2OWDA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLMRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2owdA00
3IT0A 4JOBA 5HR5A 1UJCA 4ARSA 3FDZA 3KKKA 1DKMA 5PGMA 5CX4A 1DKNA 1C81A 2P75A 4TSRA 2HIAA 5AK0A 2BIFA 5AJVB 3BIFA 1V37A 3EZNA 5AJWA 2RFLA 1TIPA 1T8PA 4PZAA 1RPTA 4HBZA 1C80A 1H2EA 2ENUA 4GPIB 1BIFA 2P2ZA 2GFIA 4PGMA 1UJBA 3GP3A 1C7ZA 3QPWA 3LG2A 1DKLA 4EMBA 3C7TA 1K6MA 2P9ZA 3NFYA 1YFKA 4JOCA 4FDUA 2WU0A 1V7QA 1QWOA 2P6MA 1XQ9A 3PGMA 3IT3A 1SKBA 3GP5A 3LNTA 2P6OA 1BQ4A 3QPUA 1YJXA 2P79A 4ARVA 3K4QA 3LL4A 2H0QA 1ND6A 1H2FA 4D4KA 3D4IA 3K4PA 4AROA 2YN0A 1RPAA 2P30A 2EOAA 3FDZB 2P9YA 5AJZA 3ZHCA 2ENWA 3GW8A 4PZ9A 3IT2A 2QNIA 4IJ5A 2P9FA 3D6AA 4MA4A 1SKAA 3E9CA 3MBKA 1ND5A 1DKQA 2A9JA 5CU7A 1SK8A 2P2YA 3R7AA 4D4LA 2P77A 1E58A 3FJYA 5HTKA 1RIIA 2F90A 1FZTA 1IHPA 2PA0A 5AJXA 4EO9A 1QHFA 4D4JA 2WNIA 2IKQA 3QPVA 1SK9A 2HHJA 4D4MA 3DB1A 5CDHA 2WNHA 2AXNA 3IT1A 2I1VB 1CVIA 3NTLA 3D8HA 1DKOA 4QIHA 2EKBA 1EBBA 2OWDA 2YN2A 5AJYA 3E9EA 2DWOA 1FBTA 3E9DA 2P78A 4E3WA 2EKZA 3HJGA 1E59A 1DKPA 3F3KA 2H4ZA 1NT4A 3F2IA 3OI7A 2H4XA 3EOZA 4ODIA 2A6PA 1QFXA 4FDTA 4GPZA 1BQ3A 2DWPA 2HPAA 2OWEA 4JODA 2H52A 3O0TA 3MXOA 4ARUA 3DCYA 4IJ6A
chains in the Genus database with same CATH superfamily
5CDYA 4KQHA 1FTGA 1E3DA 1QJCA 3TW6A 3IDZA 3TSWA 1M2VB 5IP5A 4RO0A 1WSDA 1AQUA 3PXEA 4QOEA 1R8SA 3MB5A 1IY2A 2C4WA 2C8LA 2GFHA 3RUPA 3PNQA 4B8WA 1C50A 1NG1A 3NOOA 4KN5A 1EFUA 1NI3A 3ZZUA 2I6QA 4D56A 1JHQA 2XOKD 4EHIA 2CXXA 4YFYA 3WFIA 3KSDO 4GI7A 2QG6A 3UICA 1YCGA 1A04A 2A0WA 5HIMA 4MSUA 4EG0A 4Q7MB 5BOSA 1YJCA 4OBXA 1PSDA 3NWOA 3VYSB 5EZQA 1GDHA 4MZXA 1UP4A 1E5VA 3OBBA 1TZMA 1P1FA 1E9FA 2WYWA 3WP1B 3Q7PA 3SNHA 4E1VA 1A88A 1F12A 3EZ2A 3HYCA 1GGJA 3NM4A 3QEJA 1RYYA 2XTNA 3JYPA 1YS9A 3KL2A 4I9NA 3I62A 4MVWA 3JD0A 4PAGA 4YRTA 5HMLA 4RSHA 3CKMA 3ESRA 4QWWA 4WKBA 5TB5A 2AFVA 3CX8A 3BERA 4UU8A 5IDYA 4HSGA 2JIRA 2J9GA 4QYMA 4BO6A 3CEAA 1Z13A 1O9BA 3GLVA 3K5PA 4G65A 3AKZA 2AJBA 1RW4A 3LBNA 1XB2A 3RRYA 5IKEA 1A1SA 3IJEB 4QUKA 3QHAA 1TZCA 3IQXA 4N8DA 4EABA 3ZU3A 2Y71A 3PEVA 4EX6A 2ERYA 2XA1A 1H6DA 4WADA 1TT5B 3AWDA 5DHAA 4IX1A 1VZ2A 4R9NA 1NY5A 1PFKA 3VZRA 5KC9A 2DTDA 1QS0B 1KAMA 3SS9X 3K9WA 4DG9A 2PRJA 1XBTA 3MBKA 4PPGA 1G3IA 3MT7A 2Z6UA 4CEHA 5JZVA 3HYLA 4P08A 3L8YA 2CLFB 4UREA 3UHOA 1AMOA 1ULUA 3B89A 2R8XA 5BUSA 1FVHA 1SC1A 4K6FA 4U5XA 1WCV1 1J0BA 4NLLA 1Y6RA 2F90A 5F1OA 3ZXYA 4EYOA 1N32B 4QOFA 2NV6A 1MA0A 5JFGA 3QITA 3QPVA 3AG6A 1VYTA 4MPRA 3FBTA 4RHYA 2SKDA 2WPNA 4WNAB 4EHJA 2FQYA 4TMWA 2BSQA 5FUBA 3MT0A 5AHXA 2EIXA 1IVNA 2IXEA 1B4DA 2YYSA 3EY9A 1OGYA 3R7FA 1FF9A 2VLIA 3TTSA 4UBMA 1AV6A 4G9GA 3I9FA 4H35A 4JQCA 1L7MA 4GL4A 4NMHA 5FL7D 2E0IA 2HU2A 2CWWA 1PBTA 1WPQA 4CTMA 3MJVA 3QI2A 1S1CA 1O95C 1R15A 4CR7A 1EVZA 1SC3A 3JQBC 1DADA 1EK6A 2WJIA 1BHSA 3DQQA 5COQA 5FWAA 1XZMA 5E8JA 2B6NA 2JCGA 3HJNA 1N0WA 4TZKA 1T1JA 1E0AA 2WWRA 4RA6A 3WYDA 4GWLA 3ZIAA 2WDZA 5DLDA 4ND8A 3OG9A 1WF3A 3LGSA 4QO7A 1J07A 1QPGA 4YJ3F 4MYDA 1GSIA 3VPHA 1CC1S 1TM2A 3Q5EA 8ADHA 5CITA 3DOHA 3FETA 4WESA 1WDMA 1A9TA 1PGOA 3ANMA 3UUFA 1FFXB 1PLKA 3FAKA 4Z9AA 3DDZX 2G7ZA 1VBFA 1NKVA 4JENA 4L9RA 5E95A 3U4CA 3C6MA 1TM7E 3N0XA 4MMYB 1C81A 3QY9A 1POXA 1P1RA 1VJTA 2J9XB 2XE8A 3DVRX 4HDOB 4UZEA 3X43A 2I3GA 4ZAGA 3GU3A 1KQ3A 1I0IA 1K08A 3CMMA 3MNFA 1D4OA 2GEKA 5C1IA 4GEKA 4B3BA 2B36A 4WZAE 2FNAA 3RFFA 1IZ7A 2AK3A 3ZWOA 2R2AA 1IK6A 1LLUA 1M73E 1U2ZA 2X5NA 3GLHB 1MX3A 2G04A 1FYWA 2NZVG 2YDYA 1IDOA 3GJZA 4GOOD 3SX2A 4DLBA 1F0KA 3EUEA 4QJ3A 3H0EA 1EESA 3TPZA 3U31A 1BH6A 2BM0A 4K9DA 2FUNB 5GOZA 3C87A 4E15A 2WQ6A 4EP1A 1SO8A 2OBYA 3UC5A 2Z58A 5I7VA 1QHGA 3A4LA 1NGSA 1GPNA 3L05A 4FFBB 1VIVA 2RAFA 4CM3A 5KREA 1XA3A 1CYDA 3HY3A 2UVQA 1X1CA 4N5HX 4AI6A 3CLUC 5CHYA 4YT2A 3ILHA 1J00A 1KK1A 2OHXA 3F3SA 4YP7A 5JNUA 4O4HA 1H8HA 1ZK4A 2BCJQ 3QUBA 4NPHA 3LXUX 2WD8A 2E4XA 2QUJA 3D4BA 3IHWA 3NBQA 2QRJA 2YNMC 4HAVA 3NTUA 4YASA 3REFA 4EKNB 4Z2AA 1UANA 2COUA 2GN2A 3WJ2A 2ECOA 5TGZA 5LMZA 2OOSA 2C96A 4WMLA 4WNCA 1S89A 3IR7A 3KV3O 3ROQA 5AKEA 5LYJF 5HA5A 3AEUA 3F3MA 3PQCA 2XX3A 2VPTA 3H04A 1QH9A 4GSYA 3ZHCA 3K32A 5BNZA 1C30B 3AXTA 3GUUA 6NULA 1E2GA 1KFCB 1PP4A 3HSKA 1EK0A 3DZIA 1N6LA 4GLLA 5HFJA 1QTQA 4YPOA 1HO3A 1UC4B 4KWTA 1GPDG 2P0EA 1FP4A 3LX5A 3UXMA 3OF2A 5FWNA 2VEOA 4R3NA 5J4LA 1T6ZA 2QB5A 3JQ8B 4Y9UA 5JCZA 3HY6A 3S1SA 4HAUA 4JC0A 1V11B 2B3TA 3W4IA 4RJ2A 5FORA 3NALA 3CM0A 1EP2B 2GAJA 2B8TA 2OENG 3ST7A 5AVTA 1MRSA 5T57A 3O0DA 4D9JA 3P2JA 5EZSA 4MARA 4IINA 5FBKA 1NI5A 1W94A 4NFHA 3LYAA 3O8DA 1AKWA 1NVDA 4Y2SA 1NXSA 1EXVA 1ZN8A 4LDQA 1XEXA 4C21A 4G07A 4E0BA 5C18A 3EFOA 5G0TA 4B83A 4BKUA 3VR4A 1QGYA 4M9UA 3TQIA 4HXYA 1WCXA 2FFQA 3QVUA 3HGQA 2PCJA 4P3XA 1BQEA 4PLFA 5IVDA 3VPCA 5J2UF 1I3OA 3X3HA 3AL3A 1R0CA 2ORYA 3F3KA 1OASA 3BBPA 2DPHA 3QX8A 4DLSA 3BD7A 4GXQA 3NMUF 4JN6B 1AK2A 4N12A 1Z4OA 1QQ6A 3ZLVA 3WAGA 3I04M 1DDOA 4TTVA 1X86B 2MYUA 2NT3A 4BP3A 2OBLA 2GK4A 3A37A 5DHTA 4C4RA 2H0AA 1E8MA 3MCAA 4U5QA 3V2IA 1BMFD 1N5KA 1M10A 1U3UA 1XMSA 2KWIA 3I2YX 4DOMA 2QTZA 3N5KA 4DWWA 2B7LA 5D3MA 2IEDA 4MV3A 2IUYA 5HJEA 2P4UA 5JI2E 2ZKLA 3OWHA 3Q9LA 4HDMB 2OLEA 3B1KA 4NZ9A 3CURA 2P75A 1RJDA 4ARZB 4RAOA 1FJXA 1U0LA 3OPYI 2JLYA 2ZAGA 3CE6A 4BUZA 3HNRA 2BMEA 3C3CA 4LMBA 3WL4A 1C9NA 1CQIA 1G0NA 4HDCA 4B8YA 2I91A 4JY7A 5KCMA 3QJGA 1T8PA 1WKBA 3HVKA 4MQ6A 2OE2A 4TTSA 2SNIE 3RS0A 4DCPA 1H9AA 4JYAB 4CKCA 3IA2A 3PYMA 5AWFC 3G13A 3DONA 2F2TA 4R8SA 3SKVA 1MO4A 3MGKA 3R44A 1G17A 4MCIA 3PR3A 2CMGA 2JFXA 3VX4A 2F8TA 5JDCC 1PN3A 2CLDX 5F5XA 4CM4B 4G0ZA 3CUSA 4PG5A 5DBGA 4NBKA 4EFLA 3MHPA 5IHXA 1PS8A 2GBLA 4RFLA 1MNQA 3SZUA 5CFQA 4P4UA 4EVQA 4XGKA 2IRWA 3WDSA 3M6FA 1X39A 3OE7D 3ORSA 1ECGA 2AG5A 2BUCA 4D6XA 1TI7A 1JLLA 1KJYA 3KC2A 3OURA 2KMLA 1CS0A 3HRHA 1TYCA 3K4QA 1GAJA 2J0SA 4CZ2A 1VKHA 2ZRKA 3K9NA 4NOMA 1O5TA 4QICA 4R2HA 3HFGA 1C3OA 4OV6B 4BO4A 1LI7A 2UKDA 5C3UA 4EEXA 1T9ZA 1LLFA 2PSEA 4GAEA 4ICIA 2Q5OA 2QL9A 4IV5A 2DQ4A 3H5RA 4LG1A 5FHQA 5K3BA 4RJTA 1GYPA 4J8PA 4TM7A 3MJFA 3AL0C 2BLNA 3O8LA 4E08A 1Y6GA 3L1IA 2E4WA 4DKXA 1CUDA 1PEYA 5AM5A 4YJ3A 3USES 1QIFA 5HXAA 3DE5X 2YWFA 3H1BA 2G8NA 5K0SA 4U2GA 2AYZA 4F5EA 2WBLC 1U2EA 3TB6A 4ERXA 1JT2A 3HZHA 1QG6A 4TMKA 4W8HA 1KDZA 1BROA 4TV8B 4GR9A 1OJLA 4ENQA 5B7QA 1LA2A 1U2DA 4CM8A 4BWVA 4IOLA 5D1HA 4PZEA 1CV2A 3L7KA 1EDDA 1SM4A 1P4HA 4MPPA 1G0OA 1MT0A 1XHEA 2NAPA 4ZYTA 3SSOA 1GG9A 2W5UA 3C8MA 4MQEB 3S8MA 2BYTA 4ZI2A 1EVIA 1OBHA 2F59A 2R1TA 3KXKA 3NEPX 3QJYA 3OESA 1W4CA 1EGHA 2JJ2A 2WVHA 3ZE7A 3OTOB 3QVGB 5DCYA 4OJTA 2EJUA 1BJRE 1TMOA 1YONA 2PG3A 3R7NA 5KOHA 1S8FA 4IXMA 4LC9A 3RIMA 3E22A 5FBQB 4DRYA 4ZK2A 2Q8NA 2WJJA 2C8JA 3ACDA 3HKCB 3KYIB 2ZJ5A 1UJMA 3O03A 4MV1A 3UMYA 2GCPA 1WSBA 2YMLA 1V1MB 3RROA 3KPYA 4ALKA 2DC1A 3WNDA 1MIOB 1UBGA 3X2SA 3FY4A 4F9EA 3AVUA 2TSYB 4US0R 5EE3A 1YJQA 3EDYA 3OQHA 4PZDA 3WBFA 4L0DA 1BKYA 2WRZA 1UMDB 1IWPB 1ADGA 2PX8A 3M33A 3A4YA 1SBQA 5JD3A 2TMGA 4LEIA 4CT5A 3G1UA 4MKHA 3UKJA 2P4EA 1W9HA 3CSUA 4ZV9A 3ANTA 3SGLA 2O2JA 5LBUA 3KVYA 2LKDA 4HH0A 4XDGA 5LYJA 4LI0A 2DUMA 4ECAA 3O8CA 4UUMA 5KVVA 1BXGB 2ZSHA 4R5HA 5HE8A 3OCVA 3HEBA 2CLKB 2AC7A 3HZZA 3ECCA 1BFUA 3K2IA 4R8MA 4XIGS 2A7QA 3UEOA 4EKEA 5IHPA 1O95A 1F6WA 4PGMA 1PR0A 3ORQA 5EHNA 3JQBA 2P62A 3NWJA 5AOCA 3IMFA 5EMKA 4AX4A 3LG2A 3ZN2A 1CUAA 3ZHRA 3TSOA 4CXMA 1RM0A 1H85A 2W2KB 3KE9A 4QM6A 3PQ5A 3D43A 2KX7A 4TLEA 4ZVMA 1HUQA 1E4OA 3PCRB 2VDPB 4Y9RA 4WZAA 1DUIA 3T5TA 1MF7A 4TL6A 2X5XA 1DEXA 4M49A 4N41A 2ZIWB 2C78A 2RMKA 4GW3A 1Z62A 3HYSA 1OLOA 3C3YA 3QG5A 2IEBA 2PWAA 4QDZA 1NQ5A 5THQA 1JJIA 3IL2A 1L5NA 1R4ZA 4FLFA 4WLFA 4B87A 3CVXA 1NMZA 1N6KA 4PO3X 3PNYA 1JHUA 1NE7A 2QK4A 1MGPA 4JJAA 1BCSB 4PC3A 3NX4A 3TAHA 5J2UA 4AROA 5FQOA 3O8QA 1OLUA 4NOLA 1VE1A 4U4AA 2Q0HA 5EJ7A 3ADPA 2MDTA 2M6LA 1RFGE 2PSSA 4I5IA 3GO4A 4BC0A 4ZAFA 1Z2OX 3KFVA 4R98A 4TQGA 4EPXA 3CVVA 2BWJA 4RELA 1XXLA 5BPFA 2B7CA 3WV4A 5HUQA 3NAQA 2J1LA 1KFJB 3NUQA 1WXEA 1NX6A 1Q6YA 2ORIA 2VTKA 2B8WA 3HRIA 4FU0A 1YFZA 2XWSA 1J8YF 3N8DA 1SD2A 4KWCA 3BGWA 1PWHA 2O7QA 3DMTA 4Q9HA 2EHJA 3EVNA 4MRMB 3R7AA 2Z6QA 3ONVA 3ABRB 1DRVA 1EM6A 2VRCA 3FYHA 4IHAA 1IZZA 3T5DA 1R4MA 3B8HA 4EGCB 4M98A 1DRUA 4MKXA 3P27A 3U4IA 4DLKA 3OJFA 2QTVB 3ZJVA 3LECA 4JLWA 4PIMA 1N5DA 2CK3A 4JJGA 3ZEAA 3UGJA 4B3HA 1MORA 4R9SA 5A5DA 4OREX 1GGNA 2IUTA 2NAFA 3HKDA 1Y5IA 2Q5FA 4HD8A 4J1TC 4CM9A 1X77A 2PQ2A 3WYEA 2Z98A 2WHPA 1IXSB 1U1CA 1DIGA 2CJYA 2ZBPA 4AMZA 4HAIA 4XM1A 1KSHA 1GPMA 4XSVA 5DO9A 2QRLA 2AV6A 1OJ7A 3HJUA 4H15A 4JS0A 5LYYA 3QP9A 2YNMA 3L6BA 4HQ0A 4HTFA 4AUKA 5E1BA 3BQ9A 1CKEA 1ZMTA 1P9NA 1S9HA 2HA7A 2J0UB 4D7AA 3AF2A 3LUBA 2COEA 4BBZA 4TYQA 1TLLA 1I2CA 4KGZA 4CGYA 3F74A 1GRRA 4XX0B 1J5XA 2PMFA 1IXRC 3MT9A 4OHUA 1E3WA 2BGWA 2G1KA 3CZCA 3G5TA 1I33A 1LRKA 3L7YA 4EHFA 2YXDA 4HYQA 1BQ3A 3V7NA 2PGIA 5LIPA 3T0IA 5FLYA 2R79A 1GPYA 1QVAA 3AI2A 5ERYA 1U11A 3CUTA 3FIUA 4UQLA 3S99A 5L4LA 3BHMA 2YYAA 2VH1A 3LA6A 3PWKA 1HMYA 3NBKA 1DQZA 3ZIAD 3GCWA 2IC5A 3RASA 5FPKA 4WZBB 3U13A 4EUFA 2ZYVX 4J0JA 3TZ6A 1F2UA 3V4PB 2BIFA 3IESA 5EUBA 3A1SA 3U44B 3ZWAA 1VIMA 2AN9A 5BSTA 5H3HA 4CCAA 1T9GS 1Z4KA 1HLGA 2BFOA 2FYTA 5KYVA 2E89A 2HQRA 5C1PA 1U63A 3QVXA 3PC2A 5AOVA 4Q3CA 1JKFA 3FFAA 2FSIA 4UE6A 4BLUA 4AQYB 1P6UA 1CJUC 2QBYB 3TGWA 1GN8A 1T29A 2O7RA 3L6OO 4LHZA 4YECA 3RV3A 1BFKA 1RADA 1ZUNA 3FNBA 3LHDA 3MJRA 4UFOA 2QLMA 1M72A 4WBNF 3AFIA 4JX8A 2C4KA 4C76A 4B7CA 1NLMA 4OSOA 4CKXA 1L8QA 4FYYA 4Y1GA 5AHOA 3PT9A 3EVZA 3IVCA 1IBKB 5LA6F 2ZROA 5LZ8A 1L7NA 3M9XA 4GICA 1M5RA 3C5WP 3HDGA 2O1SA 4NEQA 3E58A 5MDHA 3HUEA 3F4LA 2ZBUA 3JATA 1DBIA 1C41A 5EE9A 1GR1A 4LN1A 4RSMA 1I7DA 2CJWA 3UK0A 4AKIA 3L5OA 2ZCVA 3NHFA 5C5DA 3GUYA 4HDRA 2VUIB 3SJAA 1KI1A 3HXLA 1YULA 3R5JA 1P7YA 2E49A 3FVRA 3ZDFA 4BQNA 6AT1A 3IBYA 4B31A 3D8UA 4WFJA 1WG8A 1MTZA 4HGZA 4E4YA 5AVWA 1T3HA 3AI3A 3U7QA 4CKWB 3KEMA 4BMOB 1NUUA 1HTBA 3IVRA 2P2LA 1LX7A 4R2KA 3PKIA 4NHOA 4PFJA 3KKQA 3UJAA 1H8HD 5ESWA 1UBRS 2FEPA 1MV8A 1EX7A 3WTCA 3MQFA 1ZVMA 3PXUA 1WB5A 3FYCA 4NH0A 2C2WA 9LDBA 4U7DA 5JZSA 3AGQA 1P39A 1H6AA 1XMOB 1NG9A 3DLIA 1ZW6A 4B35A 3IAS1 5TPWB 4CLHA 4RPHA 1YU6A 5EA2A 2HTFA 3C41J 1XF9A 3TTXA 5CAEA 1IQUA 2JLSA 1KXZA 2Z2ZA 4XI9A 5JDCA 1Q19A 3PJDA 4J0QA 4AG5A 3G85A 1KVQA 1IOZA 2XLBA 2HCJB 1IRIA 3JVUA 1GN9A 2PJZA 4LY9A 5DLYA 3ZKWA 3GR6A 3WB0A 4F3KA 1CUZA 5H3LA 3NFRA 4A9AA 4WXYB 3OQVA 5ED0A 4B6EA 4BMYA 3CR8A 1MCZA 2FFBA 4NK5A 3Q0TA 3H1GA 2BMVA 3ZV5A 3U4QB 1NPYA 3UT5A 1GDDA 3GLHE 5EIWA 2BGGA 1JKXA 4TXMA 4YIKA 2YOHA 4OH1A 5DU2A 3NYWA 1J0EA 1Z5GA 1KNQA 1Z06A 4RQUA 2TMYA 2O6HA 4UDYX 3RU9A 3LFHA 5CA0F 4AO8A 2OXTA 3V48A 3QYPA 4XWYA 4ER7A 1Q57A 1WZEA 2WQ7A 2N1BA 1ISSA 3IDSA 3DKVA 1SAYA 2QQ5A 3EHEA 2VBIA 4FDTA 4UXJA 3RUAA 1RWVA 3U4DA 3F49S 2UZ3A 3KJEA 4H3HB 3VR4D 4CLOB 5BOSB 1EG2A 3DHWC 4B85A 2YS7A 5CFNA 1HDGO 1UKVY 1V16B 4PANA 3CNBA 3K5IA 3O2SB 4IVNA 4GRDA 4RE5A 3V7WA 4E31A 5HKOA 3KTFA 3OFKA 3ZDAA 1XZDA 3HO8A 1CY0A 1E1QA 3H1AA 1NN5A 1VE5A 1RWKA 1M6NA 2P35A 1NLZA 2XUPA 2ZB2A 4UZFA 5C37A 3LK6A 3MINB 3LLUA 2EKQA 3MRXA 1CUSA 4X7PA 4WNIA 4C5CA 1XFDA 3FDIA 4RKRA 2VPWA 3D6MA 4DA6A 2A1TS 1PK9A 3EXAA 1WZ2A 1FRZA 4B4KA 5DLQC 5CEEA 2MR6A 3ICCA 1GRVA 4FUQA 1N5LA 1GSAA 4YLYA 2HBQA 5CDTA 2GESA 3VH2A 2JKZA 4ZJZA 4O6VA 5EYPA 2VEDA 1FW6A 1JJ7A 4TWJA 3KOWA 3EXIA 4F72A 4XQEA 2QY9A 3T61A 4HRAA 5BSKA 13PKA 1RYNA 4RD2A 3DOCA 4B0OA 4B33A 1HT3A 3ADOA 4GEGA 1FUYB 1MJGA 1RE1A 2BSAA 3AUTA 4UHJA 2Q9AA 1RRMA 5EAIA 4N5DA 1QXSA 4RJKA 1YNSA 2PLRA 3BFVA 3C3DA 1SKBA 2CNWA 2ZOSA 1WY7A 3L6CA 4J4TA 2YVAA 3I09A 1E2PA 1RHJA 4LJ6A 2UYOA 1U6JA 4R51A 1KYYA 3GJSA 1KJIA 2JLQA 4XVRA 1AA6A 1SU8A 4MI6A 4L74A 2Y68A 2Q3LA 1WPRA 3N2IA 3UQYS 4GWGA 5A6SA 4NDNE 4KXWA 1GQFA 5A02A 1FY2A 1N1DA 2C9ZA 3RC8A 2WM2A 2XD9A 3NVMB 3RTAA 4OIMA 1OXBB 3O21A 1VXRA 3TZCA 3W6UA 4BQIA 4BFUA 2IU6A 4P93A 3DKIA 1Z5VA 2AI3A 3LHKA 4ZJPA 2DBYA 3QXXA 2FX3A 2JLZA 2J87A 4HZUA 2MCFA 2ON6A 4H18A 4OQFA 4LQ4A 3RUDA 3WRYA 5JC1A 1R5JA 4R1PA 1I7SB 1CIVA 4N5NA 2LTAA 4OATA 3WISA 2IH5A 3ICPA 4XWOA 2ICAA 2L18A 4LOHA 2VYCA 3BGDA 3OTHA 2MSWA 3ZHZA 5EIBD 4Z7NB 4D3ZA 4HMQA 4CV2A 5FOQA 4IDPA 4O2AB 4NYJQ 1ODCA 1O96B 4DEYA 1BKSB 5JNWA 1FRNA 3HABA 4LNUB 1QE3A 3BL5A 2QM0A 4DW8A 4Q9JA 5IJ0A 1SZJG 2FMIA 2IXBA 2J07A 2QJWA 2ZVQX 2SHKA 4RVNA 1DG3A 4FGKA 1DTWA 1X19A 2Q3FA 3RG8A 3AC0A 2MSEB 5HKBA 3N9IA 4MEJA 2BUBA 3REOA 4R1MA 1YK0A 2W2TA 2QTNA 1HPLA 1EFVA 3NOVA 1SZPA 4X94A 3UJCA 1L7DA 4WBNA 5FX2A 5KUTA 3LHFA 4MMZB 1Z7EA 1U2RA 2BKAA 2HU8A 1FFEA 3V3KA 1II8A 4B3JA 2JFFA 3BS4A 4YXFA 1ORRA 1QNFA 2XMRA 3KZMA 5LA6A 3OH8A 2JJ2D 4L5YA 4H7HA 4TS9A 3GRVA 2DPXA 3EZLA 1Q0TA 5CDFE 5GQSA 3BAFA 3E0XA 1VG9B 5HEKA 3OZSA 3JYQA 1DQNA 1T9HA 4QUEA 2AJTA 2J3JA 3I23A 2A5YB 2IIVA 1BE8A 1RE0A 3BSSA 2GEJA 1ABEA 1CEYA 4PCAA 1PNOA 2GAAA 3R5XA 4OP2A 3BA6A 2UZ4A 3UAZA 4X64B 1SVIA 1O6GA 3B38A 2R8OA 4F2GA 3ZK7A 2GYWA 1EM8A 2XVMA 3DL2A 3IH5A 5D01A 3JZMA 5KAMA 1CEEA 2B1IA 3FYUB 1OVGA 3O8OA 1FSSA 1B76A 5I7EA 5F7ZA 4J1TA 3V8BA 1RWOA 3KQKA 1AZLA 3ZWMA 3LWBA 1ZIDA 3CCFA 4Q3LA 1CDZA 1CX9B 4BPRA 4ZQHA 1Q15A 1JEQA 3W7VA 4D6PA 2VXYA 2AUTA 4TLLB 2DXIA 1GFZA 2IEYA 3V6LA 1XN1A 3FPHA 2FFJA 2IWRA 3LWNA 2X2PA 5KKAA 4NSNA 2D1SA 3THWB 3EJ6A 4G1VA 4INZA 4S3MA 5EPEA 2Y6VA 5COBA 3TTTA 3ZY2A 1ONOA 1WUKS 4TV9F 4QG3A 1FP4B 3CBGA 1JBEA 3Q0IA 3M8KA 2ZJFA 4QKQA 4Y6PA 5F64A 1O95D 3L0BA 4CQLA 3A3PA 4I1VA 1YXMA 3N2LA 5K0NA 4E22A 3IBCA 1VXOA 3DW1X 4RK4A 1R6DA 4QLAA 2HSGA 1NYLA 4D44A 1UXHA 3BK1A 4BBAA 2XWBF 3E70C 3AEKA 3DFZA 3OZIA 4JR2A 2PXXA 2E1RA 1X1QA 2E6UX 1PJSA 1XC7A 3ELWA 4X84A 1AO0A 4DCJA 3IRVA 4JCCA 1XTJA 1Z4PX 2Q0QA 1I32A 3KLMX 121PA 4TKLA 3QFTA 4H08A 5FA6A 1J70A 5KQGA 5CA0A 1AKTA 4RLSA 5EI5A 5FBZA 5FNVB 3EFOB 2PZBA 4RD3A 4IVPA 1UDRA 2EC5A 2Q1YA 4X95A 3V8QA 4B82A 1NLFA 2JD0A 3KUKA 2K2WA 2NACA 1D1QA 3RO7A 1UK9A 4Q19A 3N2KA 3R77A 4DLTA 2A0UA 4X60A 3EXHC 5TXGA 2DQSA 1D2CA 2AMLA 2C82A 4NAVA 3G0HA 5FA8A 1SPBS 2B83A 4PLYA 2B3DA 4DWJA 3PD0A 4E5MA 4Y30A 2VP0A 2D2IA 1QH1A 3VMMA 3BIXA 2OO3A 4XFDA 1PQUA 5K8UA 3SEQA 2CV1A 4JJIA 4B1FA 4MMXB 3ROEA 2MMGA 4ZAVA 3SSNA 5TJ9A 3KAKA 3RLIA 2QD4A 4ZI7B 1Y4DE 2B8JA 2HDWA 1LV8A 4PHFA 2VRCD 4MRSA 3RJMA 2D00A 2PAAA 3UAGA 3WNQA 2H4JA 3CEPB 3KAPA 4OYYA 2IZ7A 4J7CA 1E9BA 1WP4A 2ERCA 1Z16A 2VO1A 5LZ7A 3NVKI 2NPIA 2QG4A 1QQ5A 3FUCA 4KMMA 1CQIB 2HLNA 2CK3D 4LZJA 3C8ZA 4AKEA 1THMA 3ER9A 2CDNA 1VL8A 3OT5A 1SUDA 4KPYA 1M6WA 2BGIA 2REQB 4BQOA 1BXRA 2YVLA 4YALA 4CM9D 3Q0EA 3DTYA 2QVZX 3CLUD 3JQAB 4E6PA 1PFGA 4LWZA 2H4XA 4FCCA 3RHZA 3OZUA 2UZ0A 1Z4LA 1KR2A 3PX3A 3G0CA 4H31A 3CTPA 1QKIA 4J0KA 3NIFB 2P40A 3CVJA 2YNMD 2WYHA 4DIBA 1G8KA 2GAOA 1U9ZA 5DHUA 2CB0A 4KIWA 3FPJA 1LC3A 3H87A 3GGOA 4AJ9A 1JHPA 2WMOB 5CD1A 2JEZA 1JFSA 2D8MA 4NNOA 4UE2A 1M8KA 1AKUA 4CCSA 1KMIY 5KYWB 5ALHA 1YBMA 3GPDG 1NUHA 4PYNA 3LIPA 3TQRA 4ZTZB 2Q0XA 1Y1PA 4ZC8A 2W83A 1JLLB 2Q3DA 1OI2A 4P35A 4K6MA 4FHEA 2QV0A 3NHSA 4NBNA 4O1HA 4GP6A 1IULA 1Q2UA 4FHGA 1EVKA 1H65A 1Q20A 1U2PA 2JK1A 2VPIA 3DOOA 3T9FA 2CYBA 2V7WA 2QZPA 3Q15C 2VLBA 3IAM6 3TFQA 4DS3A 4DR5B 2YOGA 4K2HA 4FBMA 5HILA 3QOXA 4DSOA 2WJGA 2XE7A 3TE6A 2ZT7A 3L7IA 4IHQA 1LPMA 1W8DA 2PVSA 4QTTB 3I4CA 2XWJI 4ZOAA 2UYGA 3ADBA 3SKYA 2ZR7A 4UCWA 1Q0SA 3RRXA 2AS0A 4ZEWA 2PLNA 1V5FA 1RKQA 4YJ3B 3IP5A 4AZ3B 3W2EA 3MWGA 1AN9A 3G8AA 1CVLA 4C4AA 1WZCA 4MVXA 1V7QA 1DELA 2P6MA 2VZ0A 3DGFC 3GYGA 5CURA 2ZI3A 4LF7B 1E4YA 5ALXA 1MC8A 3WK5A 4CUKA 2ZREA 4O4JF 2OCLA 4BIMA 5EHXA 4CEJB 1GG5A 5JHGB 2ILVA 3ZYCA 3L1HA 2FY8A 3RYCB 1OY1A 5ALRA 1JPNA 4CM8B 5GMOA 1YIOA 1J42A 3HCBA 2ZB7A 4WJKB 5CGQB 5BMVB 5L40A 2LPMA 2PRIA 1LGYA 4WERA 1GYQA 1VE7A 4OB8A 5TF4A 3WIUA 4CG2A 1II0A 3UMSA 2PUDA 4WCDA 2PU7A 5DVZA 1JPVA 4AU1A 5CCEA 1H5NA 2VPQA 4LCEA 2WZDA 3QMPA 3QZUA 3WMXA 3H05A 5LMCA 3IXMA 4LHSA 1DWUA 2Q5QA 2HYDA 3NT4A 4A36A 1JW9B 3PCXA 3MSXA 3K2BA 3QFSA 5HP4A 2L69A 3H84A 1C7RA 2Q27A 3K9LA 1P9RA 1UBNA 4XCQA 2ECQA 4MI3A 3CLTC 4B75A 1YB6A 3QUQA 3WHIA 1L5KA 5JXWA 3IKJA 4DA9A 1FS4A 4U6QA 3WYBA 1ES9A 4HUJA 4RHEA 3BCRA 3KTOA 4IS2A 4AN0A 1FFGA 2Q50A 1MG0A 4JB8A 4LRUA 1XPJA 5DW0A 4ZOLB 1N7HA 2Y1GA 3O74A 4QIHA 2HMSA 4F38A 3OY7A 4AG6A 1W52X 1XRLA 3LQ2A 4YH1A 3IIEA 4GYJA 4GKJB 3UV7A 1Y98A 1KJJA 3V4LA 1GILA 3KPVA 3ET5A 4GR5A 2WINI 3JD3A 3NRCA 3NJ4A 4R84A 3QFFA 4QEZA 4UTPA 1B1CA 1JL3A 4MYRA 5IN5A 3N7UA 2EZ9A 4UJ5A 1FMTA 1KU0A 1U2TA 2F43A 4TV9A 3BVPA 1FVXA 2AHOA 2PMWB 3QFRA 4ZODA 1O0CA 1QKKA 4TXLA 3H2BA 1AKVA 3SHVA 1ZMOA 4MKFA 4Y6QA 4U0JA 3WXBA 1Y34E 2ZRCA 1ECJA 4MUIA 4IZOA 4JEMA 1OAKA 4MGYR 3IB3A 3FNFA 4R01A 4D42A 1M6YA 4DQDA 1FDSA 2J9FB 4G8JA 2IPOA 2FMHA 3QMWA 2Z8YA 4LGCA 4WY2A 3WYAA 3E81A 5HQ3A 2Q4RA 1HYBA 1XQ1A 1EUCA 2Q8QA 4WY8A 4RY9A 5FBLB 4ZEXA 3UXHA 3W5IA 3P0RA 1W85A 2ZSFA 3KUUA 5LQKA 2JLXA 5T3YA 4IF6A 2Q07A 4YP5A 2FUG1 4D0LB 3OHSX 1E4EA 1R2QA 1S96A 3ZC3A 1VPWA 1D2RA 3WLQA 2H18A 2P9CA 2V7XA 3GLKA 3JR3A 4G63A 3OQOA 3BUSA 1A76A 3PHHA 5BYAA 2VNJA 2CXRA 1LB1B 1WV0A 3PE6A 1WM1A 3NDPA 5DISB 3TOXA 4GDMA 1JF8A 3VU3A 2LCFA 2NO4A 4NZNA 3W5DA 3CQ9A 4R8LA 5DM0A 4Z51A 5LQNA 2R6AA 2VP4A 2OCBA 1G8SA 1A8HA 5KWIA 3HMQA 2C2XA 4FHZA 1LNSA 2MWMA 1W0JA 3C3AA 5IUJC 1Z2CA 3PPXA 4WFKA 1ZWLA 2OGZA 3EBLA 2XDAA 5LP6C 2PUEA 1M0TA 2G71A 2QUAA 3BFKA 3ETGA 3HCNA 3K6KA 3PHLA 4OQEA 4ZVSA 1PYDA 2IYAA 3LY7A 4WGFA 2JFYA 2GFQA 4JROA 5NLLA 4DGSA 4DHWA 1W2HA 5KJEA 2EOAA 1TX4B 3ONNA 1N2XA 1OLXA 2P9YA 2CNWD 4M7PA 3C16C 1Z0ZA 3DL0A 4CCYB 2H1HA 5ILOA 2BVNA 1I10A 2WDPA 4MIYA 1KMCA 5LKAA 3AR8A 4B6QA 4R31A 2GZ1A 4Z86A 3UWMA 5CEFA 4UARA 2OYRA 2VAPA 2C31A 4Y3UA 4AXXA 1UXOA 2C3UA 4EPTA 1VL6A 2PH7A 3ZWXA 3ETCA 3LPCA 5CT4A 1C8LA 3JWPA 4GC5A 4EW3A 5DM1A 4HT3B 2WUGA 1BGWA 1EFCA 4R0VA 3UIEA 3ZJ4A 3N6XA 4LZPA 1CR6A 221PA 3ITDA 4H4CA 1MJHA 2JAWA 1TO1E 4OL9A 5E7IA 3T3GA 1XDGA 3MOSA 4GD3Q 4QDKA 2H06A 3SC4A 1W5FA 4EG6A 3D5QA 1OAAA 5BWCA 3GH3A 3ROFA 2HNBA 4I50F 2JANA 3RK4A 4C29A 1NW5A 1QE5A 1TD1A 3HUTA 4RH3A 2HW8A 1YTLA 1HTWA 3W9YA 4PG6A 2EHDA 3I42A 2GT1A 3GAAA 4NULA 2G72A 4KODA 1ZN7A 4AZ0A 1Q14A 5JU6A 4FOLA 2PMKA 3WGIA 3MCWA 2EP8A 3O3NB 2R1UA 2Q1XA 3EF0A 3Q5GA 2BMJA 4DNQA 4B76A 2HIGA 3PZRA 1GVHA 2JI4A 2X58A 5KOJA 1OC4A 5IZCC 1RACA 3CU5A 4BNKA 1PLJA 3JQGA 3B78A 1YS4A 3GDFA 4PZCA 4EF6A 1W36C 1WCYA 3S27A 4O4JA 3EXHA 1KAHA 4RTKA 4LF8B 1THZA 1BCRA 1GZ6A 3L18A 3KXDA 4O2BB 4A8HA 3WNZA 1Y1QA 2ZAIA 2V6BA 1CR1A 1NUPA 3D1VA 2XT9A 2PH3A 5I3ZA 2K7FA 4BFWA 4RPJA 3ME5A 5TARA 3ZE9A 1E3EA 2Z9CA 2QGFA 4Q6WA 1WBJB 2GXQA 1P4SA 4I4TF 2VK1A 2A2ZA 1YCDA 1CTQA 5J1SB 2EWMA 1F9EA 2CJWB 2DFTA 4F97A 3DL7A 3V8PA 4OFWA 3MJSA 4YI3A 4ZK6A 1TK2A 3BTSA 4Q21A 1SCUA 2WTNA 4ZVVA 4XLLA 4EW1A 1PZFA 3OJOA 4MWOA 1MRZA 4MZDA 1T3SA 3SSAA 2ZIXB 5CB4B 1NQOA 4OU5A 3K9CA 1OH7A 3U7QB 1DX9A 1U02A 1YE8A 2GVZC 2OGSA 4MA0A 1JTFA 2Q6LA 3DO8A 2OHFA 2QMQA 2RK4A 2Z4SA 5C31A 5D6NA 4DDWA 2FZ4A 3DF9A 3TRIA 4LRSB 2AF4C 3LL7A 4XEUA 1EIWA 2ZE5A 2ORED 2X8LA 4DMRA 1NPTO 1P73A 1QVWA 1WUTA 3DH0A 3KLOA 2ZJ8A 3NHRA 4NE2A 1IJFA 5GV7A 5C32A 2F3SA 3TLEA 3GBSA 4P92A 1NJ1A 4R9VA 3JAWA 5LU8A 3ECSA 1VGQA 1G5IA 1UT6A 1B0UA 2J5KA 4IKPA 3DV0A 4RZIA 1VKOA 5CAEB 2PRZA 2QVGA 2WKRA 4CFZA 2RIRA 1Z88A 1DE0A 1H2BA 2UYQA 3WYNA 5KTMA 3FNGA 1D9ZA 3MWLA 3BDIA 2BM1A 3ILVA 2NU8B 2P0YA 3KJNA 4FC7A 1YUMA 4BU1A 4J3NA 2CNLA 5KC8A 4RTSA 2XA9A 4EPYA 2GNOA 4M87A 2F55A 2JGKA 2P8JA 1AX9A 4ONEA 3UT5B 1E4VA 2CDCA 1U4SA 2V6IA 4FLEA 3FRIA 1K7CA 3FZGA 2EWWA 4ZHQF 2ZUEA 3QNUA 2D2XA 3CGWA 2NTYC 2RGEA 4YJKA 3OCYA 1I5OA 2HK7A 4NEGA 3QU4A 4QC2A 2FKAA 3U7EB 1ZI6A 3CF4G 2BGUA 4IH9A 4LVCA 4WEQA 4YRJA 5IU6A 1J6UA 4CCWA 2XCRB 1S2NA 1OB5A 4QXQA 5ITZB 2W6CX 3NANA 2B99A 2WB4A 2R00C 4D3YA 4NPCA 1GLNA 2WE8A 4CKBA 2OQIA 3DXXA 4C5AA 2GD6A 3A2MA 1J90A 1XD8A 3PGXA 5A7FA 3QU9A 1QM5A 3TBFA 2C77A 1ESNA 3LT4A 3VUFA 1B0ZA 3CUUA 3FN4A 3PKJA 3FKQA 1NNLA 1NI4B 1ENYA 4RV5A 5TQ0B 1DEHA 3A1TA 2G0NA 1U3WA 4I55B 2C5LA 2ZE6A 3BHJA 1X74A 1QKJA 2HJWA 1TPZA 2WTBA 4Q05A 1OKKA 1VCNA 2Q99A 2QUIA 3PENA 2YZGA 2QAJA 4KFCA 1NU8A 2QTGA 3BPSA 3I2JA 4IF4A 5A04A 2JJ8A 2PUTA 2XQFA 1NVGA 3N8KA 3R3SA 1YV9A 1BRTA 4QJBA 5ESXA 2QLJA 2PD3A 1EFDN 3DTTA 3ZU4A 1CQPA 1XTTA 1NMYA 2AOXA 4M0FA 4D9EA 2UVDA 3PWZA 1U3GA 4TTJA 5F3DA 2JGFA 1UODA 3GRAA 3WGHA 1VBNA 2VK4A 2EFHB 3CNOA 5AYVA 3JWHA 5C7LO 4F6CA 1JHVA 4BO9A 4RIFA 1GXSB 4G0UA 5HK8A 1CJVC 3B53X 2YWEA 2QJOA 3GCZA 3L7OA 4JP1A 4YMUA 3AJ9A 3K8QA 4OXIA 1KYVA 1G8GA 3GMIA 3QY0A 3JR7A 3ZY3A 1BMDA 4EB6B 4KQIA 3DFMA 3ZIDA 5JATA 1J0CA 1WB4A 3JD4A 4IZ6A 4Y0VA 1YHYA 1B00A 1Z75A 4CUZA 4D81A 4ED9A 1JEYB 1WVGA 4GO1A 4IJMA 1J7JA 1Q1QA 2H54A 2XUFA 3HUUA 4K5QA 4Q1FA 1H5QA 1OZ0A 4BNJA 5DBFA 4HQFA 1ZR2A 1PQYA 1YDMA 4BRZA 1CETA 3W5AA 2HGZA 4FDUA 4DNFA 2AZXA 3DXYA 5GIPE 1Y3DE 1IONA 3RIHA 2PXCA 3AXSA 3LFUA 4WXHA 3PC7A 2FG5A 5AQEA 1NTRA 3KB1A 1AK1A 1WULS 4EUNA 1JXQA 4KWEA 4I50A 1U3TA 2HK6A 3UY4A 2JFHA 4I81A 1IZ0A 3B5IA 3WMGA 1CD5A 4XUCA 2YVUA 1XPOA 4L4SA 2AX3A 3ESDA 4TROA 4PAWA 4ZV7A 3G7NA 3T52A 3WLPA 4B5KA 3GNSA 4KR6A 1JS1X 1J2RA 2GN0A 6ABPA 2JAQA 3WMWA 2VBCA 1DO8A 1A7KA 3BL8A 3C6XA 3K5WA 4W7SA 2PL3A 1VLJA 2R6FA 2P2YA 4OHOA 4WBNB 1DCFA 3IUNA 1LWNA 2R1VA 1G291 3QEKA 4LXUA 1C8BA 4W9RA 3VSAA 3KSZO 1X1TA 4J07A 4ZVQA 2CLOB 3PK0A 1I6LA 4CMGA 1OWOA 1SCJA 4G89A 5K4AA 2ODWA 4LRQA 1WB6A 2X7HA 2X41A 4YX9A 2DAPA 2WF9A 4O29A 4I4TA 2W42A 2NSDA 7REQA 4NOJA 3NTQA 5JDIC 4KQ1A 4OLFA 4TZ6A 1R0LA 1UM8A 2I1VB 4KQWA 4WIAA 4P0TA 1XCJA 1UK8A 4HV4A 4IS3A 2J59A 2IS1A 2AXQA 4OLJA 2Y77A 1UZUA 3SDSA 4A0SA 5LP6A 4QHTA 2YWCA 3Q6IA 2ZYDA 1OIXA 3O8OB 4KYVA 3FTFA 4RBNA 3V1UA 5AW0A 3NEAA 1D03A 1PGQA 4FDAA 1U0GA 2D0IA 4UMEA 3AY0A 3I2GA 4DR7B 3W5JA 5BQPA 2OSVA 4WLVA 1KXJA 1AD2A 3EOZA 1DAPA 2I4MA 4YTEA 1NZJA 4I1UA 4XPZA 1IDN1 1S2GA 1T0JB 3R3XA 2NSLA 3L07A 3MJCA 1X80A 3TBHA 1EXWA 1LDGA 4CMHA 1UXIA 3C1TA 2P4HX 3AQIA 4YJGA 5EUQB 4U7GA 5C3MA 5K0EA 1K66A 2HRQA 3EOAI 4HLQB 2EFGA 3KNZA 3ZHVA 2HU7A 1AGRA 1R5BA 2WFAA 3H2SA 3TPFA 3SQXA 2ADOA 3IULA 5AK3A 3TLMA 1KVSA 1IB6A 2RI1A 3U1BA 3PF9A 2WF5A 3C45A 1K7YA 1U98A 3KK0A 2A9KA 1WETA 5IT0A 3C7DB 4AQDA 4AY2A 5KYKA 3D59A 4D9FA 2PWYA 1ZLYA 4JUAA 3AEKB 2BE9A 2RFLA 3DBLB 3I32A 1JHRA 4JVMA 3VC1A 4RPIA 4BTEA 4Y6LA 3GEHA 4IQFA 2WA1A 1UIRA 1RJGA 1T9KA 1UWLA 3DW3X 3EUAA 4PVDA 3OIUA 1L1FA 5I4KA 4IXDA 1PS9A 1CEQA 5I47A 3RARA 4BEJA 3RSOA 4CM1A 4ZHQA 2OZPA 5FBHA 5CA0B 4CF6A 3NHUA 4KGVA 2Y1EA 3KQQA 3MRTA 5K3AA 2FK7A 4HDNB 2P69A 4D5EA 1D8AA 2IYZA 5JY6A 3HNPA 1N33B 5BWNA 5F1KA 2EXXA 1GTSA 2NXEA 1SCAA 3DLPX 1ODFA 2JCXA 1OFTA 1XQ9A 1P5FA 2PJDA 1YFJA 3ERCA 4KOAA 2XUGA 3C3WA 5IZCA 1VJ1A 1A8QA 2V3WA 3ICQB 3CNQS 4JLNA 3JTMA 4OHFA 4LJSA 1Z6GA 4MS4A 4BJ5A 2A3NA 3AKEA 3CBQA 2Z8YM 1YR9A 3VU8A 4X24A 3LAWA 1PO7A 3HBAA 3E5MA 5FYDA 1JI0A 1L4HA 1KZYC 1VHWA 4W1QA 1AHHA 2AMYA 4U7TB 1J1UA 4DV3B 3KP1A 3DMDA 3VOTA 4GZ5A 2V7GA 1EXNA 4IGIA 4OHKA 2RHDA 1G8FA 4OP1A 3SX4A 3T3HA 1W5BA 2P3SA 3HCRA 5K0FA 1UKCA 1GY8A 1W4RA 3BE8A 1TQ2A 4FFWA 1ZAKA 1VE9A 3K0EA 3IT2A 4C4SA 5K8IA 1MQAA 1IHUA 3EVTA 3JQDA 1N2CA 4Q3OA 5E1DA 4E5SA 2NTNA 4EUSA 1ZGGA 2I3AA 3RJ5A 4CR6A 2ACKA 1P74A 4P3YA 1J8VA 3AB8A 1ZHFA 5ARBA 4QUJA 1R4NB 4I4NA 1E2EA 5IBRA 5KVAA 4MQFB 4LRTB 2P77A 2IHNA 4HN9A 4CM6A 1BJKA 1QGUA 1I2AA 4E2XA 2RGDA 2DLDA 1JLRA 3KHKA 4KE8A 3T1TA 1B73A 2KJQA 3RQSA 2ZB3A 4GQAA 4HNTA 1U1FA 3MVEA 2ZYWX 1MEOA 1Z29A 4XIYA 2C9BA 1F14A 1XKQA 5DLEA 3WGNA 4BLRA 1H4SA 1VI5A 1T1IA 2XMGA 4O8ZA 4G4GA 5K0BA 1U8YA 2AG8A 1Z0AA 1WXIA 4POAA 1FLDA 1HNNA 4OI2A 5B1HA 3TD9A 5FR1A 1LBTA 2H7YA 2OQRA 2XR1A 2F3TA 5JWOA 1FTWA 5B55A 1EE1A 1WY5A 3FKSA 3HL4A 4L75A 2OGUA 3NNNA 3UUWA 2DECA 3G9UA 3KG2A 2JHGA 3I9NA 2HSDA 3DJYA 3HE3A 5ALLA 1AQNA 1F8UA 3PQFA 4H6VA 1CUGA 4TXNA 1RQXA 1S8AA 1Y81A 1XROA 1OXSC 2FN8A 5E6UB 2ZRMA 4U2DA 3V80A 1R9NA 4Z99A 3FHCB 4C7VA 5AUOB 1ZOPA 1RRGA 4ER0A 5B3JC 3U37A 3JZAA 1MENA 1NKSA 1DO0A 4JVNA 4REOA 1Z12A 4TRNA 4FJ0A 5SYAA 1BA2A 2PT7A 5DBEX 2QA5A 2MINA 4HUQA 4A2PA 4QVIA 1GCUA 3DLBA 4DA0A 4QBKA 1ZS9A 4OBEA 1U2GA 1V8BA 4G8DA 4FI3F 2B0CA 1BOFA 5IDVA 4A8JC 5K03A 3SI7A 1OXMA 3ZCSA 1DSSG 2O9JA 3CWZA 3N5CA 4JXZA 3QXGA 4XQ9A 2H16A 4O0MA 5IF3A 4FE3A 4EB0A 3EJWA 2Q6IA 2WKWA 3NTXA 3F96A 4PZAA 4RWZA 3SYTA 1K63A 1J56A 1Z6ZA 2OXRA 2VUTA 4F1JA 4WE3A 4XQCA 4JAVC 1M6VA 3BHNA 4D0RA 4GRAA 1GTZA 3CO0S 2PX2A 1S8OA 5LP1A 3A8TA 4QJ4A 1UDCA 2VWPA 4MQMA 5K3FB 4FQ5A 2AOUA 5DYIA 1QO7A 1Z36A 1YZTA 4P98A 1DBRA 3HGTA 3BXGA 4RHFA 3BXZA 4JYZA 3UG6A 3EDMA 2ZU6A 4FFSA 4Z0PA 4BVFA 5ICSA 4ZRDA 1TA9A 3ZE0B 4YS6A 4AUNA 2YCLA 4A16A 2O5RA 2J48A 5BVHB 4JT2A 4IDGA 3P96A 2WW8A 4G1MB 1GHTA 1FDUA 1HFEL 1KERA 2B4KA 4IIJF 4MEAA 4Q4AB 4XE5A 1MC4A 4H2DA 4UU1A 3TL3A 4C7XA 1OGJA 3O26A 2YRFA 3EW7A 1I6WA 4LY6A 1MO6A 2FWIA 1CT9A 1BHO1 4F3RA 1WUJS 2JHPA 4BZPA 1Z74A 4Z2YA 1XYVA 1FPQA 3IPRA 3X44A 2LE0A 4MA4A 1FDTA 2G7MC 2CV2A 5GONB 1PD1A 3PC8C 3RBXA 3UAWA 2QPOA 1SK8A 4W6ZA 4P4TA 4D9IA 1ZSVA 1LVGA 2WFMA 1VCIA 1C3JA 1NC1A 1XTIA 1ACJA 2R62A 3E2IA 2F43B 2RH9B 3FDXA 3PFHA 3JALB 5EY5B 4P80A 4B9AA 5C4IA 1QP4A 1BX1A 4IH4A 1ZD5A 2BMFA 2W00A 3CNLA 2EW8A 3DOJA 1CY4A 4ILEA 4IXWA 2NXCA 4JC5A 4QFBA 4YQEA 1P0QA 4PS0A 4ZYUA 3FI9A 4J29A 4CLRA 4LTNA 3HCEA 4FEGA 3EOBI 4D4GA 3AB3A 3A9TA 4DLRA 1DKOA 3NIBA 3SOZA 1DS6A 4A6XA 1EZ4A 3V34A 1YDHA 1Z37A 1E18A 2Q4TA 2RHOA 4PNZA 4QGAA 3KQMA 5HQ3B 5CFZA 1J23A 1IIRA 1W76A 1YMVA 3U4GA 3I5XA 1Y5MA 2IZ0A 3GGPA 4J7AA 4KIGA 2PZEA 1D0IA 1RTTA 1USIA 5B64A 3PT5A 4OD0A 4ZRMA 1W85B 2Q3CA 3MK31 1ZG3A 5AKJA 5LBTA 2W6PA 1EIZA 4ALLA 1W0CA 4YCSA 2Z04A 2O6LA 3LQ4A 3DFUA 3Q2OA 3V6MA 3Q6MA 4L2IB 1QUFA 4EKGA 5IS2A 2RE8A 3FOCA 3GK3A 1WU8A 3F73A 4I5FA 2V7TA 1XXHB 4OI4A 3PSHA 3DOFA 4FCVA 2JVKA 3C3MA 5DIFA 1XTRA 5E3JA 1U8FO 4L22A 2OBNA 1ODJA 2QRQA 4I9HA 4Q7JB 1JA9A 3PQ7A 2Q7DA 3RFXA 4A3SA 2FEOA 2X15A 3ETHA 4EPWA 4TWIA 1TVKA 1HQDA 1Y89A 1OKKD 5EIHA 4KV7A 2O8CA 2R5NA 1W4LA 3IT0A 1TL7C 3E1GA 2PR2A 1JYFA 3T9EA 3BTVA 4NC9A 4QREA 4R5MA 4JP3A 3I37X 4NBVA 1PHRA 4MYHA 1TVEA 4TVBA 5AHWA 4XVUA 3LX8A 3IP1A 1ZINA 1PLLA 2QZZA 4RA9A 2XVZA 1M34E 3IVAA 1T2VA 3KJQA 4Q01A 4X20B 4D2IA 1E3JA 4LJYA 2TS1A 4J91A 2QN7A 3L5KA 2WWYA 4HB4A 2C07A 1UDXA 2F8SA 4WK2B 3COSA 1BWQA 1U6IA 3AEZA 3EPRA 3CLTD 3EAQA 4GIBA 4OHVA 4ZZ3A 1UK7A 1O6CA 2L82A 4YCBA 3UBMA 3SDBA 1VHLA 4AZSA 1U7ZA 5GVSA 5C8ZA 4M22A 1T2UA 1OLXB 1N36B 1P31A 2EFJA 4WKPA 3BIWA 3HA5A 3OZAA 2FQQA 1OXTA 3TJZA 3TGLA 1P0CA 1RXUA 2IYYA 4JYBA 3S6JA 4M55A 4CMAA 1QP8A 2ZQ5A 3A28A 1LS6A 3WFZA 4B81A 1KTIA 4MS3B 1JZQA 4ZANA 3EFHA 4HN2A 4DWOA 1TO6A 5KOYA 5TMPA 2V03A 1K6EA 3CHYA 4NJOA 5CTAA 3NVDA 1L5OA 1N34B 5KWVA 1QF7A 2OFOA 3DEFA 3SZOA 1W48A 4YRAA 1FC0A 1UBUS 3GLIB 2NU9A 4TLBA 1QG4A 4BMNA 2VNIA 3OZGA 4DNPA 1QV6A 1KY4A 4DA7A 1HFKA 2J0EA 3JAMA 1T6XA 3OM8A 4H60A 3KWLA 2HU5A 3H11A 3JRWA 4MLZA 3GJ7A 5BW4A 4EHNA 3HB5X 3WMEA 2NWQA 4PSKA 2W4MA 3KEQA 1E3MA 1CZKA 4J16C 1N6OA 4CHTA 1V26A 1VLQA 4Y18A 3CPHA 3IA7A 1TF5A 4AZ0B 3IV7A 2VKQA 2J3LA 4TKUB 3TIGA 4EFKA 4MO9A 5D6OA 3N6RA 1J8QA 4L8LA 2EL9A 4ROTA 1EA7A 4DLVA 3ZY6A 3FR8A 1DLJA 2CSUA 3UWPA 2LIVA 3KR1A 5HGXA 3ZZMA 2JARA 3ZV7A 4GF5A 1FQOA 4CE6A 6REQA 4H77A 4O4JB 5HF6A 1WMBA 4AMYA 2BZGA 3KOYA 1BCRB 3I8SA 1KOLA 3VTAA 3WLTA 5EMHA 1Z6XA 1Q1NA 1KKLA 3KOUA 3OEYA 4O59O 2B6HA 4FDMA 2DU8A 1U2QA 3LYLA 4D8XA 1QDEA 2WJYA 1XJQA 3DBRA 3R7LA 3QKUA 3FCUB 2DWOA 4RHCA 3V97A 3B7GA 2YXNA 2ZIUB 4GM0A 1KE1A 4DLWA 2GRUA 2OYSA 2P4QA 3P9SA 3BMQB 1E59A 2IY8A 4W7IA 3TBKA 3UK6A 5AVSA 4XRGA 1C3VA 2FF5A 1EQAA 3L02A 1K9VF 4V38A 4G09A 3STYA 1SRRA 1X7ZA 3U7HB 4YREA 4EFDA 1Q17A 4QRHA 4AO7A 2C59A 4HGOA 3I73A 5A4KA 3DVSX 5LWHA 1P3JA 4KUEA 1R10A 2ZXEA 1OA0A 2PSJA 1YS6A 3AJRA 4BP1A 3HJTA 2FFHA 2WMYA 4LKOA 4C3UA 3Q3VA 4W5TA 4N7JA 4PGAA 1ST2A 1KC1A 2ZVDA 3CT4A 1EUDB 3PA8A 4QXMA 3DAYA 4KMSA 3SHFA 4A23A 1OXVA 1MEEA 3IO5A 3BH6A 1X1RA 4NYJR 4RF5A 4GVLA 4IIJA 1GP2A 4MQBA 4Q3DA 4Q24A 5IVHA 5F21A 2COKA 1LDMA 2O4CA 3QWHA 2YH2A 1QHSA 3DV0B 3QUSA 4GMXA 5BR4A 4RADA 2R9VA 4H4EA 4K1XA 5ADWA 1G2OA 1NAHA 3VGJA 1EK5A 4DSTA 4KRFA 3KKMA 1JDTA 1P2TA 1K5DA 4O4IF 4Y6RA 3UKDA 4REQB 3KSMA 1VM6A 2Y93A 4Q4LA 4ZAXA 3G2QA 3IUJA 2CNNA 2YINC 4XFJA 3RK0A 3FMOB 1V48A 2ZU0C 3K70B 3I0NA 3IMKA 5A7HA 3U1VA 1QF6A 1K4KA 3FW1A 4K0RA 4X7BA 1M2HA 2QAGB 5DTJA 5TT0A 4DCVA 3B3AA 2ORWA 2X19A 1Y6FA 2IOHA 2JW5A 3IOBA 4R05A 5FWXA 4BB5A 3RDPA 5B3JA 1K7EB 2IA5A 1CJMA 4FR0A 3T5CA 3RU2A 1FX0B 3NP9A 1QP7A 1U81A 3AVWA 5GIOE 2YV2A 2Q5CA 1PJCA 2BF4A 2A9VA 2AK2A 2HN9A 3GQBB 3HDJA 5EXXA 5HIJA 2O52A 3OMXA 2W0SA 1H2FA 2EZUA 2GD0A 4CKBB 1KMQA 3KWMA 1YRHA 3NVAA 5CM8B 5HJ7A 4A8JA 4FX5A 3OAAA 1P3DA 1CUWA 2P4SA 2GKGA 3T1YB 4ABTA 3FZQA 4CL2A 1W36D 1BYUA 3WL6A 4BQSA 1QG2A 4A73A 3L0OA 4P4SA 5TS3A 1HM5A 1TAQA 2XZPA 3UGQA 2HY7A 1DCKA 1FXUA 1EUYA 4GT1A 4EL5A 1WJGA 3SZGA 3KLBA 2CB9A 1ONBA 2N1MA 4HWRA 1ZJZA 4FVTA 1DQPA 2CFSA 2GTHA 4FMCF 4JLBA 4PQRA 4CW7A 4QSHA 3IELA 2R751 2XUHA 3OJLA 4MR8A 2G9QA 5ADVA 4D4JA 4GI2A 3ER8A 2ZAOA 2J67A 3AEQA 3MD0A 4TKVB 4HVCA 3SX0A 3IPXA 4TL7A 1JDBC 1NV9A 1UC5B 4NATA 3DLTA 3D3JA 4NCAA 4IUBS 4YDQA 2FN9A 1JQBA 1NF3A 2G77B 4ZT4A 2CLIB 2HMYB 3EZFA 4E1AA 2PGNA 3EQ2A 1A27A 1ZN2A 4Q9DA 4G86A 5D1NA 1W5AA 3VYTB 1L5QA 4XDYA 4GE3A 5JNLA 3EIFA 2R8PA 3BIOA 4G36A 4D1YA 4JDUA 4B80A 3G0BA 4LYHA 1WKVA 2QSJA 3UYLA 4MV5A 3CUVA 3DL4A 3PC3A 4QOJA 1RYMA 1LEHA 1A4UA 2W11A 3JD1A 3ONFA 3QV1A 4TMZA 3U9SA 4EVSA 5T67A 3OY2A 2WZBA 3FYDA 2Z3VA 2DCUA 3D8NA 3FKSD 1BHJA 3MTAA 3WXMA 4KP7A 3VNRA 3N3BC 4N0PA 4Y2GA 3PC8A 1T9BA 4BX9A 1F0PA 1U1IA 4OHRA 5CUQA 5DK4A 1XCBA 2OPHA 1W46A 2E55A 3OPXA 5GPBA 4ZCMA 2WJ4A 3E1SA 3DCNA 1OC2A 2JFZA 3PS9A 1G8AA 1WQ1R 1RHMA 3E9ZA 2C99A 3L8CA 1DTSA 4RK7A 1E0DA 1UAAA 2L0XA 2WE7A 4EMUA 3MS2A 4RZSA 3U3KA 2QXTA 2XTAA 5AI0A 3I0MA 4YY3B 2AL7A 2AOVA 2FW1A 1YBVA 2NGRA 2PNFA 2G5PA 3IEIA 4QE3A 4DFDA 4I50B 4CF7A 1JQEA 3AESB 2JLVA 3PEUA 3P9KA 4Z5XA 1JJBA 1T36A 2GX6A 2WJAA 3FPEA 3LV8A 4RMGA 4Y2PA 4D5GA 3RRZA 2X86A 1ZZGA 1HDRA 3MTDA 1NVBA 3X1XA 1IHXA 3C1UA 1N78A 5IAOA 1IG0A 2XMSA 5DRTA 5HK9A 3ROZA 3GLUA 4ARIA 2R6DA 2ZJ2A 2JFVA 5IC4A 1GU7A 1PS0A 3TLJA 3QX3A 3FZNA 4BVJA 1J9GA 2GZSA 1UM9B 3I30X 1SC6A 4RMIA 3TXAA 2GSWA 2BKEA 1ZK0A 1RC8A 2IV7A 4D98A 1RWMA 4ZXPA 1V6CA 5B2FA 2W48A 2PMCA 4QGSA 1GUYA 3Q6NA 2ZUWA 4IR7A 4ZT5A 3ZD6A 1P0IA 4UTXA 2EDAA 3DZKA 3GP5A 2I33A 1PJ2A 2P6OA 4UAUA 5F7XA 2PWPA 3P2OA 1R12A 4R41A 4YLEA 1GPLA 2P7IA 3TZKA 5LZ4A 1C9MA 3D54D 5CH5A 4A5SA 2FVYA 1ZGHA 2BFBA 2ZUCA 4I4TB 4L15A 3ODPA 4UASA 1FU8A 2D5CA 2R68A 3C7KA 4TM8A 4TQUS 3IEVA 3PEYA 1IL0A 2XUKA 1P0MA 2BLLA 4HWSA 4B3DA 3GVXA 3ZWBA 1K7XB 1ORDA 1D5WA 3L6UA 2CVQA 3QPCA 4E2ZA 2GCOA 5K09A 3O2NA 4Q1DA 3LHIA 2H3HA 4PG8A 1UZLA 2NU6A 2Q7XA 1QYWA 3BIJA 3ORRA 3D81A 5JY1A 3DOUA 1LRLA 5KU1A 3VA7A 3H16A 1IUOA 5HPYB 1L7XA 1RCUA 3VNAA 1ADYA 1FRFS 2OFPA 2WI8A 3G2NA 3LCUA 4NBWA 4EPRA 2PDAA 3FGOA 2A5JA 1JP7A 2NO0A 5CBKA 4M38A 4H7JA 4XJTA 5D3ZA 4AS3A 3DO5A 4HADA 3OZVA 3GXBA 4HPJB 5C4GB 1F48A 1QYCA 1FP1D 3A06A 1Z5WA 5FBRB 5KNCH 1YUBA 4UBJA 1GUFA 4RHUA 1G4HA 4MGEA 3IE2A 2W90A 3VH4A 1WPXA 4AJLA 1Z63A 2FA9A 4MX8A 3C15C 3EGDB 1I3CA 1FNSA 5E6SA 3EEOA 1OI4A 1I4LD 1VBKA 2WYIA 5I9NA 4S1OA 2FHPA 4E3ZA 5HIIA 2FMUA 2ZXUA 3GT0A 3ABQB 4U9UA 1ODIA 1HDZA 2ZYRA 5CW2A 2D2EA 4LC0A 4O4IA 3ICOA 2XF2A 2H1SA 3KJXA 2P90A 1VPVA 3EIQA 3C4JA 5FPHA 4DLNA 1J9ZA 2Q7OE 1UPAA 3VI3B 3AX6A 1GNTA 1NVTA 2RKOA 3PDCA 3R4CA 5IN4A 1YASA 5A4IS 1AKYA 3KYBA 3Q88A 5E1MA 3S2FA 1N1MA 5IKOA 2Y3IA 1JFVA 4YV0A 3S7TA 4U3JA 5M34A 3T8YA 2H9AA 2GERA 2WA2A 3BB3A 3E03A 2DZDA 3EEYA 2P67A 3SIPA 5BUZA 2WFZA 5HZMA 4EG3A 2LD4A 2Q5IA 4TWRA 1JG7A 1FIUA 2RDMA 1Q0RA 4ME6A 2IBTA 1XQVA 2VBFA 1LDEA 2E7ZA 1A77A 1NHWA 1LK0A 5A5FA 5KNBA 2VL7A 2GLXA 2NVUA 1BOOA 3ONEA 4G2TA 1M75A 2VFAA 2C0CA 4OF4A 2EW1A 4CV3A 3H5WA 4TT8A 3IODA 4YRBA 4M1SA 1KH1A 2O3UA 1TAUA 1ZJ4A 5TDHA 5JI3E 4M0LA 3IHKA 4LJKA 4MB6A 4QDTA 2F9MA 2FN7A 5G53C 4V0NA 1KQPA 5TRTA 1IUKA 1W59A 4CFYA 2B2XA 5JQGF 5ES3A 3GLGB 1O57A 2AT1A 4YEDA 5CB6A 3QLUC 1JIUA 4BJ6A 3B1WA 2E4ZA 5LL6P 1NQVA 2Q8PA 1XVVA 3GRZA 4OQDA 4FYWA 3L2OB 3R9XA 1QU3A 2NZ2A 2BW0A 2XNKA 1RHRA 4DZZA 1N2CB 4W5OA 4KV9A 4CI9A 4A5OA 1VMAA 4KSYA 4BN0A 1YZUA 3OQPA 3JYNA 1XE3A 2IHZA 3MHTA 1FVOA 3TN7A 1LLCA 3PL5A 4ARCA 3S44A 1BH2A 4D79A 4H6PA 4HVAA 1QGUB 3JASB 3TMYA 3C5HA 4RY8A 3NRBA 1KOJA 5DDIP 3C6BA 5DGDA 2PNJA 3GVCA 3G6KA 1BEZA 3U7IA 4IO1A 4QBGB 1RZ3A 4HRYA 4RL6A 1CF4A 3LZDA 4G4SO 4NVRA 1EJBA 3I58A 2VH5R 1OCEA 4EDHA 5B1YA 3DZDA 5LQUA 2GJ9A 2ZJ3A 3AHFA 1O4VA 3K4PA 2YXEA 3VPGA 2NXWA 4EX7A 2XGMA 1JG1A 3BE5A 3A4NA 3TLGB 2P30A 3KQVA 4A15A 3C3BA 2DULA 2IHVA 4RTRA 3P1JA 4J90A 1FQWA 3GAZA 3GW8A 3BGIA 2WJ6A 3IIIA 3H5AA 4JKYA 4OB7A 3UHAA 4MLCA 4Z1OA 4G84A 1XXHE 2AKAB 2ZSAA 1QIKA 1EWYA 5FO0A 3TAXA 1Y8RA 5B12A 5IPFA 3A6FA 3EVAA 3BZWA 3OWOA 2F4NA 4LYEA 1BDIA 4Q82A 4BPBA 1Z5NA 3EH1A 1JHYA 4PNHA 2WC1A 3DB2A 2BFEB 5FIUA 3F6EX 3EGIA 4OL0A 3K6SA 2V0GA 2Z09A 1SNYA 2NPOA 3NIWA 4YMIA 1SCDA 4ZO9A 3VZCA 1DPFA 4QA9A 2JASA 3AUYA 5ISMA 5LD2B 1OWPA 4X6YA 1L6RA 1O87A 4OGKA 2CLCX 2O7NA 4UKDA 1VRWA 4M0PA 3EB9A 5FP0A 4C7KA 3D7MA 3EHDA 3LUAA 3WKBA 4U2KA 5GJVC 1ATZA 2GBCA 5CK4A 2QLNA 4HUQB 1R9GA 1Z07A 1UEXC 4G6ZA 4C3ZA 3R6GA 5KB3A 4IRMA 1AGXA 3QU7A 1ACMA 4KK4A 2QTAA 2YY5A 3OX2A 4JLPA 1P7VA 1QAMA 3LP5A 1PYGA 3QKSA 4Q34A 5CK5A 5IJAA 1NBIA 1NJFA 4P82A 3VXKA 1TEXA 4ENVA 2J4FA 2E85A 4AJ2A 2NP6A 1B23P 3TNYA 1SKYB 1TJ3A 1XU9A 3DSRA 5JISA 3CLVA 4ZZ2A 4P83A 1FMJA 1SQSA 1BN6A 1VB3A 3G2LA 4K9RA 4NMWA 1PFVA 1MQ8B 1VSUA 2ZI9A 3QYFA 2VT7A 1IIBA 2AZ4A 4Z9BA 1XZAA 5HF9A 2WAXA 3QRWA 3T9BA 4BLSA 1SC9A 5C8XA 4AUMA 1NRXA 3FOWA 4QASA 3QF4B 5L3ZA 1B74A 1U5BA 1YDGA 3RLFA 2GCNA 4RTLA 2ETVA 2AOUB 4NI5A 2CNBA 2ZR9A 1HORA 3FJOA 2IP4A 2XHZA 4G1BA 1QHNA 3KKKA 2WHYA 3WLFA 1DJPA 3GEDA 3E61A 3F97A 4KBGA 2O2IA 2BHLA 2YXPX 2HZ7A 3S4YA 1OT5A 1QV9A 1NA5A 2AQHA 4AJKA 5F98A 4XEHA 2IYRA 3J7TA 5AKZA 2CZGA 5KWEA 4C07A 3GDGA 2MMCA 2JZNA 1KEEB 2PY6A 2VQ6A 4NS1A 1A3CA 2NSJA 2QM3A 5EOVA 5IAEA 1KSGA 1E32A 4NCJA 4ESVA 1ZNWA 2HRDA 1NVXQ 5AUPB 2I8CA 2W0MA 5ITSA 1UBMS 1TF2A 4B73A 1YSCA 2OFFA 1XALA 5FOWA 2D1YA 5DXAA 4R2XA 3M4XA 1J20A 1J2YA 2XXBA 3PFCA 2FFAA 2MSKA 4P31A 2XNSA 2WMNB 3ZWYA 4DV2B 1NW9B 2W2NA 1YFKA 2H51A 2XNDA 3H86A 4Z1MA 5HQJA 3AZOA 5LM3A 3UOAB 4JZYA 3NTOA 5C1BA 1UJ6A 4NBSA 4YBZA 3MD9A 4JMLA 4ABYA 3GF4A 4UPDA 3QW2A 1NBME 1OZGA 3E05A 3AL2A 5CXQA 3M82A 1KRXA 1ULTA 1EFPA 3S2SA 4QU5A 3ZV6A 1Q7EA 2UYYA 3RT9A 3OQNA 4LECA 4HNAA 1CY2A 4O5AA 2X9QA 3TW8A 1F2TB 2P2NA 1XZQA 2QRNA 2QV7A 3F78A 3TYXA 4YRCA 1JQDA 2IOYA 4NZYA 1I7PA 2D2FA 4QPZA 1JECA 1OGIA 1BRMA 1RLUA 1XZCA 2HMTA 2M2IA 3IUPA 3F5DA 4MDHA 3I6BA 1GVNB 3B20A 3Q8WA 4GZ6A 5DM4A 2QZ9A 4H27A 4Q18A 1I3MA 1PT9A 2H2WA 5BSRA 4NZMA 3SC2A 1Q7BA 2PKQO 4PZLA 1BFDA 1PDOA 5KX5A 5HIKA 3AKCA 4BV8A 4B3IA 5AW4A 4CHGA 3DEZA 3P20A 4MHOA 1SU4A 2SCUA 1VJRA 2PGXA 3BH0A 2OY0A 3T5AA 3OAAD 3TINA 1QRDA 5MFZA 4U8GA 3IEPA 5FUVA 2WJVA 1F9AA 1Q44A 1T3ZA 4H17A 5LNK6 2DR0A 1JR2A 1N2ZA 3RKRA 4FYMA 2ORVA 3KE8A 1K88A 1K6IA 4UULA 1MABA 1TYBE 4QQ8A 5EJ6A 3CS3A 3KVNA 4TTRA 5LJIA 3AWIA 1TVKB 2BFNA 3JQRA 3FVQA 2JS7A 2RIPA 2DUWA 6GPBA 4GLOA 3KJFA 3VV2A 2Q9CA 1CUIA 4BO7A 3LO8A 5JQGA 5K6AC 3M70A 1RJFA 3O4IA 4FWIB 1T5SA 4DQXA 4JT9A 4LE1A 1ZJ6A 4P86A 3CF4A 5C8DA 3RUIA 2GBFA 1WUYA 1DU4A 9LDTA 4OO3A 2A5FA 1MOQA 1XHFA 2O3TA 1QYVA 2AC2A 4HEQA 3ZE1B 4D0GA 1TIKA 2I78A 3S2EA 3PTAA 3HRKA 5ALYA 4DMUB 1SCIA 2B8NA 1LW6E 2FW0A 3URKA 2XITA 4TYYA 5CHEA 1D1SA 2B5OA 1C7QA 4BO8A 4YRGA 5GGYA 4ZCPA 4QOHA 1LFDB 1O5IA 2WSIA 5JLJA 2FPSA 3GFPA 4PCUA 2VJKA 3RWBA 1X3LA 1T1EA 1YCHA 1IVSA 1A9RA 3USCS 4G5XA 1A7JA 3MWDA 2J8ZA 2CFIA 2PVCA 1T4DA 3OT1B 2A1UA 1QZZA 4ZDJA 2ZYSA 1RYHA 3GYBA 4IIXA 2APJA 2EDCA 2OA0A 3QXJA 4EKYA 1FYDA 1CS4C 3MOIA 4WRRA 1FMCA 1K5HA 2ZYTX 5ETJA 2ZRHA 1PAUA 4S1PA 5L45A 1VHDA 4MUGA 1Z0UA 5L3RA 1RVDA 3EZNA 1HT0A 3BDAA 4FKMA 1LJLA 4I14A 3A1FA 3KOOA 3KZKA 5IVKA 3W5BA 4NH4A 4DTIA 1XNRB 1SIOA 3LH5A 1X3SA 1RHUA 1E1CA 1M8PA 1C4XA 2JVIA 3E23A 3V8EA 3IQEA 3KDAA 1R66A 4CDGA 1L7PA 1COZA 3OFSA 3BMOA 1Z22A 4K1LA 1BIFA 1UMCB 2VDRB 3RNLA 4HTAA 3U80A 4D0NA 4E4TA 2FG6C 3R6DA 4XXHA 5JSFA 3IIKA 1T9AA 3H11B 3RODA 3A6JA 3GLFA 3T3MB 2XRZA 3VDQA 3I6ZA 4TMVA 4IKEA 1Y9JA 3L1VA 3BMCA 4D8UA 1ZN9A 2QYTA 2PUGA 2YMQA 3QSYA 4GOMD 5U9CA 1LSUA 3H9GA 3DA8A 1Z0DA 2B98A 3O1LA 4WACA 4YP1A 1G8PA 1M5UA 3DAGA 4CDRA 1NZDA 1RQ7A 2B9EA 4N0EA 1FFBA 1E7RA 1ULZA 3ACBA 4UTOA 5ALUA 3C4QA 3L4BC 4EY3A 3Q3HA 3LNTA 2IZZA 4PICA 2JEYA 2QP4A 2O07A 3M3PA 4YT5A 5EWLA 3SSMA 5EJEA 5LMUB 2QE6A 4G97A 3LL4A 2XYHA 2B9VA 5CVUA 1I3NA 1WMAA 1NM5C 2YRXA 3FIJA 4I8DA 4LS3A 4US1R 5FHRA 3AF6A 1EFLA 4C0JA 2X1VA 3LBFA 3T06B 2A86A 4QPNA 3RV4A 3PLRA 4BCBA 4PN7A 4ND1A 5CEJA 2ZSKA 4M0UA 1XP8A 5DM70 1I2BA 3DBRB 2GBIA 2VNHA 2DT5A 2P9HA 2AQKA 5HBRA 4I4LA 4XIJA 2EARA 4DSNA 4E07A 5B58C 3QLUA 4DGQA 4E2WA 821PA 1G18A 2O2DA 1N92A 1B14A 4IFIA 4D4LA 3QEAZ 4OQLA 4TRJA 4YUAA 2PUFA 1WDKA 1J8MF 2V5VA 2H17A 2YX1A 4XFKA 1SD5A 1W581 4IJVA 2QVYX 2BGJA 1XVUA 3IRUA 3GT3A 1E6MA 3OCWA 3WK7A 4RTNA 2HT1A 3A4MA 4WBSA 3L8GA 3LY9A 2Y0PA 4EFNA 2ZJBA 4TRRA 3KU4A 1X1BA 1XCOA 1YJ8A 4MVYA 3F6SA 4DLZA 3IEMA 3UT0A 3ZUPA 1I3KA 1SJ9A 3JS5A 4HR7A 4L85A 4LZOA 4O0LA 4PHCA 3PC6A 1Q3HA 3CW9A 2FWPA 3IP8A 2HA2A 4D46A 5CXSA 1HC7A 2C5SA 4K87A 2IUEA 3B13B 4OH7A 3PTZA 4J0GA 5ECGC 2B2CA 3COWA 4YAEA 4BQFA 4DIKA 5T6MA 5JIBA 1XQXA 4G81A 3NPMA 4Q7KA 2YTZA 3N2GB 4ACBA 4XYGA 1Z6PA 5LCXA 1G4AE 4FR5A 3CJRA 1OU0A 1QBGA 2HF9A 4MUFA 3VNSA 4F3NA 1QOPB 3K2EA 2YXBA 1AXGA 4JP2A 3L4SO 3K0SA 2LUOA 1ORWA 5G0SA 3F4BA 5B30A 3PEWA 2Y92A 3BC1A 3HWRA 4P7JA 5L7YA 4KLNA 4KQJA 4G41A 4XCVA 4DCCA 5CFLA 2W2VA 5AVQA 1PJ4A 3E5NA 4MIKA 2OP0A 3ITEA 1CIJA 3ZOZA 1JAZA 2QQGA 1X0VA 1UQTA 4QU9A 3A4IA 4BNLA 1X70A 4M1MA 5EJFA 5IEJA 4QXOA 2ZJYA 1L5HA 4KAXA 1H1LA 1IBCA 3O2QB 3SU8A 3OLYA 2JCSA 5LUAA 3BK7A 1GUAA 2TRSB 2ZIAA 4Y9TA 4EKIA 3EN0A 2R6R1 5JUWA 1I5EA 1XJ5A 5JJIA 4DA8A 5AK5A 2IYLD 5FUWA 5FJJA 4ZVLA 1DFIA 5CIQA 1CQJA 1N6NA 5C46F 3AERB 4DZTA 2X8BA 5SZJA 1N2OA 3FB1A 1C9JA 1M0WA 3AYXB 3T1HB 2X76A 1USKA 2CHUA 4OBBA 3F5SA 4RHTA 5GZ6A 1CVRA 1ECFA 3RSFA 2Z83A 1T8YA 1Z33A 3DNPA 4FS3A 5T3UA 4Y67A 1KFEB 2HX1A 2JCBA 2Z8XA 5DEIA 1TU4A 2OAEA 3MM4A 4EMBA 3EXFA 4I5EA 3U3ZA 1O54A 5AVKA 1SQFA 2HRBA 2NVOA 1P18A 2P9EA 3ASYA 4GI1A 4UHEA 2IQIA 3B60A 3GVIA 3Q9UA 2FW9A 3ABZA 3TSZA 4HB2A 4AM8A 2ZUUA 1LBHA 4AWAA 1MVNA 2ZTUA 4IMRA 5A3QA 3COJA 2VA9A 4JLMA 4MR8B 5BV8A 3U3JA 1B41A 2BT4A 3OZWA 3TKLA 3ZVLA 3SZMA 9ABPA 2AA3A 4FT2A 3FA2A 5D87A 2DHDA 5KYGA 1SCQA 1TCAA 1NONA 1P3Y1 2P2SA 3I9V1 1G9XA 3LXXA 3OZXA 3PRKE 2QL7A 4O5OA 4RPGA 2GF2A 5FFNA 4GKKB 4DY6A 3ESYA 3FX2A 4M0DA 4RXTA 3TG8A 3FDZB 1LPOA 4G5HA 2IELA 3M4YA 1LI4A 5AVYA 2AWOA 4JQYA 4IJ5A 4OLHA 2HH9A 1T5TA 1PYOA 2EVWX 4L9AA 3E7DA 4PCVA 1T4CA 3DNMA 2J7PA 2WTEA 4QUHA 3TECE 1UKYA 2X3UA 2Q5EA 5B5SA 4K9QA 5DHPA 1QOZA 3BXHA 3N75A 5G1PA 2B94A 3EFBA 2YV4A 3OU2A 3CRMA 2HJRA 3GVHA 1YOVA 2XTZA 4QZVA 2D1TA 2GARA 4XVHA 2WWTA 2NPFA 2QIOA 3W4JA 4BNIA 1FFHA 1N5MA 3ZX5A 4HRVA 1BE6A 5BURA 1IHDA 4CWAA 4WEOA 5KJCA 2WY2D 2JIDA 2YZKA 3BCUA 3PFGA 1EGMB 1YVUA 2G0AA 3STXA 3VC2A 2VHCA 4URXR 3CVUA 4KLAA 4TWBA 3SIRA 3OQIB 4RH0A 3GLGE 1SXHA 3BJRA 2WD7B 1NAIA 3F6PA 1NUAA 3U17A 5IDXA 4JUBA 3O83A 4CL8A 5BN1A 2VNAA 4V1CB 4M0CA 5E9JA 4FB4A 3M6XA 4O25A 1IFXA 3ASUA 1S2IA 1T36B 1Z68A 2WP0A 4MAMA 4XYLA 4JBIA 5IDQA 1XZNA 2JI7A 4B9EA 2I67A 4NQZA 2XQJA 3QKIA 3D3EA 3SXUB 4FQ8A 1GAXA 3N07A 4NL4H 2FWNA 3SICE 1N2BA 2CDRA 4AICA 1MJFA 4I9FA 5ENZA 3KPWA 1M2NA 1E5XA 1XTSA 2BP7B 4KLZA 4ZAZA 5LIRA 2WIFA 5FWYA 4H6WA 1GQSA 3P9PA 3RVLA 4B6PA 2BMWA 3BICA 2V9CA 2I29A 2NUTB 4RDHA 1QRAA 3V1LA 2Z9DA 2PQ0A 2GLUA 2Z2JA 5PGMA 1OROA 1Z56C 1DKNA 3ZHOA 1KR5A 1A9OA 2G80A 4HYTA 3MUFA 2HIAA 1IJEA 3PP8A 2FHSA 2PRSA 4R4JA 1TM3E 1DWPA 3L8ZA 2E6KA 3QBDA 1YR3A 4GX0A 4L95C 3BRSA 4ZYLA 1RJ9B 3N0WA 2BFBB 1O8CA 3INYA 4D6YA 4F7WA 3FNQA 4HVLA 5K6AA 2AFHA 3ITNA 1OB2A 4X90A 2QGZA 1U0JA 3EWSA 1CG6A 2ZI6A 2GCOB 2H9IA 1Z25A 2Q29A 2IOFA 1RXSA 2CJPA 3NBXX 3ANLA 3GUVA 2UVPA 4I8IA 3UH1A 3ZCXA 4BZWA 3JZIA 4AIRA 4YAJA 2QENA 4DARA 1SB9A 3GAFA 2DX7A 3I4LA 4FGZA 2OHHA 5HYVA 3TFWA 3D6NB 3NATA 3CINA 4NEHB 1KDYA 3BILA 1ZNQO 1JDNA 1QH8A 1Z38A 3GFFA 5H1YA 1T0BA 2IZ5A 3QLTA 4GOJA 1M0SA 1Y4AE 1HH4A 5JRZA 5EESA 2WZCA 4IJKA 3Q3JB 1NDHA 1X8LA 3PUVA 3LQKA 4Y1RA 3EVCA 3G82C 4RX1A 5ALDA 3FTCA 4GZ3A 3REQA 2AR7A 1PDVA 2ZCJA 4OY3A 5H81A 1N0IA 1PUJA 1PF7E 1LKZA 3K94A 4P3NA 2XNDD 1P5ZB 1UT5A 2PXAA 3GRRA 5CA1F 3H99A 1XUOA 1MXHA 2GEVA 4DYHA 4JIGA 1E1NA 1SKYE 2OESA 5AJZA 5IUKC 2WG2A 4I6GA 3VNVA 1T0HB 3UJ8A 3A4TA 5I7AA 4RVDA 2F7SA 1CJSA 3L7NA 1HDXA 5JALA 4X65B 1W88A 4XIIA 4BATA 3RBAA 1CR0A 1OOEA 3ETJA 3FAZA 2GAIA 3GCDA 3MEQA 4KH1A 4RQAA 1J2TA 2D1RA 5AKKA 2NMVA 4PYMA 2Z4TA 4M9QA 5SZHB 4CR8A 2O8EA 1W30A 1UFVA 4YC7A 2VT6A 3AVPA 5FXMA 3ISTA 3PRJA 4KLRA 4LX0A 3VTZA 4ZHSA 3UPDA 1T8UA 5BO5A 3T0GA 1A9PA 2YXLA 5AP9A