AG6A 4BASA 1PUJA 1VECA 2JFWA 2PFKA 4R8KA 1Q0PA 1PR1A 3CVOA 2IYUA 5B6PA 4B3IA 3NEAA 3UB4A 2GEBA 5JXHA 2X4IA 1XZMA 5AOAA 5BN4A 4UE3S 1LU9A 2DSTA 4KLZA 4EY3A 2PUTA 1PD0A 3LGAA 4J7UA 3KD2A 2HLHA 3R3JA 2G80A 4N7BA 5CRIA 3PU6A 4I9HA 2ORVA 3K0SA 2I66A 3EC7A 4INJA 2A5JA 4H6WA 1NMZA 3GGDA 3BCUA 2AX4A 3WK7A 3GFBA 1UP7A 1IG3A 1YL7A 2BDEA 2J33A 2VZEA 3D0KA 4WY2A 2NTNA 1B0ZA 2H4YA 2O8EA 1CE8B 5C51B 4NCIA 1HMYA 2OHJA 3Q0TA 4IEFB 4A2QA 2YBEA 3O2SB 4S1OA 2O0HA 2PUWA 3CB4A 4HYYA 4UUBA 2H2AA 4WCFB 1HNZB 2M6RA 1KVSA 4YQZA 5K1ZA 4QNRA 2DBYA 1EZ4A 5CAEA 3IR5A 1DV1A 1VYVA 2V7VA 2D5AA 2O4CA 4MUIA 3A3KA 5LZ2A 3TB6A 1VM6A 2DU8A 1NOJA 5AKLA 3OE7A 2MINA 4EB6B 2M9MA 2QRMA 4U4AA 1YB7A 5AUNB 1YQDA 5ALLA 4CMGA 5AJTA 3GEEA 3FIJA 2QTVB 5A7GA 2FUKA 2JFUA 2OP1A 2JLYA 4ARZB 2J0SA 1CB7A 4GXTA 1IZ7A 1SGWA 3CW2A 4KE6A 4V24A 4MHTA 2BVNA 3LY5A 2Q6VA 2ZRMA 4Y6PA 3I42A 3STTA 1FNDA 1JALA 2HMTA 3FDZA 3JASA 3WI7A 1M7BA 2HT6A 4W99A 3TZHA 3C4QA 2JHFA 4QBTA 1VLHA 4U2BA 2DQ4A 5L51A 1IIBA 2IQ5A 3W5VA 1YCFA 2YY6A 4XWAA 3TJMA 4HRVA 2W2VA 4EF6A 4WACA 2Y1LA 3EWAA 4HYTA 1KSFX 2XQGA 4N65A 5IKOA 2IYLD 4MUBA 2PX4A 2R1ZA 3IPRA 5EXDA 2P2NA 5F4BA 5TJ9A 1ZQ1A 2G1UA 4DQLA 2JFHA 2OBNA 5E1BA 2R8RA 4QUBA 2ZRHA 3CLUD 4ARVA 3W77A 3NHFA 3SK0A 2A9KA 2ZOSA 3C8DA 4ZJUA 3LQKA 1JPVA 2JG3A 1LW6E 3CJTA 1KH1A 1FYFA 1Q50A 3UGKA 5FOXA 2QOEA 2ZS7A 3FPHA 5F5XA 1LBSA 4M2LA 4CG2A 3TRJA 2XA2A 5A6SB 4M36A 3MXOA 1N25A 4AUEA 1YJQA 4CF3A 5C1BA 2X1HA 3CVWA 1T4MA 4LOHA 1ZJWA 1S9DA 1T9ZA 3R7DA 4AIRA 5GZ1A 4KC0A 4D4MA 1J00A 1E1MA 3NLLA 4LRTB 4Q3NA 2WAAA 3HUDA 3D8HA 4CGYA 4M0PA 2YH2A 3K6RA 3NJ8A 3Q3JB 4JN6B 2NU7B 1AO3A 2YZNA 3Q7QA 1AZWA 4YPOA 5EEHA 2C1ZA 3S29A 1NU8A 1IHXA 2X8WA 4ON9A 4XGRA 2TRSB 1DCFA 1A9SA 4LHYA 4CFSA 4JEUA 1TECE 1ZI8A 3QRWA 4UTRA 2M1ZA 2DPGA 1XZDA 4C30A 3PPIA 2BMVA 4B0PA 3ZQ6A 4K86A 4FGSA 3LW8A 3MWLA 1T10A 5U9CA 3ZJUA 2YC4C 1UAGA 1U0RA 3JQGA 3TINA 4Q4AA 1EE9A 3HCNA 3ZIAA 4LWOA 4BIMA 3V00A 1AGXA 1LZLA 3RUHA 2BEWA 3IIKA 3N39C 4B79A 1VI2A 2DHEA 2Q29A 3CGGA 3G1UA 3R20A 3MOIA 4B9AA 1DEAA 3PEFA 2XJ9A 3CTPA 5IEBA 1E3MA 4M9CA 3FWYA 5EWMB 1ZM2A 4YRTA 3V7NA 2I54A 4ZJZA 1VRVA 1PP4A 5KMGA 2INGX 3FAKA 5ERXA 3WS7A 1BX1A 1K6JA 3CT6A 3G9ZA 3UC5A 1ARZA 5JQWA 4JYZA 3F98A 4YP5A 4PTYA 3SDZA 1L4LA 3FPBA 1RZRD 1YRQA 1DB3A 2VDQB 3T1VA 3REQB 3LUKA 4L5CA 4QOHA 2V74B 4DNXA 3E82A 5EWMA 1JEAA 3HY3A 3SVTA 1RYNA 3S44A 2JBWA 2RHRA 2OC4A 3LWZA 3WRXC 1Y9DA 4HCJA 4GR4A 5KDDA 2HHLA 4ETWA 4ZZIA 1BN7A 4ILKA 3OLCX 5LBUA 3EIWA 4ZXPA 3TQSA 3PLNA 2QXUA 5ER9A 1YZGA 2RAPA 3IE1A 1W2WB 1GCOA 4TMYA 1QV9A 2OBXA 1RHKA 4WXEA 4RJLA 2VEOA 3K5PA 3DBOB 2XF8A 4HPWA 1IOWA 4CW7A 1CYDA 2NU6A 2PCLA 3BGIA 4LWQA 3URMA 4ZCLA 4YMSA 2WHEA 3RUCA 3DBLB 1U81A 4G56A 5CJPA 3EFHA 4BUCA 2COEA 3EMVA 1FXUA 3BD6A 1MB2A 2MIIA 3E7DA 3UNXA 3SBOA 4RSGA 3NNSA 2QJTA 2VH5R 1OZAA 4MPJA 4MOWA 4HGYA 1IZZA 3HH8A 2NU6B 2Y99A 2JJQA 4KX3A 3Q3HA 4S2UA 1W59A 3QVGA 2Q46A 1C0EA 1EUCB 3I4FA 3RIXA 1E2FA 1LSOA 4L73A 1A96A 3TLMA 2F55A 5G53C 4PIVA 1ZCFA 3ROFA 4DV7B 1QRDA 1DBPA 1X19A 1ECLA 3H2BA 5EUCA 1XLUA 1DTSA 4Z4CA 1W4CA 2IU3A 4E15A 3NIWA 1QZTA 3EC2A 2ATEA 3FWZA 2H31A 3P7MA 4G0MA 1P6QA 1ZR4A 3U4GA 4EBFA 2O0JA 4M9XA 1MUUA 4MR9B 2X9QA 1Y33E 3EIUA 3I0NA 3B2NA 3VU9B 4CIXA 5LDDC 4XEHA 4NPCA 1KDTA 2NACA 3OPNA 1K27A 4ZOBA 5E9JA 1Y37A 4CUZA 3N3AC 3W6UA 1BA3A 1JF8A 2K7ZA 4M9RA 1V8OA 2YY5A 1FDSA 4N12A 4ND1A 4B3MB 1PKEA 3RGGA 4IMIB 1BVRA 4TLMB 1Z18A 3ZWYA 1F7VA 1Z4QA 2CLIB 3HP4A 2E4VA 8OHMA 3TQRA 4L22A 4R16A 3AUSA 1O8BA 2CNBA 3MIZA 1XLWA 1SB9A 2OL4A 3N75A 4C4YA 4E5UA 2XUHA 3FI0A 3LXRA 4FT2A 1VOTA 4ZVUA 5TMBA 3VZSA 3W5UA 1X42A 4O2BF 2V0CA 1Y8AA 1I6MA 3UYKA 2IY9A 1PQYA 1QP8A 1CU1A 4NE2A 1PGJA 1XMJA 4OK3A 1CK4A 1TQHA 4C7OA 3VR4D 5CCBA 1HH4A 4MRAA 4ZMSA 1TXGA 5FWXB 1YB1A 3P9PA 3MGCA 3LBAA 4TQGA 3HA5A 3TX6A 3HMQA 4BVFA 1CERA 4KN5A 2O23A 2VP2A 4LPKA 3S5UA 4X62B 2VDWB 4JI1B 3HEMA 4H1TA 1E1CB 2BV3A 5A4JA 2AC7A 3IC5A 4Q4HB 5ALMA 3OX1A 4CFYA 1VYHA 4I4TA 5KPJA 2MDTA 4IS2A 2AG1A 4GR9A 4KIJA 4B6RA 2VJOA 3NDPA 4AZ0A 3GLHE 1KYYA 1MC1A 1XELA 4DA6A 4CF7A 5CM8B 2OA0A 4CMKA 4G2TA 2NGRA 7GPBA 2X41A 4WDRA 1YDEA 3PR1A 3F6SA 5KTTA 1W2GA 1XTRA 3GCZA 4TTVA 3WRXA 1COZA 2Y1OA 1QDEA 1XU9A 1QIKA 2KPOA 3OLVA 4UQPA 2G5TA 5CDUA 2HREA 1NUTA 2AH5A 3DOUA 4NBVA 1QWOA 3NUGA 5SYAA 5HIAA 1XDSA 1JWLA 2VL7A 3BMCB 1C0IA 1UBNA 3VGPA 2QIPA 4CE6A 1G5FA 4TLAA 3L41A 5TDHA 1E96A 2EX1A 3D64A 2ZJFA 5I9MA 1ODTC 1HE5A 4FUTA 1U6JA 5J5CA 3P4YA 4YJFB 1P2TA 2G9VA 2NV2B 4KP7A 2KBFA 1GGJA 5BWNA 3WYCA 4X0EA 1I3NA 1H9AA 2E85A 2GLTA 1HDZA 1R74A 1VJDA 3DE2X 3KYJB 1PG0A 1KFEB 3PA8A 3R44A 4G07A 1HFEL 4KWEA 4C04A 2ZLBA 2GCGA 2E87A 1YU6A 5JASA 3AYZB 3WICA 1CPYA 1ORVA 2HMYB 3N0XA 5LZ8A 2GEFA 5FPSA 1X1BA 2CMDA 2H1OA 3RS4A 3K8OE 1ZKMA 3VPFA 2GD6A 1KSGA 4BWVA 3F78A 4OLFA 4ER3A 2D59A 2GZSA 3U9LA 3ZLVA 1I36A 3GUCA 4MKFA 3SC3A 2SKCA 1W5AA 4L4SA 5AIBA 3KE9A 1JR2A 2BZSA 4BNFA 3WJ2A 1M66A 1W5FA 3MMNA 5HK9A 5KOJB 4BKRA 3PUJA 3CRQA 3KFXA 5F76A 3T9DA 2DHDA 1NV9A 5AVJA 3OUTA 3H2GA 4GP9A 3GJ4A 1BIFA 4GE0A 4YCJA 2QW0X 1H6CA 1DJQA 2LKDA 2C2BA 2M32A 5JZBA 1I1HA 2B8WA 2JAPA 3HDQA 2F3PA 3FNEA 1I6LA 4DLVA 3E2MA 4EYOA 1XP8A 5JATA 2QRGA 1T6NA 1SBTA 4OJMX 3C5CA 1C9JA 2K6GA 3GA5A 3BMOA 4WZBB 1D7OA 2VK8A 2W2LD 3C16C 3M6VA 2OO5A 4XFDA 4BO1A 4G1FA 4XEUA 2JA1A 3VNRA 5IT4A 3OZDA 3G17A 2HI0A 3QWIA 1RADA 1Z7GA 2FUG1 2GN2A 2JASA 3SN6A 4FP9A 2EQ5A 3D6FA 4HB3A 4J0DA 3VBEA 2E2WA 4IIGA 5C8XA 1Z4PX 4M9UA 2BGGA 2RHTA 3A10A 1J2EA 2ETVA 4PRLA 3OF2A 2FPPA 1RRVA 2F3UA 2YMQA 3R8CA 4RAQA 1NQUA 2FEXA 4XVQA 5EHNA 3SP1A 1UFVA 3UK1A 1LTKA 5DO9A 5AW8A 3BXXA 3BD8A 4MQ5A 3TW0A 3WNDA 1H5QA 1QHIA 4JP8A 4A8TA 4ZI7F 2JD2A 2FXVA 1WXDA 3KT0A 4LYHA 4FSXA 2BHLA 5KDLA 4YT8A 4XWTA 3FOEC 2I1QA 1XGKA 2VS1A 3TUJC 4UBMA 1ZD5A 3M3PA 2IE8A 1NUAA 4DDMA 2EQAA 2P9YA 3GWGA 3QX8A 3NH6A 2QTZA 1WHSA 3EEBA 1T0BA 2QN7A 1XOIA 3TH5A 2P4EA 1EFVA 2W70A 4D25A 1SC9A 2J85A 4ZO8A 2Y1DA 1D5WA 3PE3A 3T7IA 1JILA 2DTDA 3U31A 3UM9A 1EFRD 4ZFNA 2HEGA 3QQPA 3GLHB 1K92A 5JXJA 3G59A 1KEWA 4MV4A 4J76A 4Y2YA 3C5EA 4X41A 1ZIOA 5H83A 5IUNC 2ZTLA 2VFAA 4F2WA 4PANA 2Z1NA 3H1BA 3TFQA 1TZ2A 5K0LA 2ECFA 3KJNA 4QTUB 1VE7A 4CLDA 2QMOA 1XEXB 1XZ8A 1ESMA 2CXPA 4BCDA 4NECA 5FHQA 4Q1DA 1E20A 3U3XA 5C31A 5AW1A 2P4HX 3RJ9A 1IJKA 1C50A 3QG5A 3QXJA 3JAWB 3E5RA 3KX2A 4R54A 3IH5A 3SF8B 1I1NA 1ZOPA 1RM5A 4IKPA 2WG2A 4O33A 4CI9A 1I1OA 4EF5A 1GG9A 4DZZA 3QG1A 4HNAB 1L8QA 2JH9A 1GUYA 2XDQA 3D8SA 4I6JA 4MAMA 3RKRA 3WGTA 3E9MA 4J6EA 3EEOA 1BSVA 3IMCA 2IEGA 2N75A 3R5HA 4JP1A 2OE2A 2VHZA 2QTFA 4B71A 3E8SA 1BOFA 1RZ3A 3UIEA 3RQSA 2JJ1D 2RC6A 3ZK9A 1OW3B 1MVNA 1HRKA 2WU3A 4P4TA 4DDUA 1U3DA 2IHNA 1KR5A 3BG5A 5L3SB 1XQ6A 4JJGA 4UM9B 2XTMA 2WU8A 3ZHZA 3OQ6A 4Q48A 2HXGA 2Z5FA 3RTGA 1I51A 2Y76A 5JY6A 1ORDA 2V7TA 3JD3A 4E5DA 4ABYA 1C3LA 2ZQZA 1QH9A 2IYSA 3KB2A 4QXPA 4NAHA 5EQDA 4EPWA 4L4XA 2FK7A 1GHTA 1Z5NA 1H0RA 2Q3BA 3C7AA 1H8HD 3R3WA 1GUFA 2TMYA 2XAUA 2X86A 1WZIA 2A9JA 2J9FB 3OWOA 1C0LA 3SXUB 1G8HA 2MR5A 3IEXA 3KSRA 4L6CA 1NOKA 4WOCA 5FUXA 1OWPA 2R1TA 1G4HA 3EVZA 2FCRA 4PQGA 1AUOA 4U8GA 3T95A 4MR7A 1D8TA 5K0GA 1EJ2A 4PPYA 4WH0A 3C6ZA 4UC0A 4LV6A 3ZWQA 3NAZA 2WP8J 1I8TA 3D3WA 4WLFA 4NV1A 2B0JA 2YXDA 5EZ6B 2HU8A 1SG6A 1O03A 3QNUA 3TBFA 5G1NA 4YFYA 2DY1A 1POXA 4EG1A 4YRCA 3RU2A 4B3TB 5REQB 2BGTA 4YUYA 4F3CA 5A3RA 1IU9A 1AA6A 1UQUA 3KL2A 1Y42X 3N0VA 3M6UA 1YIAA 1JQKA 2FMTA 4CMIB 1D5CA 1KEUA 4KR7A 2BFOA 3G5AA 1MD9A 3GH3A 3OCWA 2VA8A 5DXJA 4YJHB 1L3BA 3VDQA 4AU1A 3W8EA 5LQUA 3IOEA 1GA4A 2J7KA 4NARA 4Y18A 1KJNA 1Q7RA 5AW9A 1ZOOA 4RGQA 1HEIA 2P30A 5C8DA 5JTUA 4UXHA 4FS3A 3VJLA 1XR3A 3T1OA 3R1IA 3X1YA 4E46A 4KQJA 2ZYUX 4MS1B 3FGZA 3KALA 4CKWB 3A2KA 1RLMA 3TSCA 2V4UA 1GUAA 4N5HX 4D9MA 4IDHA 1USWA 3KBOA 1U3WA 4PBTA 3FSJX 1PHRA 1D4FA 1E1NA 3AR8A 4ETIA 3DZFA 2OLKA 1FFHA 3Q5GA 2G70A 3KJQA 2FGJA 4L3WA 2QLTA 5IAOA 3IVAA 1DXHA 2EATA 4MI9A 4ZQHA 3VKWA 4I0WB 5EIAA 1P7VA 3A0UA 4TL9A 1NQTA 3QBJA 4O8CA 3U81A 2CB0A 2R4QA 2FPGA 2I4NA 1V45E 1I0ZA 1DC8A 2IF0A 4K8OA 1O94C 1L4FA 1YB5A 4R5MA 3R7LA 4TXJA 4J0KA 2QXYA 3AHEA 1E4YA 2Q9UA 3PI7A 2YHIA 1U8TA 1HYBA 1XRPA 4TUYA 4CEJB 1N2ZA 4CL0A 3NHWA 3FPSA 2GLUA 2XR1A 3QU5A 3QFTA 4L4ZA 1F12A 2XCLA 4O4LB 1JDZA 3THWA 5AW4A 4G97A 2Z9CA 5K3SA 2OGTA 4FFNA 2B3TA 3W7AA 2EYQA 4JP2A 5F1PA 5SZHB 5G4KA 4EJFA 3K1AB 1CNMA 1UOQA 4ZV9A 5LQNA 1UJNA 3O1JC 4PYOA 2I6QA 2Q49A 2YRWA 2D62A 4QKQA 5HJEA 2J3KA 1XZNA 2YHIB 3OM8A 3QEJA 5TNXA 3HJGA 1LQ2A 3O6VA 5HDQA 3PFFA 5J2UF 2BFNA 4IF6A 2WJWA 4DV4B 2C2OA 1NWHA 2PMFA 1H4SA 4N47A 1T4GA 1JGTA 1P2DA 2D74A 1HG0A 4X7MA 2VNKA 1R0SA 1N6PA 1IZ8A 2RJNA 4EDHA 5K01A 3HXMA 1XVVA 1W1IA 1SJ9A 3WLJA 2AN1A 3G6WA 3BGSA 4D0RA 3TG2A 2OCGA 3D8UA 3OPQA 1CDZA 5JPIA 1P4GA 3DLPX 3CIFA 1VL6A 1K2VN 2GXUA 3UPUA 1ZVVA 1N2SA 4M86A 2A3NA 1FDTA 1G20A 4WCDA 5K8LA 3DZIA 4RIEA 1Q16A 4GH5A 1P9OA 2Y6UA 1XIVA 1CV2A 1GCIA 2VF4X 3KE8A 3PKJA 4DGQA 4GVLA 4BFSA 2J9XB 2VI5A 2WHQA 3C8ZA 3DE5X 4YRFA 4PGAA 2WF6A 4MYTA 3R0QA 3TIGA 4WY5A 2VP6A 3DLIA 1XP5A 1P80A 5F2OA 4K1XA 4BO6A 1BA2A 1J20A 4NYIQ 4EI2A 4EG5A 3UTCA 3KUDA 1NYRA 3B78A 2X0DA 3GMDA 2X2EA 2H85A 4HNHA 1HDYA 5AJHA 4CM3A 1OI7A 2VNHA 1P0MA 2IY7A 1L4GA 2BFDB 4XSHA 4HYQA 4RWEA 1DAKA 3D6JA 3EWIA 3CZMA 3D4LA 3NDIA 4QPCA 4WKGA 5WRFA 3TR6A 4K46A 1IEVA 4Z51A 2WYIA 3IT2A 1XMPA 1R0XA 4HFJA 1KJ8A 3VO9A 4Z3OA 2XT0A 1Q1ZA 1YDGA 2DF8A 2G1AA 2X5KO 2AX3A 3IOBA 2X9VA 2FYTA 4BZQA 3L8GA 1O5OA 2QZZA 4HGQA 4DSUA 5B1YA 3LP6A 2ADFA 2PLFA 1UK6A 2NNWB 2TYSB 3G6KA 4B7UA 2GK4A 1P72A 1T2AA 2QUIA 2YXNA 4FQ7A 2FDXA 5JYDA 1V4VA 4CQNA 4J0CA 4RDIA 1LV8A 1UT8A 4V0QA 4ZU3A 1H93A 2GYWA 5ISMA 1F7UA 2OGUA 1TUGA 1EFPB 3DB1A 1HTBA 1PS0A 1L7VC 2I29A 2IZ0A 1TIBA 3PYLA 3H5TA 5BWMA 1T5HX 2UXCB 3BH7A 1JLKA 2Q5FA 2XDYA 1BE6A 4PAMA 3TLKA 1VI6A 3PXAA 1U7ZA 2GN0A 3GEBA 1E5LA 3IKMB 4LMRA 4W8OA 3SXPA 1UH5A 3H9CA 4C43A 1SXGA 3OOHA 4W1QA 1DI0A 1OVMA 2ZG6A 2GFHA 4FS8A 3UXMA 4J7XA 5MFPA 4MPPA 4RZXA 1V6CA 3AM4A 1TLFA 3ZCQA 2AF4C 2R6CA 1ZD1A 2OECA 3I32A 3L7KA 3ONNA 3W06A 4XWKA 3DZHA 1ULAA 4MUHA 3D4IA 5LPNA 3D8BA 4GI1A 4HX9A 4EY5A 2AOVA 1D4ZA 1KMMA 4ZC1A 1L7AA 1NOIA 1BEUB 3CKYA 2WJGA 3DXFA 4KQWA 4ML3A 3T5AA 3NIBA 3JR7A 1UAYA 2CCGA 1LDBA 5D51S 4IHJF 3SIWA 5I8WA 2VPWA 5CVUA 3JV7A 2VHWA 2YBDA 3KYDB 5AKHA 3ADDA 2NZUG 4J43A 1H3EA 1YBMA 3G2QA 4TMWA 3KM0A 4DIOA 3JD4A 1VIDA 3MRTA 4DSTA 1N1GA 2GF0A 4GICA 1UBKS 1UKVY 3EXHC 4D5EA 4MTLA 4E2ZA 3A1FA 1Z15A 4QPJC 1DU4A 1MDBA 4RJKA 1FNNA 1QTNA 2X42A 1B3BA 3AUXA 3L8CA 2CLSA 4G5OA 3TRIA 5KDOA 4RUKA 4M46A 4C7JA 1XNGA 4ZVQA 5IJWA 2RKWA 3I6BA 1F2TB 4KXUA 4ZCSA 3P9IA 1WKBA 2F1RA 3OX3A 4RGYA 1XXHA 2QRQA 4JC5A 1ODKA 1LNSA 1NI5A 1QONA 3FNQA 3GEHA 2PBZA 4NBRA 3PXXA 4DLXA 1NE2A 4OL0A 4F6RA 1PT9A 3O2QB 3VH2A 2CEAA 4OIFA 4OKNA 3EDCA 2FPOA 3RAFC 2Q1TA 4BFTA 1RI3A 4CM1A 5TV2A 1SXJE 5BVHA 3OEHD 1YC5A 3W9YA 3EF1A 5A3QA 3O92A 1XXHB 4KODA 4MJ7A 4NCBA 1D3AA 4BFCA 1KE1A 3PFHA 4P53A 3ZQUA 4OU5A 1XZKA 1IULA 1NLMA 2C9MA 4RE6A 5AVQA 3OCZA 2E5WA 5IVHA 2WV7A 2FU5C 1NUPA 1W9MA 5IVIA 2C5HA 2C5AA 1JH9A 2UUAB 1YVDA 3GRUA 3QE0A 4R69A 1B1AA 1JQ3A 3K4QA 3QLVA 5I51A 1R6BX 1XLTC 3E58A 3C3XA 3EDYA 2LNDA 4ZEXA 3ZDQA 3GV0A 2WG0A 1PL7A 3UK7A 5JCOC 3B1YA 3MZ0A 2V6MA 3KZNA 1J0XO 4KUEA 1A8HA 3HWSA 4S1NA 4DZRA 2J3EA 3MCAA 5BUCA 3WGGA 4INPA 2Q4DA 3UMJA 1EX6A 4DDTA 3LKBA 3G7UA 2R6DA 2X8LA 2PX2A 3CO5A 4UMDA 4TZ6A 4IQFA 4BDSA 4GEKA 5KKNB 1C7ZA 2QP9X 3FCCA 4AXXA 1DC5A 3MA0A 1QMPA 2QB5A 2QENA 1UKYA 1NMXA 3M4XA 4K2HA 4GOKA 4MQLA 5IAAA 2V96A 1EGQA 1DCTA 3FBTA 1BU8A 3KXPA 1H66A 4OHMA 4BWYA 2CHFA 3KIPA 3CS3A 3DGFC 1VZ3A 3IHLA 1VJ1A 4RORA 1ISIA 1P4JA 2PU7A 3V97A 4DFDA 3G8BA 2FE4A 1I0IA 2V7BA 3HRKA 1NNUA 3L4BA 4X65B 4MEAA 2ABWA 4JIGA 1WXFA 1UOOA 3Q7RA 5IKXA 5K09A 5C5DA 3L0YA 5C46F 1CUJA 3A4NA 1XNRB 3DHNA 2JJ2D 1ZZGA 3EXEA 1FC0A 5JHHB 3G2MA 3N8HA 1ZESA 2G9NA 3W1EA 4EOGA 3JQQA 4ZTUB 2H1SA 3KEMA 4IUCS 3DE6X 4MROA 1A8PA 1I2DA 3LGSA 3GJTA 4M9ZA 4NBLA 5CIQA 5DFAA 5KWIA 2Z6AA 5DTEA 5LOVB 1U31A 5EE5B 1ISPA 2BELA 3WDKA 2JIOA 2PXXA 1QZUA 4PPNA 3UYLA 1K98A 2DPYA 3HVJA 4KSYA 4LMBA 4MDYA 4N3CA 4W9RA 5IMSA 2VLIA 1H22A 5TC4A 2RHBA 4H7EA 1I7NA 3PVZA 2AZTA 1I3KA 2W6OA 3HABA 3ZHSA 4DT1A 3WZ2A 2VRCA 5B1SA 2EGGA 2B3DA 2ERYA 1HV8A 2C2GA 2A0UA 2F3SA 1DS6A 1CNEA 2JBHA 3E3OA 3LTEA 3MILA 4A1FA 1R6XA 2W8ZA 3CRW1 3IOYA 3OQIB 4DUGA 4L1KA 1O5TA 4OHBA 3C4JA 5DI3B 1QQ5A 4OD0A 2NXWA 1NV8A 1NW6A 1JWAB 1V7QA 4C87A 4ZCRA 3CYFA 3ENZA 2AK2A 1M33A 1QP7A 4FLFA 1RBQA 4IIUA 1XXHE 2NZWA 5AJWA 1IB0A 1HT0A 4DT1B 3ZCTA 3G2HA 3KKOA 4HSEA 3MWKA 4LNUB 2HMVA 1IEXA 3R2JA 4QOFA 3LY8A 5DTQA 3BWBA 4HN4B 1N2CB 4CLEA 1D2AA 2VH2A 3MYYA 3TXXA 2VK4A 1RWQA 2XDWA 4FEGA 4UHCA 1W8DA 4BMPB 2N0SA 4D1YA 4EJSC 4ZVLA 4M3NA 3IR6A 5CK5A 2Q9AA 1EK0A 1IHPA 4K9DA 2BLLA 2QJRA 3WGQA 1Q0TA 2WHPA 1AB6A 1Z6TA 3ETHA 2Q3EA 3HU1A 4GYYA 4NJMA 2EJVA 5C8ZA 5AI0A 4LOKA 1H5NA 1SWVA 1WR8A 4YUZA 3ANMA 4KRFA 3MYRA 3C1AA 1XLTA 2I1WA 4YHHB 1S3SA 3I2GA 4ZEMA 4TYQA 7YASA 4ZQCB 2Q6OA 3W1WA 2I2DA 4N3GA 4O8ZA 2IZ1A 2DFKB 2HJHA 4DB2A 3W3AH 3RBXA 1J8YF 2GK7A 3EEYA 4NAUA 4Q4CA 4X63A 2EP7A 3K20A 2ZI5A 3LUPA 4GZLA 1CZNA 4UJ3A 5CCDA 1UDWA 1HYHA 2CV2A 3ZKWA 4E51A 4WXRA 2XMGA 4RCYA 2VJDA 2OOSA 1EJ6A 2D4AA 1S2MA 3INYA 1R5BA 2Q0QA 2OY0A 1QRAA 5EPEA 1JQAA 2YUTA 3JYHA 3UAZA 5P8WA 3BAZA 4QDOA 1FP2A 2YVUA 4QEKA 1QF9A 4YA6A 3MGAA 3CLKA 3QKIA 4FE7A 4FFLA 4HBZA 4BMCA 3IA2A 4MAAA 4ZIRB 1YIDA 1R3UA 3NT4A 3OQJA 13PKA 3D3KA 1A4IA 3S1AA 1ZEMA 3KQHA 4HNGA 2EW8A 3Q72A 4TN1A 2BEVA 2JDID 3DMGA 3E70C 4UBNA 4OYLA 5DHUA 2ZUFA 3C7KA 1PWHA 3BXZA 1GGMA 1QC5A 1JHXA 4GI7A 3TTSA 5IU6A 4QWWA 3EYWA 2FZVA 2YWBA 1CUDA 2A5GA 3P52A 3ZR4B 5JY1A 4U00A 2Z5GA 3F7TA 1YDWA 5I6DA 5HGJA 5FI1B 2IHJA 4V0LA 4D82A 1H2YA 4LDNA 4YCCA 1X86B 2FWIA 3BE6A 1WE2A 2QI9F 2WTXA 4TKVA 1EFTA 1TYDE 3BIJA 1EP2B 1QH8A 3R24A 4BUJA 4AT1A 3FI9A 3W2GA 1RPJA 4DBLC 4U2FA 3PGKA 3WO0A 2CXHA 4PHTA 4F45A 3FRJA 1HTTA 2FSPA 2X9NA 3TZQA 2QWXA 3H0EA 1UIMA 1JU3A 1B3RA 2O20A 3BYZA 3LL7A 2Z5LA 3P2JA 2X23A 4OXRA 5DMXA 2NYVA 1EHYA 4WT7A 1Y3BE 4RY0A 2FR1A 1DP4A 2IPNA 1M7GA 2O7VA 2Q3HA 4WZAE 1WL8A 2J41A 3I2IA 2PSEA 4OU4A 4Z8XA 1V48A 5J63A 3SYRA 3ZX5A 5C81A 4BMXA 1WNFA 2O7NA 4MMXB 5DH9A 1GD1O 2W9XA 4HDKA 5FR1A 4EB0A 1A76A 2WTUA 4LE0A 5HF8A 4IG9A 1V3UA 2PUVA 1JIXA 3OIVA 4LI0A 1SHUX 2MSNA 1CRPA 1BCRA 2C4KA 2OORC 5EE1A 4TL6A 2ZPUA 3M6MD 1P9RA 2OLEA 3BH6A 2IBMA 4HB0A 4OHXA 2R751 2JK1A 4Q3OA 3WGOA 3PTAA 4EJSA 3PJDA 3QUTA 5CCXA 1YONA 1B4DA 5IDYA 1YE8A 2IXDA 3ONVA 1KO1A 1LDEA 1ZRSA 2CHGA 3JALA 3KR0A 4LDAA 4RHUA 4TMFA 1VPWA 4RZSA 1PGPA 4P4NA 4JB2A 4EI8A 3RYFB 1P2BA 1PR3A 4MUNA 1CQPA 5D6OA 3X43A 1HTWA 2WD8A 2AE1A 2PYIA 3T94A 4EJSB 4WCFA 4H31A 1WDKA 1LB1B 1CUWA 4UAVA 4IY1A 2IC5A 1U2GA 4IIBA 1SVKA 1KHTA 4ZCQA 2QMEA 5KQLA 2P2DA 1DFHA 5GMOA 5I8ZA 3WHLA 4AMVA 1NW3A 1P7YA 1QGOA 1JVBA 1USGA 3FYDA 3KTAB 1T9CA 3O31A 3IUYA 2RH5A 4M55A 5LN1A 2JKVA 5F12A 4CMJA 1W49A 1ND6A 5BR8B 3LLSA 4KMMA 4KTVE 4XQGA 5K6AA 3ZXXA 3CEPB 3PGJA 3ELYA 3Q2KA 5EJ5A 1Q0HA 1M9NA 5HFNA 2JL1A 3G0GA 2CKMA 1SUBA 4DNQA 4B73A 4JWTA 2RHHA 3F8WA 3EVTA 2CWDA 3EZ2A 2OCYC 1DDGA 1SQGA 1VLMA 1G7CA 1GGKA 3AUAA 3P9SA 4DGSA 4DTIA 4AQYB 4FUQA 2H18A 1E2EA 1X13A 3C0KA 3H2YA 4P1ZA 3TKLA 4MP3A 4R2JA 4CN9A 5JJKA 3TNDA 1ZS9A 4KXNA 1Y4ZA 3MINB 2IITA 4MB6A 2HSJA 5DN9A 3DULA 1XK6A 1P9WA 1WEKA 3GJ8A 2OZLB 4L7QA 3AEQA 3O93A 1NBOA 2PS0A 1CZRA 1O89A 2XLBA 2RBKA 2I7XA 3A6HA 1NVVQ 4PSKA 2QE6A 1LV7A 1F4VA 1SUWA 3NVMB 5CVJA 4OTZA 2X8JA 3MCWA 4QM6A 3JTMA 3VPAA 2CLDX 2P65A 4LJ5A 3GT7A 3NWBA 3GLIA 2JVJA 1Y6QA 3AEQB 2XOEA 3Q4GA 5AI4A 5BXYA 1XNQB 2O1EA 3KRTA 2HQBA 4PSUA 4XB6B 1N5KA 4C3VA 2GZAA 2V3CC 5FTLA 2FWMX 1UC5B 3FPAA 4C03A 1H2AS 3L49A 2OUIA 1EK5A 4OGKA 2GM5A 3OEED 1MXFA 2B34A 2XAAA 3I76A 3FN4A 4Z9XA 1QPBA 4PFSA 4CUKA 5KVCA 1WM1A 1NMEA 3SLKA 1EVZA 3HCCA 3LUFA 2P5UA 3H18A 3DV2A 1MX3A 3ABSB 2QM8A 2WKSA 4YP9A 1QH0A 2OORA 4MK4A 2JFYA 5K20A 2QUHA 3WSVA 4JK3A 3W8RA 3TJRA 2AUNA 1H94A 3VMMA 4GVPA 2HLNA 2QNIA 3P2IA 2D4HA 4L5BA 4L74A 1FFSA 4RA9A 5FEMA 3WLQA 3ZK7A 5HE8A 1KIAA 3UCFA 4DY6A 3QEBZ 3W2EA 4I55F 4GF5A 3WMEA 4B3HA 4BKPA 2ZYGA 3HZZA 3FJOA 1CUYA 1T2CA 4HDSA 4N7MA 2NAFA 3AEXA 3F96A 4HB4A 4E31A 4I46A 2DB3A 1ZO8A 3FWPA 5EMMA 3K53A 1ZOIA 2EC5A 4WCFC 1OREA 4FHGA 2D6FA 1R3DA 4MV1A 4KHPB 1M1YA 1Z3CA 2PEZA 3FKQA 3HU5A 4XTCS 4U7HA 3WL4A 1Y8QA 4RZ3A 4DCPA 2CWWA 3GH1A 3ABOB 4QFCA 2BYTA 1MHTA 5AM1A 1UPFA 2XV1A 1U3UA 1GPMA 1UBGA 2DY0A 3ZU3A 3OI7A 3OJWA 2X5NA 1J8FA 4AF7A 5KYXB 1Y1PA 4Y6OA 4Y2PA 4C05A 5ILGA 2YZKA 4TLEA 1NKSA 2IIVA 4R9UC 3KQKA 4MQEA 5F64A 1TA9A 3D5EA 2Y1WA 2F1OA 1QOPB 4XCQA 3IJRA 1E2DA 1YR3A 1T9GS 2FX5A 4ZO4A 4ZZ0A 1XTJA 5T64A 3TSWA 4R01A 3A06A 3V8PA 8GPBA 3I6YA 3UKOA 4I1IA 3WGKA 4RVOA 1A7JA 4JVMA 5E9WA 4ZVKA 2AN3A 3L7CA 3WYFA 3ZNOA 4X90A 3OAAD 4B8WA 5J2TA 1JEQB 1YBVA 4B6EA 1I24A 1Q20A 1FNBA 2WFLB 2DKNA 4G67A 4F4HA 1EZZA 2VJMB 5CJ2A 3RHFA 4E4YA 1YU9A 1LJ8A 4X44A 1TQDA 4ENPA 4LY3A 1O6GA 5I7HA 2CZGA 2Q50A 3RJZA 3RFXA 2DULA 2REBA 5KS2A 3L7DA 2DQSA 4IHQA 1L5HA 3LMKA 3VHRA 4LECA 4D3FA 4DA4A 1HQDA 4KK4A 3ZUGA 2ZIAA 3SKXA 1GAQA 4HS9A 2W58A 1OPXA 2F9FA 4MPRA 5B7QA 4AK9A 3QE9Y 1T29A 1JFRA 4HHEA 5BUSA 1ZD4A 2OLJA 2VF2A 2YFYA 3FCXA 4XWGA 4MJXA 5C9ZA 5SZJA 3DCYA 1AXGA 3CQ9A 3EHDA 1U99A 2VQ3A 5KQMA 4C4AA 3EAQA 4LXGA 4C3ZA 2GPNA 4H6XA 3OLQA 1R6DA 1JB1A 3JD0A 4Z8YA 4I3HA 5B1DA 1L4BA 3AEUA 5GOZA 1OTXA 1RACA 1WVGA 4EGAA 1MX5A 2V1XA 3ER6A 3PE6A 2ZIUB 2PT6A 2ZUCA 3HKEA 2DLNA 4K1LA 4MWTA 2Z57A 2R2AA 5EZYF 4LJYA 2P78A 4JBNA 1RQXA 1BJKA 2WNIA 2V58A 3E1SA 3N53A 2WE8A 4B17A 4PYIA 3AF1A 1UEXC 4JX9A 4DLBA 4ZAXA 2YYSA 4CM5A 1NN3A 1YKSA 4IZOA 3VHXA 1WLYA 2ZP1A 4LQDA 3N2EA 3RM3A 3PQDA 1QG6A 2CHQA 4RKRA 4FFRA 3N8DA 1AKEA 1MGPA 2H1RA 2ODTX