3DLCA

Crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
GMSENKKKFDKKGAKNMDEISKTLFAPIYPIIAENIINRFGITAGTCIDIGSGPGALSIALAKQSDFSIRALDFSKHMNEIALKNIADANLNDRIQIVQGDVHNIPIEDNYADLIVSRGSVFFWEDVATAFREIYRILKSGGKTYIGGGFGNKELRDSISAEMIRKNPDWKEFNRKNISQENVERFQNVLDEIGISSYEIILGDEGFWIIISKTDQEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative S-adenosyl-L-methionine-dependent Methyltransferase
publication title Crystal structure of a Putative S-adenosyl-L-methionine-dependent Methyltransferase (NP_988299.1) from Methanococcus maripaludis JJ (DSM 2067) at 1.15 A resolution
rcsb
source organism Methanococcus maripaludis
total genus 84
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dlcA00
2UYCA 3KQSA 1AQIA 4YMHA 1JSXA 1G8AA 2XVAA 3LCVB 4OBXA 3UJ6A 5FHRA 3T7RA 5E2BA 1YFJA 3DMGA 4WXHA 4MQ4A 1TW2A 1NBHA 3EVAA 4OQEA 5M5BA 2B2CA 4AZWA 3EVGA 3KR0A 2AR0A 5LSAA 2PWPA 4R05A 1FPQA 2BH2A 4DA4A 2JG3A 5DX8A 5U4XA 3PFGA 1L3CA 2P35A 2AOTB 3SXJA 3HEMA 2Z6AA 2PBFA 4YUVA 1R8XA 4C04A 1BOOA 2PXXA 2R6ZA 1ZGJA 3ANXA 4PYJA 3FUWA 2OBFA 4KRGA 3FPHA 2AOUB 3LCUA 4XCXA 5T6BA 3ERCA 1L1EA 1FBNA 4DZRA 4U7TB 4DQ0A 3BXOA 2AS0A 3HVJA 1PRYA 5IH3A 3SSNA 2PWYA 1X19A 2V74B 4IV8A 3AJDA 4RV9A 5K0NA 2CMHA 4PGHA 3FZGA 2VDVE 4QTTB 2GPYA 2I62A 5EG5A 2ERCA 3FUTA 3IYLW 4GOMD 5P8WA 3GRRA 3GRZA 4OQDA 1VIDA 5DSTA 3LBFA 5K0BA 5LQAA 3FUVA 2XVMA 3R0QA 5FA5A 3UA3A 4DF3A 2FYTA 3E23A 4E2ZA 2HNKA 2OPBA 3HA7A 5JR3A 4G56A 5B1SA 2G8NA 3HCFA 3G2OA 4KIFA 2HR1A 3VC2A 2JH9A 2UYOA 2AN5A 4MHTA 4YUWA 2ZBQA 2ZIFA 2ZSUA 1KYZA 1SQFA 3R24A 4R6XA 2IH5A 3KHKA 2P3QA 1D2CA 2HV9A 3I53A 4C05A 5CCBA 2YTZA 4FP9A 5EEHA 3MTEA 3RODA 3TRKA 1VBFA 5DRYA 2IIPA 4RVFA 3D2LA 5DTQA 4AZVA 3UFBA 2ONYA 3PVCA 2EJTA 2BR5A 3T0IA 3KPVA 5EMLA 4YUXA 1IXKA 1XTPA 3FYDA 3P2IA 2GA9A 3PFHA 2AOXA 1YFLA 3BZBA 2EG5A 5F2OA 5FQNA 2ZZKA 5LQRA 4RYLA 1EG2A 3VC1A 5C9ZA 3VSEA 2PV0A 2PX5A 3MERA 2H1RA 3LKZA 5CVVA 3TKAA 1KHHA 3BWYA 3DXZA 1MHTA 3MHTA 4P58A 4CKCA 4GOND 2AN4A 4IWNA 1RI2A 5EPEA 2K4MA 2ZLBA 3B3JA 1JTFA 3TKYA 3FUUA 4EVIA 4YV0A 1XDSA 3CBGA 2B78A 3P2KA 5LQKA 4QDKA 5KVAA 2G1PA 3OU2A 5FULA 4PWYA 3LGAA 1P1BA 2QYOA 4E33A 1XJ5A 3DTNA 3R6TA 2QE6A 4PCLA 2FPOA 4GBED 5DRTA 1VLMA 2G72A 2PX8A 3DXYA 3TLJA 3LECA 4XUDA 5E1BA 3RIEA 3FTFA 1JSZA 3LPMA 4X61A 5E1OA 2EFJA 1L9KA 3NW9A 5K0GA 1NV9A 5K0LA 5EIFA 2NP6A 5DTMA 3EGVA 2PX2A 3A25A 1G8SA 3NVKI 2H11A 1F38A 3FTDA 1EAMA 1NW8A 2WA2A 5BP7A 2Z6UA 5ICFA 1VP3A 2ZIEA 2O07A 3GRVA 4Y30A 2P7HA 4KWCA 4YV1A 4FZVA 4PYKA 2AZTA 3CCFA 4RTMA 5EQJB 4B17A 1KIAA 2XYQA 3M6WA 2PJDA 4AUKA 2CWWA 5CVDA 2NXEA 2PX4A 2EJUA 3BWCA 3DH0A 3E8SA 4KVZA 4E70A 3G8AA 4C4AA 5F2NA 1N2XA 3AXSA 3FYCA 4KW7A 3DLIA 3HCDA 2PGXA 2OXTA 2O57A 2FCAA 3QOWA 2XYRA 1X1CA 3B7PA 1RJGA 3CJQA 3EVDA 3I64A 4H0NA 1VE3A 5HZMA 5DM1A 5LQCA 2H00A 3H2BA 3OE5A 1DCTA 3P71T 2NNWB 4RTPA 4P7JA 4QTUB 4JXJA 4BP1A 4PYOA 3P9KA 2OKCA 3HVIA 2Z6QA 5CUQA 2PXCA 2AVDA 2PKWA 3GXOA 4EK9A 3MB5A 5H02A 1HNNA 1Z3CA 2ZBPA 3KQQA 3C3PA 5E9QA 1ORIA 5FTWA 1H1DA 5DLYA 1OR8A 5CVUA 3HTXA 1RI1A 3M6UA 5CVEA 3KKZA 2PT9A 3NTVA 1G6Q1 1JG1A 4RVDA 3UWPA 2YR0A 5EKXA 3PLAE 3LBYA 3FTEA 3ER9A 5E1MA 4FSXA 1R00A 2Y1WA 3HVHA 3G7UA 5FADA 3GRUA 3P9CA 3FRIA 5BW4A 5E9JA 5ICGA 4O29A 2YXEA 3OU7A 1Y8CA 1NKVA 1NW6A 3ELDA 3M70A 3TM4A 4HGYA 4A6DA 5HEKA 1NW3A 5GIPE 4R8SA 2OO3A 3QV2A 2FHPA 5EC8A 1P39A 3BKWA 5K0EA 2C7RA 1R74A 3DMHA 2IDJA 3MGGA 4PINA 2PXAA 5EMMA 2YX1A 1BHJA 3CGGA 4QDJA 1JQ3A 3ORHA 3O31A 4Z2YA 3LHDA 2GH1A 1DL5A 2PLWA 1RI3A 2ADMA 3KPYA 3HCEA 2P8JA 4QQKA 4Y2HA 4F86A 1RJFA 3LDUA 4BLVA 3KQYA 4GQBA 4FT4A 2CKDA 3AY0A 3OFKA 5K01A 4GF5A 10MHA 3C0KA 4EQZA 4OX9Y 1SUSA 3NDJA 9MHTA 3B3GA 2ZTHA 5K03A 1INLA 2ONZA 3ME5A 4GUAA 1JQDA 3U81A 3VYWA 2KW5A 3PT9A 5T64A 4FSDA 3FPEA 3OZTA 4OA8A 1VP9A 3ID6C 4BLUA 1IM8A 1KPHA 3MQ2A 4RTSA 1EJ0A 1NW7A 4IV0A 4ER6A 5D1HA 1ZKDA 3DXXA 3HVKA 3SSOA 3EGIA 5LQNA 5EMKA 3SX0A 3K6RA 3P8ZA 2Y1XA 2ZW9A 3BGDA 1WXWA 1T43A 3LL7A 4ATNA 2B3TA 2C7QA 4E2YA 3BT7A 1XCLA 1QYRA 3KR1A 4XUCA 3G2PA 2PY6A 4QPPA 2NXJA 1F3LA 4E2WA 3DUWA 3NDIA 4FR0A 4MTLA 5DM2A 4RTOA 2P40A 3A26A 2HMYB 1WXXA 1R6AA 2NXNA 3KPUA 3KQTA 4P7GA 3UJBA 4ER0A 2I6GA 3UJCA 1QANA 1Q0TA 1ZHFA 2ZBRA 4P7KA 3SM3A 3V8VA 1XCJA 4YV2A 1BC5A 1N7IA 2G70A 2FK8A 2IDKA 3ELYA 3GDHA 2BZGA 1WY7A 5CD1A 4AZTA 2P41A 3P9IA 5MHTA 2GAFA 5IKMA 3G8BA 4QVKA 3G2MA 3SSMA 3Q87B 4BY9E 1JG4A 2I7CA 4HSGA 5DTRA 5EIWA 1SQGA 1X1AA 5G02A 2VS1A 4KDCA 2B25A 4FS8A 2B9EA 1L3IA 3F4KA 5K05A 2IP2A 5DXJA 4X41A 3T7SA 2IBSA 1KP9A 1U2ZA 3PX2A 2ZCJA 3FRHA 2QM3A 4GC9A 5EZQA 5K8VA 1B42A 1ORHA 3L8DA 4MIKA 5T67A 3MCZA 1UFKA 2P7IA 3C6KA 1G60A 2OZVA 4GEKA 4PYNA 1O54A 1ZQ9A 3EMBA 2N47A 4A6EA 1KPIA 3M6XA 5EHIA 3WSTA 1DUSA 1QZZA 3I9FA 3IEIA 4V0RA 5E8RA 1TW3A 4EMSA 3HP7A 3NVMB 1AQJA 4QVGA 4P7FA 1NT2A 5EKUA 5GM2A 3UJ7A 2P3LA 1JG3A 2UZ4A 1N7JA 2YXLA 4QPNA 5DT2A 2V7EA 2HWKA 2VP3A 5ERGB 4DKJA 3I58A 3R3HA 3P9NA 3UJ9A 5FHQA 2IFTA 2I9KA 5K0JA 1ZGAA 5EEGA 5GIOE 2JHCA 1VPTA 2ZWAA 3EVFA 4YUZA 3BUSA 4DMGA 3IHTA 2AN3A 5GM1A 5KYGA 3UJAA 1EJ6A 1JQEA 2LD4A 2YUIA 5E9WA 5LQJA 3DLCA 2AOVA 2NXCA 1X1BA 4RSRA 3HCCA 1WZNA 2O0LA 4C08A 1EQAA 1EIZA 4RTJA 3PS9A 3TMAA 3REOA 4RVHA 4F85A 2C7PA 5HIMA 1QAQA 2E5WA 1FP1D 2NP7A 3GIWA 1BKYA 2G71A 3OU6A 3SVZA 3FPGA 3TFWA 4ER5A 2AOTA 4F84A 1WG8A 1O9GA 5FUBA 4E32A 1X1DA 2A14A 2F8LA 4PYMA 3UJDA 5K0CA 2XBMA 3GWZA 3QOXA 4CKBA 4L7VA 4E2XA 4PNEA 2IH2A 5E8JA 1IY9A 3S68A 1Q0SA 1XXLA 3HA5A 3FTCA 3NJRA 2ZFUA 4OBWA 2PVCA 3ELUA 3GJYA 4KIGA 5EHGA 5K09A 3G5TA 1QAMA 3G89A 3OFJA 4FT2A 1YF3A 4DCGA 3DULA 2UYHA 3KPWA 1G55A 4ISCA 4RWZA 1O9HA 3NWBA 4AX8A 4E31A 2JHAA 1YUBA 5FWAA 3SMQA 2HTEA 3JWIA 4LECA 2VDUE 3A4TA 3GNLA 2BR4A 3HCBA 5CVJA 5HIIA 3THRA 3CKKA 2ORED 4R8RA 3G88A 3CJTA 1JG2A 4RX1A 4CTKA 4K6MA 5BW5A 1SG9A 2AOWA 3UBTA 3A7DA 3JWGA 2ZIGA 4PIPA 5FWDA 3C6MA 4V0QA 5EZSA 3EMDA 1ZG3A 5HOQA 1UWVA 4RTRA 3C3YA 3PTAA 1NW5A 4C07A 2R3SA 1L3BA 3G2QA 4POOA 5CCXA 3BWMA 2YVLA 2GLUA 4PIMA 4UOEA 2YXDA 3B5IA 2IGTA 2IBTA 4QQNA 2PSSA 1YB2A 1MJFA 1YZ3A 2O05A 3HA3A 3JWHA 4KDRA 4ZTBA 3MAGA 3TR6A 2VZ9A 5E1DA 5JUWA 2AVNA 3RW9A 3LDFA 4PGGA 4YMGA 3NWEA 1RI5A 1R18A 1KR5A 5FQOA 3KQMA 4CTJA 4DCMA 4EKIA 2ZULA 2ZZMA 3LX6A 3CVOA 4HGZA 5DX0A 4FGZA 4CWAA 2OB2A 3KQVA 8MHTA 3LCCA 3PX3A 4M37A 1SKMA 3OCJA 3THSA 3GCZA 4GOLD 5DXAA 1JTEA 1M6EX 3E7PA 4LG1A 3BWBA 1M6YA 2OB1A 3DMFA 4RVGA 2QY6A 5LR6A 3TM5A 2DULA 5EVJA 3GRYA 2O06A 1KXZA 5DX1A 3V97A 1R8YA 3EVZA 2ZVJA 3OE4A 3GO4A 4M36A 3HNRA 5D1NA 4WVLA 2JH8A 5HILA 5HFJA 2OY0A 2Q41A 1D2GA 1FP2A 2C7OA 2WA1A 3KPJA 4NECA 5F2KA 5GP1A 4ER3A 4YUYA 4U7PB 1KPGA 3CC8A 3EVBA 3KR9A 3EGEA 3LDGA 5GINE 4HC4A 2EX4A 3A7EA 4CKEA 2WK1A 1P1CA 4HG2A 4RTQA 1V39A 2P3OA 4X60A 3O4FA 5FCDA 2BM9A 4RTNA 1YZHA 5DPMA 3OPNA 2PT6A 3KQWA 2IPXA 1RJEA 3HM2A 4DM3A 2DPMA 3LSTA 3M33A 4OA5A 3AXTA 4EKGA 3FUXA 4M7RA 3AWIA 3X0DA 4BP3A 2BM8A 5FA8A 4C03A 3T7TA 3DOUA 3EEYA 3KU1A 5ICCA 3IV6A 1I9GA 4LWOA 4PYIA 3DP7A 1TPYA 1D2HA 1G38A 1FJXA 2NYUA 3UZUA 4RTLA 2CL5A 2CMGA 3M4XA 1SVUA 4IKPA 1XDUA 4HRAA 3DR5A 3O7WA 4HTFA 3OZSA 4X63A 5DWQA 3BKXA 5DSXA 3KQPA 1VL5A 2XYVA 3M6VA 5KS2A 2JHPA 1XVAA 1RJDA 5K0FA 3HCAA 3MTIA 5DM4A 5ICEA 4ER7A 4MWZA 4PONA 3TQSA 2ZWVA 2QRVA 2VDWA 3KR2A 3NMUF 4PYLA 3ELWA 2JJQA 3UJ8A 3EEOA 1QAOA 2P1DA 1NE2A 3GU3A 4PYQA 3B89A 3FPJA 5DM0A 3OZRA 1NV8A 3SGLA 5HIJA 5C0OE 5EGSA 1AV6A 3EPPA 2FRXA 2ZZNA 3FPFA 4R6WA 4XUEA 5EOVA 1SUIA 5C1IA 5CIYA 3CJRA 3B3FA 1M0EA 1VQ1A 1KYWA 3SR4A 5GOZA 2FK7A 1P91A 4X1OA 3EVCA 7MHTA 5HIKA 2IH4A 3JWJA 3K0BA 4GOOD 1NBIA 2BR3A 3MCTA 4HTFB 3TPZA 1AF7A 4AZSA 1PJZA 3ER8A 4M38A 1RI4A 1XDZA 1HMYA 4C06A 3Q7EA 3LKDA 2ESRA 2GS9A 3G5LA 4GC5A 2AOUA 4HH4A 1JR4A 1WS6A 5KQSA 5CM2Z 4E30A 3BGIA 3P97A 4BLWA 3R9XB 5BXYA 3P2EA 2QRVB 4CXMA 4PCAA 3I5UA 1I4WA 3KQOA 2OYRA 3UA4A 3BGVA 3GGDA 5E2AA 5EMJA 3PB3A 5KQRA 2UYQA 3A27A 2GB4A 3EVEA 2YQZA 5LQUA 3TOSA 5GWXA 1I1NA 3E05A 4LWPA 1UIRA 4RTKA
chains in the Genus database with same CATH superfamily
1QLHA 1BE0A 4GX2A 4L27A 3GLTA 3CZPA 1W76A 3EYWA 4J0QA 4OBXA 5AW4A 1TCAA 3FKJA 3ZDZB 4EYOA 5B4TA 1DOHA 2LDBA 3PHJA 5CB4B 2Y1GA 3F3MA 4YHBA 4BMCA 3EVGA 3KR0A 5LXTB 4RD4A 3OLCX 5JZ9A 4RLHA 1WSAA 3P9XA 2P35A 1PR2A 2XECA 4WSOA 1SBTA 2XF2A 3GP3A 3ONDA 4CUJA 2Z6AA 1Y7IA 3H9CA 2F67A 4C76A 2F3TA 3ZWPA 4WEQA 4FYKA 3KXPA 4PQEA 1OH6A 1Z68A 1NVVQ 2OBFA 5JI3E 3GEHA 1YCGA 4OSOA 5AIBA 4LNUB 4WLFA 2D62A 2NMVA 2BJWA 2Z1MA 3BXOA 1YHYA 3PA6A 3Q6NA 3S28A 1FBTA 5SYNA 4ZANA 2YC4C 3ESCA 4M1KA 2PXHA 2UAGA 3QVJA 2DR0A 1KKLA 2OCXA 3G13A 3KV3O 3JVDA 3H5VA 1VHJA 3CNBA 1DJPA 1GN9A 3SNHA 1IJBA 3R0JA 4G89A 4L4XA 2RCYA 4KGDA 3M9WA 3CBQA 3TLBA 1SQ5A 3ZW9A 2M6SA 1N6OA 2DWQA 2J3JA 4JUIA 1IM5A 5KDOA 3FUVA 1TMKA 3KKMA 5DNCA 4YP1A 3SXUB 1NE7A 3AVYA 6YASA 1XVVA 4A91A 2DKOA 2WJVA 1OW3B 3ADPA 5K3OA 3K8OE 3R9KA 1F8GA 1P7PA 2E49A 3JQBA 1J21A 3RASA 1E2UA 3C98A 1R50A 2DUJA 1BSVA 3HCFA 3I09A 3N8KA 2GEJA 3N39C 3PRKE 3L0PA 3W78A 4QXAA 3DBLB 1EGAA 1QHYA 4DXAA 5BSGA 3UG6A 3MWEB 4B3JA 1ODFA 5HTKA 2P3QA 3ZUPA 4C05A 3DZFA 2AI3A 3PDHA 2AD5A 2HDNB 2MYUA 2GEBA 2I6XA 3PQ3A 1L7NA 4PZEA 4AZVA 5DM70 5TSDA 2WICA 2ZPAA 4DJDC 2EJTA 4YVFA 1WHSB 3KJHA 1I94B 3WS7A 2V6MA 5KTSA 5FBWB 5F3RA 3SKYA 5CU7A 1HNWB 5CA1F 5AHKA 1DKOA 2FZCA 3K15A 1TVKB 3ABSB 3R4VA 4LXIA 2BKXA 1KJWA 3EH1A 3F7MA 4INOA 4XDZA 4YLGA 4JFAA 1D8AA 4EGQA 4HRVA 4HH0A 1OYYA 1PYOA 1P1IA 5LQSA 4IGIA 5CVVA 1B76A 3WYNA 2X15A 1JALA 5J40A 1JBQA 1BDIA 5ERXA 3RWBA 4GOND 3H6KA 2FSUA 2WFLA 1XXHA 5BSKA 4ZAYA 3QWFA 3VH3A 1QVVA 5LQKA 1F8UA 1YZYA 2ZYIA 3A3NA 4QDKA 4GHWA 5B1HA 1MB0A 1QO0D 1DU4A 3N70A 4OSPA 2QYOA 2HMSA 1GTVA 2QROA 3SS9X 1ISRA 3BTOA 3T7DA 3D1VA 2YWHA 2COUA 2C8LA 3FYHA 3ANSA 5BNZA 3A06A 3LY7A 3PVZA 1S3FA 3GDFA 4UASA 2HM7A 2V7QA 3I52A 2C2BA 2J08A 1R6TA 1QHIA 1C9KA 1XLVA 3PQ5A 5BRAA 2GCOA 5CFPA 3H0EA 5EIFA 4J9UE 2WHXA 2XCLA 4FQ5A 1DEHA 1FRVA 1YZQA 2IC5A 2ISQA 2YRFA 5IKOA 1YUMA 1E6CA 5H68A 2QR5A 4Y1GA 4J2OA 2H08A 3QVTA 2F64A 3OPYI 4TV8A 3U4QB 5DN6A 1XZEA 1FVOA 5EIBD 4JXZA 5H9VA 4FZRA 1Q14A 1QWOA 3I9V6 3KOXA 3LHKA 2WTEA 4UE3S 4L5AA 2V7XA 5HRCA 1CP3A 4DMKA 4X8HA 2FXIA 1IZ7A 2X4LA 4NNPA 1CUEA 1HE1C 1VXRA 2NXEA 1KZ4A 3DOCA 3H2KA 3KL4A 3L2OB 1NVGA 3MMXA 3PFBA 3PJEA 3CIOA 2P0EA 2R1ZA 4ODIA 5DCWA 2UXBB 3L18A 3FYCA 3FWPA 1ZK2A 2LUOA 5DYTA 3WDMA 1USKA 4ENPA 2O57A 2OCBA 3GNSA 3RYHA 4X92A 4N8DA 1CDEA 4BBAA 1N1GA 2GXUA 2B20A 2NNWB 3U4IA 2VUTA 3GLIE 1XVIA 2KJQA 3AVPA 4BP1A 4ZHQA 3N74A 4JR2A 3CX3A 4X91A 2GHRA 1E9FA 2PXCA 3PHLA 1FB5A 1U7HA 2HN9A 1SU6A 3GLGB 2WUWE 3OH8A 4WADA 2YV1A 5CLQA 3U56A 1N8KA 1WSWA 2NT4A 4DAEA 2CK3A 1U0LA 2QRJA 2FSGA 3R20A 1H1LA 4F45A 1ZJWA 1Y42X 2PBRA 4JLPA 4KR7A 3PE4A 2AJLI 3CNLA 1LS6A 1TU3A 3C8ZA 4S1NA 3UWPA 2FUEA 3AHHA 3LLCA 1KOGA 4UREA 1TCCA 4CBVA 3Q3JB 1BQ4A 1IM2A 4B7UA 5JSUA 3W8RA 1H23A 3QPWA 1Y8CA 1NKVA 1T4BA 4KVAA 2NVUA 1Z9BA 3H5IA 3AWDA 2VRWA 1BN6A 3MPOA 4ZVMA 3KHTA 4U0JA 1RQNA 1IOLA 4FILA 3DMHA 4I6GA 4PINA 3A31A 1WPQA 3GJSA 4B3XA 3FMFA 4BB5A 1ESMA 4D8XA 1G4HA 1Q19A 2DPLA 1H0KA 3GAFA 2ADMA 4QQKA 4WZAB 2O5EA 1C1DB 3LUGA 3ECSA 2Q1XA 4JJEA 5COAA 1KKMA 2GHIA 4BLVA 5IMSA 4GLBA 3QFSA 5HJEA 4GF5A 1WVGA 5IULC 3RSGA 3AIMA 2B82A 3IP6A 3LFHA 4EQZA 2Y1FA 3EZNA 3OJWA 2QRPA 1NUUA 3JR3A 4O2RA 4UHCA 5AHWA 2OLJA 1W4ZA 2BL4A 4L9AA 1JQDA 4PGAA 5HG0A 1KZYC 2WF9A 5JMPA 4G9GA 4FWTA 2GBLA 3STHA 4L6AA 3GLFA 3JY6A 3OZTA 1YTLA 1P17A 2IDZA 4ILKA 4Y9DA 3TGLA 3A1NA 1DDGA 5CLGA 1QX3A 3QK7A 3DXXA 1DOAA 1WHTB 3R5KA 3ZDAA 2EGGA 3QUQA 5ALRA 1ULAA 4YP6A 1WXWA 4GGOA 4MCHA 1U11A 3MWYW 2ABWA 4X00A 3WGMA 1F8XA 2BHSA 2WVHA 4E2WA 3QG5A 3NAZA 5DM2A 1NNLA 2WJHA 2WG2A 1XTBA 3KSMA 4FDAA 1MFPA 1GAEO 2XZPA 3H0KA 2G77B 4KTTE 2YIJA 3A4NA 3I62A 2AZXA 3AF2A 1QF6A 4C4XA 5K8LA 5KVVA 1YQGA 3OE7D 1RRKA 4PX9A 1E8MA 2D0DA 4MEBA 4RZ3A 4YRTA 2IHNA 1CJVC 3JD3A 3TUZC 1ZX1A 1JDBC 4FK8A 5F5LA 1UKAA 3LF2A 4QVKA 1UODA 3I5XA 1FZTA 1HDZA 2OHFA 1ECGA 1FUIA 2WKPA 2BPOA 2IUFA 4HSGA 3U1TA 1GZVA 1ZI8A 2R00C 1QGZA 5T5QA 5C8XA 2IEAA 3H1EA 3LUPA 4UHBA 4KPFC 1E5XA 5DHSA 4CCYB 2JIZA 4LDPA 1E99A 2RKBA 4DLWA 3IAAA 4Z0TA 3C6XA 3A6DA 5JCPA 2O8DB 4MLPA 1JEAA 5LZ5A 2QTFA 3V4FA 1WWKA 2ZDQA 3WK7A 3R2JA 5BQFA 5KWVA 5DHFA 4AJ9A 4MQ5A 4E13A 3WNZA 3UMMA 3GFBA 3U26A 2AX4A 2PUVA 1CLEA 2YWGA 3GW8A 2PWAA 3ILSA 3N2IA 1MVNA 3MSXA 4C20A 3IUJA 1TD1A 2QT0A 2XMZA 3KWLA 4H3KB 4UNIA 5F1YA 1KYXA 3AVQA 2O1XA 3IJ5A 2GARA 4P83A 2HRQA 1MEEA 1MAHA 2BFDB 4OLBA 4P7FA 1U2DA 3UJ7A 1IZ8A 4QGHA 4ZCIA 1G8HA 4P4SA 5G3ZA 1BVRA 1KMHB 2HWKA 2YHSA 5DT2A 4PG8A 3PGJA 4A0FA 4M1WA 2B2XA 3R7WB 5FUXA 5JS1A 3OQIB 1SUCA 2VT7A 3LO5A 4RF3A 4JLSA 4FX5A 4CKCB 4KMOA 2NU7A 1FYFA 4EAAA 2FDXA 4HDSA 4UUMA 1B15A 1KP2A 1NFQA 4DWJA 3EXEB 4GRIA 3MCWA 1M2GA 3QIAA 4ZI5A 1TJ4A 1X1BA 3OZDA 1JDUA 1GYRA 1T1IA 1ZC4A 2Q1WA 2QQEA 1THTA 1DKRA 1XD9A 2HWUA 1RLJA 4IGKA 5JD6A 1BGVA 5KBYA 4HNTA 5LD2B 2FMFA 1Y7PA 3B1KA 2QB5A 5TQ2B 4WBNF 5BWOA 2FWRA 4PSAA 1ZBQA 5DISB 4DQUA 2VK2A 5U4QA 3AI7A 5AW5A 2W2LA 4ZU3A 1LJLA 2PZMA 3ODGA 2XGMA 1VOTA 1XL0A 2PVCA 2CHFA 4HATA 4RJTA 7REQB 1SBYA 1Z0ZA 2CFTA 3Q8KA 2X0EA 3DULA 3RB8A 1TIPA 4QT0A 4NEHB 1NJ2A 1C8VB 1O9HA 1VE1A 3IKJA 3ZGXA 4ZI7A 1TMYA 3DE2X 4OJMX 3O9MA 4GX5A 3PZBA 1L5VA 2WPDA 2ISCA 2XX3A 1IIRA 5CVJA 3H7AA 2ORED 5IJ9A 2YJ4A 4AKGA 4GMGA 1ZNXA 2Q6VA 2X5KO 5SICE 1JMKC 5ESXA 4AY5A 2ZIGA 4WLOA 2VCEA 4ZIRB 4KIJA 2RAPA 3CPJB 1WR8A 3EZ2A 4YAOA 1J2RA 1E9EA 4W5QA 1GTRA 1JPNA 1IBRA 1XT6A 2VFAA 2V98A 3CXUA 3N8HA 3NBAA 5AICA 2PD6A 1D7AA 4POOA 3OOHA 1AB5A 5CCXA 4K7JA 3VHRA 4FYIA 1LW6E 2DH5A 3SEQA 1E7YA 1Z75A 1BS9A 2GXSA 4P1ZA 3T35A 1EA7A 4JYZA 4MYCA 4Z7NB 3VTFA 4GWKA 1NI4B 1K8YB 1Z4OA 4W8GA 3AL3A 5FQOA 4EJ6A 4FEGA 1A2BA 4FYXA 4OEHA 4D43A 1KQNA 4GSKA 4M1ZA 3VV2A 4OXXA 1E0AA 3KQVA 2W6NA 5KINB 4YCCA 1F2UA 1HV8A 3GJ7A 3OCJA 3VSCA 4QOGA 1DAIA 1PZFA 2GBGA 4X7MA 5J4YA 1JVSA 5JALA 4HN9A 3RARA 1FRFS 2QP3A 4UHJA 4L0DA 1DTWA 2FZVA 4IMIB 5L3SA 1D1TA 1P4HA 3UOWA 1PSWA 3U3OA 5LR6A 2DULA 3D6MA 3ZDEA 5B1YA 5C7YA 1US8B 4CIDA 1VE7A 1GZ3A 2JEZA 1EBBA 2EIXA 3G23A 4H7KA 4N6GA 4H7FA 5F52A 3T3HA 3NUZA 2QAGA 1JUDA 2OY0A 2PWBA 4OXYA 1NAIA 4I9GA 2EHDA 4PU0A 1KRWA 1TMOA 3CNEA 4NECA 3P26A 4TM7A 2ZUVA 1BDMA 1ECJA 3FCYA 3OO1A 1RD4A 1Z88A 1U1IA 1RXIA 1IHUA 2AQHA 3OZ7A 4JEHA 5ED4A 5FXMA 1JRLA 3A7EA 4UQOA 5KHOC 4UFNA 3PQEA 1YDMA 2R7MA 4OO3A 3WWDA 4BEVA 2XB2A 1JIQA 4M88A 1P7YA 2FZ5A 4FDLA 4YDRA 5HUJA 2W2XA 4CLRB 2O2HA 5C1DA 3B53X 2J31A 2M32A 3C4QA 2N1MA 3DD5A 2BGWA 3AWIA 2QD3A 3L01A 5IVKA 3EDYA 3KU1A 4MQUA 4G07A 2FKAA 2RH9B 3K1JA 4E5SA 4CM4B 3RSCA 2O2YA 4NCAA 3A2KA 3HJAA 4GT1A 4RTLA 4FOPA 3WL3A 4PANA 1K3TA 1Z73A 3RFXA 4EB6B 3O7WA 3D6UA 3SF0A 1XZHA 1HPLA 4J1QA 4RD6A 1WXQA 4HR7A 3BKXA 3U3ZA 3I1JA 1T3HA 1Y81A 2QRGA 2YW2A 3DE3X 4JB3A 3ZBQA 2V4UA 4KPGA 3E9MA 2QVXX 3HB5X 5M3BA 1CUBA 5K9ZA 1ZQ1A 1C9EA 2BGKA 3COWA 1VJCA 4MIEA 2QRVA 2DY0A 4KE9A 1PR6A 1OBCA 3R6LA 5EZ6B 3ZDCA 4RACA 4DXHA 3SIWA 1Q1AA 1Y82A 5JZMA 4EB8A 1EG7A 1P2UA 2OZLB 1PF7E 2BEVA 4OHVA 5C8DA 1QSGA 3OZRA 1HETA 4Z4QA 1ZMTA 4XB1A 1E5QA 3TZBA 5HXAA 2I2FA 4MVJP 2CL0X 2CW5A 2ZI4A 2EBUA 1O94A 1MIOB 2P67A 3NBFA 2GO1A 5ALWA 2EQAA 2RKOA 2ZDHA 2FSIA 1MOQA 2IYPA 1ST3A 2OFXA 3E5HA 4XJVA 1W87A 4Y1FA 1GPNA 4OAQA 5C1IA 1OGIA 3QWIA 4YP5A 4PHCA 5FLYA 1PKXA 4QTZA 3ND6A 1HSOA 3CLUD 1X9GA 1ES9A 1YR3A 2XQVA 2JKVA 3F9CA 1Y1RA 4M9RA 2MSCB 3O83A 3MMPA 4RHUA 1E4VA 1U1CA 2FPUA 2X4IA 1NG1A 4F4JA 2ZTMA 4BEBA 3IDQA 3L05A 4E4YA 4X93A 1U0NA 2Q07A 3COYA 1ZCZA 2XA1A 3V80A 2AW5A 3G0OA 3ANNA 1EHYA 3VNAA 2GS9A 2HWXA 2RBEA 1VJGA 2AOUA 2JLWA 1C3JA 2FN7A 1RYDA 3P97A 4MP6A 4E30A 4LSGA 2G83A 4NU0A 2ZYWX 2CCKA 2NXWA 1XEWX 3S29A 2OECA 1CB0A 3P27A 1TRKA 3IP3A 5EFZA 1P1HA 1DIHA 2BJVA 1KC3A 2QX6A 1O9BA 4MGZR 4J8PA 1E6LA 1ATIA 1GQQA 3LCVB 2DPHA 1IATA 5E2BA 1KY4A 4L7QA 4FN4A 3MD9A 4JMPA 2V7WA 1ZD3A 3H6HA 1M6HA 3AF0A 4MQ4A 3PSAA 4TTJA 2O7VA 4FW8A 3JVEA 5ESWA 4S3MA 2FEOA 1EXWA 3AF4A 3R7NA 1YB5A 4KYUA 5DX8A 3W0LB 5LA6B 4D3SA 1MU0A 3I04A 1BS2A 1YS4A 4FLMA 4OL9A 2A9FA 2C77A 4X44A 1Q50A 4EYSA 1K08A 1Z4KA 4C04A 3MPUA 3OIVA 1BOOA 2R6ZA 3RYCA 3OJ0A 4LJ6A 2G9RA 3S1LA 2LW7A 1B1AA 3VR4A 3ERCA 3IEXA 4CLEA 1ZESA 4DDUA 4O4LA 2QNRA 1PR3A 1FDVA 1R66A 1DIGA 1FBNA 2I4OA 4ITUA 5AH0A 5HZGA 3TXXA 1AGPA 3E0QA 4BNDB 2PCLA 3K96A 3JU3A 3H7IA 5B58T 8LDHA 2A1TS 4RJKA 1M2VB 5KTTA 3EULA 4HDMB 5EJFA 1PT7A 1RJ9B 2IYXA 1M34B 2QDXA 2FPGB 3LM8A 3O8LA 4G36A 4R81A 4YRQA 3H84A 3U1BA 2UU9B 4GE3A 5JSYA 4CPDA 5TNXA 2P1ZA 5A5FA 2YYSA 1CDZA 3D02A 3VDMA 3LBFA 1ABBA 3JQ7A 3RKUA 1OXXK 1FNNA 2JIPA 4V0NA 2ODEA 2H5EA 1RIFA 2OTCA 2BGUA 2Y3IA 2QTCA 5IK2D 5JOQA 1X9HA 1J39A 1DBSA 2XCSB 3BBLA 2VNSA 3LI2A 4KFRA 4I1PA 2O8FA 4OGWA 3THXB 1XZBA 1NVFA 1RC0A 2AKEA 2WYOA 3CRZA 4ND3A 3VOTA 2R7LA 3IXLA 2I6UA 2WV9A 3IA2A 2XT9A 4N5LA 4ESEA 4POAA 3K0CC 3FMIA 4UE6A 4L8FA 3SJ7A 2OFPA 5HGXA 3T0IA 4F5WA 2I2CA 2I1LA 4AQDA 1SOMA 1P62B 4PXAA 4Q02A 1TZBA 1Z7BA 1LNZA 3FOEC 2EG5A 2P9FA 2H9IA 1B43A 4GPZA 2IYFA 1ZCAA 3WICA 2GEFA 3QVWA 1CK4A 4EYEA 1KHHA 5C1PA 3RUIA 3K5WA 4UEJA 2XWJI 2PN1A 4D4JA 1YJ8A 4E03A 3UWMA 3GOHA 1XDSA 2HI0A 4QYXA 3K2EA 1BFDA 4UCXA 1MVOA 5ARDA 3RFFA 3B60A 2G1PA 3AB8A 1F2TA 1P0QA 1SBIA 2UZ1B 5FPQA 3WGOA 2CCJA 1XELA 3AF1A 5I7EA 2GKGA 1IVSA 2GQ0A 1T91A 2BMFA 1ETHA 2CDBA 2IUEA 1V8DA 3VNVA 1OXKB 4JV5B 3DO5A 3QG1A 2Y76A 4M60A 4XUDA 1JWLA 2QPTA 3W4KA 1OIXA 4IUCS 3K9NA 2Y8EA 3IAEA 4RZ2A 2WU0A 2EFJA 3ESRA 4HDNB 5KJ6A 3BTUA 4Z1MA 3SDZA 3CRMA 3CKLA 1DKUA 2ID7A 2WAMA 3KS9A 5BN5B 5TV2A 1KSGA 4R2WA 1KFKB 1MGPA 4X3OA 6ABPA 2Z6UA 1TXGA 1XOIA 3KQNA 4XCVA 5J9FA 1R9NA 1MB3A 5HQ3A 3DTTA 1R37A 4ACAA 3DEKA 4OHPA 3V4PB 1EX9A 1K6XA 1AK2A 3WGIA 3GUHA 4R7TA 4OQXA 3U4CA 1N1EA 1SCNE 1L4BA 1YAJA 2W2PA 2XE6A 3E9ZA 4KIWA 4B40A 5CJ2A 2HX1A 3PPVA 1H4TA 4I4IA 2QZJA 2QLFA 3KKPA 3MYRA 2BZ0A 3FRJA 5CK5A 2R1TB 2H51A 3FDFA 3VA7A 4H0NA 4D4KA 3OO0A 1Y9DA 4QBGB 3D3NA 2I87A 5HS4A 3FCXA 2PMCA 1DEAA 3OE5A 1GQRA 3L1VA 4KQ1A 4M99A 5ECWA 1Q0QA 1U0FA 3FWNA 3QVGB 2X42A 1UM9A 2BKVA 4L4ZA 4DLSA 2J5BA 3MLAA 5AR1A 1VLQA 1CRZA 1Y3IA 4YNBA 3KKKA 1XALA 5GONA 4F6LA 3I1FA 4BO2A 2OL4A 4H0FA 3HPRA 1Y3HA 3TUIC 4JOCA 5CVUA 5EHQA 1VSBA 2NZ8A 2WNHA 4KBGA 2SKEA 4DJEC 1QRTA 4K87A 2NUPB 1G6Q1 4ND7A 4RVDA 3ITNA 2VNAA 4Y2PA 3C6ZA 2D5AA 2I2BA 4DUGD 3E2PA 4RHYA 4Z4GA 1MJHA 1LV7A 2QZSA 5E1MA 1NRXA 3FPCA 2H5IA 3OJEA 2B61A 1T5TA 4QICA 4PNZA 1NUQA 2P2ZA 3ZE2B 4B0OA 1JLRA 2H2GA 1MUUA 2JBHA 4XVHA 5FV7A 3NT5A 1IHOA 3T61A 1VRWA 3WGQA 5ENDA 1SULA 3H2SA 3AETB 3B78A 4IDOA 1L8LA 2WU1A 1J6UA 4J90A 4GL2A 1U98A 4A8JB 3QV2A 2WR8A 1YOVA 4GMFA 5HFAA 3VR1A 3A9TA 1GRVA 5CP8A 2C7RA 1K89A 2JNWA 2HO4A 3MGGA 3IDOA 1G8PA 5FOQA 2YX1A 1UC5B 2HU8A 5EQTA 1YZUA 4BB6A 1MC8A 3P4UA 2EZTA 1T6NA 2Z2YA 1DL5A 1SQ0A 4PG5A 5T8KA 3EW7A 1YBMA 4I5DA 5KJFA 2OV8A 4RBNA 3YASA 4MKIA 3TG2A 3OTOB 3QH4A 2ORWA 4XX0B 5CFQA 3N2KB 4PBRA 4KNYA 3M9XA 4DV7B 5HP4A 5BYAA 4WL0A 4R51A 3KSRA 1JP7A 2OV3A 1UC8A 3GLRA 4A03A 3M3PA 3X2EA 2HSWA 1KTVA 3FFWA 2YBDA 3DDZX 1DBQA 1CB7A 4DARA 4C4ZA 1EVIA 1DPFA 5IS2A 1Z13A 2JGLA 4UQPA 5EUBA 5D7BA 1AF4A 1A2QA 1XF9A 1GRRA 2L69A 3QW2A 4QQ8A 3GG9A 4KPEC 1VSQA 4F4DA 2CMFA 1E4EA 5KB3A 3DW1X 1TT5A 3ET4A 1NW7A 1T8UA 3MIIA 4Z4IA 5L9AA 2ZUEA 3WKEA 3U60B 5EPOA 1EVYA 1ZI6A 2NUTB 3BT7A 3P0IA 2GJ4A 3JQRA 4I5GA 4ND1A 1SVKA 3KR1A 4ITVA 5B6JA 1USVA 2YXBA 2QM8A 3CISA 3DD1A 2CBZA 2DVMA 1LU9A 3KL2A 1JEDA 4XGIA 3DEHA 2DWOA 4ZAFA 3ZXSA 3EPKA 1XD2A 3KEOA 4WACA 4KODA 1Q0TA 2O50A 1QK3A 4LJ9A 5KSWB 4DHEA 2WDZA 2H9AA 1F0NA 2ZROA 5CNIA 1LK0A 1WV1A 1WY7A 3B2QA 2X2EA 4FXPA 3H83A 1Y8ZA 2PMBA 3H5WA 5IRCD 3GUUA 5G4KB 3FB1A 1GR1A 4D4IA 3TD6A 1JBKA 1QVRA 1WLYA 4PBSA 5BNIA 1MCZA 1J2JA 4B4KA 2VPXA 2BEUA 1WBBA 3RS8A 2I67A 2B25A 2Q3MA 1NBAA 1LKZA 2OYSA 4PLYA 4YONB 3F6BX 5FAKA 4IL5A 3VU3A 2C97A 4A16A 1HSZA 1G4AE 4FFRA 1LJ8A 2WIKA 4YPFA 1L1FA 4BRWA 4DCCA 1RWXA 5DM60 2XTZA 2WB4A 2HQ1A 1ECFA 3NP9A 3R4CA 5FL3A 4M6WA 4R1OA 1T8WA 3VKGA 1F0YA 2H48A 3GMSA 1NIJA 4W1SA 1RLUA 2OZVA 1O96A 2VEDA 2W8ZA 2GEVA 3WQHA 5FUMA 5LLTA 5EHIA 1U8FO 4DA6A 3WX0A 4V0RA 2GDJA 1SHZA 4EMSA 4A8PA 5IAKA 2ILTA 3L7BA 5JQGA 2UZ4A 1Y1KE 4N5NA 1WX1A 5EVCA 1GGKA 1HEIA 4MDHA 3TIIA 3T3MB 2DSNA 3MC1A 4K46A 2PFSA 2AQIA 2C2WA 2VF4X 3RWMB 4I55B 3PD0A 1TL7C 3H18A 4Q4DA 3RBAA 1ZNZA 1GDHA 1NVDA 3NXKA 3WGHA 4AZ3B 4D8VA 2ZCVA 9ATCA 4RHTA 1JYSA 1NW4A 3E15A 3OFVA 4D82A 2GK3A 3VH4A 2AN3A 1VMIA 1QKJA 4GMXA 2VZEA 2WSLA 4I19A 4PV7A 2GD6A 4YCJA 4NFHA 1N6IA 2O0LA 2ZJ8A 4LIPD 5GMOA 3RVMA 1Z6QA 2WWFA 2PS9A 1GGMA 4GPIB 3JPYA 5LZ9A 4CMIB 2D6FA 2HFJA 2E37A 2VTKA 4MUYA 2ZR7A 4UE2A 1ULUA 1F2DA 1WG8A 2BFMA 1K75A 4V2UA 2EATA 1KU6A 4YACA 3IBFA 4N41A 1GKKA 2WDPA 1ZRSA 3DL2A 1FYWA 4ZOEA 1H3EA 3Q8MA 4DSOA 3F7OA 3D7NA 3CLUC 3V2GA 2XNCA 1Q7GA 1VLHA 3OFJA 4XW2A 4RIHA 1VCIA 1XKLA 1EM6A 3KXLA 4IH4A 5HE9A 4EUSA 3DOEA 2OUIA 3ROFA 1OI3A 4C9BA 3WYDA 4OGLA 4OGGA 3SBDA 5KYXA 2GPBA 4HRXA 4OUKX 5JY1A 2CFSA 3HCBA 4TGLA 3P9YA 4C4PA 1TZCA 3G88A 2D7DA 2AG0A 2OXFA 4JITA 5LP6F 3UHOA 2BM1A 3SKXA 2NZVG 5FWDA 3E9DA 5E2IA 2A57A 4JSYA 4QULA 3F97A 3WJ2A 1OX6A 3C5VA 2IYRA 1G0OA 4OAPA 5HOQA 1E2JA 3MSCA 5D5PA 2ORIA 1N2CE 1F51E 1RABA 2P2GA 1UMBA 2P6PA 2R3SA 3F6EX 4IIHA 4PSKA 4QFDA 4C0WA 5B4VA 1G8YA 3Q7PA 1Q16A 1J7KA 1OI4A 4Q7JB 5EXXA 2ATCA 2O3QA 3P2MA 5KWSA 4MVJI 3DBLA 2PSSA 2F4VB 1MJFA 2IE0A 1GYPA 1NSFA 4P4UA 2A7XA 3WIOA 4UNQA 1O3YA 2B0CA 3BX1A 4M1TA 5E6RA 4C7OA 3EFHA 2RAFA 3H1AA 1TE2A 1E0KA 1UZLA 1W1UA 1WXHA 1JDPA 4HGZA 1RRGA 4M0PA 1TI7A 3IKVA 3PVSA 4PLTA 4TTQA 2Z04A 2P11A 2QPOA 3LCCA 3PX3A 1ZW1A 5F77A 5EYPB 1IMOA 4TYWA 2AK2A 4EY8A 2L17A 4CFYA 3F8SA 1JTEA 1LJUA 1W47A 3N2GA 5TJHA 4TKMA 4AMYA 4EB0A 4PX5A 3BWBA 3NXSA 5JSFA 2J4FA 3GEPA 1A1SA 5DT9A 2BYTA 1CS0B 1VGVA 3NQ41 1VE6A 1RYEA 3D8HA 3L82B 4J6EA 5AJUA 1QIGA 2PZGA 4B09A 1BXRB 5SY9A 5F7JA 4HDRB 3K4QA 3WL8A 2YJ3A 1T0IA 3GO4A 1N6KA 2C1XA 2JH8A 1D2GA 1QB7A 3RLIA 3FPLA 3HU5A 4E5MA 1WPXA 2B34A 3EDRA 3AG5A 3AUXA 3EVBA 4IDHA 4WGGA 1E62A 1CJTC 4BV2A 1UBKS 3LDGA 1PR5A 5A3VA 4H4EA 3G49A 1YQ9A 1PE0A 5HCNA 4ONEA 1R0XA 2Z4TA 4GEGA 2PQ6A 3L06A 1E7QA 1EM8A 4MRVA 4Y9SA 3M6LA 2YCLA 5AKYA 3FUXA 3B1FA 2GN9A 5LD2C 2B94A 5MN6A 3IAS6 1ZOIA 1N9GA 3NHFA 5H83A 1UBSB 3H4MA 4D41A 1Z37A 1EDOA 1PJBA 2WKWA 4URHA 1PU2A 1GNTA 2JI7A 4EHHA 4X6UA 3EIWA 4N49A 4L5IA 3WK8A 4E5VA 4DB2A 1X6VA 1DLJA 4I3GA 1XDUA 5IARA 3PL1A 2H06A 3OC0A 2HREA 5EXPA 5AXAA 2VQ3A 4OU4A 3J7AC 1E3DA 1M8FA 2BEKA 3FHTA 4AROA 2F4NA 4QBKA 4PNPA 3PXXA 1UJ2A 4LF9B 5DKFA 1RRMA 3HO8A 4LYHA 4U7FA 5DM4A 5ICEA 3ZU3A 4ER7A 5IUNC 2FEXA 1DC3A 3VTZA 2QW8A 4RE5A 2IW1A 2ZWVA 3TQSA 2QSUA 4BE4A 3G1TA 3NMUF 1NWHA 1IEXA 4UUAA 4BO5A 4NBNA 2FEPA 5FUVA 2CV2A 3MW8A 4P32A 4BNHA 3J80A 2BI8A 2E1PA 2YQ5A 3VO1A 5CFOA 2CXRA 3AVOA 3H99A 3BH6A 3W2HA 5BV1A 4XWYA 1REQA 2QI9F 1AV6A 4AKHA 4WECA 1IHYA 1P72A 2FRXA 2QJTA 3VOAA 3BYZA 2V5UA 1GV1A 2BFEB 4B6SA 1PR0A 2C1ZA 3NNNA 3GLGA 2UVDA 3CHYA 1SFRA 3CJRA 4MJ3A 3GGGA 3L04A 1ODLA 4UAGA 3Q7TA 2IOFK 2Q3CA 1JU9A 4IICA 4AUMA 4KMRA 2UZAA 1RKXA 4UULA 1CVLA 2OMKA 4LC0A 1G5QA 1NT4A 2MR5A 2W6MA 3MCTA 4GI3A 4TWBA 5EJMA 1AF7A 3V2UA 1W4LA 4BKPA 3RSLA 1EWYA 2HT6A 5HE8A 4XH9B 3WIVA 2Q3LA 4KN9S 4EENA 5IU6A 3ZTYA 2I1VB 5I47A 2VVTA 4JI6B 4DBZA 3DCIA 4RD0A 4V1CI 4EF6A 5ES4B 3QXHA 1L5RA 5KOIA 1PFVA 5EHXA 2VK8A 1I4WA 3I5UA 2PCJA 1U9CA 1KBZA 2ZUDA 3K1YA 5DNAA 1GD1O 3FOBA 3PC7A 4EAQA 2IZ0A 3IOMA 1ONSA 3TOSA 1LDMA 3EIEA 3KLMX 3PLRA 4MDYA 5C18A 5GWXA 2HMAA 1Z4IA 2GF0A 3E05A 2RK4A 1JMVA 1ZHHA 4MUEA 2K6GA 2RE8A 4QGFA 4RMJA 5CFMA 2Z9CA 2YL2A 4KXMA 4ZP1A 1G9TA 1L4LA 2DKFA 3ENWA 4X3CA 4B81A 1ZM3A 2FN9A 1I2MA 1LNQA 4DMCA 4CF7A 3AOGA 1XVUA 4BB9A 1E2DA 2QM7A 4I50F 3WDSA 3I83A 4ERNA 3NHRA 2QTBA 5LSAA 3T1OA 1YJ5A 3PRYA 3V00A 5D3KA 3ZCXA 2IOQA 1TGYA 3DVSX 2DTXA 2SCUB 4LDZA 3ZIDA 5IN5A 4XXHA 3WV4A 2GZSA 4B4DA 4LHZA 1EFVB 3CKMA 3VR6H 4D9IA 2VHWA 3QF4A 4R2HA 3FPHA 1WUIS 4GOXA 3AY3A 1H4SA 2O8NA 3IO5A 3SKVA 4ABYA 1SA0B 5CDSA 1L4UA 4CG2A 1JHMA 5JS7A 5HK9A 5B37A 3SF8A 3ICQB 2HHHB 2AS0A 2QLTA 3H05A 2FG7C 3P2OA 4DA8A 4O2AA 3CVWA 3W3AH 1Z5ZA 3GUVA 1DBPA 2OZPA 1TQ2A 1XN1A 1Q3KA 1II0A 1XJQA 2BD0A 3QX8A 5K3EA 3TH5A 5KTMA 1RC1A 4K1XA 4RMHA 1QGUB 1NMYA 1OV4A 2VJMB 5L6LB 2ERYA 3UA3A 3E23A 5JSZA 3A4MA 3E7WA 1E9DA 3ONNA 4WINA 3W6ZA 4C4SA 1LLFA 4MQBA 1WETA 1HDCA 2A7QA 4IRMA 3LGXA 1XHLA 4LKRA 4M0UA 3V7WA 2HGSA 4P22A 1PJAA 1TA0A 1DO0A 2B4AA 4YASA 4CIAA 4N7JA 2H8GA 1BCRB 2IL1A 4AD8A 1PT6A 2VJBA 2VO1A 3OEEA 3KO8A 4A2WA 2R96A 4WUVA 2YJ5A 3GT7A 3E9YA 1ZFNA 1CY2A 4GNRA 4K6FA 2R6R1 4N3NA 4ZO4A 5DRYA 3TQRA 2XXAA 5KYTA 4MV8A 4YUXA 5IDQA 3BS4A 5AKXA 4CMGA 3I9OA 3CSUA 1YR6A 3O8CA 1IWPB 3TZKA 1GL7A 2YJZA 1S9HA 1WXIA 4AAYA 1OB2A 5IP5A 2EEPA 3BB4A 2PANA 2MTBA 5J5CA 1OGJA 2PX5A 2YVUA 4Q01A 3ZPXA 3TECE 1TAUA 1E1CB 2FW1A 4HQKA 1V3VA 3M6FA 3MT8A 4XLZA 4P58A 4ZV9A 1N2IA 5HMMA 3VNRA 4CKCA 5L3QA 4OP2A 1QIFA 3INYA 2NU8B 1D09A 3QXGA 1KI4A 4FGUA 5EIAA 1Z6TA 1DNPA 4Y98A 3O4IA 1U9ZA 2AC7A 1P1KA 3AJEA 3QVSA 4TMTA 2AZDA 4B3SB 3IUBA 4GVXA 2FPOA 4FNGA 3WLSA 5K6AA 1C30B 1P9WA 3GLHE 3MMNA 3EQ7A 4MR8A 5YASA 5CBPA 1P0FA 3A2MA 3GGCA 3HB7A 3O3MB 3T7JA 1E60A 1CUXA 2XSZA 4HGPA 1KE2A 2IGBA 1LH0A 1JILA 3M49A 3VR3A 5KWEA 3L7KA 4AQYB 2FTKE 3FTDA 2XCTB 1NW8A 1XRRA 1DCMA 2J5RA 4FM9A 5BP7A 1KR2A 2NM0A 2HU5A 2C4TA 4LDJA 5AQ1A 1EWQA 3PWTA 4OBBA 4O4HA 4BCCA 4TQ9A 3IEVA 4PYKA 3DLPX 1U28A 4N9QA 1E20A 1B6SA 1I0LA 2OBBA 2OM6A 2Q6OA 4OHOA 4ZYVA 2ZM6B 1YZFA 2Q62A 2BUBA 4ALKA 1ELOA 2GXAA 2OMEA 1IMJA 2AE1A 1NYQA 4MOWA 2EJUA 1P9OA 4N6OA 1PZEA 4O1IA 1YZNA 3U9LA 3U4AA 1KDVA 3L4BC 2HCBA 2QUBA 5A71A 2FEWB 4UTNA 1D6MA 5DGIA 4N47A 4M0LA 3HS3A 3W5HA 1Y4AE 2VHCA 4DDKA 1YL7A 3W9UA 2PRIA 2A86A 5EIXA 1MIHA 2SBTA 3Q4GA 2OOKA 1WPGA 3KZVA 4FMPA 4XD7A 3GQVA 3TXYA 2W2VA 1WEHA 3NGXA 4Q15A 2OKCA 3AEUA 1NYRA 2Z6QA 4QYIB 3PUKA 4P34A 3G0BA 5FLEX 3GXOA 4W7IA 4ZOAA 2HJVA 5EMNA 1KYTA 2G5TA 2FG5A 5IAGA 1E3JA 2GTHA 2ZBPA 1EPUA 1M0TA 1ORIA 4BUZA 5I3ZA 3M6IA 3O75A 2CD9A 1MJNA 1UMDB 2YWCA 4ZVNA 2ZBGA 5JQGF 3DZIA 4DR6B 3FZEA 3PLAE 1G291 4YTEA 5BO5A 3UF0A 3LBIA 4CHGA 4NXNB 3LQQA 3N8IA 1Q17A 5CDHA 1H5NA 3HVHA 2QU7A 2WAAA 2WNSA 2BE9A 3H1PA 2XGSA 3SYKA 3W04A 3L6BA 2L82A 3ENVA 1AG9A 2J3EA 3NTLA 3RLFA 1ZITA 3GCGA 3PT5A 3PUWA 1E6EA 4V0KA 5KKNB 5TLSA 1Z28A 2IXGA 5HOEA 1COWA 2EL9A 3GMDA 1TECE 3AHJA 1RE1A 4F6RB 4PRYA 8AT1A 3E58A 3BKWA 4R9NA 5FWNA 1LA2A 1B0ZA 5IUKC 1X8JA 4WK4B 4BFXA 2J6CA 4EJFA 3U7HB 1HURA 3NEYA 1BE6A 1PYDA 3IQHX 1VE9A 3RK4A 3HCEA 3X1JA 2FR1A 4GP6A 4E7PA 4UBLA 2LPMA 4QUJA 2F62A 4ASUA 1DEXA 3BM5A 3O1IC 4RLSA 3SHTA 3ZV4A 2GM4A 1HY3A 3OFKA 3GEBA 1Z5UA 3GP5A 5SV2A 3U3RA 4CLRA 2AKAB 3NDJA 1UADA 3JWEA 4FXOA 3CEPB 4IEIA 3P52A 2OFFA 5F3DA 2BSQA 2GKOA 1XIVA 3OMXA 5CNKA 4RULA 3KOZA 4HBZA 2N42A 1UFRA 3QITA 1VCOA 4CM4A 1QNFA 4RF2A 3TO5A 1ZW6A 2ZRKA 3FVQA 4B3DA 4DWWA 4XWOA 2W6ZA 5LQNA 4WASA 3BMOB 3AHGA 4G9BA 3JATB 2PFGA 2B3TA 2H63A 4W5HA 1ATZA 3ZYZA 4GIBA 1S2DA 2H4YA 3OF3A 4MLDA 3EEQA 3ZNOA 4ZMRA 4UBKA 1YQXA 2YHIB 1HH4A 4IHJB 2JJ1D 3FNIA 3ZHXA 4RTOA 2V5VA 2Y1OA 3PBKA 1O77A 2J4CA 3AR6A 2XF8A 2HJSA 5J5VA 3QX7A 3D64A 3ZLVA 4QRIA 4BBJA 3JASA 3VR2D 4Z4CA 3W7VA 4LJ8A 4NLLA 5MHTA 5CX1B 1HTWA 2OXRA 3KOOA 4YRFA 3TKLA 4M9SA 3MS7A 4UFPA 1T4CB 3TG8A 1OFVA 2ZREA 1D9XA 1XKTA 3TDMA 1RZ3A 1QZ3A 1QCCA 1G3UA 1OWLA 3QYFA 5CDGA 5GOTA 4EFNA 1CF9A 2EP8A 2PGIA 3E3LA 3MGAA 5CT9A 1CX9B 5KU7A 3PYLA 1CZUA 2AFIA 1P75A 1YB4A 1LS1A 1H2YA 3GAMA 4JB0A 4L78A 4RFVA 5B3JC 3T7SA 4F4HA 5ERYA 1K4MA 1TYBE 2YNMA 3HSKA 4N18A 3W79A 4JROA 2JGRA 4B7ZA 2XCRB 1JKFA 2NSLA 1R6UA 3C8UA 2FLKA 4GC9A 3I72A 2WM2A 3EDQA 5AJZA 2MYTA 4CL8A 4D6XA 2IKSA 1WMSA 2J0VA 3NOVA 1YACA 4GPAA 1R3DA 2RGNC 3FM9A 1QR6A 3QXJA 4MVJF 5FB3A 3I9FA 4EFMA 5E8RA 2QMHA 2R7KA 3Q2IA 4J49A 1W25A 3REQB 3LT5A 4YJKA 3VQTA 1FVHA 1NT2A 4R9UC 4A8JC 4DIOA 1PAUA 4D98A 4EKEA 4TT3D 3LPNA 4RLFA 3FHLA 1E2BA 1B3RA 1R8QA 2YZNA 1QH8B 2KBFA 2ZSBA 3NATA 5E4TA 3W2FA 3DAYA 2KLBA 2IKQA 2FW9A 2H3EA 1CR2A 2GX6A 2PD4A 3MTAA 4G5SA 3DFMA 1IN5A 3QUBA 3BCSA 5AM5A 3ROGA 3KHSA 3DWEX 3LQYA 5GM1A 1U3UA 3BXZA 3N58A 3UWKA 3AZQA 4Q7LA 3EOAI 1G1MA 4II3A 2C7PA 3CO0S 4LQ4A 4IS2A 5JLJA 3SC4A 5EE3A 4Z8YA 1ACMA 4U00A 1BEZA 3OY2A 1T2NA 3VZPA 4B74A 3LP5A 3UTDA 1HM5A 4KH1A 1OIWA 2IH2A 4BMSA 1SCUB 4PLZA 1T4DA 4E2XA 1VHLA 1XMXA 4LXYA 2CB9A 3BRWD 4R8MA 1ZGCA 3MTQA 3NJRA 3L3BA 1L4HA 3WB0A 4OBWA 2ODQA 4CIXA 5ISMA 3KKEA 1UT6A 1JS1X 5C37A 1P5RA 1YF3A 2C3PA 1KK2A 3EDMA 4MPTA 4O2BA 5KOHB 2VZ8A 4G5OA 4NXMB 3FMGA 3NWBA 4MKXA 3OWOA 1OB5A 3GJZA 4XIFA 3KK0A 2IEDA 3ZXIA 4D0NA 4WEOA 1A72A 4HDMA 5FTMA 3LV8A 1YBFA 1X7WA 3BICA 1MHPA 3CKKA 2L0XA 2QUIA 4OYHA 2A0UA 2Q2NA 2YHUA 5ILOA 4OLJA 4B7AA 1Z4QA 3OIGA 3CNNA 4TZTA 4V0QA 4MUBA 5CXSA 5TF4A 4ZK2A 4RNCA 2OGWA 4X1KB 1IY2A 2G9VA 4MWSA 4DS3A 3ZJVA 1TYCA 4MEJA 4P4GA 3BE6A 5IH7A 1Z25A 1NX9A 1WUKS 1WZUA 3P45A 4NBVA 1K1EA 5ER6A 4DCNA 5LZ8A 4X62B 1LZLA 4FOLA 4PQFA 2QXTA 4IYJA 3KT3A 4AS2A 3DEJA 4DC0A 2EERA 2RAUA 4UZEA 4S0XA 1VI2A 2YDYA 3OF5A 4CTJA 4LBZA 5M04A 3Q3IA 1T3SA 3FNQA 2ZULA 1R6DA 4KQEA 4CM7A 4UBIA 3GJQA 3GJ5A 3N7UA 1XR3A 5K0ZA 1OVGA 3E1GA 1YRBA 5K6TA 8MHTA 3ISTA 4L5CA 4BVJA 1DMRA 1UK9A 3RS2A 1W4AA 1DIBA 2NU9A 4GOLD 1LPOA 1OFGA 5AKEA 3E7PA 1N36B 3NYQA 4MS3B 4EO4A 1M6YA 4S1PA 1BMFD 1GEGA 4LYGA 1I4EB 3STVA 2RGRA 1Z8HA 4NPAA 3IVRA 2H4XA 1FJGB 2Z8YA 3AEKB 3GZNA 5HJ7A 1EFUA 3WXBA 4M36A 3UIEA 2JGEA 5KNDA 1UBLS 4F5ZA 1MDFA 1HYEA 2ERXA 4M98A 2VSFA 5HFJA 3ROPA 2ZSIA 2YDXA 2WA1A 1AQ6A 1V0JA 3D6HA 2Q99A 3OA0A 4NBKA 1M0WA 3RIHA 1XX6A 4U7PB 4YAJA 1NLFA 2A0KA 1O95C 2OQIA 5TVGA 3BWEA 3T5GA 4DLTA 4JB8A 1CZRA 3PQCA 4C4RA 5HF8A 3AEQA 4YO7A 2DR3A 1LDEA 1NHWA 1J90A 3NV9A 1T9HA 3R3YA 4ON9A 4TUYB 1LVUA 4Y7DA 3VBCA 4MS1B 5DBOA 1RJEA 1A9SA 3Q9UA 3W5VA 1DMSA 4KN8A 2BH9A 3LLVA 1OFIA 3D8SA 4M7RA 4QLOA 2P4QA 5A5GA 2EKDA 4O2AF 5B55A 5C1BA 3T5AA 2WSSA 2G6BA 4PLFA 2WAXA 2D13A 2YWRA 4Y1RA 3BDIA 5CDFA 1V5WA 3GRCA 4PQYA 2NYUA 3G2LA 4DLPA 3GCXA 1SMKA 5K99A 2Q28A 4B71A 1UXHA 3NBKA 5EIHA 2Z8XA 1R0SA 1WU8A 5TPWA 2VP0A 4HTFA 4I1SA 3DPSA 3A32A 4JQOA 4EA8A 3GPIA 3N53A 2F1JA 3WYEA 5EHZA 4RVCA 3C7TA 1T2FA 2KHZA 2WLTA 3AKDA 2IIBA 3KZNA 3N3BC 3T3IA 3DWIA 4X1YA 2YASA 3ND9A 1AVTA 2HA7A 3NHBA 4HQNA 1CQIA 3O9ZA 4I4CA 1CQZA 3V8QA 1SBZA 4M0KA 1EGHA 2GDZA 5ALHA 4ITRC 3O0TA 2R0QC 1U3WA 1OCEA 1Z12A 3D0OA 1UJ5A 2Y6UA 4BX0A 4U9IS 1KZ6A 2HRZA 4DV1B 5BURA 1JHDA 3SGLA 5TQ0B 5IKEA 2VAMA 1U7OA 1UAAA 2VPTA 3CINA 1N2HA 1JKXA 1TUIA 1U2PA 5JDCC 2ZZNA 4L74A 4O4IB 2QLNA 1W73A 2FDCA 5EOVA 3VNBA 2Q4RA 3NHJA 4BFWA 4E5NA 3ADBA 2AHOA 3UGQA 4DIKA 4UNRA 2XAUA 1ZOOA 4X1OA 3WNCA 1KNXA 3OX1A 4HNVA 3N3AC 3WWZA 4EJ2A 4E70A 4EHBA 2VPQA 1NBIA 2C20A 3NHAA 4AZSA 4IQ0A 4ESOA 1Z35A 1T8RA 2A84A 3FWZA 2CDCA 1Z74A 4UXHA 2C1EA 3NALA 3ZLJA 5T3YA 5DWVA 1IIBA 1EFPA 3G5LA 4MYSA 2V4ZA 1W46A 3DTYA 3VYTB 5H3HA 1B2LA 4C4TA 1TUBB 1W9HA 2XHEA 3P2EA 1OLXB 2HO5A 3BGVA 1FXSA 1LI4A 2X9LA 4FQ8A 4DW8A 4J76A 2WTUA 2P5YA 3G2HA 4FD2A 1E98A 1GADO 1SPXA 3B52X 3MTDA 3WK6A 1I1NA 3X1KA 5JAPA 1QVWA 2EZ8A 1IHPA 2UYCA 2G9UA 1C3OB 4MQEB 3KB8A 3NHMA 4XX0A 5B4UA 5BMVA 4TN1A 2XE4A 1BA2A 1FMJA 4KYTA 4R68A 2ZBEA 1AGRA 2VPPA 4JWKA 1G63A 2GPAA 3ZGOA 1ZJZA 3VPAA 1U0JA 3H17A 4R54A 3R6WA 3PDUA 1K66A 3KB2A 1LEHA 4WOKA 3KVNA 3F7TA 4MXDA 3VOSA 2BH2A 1SUAA 2BVNA 3CFYA 1RTKA 2JG3A 3UC9A 1NKSA 4H7DA 2WT9A 2CD7A 4R1QA 1PNRA 4JJAA 1YIDA 1NN5A 2B3DA 5T6BA 4G65A 5EJGA 4O4JF 4XVQA 2D1YA 3ECAA 3GHYA 4KHZA 4LJSA 1PG2A 4EECA 3IOBA 1U8YA 3ETNA 4BO0A 4YP0A 3CCBA 1XUOA 4TRNA 4XYBA 3ROZA 1E58A 4DDVA 1GPLA 1KYVA 5AKZA 3WLNA 3QUAA 3ZJYA 1RRCA 2VEOA 1UQUA 3DWGA 3FZGA 2C4VA 3UANA 3LUFA 5G0UA 4LJKA 5EP1A 2GN8A 2IPNA 3LHIA 5TPZD 3DZJA 3KSUA 2A9VA 4GZMA 1BEUB 3ZWWA 4H3SA 4KQ6A 5A62A 2PX0A 2CXOA 2ECFA 3HYTA 1G20A 2AMFA 3AGPA 4JJ4A 4F93B 3R0QA 4WDRA 3CPHA 2HU7A 5ITSA 2XCIA 1E2IA 2VSOA 1GKYA 4N0EA 3V46A 3EPHA 4BFUA 4MP3A 4BJ3A 4NBSA 1NPTO 2HCJB 3D6NB 3GGOA 4AG5A 5IN4A 4H9GA 1A9TA 3NNSA 5AHRA 3VC2A 5EZYA 3GN2A 1P7ZA 1DT5A 1FIUA 4YIKA 1C9NA 2EFDB 1UK6A 4B5LA 2VRNA 4EZEA 3AI2A 3DG9A 5FTNA 1UKEA 2UZ3A 1CNFA 4GICA 2JZNA 2FSSA 3FUCA 1XXHE 1JR2A 3GPCA 2ONYA 4BECA 4B75A 1GNVA 4TKUB 1HORA 3EF3A 4XEUA 3ILVA 5FA6A 3GRFA 3C3DA 2O8EA 4K8OA 3PFHA 1YFLA 1JI3A 1IN7A 1Y3BE 1W19A 1LLUA 2IEIA 1LGYA 3K9FC 5LPNA 4OKIA 4FGSA 3OLQA 1U7PA 2X0NA 1IY1A 1J4AA 3B5EA 3E22A 3JYQA 1GPUA 1HKHA 1RBYA 1S4MA 2G08A 3QENA 4HN2A 3ZGLA 2XWBF 4AZ3A 1H2WA 4B9AA 1E5TA 2OO5A 2PH1A 1HE4A 3SYMA 2VT3A 3KUXA 1C0LA 3DDNA 1V3TA 1J0BA 3L0OA 4G0XA 4P86A 1I4LD 4GU5A 4F2PA 1QP7A 1N78A 3PPWA 4C21A 3RREA 4YJ3B 1Y5NA 4NJEB 1MZPA 1GQ2A 1XB2A 5DRTA 2PO5A 2QD5A 1Z5GA 1J8MF 4TTAA 2VPYA 1FNDA 2Y1LA 3DVQX 4XDYA 5L3ZA 2IP1A 3W4IA 4PZDA 4XIIA 1LSOA 1G3MA 3NI2A 3OAAA 5EXSA 4QAJA 2IOFA 1OY1A 3RIEA 4GH5A 1WUHS 4HMQA 3DKIA 2PNJA 3T3GA 3NCTA 3ZGNA 3DAHA 3UICA 5AM2A 5K0LA 2XQJA 3LQ2A 3N9IA 2NP6A 3JX9A 4R0NA 1W7AA 2PX2A 4AXBA 2OQRA 3OWXA 1PFQA 2ENUA 4L57A 3LU1A 2HJWA 1G18A 2ZIEA 3CLTD 1V9CA 4UD6A 4GPD1 4EF4A 4B3MB 4X64B 3DDCA 4FZVA 4UZSA 1ZD4A 1ZOLA 3PV0A 2DFVA 2C3UA 4YDQA 1XMQB 3Q98A 2QVLA 2YC2C 4G2TA 4TZKA 4TVOA 1GP2A 2XQFA 3TTTA 2GAJA 3W8EA 1TLLA 2I55A 3QYAA 4OIMA 2UUAB 4B47A 2FG6C 2P75A 5SZKB 3T4EA 4AJNA 4IWXA 5IJWA 2CVPA 1XTIA 1L6RA 1U3VA 2I33A 1VCNA 5HZMA 4LNAA 5K3FB 2I8AA 1B8OA 2H00A 5FBRB 4MV4A 2WV7A 3P71T 1ZMRA 1ODKA 3KVYA 4P7JA 4DNQA 5DI3A 5BOSA 2IYEA 2BFFB 1FU8A 2WD7A 5CUQA 4G01B 5JT1A 3TTWA 3HL4A 1O6GA 2VT6A 1BCSB 5EL0A 2W2NA 2YMMA 2FXVA 3N86A 4Q4HA 1P9RA 3LVRE 5DLYA 3SJBA 4GP7A 4ETWA 2DOKA 1DC6A 4K9SA 4NATA 4UBOA 2OXIA 3DLHA 5IT4A 3G0HA 3D6FA 1SGWA 4BN0A 1RAAA 3IKLA 2HA2A 4MRNA 4NF2A 5EYPA 1W94A 4B43A 5FADA 1TVMA 3GRUA 4RJJA 1WB5A 5C8YA 2I4IA 4HLUA 4YI5A 1X42A 2P2YA 3T7AA 4Q4JB 2A88A 3K6JA 3ZZUA 2BKEA 4RZXA 4HGYA 1CS0A 1NW3A 1K6EA 3AESA 2Q3HA 3NGMA 3RJMA 3WL7A 4HRYA 1T10A 2FFRA 3Q5GA 3MWFA 5CYGA 3HDGA 2QTNA 3MJHA 5A3QA 2HHAA 4R1SA 1VDZA 3UPTA 1JGTA 4RJLA 3DT8A 3KP1A 3FOFC 3L49A 4TZ0A 3DF9A 3MJSA 1ZIDA 2AMVA 3L7LA 4LOKA 2Y77A 4QARA 2VATA 3KHUA 4DN6A 1QNLA 1MF7A 1TK3A 2RBKA 1FE8A 5FUWA 1Z17A 2W8BA 2RGAA 2ONCA 1ZA2A 4Q82A 2IHKA 3U4HA 3DP9A 1DZIA 5JNLA 5K03A 5AM4A 2QE7A 4YMWA 4YPVA 1RVDA 3TGPA 1Y0BA 4BNXA 3LY9A 3IR6A 2N75A 3LYUA 3D6TB 3VZCA 2P30A 3BB1A 3U39A 4IJVA 1KOJA 1OYOA 1ESNA 3E7XA 5EP3A 3UYLA 3GCDA 1MAWA 1QF7A 3ID6C 5KYYA 1SUDA 1XWIA 3MQ2A 2V1XA 3BILA 4MUGA 2WM8A 5IF9A 2Q9UA 4J9VA 4HV4A 2JFFA 2O2EA 2VF7A 1QGAA 3DV2A 3PFIA 4WOPA 4IIJF 3VDNB 4GZ3A 4HAOA 4L0CA 4NYJR 3QJGA 1H2HA 4R9VA 4CQNA 4QJ3A 4X8LA 3HABA 3KT8A 2FF7A 4BLQA 4B9EA 1JHXA 2JLSA 3DHYA 1YZGA 1ODJA 5IAEA 4AQ7A 2C2HA 3HBAA 1E2PA 3NB0A 3RCBA 2IBMA 3RK1A 3TIFA 2HMYB 1SXGA 2RGCA 5CITA 2NTNA 4F11A 4HDAA 3OLZA 1UK8A 2O5RA 5CLIA 4LMRA 1NOKA 2ZTUA 1G5TA 3KXDA 1CZLA 3AIOA 3C45A 3AO0B 1FK8A 3ULKA 5JD5A 3F0TA 3IQFA 4AZTA 4O0LA 3UATA 3PWKA 4Q16A 3V1TC 3VPBA 2D06A 1RYZA 2A9KA 2ZANA 5EE5B 3T12A 1WKCA 3I8OA 3HY4A 3LA8A 5BSFA 2X86A 1AC5A 4EW2A 4YLYA 2ST1A 2WHRA 2WVGA 4L4YA 13PKA 4FS8A 3T5DA 2DHRA 3RVJA 1GUYA 1R88A 2OV6A 4MS4B 1JFRA 2A5LA 3FYUA 1YQDA 2E82A 2JDID 2ZYGA 4LPSA 5DXJA 3O2SB 5INTA 1M83A 4I4TB 4CDRA 2IX3A 3JAKB 1UAYA 2BDUA 2IIVA 4GPTA 4RIGA 2VTEA 2B8NA 1NIPA 4E15A 1DADA 2G88A 3K8ZA 4ZCLA 3R9XA 1QLJA 2Y1DA 2UUCB 3EZYA 1YR7A 1AU9A 3DNFA 5ECDA 4H35A 3CT4A 1Q0PA 3KFXA 4ZI3A 5IBPA 2CLHB 4XASA 3GLSA 1LRLA 4R4JA 1E5DA 3D8NA 3UOGA 5JXIA 1OVMA 1VIAA 2JLRA 3IESA 3IT0A 4FMBB 4NZOA 3SWWA 2X9GA 1UKBA 2D0IA 4GXNA 5E6UA 3T3OA 4F2WA 1EJ2A 1CF4A 2GFHA 2FFAA 4YHHB 2VHQA 1P5JA 1KDPA 1PJ2A 2CYAA 2VP3A 4JLAA 3NV7A 5E3JA 2CHVA 4B0PA 4DJJA 3ZDRA 3P9NA 3E2IA 4KDEA 2IFTA 4XGQA 5A7HA 2X0KA 4L3VA 1Y6ZA 5ICSA 4JY7A 3ZCQA 1I7NA 3ZHUA 1N5RA 5JARA 2JHCA 3EVFA 3RAPR 4DCJA 1FXWF 1UZNA 2P62A 2ISSD 1M74A 5ED0A 3WAGA 1SBHA 1MO5A 3AFHA 3ESXA 3IQXA 5EY5B 1EJ6A 2OV4A 4C88A 3L1KA 4FHGA 2VDRB 4NNOA 1WCV1 3I9V1 5JYBA 3AVWA 5ENZA 1SOVA 3ZHBA 1I4OA 4BUJA 2PUAA 1T2CA 2XNDA 1R10A 4BV9A 4FYPA 4Q0MA 3GIWA 4WJZA 4ER5A 3SVZA 4J1SA 3FOWA 5CPFA 3VPGA 1AE1A 1UCFA 3GJXC 1AXEA 1N9KA 1YH3A 4GAEA 4KUHA 5LB4A 4G37A 1E7MA 2X5OA 2Q0QA 3TWOA 4CF4A 3KYBA 3RBXA 5BR4A 1XDBA 1YB6A 3HA5A 4L8LA 2X8JB 3KWMA 3LC7O 4ZT6A 4A0HA 5AKKA 5EHGA 5L95A 4Q1EA 2I5PO 5GVSA 4QUIA 4BZQA 1T0HB 4ZYXA 4WESB 3T1VA 4AX8A 3G0IA 4M9QA 4XQCA 2RJOA 4HI0E 1OHHA 1ZZEA 4C29A 4H0CA 3EWSA 5ETJA 4B35A 1A4IA 4ROSA 3WB2A 1NSTA 1UP6A 1OI7A 1ZPDA 2I4MA 2K7ZA 2P69A 3D3WB 1ADGA 2B4TO 3ZHCA 1ONBA 4ANFA 5H70A 2OEPA 4RX1A 1C9JA 1KSJA 2FX2A 2ZB8A 4D8UA 5JG7A 2AWOA 2JW5A 2NQ2C 4OHWA 4ZOCA 1DJNA 1E6WA 4LNHA 1WA5A 4PAGA 3PXGA 4X6YA 3RJZA 3VSBA 5CG1A 5ITZB 4TT8A 3PTAA 3IAM1 1PEKE 1HA3A 1WNFA 4LDAA 3CUEF 4O02B 3UTCA 5FP0A 3DO8A 1L3BA 3F5FA 4L73A 4M7PA 2ZYSA 4MIOA 4XFKA 4BL5A 1HYBA 2NQTA 1JN0A 2H1CA 3EXHC 3II6X 3IUSA 1BO6A 1U5AA 2ZE8A 1KSFX 2YXDA 3ADOA 1RLOA 2P27A 1ZK0A 1V9SA 4RIEA 4M83A 1OT5A 1CC1S 1ODIA 4OSEA 2FV8A 5DYGA 1NUTA 3KSAC 1EAYA 2GJAA 1BQ3A 2CYCA 2W2TA 3L7NA 3R5TA 4IJUA 4PGGA 4G5GA 3KQMA 4QD3A 1Z7WA 3OFSA 4PRLA 5AK6A 4EHIA 3QEOA 4TMZA 3SQOA 2XBLA 5DX0A 5LIRA 5B7QA 3ROKA 5FNVA 2FEKA 1I1HA 3OZEA 4YAWA 2QJWA 1GG9A 1L4NA 2NYRA 3PNSA 4OM8A 1SC1A 3KT0A 5I7WA 1RWMA 3HMKA 3S1AB 3V1LA 1YQUA 1EP3B 1KAGA 2O3UA 4Q9LA 2X1VA 4B32A 4CF3A 5L45A 1A76A 4F4UA 1HNXB 4GQIA 3TTUA 4ARUA 4FFVA 4M8SA 5B30A 3FGNA 1M1ZA 1Q11A 2JVIA 4HUQA 4F12A 2GZDA 2VKQA 3E5MA 4FHEA 3VXKA 1N8SA 2C7OA 5HILA 4CMKA 1CEXA 1Z8FA 1EFCA 4H6XA 4B8WA 4EH1A 4ER3A 5KYUB 4W99A 2G80A 1E7SA 3NDPA 5L3RA 3WGKA 2Z56A 1G2OA 1A3CA 3MQ4A 3R5SA 1M1XB 1SU4A 2Y93A 2OCAA 1V2HE 3DE7X 3KLNA 1A5SB 2IEGA 2JLYA 1C30A 4KN5A 4MUFA 4Y6SA 4AO7A 3M2TA 2QBYB 1X80A 3K5HA 3HM2A 1UH5A 3QHAA 4PO3X 4NU5A 4RA9A 1TTHA 1YSCA 1N4AA 1NUHA 3UHFA 5FTLA 2V6IA 4ZVSA 3EWIA 3LH5A 3T7TA 5JC8A 1RHJA 2NIPA 1EWVA 1N2CB 1QGOA 1RHMA 2H07A 2ZJ5A 1PJ8A 1X8KA 3MQFA 4LWOA 5FR2A 1OU4A 1UMCB 3SYRA 1W1IA 3GDWA 4I5IA 4S0ZA 221PA 5EXDA 3ZXUB 3O0DA 5DGHA 1ECBA 4EJMA 4B6JA 4GZ6A 4IKPA 1YRWA 4BO6A 3B9PA 4DSUA 1AZSC 1TFUA 2RBGA 4BMXA 5DWQA 3UJ3X 5LOVB 3HZZA 2SHKA 3IP5A 4YRCA 3KQPA 4JA2A 4ZQFA 2JCVA 2E4YA 4JP3A 3UJPA 3V4SA 1LDNA 1OAOC 2C7BA 4BTEA 1P18A 4YAIA 5BSMA 4JBYA 3TFQA 2VHYA 2G9NA 4IX1A 1N2GA 3PI7A 2NAFA 3L92A 5KTRA 4KUGA 3DQZA 1N3BA 4N3BA 4BRZA 1YBHA 2FSVA 4COOA 5ES3A 3UWOA 2QIOA 1ND6A 1CJSA 1L1RA 3GU3A 4K8RB 4RK4A 4WI1A 1VECA 3ZQUA 1YDFA 1XZIA 4PLPA 4ZVLA 2WUVA 1RWQA 3ZHZA 4IAOA 3QJYA 2PO7A 1EDZA 4DR7B 3NLLA 1GIAA 1MG5A 4PAQA 3ER6A 3RSZA 2PYIA 3IQGX 3ORQA 4MINA 5AHOA 3SHQA 1ZM2A 3BA6A 1KYWA 1NN1A 4YP7A 1QYVA 1CXZA 3AR2A 4PX3A 5KOYA 5JADA 8ATCA 1OKKD 4WN9A 5TEVA 2KMLA 3TZCA 2BZ1A 2WKQA 2XTNA 1F60A 2H16A 1OXTA 2YVKA 3CUYA 4Y6QA 4NONA 5K3CA 1HGXA 1LFAA 1MC1A 1NBMD 4HNQA 5JH7A 2C0CA 3QVOA 4HH4A 1DXHA 3CZ5A 2I3GA 1D3AA 1I2AA 3EN0A 2Q2QA 3KDAA 1QU3A 3ZI4A 4DIBA 3I5MA 2XUOA 3CLTC 3PXBA 4YEDA 3FCSB 5EXTA 4CMEA 1XLTA 2F9FA 4ZRDA 3SPXA 5AJWA 5LQUA 1HX7A 1ZYUA 1FW6A 5F64A 3DA8A 2K5UA 1BXGA 3F96A 2JKZA 4S2EA 3V4ZA 1GZ6A 4KFSA 4JZYA 1DG9A 3LL4A 4BRSA 1CYDA 2OXEA 2XVAA 1EK6A 5FHRA 1R0BA 3WSWA 1G0NA 1KGSA 3DMGA 4GX1A 4MUMA 4D57A 4KPYA 5HFNA 3C7DB 3CZCA 1JL3A 2J5XA 4FC7A 2NSHA 4LGCA 4ZT2A 2YWJA 2BP7A 5BSRA 1W2HA 1XJ0A 3K5IA 4L15A 4P7BA 2GZAA 3EQZA 4CKZA 4BYMA 1FLVA 3D7MA 1U02A 2PBFA 2G82A 3EG9B 1A0OA 1Y48E 2VBIA 1XZLA 1H4VB 2REOA 4M1QA 4TTTS 3R41A 4PYJA 2WU4A 3Q88A 2ZCUA 3W9YA 5EQFA 1OASA 1V41E 2QUHA 2DHQA 4H6WA 3ZWMA 3B7WA 1OF1A 3EC2A 1H22A 4LYAA 4REQB 5HF5A 3PDWA 1TOAA 5D00A 5BWCA 4KB5A 2HSGA 1UJCA 3UCXA 1W75A 5B1DA 4IHJA 1TTTA 4UBNA 3EVTA 3KAKA 4RV9A 2IPOA 2WQ6A 3RSQA 3TMYA 3I73A 4BQQA 1G64A 2XZLA 4W1QA 5I6DA 4N7MA 4Y7CA 1XZFA 3X2FA 1T36B 3OICA 5HF6A 3IIIA 3OM8A 1DRUA 1KIMA 4HH3C 4M0FA 4Q21A 2CFOA 1TM7E 2HMTA 3PG5A 1F14A 5DSTA 3COSA 3L7OA 1LDBA 3OCYA 2ZBDA 4FUTA 4HZIA 4DF3A 5JVDF 4JI2B 2PL9A 3BFXA 3N7TA 4PLGA 4QU5A 4E2ZA 2C07A 1F9EA 2HSEA 1DJMA 4EITA 3TX2A 2BF4A 5DK6A 5CFNA 3FGPA 1LV8A 2VH1A 4IMJB 2PNFA 1SB9A 2VBCA 3DT6A 1AQNA 3TEMA 2JBAA 2IH5A 3LZDA 4XRRA 2F9LA 1FQWA 2JVKA 3ILXA 5CT6A 5NULA 2NPOA 1JXOA 1VC2A 2VJOA 4IOKA 3V2HA 3VU1A 4F4CA 1DC7A 2WMYA 1VBFA 1STOA 2HAEA 1DT3A 3D2LA 1EUZA 1VG0B 4NENB 2X2FA 4O08A 4PWZA 3IB3A 4S2UA 4UM7A 3ZBUA 1JDTA 1XTPA 3TDNA 3H3XA 4EVRA 2HIGA 2HQBA 2HHCA 3TEFA 1UOOA 2UVQA 3CMMA 3TIXB 4OXKA 2LZ0A 3BZBA 3FR7A 3NDBB 1YI0A 4PE5B 2WIFA 2VWQA 2VXCA 4QPJC 1GUAA 3PEWA 2ZXEA 4A2CA 4DB4A 4DR2B 1SRRA 1GEEA 1G3IA 2I22A 2ZK7A 2ZWMA 3JQ9C 2IYSA 1W5FA 4KAFA 1CU1A 4MLZA 4XKJA 4C89A 2H57A 5ANRB 1YMQA 3PGVA 4O8ZA 4QBIA 2BMDA 2D7CA 4NZNA 5AVYA 1IWOA 5FBHA 2CUNA 5J2UB 3RRBA 3TL6A 2H5JA 5HR5A 5FOUA 5E38A 1RI2A 2IUSA 5EPEA 1JLHA 2JIDA 3RGGA 3NAQA 3AF5A 4WT7A 4DIMA 2OCIA 4AMUA 1NURA 3O8OB 3G6WA 5ER9A 1PIWA 4BMVA 5AK3A 1P1BA 3BB3A 3W5JA 1CUWA 1DJLA 1KH3A 4FTWA 3IL2A 1JSCA 5HKOA 3WRYA 4L9RA 1E89A 1RLIA 5IYZA 2P9TA 2A0WA 1Q2UA 3CR8A 3PEFA 4LGYA 3EX7C 4HTAA 3ZBTA 1XO1A 1L9KA 1QORA 4C6RA 4P38A 3EQ9A 1YVEI 3OE7A 3TUJC 3D5QA 1N0UA 3BMNB 1Q7BA 5DTMA 1R15A 5TJ9A 3SG0A 4C7JA 1JSRA 3WO1A 5GY7A 4DTCA 2PUGA 2QNBA 2BFCB 4IJMA 4EA9A 2JPDA 1QFJA 2CVHA 4DM3A 4YV1A 3ODPA 4B8ZA 2MYPA 4RTMA 3D7RA 4I3HA 4B84A 2O8BB 2BKAA 5A2QA 2YN2A 5ILGA 2XYQA 2ZRPA 2FN8A 2SICE 3QVKA 5IVPA 3IMFA 1K8RA 5IJAA 4HLNA 5HJ2A 4M54A 3FDZB 3F4LA 2C83A 3K0FB 821PA 2QMQA 3BORA 3CLHA 2BFNA 3W77A 1DJOA 4BNLA 3EXAA 1BVYF 4LYFA 1N32B 1F0KA 5CT4A 2VH2A 2V58A 3EVDA 4HVLA 3IRUA 3QTBA 5HA5A 4I9UA 3JPWA 3B7GA 4WQMA 5FFFA 5F3WB 4UTOA 1C7ZA 1J1ZA 3WLRA 2PKWA 1P81A 2Y6VA 3CEMA 5C3UA 5LMCA 5JYDA 5BR8B 3C3PA 3Q40A 1WSBA 4JX8A