2OWDA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLMRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
molecule tags Hydrolase
source organism Thermus thermophilus
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2owdA00
1EBBA 2A6PA 1DKOA 2YN0A 3K4PA 1QFXA 1RPTA 3HJGA 1SKBA 2P6MA 1V7QA 1FZTA 4JOCA 2HIAA 2OWEA 2ENUA 1C7ZA 5PGMA 1XQ9A 4GPZA 2BIFA 1C80A 2YN2A 1CVIA 2A9JA 4ARSA 3K4QA 4EO9A 2EOAA 2P30A 1DKLA 3LG2A 2PA0A 2WNHA 2OWDA 3OI7A 1DKPA 2P6OA 4EMBA 1QHFA 3EZNA 2EKBA 4IJ6A 4TSRA 3E9EA 1YJXA 2P77A 3PGMA 1K6MA 2RFLA 3FDZA 2DWOA 3E9CA 4MA4A 3R7AA 2GFIA 4IJ5A 3IT0A 3IT3A 3F2IA 1UJBA 2H4ZA 5AJXA 5AJZA 5AJYA 3DB1A 5AJWA 1IHPA 4PZ9A 2HPAA 3EOZA 2P9FA 2DWPA 1E59A 2P9YA 3D8HA 4QIHA 1SKAA 4AROA 3D6AA 3GP3A 5CDHA 2P2YA 1BQ3A 5AJVB 5HTKA 5HR5A 3FDZB 4HBZA 2QNIA 3ZHCA 2ENWA 3QPWA 1T8PA 1DKMA 1RPAA 2WU0A 5CX4A 4JOBA 2H4XA 1TIPA 3MBKA 3NTLA 2HHJA 1BQ4A 3IT1A 1H2EA 1C81A 2WNIA 1NT4A 1H2FA 3D4IA 3GP5A 1FBTA 1UJCA 2H52A 4D4KA 1ND6A 2P75A 2IKQA 3BIFA 2P78A 1YFKA 3IT2A 2AXNA 3C7TA 3KKKA 1SK9A 1DKQA 1V37A 4FDTA 3GW8A 3MXOA 4JODA 1E58A 3QPUA 3LL4A 3O0TA 4ARUA 1DKNA 2P79A 3FJYA 4GPIB 4PZAA 2P2ZA 4D4JA 5CU7A 1SK8A 2P9ZA 1QWOA 2H0QA 4ODIA 4PGMA 4E3WA 3QPVA 4D4MA 4FDUA 3NFYA 2F90A 1BIFA 2I1VB 5AK0A 1RIIA 4D4LA 4ARVA 3DCYA 3F3KA 3LNTA 2EKZA 3E9DA 1ND5A
chains in the Genus database with same CATH superfamily
1SEPA 2C4TA 3QHQA 3EZYA 2ON6A 3AP2A 3UJBA 1VG8A 4BMSA 2PRIA 4R9UC 4UC0A 4L6AA 5LB4A 3AUSA 5GVRA 2I7CA 2P6RA 1YB7A 2WSBA 2AW5A 3SSMA 1VBKA 1HQYE 4B32A 5K8TA 3ACBA 1M1UA 2QVCA 5SYAA 1ZFNA 3UN1A 4OSEA 3ZHSA 4CQMA 3JALA 3TEJA 4BGVA 4D46A 1LLCA 2Q5LA 3IAUA 3PUIA 4QSHA 3EPKA 4TM7A 4X7BA 3QWIA 2QRHA 5B2ZA 1NKTA 1KYIA 1KY3A 2O7SA 3A8TA 3HFRA 3JQAA 3OLCX 3WLOA 2BFCB 2BE9A 3TTSA 1J5EB 4JLBA 4LE0A 3KXDA 3OZWA 3QY9A 4H35A 3GAZA 1NBME 5FL7D 1JBKA 4FNGA 4LRSB 4N8EA 4D8WA 1ODIA 5EHGA 1WUJS 4KBGA 5A3VA 5FOQA 1YJXA 2BUBA 1ULBA 2FWJA 2P77A 4D8VA 4YHHB 4ESVA 1NI4B 3ZGXA 3FOAA 3GAMA 1EFRA 1QRDA 1CJBA 4X92A 3LW8A 1Z4KA 4UEOA 3NO4A 1E1DA 3SOZA 1P45A 1RYZA 4WHMA 1Z5OA 5EP3A 3DYVA 4E2YA 1FMFA 4EDHA 3QSGA 1J7JA 3FB4A 2VHTA 2RGNC 3W5JA 2BOVA 1RMQA 2CNOA 2GPJA 3W7BA 2A4KA 2HA2A 3HCCA 3C8ZA 4JV5B 3BMNB 3KCNA 1RWPA 3ZG6A 3A9TA 4DG5A 1T8SA 1G63A 5K45A 2OUKA 3FR8A 4DT1B 4FFPA 3ZY5A 5IZCA 2QKYA 1R6UA 2J3LA 2QE6A 2WFLB 3DL4A 3MQFA 3O8QA 4CTKA 1K5PA 1YK0A 2G4CA 3HJNA 3KJNA 1W1WA 4C2AA 1G3RA 3QPWA 4UZEA 3TRHA 1XWFA 1ZC3A 2PPVA 5SY6A 3SM3A 1W0JD 3F71A 2HHHB 3ETNA 3ND8A 4JY7A 5E3JA 4DXHA 3QFCA 5D5HA 2I4OA 3BXXA 1P0FA 4MZXA 3R5KA 2WIFA 3JRNA 5CGQB 5HKBA 3T38A 1TQDA 3HNPA 3LIIA 4H2DA 4K05A 1J1UA 3ND9A 2XDQA 4ZCLA 2YW9A 2C2XA 5K01A 1Q3HA 3B9RA 5INTA 3E4CA 2P8JA 3GVHA 4FFBA 4ZU6X 3T5PA 3K0FA 3NOXA 3C3MA 4L78A 4DR5B 2R2GA 3S2SA 3K70C 3M82A 5EVJA 4DB4A 2LDBA 2EJVA 1VJDA 3LIPA 3TIFA 3T9BA 1PFQA 1TFUA 1HBJA 4X85A 3WDMA 3DLAA 4GGOA 5DKFA 4AJIA 4PZAA 4GKKB 4ESHA 2YW2A 3WGIA 2L19A 3A14A 3P27A 5CK4A 3PR1A 4EI8A 5BV0A 4LGMA 1YJ8A 4W63A 1USUA 3FMFA 4JUCA 3OZRA 4L28A 2WAAA 5EA2A 5FIUA 2H9YA 1UBCA 3PUWA 3ESQA 1IVYA 1Z8FA 1I30A 4UVGA 2M6LA 5DP1A 3CUYA 4BVLA 4RM2A 4P8RA 2QTVB 1UEJA 4MI9A 4ZDIA 1GAJA 4R1LA 3QW4B 4XIGS 5J40A 2CV1A 1WPRA 3LZ6A 1KTIA 3VGJA 5TGZA 2VCYA 4GBGA 1I51A 1AOXA 2CN1A 4N9WA 4OYHA 4WK0B 3IAXA 3SF8B 2D0DA 4NNPA 3EQ8A 1RTKA 2VDKB 5HWSA 1CF9A 1CS0B 4MQLA 1N1MA 1N5MA 1CF2O 2PFSA 1TZJA 2VH1A 3KOZA 3V4OA 4F2GA 1TCBA 1F38A 3A32A 3FF4A 5KWVA 2FZVA 2AFIA 1M6NA 1ORTA 2H31A 3N76A 3PI7A 3LGXA 3HXTA 5CG1A 4LDZA 3K6SA 3ZNOA 3I39X 2LD4A 2C2GA 2DHEA 3DBRA 4FGKA 4IAOA 3DKKA 4R2LA 1MV8A 4YI3A 1CVRA 4Z0TA 2ZT6A 3G2OA 5JYDA 1EFHA 4H17A 3I72A 3GUCA 3UBTA 3GFTA 1C3VA 3TECE 4YJ3B 2YVQA 4PG7A 5HFNA 3ANTA 1IXSB 3UGQA 4BMOB 5CT8A 4MI1A 1E4OA 2DQSA 2GPBA 3CRRA 3I3SR 1YIOA 5C8YF 5HZMA 3TLAA 4EG8A 2OY0A 3D6UA 3ESXA 3A0UA 3R3JA 4HP8A 1MVNA 2NYUA 3DH0A 4WLFA 3UOGA 5SYMA 5JASA 2J09A 1V2HE 2FMIA 1MN6A 2CE7A 1IDOA 1UKCA 2HMAA 2KS6A 3DEIA 3NAZA 3OJLA 4G5SA 3E5MA 4OAOA 1CUDA 4M1ZA 3T5GA 1H4VB 3OU2A 4GGMX 5IC6A 1YDMA 4FOOA 4DIMA 2UUCB 4LXUA 4EG5A 2YXNA 3ZDRA 4TMWA 1HMPA 1NTRA 3C3KA 2EHDA 3NKFA 3NIFB 3DKPA 1NBAA 1O95D 2Q3BA 1JFFB 3FIJA 3DDNA 2IYUA 3VKUA 2NPFA 4CV1A 3OEHD 3NX4A 4G0VA 2IZZA 3R7WA 3HJRA 3R4VA 3TB4A 5DGXA 1A8HA 1EFUA 1G3UA 1HC7A 3KFXA 2AFHA 3VH1A 4OBBA 5CITA 4X66B 2WJ6A 4C4YA 4DLPA 5FBVB 1MRSA 3ANXA 2A0WA 6CHYA 3CVWA 3C5WP 3C6QA 4ISCA 2WNIA 5EWJB 1WY5A 2HDHA 1UM9A 3UOAB 3OQPA 3JQ8B 1QHYA 1TC1A 2GN9A 2CK3A 2YWDA 4NDZA 4GMXA 3G5UA 1XNGA 3D7KA 1QGOA 1QUFA 3AP1A 4GT1A 5AP9A 4BQEA 2X0FA 3KKKA 1MHPA 3P9PA 2IHBA 5EJ4A 1C0EA 3OEHA 3ZXSA 3DL7A 1ESZA 1O0CA 4U4AA 4NVRA 4JLSA 4UCFA 4GWKA 4YAFA 4D3YA 5J3JA 1X7GA 5LP1A 4OQYA 1GV0A 3F7TA 4NBKA 2ZI6A 4RTSA 1J99A 4X0EA 1F0NA 1ULUA 4CU2A 2GA8A 2VT3A 1ILEA 1P62B 3GWGA 2WF9A 2OBMA 3FCAA 2FNAA 4EEXA 3H8WA 3VNSA 2HJSA 4X20A 2AR9A 3EVAA 1ZMXA 4LK3A 3SS9X 4GNKA 1PYDA 3AEZA 1R5OA 3LZCA 4M9QA 2EKZA 4RETA 1J5XA 3COZA 3ZCPA 3TAHA 3AB3A 3QYJA 3STTA 2DPXA 4GR5A 2AFIB 5BMOA 3F8TA 5A9TA 1O94C 4DOMA 4B9AA 3KO8A 1GQ2A 5EE9A 4IXNA 3FSGD 1LS6A 5E9AA 4FE7A 2I54A 4UE3S 2E4YA 4X6UA 4Q3EA 2OM2A 2VJKA 3OZBA 3IIJA 2FTKE 2O1EA 2XAUA 4PYRA 4WY8A 3ZGNA 5FNVA 1KEEB 3GPCA 3W8DA 1X15A 2ZJ4A 3Q9SA 3B5IA 4C4RA 2C3OA 2SKDA 2YOFA 1NFRA 3IBYA 3UUGA 5GONA 3K9BA 4UHCA 3M70A 3VR5H 1H85A 2QTMA 1A4IA 4M60A 2FPGB 5BMVA 1KDZA 3GWZA 1VGVA 4ENUA 3LY8A 4ZDKA 4LZWA 2J9ZB 4XUDA 5JLJA 2ZIXB 3ZIUA 2X9GA 3W8FA 5CA1B 1CY1A 1E3MA 3PFNA 3WLIA 3UHJA 1LNZA 2KW5A 1QH9A 1ZU4A 4JQCA 3G68A 4LOKA 4P6VF 1G5IA 1A9OA 1JLHA 2P0EA 2REOA 3BJIC 3DBLB 2Z6QA 3AHHA 5KVQA 1GAQA 5HKAA 4WDRA 5CTJA 1FLDA 1OOEA 3MGBA 1LWOA 1ESEA 1ONOA 4ND8A 3AYXB 4R0VA 3FGPA 5DTMA 1QBGA 1B8VA 2W6OA 4EJSA 1HE4A 3G7SA 4EHAA 4CM8B 2C1XA 1JXQA 2OXRA 2CJWB 1PR0A 2YZ7A 3CQ9A 3GD5A 1T9AA 5EP4A 1F5SA 1Z13A 3EGXB 1YOBA 5ALSA 5IH3A 2AFHB 4YXWD 4PN3A 5ALNA 5JZOA 1M2VA 4TV9B 3IMFA 4TGLA 3LUJA 3IQWA 3IXMA 2YRFA 2AEEA 4M0PA 2P68A 3KBOA 4QVKA 2CJYA 3NGXA 4M9CA 4D79A 5LWHA 1N4DA 1MIOB 4ZCMA 4P93A 4KSYA 1PUXA 1UKYA 3KT0A 1GRQA 1Z75A 1RXSA 3G5MA 5B12A 4G5XA 3IVMA 3ER8A 1BFUA 2YDYA 1SULA 3H8JA 4ZV4A 3FKSA 5JC1A 2FMKA 5EWLA 2HSJA 1SXJD 1IMOA 4M6WA 1R0ZA 2YBEA 2QR3A 4UM9D 1GLNA 5CVDA 4DDTA 2Q3CA 5TT0A 2PMCA 2AOUB 3WNQA 3IDOA 2ZG6A 4MVJI 4S2EA 4ZTBA 1N3IA 4DA9A 5BRJA 4KCGA 3FTCA 4FX2A 4XFDA 4YUAA 3OPNA 3A4YA 3PDIA 1PKEA 3ZE1B 4JZKA 4ZEOA 2RAPA 4XTCS 1NX6A 1XJWA 1A0OA 1R18A 2GR9A 4W9NA 3KVRA 5C8XA 2ZUEA 4MGZR 2PZKA 2R8BA 1E92A 4MUEA 3LUBA 2ZJ2A 1T25A 5IK2A 2H1SA 3G1UA 1T1RA 1E62A 2IZ0A 1ECFA 3TNLA 1IUNA 5G0SA 2W42A 3I76A 3LT1A 4M37A 1UP6A 4MS3A 2QRGA 2XE8A 4NKRA 1VG1A 2NU8B 4ACBA 2WQ6A 4ATNA 4W8GA 1B26A 1PIWA 1A04A 5KDDA 1O4VA 2CBXA 1OC4A 1I7DA 2C78A 1E0SA 2QLTA 1AQUA 2GRJA 4L57A 2P5UA 3IBGA 1JSRA 2RAVA 4R1UA 3IOBA 4JENA 3ISTA 4QQ8A 1WNTA 1JTEA 4FYKA 4JK3A 5HS4A 3SDZA 1PLKA 3K92A 3KDSE 4ZP1A 3OC6A 1WWKA 2V7QA 4B76A 2UZ0A 4WY5A 2XCTB 1L1EA 1HT2E 2VBIA 5DLEA 4YY3B 7MHTA 3MS4A 4DA4A 5B3AA 3HJUA 3QKSA 2B3DA 2TMGA 2CD9A 3RWOA 5CDFA 3OAAA 2WD7A 3ZNNA 5CA1A 5JVDF 3MBIA 2C20A 4B6QA 2CLMB 3BJZA 2JGKA 4FQ7A 4NBUA 1H1LA 4EQ6A 5BV7A 5E1OA 4D42A 4I1UA 2GEBA 1L7OA 1GU0A 1UOQA 2YV2A 1L7AA 2DOKA 1GGVA 3BD9A 3L5OA 1Y7IA 4MGKR 5TF0A 2OQVA 3M6IA 5K4HA 3ZV5A 3K1JA 3WISA 3DFUA 5CJ2A 4GICA 4PE5B 1ECLA 4PS1A 5AW0A 5CFRA 3P4YA 4MQFA 4KUGA 2IK8A 1REQB 3A05A 4GPBA 2V8BA 1T6XA 4N0QA 1EX1A 3HR7A 4U8HA 3TGWA 3HVIA 3UH0A 1TYCA 2WWIA 4JNKA 2EX1A 4PO1A 3T1HB 4ITRC 4EH1A 3RSGA 2XHEA 1OXSC 4LKOA 2KLBA 2ZYIA 4NFHA 4BL5A 1G0NA 4EB6B 4G2NA 2IH2A 4RJLA 3IAFA 3P5SA 4K03A 1K2WA 1T36A 1ZVQA 2AEMA 2QW8A 4OGWA 2P4SA 4FZVA 4RFLA 5G4KB 3GYGA 1PVOA 1USKA 3HZZA 4XJXA 3DP7A 5YASA 3HEAA 2ORWA 3RSSA 3TIGA 4AUKA 4CFZA 1SQFA 3NBYC 2O3RA 3DR3A 3ONEA 2RBKA 3O8DA 4XOUA 3EZ2A 2MYNA 4DEVA 3CVUA 3I53A 3D7LA 3U2QA 2ZRDA 1WQ1R 5DE3A 3DL0A 2QD2A 1PS8A 1KNQA 4JVMA 4DCOA 4D5GA 5EJ6A 3NT5A 1TZ2A 1XELA 4UBIA 1DUVG 1ADGA 1ZMBA 3PDIB 4HEA6 4RHEA 1NUTA 5M34A 5C53B 4I66A 5JISA 1W0KA 3R7BA 1JFTA 1S02A 5D3MA 1M1XB 4JLJA 5A7GA 4Q7JB 2IHVA 2REQB 3C24A 2ERXA 3MUNA 4AIRA 2WKRA 4MLZA 3RWMB 1T5SA 4XQGA 4AJJA 1EK2A 1JI0A 3G9QA 2X0KA 4AUNA 4U7PB 3R9XB 1IDN1 5H5JA 4MAMA 1OXVA 4JHXA 4D4KA 3IA7A 3PTLA 1SKUA 3JQ6A 3CB4A 2AI3A 2VK2A 5DEOA 3NAGA 3MWEA 4LIPD 4MV1A 4ZQHA 5DF1A 4D26A 2W6QA 4WESB 1VP9A 4KR7A 1MH9A 2EBFX 2AYZA 2BFBB 2O54A 2B8NA 3VJMA 2AG5A 1ICEA 2G0NA 4UATA 4BO5A 1X86B 5KVAA 3P9KA 1SELA 3H11B 2VZ9A 3HCAA 1YGPA 4R40A 2P69A 4RL6A 1C8KA 2AHRA 2ZM6B 4M1WA 4PZEA 1MAHA 1P4HA 1N5LA 3A9CA 1XYGA 3L92A 2OFPA 3QU9A 2HQBA 4FT2A 1LPNA 2HC9A 4QBKA 3TS1A 4OQFA 4PGMA 4PLZA 1FVOA 1TVCA 1W5EA 2WB4A 4GS5A 4Y67A 2XADA 4N54A 3G89A 1EWQA 5C1PA 3RJZA 2WD7B 2X77A 2CVFA 3HABA 4IRUB 1XZQA 3EIHA 4H27A 2CB9A 3SR0A 3HXOA 3LBFA 1PDWA 1TLLA 2I7VA 2MDTA 3QK7A 4KQMA 4EWLA 3BJEA 1ZUWA 4HDNB 3HYRA 3UICA 4EJ0A 5KNLA 3A27A 2O5RA 3D2CA 2ST1A 3S70A 4DNOA 1SOVA 9ABPA 3P0HA 1G8YA 5HFAA 4KPYA 1IQRA 2HIGA 3IIIA 3LUPA 1SXQA 2HIAA 1S3GA 3H4VA 1V25A 4JXKA 3HU2A 4MWZA 4AU1A 4R2MA 3IUPA 3ELWA 5FD8A 5IKOA 4DJEC 2RBGA 2BIFA 1UXOA 3Q11A 4CM6A 3VYRB 4DXDA 3BSSA 2FSGA 3UHFA 1TGVA 4BO2A 4C0WA 3U6BA 2AVNA 3G9UA 2GBPA 3H2BA 4QYMA 4TYPA 1JQDA 4M21A 3HDGA 1PT5A 3C6BA 3C6XA 4PSVA 1SXJA 1X0XA 2C61A 1IBRA 8GPBA 5DHSA 1KRHA 3AZQA 3IP5A 1BD3A 3FYUC 1ZRNA 1Y0BA 5CH5A 3KUKA 2EFHB 3AY6A 4DUPA 4EVSA 5CB6A 3IR6A 1NPYA 2XTNA 4WXEA 3ETHA 1X8KA 3CVVA 3BMQA 4ND5A 4BE9A 2IBSA 1BXKA 4B74A 3IMKA 2J0UA 4MP8A 1YE3A 1J20A 1GA6A 1JLMA 3A6FA 3OHSX 1IHOA 2GD6A 3BTSA 3GN1A 5DM60 621PA 2LZ0A 5GM2A 2JAXA 3MLBA 4JC5A 4CCYA 1CUXA 4AZ3A 3BK2A 3OX4A 4BWFB 1FQJA 3TD9A 4WFKA 2QN6A 3I1YA 3S4YA 2KI5A 1KVQA 2B30A 2VHVA 3HZRA 4NE9A 4OATA 4Q02A 4BGIA 2XWSA 4DBZA 3T5AA 5FPPA 1EUDB 5A9SA 2Q4OA 4IHJA 1ZJJA 5ES4B 3VNVA 1ZSVA 4HRVA 3Q0EA 3AUKA 4N40A 3OU7A 1EFVB 5C8DA 1PJQA 1A97A 2WE7A 1VE5A 2BEKA 5F1YA 2CEAA 4KB5A 3ZBTA 4BZWA 2EDCA 3D4PA 3SXUB 3OCJA 4LZZA 2XB4A 1CZRA 5IVDA 3TW6A 4H18A 2OVFA 1NI3A 1QPGA 5JSQA 2CVHA 1GNSA 2GD2A 2JJ8A 2QX9A 3X2FA 1H4SA 1AZTA 2HA0A 3D3WB 3GH3A 5A3QA 3U80A 4CT5A 1EX6A 3NT2A 4DV2B 3PX7A 2HB6A 3HKBA 3I32A 4K3UA 5EOVA 1S8FA 5HSGA 3WMEA 3PGKA 3ZLVA 5LJLA 3RS8A 2WLSA 4C89A 2CFSA 2XKAA 5CLFA 2HBQA 1UQUA 4LMAA 3WYEA 3EEOA 2WF8A 1S9DA 4J6EA 1U9ZA 5HJ2A 1ZNYA 4TT8A 5GOZA 2MR5A 1FRVA 1COWD 1M83A 2QVXX 4J94A 4P80A 4EYQA 3BB4A 2C57A 2Q1YA 2R86A 1SUEA 5F51A 1HQDA 2HMWA 1Z73A 1IZZA 3KB8A 1KERA 3O92A 4RF3A 2O8BA 2DF8A 3QHPA 5ELLA 5EXTA 1G55A 3DPIA 1I94B 2QGFA 4G1MB 4RV4A 2XGOA 4AQYB 1PR9A 5F73A 3KYJB 2O07A 5DX0A 1BIFA 4PTZA 4F4IA 1M34B 3H17A 4ARVA 1WS6A 1LJUA 2OV2A 1BX0A 2WJPA 3I05A 5A5VA 1M54A 2XWQA 1SGWA 5JJKA 1X14A 2H08A 4YWHA 4GM1A 4BX0A 3FCXA 3V46A 1J6UA 4Y2TA 1JDSA 1T24A 4LG1A 2Q3FA 2PX4A 3NVMB 1U3TA 1MU0A 1Y34E 4RXUA 2ECFA 5JMWA 2R65A 2GAJA 2OHXA 3UFXA 4CTJA 3MGKA 2FOLA 1O1YA 4UQLA 1SUWA 1Z74A 2QP9X 2QJRA 1JAXA 1U3DA 2VHJA 3HVKA 1DIRA 3L06A 3KPUA 3ONNA 4QBHA 1NXWA 2XZDA 1G6KA 3PZRA 1Q0PA 1YS2X 1ORHA 3OBBA 2V5UA 3L6RA 1LSSA 4JJZA 3EXIA 4Q66C 3RSOA 3E3OA 3I6MA 3ZXIA 1CPYA 5HOEA 2GXAA 3MTAA 3S1AB 1W6UA 2DULA 3MCAA 2ATVA 4HDKB 1FFXB 2PRYA 2VJLA 3OI7A 4O4HA 3ACCA 4D6XA 1PL0A 1LFAA 1C3XA 4N7MA 2BEVB 5K3DA 3R9KA 5C5IA 4LFAB 1K9SA 1XCOA 1CQJB 3GL9A 4LXHA 2AWOA 3V33A 3QTLA 2EQBA 3ZLBA 3EXHB 1HT3A 1XD8A 4E4YA 1GDDA 2WEKA 3SIXA 2VPZA 3Q3EA 3PQ3A 2XHZA 1M1YA 2YZNA 3RFCA 4UE6A 5HCNA 1NIJA 1K7YA 1B6TA 5SZKB 2YWHA 3O1JC 1ZQ1A 4UOEA 1UANA 4WN9B 2H00A 2GPYA 4RK7A 3QELB 5AJZA 2W6PA 4H0NA 5EE3A 4G1UC 5DISB 4OYLA 3HQ4O 3OIUA 3FZYA 3THXA 1CEXA 3HBLA 1PS9A 4UVIA 5SYNA 3OQ6A 4RK1A 1UZMA 3DVQX 4KE9A 3JD4A 1Q84A 3TI9A 1E0AA 4RX1A 2ZDQA 3WZ2A 1P60A 3PWKA 4K1LA 3NKLA 3R9WA 3CZQA 4NPAA 1WUIS 4O1MA 2Q3DA 2CB0A 2VXYA 1YZYA 3MWDB 1JG1A 3NPAA 1T6BY 4IJQA 3A3PA 2IDMA 3SHTA 4F9GA 1PW7A 2DHCA 4Y2SA 4E5MA 2J5RA 2JLUA 2FR1A 1NX9A 1NBOA 3NS7A 4JBIA 5DNDA 2D1RA 3VTKA 4DIDA 3ANNA 1E3EA 3QXCA 1I13A 3AC0A 2A8YA 3RABA 3E27A 3UYLA 1U2GC 3C4QA 4URVR 4FKZA 3FHOA 3KUXA 4HDRA 4OQDA 3EPJA 3K31A 4D44A 4CMIB 4GI3A 5JAQA 3P32A 5F5LA 5J2UF 3HKEB 1UMBB 4P7JA 4MR8A 1K4MA 4E6PA 4MMYB 2CWDA 1RQPA 4NV0A 1UKEA 4DM7A 2C2KA 3A0RB 1O7JA 4DQXA 2HA3A 4KWIA 3STXA 3BIOA 1LSJA 3C8UA 1RRPA 1M1NA 4R1PA 5FOSA 2AN5A 3QXGA 2H7VA 3OKAA 2FRVA 1VI5A 1JUDA 1KIMA 1V8PA 2HV9A 4GRDA 4MS4B 2QSJA 4AFNA 1U0TA 2PMBA 3UAWA 1YDEA 1TIBA 4HDOB 2WHXA 3ZZMA 1QAQA 1NG1A 2MINB 2PUWA 1M10A 2G09A 3EZFA 1FUYB 4DLVA 1RPZA 3RC8A 1TPYA 4BZQA 4ZYLA 2W8BB 3A11A 2IELA 4LFCB 1MQSA 2F90A 2PKCA 3K7EA 3UHPA 4IRMA 4JEUA 2B1RA 3QBEA 4PZYA 3RVJA 5CXXA 4CCAA 4E5DA 3PD7A 2IS6A 4A16A 1X92A 3HB9A 1Y6JA 5KQMA 1F2TA 3S2FA 1MXHA 3RIMA 1F6BA 1E1QA 4N6NA 2RHBA 1D03A 2KMLA 3B52X 3HCNA 3THRA 5I7AA 1OLOA 4GR9A 3AY7A 2XNDA 2E1RA 5KYGA 1KP3A 2ZKLA 3LCRA 1E2QA 1VSQA 1Z8DA 2W48A 2QEQA 3DLIA 1W5AA 1PGPA 3EQ9A 1CJUC 3IELA 5FI3A 2HMUA 3ABIA 3AEKB 3JCZA 2VF4X 3VSAA 3VJRA 2H8KA 1QZTA 4FR0A 4XJVA 4ND8B 2CVQA 2LRHA 1STOA 3ACDA 4LRQA 4TKLA 4A6DA 4AJ2A 4WW0A 1NVWQ 2Z5GA 1D0SA 1LK7A 3MJ4A 4BLOA 2O4UX 2GJ4A 3RC3A 2NP7A 2ZUWA 1P4RA 3RF7A 4AK9A 2ZWAA 3UJPA 4TSRA 4R2XA 3QVGB 5JSFA 4WKOA 2DKFA 4B40A 5A02A 2CV0A 3AIMA 3KOWA 4WZAB 2PBFA 2GO1A 1DAIA 3NZEA 3PQ4A 4XYEA 2E5LB 4REQA 5BN1A 4CMEC 3O9VA 4R3NA 4ILEA 2X6QA 1H2ZA 1BOFA 3TKAA 3EZ6A 1QGDA 4FN5A 1FP4B 4HI0E 4S1TA 1UH5A 1E1CA 4WX2B 4R9NA 3OHPA 4KVFA 3MPOA 4B3MB 4ECAA 2X58A 1OXKB 4QBGB 5CT6A 1ZUD1 4I1YA 1U1DA 1TD1A 2F9MA 2HK7A 4JJFA 4K5QA 4QO8A 1B23P 1VHQA 1PK8A 1RNLA 1WIWA 3CH5A 3PHCA 1MO5A 1YUBA 2D0IA 4OJQA 4W6ZA 4I55F 4Y0VA 3L8FA 1MQ9A 4BMNA 3B1ZA 4NF2A 3T7JA 4C2UA 1TQ4A 2BLNA 5ICSA 5L51A 2FU5C 1GCGA 2H57A 4WBNB 3OY7A 2F67A 5B7GA 2H4YA 3FFAA 2AMYA 1WMEA 4HH1A 4HYQA 1N9ZA 3ZU2A 1UEIA 3MT9A 2CLEB 3HZHA 1D6SA 1NUPA 4XCQA 3X1KA 4JD5A 4UXHA 3HADA 5ULLA 5KNBD 4B80A 2B5VA 2GJSA 4G4SP 3UGJA 1FDVA 2PRSA 4JCOA 4GL2A 1X1BA 3Q3VA 1AD2A 4WRRA 5THQA 1PFUA 2AF4C 2H06A 2P0YA 1ODTC 4MSUA 5JJLA 4GSYA 4FDVA 3WB2A 4HJXA 1E9FA 2PXAA 3QXXA 5DBOA 4B4OA 1K4YA 4E5SA 3NDBB 1GQOA 4K9LA 4B3RB 3U3OA 3KV3O 4CL8A 1D8TA 4D3DA 1DWQA 3ESDA 5JYBA 2AB0A 3OZXA 1A9ZA 3FWZA 2V54A 3T94A 4CRWB 2JFGA 1G8HA 2J48A 4IIDA 4Y2JA 4I5DA 4MW9A 2B83A 1IHYA 2H11A 4C5CA 2YYZA 3T7SA 1PGQA 4P4SB 3FLAA 3PNMA 3DWEX 1ODFA 2YJNA 3C7AA 4GKBA 1QRUA 4UCXA 1PFKA 1P74A 1RMYA 1PWEA 3G0IA 2ZULA 4GMGA 2VXOA 4M55A 4QAJA 1KZHA 4J0EA 4QDXA 4M46A 3O8RA 2VSXA 2GO7A 4BFSA 3ZHZA 4X61A 1M74A 2J6HA 3KHTA 2G82A 4OQXA 3SYRA 1YRLA 4NK4A 4HPJB 5C9ZA 1UXKA 3KT3A 4C0JA 5TX7A 2FYTA 2OAQ1 1QQ6A 1UP4A 3AEKA 4JLNA 3QENA 1H0SA 1PZXA 4X3PA 1KFJB 5JOQA 3OTOB 1SVOA 1PTKA 2Y1XA 1QF6A 2FN4A 2W6JD 2XUIA 4IVPA 4AKIA 3HCBA 3PP8A 1Y33E 4M38A 5FLYA 3B60A 1NURA 3ML1A 4G8DA 1VCMA 3A9WA 3C8HA 3EC2A 4O1IA 4ZRNA 4FFNA 1XHFA 4BMPB 2HLNA 4DVJA 2F48A 1S4QA 1FXWA 1V1RA 4HH0A 4MCAA 4QWWA 3HO8A 5I9NA 3GNTA 5T4BA 1JFVA 1YDGA 2D1SA 4Y7CA 3PICA 1KC3A 2CNKA 2CKMA 3DOJA 1YACA 1U63A 4MVJP 1UBGA 1V7PC 1O03A 2DGDA 1H3FA 4CM7A 4HSEA 2I4RA 3UMRA 2BFAA 2XUZA 3HDVA 3IODA 1HWYA 2OGUA 2PZAA 3GJRA 4LVOA 3GRZA 4DCNA 1TMGE 1NA5A 3L8CA 3A3KA 4QTTB 5FWXA 3DO6A 2GLUA 2LW7A 4IZ6A 1RJWA 3WGOA 2MSLA 1LBTA 4ZAWA 3TRKA 5KYWB 1VJGA 1Z2EA 2FXVA 3EXG2 2YXBA 3Q15C 5K2OA 3I01A 2FPOA 2H29A 3ZTTA 1Y8QB 2DBYA 4ZANA 2HREA 3EAQA 3HYNA 4RKRA 3EW9A 2HJ9A 3BL6A 5EHXA 4IDNA 1BG6A 2FK8A 2G06A 1GAEO 2YHAA 3BG5A 1VE6A 1YRAA 4RZHA 3ECSA 2RGGA 4DG9A 2REQA 4CZ2A 1VYHA 2WSSD 3OEYA 3F8SA 4ALMA 3DXFA 2P1RA 1R0KA 4CJXA 4P7FA 1PTJC 1E6LA 4N3NA 1PCXA 3GHHA 2C0CA 5FR1A 1P72A 4M76B 3M2TA 3TW8A 3ZX4A 1Z7WA 4B17A 4ND4A 2AXPA 2ESRA 2JD2A 2ZRLA 1NV8A 2VJBA 1ESNA 3OIDA 4IDGA 5IUKC 3GGSA 3ZCSA 2QNIA 4H60A 1DT3A 4E31A 3OURA 2O8DA 3ZVKA 3T1QA 1RKQA 3BH6A 3TJZA 4GDFA 4PPYA 1P0IA 2QG4A 2PX3A 3NRJA 2QSZA 2XTJA 5KSWB 2W8ZA 3K8YA 4J1TC 4Q3BA 2MSNA 2P9EA 4CV0A 2SICE 4P4SA 5G1OA 4HWKA 3V97A 3WQHA 2F8TA 3QXJA 2XXAA 1SG9A 2ZI7A 4NU5A 1RC8A 4N03A 1E69A 3EPRA 3IKJA 3HXPA 2H1IA 2AEFA 1FBTA 3ES9A 1P2TA 2QV7A 1PW5A 3D6MA 3MIIA 2O8EA 4YCSA 3CLUC 4WIAA 4F9FA 2A0FA 3W04A 1J2EA 1DJLA 1WB9A 1BVHA 1QVAA 1NXPA 2O1SA 1I7PA 1RRVA 1NRXA 3P94A 2JGDB 1N5RA 2V9PA 1DGQA 3GUUA 2NZ8A 4M36A 2J3IA 1WSWA 5E1DA 1OWMA 3RU3A 3O8BA 3ZCRA 1RQGA 2JAQA 7YASA 5AI9A 4C0SA 2GKGA 3NGLA 1CUZA 2ARKA 4YI5A 4C07A 4DIBA 2B5OA 5FO0A 3VR6A 4EKEA 3S28A 4CIBA 1D2HA 4HNAB 1PE0A 4FNMA 4QOEA 3EBPA 3F90A 4QYWA 3G2QA 3UTDA 4NQRA 2PUGA 3CH4B 4IX1A 2BM9A 5JVDA 2ZFUA 2D5IA 2OT3B 2B6HA 3P4UA 5DFAA 3ZE8A 4I81A 4J3JA 4LDQA 1WZEA 2IL1A 1X87A 2DR3A 2X0RA 3AUYA 3PC2A 3AW9A 4TWJA 1L5RA 4JYAB 4DNPA 3X1MA 2VEOA 1UBUS 1VPTA 1U6JA 3CLUD 2BSXA 4URFA 1KFCB 3OMXA 4GPEA 3K6SB 5ALKA 5JQGA 3LC0A 1FNMA 4RY0A 2VTBA 4NZ9A 2PVPA 2HDNB 2Q5CA 3UATA 4RMNA 1VHDA 2IC5A 3KSMA 4W1PA 1KPIA 3EMBA 4XIYA 5IKXA 3ZWAA 3DD5A 4IH1A 3BXFA 1EDEA 1XEAA 4JGIA 3VUFA 4BLUA 3TQIA 1YS4A 4JH0A 1ISMA 3SVTA 1NW3A 1Y80A 2P2NA 3JAKB 2QI9C 2VJOA 1Y4DE 3I0ZA 4IHQA 3ZNPA 3F2VA 5ALWA 5HF8A 4A26A 1O97D 4OI4A 2NU7A 3ENKA 4FS8A 4OHKA 5LXTF 5B3LA 2RE8A 2OWDA 5HXAA 1DAOA 1OBFO 5JFTA 4OI0A 5DK4A 3I2KA 1L4KA 3TXAA 3TLMA 3GT0A 1E2IA 3ILXA 3L8HA 4BU1A 1EK1A 3EQ7A 3RS0A 3RAGA 4RTQA 1M33A 3WL8A 5A9SB 1NLMA 3T9EA 4F5ZA 2PWBA 2XBMA 3KE9A 1YRBA 2JIBA 2NXJA 3EDRA 1OLSB 4EL0A 1U8XX 1DS6A 2R751 1OYYA 2YNMD 4J0KA 2VSOA 5SICE 4DZTA 4F7DA 1RKVA 4YP0A 1FNNA 2OXFA 5BVGA 2RIRA 1XZCA 2XX3A 3B2NA 4TV8A 3MGGA 3R7SA 4QOFA 1QG2A 4HQ6A 1SBHA 2TRSB 3T4PA 3H13A 3GELA 3GCXA 4CCWA 2FRDA 1WDTA 2O4CA 3MJVA 1PAUA 2WG2A 3T7TA 1D2NA 4WBNF 1PJBA 1TM3E 1N7GA 2CHEA 1Q14A 4JDPA 5KQSA 2QAGC 2HWUA 4EI7A 1UC4B 3FX2A 2IA5A 3CXUA 4LC1A 4Q3OA 1VBNA 4L72A 5DI3B 3HVHA 1DO8A 3VR3A 4CI9A 4KREA 1VL1A 3IQHX 2VF5X 4ZVNA 4RPGA 4EI2A 3BRWA 2W98A 4I2VA 3SDBA 2IBTA 1R7RA 2R48A 3Q3CA 3FUXA 2ZB8A 4UCQA 4DCSA 3GH1A 1A96A 3LTEA 1LVGA 2O2HA 3L7YA 2P1ZA 3KFLA 4HB2A 3UJAA 1M75A 1QNFA 1XRQA 1LK0A 2BE7A 3BFJA 3O6VA 4O4IA 4OLJA 1TU3A 4PLPA 4ZVMA 3WGYA 2IY9A 2Q4TA 1N92A 1UADA 1KQNA 3NIDB 2J3HA 4IHKA 4Z51A 3NATA 2WYHA 4OQPA 4TWAA 3OM1A 2QJWA 4GOMD 1DRJA 1DRUA 5AD1A 4HTFA 3GIWA 4X71A 5KYNA 5TPWA 3PQCA 2UZ1A 1R12A 4O5AA 4ZC1A 5L8VA 1ZH0A 3MMPA 1MKYA 3BDAA 3W4IA 4EMTA 2W2QA 4CN9A 1I9GA 3PYLA 1YKSA 1X8LA 2Q99A 2B1GA 2W5UA 2JCSA 4AN0A 1BDJA 4F04A 5D6OA 3HE3A 4WA7A 2BPOA 2D3TA 4AT1A 4QVGA 5JJ5A 1X39A 2JJ1D 2F64A 2QYSA 2VHCA 4Q9DA 1L7BA 3SEFA 3QVUA 2XMQA 2Q8QA 2VHUA 3RKRA 5HIMA 2FEKA 4RQUA 1E1MA 2NXNA 4P31A 3N8NA 1IHXA 4NH0A 5HIJA 1DIOB 3K5HA 4MVCA 4N82A 3TMAA 3TOVA 3WGGA 4CUZA 5JXJA 4E1AA 1O9HA 2QG9A 5FH9A 5BORA 3E9DA 2HSZA 1Y1RA 3CZ4A 2C2ZA 1EBBA 2YWGA 1KDRA 3HDYA 3O4GA 1DUSA 1QE3A 2YXEA 5DWQA 1KDYA 3IA2A 3LVRE 5FOXA 1CQJA 4U6NA 5TJ9A 4PICA 5ITSA 3T7EA 1UDWA 4ZAVA 3OPQA 2HA6A 4F93B 5BR4A 1TW2A 2NYVA 1E3WA 3NM5A 3NBFA 2X6TA 4K6MA 3ZGVA 5CNJA 2Q8NA 3QF7A 2A59A 5FHQA 2YFHA 1ZX1A 1MNQA 1XLVA 4L9SA 3HWSA 1MB2A 5ALOA 4DC9A 1UJMA 1WUKS 4G5YA 3O1LA 3QI2A 4TRNA 1DKLA 2OXCA 3THYB 2C97A 5LUBA 5I8PA 5JI2E 2C83A 2HA4A 2AGVA 1LA2A 4RK0A 4ILKA 5A4FS 1VRVA 3HB0A 5J2UA 3NOOA 2WYUA 4IYJA 2JANA 4DCPA 1P1FA 1V43A 4PSKA 4UMVA 1D4FA 2QSYA 2V97A 2X9LA 3M6LA 4IFIA 3QU5A 4IJKA 1XK7A 2VPXA 4XD2A 3MCTA 2EZ9A 2G9ZA 3E61A 3F5QA 1NQVA 5A1JA 2P7HA 3ZGZA 2FPRA 1U8EA 2WUDA 4D5EA 3W8RA 5EXDA 1A4XA 3IH5A 3KZXA 4XLTA 3DF7A 4RJKA 4CYMA 4F1WA 3ERCA 4H9GA 4ZGWA 2C5EA 3IVXA 1NP6A 4EGAA 4OHPA 4JFRA 1T8WA 2IYEA 4HDRB 4HYEA 1JYFA 4H3SA 3T5TA 3T61A 1IPFA 3AZOA 2UVPB 1G20E 1BTOA 1M8PA 4ZQBA 2GKOA 3SC6A 2I3DA 2Q5JA 4XFJA 1Z37A 3U3DA 1N0IA 3PXDA 3IKLA 1J0DA 1AT1A 1PGNA 2JK1A 4C08A 1MZPA 2R8RA 1X7WB 3FOZA 1KVRA 3HK2A 1ZN7A 2BFNA 1W1IA 3FCUB 4KTVE 5K8LA 5B2EA 5IVKA 1OIVA 2PGAA 1ISIA 4ABYA 4HBZA 1H8HD 4B3XA 1Q1ZA 1KQFA 1L9KA 5L3RA 4HTFB 4FW9A 1CUEA 1I4EB 4B31A 3K3PA 3F6RA 4BTLA 1MRNA 3JQ9C 5IM4F 1U3VA 2WU0A 2NMVA 4RL4A 2J87A 3R7DA 4EM6A 2GBLC 3NHBA 2O59A 4NYJQ 4L51A 3KWJA 3EXEA 4KNVA 2UYQA 2C7OA 1ZCJA 3MBKA 2ICAA 3MOGA 4AJNA 5K6TA 3IUJA 3CX6A 3WVNA 1PGOA 2QZ9A 4ISBA 4RS3A 1NHGA 4QC2A 1MO6A 2AMLA 1O9GA 2Y1FA 3EIWA 2BEWB 2R4QA 3IKMB 4TWIA 3DTVA 4LGVA 3QLJA 1W5FA 4Q6WA 4BMCA 3CTPA 3LUKA 2CNDA 3HCEA 2CE2X 1MORA 1GXSB 1UBJS 1E7YA 3WMFA 2CT8A 3GW8A 1X77A 3FCSB 1XTKA 4RESA 1RM5A 5CHYA 5EQFA 5IJ0B 1J56A 3FPGA 4J43A 5E0OA 1EAYA 2A5YB 2B36A 4QPDA 4RORA 4X6XA 4WXRA 2W2XA 3AP3A 3KAPA 2ATIA 1ZIYA 1ZL0A 4BJ6A 1GCAA 2NQTA 4OO3A 2CVZA 4X3CA 3SZMA 5JCPA 4WJKB 2CSXA 1FSGA 1E2UA 1XTBA 2PAAA 3RPEA 1QWOA 1XZFA 3GBPA 1VL6A 1JHUA 3NFYA 1QO0D 3VOAA 2NNLD 5ENZA 4Z2YA 3U4QA 4LUCA 3SZ3A 3LPMA 3QW2A 5LL6P 1L5HA 3FHJA 3JQ7A 4UZFA 2FUCA 3DZ8A 4YT8A 4B9EA 3LRPA 3EA0A 4FUTA 4HPXB 4DLSA 1DELA 1UMDA 4V3BA 2I76A 2ILVA 4CL0A 4L0MA 2E1PA 2X8JA 2ZS9A 4Q3LA 5HTOA 1D4ZA 1W48A 3OPYI 2XUOA 1XKXA 4FJ1A 2X15A 2IPOA 1O4WA 1X2BA 1XVLA 3O7WA 1PT6A 3G0BA 4FOLA 4LZJA 1W4RA 1W47A 4WNIA 4MQFB 3TTWA 1LPMA 1KU6A 3V2IA 3F6SA 3ZQ6A 1QKIA 1CUHA 1KEUA 2QRQA 1MP0A 2DMRA 3OEED 4MVJD 4D6YA 2Y3IA 3UUEA 4WBXC 3BK7A 4XDHA 4KNWA 3BGOS 2VSNA 4V02A 1UPAA 1JKXA 1WABA 3UXMA 4H4CA 2LPMA 3H87A 4CKCB 4XQCA 3FA2A 3ZE2B 2PLRA 1XZIA 1GTJ1 2QU8A 3UJDA 1MJHA 4QT4A 2B4TO 4C20A 4DA8A 1U9JA 3IRVA 3L46A 4NIMA 4YP7A 4KR9A 3MB8A 4JC4A 1K86A 1L5QA 2JATA 2QM7A 2ZSIA 3CXRA 3O90A 2RK6A 1W9HA 2VHZA 4IG9A 1U1EA 2VTDA 5EE5B 3OZAA 4BJ3A 3CLSD 2B21A 4AUMA 1QGUA 3CZ5A 2HWWA 1XZ8A 4XKJA 2ZI3A 3UV7A 1AK2A 4B45A 4NENA 3VPAA 2XCRB 2DWPA 1W6RA 3OZIA 2PANA 3OIFA 3RQIA 1Y98A 2GTPA 2WWFA 4MDHA 4NYIQ 2H8GA 1T35A 4OH1A 3RUDA 5JIBA 4DIEA 4U7HA 3AI7A 3RSHA 2X8WA 3LBHA 2X42A 4U2DA 3SE7A 5K8VA 2P90A 5F33A 1TD9A 1DOZA 2VHQA 4NAVA 1G2PA 3CEAA 2B9VA 3I2GA 4LJ6A 2CJFA 1SXJE 1J42A 3F6CA 4JUIA 4PQGA 4CMEA 5ALXA 1NSYA 5DNEA 4O4LF 2F3PA 5LMCA 1NMZA 4DMLA 5EZ6B 1NW4A 2BW0A 1NMYA 4Y9UA 2WIJA 4ONEA 2WHPB 4UVHA 5DYGA 2Q1XA 2XB9A 1C8BA 1Z5WA 3AIIA 2OO5C 4Q1CA 5DU2A 4AJ4A 4CLEA 1ESMA 5C3MA 5NULA 16PKA 1DQSA 2P5YA 3ZDXB 1UXIA 1T9CA 1Y8RB 1DOAA 3VU3A 2ZKIA 4KLZA 4Y7DA 4HHEA 3S68A 3GLFE 3A70A 3K94A 3GGGA 2AFHE 3F5MA 3Q8WA 4L22A 3U4GA 3HH8A 1ZA2A 4IICA 2XI4A 2QG6A 3OECA 1RZUA 4NE7A 3VYTB 3P9IA 1ZW6A 4PVCA 5G02A 3RVBA 2YBDA 1L7RA 4G37A 4DLKA 3GJ3A 1FTSA 4HLUC 1DFHA 1XMVA 2HCRA 2JFOA 3HGMA 1V1RB 2QROA 4RDCA 4BNYA 2V59A 1GKYA 3S2ZA 1QR6A 3L7OA 3ZTWA 3GUVA 1DX6A 1ZQ9A 3WLAA 1HSZA 1LD3A 2D2FA 4RQAA 3DGEC 3F4BA 2XVMA 3ZV6A 1GL6A 2ID9A 1VRWA 4BKUA 1EX7A 2H1CA 3V1UA 2HD4A 3FYTA 1OBOA 2EWVA 1WXWA 4JBXA 2Z2YA 4FVTA 4HQFA 4F96A 3ND6A 1BS9A 721PA 3IE2A 2DH6A 2R8PA 3ORQA 3CU5A 1IPEA 3VYVA 3P2OA 1DC7A 1KJ8A 3H1AA 1YL6A 4ZQFA 4BTEA 1G42A 1V7CA 4CDMA 5ISMA 1A8IA 4FK8A 5CAEA 3MQ4A 4PIVA 5K0CA 3HGQA 1GPH1 1P2BA 3ZGYA 2XMGA 3UXYA 2FP3A 2KPOA 3EHEA 2D59A 4HMPA 3T3GA 3ZKAA 2WW8A 4PX2A 1FQWA 1F4VA 4MW6A 2Z6AA 4KLRA 4Z7JA 4G2TA 4EO9A 3I37X 3KLNA 5GJCA 2P3LA 4DA6A 2ANBA 3NCHA 2XYHA 3IP9A 4D9KA 1V3VA 3H3XA 3AOEC 2IU0A 2ZYVX 3LVQE 1J07A 1PR5A 5JSYA 1U2GA 2XYPA 3LVFO 3QEMA 5K3CA 5GIPE 2BGUA 3KD3A 5CFZA 1ACJA 1QQBA 1JDTA 3CIFA 2HWKA 2V8OA 4CIVA 2YJ4A 1DC3A 4ZOAA 2EEPA 1NIPA 4IV8A 2OSBA 4LMPA 1M2EA 1TXGA 3OPMA 4JEMA 4DAOA 1TCUA 1Z7EA 1SCQA 3RYCB 1PWHA 2X2FA 2R8EA 3OFSA 2WYVA 2YWFA 4HUJA 1F8UA 1QCCA 2CFRA 2ONZA 4I08A 3WGLA 4QYTA 2XDYA 2PGJA 2QY6A 1VLHA 4X41A 4XD7D 1CY6A 1QC5A 3TZQA 3D64A 3VPCA 1CX9B 1GAXA 3VHXB 3W4JA 3U26A 1HDOA 1JXMA 1PT7A 3MRSA 5EQDA 1HYQA 1N5IA 2HNBA 1SVWA 2PSSA 5BSGA 2YN4A 3HB5X 1N33B 2I29A 2A9FA 5AXCA 4BMXA 2GA9A 5DWVA 5HE9A 2AJBA 3CN7A 3L0IB 1U11A 5L9AA 2AE1A 3T35A 1UJ6A 2G1PA 1TVKA 1LF5A 2F43B 2Y66A 4F6RB 5DB4A 1K0FA 4QUDA 2VJNA 3P7MA 1SHTX 4V0NA 1CB7A 4FYPA 4MLPA 4K9RA 1E5TA 3VISA 2DH5A 4BASA 1OX4B 5J4VA 1FRFS 2Z5FA 1F48A 3HDTA 4S1PA 1XOIA 2WBLC 4MYUA 1WUYA 2VHEA 4A8PA 3STYA 1T5DX 2C58A 1M8JA 2YV1A 2JLCA 4FHCA 1BVRA 4HD8A 4X63A 3TX6A 3QLTA 1OXMA 2WSLA 3NHFA 1U28C 1D07A 1Q3KA 3UQZA 4D45A 4I4TA 3EGDB 3AVXA 1YE8A 4DQLA 3U7HB 5T7BA 5D3ZA 3KQLA 3U3XA 3GLHB 1OMOA 4BB0A 2M6SA 4MYRA 1G1MA 1I2CA 1WXGA 2Q07A 4UAUA 4AURA 1SUCA 5BVHA 1IOLA 3AEQA 4TKZA 5HILA 2GF2A 4OKIA 4BFZA 5KO2A 1KBQA 2EEZA 4Z0HO 4MHSA 4OCZA 5KTNA 4AZWA 1Q2XA 2HKIA 4UEQA 3I2IA 2Y9PB 4MAAA 2EFEB 3PFWO 3H1BA 4M9RA 1N6NA 3VPGA 6ABPA 4E6EA 3ULKA 1ISJA 3CO0S 2VT7A 2GBGA 1FXWF 2WA1A 4F3YA 4YRBA 4CKWA 3UZUA 4BV8A 1P2DA 2Z9DA 2ZYAA 4TL8A 1YR2A 2YS7A 3GRAA 3MJRA 5I9LA 3ZD6A 3JV7A 3KT6A 2BMFA 3Q7QA 2GEKA 4FM9A 3ADDA 3C6KA 5AUQA 5G0VA 2VRCA 4QFBA 3TGLA 4ZK2A 1ECPA 3P2KA 4BTVA 2A5JA 2XXJA 3BUSA 3DHWC 2GDJA 1M2GA 2AX4A 4OHZA 1HKHA 5MGBA 5CJPA 1KK2A 1DIBA 1EP9A 3BWXA 4QOHA 4V2IA 4DMRA 5BXQC 4QU0A 5K6AC 3ZZNA 1QLWA 1QRRA 1R1DA 2DT5A 2QLMA 3OZTA 5E4YA 4BGUA 2NPIA 3W5IA 2RGUA 5MN4A 5EXXA 1EJ0A 1NNLA 2BHSA 4BMVA 4BX9A 4NCNA 1P5JA 4UCWA 1FDRA 3NDRA 1XZNA 5K8IA 3TAXA 2BMJA 3DVSX 3M0EA 2GETA 4UQOA 4P83A 4QDJA 2EJBA 4Z86A 2JFNA 2W6CX 1TNDA 2H16A 3EWSA 1SBCA 4IFEA 4JYBA 1VE1A 2O9JA 3K9CA 5AI6A 1DCMA 1C5KA 1ZYUA 3BFXA 4A10A 5C4MA 5F64A 1X7HA 5EIEA 4JELA 5LLTA 2WJAA 2CXUA 1C4WA 2FZ4A 1I5EA 1NYQA 2HCFA 2PXCA 4TQAA 1R0BA 4GZLA 4N3CA 1GNLA 3KOYA 4FSHA 2AJDA 4GM4A 5EIOA 5DNWA 4RIGA 3PWTA 1VHWA 2ROQA 2XA1A 3IT3A 4UQPA 5AUNB 2Y05A 3Q5GA 2QMOA 5EZYF 3W5BA 3BWEA 1Q57A 2CLLB 1XNHA 2CNBA 2FPUA 7GPBA 3L0CA 3UC5A 3MTGA 1VLZA 4H3HB 1C30B 1EVEA 1J09A 2JI7A 3R1IA 7AT1A 1MA3A 1QVZA 4Q01A 1KZ9A 2ATXA 2I6QA 2QTHA 3DBIA 3HKCA 4TTVA 3RVRA 3WDKA 4BQNA 5C4IA 5KQRA 5KVSA 1NQ5A 1IAVA 1RWVA 1R2QA 4EO4A 2V9ZA 2Q9BA 3V4SA 2OKCA 2Z09A 1T10A 1KJWA 4IIXA 1C9KA 2UUPA 4MW4A 3RV3A 4ALKA 1QTRA 2VBGA 3CONA 5LM3A 3M5CA 4G8JA 4O2BB 3WFZA 4B0PA 2W0MA 3K1TA 5TDHA 4B81A 3ZW7A 1CZNA 3C43A 5KTRA 3I8OA 1TQ8A 2NUTA 3WRYA 5BUSA 4WD3A 3OZSA 1KJYA 4X91A 4QEKA 4C9BA 4H15A 1QSGA 1EPUA 2XW6A 3GGCA 1KS2A 1KZGB 4O4JA 4HDMB 5LQSA 5HVNA 3NTUA 1B0UA 2N3ZA 2V55B 5DVZA 1BXGA 3CUWA 4MGYR 1G3IA 2MINA 5TB5A 5DT2A 3ROXA 4EHBA 5LJIA 5TMPA 1ANKA 4JA2A 2XWBF 3HCRA 2WRZA 3S2UA 2I2BA 1Z8HA 4IIYA 1ZN2A 1SK9A 4N5IX 1VM6A 2UDPA 3JRWA 4HK4A 3LXUX 1EUZA 1NSFA 1QIMA 2J1LA 1WNFA 2DFPA 4KO8A 4PYQA 1N9GB 3S7TA 2FOXA 3GJ5A 1AKYA 3KYCB 5K4AA 3NDJA 2PD4A 3KVYA 4REOA 3JD1A 4WMLA 1ITZA 1ZXXA 1QG4A 3ANSA 1KWGA 3VU8A 5CDFE 1CRQA 2I6XA 1TLFA 4NSNA 5JI3E 1H2XA 3OKPA 4Q6BA 3TSAA 3C6ZA 4B3SB 2MTBA 1RRKA 4BZZA 1GTL1 3IIEA 3A1CA 4MK4A 2G08A 1TYBE 1L3BA 2WY2D 2JVIA 3BRWD 3CMCO 1JMVA 3N0XA 2BZ1A 4TLMB 4BRZA 4YV7A 5LXTA 2YHUA 4TWZA 5JAPA 3PNSA 4YJDA 5CFPA 2XR1A 3L01A 1V8BA 4B7UA 1DBSA 2W90A 3UAGA 4DS3A 1FZTA 3VDRA 2AN3A 1JJBA 2ENUA 3T3OA 2J08A 3KHKA 2X3FA 4WLUA 1Q17A 1BXRB 3CHYA 3FSEA 1T3TA 4P54A 4UZSA 2Z3WA 4YAEA 1F2VA 2Z2ZA 4IYRA 4RY2A 3H5LA 2BGLA 1NP3A 1VPWA 4TWBA 3QJGA 3TG2A 4N76A 3MAAC 4RY9A 4EMBA 4LDNA 1HX7A 1U1FA 5KOYA 3ITNA 2FMTA 2IXGA 4GG1A 1SIUA 2P41A 4RVNA 1G4UR 4R98A 5M04A 3AR7A 3T7AA 1QP4A 4OMDA 1RADA 3QOWA 1UBOS 2RK3A 2FHPA 3FGNA 2I67A 1WU7A 5A03A 2OLJA 1SBQA 3KKZA 4EHIA 4RA6A 2JCBA 5TEWA 1JKJA 2QVGA 2XODA 3ZEAA 1VB3A 1NT2A 3NB0A 5KINB 1VI2A 4JEHA 4AM8A 1N32B 1UAAA 3V7YA 4B7XA 4UBLA 1OAOA 3DVRX 4AICA 1H42A 4I5FA 4MWOA 2CCGA 3BD6A 2YOGA 1ML3A 4G9BA 1NLYA 3MVEA 1OBCA 2BI7A 3Q85A 3VHQA 3K0EA 5HBRA 4N5LA 1C1DA 1TQ6A 3NDIA 4PZ9A 4BLTA 5HUQA 3DLCA 5FUWA 5IAKA 4UOZA 1RYBA 5IX8A 3O8CA 4L0DA 3D1LA 2NUTB 4KQGA 4NCAA 5F9FA 1GRRA 2NX2A 2P2YA 2FQQA 3AJEA 2XKBA 5AESA 4HAXA 1UMCA 1TAGA 3TZHA 3INNA 3K0FB 1C0PA 1KJNA 4YCBA 2H3HA 3O75A 4LWQA 2IZOA 2BR4A 4CKBB 4D4GA 2WU1A 1GVNB 1PZGA 3E7PA 5EMNA 3WV4A 2A1UB 1R64A 2ORYA 3KALA 3N1UA 4HDAA 4JVLA 1OB5A 1LRKA 2GEUA 3AUUA 3W6ZA 3KTFA 3M2PA 3BEOA 3VDMA 4PSCA 1Z06A 2QMQA 5IHPA 3ZGOA 2AOTB 1C81A 5FOUA 3SMQA 5B6IA 4S2UA 1XVAA 3E18A 5EZYB 3VC3A 3WO0A 2YWXA 3X0DA 3RAFC 4P81A 2PL9A 3IP7A 1YR7A 3G49A 1U7DA 3K6RA 4Y9RA 3NRBA 4II3A 5IS2A 4RD1A 1VLMA 3TD2A 3JWHA 1GZ6A 1UMDB 2E85A 4CNBA 4MDEA 2KQUA 1RYYA 3VR2D 4LFBB 2QPAA 4RVHA 3NOVA 3KS9A 2RGYA 4LTNA 3FYHA 5CM9C 5F23A 3SQWA 2QM8A 2ZJ1A 1ZK0A 4KLAA 1D2MA 3GPLA 2G9NA 4PYLA 1Z08A 1GGEA 1IEWA 3WK4A 5KKAA 3WIBA 3EX7C 2BCGY 4A15A 4OLAA 1GU7A 2ZYWX 1OX4A 2CXRA 3HRIA 1H6DA 3PLRA 3OZUA 5BSHA 4DNXA 1E4YA 2NXCA 2H2FA 3V8VA 4ENRA 2KHZA 2F1OA 5JNWA 3QU4A 1WVGA 2JZNA 1L4BA 3H83A 5KTYA 1LPOA 1VTKA 2JGLA 2HQOA 2AR0A 3QI7A 4G4IA 1FEZA 2UZ3A 2F9LA 3LNTA 5E6RB 5IJ9A 2IUSA 1N0UA 1EFLA 1ORRA 3OM9A 4HXYA 4M1SA 5K0FA 1O95A 5BSEA 4LW8A 2X9VA 3GLHA 1A5SB 2VPWA 3KU1A 4IOLA 2CJWA 2VFAA 3FRJA 2P4EA 4L8YA 4KOEC 3SZOA 4V1CB 3QX9A 1OF1A 1QF7A 2CWWA 5KKNB 4YIHA 4FQ8A 3VPFA 3WLHA 2C5BA 5H81A 1O3YA 5FORA 5LDHA 3FFXA 3JZDA 2JARA 4YRPA 4EELA 4DB2A 2GMWA 3L7AA 2JDIA 3CFYA 4HR7A 4TKUB 2PN1A 4L95C 5U1PA 1WVMA 3D9QX 2W6NA 1PWZA 4Y98A 4Q4HA 1XNRB 4IILA 2AG6A 4IINA 3IV9A 3IDFA 4XE5A 3L4BA 2HK6A 1EM6A 4P35A 2JI8A 1U0JA 2CXTA 3CLRD 1YBAA 1X8JA 3NH9A 3OQIA 4MLDA 2DECA 3DYBA 2JD1A 2FPKA 4OJKA 4ZI7A 4Y0NA 2UZ4A 1IPHA 5HF6A 1SB9A 2RHGB 2ZYSA 1S2MA 4EK9A 4M0CA 2WZCA 3PDJA 2PGOA 4KH0A 4CV3A 5BOSA 2PUTA 2C3YA 2O0MA 3PL5A 3PKIA 5EHIA 4AJPA 5BNWA 2RC5A 3DZCA 1KHTA 3AUFA 4G65A 3DB1A 3R3ZA 4G9EA 2D2VA 4KDCA 3DFZA 1P8JA 3GEDA 2OGTA 1F9EA 2WDPA 5AJHA 1GEGA 3ONVA 5EXSA 4DADA 5BY2A 1OH7A 4UJ5A 4B0OA 4PWYA 2OUIA 1I3OA 4Y2UA 4PAMA 2FPPA 5GJWC 1EFPA 1XPOA 2DLCX 4QGHA 2E5WA 3DEJA 4HX9A 3G2LA 2NAFA 4J7UA 1A9PA 4M7PA 1T26A 3A4IA 4RM3A 4BKRA 5G1NA 3M4YA 4QQFA 3WFJA 5C51B 3NWEA 1YBFA 2GN0A 3IESA 2FPWA 1YQWA 2ACEA 3AY0A 3R5FA 1CT9A 1CULC 1NOJA 3TIXB 2QMUA 1AGYA 3BGVA 4YEDA 2OFOA 1HYGA 3GRUA 4BO3A 1XTTA 4OSPA 4HVLA 4CF7A 1JIUA 2FK7A 2PFKA 1V1MB 2DUJA 2QRPA 3JYHA 4FTWA 4HB0A 4HDSB 5DN6A 1A69A 2B35A 2Q6IA 2Y93A 3VTZA 3Q41A 2HUPA 3PA6A 2B8JA 4MKXA 3EZ7A 1XA0A 3DDWA 4HY3A 4JUFA 4F06A 4E1VA 5IVPA 4L75A 1R0WA 4QA9A 1IIBA 1P2SA 2OK8A 4Z4HA 2OCXA 1N2HA 4LF8B 3IB3A 3P9YA 2O2CA 1FU7A 2A5DA 3GVCA 3U31A 1JFSA 1KI9A 5LYYA 4I1VA 2B2CA 2WUEA 3TINA 2O2YA 2W2LA 1GG2A 5CAEB 1MR3F 2CXQA 1FUUA 3G0DA 3KEFA 4X1OA 4PZUA 1IQ0A 4MKRA 3A9VA 3EAFA 1FU4A 3DHNA 3WBFA 1K08A 4HDMA 4DBVO 5JHGB 1AGXA 2WFAA 1MAVA 1DMSA 1QYCA 4EB6A 3MMNA 1BKYA 3TQFA 1N2CA 2OZVA 1T1IA 3G0HA 2G17A 4JJ4A 2FKNA 2H2GA 3QKUA 2AC2A 2VOEA 4U9IS 1AZLA 4A0QA 4DQDA 2IY8A 4G97A 4QOSA 4HUQB 1L7QA 2Z30A 3SQNA 2VF7A 3QEMB 3KE8A 2JHCA 1L7PA 2V9CA 5BWBA 3IYLW 4RADA 4DAEA 5CBPB 4FOPA 3AM5A 3FZGA 1K7EB 4PGAA 2UYYA 3B13B 2J0SA 3IP6A 1UDXA 2YVAA 3NNNA 2QWXA 2F8MA 2XOEA 4BNZA 3QVLA 4I1OA 4ZV9A 1HDGO 2BRUA 5D84A 3RUIA 3JQRA 2OFFA 2AN1A 3RU7A 3NPMA 3V6LA 2ZOSA 1GG5A 1C3EA 4RH0A 4TLEA 4AZ0B 1T1JA 5CIQA 1XMXA 5ECGC 1CUYA 3TDNA 5K0LA 1Y8CA 4RJTA 1K06A 2JGNA 1LX7A 2YJGA 1V6SA 5A0FA 2WSMA 3WYNA 4W5NA 4FWBA 5CVJA 3M1LA 2ODPA 2IYNA 5AM1A 5BVGB 1U99A 2J8ZA 3CRQA 3COYA 1ABEA 3Q4GA 2JLBA 2Q9CA 3GFBA 1KYYA 3JD0A 3O4RA 5ETJA 1IJFA 5D7BA 5AVKA 4CODB 4F71A 1G6OA 3PVSA 1L4YA 3TOZA 2C8LA 1M2VB 1C3JA 4TV9A 1G5HA 1WMDA 2EHJA 2YIDA 2RAUA 5FAXA 1VJ1A 3KB6A 5D1NA 2Q9AA 1RCUA 2F3TA 3A3YA 1KQOA 3H97A 3IAM6 3LYAA 1PV1A 3M6UA 5BW4A 3PFCA 4K8RB 4WCFA 3CCCA 1U0OC 3ELUA 5AHKA 5ERGB 1J06A 1MX9A 1F14A 1KK1A 2VJYA 5ICCA 1H5QA 3P20A 4TXLA 4II2A 5D85A 3ZWDA 1V3TA 1XZJA 3B1YA 3HR4A 4C1NA 1UBKS 4NFYA 2P91A 4B3GA 3VVBA 1Q1AA 3EPHA 1PZMA 1W36B 3HMKA 5DLQC 4BP8A 1LW6E 2DPYA 3KYDA 4I1RA 1XXHA 3KX2A 3C1UA 3UC9A 3U1TA 3WBKA 2D8AA 3MILA 1YTUA 2BH9A 1RAEA 3U7GA 1B0AA 3HWX1 4L76A 4RAQA 2YKGA 4R8SA 2QVBA 5BW8A 3E53A 1RPAA 3UYKA 5A4IS 3EQZA 5JPDA 3OLZA 1OVGA 3TRDA 1KFEB 2Y1EA 2BDEA 2CNLA 3ETLA 3V8EA 1KO5A 5MFZA 2Q6TA 2YZGA 3ASYA 4LZNA 4YJGB 1L5WA 3L9WA 1QG6A 1Q6YA 2FX2A 2VSYA 1Z2PX 3IJ5A 3OPYB 3QIAA 5AVXA 5LYJB 4R69A 2ZTSA 2EKPA 3NHJA 4MA0A 4XSGA 2P1DA 1VKRA 4C0LA 4HF7A 2H3EA 1QUEA 4C7JA 1CB0A 1P3JA 4EZBA 5L53A 2FDRA 1PJ3A 2JLRA 5FKJA 4MW2A 3RTEA 1Y1PA 4JJGA 2B61A 4RVUA 5K51A 3VKHA 2W2OA 1YI0A 3BWMA 3FSJX 4EDFA 3FJYA 3SYKA 3IS3A 2QN3A 2IQIA 3SCZA 2RH5A 4D4JA 5I3ZA 4CEHA 1D8AA 4OK6A 1GTMA 4URYR 4JU9A 3TQTA 5JCOC 2DFTA 3L6DA 1ZL2A 1W88B 4OMCA 4P3NA 4F60A 3IAM1 1QHSA 4GI7A 1RHUA 3ISVA 4GVLA 3KTOA 5CIWA 4NECA 4EFDA 4MVWA 3EGOA 4BNXA 2Q5QA 2PT7A 3RRBA 1AGPA 4HZUA 4D4LA 2J0UB 2PUDA 3VHRA 5CT5A 3K96A 4MVYA 2A0XA 1OQAA 2POQX 2QD3A 3L0DA 4NZNA 4M0KA 3R77A 3LXXA 4Y2RA 4B85A 4BBJA 1A8UA 4QFDA 1U4SA 1V8ZA 2O2JA 4US1R 2HDOA 3SX0A 3TDMA 3RU9A 5LNK1 4MULA 2HPHA 2D1FA 1H6AA 4DEXA 4F3RA 1B16A 4B46A 2J9XB 3RVMA 1BA3A 5JXIA 1EZ4A 4GFDA 4F91B 3RW9A 1Z16A 3GIDA 3A1FA 1HTBA 3WAKA 4DGQA 1BSVA 4WLNA 4I1SA 4LE2A 5REQB 1PT8A 3K4QA 3I28A 3ZWKA 2GCOA 4DDUA 3ONWA 5FPKA 4NPHA 1E1KA 5EZ5A 2HJVA 4X1YB 1M0TA 1MV5A 3EWAA 1E2LA 4JITA 1KO8A 1ZNZA 2EKBA 4DY4A 5KWSA 2A3NA 1X7ZB 2CC2A 5DNCA 1EQAA 3KOOA 4M9ZA 3ZCVA 3QF4A 1XAJA 4TXHA 1PL6A 3NV7A 4DA7A 2XMPA 4R1NA 4Z7QB 1ZBDA 3TQSA 4WUTA 3HRKA 2AD5A 2IEYA 1C9NA 4LHEA 3R7AA 1D1QA 1S0UA 1H4TA 4MUAA 4TTIA 4YMTA 3JALB 4ITVA 4IIBA 2B3TA 1ES9A 2FAXA 3DZIA 4PR3A 5AR1A 4Z9BA 4CM4B 2I66A 2QJTA 2O2SA 1KMNA 1QMGA 3PWSA 5TXGA 4B2YA 1QTNA 3L02A 5LZ7A 3ZDEA 4AQDA 1SU6A 3RQSA 1DPFA 1T34A 1YJAA 2Z1NA 3AB7A 1RYDA 3TUZC 4FYVA 1UIMA 3UMYA 4D2IA 4QVIA 2IOYA 2VUHB 3HSKA 3AR6A 4BVHA 4O02B 3WB1A 4FZJA 3WLRA 8ABPA 5EZQA 3W5AA 4UBMA 4F6CA 2FGKA 3TPCA 3TXYA 4RFVA 4HAVA 4KX5A 1PS0A 1U9IC 2H92A 4PX5A 4R3UC 5ES3A 4KR3A 5IANA 3UV6A 3FYDA 5B1HA 5FBQB 2ENWA 4JLMA 4UBNA 4TZ6A 1M8GA 5IHXA 4KEAA 1KO1A 1I1NA 4JP1A 2VI5A 3J7AC 3PQ8A 2I6SA 4MEBA 4F0JA 2CJXA 3OCCA 4UDXX 1YF3A 1IATA 4JP5A 1UJNA 2O5VA 2P11A 3F49S 4MX8A 4ZOBA 1AE1A 2Y68A 3WYCA 2EYQA 1RWMA 3C14C 5T5QA 4BLSA 4UNQA 1YONA 1XALA 4YGYA 1S3IA 3FKJA 4I99A 3R7LA 1CQIA 1GN8A 2VF2A 3EYAA 3K32A 4BLWA 5KC9A 1PQWA 4HGNA 5J4KA 2JB9A 4PONA 1BE6A 3R4CA 5CYGA 4R9VA 1F1BA 3JYOA 1PR6A 2QNBA 3MRTA 1P1KA 3NJ4A 1AS3A 1XVIA 3E7XA 3PIIA 2AC7A 1P77A 4GPIB 5A04A 2B0JA 2VPYA 4IDCA 5IMBA 3SOPA 1CUWA 4ALJA 1EA5A 5AJUA 4F11A 1YQUA 1KC1A 1JR2A 1IE3A 4ML3A 1U94A 4L7VA 1K7XB 5F4BA 2H1RA 4NNJA 2Z9CA 1OGYA 4A0RA 4BAZA 1CIJA 4QZVA 1FMLA 5AYVA 1W0CA 1W7AA 2FSPA 2FFAA 4G5QA 1CBUA 1DXHA 1I6KA 1JX6A 4DR2B 1UK6A 2J59A 3T5BA 3Q7EA 3DO5A 1OYOA 1UFRA 2WV9A 2I3ZA 4GOXA 5EUCA 4P3PA 3EVFA 4WKCA 1KO4A 4YRGA 3GJYA 5GONF 4D74A 1K5DA 5IUNC 1E8MA 4GC5A 3E0QA 4O2AF 3RC2A 2Q50A 3JSXA 2FMHA 1WXIA 1MC1A 1HDCA 3HNOA 3K9GA 3MM4A 3N58A 1YH3A 3PHJA 4RZ3A 4P34A 2P2DA 3PNVA 3H99A 3QVSA 2G07A 5HDBB 3BWBA 1VA5A 3G2KA 3IHWA 1X7XA 4UEKA 1QIJA 1RPJA 2IEGA 1RQLA 4FEAA 3UXEA 3GFFA 4MRAA 4HATA 3DM9B 1U9YA 2WNHA 2FN7A 5JXWA 4BCCA 1QG0A 1HRDA 3KLMX 5FR2A 1D04A 1IZ0A 1UIRA 2ERCA 2JCGA 3A6ZA 4H1TA 3UMVA 1KFKB 1L5MA 4E32A 4J76A 1XU9A 2MSKA 2RB4A 4KHPB 5JBNA 4YS6A 3A26A 1QRSA 1OYWA 4PNHA 1GCOA 4D9JA 2B8EA 2HLDD 2NUAA 3FRHA 5B58T 4AAYA 4HGYA 3TWOA 2FJ0A 4ETMA 1OU4A 2LVBA 1OKKA 4WKBA 4M1QA 3BVPA 2QTLA 5DX1A 2IKSA 4MTCA 2NUPA 4X94A 2ZJOA 3JYLA 1XR3A 4KWHA 4A3SA 5AFSA 4K6FA 1YDFA 1JSCA 4QIHA 2FCAA 2WWWA 4E51A 1E7QA 3BQMB 2GPNA 3L49A 1Q0HA 3FWNA 3ZXUB 1OVMA 2JKVA 4TMFA 2CL7X 2NPOA 3TLKA 4DARA 2CDAA 2X7JA 1EB8A 4TVBA 4N12A 4R3WA 3LLVA 3PXEA 4TUYA 1R37A 2HZ7A 2GWRA 3HN6A 4DLWA 1KSJA 1BVUA 1L4MA 2RBEA 1DKMA 2PV0A 2ZCUA 4GXQA 1MUUA 5AKKA 3GDHA 5GGXA 3RC1A 3ZLTA 4LJ7A 1PJ4A 3E8XA 2DUUA 4AMVA 4JCCA 3SJUA 1IUOA 1BQ4A 2CCJA 1N2XA 2RHHA 1N2SA 4BQFA 5EPEA 2Q8PA 5AVJA 2CFCA 4RNCA 4KC0A 3DNMA 3D3KA 3OM0A 1N6HA 1Q7TA 2IOQA 2YXDA 2QL6A 2P40A 2BKVA 3HFSA 3OOEA 4YPVA 4RPLA 1XRPA 2WSYB 3DBOB 3TVYA 1L8QA 1ONNA 2R6AA 2VYVA 1CJMA 5EMKA 2VWQA 5BPHA 2FPXA 1WZNA 1YJCA 1BRMA 1P1IA 3IILA 4Y3UA 1MOSA 1X13A 4YCAA 3QVTA 2CVPA 3G3EA 2QYTA 2PLAA 3VR1A 3SS8A 1B93A 1TAHA 3NYQA 2VEDA 4RYLA 5TY0A 5JEDA 3VC1A 2ZVPX 3AT1A 2HSWA 2WM2A 2OFXA 2IV2X 2BFMA 4XTRA 4YK7A 5E2IA 3IR5A 4JLDA 3TTTA 1QQAA 3GC6A 4BJ1A 2RI1A 2EZ8A 4AWBA 3JQ8A 4G09A 1J8VA 3C3BA 2I1VB 1K7FB 1L7MA 2H4HA 3RS2A 3WV5A 1QCYA 1PQYA 1E1CB 1YTLA 4EJFA 3TBKA 1KEWA 4IDPA 4QPJC 1Y3CE 1BJKA 1TAQA 1DE0A 1YBMA 1UEXC 2AHOA 2D5BA 2WM8A 3A31A 3LC7O 3LQRA 4HGRA 2QM3A 1Z0ZA 4HLDA 2M98A 4WWHA 4QTYA 2WVHA 2Y67A 1VE7A 1NN1A 1GFZA 1ZKDA 4XWGA 4QYSA 5TQ0A 3TR6A 2QDXA 5EJ5A 5FYQA 4Z3DA 3UK0A 4BV2A 3GQBB 2QK4A 3GX1A 5F7JA 3M5WA 4CLDA 3AJ9A 1WSBA 3K35A 4AX8A 5DNVA 4W8OA 1JIQA 2EZTA 1AKWA 2Y77A 3AFOA 3NEAA 1QMPA 2WK1A 1QH8B 2PH3A 1DT5A 1N6IA 2BR3A 2DUMA 4Q9IA 2OQRA 5AKJA 5DSZA 3N28A 2NQ2C 3BREA 1DDOA 2RH8A 4MPPA 4FDLA 1GGKA 2HU5A 3FOFC 5BSVA 5HIKA 2YZMA 2BL4A 5SZJA 2IDKA 1R4NA 5G40A 1YL5A 3N8IA 3JQBA 1CS4C 2R47A 1YRWA 2W6ID 4QUIA 2FZEA 2H7CA 3DLPX 3M1IA 5EWMA 3DFKA 3EEFA 1NVEA 2VRWA 3NHUA 4IMPA 1AQYA 4FYXA 1QYIA 4KRGA 2DZDA 4ZT6A 5AUOB 4XR4A 1NFQA 3QUBA 3VQTA 1FNCA 4L8VA 5HM8A 4BXOB 3MBOA 3PU6A 2BV3A 1D1SA 1E77A 3MTBA 3NTVA 4OXYA 4D9HA 2EP5A 1QC5B 3D3EA 1GP2A 1CQXA 1E2NA 3F7OA 5BO5A 4JYZA 1AUXA 3FHLA 4QXOA 4L9WA 3ICCA 3Q40A 4X95A 3R23A 3FOEC 1JA0A 3BHIA 3ELBA 5A4JA 2L69A 3CBGA 1I4WA 2IHJA 4J1QA 1RP1A 2JAOA 3RYHA 1IG0A 5KOHA 1HURA 4U6QA 3QKIA 4IP0A 3WKCA 3EN0A 1K63A 4BO4A 3C15C 3TE7A 2GUGA 2R97A 4CMIA 1X70A 5IKMA 3MGAA 1PN3A 4JVOA 3SF8A 1KZ7B 4DY6A 5I7RA 4NCBA 1YQDA 2OV3A 5FI5A 3EB9A 3KBBA 1NWCA 4F97A 5CA0B 2VO1A 3IULA 4Q24A 5HKOA 5JMTA 3W9SA 2GN4A 2R7LA 1GNPA 2G8LA 1FTQA 1Z0UA 2BHTA 3TSWA 3E9RA 4JUBA 4JROA 3TUJC 4P3KA 3PXCX 2HA5A 2Z56A 4PW0A 3ZU5A 1G8JA 4ABTA 1G2OA 1T0PA 5AVWA 1DV1A 4EJSB 2GCGA 3WWZA 1YR8A 5H3CA 1NMEA 4BKPA 1ZD2P 2CY0A 3OFVA 3FNEA 4ZDJA 4DQ0A 2NV2B 3B7PA 1W34A 4XSVA 4FWTA 1NLFA 4GXRA 1WLSA 5H4GA 3GP5A 1PBTA 3DG9A 4YXFA 2Y4OA 3DBVO 5DHUA 1E79A 3OM8A 4C7MA 1E9VA 1N2CB 1SZJG 5H9VA 3CUVA 4LYEA 1EE9A 5LP6C 3A1UA 3L04A 4WZ6A 4YIKA 2W6JA 2ZI5A 4WBSA 3EIOA 1XMPA 4MRVA 4U2KA 1FUEA 3S8EA 1Z6XA 5IW8A 3LY7A 2ID7A 3Q3IA 4XVUA 1TM4E 1Z7GA 2OCBA 2H7YA 5K1ZA 2EJUA 3H16A 1HM5A 3UG7A 4DV6B 3COJA 2D5AA 4M8SA 2XMRA 2JZCA 3W7AA 4YC7A 1JV2B 1KJ9A 2QQ5A 3WJAA 2ZYGA 4E3WA 3K71B 3LZDA 2XY4A 4RO0A 4CU5A 4D0LB 4H3VA 5HM6A 4MVJF 4MXDA 4N49A 4LOAA 2B98A 2JFYA 1YZTA 1JHYA 1FSFA 3I9V6 4FQ5A 4YMVA 2G1KA 2DR2A 1E6CA 3V2HA 4YAUA 2IHUA 2VKQA 3NQ41 4YVFA 3ZHVA 3BJMA 1NI4A 2ZRPA 1QHEA 1EFAA 1U8ZA 2RC6A 5LZ9A 1XPUA 4J6FA 3M4NA 3RGGA 3ZJ4A 3TW8B 2Z2KA 3UVEA 1NSTA 4DHEA 2PSHA 3HKDB 1P4SA 5KTKA 1Z39A 2O6HA 2OHGA 4ZEVA 1QYXA 4I5EA 4ZARA 2D74A 1IUKA 1R6TA 1GLVA 1WX1A 2O23A 4QXMA 3X1JA 1DBRA 3SLRA 1EB9A 3G5AA 3SBDA 2C1EA 3LDHA 4LOJA 4I9NA 4TV8F 3CMMA 1Q83A 3WE7A 4EGSA 1G5FA 4UNRA 4OA5A 5JNTA 2X0IA 4A2CA 2VATA 4PZLA 5EG5A 2OYCA 1E6EA 1TJYA 1PSWA 1W4ZA 2BTQB 2L82A 2Z3ZA 3CE9A 3H6KA 2ZWMA 3REQA 3X1XA 4MUYA 1I3NA 4BNDB 3SSOA 4YRIA 1FX1A 1WCXA 3Q6MA 2XNDD 1IM2A 4BO7A 3AF6A 2WTUA 2O8EB 1NUAA 2FLVA 2P6PA 1WPXA 2EFCB 3OX2A 3JQDA 4IS3A 4O4LB 4RGBA 5AIAA 4M3NA 4KQIA 3MHPA 2JBAA 2XZOA 4UM5A 4GYKA 2A5FA 4KFSA 4LRUA 2CDNA 4P7BA 3MELA 5JD3A 4OV6B 4BGDA 2IWRA 4QBFA 4M7WA 3NGMA 1F6DA 2YMMA 3L3BA 3BCHA 3REFA 3PGA1 3C3EA 1GGMA 1WZUA 1EVJA 2HPVA 1O89A 2XB6A 3QV2A 2HW8A 5TF4A 2O20A 1OAKA 5HR5A 1LWNA 2VRNA 2XPCA 2V7XA 3W2EA 4I9GA 1WP9A 3WHLA 1WZ2A 3IUMA 2PHZA 2REXB 4GOLD 1AK9A 5DGTA 4NDNE 4AXXA 2HHAA 3HM9A 4YRTA 4DQKA 5C37A 1HDIA 1R5JA 1IB0A 2J41A 5TQJA 4H0CA 3T9FA 2PK3A 5GAJA 2VK1A 4U7GA 2CLDX 2OCPA 2G76A 2PKYX 3WHPA 2J5BA 4LRTB 2AJCA 3N53A 2HMSA 1EP2B 2XTMA 4UUNA 4QLBA 2RB5A 1S7CA 3HBAA 1H2WA 3QX3A 3CRMA 1LTKA 5LIRA 3QEKA 1ZW1A 1PHRA 4ZJPA 1ZM2A 4KQ2A 4X62B 1CU1A 3IEKA 4F4UA 4KXUA 3WAGA 1XQVA 3L6OO 4R1OA 4EX7A 5CFNA 4JT8A 3FVWA 1RHKA 2IP1A 3QTBA 1SZDA 4KFCA 2BFWA 3WNDA 1JYSA 4RJIA 4LGYA 1M2JA 1HE2A 4P3XA 1OXXK 2COEA 4QTZA 2I33A 4B84A 1NRWA 1I7SB 3R9XA 5EUMA 4D4MA 5LKAA 1P6QA 4R01A 2OB1A 1QRTA 1L8AA 1MB4A 1QS0B 4FBGA 4DYVA 4WKNA 1ZBQA 3JRXA 4JC8A 2EFYA 4CT4B 3T52A 4TTRA 1DNPA 1JR3D 4CQNA 2KX7A 1OY1A 3G8YA 4QXQA 5C35A 4B6JA 2Q5OA 3CZMA 1KH3A 4C7BA 2ZATA 3ETEA 1QM5A 4W9NC 2HT1A 4HAUA 1F8GA 3G0CA 3M34A 4UE2A 1AQ6A 4Y6SA 4RJJA 2QN7A 1KDVA 3JAWB 4HVTA 2B2NA 1ZN8A 3PFHA 5E1MA 3E7DA 1EVQA 2GLTA 1V16A 2HBRA 4OJTA 4YDHB 4DMMA 3SWWA 5IWAB 1LPBB 4ZDWA 4QUKA 2CMKA 4ZXPA 6REQA 3EUWA 4P92A 2VWHA 3IX7A 1N4AA 4X24A 4E7OA 4ZJZA 3U6KA 5DN9A 5IYZA 1JIJA 3Q7RA 3T1NA 3VNQA 3K1YA 3B1XA 4I8DA 3S6JA 3VOBA 2B7LA 3VPXA 1Y3BE 5TMBA 1FE8A 3A04A 1PWXA 1WQ3A 1XDSA 4RPKA 4MGHA 3ST7A 5KYXA 5KU7A 1A2KC 1H3NA 1E0JA 3Q72A 4JBHA 3RBXA 5KTPA 4IUCS 4TVKA 3INRA 3PI6A 4J0QA 3SJAA 4S1OA 1IZ8A 1HXHA 1JPNA 3N5CA 1NR5A 4IGAA 2WJYA 1JTFA 4RTKA 4OK3A 1G19A 1CHNA 1JEDA 1J23A 4IR7A 4Z49A 3OE7A 3S55A 3RLIA 2PU5A 4IBOA 1HZJA 3QUQA 1E3QA 1CDDA 2PQ2A 5CLJA 2VJCA 4YAKA 3PPVA 1IBMB 5JFGA 1XZAA 2R79A 1ACLA 3IMCA 1E59A 3J7TA 1XZMA 1BCRB 3AF3A 4B2LA 1DPGA 2PS9A 5EP1A 1T0JB 3T3HA 4JQOA 5EP2A 3W1VA 1XU4A 2QB5A 4ZVLA 4ZREA 2BY4A 4HZIA 1QV7A 2JGDA 4FZ5A 3BD8A 4Q3NA 5AKXA 4BFUA 3GJ4A 5JDIC 2DUWA 2YVKA 1F0YA 2FUG1 4KK3A 4L8GA 3PEYA 2YV4A 1BFDA 1WQ4A 2XMDA 2NGRA 4RKFA 4MHTA 1NDQA 1L4EA 2JK0A 2FW0A 2QUAA 4KRXA 1LZLA 3E70C 2JI9A 3NORA 3X2SA 2GXUA 1T2DA 2C59A 1P33A 3N2ZB 4FYWA 3NHSA 3PLNA 5HNKA 1YJBA 1F7UA 4UKDA 1REQA 2WAYA 4JHLA 3PRKE 5KPJA 1E3WB 1AKVA 1Q1GA 3KSDO 2P4UA 4YA6A 4EPXA 2RONA 2OGZA 5AW9A 1PGJA 1U0EA 3WOHA 4JI5B 1XT6A 2CMDA 5LCXA 3USES 4GD3Q 2IVFA 3F98A 5AJTA 5E3HA 5JAHA 1V5IA 5H68A 3ZHTA 1UWLA 3H9GA 2OMEA 5JV5A 1QHNA 1FFSA 2ZZMA 4RK6A 1NW7A 1SU7A 3N0TA 2LCFA 4PHGA 4YBZA 1R15A 4FEEA 5DRYA 2JIDA 1A9XB 3B6ZA 1BHO1