2OWDA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLMRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2owdA00
3IT3A 1UJBA 1NT4A 2DWPA 3MBKA 2QNIA 1DKMA 3FDZA 4AROA 2EKBA 3NTLA 1SK8A 1YFKA 1TIPA 1XQ9A 3E9CA 1UJCA 3QPWA 5AJWA 3QPUA 5AJZA 1ND5A 3D8HA 5CDHA 1BQ4A 1RPTA 4JOBA 4GPZA 5AJVB 2H0QA 3D6AA 2IKQA 1V37A 2HIAA 3K4PA 3LG2A 2EKZA 5PGMA 3LL4A 3EOZA 4GPIB 4IJ5A 3GP3A 2P9YA 2P30A 1C81A 2P6MA 1DKLA 2P77A 2H52A 5AJYA 3FDZB 2P2ZA 3D4IA 3IT2A 1QFXA 3DCYA 4EMBA 2ENUA 1C7ZA 4QIHA 3HJGA 1H2EA 4ARUA 1C80A 5CU7A 2F90A 5AJXA 1ND6A 1SKBA 3GW8A 2P9FA 3E9DA 2GFIA 1K6MA 4JODA 5HR5A 3EZNA 1E59A 2YN2A 3GP5A 1SK9A 4JOCA 3O0TA 1RIIA 4EO9A 2EOAA 3MXOA 1E58A 1CVIA 3E9EA 3LNTA 4D4JA 2H4XA 4ODIA 5HTKA 2P75A 3C7TA 3K4QA 5CX4A 4ARSA 1FZTA 2P6OA 2P9ZA 1V7QA 2BIFA 3IT1A 4IJ6A 2A6PA 1YJXA 1DKQA 4ARVA 4HBZA 4PGMA 4E3WA 5AK0A 3OI7A 1BQ3A 1QHFA 1QWOA 1BIFA 3KKKA 2RFLA 4PZ9A 1SKAA 2H4ZA 4D4KA 3ZHCA 1DKOA 2HPAA 3FJYA 2P2YA 3BIFA 1DKPA 3R7AA 4PZAA 3QPVA 3F2IA 2YN0A 4D4MA 2PA0A 2WU0A 1EBBA 1IHPA 4FDUA 1RPAA 2AXNA 1DKNA 3NFYA 1H2FA 2P79A 3IT0A 2WNIA 3F3KA 4FDTA 1T8PA 4TSRA 2P78A 2WNHA 2A9JA 4D4LA 1FBTA 3PGMA 2OWEA 3DB1A 2OWDA 2I1VB 2HHJA 2ENWA 4MA4A 2DWOA
chains in the Genus database with same CATH superfamily
3EVZA 2ODWA 2MU1A 4F4UA 1BD4A 2ECPA 3CRNA 4P3XA 5U4QA 5JNUA 4CM5A 5JAPA 2UVDA 3G8CA 4ECEA 5KX5B 2AIRA 2CMFA 4DUYB 5LYJB 1OI2A 1JU3A 4G1BA 3W6ZA 2X4LA 1EXWA 2QDXA 4KN6A 3NHWA 4FNGA 5IJAA 2PD4A 3H7IA 4MR8A 2PBRA 1ATIA 3L8EA 1FYFA 1IDN1 3PEUA 4WI1A 4DBZA 2XCSB 1IBLB 2O8EA 4AKIA 5JSHA 3ZE0B 3I4FA 1NI4A 3JVEA 1SHJA 1GAQA 3KKQA 3DZKA 2ZCVA 1WBDA 5CD1A 2PLWA 3P20A 2NIPA 3BD8A 4HJXA 3DMFA 2G4VA 3TQSA 2QRZA 1JXOA 4QZVA 5A6SA 1EZ1A 2CMHA 3OHPA 3M9WA 2R7NA 2DR0A 4GU5A 4TMKA 5CUQA 3HVRA 1NVGA 3NS7A 5B64A 4YJHB 1ZIYA 3AVVA 1ZMBA 1H9CA 2OFWA 2X15A 3SZLA 2NXCA 3UOWA 2Q7OE 4JGGA 1NXTA 3VZPA 1M1NA 2WKPA 2CLCX 2AN5A 1JFTA 3JQQA 5BR8B 2XYVA 3G3EA 4FYIA 4ENUA 1JEEA 1T8WA 4FI3F 4FUQA 3WHPA 2NVUA 2RCYA 1L5ZA 3ANYB 3R5XA 4M1SA 4X6YA 5E6RB 1VB5A 2QE7A 3LZ6A 3QLUA 2C3YA 2D00A 1U4SA 1GPNA 3L8YA 4WZZA 1TCAA 4RE6A 1WPGA 2CJPA 3B2NA 1RRKA 5ETJA 1R0SA 2ZBDA 1QIEA 5AK6A 3T7AA 2B5OA 1RIIA 1SCKA 1ZPDA 2NYVA 3AJAA 3EGCA 3F4BA 4AXBA 4C6TB 2M9MA 1ZK1A 5DM60 4TYMA 4YMHA 3QVXA 2B6HA 4IPTA 4NBWA 3IX7A 4C07A 1UP4A 1AUPA 1ZL2A 4ETMA 5ELXA 3OZUA 1JEDA 3QOXA 3ROZA 5DXAA 2X77A 3KHTA 3V33A 1ZNYA 5JNSA 5LMZA 1QQ6A 3WQSB 2GEKA 2V6GA 4BGEA 1ZNQO 5TMEA 1LPPA 1PJBA 2C2WA 4N5MA 3UJ7A 3WO0A 2I1LA 5EXDA 1R5NA 1B7GO 1TKBA 2IX9A 4TWJA 3AJEA 3COVA 4P98A 1UBUS 3HE3A 4UU8A 3RJ9A 4TV9A 3QEKA 2CV0A 1L0BA 4M38A 1VKRA 5C1BA 4L72A 3ROPA 2XR1A 3HDJA 4DL9A 1S8FA 1Z8NA 2YHBA 4JH0A 1JVSA 2RI0A 3OTQA 4B45A 2GXQA 3E9YA 3QFTA 1QIGA 4U5XA 4UBKA 1T24A 4Q7QA 1XX6A 3FH0A 1KARA 2HFJA 4NHOA 4XSVA 2WZQA 1W48A 1ZUNB 2I3AA 3N74A 1UF9A 5IJ9A 5TIIA 1NAHA 4OGLA 3O4VA 1HH4A 4FOPA 4G5FA 1W5SA 1Z7GA 5T3YA 1WDWB 3AY0A 2AQIA 4TS1A 5JVDA 3E0QA 4MUGA 1I6WA 5ALSA 4RMNA 4TVSA 4CMJA 1Z4MA 1ZI9A 4BVAA 2ZUFA 2WTMA 2WNIA 3T3PB 1GRCA 1Y3AA 1YD7A 2D7CA 4QUKA 1OFIA 1ESEA 2OBNA 4N76A 1PNQA 1XB2A 3OQBA 1WBJB 2YHSA 5K8UA 1AK9A 5KYTA 2FFRA 2VAVA 1ZI8A 1TCVA 2BGIA 2LP4Y 4HDSA 4TMTA 5H4GA 1FIUA 4P2GA 3EFOB 5B30A 5C46F 2NN3C 3CZRA 3S3TA 4AM8A 1I0LA 2ZBRA 5I7FA 4P0PB 1DTWB 1XNQB 4EPRA 5DHPA 2ID8A 1GG8A 2F3PA 2BEVB 1OZGA 1E5VA 4EI8A 3OPNA 3VZCA 3I9V6 3CSSA 4JLWA 1ZITA 1C41A 1LW7A 1W93A 1DOAA 1AC5A 2HAEA 4AP5A 3QJGA 4N6NA 1BOOA 5REQA 3DWGA 1X74A 1D2NA 5TQ0B 2COEA 3DDNA 1V8DA 5JNWA 5TVKA 4RJIA 3W78A 5MGBA 1VPWA 1K7FB 2TECE 2WYHA 2ZBUA 4JQCA 4O4IA 3O1JC 2TS1A 3A6HA 2MSKA 3OQNA 1L4EA 4IDQA 4ATNA 1W5TA 1QGUA 2DQYA 1VXRA 2D1SA 2HF9A 2IZ6A 4LYAA 4QBTA 5JDIC 2AR7A 4R51A 3W8EA 4HB3A 4D0SA 4HNAA 3I2IA 3S2IA 3EG9B 3KYDA 2HHAA 1CZLA 2AOVA 3UQYS 1C7FA 1TYBE 2QL9A 4KIGA 2W2PA 4KB5A 4LPKA 1XELA 1EIWA 4KK3A 2I4NA 1QMPA 2YV4A 1C9JA 3QUCA 4TMXA 1WUIS 4HEJA 3FHCB 5JU6A 4B6FA 2R25B 2XCTB 3HMQA 1VBFA 3B48A 5DGTA 5K3BA 2J67A 2X0IA 5CM8B 4LX8A 1BVYF 1BVHA 5FOTA 1XTZA 3ZHQA 4NK4A 3RRJA 3U2QA 1Y37A 2VBGA 4LSGA 3I6MA 2ECOA 2RMKA 3KR9A 4KXNA 2YVQA 5B7GA 4G8BA 4AUKA 1HBJA 4J03A 2ZB2A 3T0GA 1SK9A 3DE6X 3GD7A 2QN7A 4LZJA 1EFCA 4PINA 4YJ2F 5I7HA 2GYYA 2QUJA 4KNYA 2YFHA 3UTDA 4XE5A 1N2CA 4C2AA 4XDZA 2WD7B 3U60B 1FPQA 3U4AA 3UWDA 2IA5A 2IHBA 3IMKA 4DADA 1RXWA 1V1JA 2J3JA 1F9AA 1YRQA 2IOYA 3D0RA 4MV4A 2QU8A 5EZSA 3W9UA 4UNNA 3INYA 4I9GA 1G3QA 1I14A 1TX4B 4RA9B 4DDKA 1B6SA 4JT8A 2WG1A 3N2KB 3C39A 4Z9AA 1Q1QA 1Z2EA 2V96A 4IQ0A 1JLMA 3MGBA 5CPFA 2JLWA 2O2CA 2DX7A 4PPQA 4H7PA 4B8YA 3URKA 1T3ZA 1U2PA 2LDBA 3FM9A 1VYUA 3K9GA 3NHAA 4PLVA 4Q82A 4UHBA 4Y6QA 5CLIA 1KRHA 4D9EA 5JANA 1T5BA 1G5IA 2AQKA 1KBOA 4AG3A 4BIIA 1HQYE 1J8MF 3SC2B 1EWKA 5IBRA 3H4MA 4BFSA 1ZRMA 4HWRA 4L07A 3JXEA 1KJYA 4NFSA 4FGWA 4X00A 2UUAB 1AGYA 1Z8HA 3OPQA 3PFFA 1E0JA 1DC6A 2IHYA 5C7IO 3FN4A 3UT6A 2ZSDA 1FLNA 2I7CA 3BIOA 2R6GA 2N3ZA 4PZEA 2AF4C 2NU7A 1SHKA 2OHVA 2WM9B 3EIEA 4BQEA 3NHJA 4WKNA 3WG9A 2XUAA 2P78A 4OJYA 2HF2A 1GCOA 2NWQA 3AIMA 3G1UA 4DMGA 3LPCA 4J3NA 3PDCA 1P0MA 2H00A 4WTOA 2CWDA 1YAHA 4MR9B 5CNJA 5IF3A 1AKTA 2IXTA 3UMGA 4NZNA 1F17A 3D8RA 4FOOA 4WKCA 2PUDA 2F1OA 2WJVA 2R8OA 4L73A 3O8OB 1HTTA 2EG9A 3SHQA 2EQAA 3ULKA 1N6RA 4NPHA 3ZGOA 1IULA 3YASA 2FUCA 1JEAA 1KIAA 4WZBB 5IVKA 3ZTWA 3VV2A 1SHUX 4ZT3A 5COAA 1R8SA 2VNKA 2W70A 3BMXA 3TZHA 4QT4A 4ZPJA 3C5CA 2RBGA 3A31A 3HY6A 4IS2A 3IP5A 1RCFA 4I6EA 4NH0A 4BLUA 3AZPA 1Z7BA 1M76A 3UJ9A 3V8EA 3KOOA 1RKBA 1FJGB 4EO7A 2PIAA 1C50A 3C15C 3NM4A 3FOWA 2JGKA 3OFJA 3PNBA 2NOAA 5CFOA 4DMKA 4PSKA 1W9MA 4JDUA 4OXKA 5ED0A 1LDMA 3BZWA 4X54A 3PC6A 5IYZF 4NXNB 2IYPA 2WLTA 4QRDA 2IS1A 1JQBA 4FBMA 2OGZA 5CFRA 4MGYR 1WD7A 1ZN9A 2V6MA 5CA1F 1GSOA 1R0XA 2HZBA 4KP7A 1SXJD 3TLGA 2IYAA 4A15A 4Q0MA 1TDJA 1MJHA 3QNWA 3DCYA 3F98A 1IQPA 4D9HA 3L0IB 1QS0A 1ODKA 1C7ZA 1X1TA 2QTVB 1XQVA 2XYQA 3I52A 3L0CA 1Z12A 3R44A 4OHRA 4PO1A 3N2GB 3V97A 3WK8A 1L5SA 4M8IA 3I1FA 4QDKA 3K0KA 4AZ3B 1TZMA 1U0SY 4E22A 3NJ8A 2FUNB 3INTA 4UM9B 4XX0A 4P9NA 4EATA 3T5PA 2P9FA 4BNMA 4DF3A 2OVBA 4O4JB 5IKXA 2AB0A 4MS1A 1XU4A 2B98A 3P2YA 4XLLA 1FYWA 5CYFA 4RV5A 2VJYA 3PTAA 3FPGA 2AR0A 4JT2A 2IEBA 4YNBA 2KX7A 4UPVA 2HLPA 3A25A 3GDFA 4Y30A 2XNSA 3LPLA 2C3PA 3QBTA 1KNXA 5KPJA 1GZ7A 1QIJA 1Y6FA 3HHPA 2UXCB 4EGFA 1DIRA 2C82A 2VDKB 3DHNA 1XRSB 2D1RA 2O06A 3ABZA 3NTUA 2BFPA 3QI2A 2AI1A 3W5IA 1KI8A 5TPWA 4BLRA 1I2CA 4QODA 4LI3X 3IVXA 5HKBA 4EZBA 5AQEA 3PYMA 2VTBB 1KMMA 2VLIA 2CXTA 1O2DA 4KHPB 4B6QA 3EIQA 3GUHA 3K9LA 5DCYA 3IYLW 5A4IS 2R47A 2LBPA 4OHWA 1BQ3A 3FOCA 5AW1A 1XXHB 1LQ2A 2AEEA 3T12A 4X3CA 2A7XA 5KOHB 1ZEJA 4RJTA 1G5QA 1B6RA 1FFCA 5G1OA 1YR7A 4OQLA 3R7WA 4WUTA 3K6SA 1Q95A 4DQDA 4AY6A 3KQUA 4E0BA 5KNDD 2GN6A 1WCIB 1WRBA 4C05A 1T4BA 1VZ3A 3T06B 4J90A 4E5PA 10MHA 4UZEA 4IWXA 4IGKA 2Z5FA 5J47A 2ZRAA 2QM7A 1QE3A 1QZXA 2C03A 4XVRA 1MOZA 5CHEA 5E7QA 4DDWA 4YP9A 3RG2A 5AVQA 5I4BA 2NZ2A 3R5HA 1XLWA 3V48A 4PX5A 4PCLA 5EXEA 3RSGA 1PEYA 2YWEA 1KEPA 4Q39A 3Q2OA 2LPMA 1L1QA 3G85A 1FNCA 4I55B 3F6PA 5A3VA 4RDIA 1JDTA 1OX5A 4IEIA 2JGAA 5EWLB 1DZ3A 5J2UB 5LMCA 1K97A 1GVHA 3O21A 4DEYA 3PTZA 1YXMA 4B6RA 1DX4A 4J43A 2HMTA 5I7AA 3TL6A 2XKAA 1R6UA 2ARKA 3MRXA 5J9FA 1NT2A 1C0IA 3BMOA 1DFHA 4RLSA 1T34A 3IP8A 4I14A 4K1LA 1KQOA 1D4ZA 3UT0A 2GESA 3N3AC 1G8KA 1S02A 2HCFA 2VHWA 5EE0A 5AJZA 4HLQB 1QOZA 3AIOA 3IVCA 3VR4H 4C08A 2C2HA 3GFRA 5BWBA 4DARA 3SU8A 2YV1A 2BUCA 1U28C 2NSHA 3LG2A 3NVMB 4R9SA 1T8YA 2IYXA 5KX5F 2LTAA 5KVAA 2FRDA 1X15A 2UUBB 1F0NA 3EGDB 3LCVB 3L0YA 3VUFA 1KQ3A 3ELYA 3PCXA 1G3RA 1CU1A 1ODJA 1P3DA 1ZGCA 3E4CA 4NZYA 4ZVKA 4B3XA 2EJVA 3EPKA 3X2EA 3H5NA 3B3QA 5AM3A 1EHYA 3NOQA 1ISSA 4MIKA 4MW7A 3T4UA 5HVNA 1LNSA 1Y4SA 5EE3A 4TX1A 1U5BB 3PJFA 4G5GA 3AYZB 4FX5A 5AOVA 2W58A 1GL3A 3VUEA 4Z4GA 2GZ2A 2WEKA 2CEKA 3HGQA 3INNA 3KB2A 3N8GA 3L77A 4GNKA 3OX1A 2GAOA 3NIFB 2AXQA 2P7HA 1X7DA 2AUTA 2XWSA 4JY7A 4IAOA 2QLBA 4GOXA 3VU8A 1UXIA 2NT3A 1M1YE 3GYGA 3X2SA 3M34A 2O59A 5K3FA 1EUZA 2HN9A 1T9KA 2VK2A 3S40A 2J5RA 1NZFA 3E03A 4MWGA 1EUDB 1EBUA 1NP6A 4OP2A 1KH1A 2ZT8A 3KUXA 3GCZA 1F12A 3H16A 2H4JA 4L0DA 3MRVA 2B82A 5JHGB 4DIBA 5B2EA 3LH5A 4NICA 4PQEA 4EW1A 2H4WA 4DTIA 1N2EA 2AW5A 4PONA 3VR6A 2V54A 3GYBA 2QPOA 2Z2YA 4QRHA 3FETA 3CGWA 4RIFA 4V2IA 4BAUA 4PSUA 1V7QA 3ZJVA 4QBGB 3SCZA 3FKQA 3IDOA 3HB4X 3GUCA 3I39X 3VO8A 5LOVA 3OLWA 2BFBB 2X8JB 3X1ZA 2ZBGA 2JGRA 3D0OA 1QP8A 3VDMA 2DKNA 4CMEC 4QXOA 3L4KA 1NI5A 1NMQA 1AGPA 3RIYA 3TNFA 1Q1NA 3CLUD 2F3SA 3GIWA 4X66B 2ID4A 3E7DA 3OX4A 1W75A 2PZLA 4TM8A 2GBGA 1Q74A 4M0KA 4MAFA 4MR9A 3UY4A 3A4MA 2WFMA 4ZAFA 4ESVA 1SBTA 2AX4A 5FLKA 4EAAA 2QT9A 3RYFA 3ET4A 4PG8A 4B81A 4F6CA 4CXMA 4J3JA 1O6CA 4Q9JA 4URVR 3BULA 2WU0A 4HP8A 4IIDA 5KVVA 3P0EA 3ROMA 1Z0FA 1KFEB 2HK6A 2UAGA 1EU1A 1WXWA 4ZCIA 2VF2A 3D6UA 1VECA 5K0FA 2IS6A 3NUZA 3F78A 2QRMA 3DT8A 3EZ6A 1XP5A 4JP8A 1J2EA 4K9OA 1WVGA 4KAAA 4X94A 2ZRQA 4XM0A 3QPAA 2Q1UA 2OTCA 3NGMA 3QXJA 2FOIA 2HBZA 5H5JA 1S2IA 5JCOC 4HDAA 3I2GA 3W6PA 4QECA 2VZ9A 1X9HA 2XB9A 3EGXA 4N6GA 5BV0A 5KIAA 4JVOA 3EBPA 4TTIA 2HDNB 5DYGA 3PKZA 4HHEA 3URMA 3I30X 4Y0AA 1KK1A 1D2MA 2E9SA 2RK6A 1TRHA 2YJZA 3F4KA 1E3DA 4QUBA 5CB4B 4C0AC 5L6MB 5ENZA 3P7MA 1KI7A 3SDBA 1P2FA 3TLGB 3PEVA 2D5AA 5DNDA 2GEDA 4D99A 1QS0B 2HXSA 4I55F 1AJEA 1D5CA 2B37A 4YJFA 4DG9A 3STUA 5DZSA 5DT2A 5IF9A 4DWVA 4IIFA 3LWZA 3L7MA 1PLJA 2GZ1A 3U4CA 1YQXA 2QUZA 3OE7A 5JEDA 1V37A 5JXWA 5LKAA 4AUMA 3MNFA 2AZMA 4PLCA 2DQKA 2WBLC 5EJ9A 2FSVA 2Z8YA 4ACBA 2IYZA 2XGSA 3UQZA 3PHJA 4Q5IA 3R5SA 4MQLA 4RF2A 4ARIA 1IOWA 2OFFA 4W82A 3Q7IA 3L7KA 4MUBA 1FW6A 4YB8A 4BKUA 4QGSA 2C1XA 1DUSA 4TKMA 4BNKA 5AT1A 1JWLA 3VHRA 3DP9A 4OLFA 3ZTTA 1AQ6A 1EDOA 1DEAA 4W99A 5FUQA 1V95A 2DTEA 4UUNA 2DUNA 4I1YA 5F5LA 5LYJA 2C9DA 2X0EA 3TSYA 2B1QA 4LDQA 4MIOA 1U0HC 2J4FA 4RPIA 4E1AA 2QTBA 3NEAA 4NS4A 1YB1A 2IEDA 3V5NA 4J4TA 3DE3X 1AS0A 4BWGA 1P81A 2WSSD 3C4VA 3M6WA 5F1KA 1MQSA 5JV5A 4CF6A 1JR3D 2QT1A 4MPJA 5HRCA 1LQUA 2V7PA 3PX3A 4CRWB 5JR3A 1RAGA 1AS2A 2O6HA 2WSYB 4P4SA 4FFDA 5HIIA 3C7KA 4M1ZA 4W5JA 1A69A 1YZLA 1NPDA 3SFVA 5HKAA 4FU0A 4PF1A 1JJFA 1PR6A 1WM1A 2BUAA 3GVXA 4L0MA 5ALYA 1X7HA 1QNLA 5BW8A 3IXQA 3R7WB 1VE7A 2Q5CA 2VL7A 1NRXA 2CNWD 2Q4TA 2VHYA 3W7AA 2PUFA 2O2EA 2DPGA 2CDCA 1JA9A 3LGAA 1OLXA 4LXIA 1ZJYA 1SVLA 2CWWA 2VATA 2IYUA 3JQGB 3LVRE 5GGXA 2KE5A 4U5QA 3T7IA 5HW0A 3WL8A 5JNRA 2IDZA 3O3NB 3O4GA 5IAKA 1DKUA 2VJDA 5JZBA 2YVUA 4BU1A 4WE3A 1U2ZA 3M9XA 1TPYA 4C4PA 1J0XO 2ASEA 2O0LA 4P58A 1XXHE 3A04A 3RRZA 4ARAA 2XGMA 1AOXA 1G3UA 4O2BB 1ISHA 1F2TA 4D4KA 1I7SB 4C9BA 1QQAA 2VRWA 4QOSA 4ZDJA 4PWZA 1HRDA 3FSGD 3IEIA 4RORA 4K9PA 5F23A 1F06A 3H7AA 4Q66C 2R751 3I92A 4N18A 4NMXB 3TKYA 2FX3A 3U3KA 3VRHA 3ADDA 4Z8XA 1AN0A 3L02A 3UCEA 1W4AA 1GUFA 1Q1GA 1NKVA 4H60A 2YQ5A 3UKJA 1J99A 4MCIA 3TR0A 2I6TA 2MHCA 4CL8A 4N9WA 1KR5A 2YNMA 1OX4A 1H2AS 2HFKA 2FR8C 5ALLA 4JT4A 5BP7A 4MKGA 4YWJA 2F62A 4KQEA 1NONA 2BKEA 5IDYA 3QU5A 2J0EA 4HYEA 3EZGA 5SYMA 4QQRA 3V2GA 2PTGA 3DC2A 1P9LA 1E1KA 3TTSA 4C22A 2BKXA 2GOYA 3WGUA 1UC5B 3ZDFA 4OU4A 1LW6E 1J5EB 1ZUHA 4RVOA 5FO0A 3IBGA 5E1BA 1EQUA 1NJ5A 1SWVA 3CKMA 4GPTA 5DXFA 1BE1A 4RMGA 4UPEA 4JJKA 3WJAA 3HM9A 3S8MA 1CX9B 1JFFA 1YZVA 1QVWA 2CZGA 4Y9UA 2WOOA 4MYTA 1F8FA 2GKGA 3DT6A 3GEDA 3MXTA 4XGKA 2Y4OA 4IDPA 1JSXA 2YHUA 4LZZA 1RQGA 3UF0A 3ZWBA 4O02B 4AJKA 5ULLA 4D80A 4IG9A 3WWCA 3ABIA 4UVEA 2V4UA 1FJXA 1PSDA 1GDHA 1RNLA 2PUWA 4FYYA 4JL6A 5CB4F 2GDZA 3Q10A 3KZCA 2F8MA 4UZSA 3KAKA 1CFZA 1LZKA 2EW8A 4N5NA 3PD7A 3M2PA 4KWCA 4MXDA 3NW9A 4RFSB 3R9XB 1QIMA 2PSDA 3GDOA 2L42A 4HDMB 1I5EA 4V02A 1LJUA 4L7VA 1P60A 2XYGA 4BL5A 4E08A 1Q1EA 1G98A 1ZD4A 1VI5A 1OIVA 4BZQA 2QYOA 3N8KA 4Y1RB 4O08A 3ZDDA 5HILA 1SUEA 5JAIA 4QOHA 1CUAA 1MQAA 1NSFA 1MH1A 4XGRA 1Q6ZA 4FLFA 1GUZA 3FD8A 4F2HA 4Z6KA 5CBKA 1XG5A 1T5IA 3U4IA 4DJFC 4N4AA 1NNEA 1I1QB 2D62A 2XTMA 3FKSA 4X84A 2FMTA 2XQGA 3GARA 5D5QA 1NZJA 1RACA 4NCAA 4PW0A 4BKQA 4K03A 4MPDA 4NZ9A 3CLTC 4EB6B 5FTJA 3ZV3A 1JH8A 3O2JA 1I2MA 1L5KA 4EECA 3QWBA 3PDJA 4GE0A 3ZU6A 4PCAA 1QHHB 3NYQA 1W52X 4GQBA 1NJGA 2DBQA 1SXJA 1XLVA 1JHXA 1SN7A 1E9BA 3EA5A 4CIYA 5JZMA 5DB4A 1KWKA 3KTOA 2G7ZA 4JLNA 1R8YA 3G0BA 2BMDA 3RAJA 2WZCA 1CUIA 4EUFA 5F3RA 3PDHA 1RE0A 1O0SA 1VRWA 1X9IA 3NHBA 3MT0A 5FLEX 1NLZA 4EOGA 4EX6A 1V8ZA 2RHTA 2WPDD 3RYIA 4PICA 4TYYA 5C4GB 2H9AA 5FOVA 4OXRA 5FV7A 2W6NA 2IV3A 1Z26A 4V1CA 4ZOLF 4C0KA 2IQ5A 3VYTB 3PFIA 2JFVA 3A9TA 3H2SA 4E2YA 4FT2A 5DX0A 4FFPA 2FXIA 2BCJQ 3K35A 3RU2A 4WNIA 1KO1A 2FW0A 5IJ0B 1DKPA 1R27A 2PKRA 2CT8A 4W7HA 2CSXA 4KGZA 1KJ9A 2AMLA 2DE0X 5CA0F 2GO1A 3LZCA 3TXXA 4TXJA 2GHRA 3OSZA 4TPKA 1IUOA 1G4HA 1NF2A 3QG5A 3CVYA 2GEJA 1SC1A 2HNBA 2Z8ZA 3FTDA 5GPBA 8OHMA 4WBNF 4MX8A 1KZYC 5BRAA 1QORA 5TMDA 2AOXA 1DEOA 3P9NA 4R3NA 2DFLA 1KKLA 3FSEA 1A98A 5E4FA 2I0FA 3SC2A 5DN6D 2Z4TA 3GFPA 3KSRA 3GMIA 2J46A 5BQ3A 2X9NA 1JGTA 4HPXB 4FFBB 4KQHA 4MDYA 1NW4A 2ATEA 5TY0A 3H0CA 1N8NA 2PE5A 1FB5A 3JYNA 3QLTA 4F5EA 5IKMA 4BXOA 3NNSA 4FGLA 1SKYE 4TUYB 5EI5A 1FTGA 5DBEX 3QMVA 4M98A 1ZIPA 1Q0TA 3OPYB 1G20E 5IM4A 1TPZA 2VDUE 1T9GS 4MINA 3T4XA 4XVQA 1K5DA 1P77A 5AOBA 3TVTA 4C2BA 4KMMA 3I8XA 5F2NA 1KH2A 2GPNA 2QN8A 2ZYVX 3P4XA 3BRQA 3ENWA 3L82B 2UKDA 5DWQA 3DVAB 4QOFA 3U4GA 3U6KA 2QRNA 4ZT2A 4CR7A 1G9SA 1SNYA 1XZKA 3ADOA 3NRJA 1XDSA 5ICEA 4BO7A 4G5YA 4KGXA 1R9JA 2BY4A 1F3LA 3PC8A 5K09A 2RGDA 1PD0A 5B4VA 2PRSA 4MQ4A 3SYNA 1T9GR 1GXSA 5H0IA 3RFCA 3SX2A 3VDRA 4GM1A 5F7ZA 2ZSBA 4Y18A 1AB5A 1QC5A 5FNVF 1ENOA 4MYHA 4CL2A 1LBIA 4BTVA 1N1GA 1VQ1A 1G42A 2GLTA 2P3OA 5BNTA 1NFRA 5ITWA 5IBPA 4ARUA 3BZBA 1QHIA 1L7PA 4D98A 1T2UA 4TL7A 1KPHA 1P7VA 2FEOA 4MIYA 1G21A 4MYSA 4OLBA 4F84A 1VA5A 2QTFA 1JWBB 3GQBB 1UWCA 3UXMA 2HDWA 1SVWA 3HA2A 4HEHA 2FSHA 1ITZA 1NAIA 2V45A 3DA8A 4RBNA 1E2UA 1E6EA 3C3DA 3PL5A 2H5EA 2WM2A 3ZHVA 2PMEA 4D82A 3HGTA 1C9KA 1KO5A 1SXIA 1PTKA 3ND7A 2CBZA 2WAYA 3P2IA 3EOBI 4X6UA 2OCAA 1YQDA 2CN1A 2WZBA 1GZ6A 5IBCA 1KOJA 2KSQA 5T4BA 1QRAA 4I4TF 3FOFC 1Y6ZA 1L9KA 1Z0UA 3AEQB 4QPZA 5FFFA 4LHZA 3MTBA 2OGTA 2B7BA 2FSVC 2X2OA 2G6BA 1FL9A 4HADA 4KUGA 4L9RA 1P1CA 3WYAA 1TYEB 1NULA 2YICA 3RFFA 521PA 1Y8RA 3D4BA 5DFAA 4DEVA 2SCUB 1NRJB 4YT5A 5C31A 1E2EA 3CUSA 5HUQA 1FDRA 1DC4A 3PC7A 5JG7A 1KYIA 1WPRA 2RCNA 2WIJA 4MITA 5EIXA 3UH1A 3TRDA 2C4TA 2O05A 4BLWA 1G8GA 3Q2IA 5HWSA 2O8NA 3CF2A 4X8OA 2J3HA 2W4MA 1PNOA 1EBBA 1YA4A 1YZKA 3EW9A 3F96A 3R77A 4GPD1 2DBZA 4B0OA 1ULZA 3BJZA 4LGCA 1ZG3A 5K3OA 1JH9A 5J3JA 3GQVA 4UUPA 5CT8A 1OBHA 3OY2A 3K5IA 2FJPA 4LHYA 4OL0A 3S5UA 3TM5A 3VU3A 2AJCA 4L3OA 1R10A 1CRWG 1Q7GA 2F7SA 1Z22A 3AKEA 3NLLA 1C4XA 1HGXA 1H3NA 2ORVA 3IUBA 4RJKA 1NGSA 3ZDAA 5HF8A 4QC2A 1NHGA 4NMMA 4BZWA 4EDFA 4GVXA 3EXAA 3DUFA 3TECE 5LYJF 3L07A 1NR1A 1TTTA 1RBYA 2Y1WA 1L7EA 1UC9A 1ZCZA 3KSDO 1E7YA 3AUAA 1NVFA 4XGNA 4IIXA 2WB2A 1OV4A 2JS7A 3BXPA 3UWPA 1I94B 4Z4IA 1P4RA 2P2GA 1DO0A 2ZJ1A 3ISTA 4HH0A 4R0VA 4GYKA 4V24A 1C9YA 4DM4A 2M32A 3U56A 1PG2A 4QOJA 4BJ3A 4MA0A 5FRDA 1SG0A 2J3EA 4CLHA 1Q7EA 3CN7A 3TFQA 1JLLB 1JIJA 1ZM9A 3N8DA 1IY0A 1T5OA 1UBRS 1JALA 3FR8A 3H2GA 5I5GA 2GKSA 2OXIA 5IXJA 3ME5A 4HEQA 3SS7X 3DTTA 3PT9A 3ZCXA 4QJIA 1BNCA 1QRRA 3VYUB 3QKWA 5AUOB 2AZXA 1IN6A 1ZM2A 1T15A 3A3NA 3I28A 4HFNA 1XVIA 3CRW1 4Z4HA 4B2YA 2E0IA 3E8MA 5THQA 4CYMA 2PX2A 4JI8B 2YW2A 8ABPA 2HREA 2FFQA 2JLQA 4FNMA 4RMIA 3RSFA 3WWZA 4EPXA 1U11A 1R15A 1OA1A 2G09A 1CUBA 2A5GA 3MC1A 4NIMA 1SR8A 2J5QA 4OQEA 4PAOA 1ZK4A 2XWQA 4IQ8A 4MKHA 4UJ5A 5FCDA 1S89A 1GKKA 3TW8A 4EY8A 1XPUA 3IEMA 4HQ0A 3DE4X 3RDPA 5K5EA 1Z3CA 4PZUA 3RAGA 2HV9A 4AZSA 1Z4JA 3DFZA 2O1EA 4BJHB 3L93A 1LZLA 4Q3EA 4CQLA 4DLYA 1BD3A 4HDCA 5L3SA 1NPTO 3AUSA 3UBMA 3QXGA 4UXJA 2PD6A 4R8KA 2OBXA 1PKEA 1QF9A 3LECA 4OBWA 5HCIA 4B7AA 4Q9HA 3MELA 3K70B 3GMSA 1OAOA 1RT9A 2OBMA 5G40A 3IIJA 1G17A 4X1KB 2JGDA 3UN1A 3IBYA 4YCCA 4MZXA 1Z88A 1XF9A 3VOTA 4GC5A 2ZYGA 1W4BA 3E9EA 4N0EA 2C2XA 3J80A 1UEIA 2O2JA 2QMHA 1FVXA 4GR9A 4R7TA 2CLEB 3V4ZA 1X92A 2ZCJA 5AOAA 2XCLA 3ORYA 1LSUA 4YRRA 3HXOA 4U00A 4IOLA 4BCDA 1A2OA 3L1HA 2PUVA 4HAZA 2XBMA 5FPPA 1L5MA 3P96A 4DAOA 3DV0B 3K92A 1T3LA 4UZFA 4GLOA 2XT9A 1UJ6A 3N8IA 1NSTA 2OHIA 5HK8A 4ZOCA 3EXEA 3T4EA 3UHFA 4CTJA 2CL0X 2XDAA 3K73O 2QMQA 2QTLA 3NP7A 4JASB 4Z7QB 1Y1PA 1JAYA 4FWBA 1PR3A 4S1TA 1WHTB 3IDFA 3PS9A 4U8HA 3ZE9A 4X92A 2G07A 4HDKB 1Z82A 4N9QA 3OE1A 3U44A 1IZ9A 1RLOA 4GD3Q 1JKXA 1L5HA 3FE2A 3I6IA 3L6BA 2VEDA 1G7RA 4Q37A 2RJOA 1R0KA 2A9PA 4PLHA 1W19A 4QU0A 3ZG6A 4IWYA 1HF3A 1I9CA 5FH9A 1DZIA 2ODPA 3AF6A 4LFAB 4RCYA 1PZEA 1T6ZA 2EIXA 1ZHFA 4LPSA 3OEHA 2VJKA 1OX6A 3RBXA 1U9ZA 2TRSB 1D0SA 4HL6A 1EVZA 4FEAA 4HDNB 3ASZA 4DLRA 3DHWC 1YRLA 3KE8A 5DKFA 3B7GA 3WGHA 1WHSA 9LDTA 2ZWAA 1U7ZA 1U0GA 2V8OA 2W9XA 3AEZA 1EBFA 1ZP6A 4RPKA 1WUJS 5ITSA 4EPVA 5LZ8A 4N54A 5DHRA 4QG7A 1MJGA 4MZDA 2YNMD 4WKBA 3A4YA 3DAGA 1Y5RA 2PT5A 3SE0A 4FQ8A 1FU7A 5H9VA 3FPFA 2UZ1B 3HKCA 2B1RA 1JFLA 2REQA 5DH9A 1G38A 2VUTA 2WD9A 1JU4A 5FA5A 2RHLA 4FE4A 1GPLA 3TIGA 1V9LA 4TQAA 4AKGA 2UVPA 2WWXA 4KO2S 3EGVA 3KUCA 3HP1A 1S3GA 2C0QA 4DJTA 3KQNA 1E2HA 2EKZA 2E1PA 5KAPA 4EUEA 2EP8A 3Q3HA 3AY6A 1Q1ZA 4GLLA 2GAFA 3CURA 3OTHA 4HFRA 3BWXA 4M9CA 4OLAA 1O9BA 3TKLA 4HAIA 1FDVA 6REQB 3L5OA 1DC8A 2YBDA 1NC1A 1XYYA 3F0TA 4KQMA 4JBXA 4BX0A 2HJVA 4DBLE 4P5EA 2MWMA 2VTKA 5J58A 4RY8A 2JFFA 4QYSA 3I61A 3GGSA 1EUCA 4IHKA 1Z5PA 3P9QA 1I1NA 4EKNB 5A2QA 2VAPA 3D0KA 4X61A 1ECCA 1PWHA 2EKLA 3OJFA 4MVJM 2JCXA 2P3QA 5JQGB 1C3VA 4XUDA 5FADA 2X86A 4R1LA 3IOCA 5E9QA 1E7RA 1K7YA 4BASA 1PT9A 1RXUA 3P9PA 4LRQA 4H9GA 1Y4DE 4JYCA 3AEQA 3FDJA 1UZLA 2IC5A 4WK2B 5MGNA 4ESOA 2G63A 1ZX1A 1I2AA 2ZB7A 3DVRX 1QKIA 3EZYA 1KMHA 3EZNA 1FNMA 1TYCA 2IXAA 3UGTA 1D2EA 5LC1A 6LDHA 3UAXA 1BMFD 2DCUA 3LDGA 4Z9XA 4YACA 4CF3A 5BWOA 3VDQA 3FOBA 4FYKA 5J4VA 4LF6B 1KP2A 3PD1A 5IFLA 2A1TR 2QTZA 1CIJA 2AWOA 1P1HA 3C24A 1DXHA 2X6RA 1V1MA 4Z0NA 1UAAA 1IUPA 4CDMA 1GNVA 1I2ZA 3OT5A 4IJMA 4QU9A 2IUEA 1EFLA 3KPUA 1V5EA 3W2FA 3LUFA 4KRGA 4C88A 1T9HA 2DERA 3C8DA 1DQRA 3EGOA 4A3SA 3INRA 1ZN8A 4YYEA 3HZHA 2Z9BA 3ID6C 3KYBA 3OLQA 3WIVA 2QTWB 3C45A 4ZPXA 3EVBA 1H5QA 4P32A 4CMCA 1VHJA 3FR7A 4EBFA 5L53A 2GTPA 2CVPA 2KLHA 2YV5A 3WL4A 4D9IA 1JB1A 4TKVA 5ALHA 5BXQC 4RVNA 1ZK0A 2R6ZA 4GRAA 4QDTA 4WFJA 3FWZA 4MRAA 2PJZA 3TW0A 1HLFA 4NYJQ 2DVMA 3QV1A 1MXFA 4DV2B 2GCIA 2JH8A 2GUWA 2Q29A 3QYAA 4DLPA 1W2WB 1EWVA 3ZKWA 3LP8A 1UC4B 3T7TA 3DGFC 3J7AC 2IYLD 2HSJA 3FFTA 3IELA 4TYPA 3NFYA 1E8DA 2JLRA 1YNSA 5C3UA 2Y99A 4TSFD 2J33A 2VPTA 1REQA 2VUSA 5EIEA 2C2GA 1JQDA 1X14A 5IVIA 4K9NA 1SZCA 4V0RA 1PNVA 4GL4A 2BI4A 1ZMTA 2WAAA 4IIJF 4P2BA 4PZPA 1V2GA 5DLQC 3W4KA 4F3RA 4RTQA 2IUFA 1KPGA 1YR6A 2C2YA 4G89A 3HYNA 3RRNA 1CS0A 3TOSA 2HHJA 3WI7A 5I3ZA 2POQX 3LWNA 1Y5NA 4JJ8A 5IKOA 4PFKA 3G2IA 5KO2A 3K2QA 5CYOA 2Z09A 1WY5A 3LI2A 4C7OA 1ABFA 2BFDA 1FXSA 3KU4A 4B3RB 4CLXA 3BF7A 3EXHA 3I9FA 3ILHA 1MTOA 4EUNA 2ZK7A 1P73A 1QV6A 1KJIA 2Q3EA 2FZVA 4ZU6X 4D25A 5IHXA 4B6GA 4R3WA 5BN4B 3SJCA 2CBGA 2JVIA 3UWMA 1XL1A 2I3ZA 4B75A 2JB9A 1O6BA 4UNRA 2VHXA 3WIEA 4ARZB 3GFFA 4DPKA 4S04A 1GQFA 1HE8B 2ZBPA 2AE1A 3F1KA 2XIQA 1AV7A 1OXXK 2X40A 3QPCA 4I9NA 2JAWA 3WLLA 4BLSA 3A9RA 3TTTA 2FETA 3O75A 2BI8A 3HI4A 1J90A 3PXBA 4YFVA 3AL3A 4OUDB 4O4HF 2XEXA 3AR4A 3K16A 3R3HA 4FW9A 4U6SA 2FE1A 2XBUA 4UOQA 1XWFA 2F1KA 4DNQA 3I72A 5AJTA 3RARA 3V00A 1LA2A 3H5LA 1QO0D 2R6FA 3S55A 3L0SA 4MPTA 5GTDA 2ZBEA 4FOSA 5EWJA 2V7EA 1AKEA 2NG1A 4IUYA 1NW6A 5B7PA 1JEQB 2V5UA 3V9AA 2MYUA 1HNZB 5JZSA 4PZZA 4H1HA 3RSQA 1B1AA 1Z25A 2GBCA 3HEBA 5IEBA 1JIUA 1Z8DA 3CLHA 5KREA 4AIRA 1ZK2A 1ZGBA 1AHHA 1WP4A 4HRVA 2VXCA 3GH1A 4UM9D 4BGUA 1K5PA 2LVBA 2OB1A 1MF7A 3KEGA 3X1WA 1Q0HA 4R83A 3MGCA 3KQPA 4PC7A 5CA1B 3AHDA 2BHLA 3X1JA 2QM3A 3A11A 4RKRA 3ZE8A 4ER3A 4YCJA 5EERA 2YYAA 4D9GA 2A58A 3O2QB 2PT9A 4ZAYA 3PE6A 6PFKA 1KDYA 4RGVA 2D1YA 3H19A 1DP4A 1E6MA 1E62A 1PFKA 4Q16A 1IC6A 2GJSA 3PQEA 1GPWB 3CX7A 1NBEA 1XCOA 3F4LA 1FNSA 2OV8A 5JH7F 3ZJ5A 4KW7A 2NNWB 5L3SB 3IKTA 1LC0A 2A6PA 1MDFA 1YJXA 5HE8A 2O2YA 4GE3A 5ILOA 3ENKA 4LF4B 3GWGA 3LFHA 1AURA 3WMGA 3K3PA 1UZNA 3KJHA 2XCRB 3VU9A 4CM3A 5FB3A 2E49A 2Y1DA 1WXXA 1QHHA 4X1IA 1CV2A 2ZRHA 1X0XA 2QUAA 4EBBA 4ZFNA 1XTPA 3NNNA 1I33A 4CCAA 1J56A 1CUHA 5KKAA 4ENRA 4BB5A 4R16A 2V4ZA 5KNDH 3SSNA 4JI0B 3GT7A 3D2BA 2JVJA 3SEQA 1IAQA 4DRXB 1JDBB 1VCMA 2I9PA 3STHA 3LLVA 1SC4A 2AFIB 2LWIA 2OT3B 3CEMA 3LLCA 3Q3GE 4HX5A 4JBIA 3IUPA 4XEUA 4LFCB 4EJFA 5KNBD 1E3MA 3MM4A 1CRLA 5CX1A 1G5TA 3EY9A 3DG9A 1O97D 3G88A 3H11B 4N0MA 5JI2E 2CC2A 2AHRA 2REQB 1J2UA 2G9VA 4ZI5A 4RAQA 4EHDA 3RYCB 1OH6A 5JS7A 1L5WA 5TEVA 4F9GA 2AEFA 2B2NA 1X6VA 2B8NA 4TL9A 1CUFA 1V41E 2VYFA 3OPYI 1UBEA 4MQMA 4RQAA 3J81k 1I80A 3KUDA 2HMSA 3UPDA 2B4RO 5JLJA 4KR3A 4GZ6A 2XNJA 4EQ6B 3HU3A 3FROA 4D0RA 3KQSA 1XPJA 4MOWA 3BXGA 3GJSA 4OPMA 1DBRA 2ST1A 4EYQA 5LP6B 4PO8A 1UJNA 1UZUA 5LP6F 1TU0A 4ALKA 5FTWA 2C7RA 3FDIA 3P0JA 1ZOSA 4GXTA 1WDTA 2R7LA 2ATIA 4EKYA 3NAQA 4EENA 4Z3DA 4JI5B 2G4CA 4BKOA 2ETVA 1NUUA 4NH4A 3QF7A 1L4HA 1JIXA 1JDUA 2WQZA 1SQSA 4W9NC 2YWBA 5ALRA 4P08A 2BFFA 2QTAA 4K46A 5T6MA 4D3XA 4PS1A 2GRUA 4ZCPA 1Z4QA 4DUPA 2IK8A 1EP1B 5AJHA 1IJKA 4UBIA 3TO5A 1SXQA 3IPRA 4I99A 3MYYA 5DLEA 4DDTA 5JH7A 1QCYA 1E66A 2VK4A 3S28A 1A7KA 3UPUA 2FN4A 2QBYB 2G06A 3E4DA 4ZTBA 3BXXA 4YLGA 1SA0A 2I8CA 3WB1A 3J81A 1XMOB 3AEUA 1T1JA 3ZDBA 3D54D 2QDKA 2VNHA 4C4TA 3G0OA 3OFVA 5I8PA 2B78A 3IDSA 4FD3A 2G1KA 1P4JA 3AT1A 4LRXA 2C97A 1KFCB 1DXYA 3NM5A 2C4WA 4JODA 2E18A 3RRXA 3K0CA 4YAGA 4EFMA 4R0NA 3W8DA 3VJMA 1DDIA 2GYUA 4WBXC 4LFBB 2ZI5A 3P2MA 3L8CA 3O8QA 1FFYA 2RB5A 5ES4B 3TKAA 2Y1LA 5E9JA 4KIJA 1DBQA 2H1IA 1CQIB 3UBTA 1S2OA 1U81A 2MJLA 4YCBA 3RUAA 3OFSA 3C7TA 1SCUB 2ZJOA 1UPXA 1RMTA 3H3JA 4J0HA 3V2IA 3KD3A 4IJ6A 2ZVQX 1WB9A 1JKJB 2ZRGA 1AA9A 4I08A 3TTYA 3NU1A 5B1IA 4XFDA 3NALA 1PJ8A 4FYMA 5EUMA 2IW1A 2PU5A 1UKEA 2VZ0A 5KDOA 1I4LD 4OQMA 3H6GA 2JFZA 1OOEA 3H5VA 5GGYA 1XYGA 3IA2A 4DA0A 5TEWA 4A9AA 1ZVQA 2XKJE 4JL5A 4DLVA 2QW1A 2QTMA 2PMDA 2C4UA 3FYUA 5KOYA 5J2UA 2HOQA 2JFGA 3EZ9A 3OIDA 1LD3A 2I3DA 2XI4A 3CNLA 3P94A 2XKKA 1SXGA 3K9HA 3HXLA 5IYZB 4ZVNA 1S2LA 4LC0A 2RK3A 3GI1A 3STWA 4BQRA 2ZPTX 3M3HA 4XVUA 4R1NA 1QIHA 4B4DA 4BNHA 3TSOA 4DMLA 3TM4A 1PBNA 3R9KA 1TF7A 4DAEA 2JEZA 1IFXA 2PZGA 2CNKA 1EE2A 5LYYA 2H7CA 2ICAA 1Q14A 4JX9A 1T0JB 4C2UA 2AZ4A 2HPVA 3EGDA 2YYSA 4Q4CA 4Q3DA 1KJNA 4FSXA 1CUCA 1AO3A 2EX0A 2I62A 2P4UA 3FFXA 5TNXA 1ZIXA 5ER9A 4B7XA 2BGGA 1YS7A 5JATA 4TXHA 1R6DA 1Z6QA 2CLKB 2GCOA 5F21A 2P5TB 5IANA 4UASA 5CW1A 1GZ4A 4HRXA 3OQIB 4RPCA 3CR3C 2H8KA 1ZW1A 4FM9A 3G2QA 1F8UA 5H80A 3NO4A 1USUA 5J2TA 3LIPA 1G41A 1HTBA 2JI6A 3KCNA 1L7NA 2DFVA 3OJ0A 5FL3A 4OGKA 4YJ3A 4QHTA 5PGMA 3LLMA 5LZ5A 3OWHA 1KQFA 3BILA 4M1WA 3UA4A 3DOOA 2H1LA 4HWOA 2VA9A 5JCOA 4AMVA 5BR1A 1XNRB 2XB8A 2UUCB 1ICEA 4LYYA 5AKGA 4ZYWA 4YRMA 4GPAA 1JQAA 4NCHA 3C87A 1H66A 3P4UA 1OLUB 2PUTA 1KVRA 2CXXA 2AYZA 1N6NA 1OWPA 3IAS1 2FLWA 2OAQ1 4MV0A 4TWBA 3V8BA 3AVUA 3G79A 2X9GA 2DB3A 4QBFA 3FFBA 5CNKA 3RVKA 1XV5A 3H0KA 3M70A 4YCAA 2BBSA 2JVKA 1JAHA 2LXNA 4DLKA 5LQNA 2PU7A 3DC7A 3CEJA 3NDIA 1YBMA 3BH6A 4FJ2A 2MINA 2RGXA 3HU2A 4PPNA 3L7JA 1FDIA 4HG2A 4ZVTA 3SZGA 4CT5A 4EGCB 5L95A 3ZHRA 4E5YA 4TMVA 5JRJA 5G0UA 3ZW7A 1J70A 4G4GA 3BSSA 3W5VA 4NCJA 3U7IA 3MWEA 3WJ7A 2HHHB 1T2CA 1ST2A 2BHRA 1E3LA 1F5SA 2HB6A 2R87A 4KE9A 3RJ5A 2IBMA 1XMQB 2Q7XA 3L84A 5BSGA 3E84A 3BWCA 3L5KA 5BSKA 3I2YX 5HDQA 1JR3A 3VHQA 2P6OA 3KB8A 2J09A 3F5QA 2I54A 1E94E 5EWMB 1C4OA 5HZGA 4NMHA 5CIQA 1L7MA 1DAFA 1IPEA 3A1TA 3I9OA 1A5ZA 4FFSA 4IYRA 4PLWA 5EMMA 3PEEA 1KBZA 3X2FA 1TEXA 3AR5A 3IJRA 4DILA 1YIDA 4RVDA 5AKIA 3UAVA 4UOZA 4NC9A 5KZMB 4QFDA 1B14A 1BEEA 1M2GA 3E5NA 4W8HA 5KMGB 4YFYA 1QU2A 1C0PA 4F71A 3LF1A 3LUJA 3AU9A 4CM4B 3IMGA 4PXYA 1ZQ1A 4WZAE 5IXYA 1M8JA 2W2TA 4DCMA 4LRWA 1DI0A 2FKNA 2JRLA 2P6PA 2VHUA 1SC6A 4CQMB 4C2TA 2XUDA 1JDVA 2AG1A 3ZCSA 3OD1A 1K89A 4BNWA 1EVJA 3PQ4A 1QHEA 3JASB 1NVBA 2OEPA 4MUNA 3W8FA 2RGUA 3SM9A 4YJFB 3LT1A 1SZPA 2O2DA 4L75A 4V0QA 2FW7A 5IH3A 4P6VF 3A28A 2V03A 4BNLA 4L74A 2WLSA 4A92A 3Q8XB 4I1OA 3EZFA 1XVAA 5EJ5A 4OP3A 1X8LA 1ZRSA 2O9JA 4N1AA 2WTAA 4RZQA 4BEVA 4TLMB 3LPAA 3WBJA 1A5BB 4ZHQF 1O0BA 1Y5IA 1JHMA 2HIMA 2IHVA 4RLQA 2C7OA 3B36A 3DE5X 4MLCA 1SCNE 2AC2A 1CZHA 4NSNA 5DYYA 3UEOA 2I9KA 4A1OA 4DMMA 5CB0A 2B9VA 1FVOA 4B31A 3TJRA 2GPWA 3DFMA 3LTEA 3C6XA 5THKA 2HU2A 3BMNB 3GDGA 1Y6RA 2ZGVA 4N49A 2BMJA 4Y9RA 2CL7X 4JOBA 3SFTA 2J3IA 4RVCA 1FLAA 3AR6A 5E2IA 4OU5A 4L4RA 1V4BA 4DNOA 2IYTA 4HDNA 2WMNB 4O1MA 1PGPA 3TWOA 4Y6SA 1X80B 4UTZA 1Z63A 2ZWPA 1X7GA 2AV6A 4FHZA 4GNRA 5CB4A 3VJRA 3NKVA 1N2IA 1Q11A 3OP4A 4AXXA 5IT0A 3I5YA 3MBOA 1TZKA 5AVZA 1E3WB 3HYRA 4DCTA 4RTPA 2FPWA 1NBMD 2VBCA 4N82A 4BP3A 1TECE 2Q5OA 1U6KA 1SVIA 4UREA 2BUBA 4WJKB 4BFWA 3G23A 1R4MA 5DTEA 1HNWB 3SICE 1NLMA 1UP7A 2H4FA 1SKBA 2ID7A 3ZCPA 2O5CA 3A05A 1G16A 1PS9A 3LL7A 1GQYA 1PR0A 3E1GA 1FE8A 2AXEA 4XOUA 4UU7A 4ZI3A 1EFRA 1CXZA 1VL6A 4R7ZA 3IBCA 1SO8A 3AESB 1HX7A 3OHSX 1GV0A 4KO8A 1Y82A 1Y9ZA 2OG2A 5CK4A 4YR7A 1CUUA 1YFZA 1Y8QA 3SZOA 4U7GA 3UK1A 4FFRA 4RJ2A 3WRWA 4ZO8A 4G84A 5A3RA 1Z2PX 1B2RA 3FCYA 2ONCA 1SHTX 4RAOA 4JLJA 4YRTA 3G9XA 3R0QA 2FUG6 121PA 1WF6A 3FYCA 1OLOA 2XXBA 4MV7A 4BRWA 1BXRB 3DT9A 1PJSA 3ND9A 4KL8S 4QE3A 2XGJA 1FZTA 2OO5A 1LB1B 3LIIA 2JD2A 3SHVA 5IJWA 3PEFA 3F8TA 4F56A 1OB2A 2NTJA 3TBHA 3BD6A 4BO6A 2QNBA 1U0LA 3C3JA 4AQ7A 4HLNA 4HBZA 4ZMSA 4XJVA 2A0XA 2M1XA 1NX6A 1BGXT 1P2SA 3NXSA 2X0JA 4IV8A 5ERXA 4NARA 4BFYA 3U09A 1FTYA 2OBBA 3G5LA 4LJ5A 4YRDA 1JZSA 3EDOA 1U8YA 5AW9A 1FS4A 1E0SA 2HBQA 3QIAA 4EHAA 1C1XA 3DOEA 5BWNA 1DRVA 3R7AA 4A27A 1TQ4A 2EC5A 5A71A 2GVZC 4J0QA 3QTLA 2W6ZA 4MICA 5DP1A 1E7SA 3AM3A 2A0UA 1GWNA 1H85A 3E58A 4QU5A 5C0OE 5TPWB 1L7RA 2NO5A 3QENA 4FC6A 2GJ8A 1Y1QA 4BNYA 4E30A 4F5YA 2P65A 3VSEA 4W63A 4EGQA 5LQAA 4WUVA 1JFFB 4DMRA 5IM5A 1K6EA 4ZOBA 4CKZA 1MZPA 1UR5A 3MGGA 1ZU5A 1BDMA 2X2PA 4U9HS 3IVAA 3VR3D 2WF7A 3OAAD 4GXQA 4DCUA 1PJ3A 2XE7A 4M54A 4GKAA 4PLYA 2ZRLA 4WESB 5IAJA 2NUTA 4HXGA 4EW6A 5JFTA 3SKXA 1A77A 2W2KA 4V2UA 1E3QA 1P72A 3PHHA 1P9OA 2IHUA 3P9KA 4B44A 3OKPA 4LRSB 2GTIA 5GONB 1NT4A 4Q4JA 5J5AA 3AETA 2IHNA 3U0VA 3UB2A 3B1KA 1U1FA 4R05A 3KQHA 1TC1A 1NI3A 4JWKA 1DINA 2ALJA 3WRVA 4P3KA 5KNBH 4TWAA 1SZJG 1Z28A 2PV0A 3GJ4A 3KVYA 3B9PA 4M46A 1BFDA 2CLFB 5CJ2A 5AW3A 1M73E 2CW5A 2RBEA 2BI7A 2RHWA 3E22B 5TSDA 3TSCA 5FOXA 5GONF 4WBNB 4ZEOA 1V5FA 3FCOA 4BRZA 4RTSA 3V55A 1CUXA 4UAGA 3PIRA 4OHXA 3LBYA 1HDEA 4BCBA 4CKXA 2XE6A 1SG9A 5CURA 2C98A 3HYCA 4IJQA 3HXQA 4IDBA 1EFKA 3ROGA 1XEXB 1CY8A 1KS9A 2FSSA 1M3SA 2WNSA 1A0OA 1XRQA 4AY4A 3AFNA 4EPWA 621PA 2BSQA 4LVOA 3NHKA 4UBLA 3MQ2A 5TRTA 4O1HA 3RRMA 2ZPUA 3M5DA 3OF2A 2YWGA 1JDSA 2O2HA 3UV7A 2DHEA 2JLAA 1XQ6A 4D57A 1YJBA 4OL9A 3ZCTA 5K01A 2FV8A 3NDRA 5E2BA 4B43A 2HRZA 1KO4A 1SU7A 3CXUA 3EQ7A 3IAM1 5DTJA 4F9FA 1DBPA 1XDDA 4B5KA 1KMCA 1SBZA 2X23A 4NX2A 3S29A 1CUDA 2QUIA 2WUWE 5ALFA 2DCMA 1EFVA 3NJ4A 3B7PA 4OMDA 4D3DA 3GH3A 1G6OA 2FEWB 3QVVA 3WLFA 3I9KA 3MINA 3PVCA 5SYAA 5CFLA 1IBMB 1QP7A 1CE8B 2W43A 2H8GA 1TM3E 2H16A 4OA8A 4EI9A 4RZXA 4AKHA 1IY9A 2BBWA 2G9QA 4O33A 3RTGA 3RUCA 2GA9A 3C7AA 1TW2A 3MXOA 2C7GA 5B7NA 1WXQA 3C5WP 1KSHA 4HS9A 2G8LA 3GLTA 4FOLA 1DV2A 1SCBA 1M54A 2FTKE 2WA1A 4NAUA 4JFRA 4TOIA 3VPFA 3LY5A 3R41A 1YB5A 4K3UA 1QLWA 4Z54A 1F7UA 4ZGGA 1XJ5A 1H0RA 1SELA 2HGSA 3HJRA 5K3FB 3E8SA 3U9TA 3VZSA 4BN5A 3CINA 1UJ5A 4LTNA 2EFCB 2BKLA 1NOJA 1Q0QA 5KYNA 2UUOA 4BBJA 4Q1EA 1AH2A 2Z43A 4AF7A 2F1JA 4AG6A 3LDAA 4JUDX 5BVHB 2Q0SA 1VE5A 3BCRA 1Z36A 5FBWB 1UM9B 2XJ4A 1RJFA 3QW4B 4OHUA 5ELLA 3NOOA 4WXEA 2NZUG 3PNKA 3ZLTA 3CEAA 1P2DA 1U2RA 2PL9A 2NXWA 2PRKA 4FYWA 5DHQA 4HNRA 2Y67A 1HUQA 3JWEA 5ILQA 2PN1A 4FDUA 4FXOA 1W85B 1SVKA 3WGMA 3ANSA 5TQ2B 2HA6A 2VYNA 5CGZA 3KJEA 1Z73A 1P7CA 2J3KA 1NXWA 2FPIB 3Q6NA 2ZVPX 3LDFA 2AGVA 4O5AA 3QLJA 5FBVB 4XRGA 1CQPA 2IYVA 3LVFO 3M4JA 3ZBTA 4BJ6A 1F7VA 2CK3D 3B5IA 3HFRA 3VC3A 2Y1XA 3E18A 2NTYC 1D2AA 1XD2A 3LY9A 4KMOA 4V3CA 1RXYA 4FJ0A 3COSA 1TO2E 2WPDA 3NR2A 5K05A 2QP9X 3ESRA 3VTAA 5JQGF 3AL2A 3G68A 5FHRA 1C2TA 1HWYA 3RYFB 3V2HA 2JIBA 3IUSA 3OLVA 3GPBA 1LBHA 3ZY6A 5FOQA 2DLCX 1GNQA 3DOHA 4B74A 2V7BA 2PT6A 4GWGA 4QLAA 4TYNA 1U7TA 4HUQA 3JD2A 3H2BA 1GN9A 4YAEA 4X62B 2AOUA 1QV7A 2FW1A 3SJAA 2VHEA 5GOTA 5DISB 1XZIA 4OOFA 5H3HA 5HEKA 1XALA 4WT7A 3MTDA 4MP6A 4KSBA 1TVKB 3SI7A 1BQ4A 3VZQA 1KAGA 4TYQA 5CDHA 2FCAA 1N6HA 3SQMA 2H7YA 1YRHA 4LXTA 1Z6GA 3IODA 3ZQ6A 1G21B 1SY7A 3H8JA 3OQMA 1YBVA 4HLUC 5EJAA 2FAXA 1USWA 3BGWA 1C9EA 2X5KO 2CDNA 1N25A 3CPJB 4BKRA 3KB1A 3DMPA 2WWFA 3AQ4A 1UWKA 4QQNA 2BKUA 4NCBA 4GBED 1E77A 3O9VA 1SHZA 2K4MA 4ND5A 3AP3A 4NE2A 4Q00A 1TE2A 2X9VA 1H65A 3EQZA 2XMZA 3GFGA 3K0EA 4ZZIA 4R8SA 1EDBA 5A0VA 1WKVA 4X0EA 2W7TA 2V7WA 3GUUA 3NX4A 4FK8A 2PMCA 5AIBA 2G5PA 4UQPA 4HGNA 1VOTA 1C4KA 1LNZA 5JS6A 3HCRA 2XNDD 1YBAA 3GZJA 4C06A 3S2FA 4AAYA 2W2QA 1ZH0A 3EAGA 5HOQA 5E3HA 4Y2HA 3AHCA 4KK4A 1FRZA 4EFKA 2HXGA 2UYGA 3WR5A 5KYXA 2BPOA 3HBJA 3EQ2A 1PLLA 3OZFA 4DMUB 4X91A 1AZWA 1HI9A 2PGLA 4JVSB 1DEXA 4IO0A 1Q84A 3VR5D 1GVNB 3LKVA 4LK3A 1ZH6A 2CD7A 3H6HA 5DIZA 3DV9A 1VIMA 2WJ4A 2EBUA 4WASA 4LE1A 4K5QA 5BN1A 4BO2A 1KOGA 2GN4A 2EYQA 3I1IA 4KH1A 4OM7A 5G3YA 1TO6A 3FTCA 1FXUA 1ZXBA 1JBEA 2CVFA 4OFBA 1LF0A 5ECYA 4HPJB 2XY4A 4XXHA 3DL7A 2R7AA 3RKUA 3E5RA 4HEA6 3BAFA 1WJGA 3B38A 5EUBA 5HG0A 3U3OA 4AP6A 1CUGA 1D4OA 4DA7A 2FP4B 4C6RA 1JSRA 3A4IA 5CVJA 2PRZA 3EGIA 4FHGA 4PYIA 4QPNA 5DXJA 5JROA 3OE4A 4CF4A 2R8BA 1RWQA 2M6KA 3T0IA 1PT7A 2BRUC 2SBTA 2PH7A 2ZOSA 4LE0A 1PJCA 1YKSA 1P7YA 4K6FA 3KTDA 3PQ6A 5CLLA 3HY4A 4PXSA 4DCOA 3V3KA 2WT9A 4E5UA 1QOPB 3G5AA 1WDKA 2WY2D 1FP1D 1SD1A 3LWBA 1CZNA 4HOYA 2BD0A 4A36A 3VBEA 1ULUA 3LHDA 1CR1A 3MCWA 1OA0A 2BT4A 3OFND 1BTOA 4L2IB 2I6GA 2JL1A 4UDNA 1EX1A 3Q5EA 4DCNA 1X7XA 2I55A 4JUCA 4N12A 1B74A 3VKGA 4IKOA 1FVHA 1H3FA 3B6ZA 3EAFA 1VLJA 1NNLA 3INGA 3T7CA 3NJRA 1UKVY 5KTPA 2P2LA 5FNVB 3ADBA 4IJWA 3U5ZB 2K6GA 1JR2A 1F2TB 1S01A 1NVTA 3ETNA 5LL6P 3HB0A 1WNTA 2WKSA 3OLYA 2I4OA 1CLEA 1EVIA 2CXQA 4ER7A 3NDPA 1SUIA 1OWLA 1SBNE 1YS9A 4XOIA 2ORIA 2PM8A 1JDPA 1MX1A 3B12A 2E3JA 3FXAA 4KV9A 2IH5A 1J2JA 1ODLA 5I7EA 5CJPA 1A27A 1M8KA 5CT4A 2C31A 3ZZ1A 4GQIA 4JQYA 3VZDA 1VHDA 3DHEA 3L4BA 4LXGA 4A2PA 1ONSA 1CT9A 2UU9B 4JI4B 2R1VA 1QKKA 1J06A 3E81A 5LB4A 3FPEA 2HV8A 3IDQA 3TQRA 1IL0A 2I65A 4DANA 1IN7A 5HSGA 1Q44A 4GVLA 1XEFA 4EDHA 1NYLA 3C70A 3EFOA 2HK9A 4MQEB 3VR2A 1QFZA 1NUPA 2YHIB 3RQSA 3V7NA 2V3CC 8LDHA 4CEIA 2V7TA 5GZ6A 3R3SA 3BH0A 4RMJA 1VMEA 5EHGA 3LPNA 3RYHB 2GEUA 4DM3A 1KQNA 1S9DA 1SBIA 4MMYB 1M72A 3AI1A 5FJIA 3LLSA 1Y80A 1DB3A 1UBFA 1YI0A 4HY3A 2GZAA 4KLZA 4L1KA 2FPKA 3NQ41 3A9SA 3KJGA 4MQ6A 4CFSA 1DDGA 1H8ED 1T6NA 3W3AH 3QU2A 1IZYA 2MSWA 1BU5A 1DG1G 3CE9A 2PEZA 1PJLA 3NBFA 3LK6A 3WWYA 2FEAA 3CVWA 1IWBB 3NHRA 4AC9A 4Q93A 4W5NA 1K6MA 2HA7A 1HT2E 4TMFA 1TI7A 3TI9A 3GLIB 4GI5A 1DO2A 1XRPA 2QENA 2XD4A 3NBUA 4BE7B 2PBZA 2JI9A 5JO0A 2A0FA 2I78A 2XZLA 1UFOA 1SM4A 5T4EA 1P31A 2E4UA 1R3DA 1YCDA 1KY3A 1TQDA 3FOEC 2EWMA 2G1UA 2WWWA 4GGPA 1XZLA 1ZLXA 2ZU6A 3HJHA 3FPKA 4BMXA 2EXXA 3SBXA 4MTLA 1UZAA 2VUIB 4OKSA 3ZYCA 1WETA 2GM4A 5KC9A 4ZTZB 2VYVD 1PJRA 4HDKA 1AU9A 2C88A 2O7SA 3BEDA 5J5CA 3BJEA 1E92A 1GLVA 1E60A 1ZGHA 1NKTA 1HLDA 1MLDA 3DF7A 4MW1A 4AP9A 2XUZA 4LHXA 1XI2A 1DKQA 3N7UA 2OHHA 3P4YA 2C9BA 4O2AA 1NIPA 2NO1A 2ZJAA 4R2MA 3QY0A 4E3WA 1AZSC 4IMIB 5CH3A 4EB6A 2DHDA 2BJWA 4CMEA 3AI2A 4NENB 3QEAZ 2EG5A 2WM8A 4BFVA 3OBIA 3O73A 4NZZA 1WMBA 4EGJA 1MRZA 3DNPA 1HZJA 2C5AA 1X38A 2AFIE 2H65A 2ZR8A 1CR2A 1VJ0A 4KGVA 2J0UB 2Q45A 3GDHA 4RM3A 4UU0A 1EH5A 3OJOA 1V16A 2V6FA 2WHEA 1ZOPA 5JAZA 4YRKA 3FYHA 2K7FA 2W2NA 1U9YA 3JQ8B 2OP1A 4ZT5A 4JD5A 3OLZA 3SS8A 4UVHA 3WC4A 1BJKA 2O0MA 5DTMA 5AUNB 4CG0A 4MA5A 2WJZB 4JNKA 3TFOA 3CZMA 4ZAGA 1KEKA 3C1AA 1W0KD 1JP7A 1H0KA 5KNLA 3KSZO 4KR2A 1G7TA 3CH4B 2NU8A 1MW9X 4REMA 2WIDA 5TQJA 4Z7OB 4R2WA 4D9NA 1FP7A 1LK7A 4COKA 1QONA 1O5TA 3B1VA 4B84A 2YVKA 4UEJA 2ENWA 4G9EA 4LGMA 2AKEA 4F6RB 4ZODA 3ZGXA 5A3SA 2NU9A 2YZKA 5GQSA 1LUAA 2WWHA 3FDZA 3CO0S 1UJ4A 2IYYA 5EMJA 3MGKA 3C5EA 1U0RA 4EHKA 1LXCA 2NO6A 4R5MA 3JASA 1DO8A 1QHXA 3ZWAA 1KIMA 1UK8A 5BT8A 1Z5WA 4GICA 2VWGA 1WVMA 1FQJA 3A1CA 4UFNA 1Y8ZA 4U2KA 1H3EA 2HQ1A 1YWGO 2HUNA 3HO6A 1RHRA 1Z56C 2FPXA 4EHIA 1RJWA 5D86A 2V98A 3EZLA 4MJ7A 2Q6VA 4HV4A 1YHNA 1ORTA 3MOSA 2OK8A 4M1MA 3M6UA 2GR9A 4DIKA 1G55A 3E8XA 4RELA 3RSSA 1YACA 2YQ4A 5FOWA 2IELA 2JDID 1TCBA 2P5YA 4C4RA 4YBRA 1WZEA 2E55A 1W5AA 1VJDA 1XMSA 2A59A 3DLBA 5DRTA 1KORA 1U6JA 2Y76A 4B4KA 2BGNA 3OU7A 1A8QA 1G2PA 4NWIA 2IL1A 5I9NA 4CIBA 3OPYA 4R4JA 1VLQA 3QUQA 4H7IA 5JCXA 1C0KA 3IXLA 2PKWA 3B7WA 4YXFA 1VC2A 4F06A 2GX6A 4A6EA 2GZ3A 1K66A 2PO5A 1PGJA 1XZMA 2Q5HA 2W6MA 3GRFA 3K4HA 4ZVRA 2CV2A 3DXZA 4U9UA 3T5BA 3DNMA 1A8IA 3WAJA 2AC7A 5CCEA 4XWKA 2DZDA 4CETA 4OB6A 5IJ0A 4P36A 1NY6A 2DPHA 4EI2A 1F1BA 2B8JA 5LKRA 3SR3A 3K31A 3G8DA 3RVJA 3I73A 5E8RA 1U7PA 3NXKA 5DM4A 1M34E 3W5SA 2J08A 4HZIA 3FLAA 4P3YA 5A04A 1FNNA 1Y81A 2F17A 4BNGA 3HRKA 3KQKA 3AOGA 4MVJD 4DDMA 2DPMA 1ADBA 1Y3FE 3OWOA 4IZHA 3K09A 3GAZA 5CBPA 1J09A 1VG0B 4QYXA 1CLUA 3PNSA 1PJAA 2JATA 5DW0A 1YFLA 5C1PA 4JEIA 4MJLA 4ER0A 1ZD5A 3DMHA 3G0DA 4MB0A 2YWHA 1T4DA 2Z6VA 4DQUA 5A5VA 4G4JA 1TQ8A 1NW5A 2EFGA 2HJGA 1HOXA 4L50A 1YQGA 4NE9A 1Q83A 2VHZA 3SXPA 4QEDA 2HSWA 4IF6A 4UW9A 1A71A 1SMKA 2R6JA 3BUSA 4RL4A 2PLNA 4U9IS 4YONB 4BXOB 4MUYA 1SVMA 2N1MA 2WWRA 4P0QB 1CY4A 2BTEA 4JUBA 4DG5A 5SV2A 2C8JA 3RHFA 1VHTA 4RHUA 3Q9LA 3I5AA 4LRTB 5EESA 3T95A 4AKTA 4EA7A 2HLHA 5A9SA 1QTQA 4NV3A 1RYZA 2I2BA 1WF3A 4HNTA 1EGAA 1M74A 3G0IA 2V55B 2ADOA 4EYKA 3NDBB 5HF6A 5LLSA 5FBLB 1T43A 2VJOA 4QYMA 2H2IA 1A50B 1SHLA 1LPAB 3U7HB 2C7PA 3PQ8A 4KPYA 3ZWNA 1BOFA 4X5OA 1EPUA 1WULS 2CUZA 3CTMA 3GLRA 3GO4A 3HL0A 2EGHA 3QVWA 1QHSA 2OWDA 3F49S 3H2IA 3GT0A 4X97A 1C0LA 2RD2A 3AMVA 3O8DA 2GRJA 7YASA 3SJUA 2OSVA 4M1OA 4MVXA 3SD7A 2RC5A 3L6RA 3THWA 2Y66A 4M0UA 3Q2KA 2BMVA 1IG0A 5I47A 5EOVA 4TZTA 1Z2AA 3HB1A 4PZYA 4R9RA 4UPDA 3VNQA 3TW6A 4CKYA 4EB0A 2ZP1A 1NUTA 2RSLA 3LZDA 3F2VA 2AOTA 4Q24A 2ZCUA 3QPWA 1FX0B 1SKQA 2Y1OA 1ESMA 2ZSIA 3BE6A 4WEQA 4QHYA 3UK6A 4B4VA 2BRUA 3B8EA 3MOGA 4Q7KA 3LCRA 3WBBA 4M89A 2J9RA 3MMPA 5IMSA 1RP7A 1XN4A 1J8DA 1TQHA 1PT8A 2OC4A 2PLRA 4X95A 1DX9A 1SZDA 3IOYA 1KI4A 2GARA 2JIMA 4HZUA 3R7FA 3B1WA 2EHJA 4H77A 2P30A 3IBFA 4S1WA 4YP7A 3D7LA 2XGGA 2ASVA 2CJXA 5B3AA 5TQVA 2VQSA 1N2OA 2B21A 2FG5A 2HQOA 3GLVA 3NBQA 2GILA 1JPUA 2O4UX 1Z4NA 5IDQA 1N5MA 1GDTA 3RTCA 3VU1A 4K40A 3Q7QA 1Z5UA 4IICA 1RMYA 5C34B 2DUJA 3A1UA 3E22A 3MIIA 4HAUA 4JLUA 4C0JA 5IKEA 2Y05A 4GECA 4KFTA 3UW3A 1MRNA 4BO1A 3T41A 3NWEA 3UHOA 1K0UA 2WIKA 2RJNA 5CDFA 4ZIRA 3BHMA 1KETA 1MENA 2FI1A 3QVJA 3FNHA 3F5SA 5FWXA 3PXXA 4US2R 3EPJA 5G0TA 1GU1A 2IEAA 3Q72A 3EXIA 2Y2VA 4OYHA 1JYFA 1Y42X 1PQPA 3L3BA 5K2OA 2HQBA 2I80A 2JAUA 3HSKA 4B0PA 3MBIA 2RGYA 5A02A 4X7RA 2I6FA 2VT3A 3P9XA 4TSKA 4YRJA 2RKWA 4FC7A 5IAAA 5M5BA 5GINE 1RWKA 1J1UA 1N33B 1BVRA 1DBVO 2QTNA 3AUTA 2H85A 2WAXA 2XNKA 3FHOA 4Q03A 2XNDA 5K1ZA 5T41A 1MO6A 4H1TA 4ZYYA 5ICFA 1QP4A 1F0PA 1P5ZB 2ZITA 3JQ6A 3A2NA 4MIEA 3D4PA 4ANFA 2CB0A 2BJHA 4ES6A 1QANA 1RYEA 3OZTA 1X1EA 1QO0A 3L0DA 4OQQA 1CR4A 2G8NA 1U3GA 1XLTA 4KXYA 4UUBA 5DM0A 5L7YA 3DBVO 2B2XA 2WRZA 3GHYA 3VQTA 2ID9A 1YOVB 5FIUA 3N0TA 4BVKA 1MO5A 5J2TB 3OF3A 4ZV4A 1LK5A 4O4JF 4RV4A 4R31A 2BTQB 3OIGA 3GNQA 1W5BA 3AH8A 5D3QA 5I9TA 3WLAA 2QRVA 4YAUA 1E1DA 4WN9A 1IQRA 4YUZA 4G9GA 3OJEA 1N6LA 3ST7A 4YCMA 2EU8A 2XQIA 2J3MA 3M0EA 5FF9A 5IEJA 3FCAA 4KYIB 1OWOA 4NU8X 4XARA 4G67A 2WV7A 1JG4A 2FG7C 2QNRA 3KZ1E 4LA4A 3VDNB 1GFZA 2ONZA 5ARDA 4KFSA 2DPYA 3A9WA 4H35A 1GGEA 3FF4A 1SUAA 3CZPA 3D4OA 3SLKA 1N78A 1UBNA 5DM2A 4HWKA 2AJTA 3OT1B 4UDXX 2XVZA 4RE5A 3OEYA 4F2WA 3GJZA 2C1ZA 2FNAA 1ZJJA 4MVJF 5FUWA 1CZKA 2I87A 5BNZA 4YHHB 1VE3A 4C1BA 3F6RA 1NE2A 3LBAA 5AI8A 3U3DA 2BFAA 1UJBA 2DQSA 1GG5A 3OO0A 3TW8B 3N0RA 5KWVA 4UUMA 2JAOA 3HWSA 2I2WA 1C8KA 1U3DA 3G49A 5JPIA 4PYKA 3UCXA 5ESWA 1GCIA 1YB4A 2D2VA 2F9LA 3QPDA 3TIIA 1SAYA 2FK8A 5HIJA 1NNI1 4R98A 5ELMA 4UBNA 3WZ2A 3K0BA 3RV3A 4C1NA 2QMOA 3ZD8A 1CZUA 1U8UA 3UWOA 2B99A 7ADHA 1YUNA 4R2HA 1NBHA 3GELA 4JLSA 5JBQA 2O5EA 4HH1A 1PG0A 1GFWA 3EVAA 5FORA 4NFHA 3N05A 1UBMS 1EX9A 5CIWA 1A1VA 4QJ4A 3DDCA 3JU3A 3KSMA 5ECWA 4HT3B 3BSFA 1XTKA 3GD5A 3FSGA 4JL8A 3S2SA 4C7XA 2UYHA 2KYRA 2OD7A 4D8UA 4DZTA 1DBWA 2LCQA 1XZEA 3HDTA 3IT2A 3O91A 3QF4A 2JLZA 1V8PA 2HF8A 2X9LA 2Q46A 2FCRA 3G2LA 3W4IA 5YASA 2RE8A 4PBRA 5JUWA 4B4UA 3M3DA 2AOUB 4J1TC 1DHRA 1YJ8A 1TU3A 1A9XB 3ETDA 4JC8A 5EPOA 5TT1A 4QVIA 3BS4A 2H48A 2ZG6A 5CP8A 1VCHA 1GPKA 2I2FA 3I9JA 1ZUWA 2DF8A 2UVPB 3OX3A 5HM6A 2HIHA 2P9CA 1Z0ZA 4D8TA 4XM1A 4Y0VA 4DOMA 5EJMA 3VMMA 8ATCA 4KQIA 4CM8B 1R0WA 3L4JA 1ODIA 3ZI4A 3AFGA 3ZGNA 3FMOB 3DKVA 2KBEA 2BF7A 3R3ZA 1UXKA 4GMXA 4I8DA 4F8EA 3ZD7A 3WL7A 2QG4A 1RMQA 4IKEA 5FT9A 3QX7A 2ZJ6A 3RAFC 1GARA 3JVUA 1WSBA 2GAAA 3RHZA 4ID9A 3UJHA 3Q4GA 5K99A 2XYPA 4JXXA 5ARCA 2C5FA 4HB4A 4UE3S 3F6EX 3I4CA 5DHTA 1LVUA 2V9ZA 1P6XA 4NYJR 4J9UE 2JD0A 2OAGA 1Z6ZA 4BCCA 1N7IA 1OZAA 1GU0A 2XW6A 1J00A 5DSZA 3TE7A 2VP4A 1ZD8A 5B53A 1L6IA 3BFXA 2V1XA 1RZRD 4BTEA 1MG0A 3GUYA 4D7AA 2VPXA 4QULA 4OHYA 5FI0B 1ZH8A 3LW8A 1RU3A 2IGTA 2Q6TA 4Q9KA 2VP0A 5CT9A 1P1IA 2EW1A 3MB5A 3ZIDA 4ALLA 2QZSA 3WLRA 1E96A 3PQFA 2GF2A 2IYWA 1YJQA 1ZXLA 2NVOA 3EC1A 2JA1A 2XOKD 3TCKA 1B8NA 2ATVA 2FWNA 3GJXC 1FS5A 1ZDMA 3THWB 3QPVA 1CDDA 2X1MA 3ZX4A 2A2ZA 3OE7D 2IE8A 1EZ4A 1NASA 4HQRA 3TAUA 3B9RA 3C43A 3REOA 3BFPA 4H3KB 2G77B 2O3SA 3BN3A 1E2LA 1IE3A 3K53A 1XJCA 3QMPA 4FHEA 4J9VA 4U2GA 2A1IA 1Z29A 1I0ZA 4AS2A 5FPKA 1UKYA 1VCIA 4YMLA 2ZYIA 4DV5B 4F45A 2CLDX 1PZFA 2BDTA 2PL5A 3TSZA 3UXYA 1EINA 2GAJA 2H1SA 4KVZA 3VAYA 2OP0A 3DB1A 3ISVA 3A06A 3ADPA 2J7PD 2NM0A 3E27A 3EG5A 3KQOA 2B5VA 3Q1LA 4AICA 3WKBA 4JUAA 4LWZA 4C6HA 3HDQA 3NEPX 4U7TB 1DAHA 4IIJA 2ZS7A 3H5RA 3FKSD 5C7YA 4M8NE 4ND2A 2HMYB 1NVKA 2P2DA 3Q5GA 1J0DA 5FHQA 1Z6YA 4Z7NB 4RVSA 3AGQA 2ZS8A 4XJXA 4CI0B 1XVTA 4L28A 1NBAA 5KS2A 4YN3A 3HH8A 1FXWF 1I36A 1NWCA 5EMLA 3S7ZA 4NJMB 2JJMA 4YK7A 3UZUA 1OX4B 4NJOA 3C7DB 1EX7A 4UUOA 1WDLA 4OXXA 5HHTA 3SPXA 3AKYA 4KAXA 3BQNB 4GPZA 4E5VA 1SULA 1BMTA 2IE0A 2XPCA 4NBUA 1W4ZA 2WYVA 1SH7A 1LFDB 1YASA 3CVOA 2BM0A 3CH6A 2ZYRA 1Y9EA 3GJQA 5FBKA 3ZBPA 4G01B 1JI0A 1X7ZB 5D8DA 1Y1RA 3AV3A 3OCXA 4QDZA 4XD2A 4D96A 4X41A 5IDVA 2OK7A 3HU1A 1G8HA 3PRKE 2ZATA 4OA5A 3R3VA 2CKMA 3UOGA 2Q1YA 3TRIA 1B6GA 1RS0A 1U9IC 3NNDA 1MB2A 4O1IA 4J29A 1NW9B 1R12A 1IXZA 3A9VA 4FT4A 4HX2A 4NJEB 2R0QC 4JJFA 2P6UA 1G18A 1KF0A 1IY8A 3E9ZA 4EB8A 4TWRA 4B2IA 4IIEA 1MP0A 2I33A 2WHXA 3N86A 2P11A 4HF7A 3WWEA 1UBTS 2OVFA 4KFUA 2OBLA 1Z5ZA 4D79A 3NORA 3P9SA 4MYDA 3EA0A 3OZXA 5KI6A 3KZNA 3JYHA 2R4QA 1TT7A 3AQIA 5EA2A 5ERYA 2BKVA 4DC0A 4KAJA 1BHQ1 1BDJA 1B0PA 2FWPA 3EJ6A 1EP2B 1OFGA 4AQYB 4PYMA 1RYMA 3FZGA 3H04A 1T9AA 1XYVA 1FSPA 1WB4A 3ZW9A 1BYUA 2VJNA 3PA6A 2WU4A 1XGKA 4ODIA 1AY0A 5CLFA 3HVKA 3CF0A 2O0JA 5DBGA 3V4SA 5F7OA 4ZRNA 2CFSA 1LPMA 2VCHA 4F6RA 3P0RA 1JE1A 1CS0B 2XOKA 3QKTA 4X85A 3C3CA 4M7OA 3W2HA 4DIEA 5ITZB 1OT5A 3GT3A 5JYEA 1P9NA 1WD5A 3BQ9A 3BYZA 3PUKA 4LRYA 1RZ3A 3BWVA 1R4NA 4F96A 1BCRA 5CDFE 1KYQA 4BVEA 2QXUA 4EHLA 3D7MA 4R41A 3DMTA 4G5RA 2EJUA 4DNFA 3UCFA 2BP7A 2CDBA 3V4PB 3W5DA 4BQOA 3DKKA 2AQ8A 1BX0A 1ZW6A 2J7KA 4HYQA 1WP9A 2A57A 3WJ2A 4CMBA 3GPLA 3GROA 4PAQA 3BJMA 1SXJE 4IGAA 1DKNA 1UIMA 1ZD9A 3ZHSA 1P2VA 4KOAA 2Y1GA 4PAWA 1I4TD 2J07A 2IF2A 1CP3A 2EDAA 3JALA 4IDCA 5A9RA 3K70C 3THYB 4XSHA 4LTDA 1L3IA 2VQEB 4J91A 4ZREA 3ZY4A 2G67A 1OLSB 2J5KA 2X0DA 5DNYB 5EC8A 1BDIA 2H5LA 4KE7A 1DE0A 1GAXA 4NMLA 2EKPA 2IHZA 3RD5A 3T9CA 4AMYA 2G83A 4D9BA 2WU8A 4DY6A 3KKOA 1X1QA 4UKDA 4TS3A 4BZPA 1E3IA 3OZIA 4YUAA 1S3SA 2CZQA 1YR1A 4PIVA 1RXCA 1KYXA 3KQYA 5EIBC 2NUAB 3QSYA 1D1SA 3LWDA 1ONBA 1R6AA 4K81B 3ZXSA 3L43A 3F3YA 4XQEA 2H7XA 2JI8A 1NA5A 3L92A 4YT4A 3FA2A 4KC0A 1JBQA 2P9GA 3PUJA 1T25A 1N0VC 3KLOA 3LQ1A 3G02A 3IEKA 4ZC8A 1V6SA 4JA0A 4BDTA 4XEHA 5EIWA 1KSFX 4YS6A 5FUMA 3HCCA 1OXVA 3TZBA 2YXPX 2H1OA 1Q6YA 1CTQA 2NU6A 3SQOA 2EJTA 3UANA 2BGMA 1NXQA 1KHHA 1DKLA 1ZD2P 2WABA 2XWPA 3FDZB 3QU4A 1TVEA 4G0XA 1KEVA 1D03A 4MCAA 1LNQA 3PSHA 4PX3A 4CUZA 5KNCA 4Z1OA 4WCFB 2HJRA 2QYHA 1FMTA 2W0SA 2XYHA 1PK9A 4MLZA 5EE1A 4DLZA 2O0HA 1XTTA 2VT6A 5DGDA 1KQPA 3R4CA 3OO1A 2O57A 1UWLA 4UD2A 5C5EA 1VKHA 4D74A 2ZRJA 4OQPA 2XEDA 4IDHA 1R0CA 4R1MA 2Q0QA 2NPIA 3JWIA 3DBIA 3BX1A 4L8FA 7GPBA 2QHXA 5J4YA 3IR7A 5ALXA 1OJLA 2Z58A 1XMVA 5HQJA 1V5GA 1YQUA 4IKPA 1Z5OA 3F8WA 2WYOA 4H7HA 2FUEA 4FD2A 1XSEA 2HJ9A 2MYTA 2GKOA 3G1TA 3GFOA 4HSEA 1UT6A 4L8YA 4O4HB 3SYRA 3VI4B 5BMVB 3K9QO 2I4RA 1EJ2A 4EGSA 5JLAA 3RC9A 5L4NA 3G2NA 3W5HA 1EFUA 3HWX1 4ZI7B 4KOEC 5BMVF 3RS7A 2QR5A 4WOBA 3RT7A