2OWDA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLMRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2owdA00
2AXNA 1T8PA 2P2YA 3E9EA 5CU7A 1C81A 1SKBA 4D4JA 1IHPA 3LL4A 4PZAA 4JOCA 2P9ZA 1CVIA 3GP3A 2WNIA 5HR5A 3F3KA 2WNHA 2DWPA 3DCYA 1RPTA 5AJVB 1C80A 2H0QA 1V37A 1FZTA 1BQ3A 4PZ9A 1DKLA 1E58A 1YJXA 3HJGA 2OWDA 2PA0A 3E9DA 3LG2A 4FDTA 1UJCA 5CX4A 2P75A 3IT1A 3ZHCA 1H2FA 1QFXA 1SKAA 3D8HA 4AROA 4ARUA 1K6MA 4PGMA 2H4ZA 1BQ4A 4E3WA 3MBKA 2A9JA 2P6OA 4TSRA 1RIIA 1ND5A 3NFYA 4ODIA 2ENUA 2P9YA 4ARVA 2HIAA 3D4IA 3PGMA 4D4KA 5AJYA 3KKKA 4GPIB 4ARSA 2P30A 2EKZA 4JOBA 3EOZA 2GFIA 3O0TA 4IJ5A 1NT4A 1UJBA 2P2ZA 5AJWA 3IT3A 2P78A 1XQ9A 2P9FA 2WU0A 5HTKA 2P77A 3F2IA 2EKBA 2YN0A 1EBBA 4FDUA 3K4QA 1DKQA 4D4MA 2YN2A 2H4XA 2HPAA 3FDZB 1SK8A 1H2EA 4QIHA 3OI7A 1V7QA 3IT0A 1DKOA 2IKQA 3IT2A 4D4LA 3D6AA 2EOAA 4JODA 2BIFA 5AJXA 3MXOA 3C7TA 1DKPA 2P79A 1QHFA 4EMBA 1BIFA 3GW8A 3QPUA 2RFLA 1C7ZA 5PGMA 1SK9A 3EZNA 1ND6A 1E59A 2I1VB 3DB1A 1DKNA 1RPAA 1FBTA 1DKMA 2HHJA 1YFKA 4MA4A 4GPZA 4EO9A 2OWEA 3E9CA 4IJ6A 2A6PA 2P6MA 2ENWA 1TIPA 5AJZA 5AK0A 1QWOA 3R7AA 3K4PA 2QNIA 3FDZA 3GP5A 2DWOA 2H52A 3QPVA 3FJYA 3NTLA 3QPWA 4HBZA 5CDHA 2F90A 3LNTA 3BIFA
chains in the Genus database with same CATH superfamily
5ICEA 3ONFA 4BQQA 2O8EB 1JQEA 1YB5A 4DLZA 3O83A 3TI7A 4GM4A 4RJIA 1W29A 3R09A 1DV1A 2PBLA 2ZYTX 3FCUB 4OAOA 4EX7A 3FN4A 4BFTA 2OKGA 3AY6A 5CJ2A 1CV2A 4IO0A 5ENVA 2ID7A 5KHLB 2SKEA 5DM70 2XNKA 4ISBA 2WTUA 1ZKDA 4NBRA 4HNUA 5DWDA 1USWA 2GF0A 3UPUA 4DJTA 1U04A 3NXSA 1KC3A 1U0JA 2GO7A 1YZTA 2YINC 3II6X 1T4GA 4MQEB 4PYRA 3RS4A 1X0VA 2QQGA 4OJNA 3JARA 4W9NC 1M0TA 1FDTA 1KF0A 3IPCA 2EKQA 1GNRA 2IKSA 4M0PA 4X8OA 3CKMA 4WN3A 3OQMA 3R5SA 2HYDA 1O94C 1ETUA 1DAEA 2JBAB 1XVIA 1L7EA 2PS0A 3GUYA 1AMNA 4HCJA 2SCUB 1KZHA 4BVGA 3BJRA 4B3MB 4B32A 3ZQKA 1I51A 2AQHA 3ND6A 5ALDA 1XEAA 2OV3A 3NHYA 4FYXA 4TYQA 2BONA 1Q95A 4GVXA 1VP9A 4MSUA 2E7ZA 4W99A 3CTPA 4C4PA 2R25B 2ZAMA 4MVWA 2KPOA 3PXGA 3HLKA 3N3BC 1BMFD 1J1IA 5AM2A 1JR3D 3LL7A 3QE4A 4K3UA 3IR7A 3JQFA 2B34A 3M4NA 3PXCX 5E7MA 1EVKA 1GGKA 3AUSA 1K9SA 2NGRA 4IHJB 4I9GA 3A05A 2PNJA 5JATA 4LI0A 1AHPA 4PQYA 2X15A 1QP0A 1YDMA 5BQOA 3Q5EA 5K5EA 5BORA 4FZ5A 2P9FA 4TLBA 2GN2A 4GGMX 2P8SA 2BEUA 2NSLA 3HRKA 2CXTA 3L93A 4K40A 4K86A 3BB4A 4MW9A 3OBIA 1HLPA 1LWOA 1QO0A 4P98A 4S2EA 2OXRA 1XVLA 4RJLA 4BBAA 4BLTA 3KKNA 2AE2A 2YX1A 3VDRA 1U2GA 2IYQA 1WVMA 2ZUVA 4NJMB 2HA4A 4S1TA 1FY2A 1Q2XA 4C6SA 4QKQA 4D9EA 3PFWO 2IOFK 1WB4A 1FNMA 1T6ZA 1XVUA 3EC1A 3HCRA 3OI7A 2W8BB 3AT1A 4AWXA 1SBHA 1ZL0A 2XA9A 3MWDB 3B89A 3PC6A 5KZMB 5KSWB 2BIFA 4KN6A 2R0QC 1Q16A 3AEUA 5K3CA 2OGUA 2FJPA 4ECAA 1Z5UA 2FJ0A 4FP9A 4HJXA 2Y1LA 2OV2A 5GJCA 5JROA 2H2IA 4I9NA 3UMVA 2DHRA 3G9TA 1U80A 2OQIA 4OJKA 1FSPA 4QT0A 1HNNA 1DX4A 1CUZA 4BQSA 1B8VA 2P9JA 1I4WA 4KLNA 4J49A 2JVJA 3T3OA 3C8MA 3OOHA 3FVTA 4C7BA 5HKBA 2OWEA 3K92A 3LLUA 2AD1A 3MGCA 4HMQA 4NMXB 3LAWA 5DGIA 5H70A 3WK6A 3NVKI 2PZLA 2RONA 4FGWA 4NVRA 3ZOKA 3KUCA 4Y1EA 1XP5A 3QKRA 4UHBA 3HLYA 3P4YA 3IJEB 3KFLA 4GP7A 4LV6A 4JLVA 1ILWA 4H7KA 3TRIA 4N0QA 3VR1A 5LU9A 4M89A 4KO1S 3ZWAA 1A5BB 2NG1A 1WUIS 2CNDA 3H4IA 5EWMB 3OZRA 5K3DA 1IVNA 2GX6A 3QPVA 2F8LA 1QFSA 4RVSA 2V7UA 3HN6A 3E5MA 1OASA 3EDMA 4P84A 4A4DA 2QTCA 2H07A 2BFCA 3O4VA 5LUBA 1FTNA 3QSGA 5AK5A 5FYQA 4Q9JA 3CV3A 1DAGA 1L4NA 1XB2A 3K5IA 2IYFA 2J09A 2SICE 3L7BA 4JQCA 2BGKA 2UVQA 4QFMA 3DXYA 2L17A 2VK4A 1CZLA 4L72A 1TK2A 3IQFA 3L82B 1MO4A 4FZRA 4IIJF 2CNKA 2ODNA 4RGQA 1JEQA 3ZWDA 4DFDA 4ZVNA 1UH5A 4H08A 2E49A 1T4MA 2C4VA 2ZUSA 3OIGA 1B8NA 4MI3A 3U3MA 2WP0A 4BVKA 4D99A 1QTQA 3P9SA 1T2NA 4MV0A 2J0UB 3GROA 1DU4A 2GRUA 4YCCA 5DBIA 2AZTA 2A1UA 2ABWA 1A5TA 1G42A 4U2FA 2JFQA 2LNDA 3RK0A 4DADA 4P0PB 1QU2A 4UC0A 4II7A 3LBYA 4CMGA 2R7KA 1RM5A 3OC0A 3HJGA 2OPHA 1XPJA 1XL0A 1S5PA 3RJTA 3S27A 3N87A 4COKA 2VWGA 2ERXA 2WTNA 5JS1A 4N8EA 1ST3A 1KJIA 2FEOA 3H75A 2HHCA 3D4OA 4L7VA 3SNHA 1GZ5A 2FSIA 5JI3E 1F9EA 2IV7A 1O5IA 3UKJA 2QR5A 4OB8A 2ZKLA 3UH0A 1FJHA 4HVCA 3SIXA 1UINA 3F9RA 5F78A 4ZIRB 1A8IA 2YWGA 5C8VA 1G9SA 2B8JA 1Y7HA 4CT5A 5M5BA 5AJUA 4AKHA 1EZZA 1ONBA 2NACA 2AV6A 3O2JA 1T9AA 5A2GA 2P35A 1GARA 1G2QA 2ZSBA 3L7AA 2P9EA 3F5QA 5TY0A 3T5CA 3N0RA 5KYNA 3GT0A 2VRBA 2BYTA 3AQ4A 3IIKA 4Q3EA 3GGGA 1QH1A 1OB2A 1ZI8A 3TRKA 2IU3A 1C50A 3EZ7A 3O1IC 4ZDJA 4F96A 5JJCA 1DBPA 3MRXA 7AT1A 4NZZA 1T6NA 4FFOA 1NRWA 5L3ZA 4IILA 3TVYA 2J30A 1V41E 2A9VA 1OTXA 2R1VB 2CJFA 1S3FA 2DQYA 1O89A 3MAGA 4JJKA 4R01A 4TLAA 3ZJTA 3T0IA 1VL6A 2PO5A 3QXHA 2WT8A 2PAFA 1D5WA 2FPPA 1R5JA 2QUBA 4MJ7A 4BWVA 2RKOA 1Y6ZA 2RI0A 3PNLA 4BL5A 4ZVMA 2VSFA 2ZPTX 3AK4A 2CL5A 4IEFB 1P1IA 2XIJA 3Q2KA 1ZEMA 2ZT6A 3Q1KA 1JI0A 1XRNA 2DFKB 3KFXA 1W19A 1F38A 4QBTA 1HV8A 2FSUA 4GD3Q 3H7IA 5I8ZA 2HUPA 2E5LB 1R10A 4Y2YA 1Q2UA 3GW8A 4DCUA 2XUIA 5DNYB 2VTBA 3IP5A 4TVBA 2JRCA 3JS5A 5KYUA 2WU3A 3OZSA 4BV2A 5K20A 1YA4A 5LDDC 2VJDA 1RLIA 3F46A 1GPWB 4NMWA 5BSGA 2CB0A 3BAFA 3FTFA 3SBXA 4N5HX 1AE1A 2JFGA 2WJ6A 1CJSA 4LXQA 4I1RA 1OHHD 3GK3A 4PSCA 4R51A 4RS4A 4XWGA 3X44A 4MCJA 1ZAYA 1KPGA 4DB2A 1TM5E 5I51A 2C3YA 4U7TB 5F2KA 3BXGA 2FP3A 3TK1A 2YVUA 2ZIAA 4DRYA 3PXEA 4RK1A 4CKEA 5J4KA 4CNQA 2GXAA 5TT0A 5CM2Z 2VXYA 5CB4A 1SUAA 3BULA 1FDSA 2DMRA 2W2LA 4JK3A 2CMDA 3NTLA 5BV2P 1JLLA 1DCFA 1KI9A 2X2PA 4FFPA 4X20B 5SZKB 4B40A 4LE0A 4NCJA 3ZU3A 1QIEA 3EOBI 1X7WB 1NAIA 4UQOA 3WLKX 4E5KA 1YQTA 3C1TA 4GWLA 2Z3VA 1IXZA 2QRGA 2OVBA 2Z1DA 3AOGA 2WAYA 5T8KA 5ALSA 5F64A 2PV7A 3UJ9A 3HCAA 1N2EA 3T5DA 4AC9A 2H3EA 3QVOA 3UHAA 1RT9A 2C9DA 2GBIA 3HABA 4LRXA 5HR5A 3M83A 5TARA 3NHZA 5KQGA 4RPLA 4JLOA 2W6ZA 4YJ3B 4PPFA 1IM8A 5E4JA 1IHXA 5DEIA 4A0QA 1MORA 3MGKA 4CEHB 1KRWA 2Q6KA 1QIKA 4DUPA 1CULC 2X40A 3QENA 2FVXA 1P18A 2G9QA 5TF4A 1EFPB 3OZUA 4P7KA 3ZDYB 1N77A 1FXWA 2PUVA 4RQUA 3W7AA 2KHZA 4OP1A 2IDJA 4OGGA 3MTEA 4WZAB 5LA6F 5BW8A 2FGKA 3I1YA 1T1GA 2ZQ5A 2IYZA 1T5SA 3VTZA 3A3NA 3ASUA 4XYBA 1Y3IA 2JD0A 3H17A 3GJ3A 4E5NA 5CLJA 2ZVDA 1KSGA 3FVQA 1TF7A 5CTJA 1OQAA 2ZUEA 1T2CA 1TB4A 3F9CA 3VKGA 2I4TA 3FETA 1UPFA 3P9RA 2EJCA 2VWPA 4GYJA 3WICA 4HLQB 1L5LA 3UPDA 3VDQA 2RE8A 2HWKA 1NI3A 2GPYA 5E9QA 3RSCA 2WG0A 2XR1A 3QX8A 4BLSA 3IE2A 1FTQA 2JHPA 3C6MA 1GFIA 3KCNA 2VDWA 4RK5A 2VDNB 1OA1A 4K6FA 6ADHA 3EA0A 2XXAA 2WQZA 4UPVA 3CLTC 4JI3B 4EDFA 3RJZA 3MERA 4ZCPA 2G63A 3HNOA 5IHXA 4KJZA 5K01A 1ZZEA 2JGLA 3FOCA 3S28A 4BDTA 1LY1A 3IRUA 4KBFA 3IUMA 1JR2A 1LD3A 2FKNA 4IFTA 3SIWA 1W36B 1BRMA 1NM5C 2IIQA 1JECA 1DAFA 2PCJA 4WL0A 2OC9A 4CL0A 4JX8A 3AMVA 1OAKA 2H4XA 3D0QA 1LDGA 1PS8A 5DP1A 4EFLA 3T1VA 5ALJA 4NBWA 5FPSA 8GPBA 5H9WA 3TZ6A 3FOFC 4DXDA 3C6YA 1IOZA 1WPXA 3I8SA 5G0SA 5A62A 4HXEB 4A10A 4MV1A 2HSEA 1R0CA 4LXUA 2EFCB 4AJ9A 4D3SA 3DNMA 2KWIA 3RABA 5JMTA 3MGGA 1E3SA 1UFQA 1FJGB 1KI8A 3QW2A 3BTSA 1E4EA 1K7FB 2RMKA 1U0TA 3LUHA 4A6XA 4N6GA 4M53A 2XUPA 3IJRA 2AMLA 4UUMA 2X1MA 1BDJA 1P5FA 4MV3A 2ZU0C 4WW0A 5J1TB 1NW8A 4P53A 5IKEA 4MUBA 5KTSA 5G1OA 5DHFA 4ZQFA 2HF2A 3OE4A 3VPFA 3ND7A 2F1IA 1V45E 2Z8ZA 4LXYA 4Q48A 2HK8A 1TK9A 2VH1A 2I2AA 5JVDB 2A7XA 1M2WA 3F4BA 1FNNA 3MN1A 3BWMA 1MTOA 4YAFA 3H5RA 2EQ5A 4EY7A 1IUOA 4N48A 2CLEB 2AQKA 1L1FA 4M1SA 1U2SA 3OZBA 4RF2A 5HF8A 1EWQA 1DADA 3NH6A 2O5RA 2YXEA 4GMHA 5ALXA 4FGKA 2IZ6A 4TKUB 1S02A 1PZEA 5GJVC 4ZZ2A 3SX0A 2D4AA 4LRQA 3F74A 4PCUA 1CIJA 1RYBA 2P27A 4GU5A 1DT5A 1VIAA 3E9EA 4P81A 3S55A 2JA2A 4WECA 1OC2A 3F5FA 3EXHC 1WY5A 1N9GA 1V6SA 2VCYA 2Q3LA 4KGZA 1YK0A 1NIPA 3I04A 2JASA 1PT6A 1EIWA 3K8QA 3LU1A 1AY0A 3TGLA 1AZWA 1XNJA 5DRTA 2J67A 4EW3A 4UTNA 4MKHA 2P2NA 5C1OA 2RG7A 1C8LA 1FCJA 3DDUA 3O3MB 4DLBA 2R8BA 4WZAE 2OHIA 2AJDA 3BOSA 3AQIA 3B12A 3EIUA 4UATA 4GUAA 1QS0B 2PX0A 3LPCA 4ZODA 5AVVA 2X6TA 4D9JA 2GRAA 3AH8A 1HDIA 3X43A 4JYAB 3FTDA 1Z3CA 3AJ9A 2CBXA 4AKEA 1P7ZA 4UHFA 4ENQA 1JWAB 2HDWA 3IAM1 1N5JA 1G8PA 1MT0A 3UK2A 5HILA 1NQVA 1DC4A 7REQA 1C9EA 3K70C 3T3PB 4QPPA 2HO5A 5G02A 3EULA 3U3RA 2O14A 3WNQA 4J2OA 3RRFA 4US0R 2Z56A 3L4EA 3C14C 4ALJA 3WFIA 1YR3A 1ECCA 2WIDA 4BMDA 2D0OB 2G6BA 2ZGVA 5I7UA 2ZVQX 5JS6A 3ITDA 4WOCA 1Z0ZA 3Q7PA 3UMGA 3D5QA 2CHEA 3UF0A 3PNBA 4RIHA 3FUCA 2QAGA 3ED1A 1JBEA 4Z99A 3GVIA 3CVWA 1X7XB 2JNWA 3E9RA 3LCVB 3K09C 3N8NA 1XHLA 1ZD4A 4I55A 4V0LA 5DM1A 1VHTA 2DM6A 2FUNB 3G79A 2AE1A 2V65A 3TTVA 1RM3A 3EUFA 1YE8A 3X2EA 2O3QA 3ZTWA 1C1DB 1NVAA 3B6KA 4YPOA 2WR8A 2J0VA 3IAAA 1CUYA 3UB2A 4NJEB 2PEZA 3HSYA 4REQA 4DJAA 4LOKA 2JFZA 2YQZA 5I7SA 5FOUA 1T34A 4XGQA 4B7ZA 3HNRA 1P7CA 1H69A 5K2MA 1BMQA 1QV7A 1IYZA 1YOBA 1ZMXA 2B37A 2P5UA 2QE6A 1BGVA 3AI3A 3ETJA 3M89A 3ETDA 3IIEA 3OEYA 3R20A 5HJ5A 1Z5ZA 1H9CA 2ZXUA 1KFEB 2FZ4A 1II8A 2D7CA 5I4IA 1Z6AA 5JRZA 1RE0A 1UM9A 3TR5A 1GPKA 2QMQA 2NZXA 1C7ZA 2B2XA 3O6VA 4MQ5A 2P90A 5GJBA 4N47A 2A35A 4N82A 1JLHA 1PCXA 1OPRA 3IKMB 4JAVC 4MA5A 2XA2A 3JAKA 3K0EA 4RAQA 2J3QA 3UHFA 3VR4H 1O6BA 3WWPA 2VHYA 3PZRA 3ZZMA 1U7OA 1VLVA 1LBIA 5TS2A 2YY7A 4XWKA 3TBFA 1Q7BA 3NJ8A 1PYOA 1Q74A 4B0PA 5BN5A 1TJ5A 3BDIA 4FZJA 1TT7A 3C3BA 3U44A 1XF9A 5EQTA 2QM3A 5K0LA 2WA1A 4YIHA 2EU8A 1P2UA 1XQYA 2PX2A 4IKPA 4LSZA 3BEOA 1NXOA 1O9GA 2JLQA 1D8AA 3GO4A 1MJFA 1KYVA 4Y9DA 4BVLA 1BS1A 4LRSB 1HYGA 2XUFA 3RUHA 4LXTA 4BPRA 4LVUA 4U7HA 2BC9A 2DWOA 3KZMA 1ZFNA 1U4SA 1EZ4A 3QPWA 4FW9A 2KBFA 4IF6A 1J0CA 3HDYA 3QX7A 4EUEA 4N18A 4F84A 4POOA 5I3ZA 4Q82A 4R6XA 4UZEA 3KAJA 3M5WA 4RADA 5ITVA 1RLOA 1CRLA 1YRBA 3I53A 2BE9A 4J4HA 4JXZA 3PWTA 1Y48E 1M1UA 2V7EA 3IBFA 5HEKA 3FWNA 4GOND 4JFRA 4EYQA 3U4QA 4DDMA 1P75A 5HZHA 3TTTA 2VP5A 5AHKA 5I48A 3KKPA 3DAHA 3JQCA 3EG9B 5IUKC 2JZNA 3K1JA 1SCKA 2RI6A 3BGSA 4B85A 1FW6A 3DXFA 3UMMA 1UZMA 2B2CA 3GEMA 2OV1A 2X8JB 3L9XA 3R4VA 3G2QA 2GNAA 3DW3X 4V24A 3RC2A 2WUGA 3ZUPA 2ON6A 3G7UA 1IC6A 4H6WA 4JI7B 1QHHA 3DM9B 3G6KA 2YW9A 4CQLB 3B7GA 3CZ9A 1R3UA 4NU6A 1CS4C 1T9ZA 2RH8A 2FMHA 2WJPA 4L5AA 4V0OA 1DX9A 2COKA 5TB5A 3QEMA 3RJ5A 1VCOA 3DF9A 2ZYUX 4H1UA 4AO7A 4QELA 1T9GR 3AEKA 3G1UA 3RIYA 4YMIA 1S3SA 3UFBA 3UY4A 1K3UB 1NKSA 1T9BA 2HRCA 3QTBA 3I9FA 1NZFA 5IFKA 1VJ5A 1GV0A 2VDQB 1CUJA 4GPIB 5GVSA 3OFVA 4UBKA 2R1ZA 4US2R 2EARA 1Z2DA 1QNLA 2EJUA 1P1CA 3RYHA 4UMVA 1JEYB 1EPUA 2VYCA 1P2VA 1XNGA 2CGEA 4WCFC 1NURA 2JA1A 2PIDA 5CUQA 3WKAA 1P1FA 3E15A 2IUUA 5JCZA 1P1RA 4DA6A 4KOAA 3WLOA 1NY6A 4GE3A 3VR4A 1T35A 1XZCA 4D8WA 4U2BA 4CE6A 4DA0A 3JR7A 4NNJA 4H3SA 2YKGA 1SXGA 5DGHA 3T61A 3NTVA 3JALA 1T0JB 3OP4A 3EFEA 1D6SA 2B9EA 2XWJI 3RARA 5EJFA 3D8BA 1X2EA 1XTRA 2JANA 2E6KA 4IKOA 4YWHA 2IZ7A 2ZTSA 2WTMA 4RMJA 1BGWA 4L0QA 4KDFA 2CCKA 2GTHA 4NOKA 4O4LF 1ONPA 1H3EA 3E0QA 4BCBA 3DUWA 3JQFC 3H1TA 1RPZA 2YY5A 2X2EA 3T5TA 1QC5B 2D1RA 2OP1A 2EG5A 3DPUA 2IS2A 1QRAA 1NSTA 1B73A 4OBWA 1CQPA 4V0MA 3RIHA 3JYPA 2IP2A 3ELYA 3LWDA 1Y0BA 2HLHA 1BS2A 3WGGA 2HA6A 1FA9A 4JDUA 1MUUA 1AKNA 1F1BA 1J56A 3O4FA 1XSEA 1KZ1A 4L7QA 3UXYA 2WLSA 4DG9A 4BAZA 2WOJA 4FQ7A 3BE4A 3DEIA 3TTYA 5CNKA 4HDCA 1J99A 2QTVA 2VNAA 4F91B 2FZLA 1I5OA 1L7NA 2F62A 2I8LA 3LQKA 2NT4A 4LRTB 1SHUX 1TO6A 2DFVA 4LWQA 2WIBA 4RPKA 1ZIDA 5GMOA 4AMUA 2ZXEA 3L7IA 2QRUA 5AO9A 5DYWA 2PS9A 4B6RA 3NYIA 2E1RA 2O0MA 5G0WA 2GS9A 1R37A 2HNBA 4KN5A 3G8AA 1CZUA 3WNZA 1TVCA 3ZVRA 4BB0A 4MB2A 4JB0A 1V48A 2F90A 3GFRA 1LPAB 1EDZA 5CITA 1N3BA 2H31A 5IBRA 5J63A 1Z4NA 3RB8A 5D00A 2IHKA 4M1MA 1F51E 2J46A 1L6IA 2PYZA 3PL5A 6LDHA 2YL2A 1GAJA 4ZK2A 4M9ZA 4HVAA 3EQZA 1W9HA 4CGYA 1JA1A 2Q1UA 4GKBA 4KYVA 1CVIA 1G0OA 1B23P 5AUPB 2JB9A 2CWWA 1Y4AE 2WNHA 2YWCA 5GQSA 5KJFA 1NVBA 2BFAA 3CWCA 3EZ6A 4RA6B 5I5EA 3EX7C 1U3FA 2UVDA 1AX9A 3AR6A 4MVJH 2FY8A 2IIPA 5HF6A 4FI3C 1EDEA 2TS1A 2WD9A 2X4DA 4L76A 3T7EA 4BQIA 5DW3A 1ZP6A 1Q7EA 3K0BA 3R5TA 4QVIA 1SIWA 3DV0A 2H2GA 2QRLA 3HJAA 5CX4A 5EJAA 2DAPA 2Q5FA 2WAXA 1P2TA 3R1IA 4EY6A 2CLIB 4YQFA 3T0FA 2ZJZA 3ELWA 4IHQA 1QFMA 4N5MA 5J4HA 3NM6B 5JC8A 2O2JA 3E7FA 5BSEA 4A8JB 2DJIA 1M8GA 1FU8A 1HEIA 3FCXA 5KOJB 3PVSA 4JT9A 3GA0A 4Q7KA 1G4AE 4DSZA 2ZS8A 4HB0A 4BLWA 2CLFB 3F3YA 3A1FA 2P2GA 4YX9A 1WHSA 2CLCX 3A6HA 3HL4A 4MUFA 5AJYA 1BJTA 2XAUA 2PZJA 1U2ZA 2O7VA 3JWGA 4FR5A 4WIAA 3HH8A 1MMFB 3URMA 3G2LA 1PWXA 3OY2A 4QJBA 3PGA1 1YULA 1CFZA 1CUVA 1CWUA 4KZPA 5EPUA 4RXTA 3NHFA 4I1SA 1GGMA 1OA0A 2YTZA 2WAOA 3EPLA 1KY4A 5F21A 1Q84A 2I71A 5DI3A 1JJ7A 2BLNA 2X0IA 2C04A 1JKJA 3MRSA 3FTNA 2WF7A 2VZ0A 3OZCA 4LHXA 3T35A 5IN5A 5JNWA 1WZIA 3NHPA 4YDRA 3GLFA 3ITNA 4R1SA 1J49A 4LOHA 3OBBA 4OB6A 2C9MA 5DTIA 1EX7A 2ONZA 2AFIB 1MOPA 4ML3A 1SVMA 4E13A 3FSJX 1XLUA 4F5YA 4OKSA 1N6NA 2FW8A 3R7FA 1F9AA 2CXXA 5T4BA 5BYBA 2WV9A 1B8PA 5JD3A 3CLRD 4LN1A 1O58A 5BO5A 1GDDA 2DTXA 4R84A 1HORA 1SMKA 5DGDA 4OP2A 4M8LA 1MABB 4M0KA 1KK0A 3KVOA 1LVGA 4RETA 4AKGA 1BW9A 2ZI4A 1NMQA 3FKQA 4F04A 4YRSA 3K20A 4H4DA 2HW8A 1MRNA 4E5SA 2BFPA 3WLEA 2CXHA 2H08A 3AU8A 2PBFA 3GPIA 3TGPA 3DE7X 3HACA 4GX1A 4G1BA 4I50F 3DHWC 5L3RA 4HDAA 3BRWA 1HLFA 4OLFA 1LBTA 1Y34E 4RBNA 1KBOA 5EJ6A 1VMIA 4IQFA 5BSRA 4EK9A 3FYUB 1BEEA 4MWZA 4MVJA 5FOXA 4NV0A 4L5IA 2RHTA 4JLBA 1Z88A 3U09A 4D4IA 1I7NA 1ZJWA 3KVRA 2F55A 4M0DA 4B3CA 4RDCA 2I99A 1JSXA 1JJAA 2QRJA 3W5SA 2VAVA 4HXFB 1SKUA 4RELA 4E5DA 1QGUA 2HF7A 2EXXA 2HRRA 3AR4A 2HK9A 1FVOA 1V96A 3ZHVA 3SR3A 3D5EA 2GCPA 3BAZA 3QELA 1WP4A 1VCIA 2PRIA 4K6MA 4TLCA 1OOEA 2WUEA 2V9CA 3M5DA 4EWLA 1E92A 1OBFO 2IYEA 3AL3A 2QU8A 3GJ4A 4QFCA 3MCUA 4YI3A 3ZLTA 1IOVA 4EI9A 4CIBA 1VL5A 4WMLA 5I45A 3EIEA 3WSWA 4DXAA 2CYAA 2H92A 1YL6A 1SXJB 3DZ8A 3AI2A 4Z7NB 1NF2A 3P52A 3NV7A 5A4MS 1FP1D 3IIIA 3VZPA 4M0EA 2ATEA 1SUCA 4TLMB 4W8OA 1JKFA 3VGPA 5JI2E 4WLUA 3LCCA 3BKXA 3IALA 2SNIE 2ZREA 1X9IA 2IL1A 2LDXA 4Y2HA 1R0YA 2ZFUA 1CJKC 2WSIA 5CGZA 3U2QA 1GKLA 3VU8A 4LFAB 5T8KC 2XYVA 1QO7A 3DUFA 1QORA 4IIUA 1AM4D 2OOKA 2XBLA 3C74A 1GUZA 1MVOA 4H6VA 4U39A 5L7YA 3DHVA 1B2RA 4JBIA 1XMOB 3QU4A 3QHAA 5HS6A 3CZMA 1QMPA 3DD5A 1PNVA 4XX0B 4MEAA 4MTCA 1MX3A 2ZRPA 5B3KA 1ULUA 2FF7A 4MDEA 3T3GA 4BKUA 4CEIB 5HMMA 3HQ4O 1EUDB 2ZJOA 4R5HA 1JHOA 5L8VA 4H1TA 1EVEA 3R0QA 4RSGA 2YZNA 4Y6OA 5TNXA 1UKZA 2VTEA 4BNNA 2G88A 2OTCA 3GQBA 3ML1A 1N9ZA 4TKLA 3T9BA 3U3ZA 4CQMB 5JZVA 3OETA 4G1UC 4M9QA 5A3RA 4W5OA 4F4DA 4I4CA 1B6TA 1G98A 3VNQA 5B55A 4WXRA 4TKVB 3ZWKA 4Y2UA 4B9EA 4OQLA 3DKPA 4ZEOA 4C5BA 3QMVA 2J5KA 3BL8A 2PUEA 1VJTA 1K7CA 2WJIA 5KOIA 4YJFB 3RPEA 1ZA2A 1L3CA 2D74A 2X41A 1TM3E 4US1R 2VPWA 1I7LA 2HMUA 2O3RA 3OTGA 3SQLA 3KAQA 5DKFA 3T3EA 1ZGBA 1BHO1 2P3SA 1T91A 3MOSA 1IVSA 4RLFA 4YCMA 1D1PA 1M83A 3E9MA 4WOBA 1WCYA 1QIHA 1P6UA 3EVZA 4PRKA 3A06A 3TW0A 3JVIA 3E53A 3L7KA 4I4NA 2HHJA 5DISB 5FJIA 1QV6A 5KYKA 4AI6A 2EP5A 4EO9A 1VJ0A 4M6WB 4S1WA 3BJEA 1QP4A 4G0VA 1L7MA 4MB0A 5DBGA 2GVDC 5JS8A 2C5AA 2VR1A 4M9XA 1Z5OA 3BIWA 3GWGA 3H42B 1L4EA 2DUUA 2DFPA 1LLQA 5LXTF 3TI9A 4Q9KA 2M6KA 1TCCA 4JQYA 2P6NA 4WNCA 1NP6A 1BHQ1 2BH9A 2AR0A 5ADUS 2JJYA 1ZD9A 4PR3A 3CVXA 3C43A 4KXNA 4OK6A 2H6EA 1YR2A 2JIRA 1M8KA 2WT9A 1Y1QA 1JSCA 2YR0A 4ND1A 4PM4A 4CIWA 2E4ZA 3WGIA 5DE3A 2WIGA 1LDNA 3W78A 3BE5A 3CRZA 1N1MA 3HBLA 1GTL1 5DF1A 4HL6A 4YAGA 4MPDA 2W37A 2FSVA 2OBBA 1OZFA 2B4AA 3OM9A 4ESHA 5J4VA 3PNKA 4R8LA 1HTWA 5CTAA 1V26A 2FX5A 4YAUA 2P9QA 3U4GA 1RSZA 1HT1E 4HSGA 3U1TA 1SXJE 1W59A 2G9VA 1VFPA 4XI9A 5EFOA 5J5VA 5GM1A 3S99A 3SJZA 4EL0A 4G8JA 1B0ZA 3LK7A 4JEIA 4RIIA 3NP7A 3GJ6A 3E48A 3OJEA 4OLAA 2VPTA 4YGXB 4ETNA 4F1JA 5BMVB 1TX4B 1E2GA 3ENKA 1IN6A 1AOXA 3BGOS 3ABQB 5FA6A 5CLFA 9ABPA 3K6KA 1HFWA 3A1WA 1NUUA 1P73A 3CT6A 2D1YA 1P45A 1P2BA 3GVPA 4PZ9A 2LCQA 2VNJA 5AMXA 3QHPA 1FDRA 1IWOA 2Q9AA 4KK4A 4L4RA 4ZEWA 3PXAA 4OV6B 3DVSX 3Q88A 1PVOA 2BVNA 1R64A 2HQOA 1CY1A 2J85A 2R87A 2ZWPA 3SJ7A 1N2CE 3NOXA 5GM2A 3STVA 7YASA 1BHJA 3EWNA 4QJ5A 5JECA 3DYBA 4RYDA 1KOGA 2MIIA 1UT6A 2ZITA 4CTMA 1H5UA 3WGZA 5KJ6A 2BFFB 5F9HA 2FWRA 3WGVA 1H6CA 3SCZA 2XT0A 1ISSA 3N7UA 1W7AA 3ZV5A 4TSRA 3ZQ4A 2C5SA 4GPAA 4O4HB 3RT9A 3VH3A 2N47A 1SVWA 2K4MA 2NTVA 3K9WA 3M5CA 3M8KA 5I9MA 1DG9A 3QUCA 1N9KA 2J33A 2P3LA 4Z54A 2G04A 5LDHA 4ZU3A 4QU8A 3H86A 1I9CA 1D9ZA 3EOZA 1N6RA 1K5PA 3JQAB 3GPLA 1J21A 3SKVA 3JASB 3KTAB 2GYYA 1A4UA 3IVRA 3RVRA 4KRFA 3AEQA 1R5OA 2C2GA 4X64B 5GINE 4GSKA 1DC8A 5FL7A 3ZWBA 3SXJA 3WQQA 3ZH9B 3P4XA 4OD0A 2J7PA 4GZ6A 1HT3A 2OUKA 5E8JA 1WOMA 3M1YA 1X3SA 1PJAA 2QX7A 3W7VA 1UWKA 1OYVA 1A72A 1I24A 2CVQA 2EZ9A 2OG1A 1JXMA 2ZRAA 3O2SB 3FKSD 4M38A 1N6LA 1T8SA 3SZOA 5J2UF 4ND8A 1HDYA 4MR9B 1U7WA 1U2DA 4BQOA 4ZT6A 5TRTA 4LSGA 3HB7A 2KQUA 2OCGA 3LDFA 4M7PA 4JJFA 1GNLA 2O0LA 2EGUA 5IULC 1BU5A 4RHEA 5KYWB 2X3UA 3DEFA 1J8VA 3TJRA 4MNTA 2QAGC 2QM8A 4G1EB 5ED4A 5LYJA 5CFMA 1U8UA 4OHKA 1YRLA 3CR7A 4M1WA 1ZONA 4MUMA 1SK9A 2OBLA 4UDOA 2RSLA 2O7QA 2WVJA 3H9GA 3UYKA 4YP0A 4JI2B 4AJ2A 1YUMA 3EXAA 4X91A 1S2IA 5B53A 4YRBA 3W1WA 1CS0B 2VH2A 1R2QA 3LY8A 3U49A 4F4CA 5TR9A 4B3FX 3R5KA 3O2QB 3QE2A 3ZE2B 1IZ0A 3PDJA 1FX0B 1M74A 3OZWA 1DIGA 4KRGA 3UXMA 1D2AA 3K7EA 3NETA 5LWQA 2VJKA 4PNPA 1QZUA 3DE6X 4TV8A 2OQVA 3UT6A 2VQ6A 1XTBA 3EE6A 4XOIA 2Z6VA 4GC5A 5CA1F 4B3BA 2X0KA 5KB3A 2I7DA 4J0CA 1ATIA 4C1NA 1AH2A 3V42A 3H5LA 4MO2A 1DOAA 4J03A 2GMWA 5IMBA 1JYEA 2EYUA 3VTAA 2C3PA 3B6MA 4RMHA 3NJ4A 1WXHA 1N32B 1JDZA 1MF7A 5CNIA 1SPXA 4ARZB 2WUVA 4G23A 2HCFA 4ARBA 1CSEE 3GN1A 4QTUB 3LWBA 4MP3A 4TUYF 4CKWA 1NQTA 1QDLB 3OFNA 2Z9BA 4TKZA 1Q1BA 4O25A 4QPCA 1AKUA 1AKYA 3PA6A 1ABBA 3K9QO 4PWYA 4R1UA 1OXTA 3GJQA 3HUDA 3LOUA 1L5QA 5IEBA 1PW5A 1EVYA 4KXYA 4MGHA 1KMHB 2DFNA 2POCA 4N8DA 4TTTS 1HNXB 4ZVKA 3QW4B 3U7HB 3Q3CA 3EXEA 4EMUA 2WD7B 4X95A 2AG6A 4C07A 2C78A 3FBTA 2Q2QA 3BSYA 3IXQA 2IZ1A 3VOSA 3ZBTA 4RLQA 5BQ5A 5TPWB 3ICEA 4B35A 4CIDA 2Q5QA 3I2HA 5FOSA 3LP8A 1H2FA 2J07A 2FRDC 5BUSA 3LUJA 5HS4A 1U0BB 1OFGA 1M6EX 2IHZA 3TQFA 3KOYA 2B82A 2F4NA 2V4UA 1C3OB 2PH7A 2NW6A 1UJ2A 1PK7A 1Z35A 2CXNA 1X77A 2RHJA 1CFJA 2RDMA 4UJ3A 3K4HA 5C5IA 3KLMX 4XSHA 4BNYA 1AHNA 5KQLA 2UZ1B 2EF0A 4RL4A 5CXXA 3NH9A 1EQAA 4PO1A 1P7WA 4C0KA 4JHXA 1EK2A 1I3KA 1DIOB 3Q15C 3RYTC 2BL4A 1JQDA 2WK1A 3FNFA 1Z6ZA 1F4PA 2XUJA 1A71A 3CH7A 3EXIA 3KYIB 3QVXA 4HFRA 5ERXA 1JDUA 2P2DA 1A9RA 3O7MA 3P20A 4C3UA 1MVNA 2D1TA 1KI7A 4FLMA 3DLTA 1Y80A 3JVUA 3ERCA 3HU3A 2VXBA 5CH5A 4PIMA 4GXQA 1QKIA 2X7XA 2XW6A 1LTQA 1UDRA 4UXJA 1AQYA 1Y1SA 3IP3A 3GEHA 3ZD9A 4C0QC 4E3ZA 1S2MA 1DEKA 3LQYA 5HDBB 3QUBA 1Z4LA 2OA0A 4WT7A 4GSLA 9GPBA 1IM5A 1H23A 2ZROA 3KLBA 3VJMA 1NI5A 1PJZA 4RULA 4EKDA 2Z5LA 3K9BA 3LLCA 3ND8A 4D6PA 3ZEIA 5CLHA 1WQ4A 4OY3A 4YREA 4ATNA 3AB8A 7MHTA 3STTA 3R41A 2C3OA 3U37A 1ZJJA 4FYIA 4YIKA 1DWOA 3MNFA 2VF5X 3AI1A 3PQFA 4MIOA 1YS4A 2Q28A 4DBLE 1YR7A 5KSYA 4OI0A 3WGJA 4IJMA 2WWYA 1MC1A 3OTWA 1M8JA 3OQVA 4YJ3A 4TROA 3T4XA 3W8NA 2YJ6A 4YJGA 3AFOA 2QRHA 3E84A 3LGSA 4CDRA 5DX0A 1PD1A 2ZJFA 1E62A 1CD5A 3LUDA 4DWWA 3L0IB 5A4DA 2VSNA 1FQWA 1KDRA 3AKEA 3WLSA 2H2WA 4JASB 1PFUA 1Q0ZA 1YZVA 1EFPA 4XFJA 2WZDA 3A3YA 4E4RA 1CKEA 4JT2A 5JCOA 5L3SB 4RZIA 5A05A 1Q1GA 3F97A 4CFYA 2CYBA 2QTGA 4B82A 4Y2TA 2PWAA 3CGWA 4D96A 1I4TD 3ESDA 3HUUA 3VSBA 3DC2A 4HHEA 3T9CA 1NVXQ 1W4AA 5IAKA 3FPHA 3RVBA 4B3RB 4OFBA 5IDXA 1C9KA 4JC0A 3TNYA 4NFYA 3EGVA 5CA0F 4NZYA 1HBJA 3QBTA 3VU1A 2K5UA 1AU9A 2ZDQA 2IS6A 1B7GO 3OF3A 3ESAA 2HA0A 5CG1A 3C7CB 1QRRA 5GGYA 2IV3A 4CF3A 3HN7A 1T43A 3AJRA 4MCAA 1SWVA 3QVJA 1XX6A 2PDAA 3KQWA 3JRNA 2P9ZA 4B3HA 3T7SA 4UCWA 3LBNA 3O21A 2ZIEA 1Q1QA 2Y4NA 5DI9A 3HXOA 1TYBE 4HGRA 4TLLB 1HSOA 2JAQA 1XIVA 4NYJQ 1RCFA 2QL9A 4B71A 3CF4G 4GRIA 4LXIA 3AILA 5KUTA 3L1IA 4RSMA 4BLRA 1EEXB 3UCXA 1C9NA 1FDOA 1TJ3A 4HQFA 3W2EA 1VQ1A 2QE7D 3OE5A 3N8GA 2H9IA 1PP4A 4BAUA 2FH5B 4BBZA 3I9OA 4JROA 4YFYA 4ZCSA 2ZUUA 1EFKA 2QR2A 2ZRDA 3K9NA 1N92A 3W5IA 1RRGA 1CTQA 5KKCA 3ZV3A 3DO6A 3DYIA 2FSSA 3GMIA 2MCFA 4UU7A 3KWMA 4MJ3A 2BCJQ 5F3RA 1WMBA 3MW8A 4FE4A 5FCDA 4B4OA 1TRHA 4RV4A 3NI2A 4HDMA 4KQMA 5GZ1A 2NUBA 1WKVA 2PZBA 3DO5A 1NXWA 3N76A 5CVJA 4XVCA 6REQB 5F5XA 4OQYA 3TCNA 1FLNA 2CLLB 2IXGA 3IAS6 4ADSG 3MINB 4A27A 3BRQA 3VXKA 1KEVA 3KAKA 1K2VN 4NBTA 2W42A 1H2YA 2YWHA 2BP7B 3DE2X 3R0VA 3UBMA 3CXUA 4C3OB 1SU4A 1UANA 3CFYA 2PUFA 3IUJA 4TXHA 3ZWYA 2NNWB 1Z28A 2EFDB 4A91A 5KKAA 1M0WA 4FGSA 2V7GA 5TJHA 4G6ZA 3DD1A 3K0SA 4RZSA 3WNBA 4DSOA 1KFKB 3I9V1 2D0PB 1M6NA 3LDHA 3HN2A 3OEHA 4Z2AA 1G66A 1G4HA 2XVAA 3IO5A 5D6NA 4HEHA 4QM7A 4GBGA 4OX9B 4U7WA 2VPXA 1HTBA 1Q21A 1RRVA 1U1FA 2PGAA 4MRMA 4ZOLA 3V1KA 1NJ1A 1ECLA 1F2TA 1G8YA 2Q41A 2YS6A 5K6TA 4LF8B 3B8EA 5JXJA 5A0VA 4WZZA 3UENA 1T0HB 2FMUA 2PUAA 4YRDA 3F96A 1JH9A 4L0MA 3WL5A 4P86A 1RKVA 3DTVA 3OFND 3EVBA 3QEKA 3WMEA 2J6BA 2GARA 1WRBA 1IN8A 3DVAB 3SFTA 2DPXA 4AMBA 1VMKA 5LJLA 1OBVA 4DDWA 3V2UA 4XDZA 4UBMA 2EZUA 2FQ1A 2PZFA 5H81A 3WA6A 2X4LA 3EK2A 2CZQA 3FVWA 1XEFA 2WU8A 3A4TA 3VYSB 4K7JA 3ZPXA 4OOFA 1GITA 8MHTA 1XAIA 4Y7CA 2OKCA 4D0GA 3N8IA 1HYHA 4YYEA 3JZFA 2NPOA 5DH9A 2BMEA 2W70A 4DBVO 2AUMA 4LDJA 4PF1A 1XMIA 2QD3A 4IZOA 4JLAA 1NWCA 3EXG2 4L8FA 4E03A 3NFRA 4L74A 5KVCA 1MT3A 3MHPA 3A6ZA 4F3CA 1YZFA 3U62A 2QLBA 1UMDB 3IBCA 4LK2A 2O8FA 2JHCA 1ZJ4A 1PV2A 2W58A 3DFMA 3OQIB 1X7XA 4LJYA 4X85A 3GBVA 3B9BA 3LE8A 4BFSA 1QRTA 2ONJA 3Q7SA 4BU0A 1W0CA 1OW3B 1VMAA 1Y1TA 4IQ8A 3HDVA 2PT5A 1P1HA 3OECA 4XPIB 1BAPA 2C57A 1FNDA 1R8QA 1YOVB 2B5OA 2WDPA 4TWZA 1E9RA 1T9CA 3UAOA 2AB0A 1DHRA 1JG6A 4BX9A 2IC5A 3AJAA 5AJVB 1RWXA 1YBHA 2HD4A 4A3SA 2AQIA 2OAQ1 2ZUWA 3O91A 2XF8A 3RYCA 3LDGA 4QNNA 4E2WA 1I80A 5EE5B 1G6OA 1Q3HA 2NVUA 1FRQA 3I8XA 3UKOA 4IIJB 4AN1A 2ATIA 4NYMQ 3RBZA 2QUKA 3Q3HA 4PYNA 4V03A 2GUWA 4FKZA 1JFRA 1S2DA 2GZMA 2OZEA 4R7ZA 5LBIA 4FB4A 3A6DA 3S81A 4UM9B 4RTLA 4HZIA 4KVGA 4CKBB 5TVGA 2RHMA 4N7RA 3GDFA 3P0FA 4PGMA 3WGHA 8ABPA 1P2FA 1LI4A 3MBKA 4P2BA 1NBMD 1V16A 1ZGCA 3KUKA 4LZPA 1LPBB 2PK3A 3KPJA 2QG6A 3FNBA 4FZVA 4K81B 5J9FA 1SRRA 4XUCA 3KV1A 3ZVKA 2CVZA 4NPHA 1FSZA 5BWOA 4F7DA 1XD2B 3EH2A 4OF4A 5BOSA 2AZMA 2OMEA 2ZJBA 3OF5A 4WK0B 2BM8A 4ZZ1A 1CRQA 3G9UA 1TEHA 4FJ2A 4DQLA 5JCXA 1TEZA 1I6LA 1WU8A 2JLVA 2PPVA 5K3FA 3RAPR 2V4ZA 2VJBA 3AG5A 3HCPA 1XELA 3L04A 4LHYA 1QU3A 1N1DA 1NF3A 3MLAA 4C0WA 4I0WB 3D64A 5JANA 4HQ6A 4H0CA 4CLEA 1TEXA 5AK4A 4DRZA 3WYDA 1NQAO 2X9QA 3KQPA 4G85A 2J31A 4I1UA 4P7JA 2JEZA 4ZKDA 1UOOA 1VIDA 4L9WA 3H2ZA 1V4VA 2DLNA 2RGGA 3PC4A 5HBGA 3K6SA 3MWEB 1A8HA 2WI8A 4WESA 1BXGB 2W0MA 1HNWB 1DC5A 4X44A 1LPOA 3UJAA 3IMFA 4DBZA 1AK9A 3KB2A 4TXNA 1PO7A 4DC1A 4I5GA 1CU1A 1M2NA 5AH0A 4J0DA 3UMYA 4MVJE 3HKDB 1AO0A 4LY6A 2O2CA 3C3KA 3AFGA 3HCDA 3BK1A 3K6RA 4C6TA 2XWBF 3IB6A 4R3NA 3HGTA 1G3UA 3GXOA 5ITZB 4CTJA 2X8JA 3LBFA 2RHBA 5EVCA 1PGPA 3GLFE 3PS9A 1W36D 2A6PA 2G9ZA 1QIGA 3EA4A 1XDZA 3QA3E 4IUYA 4JJ7A 2QX9A 3ZCQA 5GIPE 4OHXA 2AJ8A 3JWIA 1K86A 1C1XB 4UXIA 1UDBA 2DHQA 4FNGA 4C03A 1WR8A 3E9NA 4PNZA 4JZKA 4GPEA 1EDOA 4PZEA 2FPLA 5L6MB 3GDOA 3C3YA 2Y67A 3R5FA 2P0YA 3VHQA 3RHZA 5CYGA 2OQ2A 1H65A 2JKZA 4MW1A 4OJMX 5LLDA 3BD7A 2IZOA 3A3PA 3E6AA 3F8WA 4WY5A 3RE1A 2H5JA 3ZHUA 3SM3A 1E7MA 4BKMA 5IU6A 2G1KA 2HR1A 2O8CA 1G18A 2AOXA 2IPMA 2JCBA 4IIHA 4LJKA 3PJRA 4J6EA 4WK2B 1WF3A 1I7DA 2PNFA 3MCWA 2PH3A 4WUTA 1EWRA 2VSYA 4XVUA 5ES4B 2FA9A 2PRJA 1RRMA 4G9EA 4LV5B 4KSYA 4L9SA 5CEJA 1VMEA 3CE9A 4IGAA 1Y63A 4RACA 5CNMA 3S2GA 3IDZA 1ZUIA 1CY2A 3IV6A 2R8EA 1ZK1A 1ODFA 3MWJA 3MILA 2VK1A 3GRUA 2W8ZA 7ABPA 1WZCA 4NNOA 3F6PA 4FKMA 2Z8YM 2WWVD 3E2IA 4V0KA 3CUVA 4RO0A 4ITRC 5BV1A 1XBTA 4XJSA 1KI6A 1D1SA 5TDHA 3ICOA 3DEYX 3A32A 1SKAA 3NX4A 4KE7A 3OIUA 1BU8A 2CDRA 4DA7A 2FSVC 1QBKC 2CDAA 3UC5A 1YO6A 1ZQ9A 4WN9B 5TEVA 4BNUA 1T4BA 2WFLA 4R71A 1P5ZB 1TGVA 1DEAA 5HRAA 5GOZA 1YXMA 1LNSA 3D1LA 4LY9A 1EE9A 2BBWA 1K3FA 3SLKA 3ZHYA 4EZEA 3TSWA 3OVMA 2C59A 5J5CA 1Z7BA 4B31A 3D3WA 4UUPA 4PRZA 1C7EA 1SO8A 2EWWA 2QNBA 4HWRA 1E69A 4OHFA 3L9WA 3OKFA 3VHXB 5LNK6 1DTSA 4IIDA 5FUVA 3C3WA 1DV2A 4JOQA 5LA6B 3VZDA 3ZYCA 1JZSA 5IM4A 3ZY4A 4AYTA 2FWJA 1V1RA 2HMYB 4R2LA 3OIYA 4BQRA 3RYFB 2CHVA 3H9CA 1DQNA 5JYDA 2VJNA 3CN7A 3COSA 3W06A 5LMNB 3TNFA 4A6PA 2REQB 4WWHA 2H1OA 3QUQA 3ADBA 3BMNB 3KJHA 1EZ1A 2D2XA 2DOKA 1XFDA 5H3HA 1Z0IA 1EK0A 2NO5A 3OZIA 1RHUA 2HPVA 1DE0A 2HBQA 2I6FA 3VH1A 4N40A 4NMMA 5KWIA 4KIJA 4R1TA 2H1RA 4YT8A 5F5NA 4I08A 2F48A 2RGEA 1UQTA 2XTZA 3SHTA 3PHBE 3WMFA 2HHLA 4LJ7A 2Q8PA 2ZYWX 4AZTA 3ROEA 1MO3A 3DONA 2JF0A 3EGXA 4Q1EA 4IDAA 2B5WA 1A96A 1TNDA 4ZHQA 4WLNA 1WBJB 4YWJA 4FX5A 3TIVA 2HH9A 2M2IA 3HXMA 3NOVA 4C7OA 1J2JA 2GRJA 3FE2A 2KYRA 3QLEA 3CEPB 3MBOA 3AUTA 1THGA 2XXJA 1JNYA 1C4OA 4MAFA 2H9AA 2JJQA 3WWOA 5ISMA 4D8XA 3ZD6A 1EWTA 2BWJA 3AJEA 2DULA 2OZLB 4NC9A 1TEVA 2X14A 4IGIA 1HA3A 2FQYA 4W5HA 1U2DC 2WILA 4KUEA 4KIUA 3E18A 3PFFA 4IQ0A 4QHTA 1EFDN 3C15C 3SM9A 4D25A 5D7BA 3ZI7A 5TXGA 3PK0A 3HBNA 4GOOD 1P9LA 1RKBA 4L2IA 3TOCA 3WIEA 1O95A 1UWCA 3LT1A 2NV0A 1B42A 3IPYA 5A9SA 4LJRA 1FQKA 1P62B 3THXB 2B9VA 2F6RA 3P9KA 1G6Q1 2J3KA 3OMXA 4YUVA 2HV9A 3B3AA 3GUVA 1L5ZA 2JDID 3K2IA 1YKSA 2CK3A 1ZBDA 1PW7A 5MFPA 3FOAA 3RODA 2G70A 4L75A 1FFBA 1D6MA 4RFSB 3AF1A 3ZVLA 1MG0A 1YBMA 3AESB 3S68A 1XZGA 3E22B 4C1BA 3ICPA 1TCBA 5DT9A 1NXPA 1V47A 4CG1A 5JQGA 1KMQA 3QU9A 5BPHA 5EYPB 1A76A 2YS7A 3OZTA 2N46A 2P4SA 4K9SA 5C0OE 1F20A 4UTZA 3UMJA 1JB1A 4IDGA 4IOKA 5IVIA 3MRTA 1TTHA 3AU9A 3VFDA 1QH8A 2C84A 4NV1A 2PR2A 4XSGA 1ZH0A 1VRWA 4DSAA 2A1TR 3BREA 3U17A 3UJ8A 3MJDA 4E30A 5DSZA 2P5SA 2NZJA 4IH4A 3WNDA 3WJ1A 4XSVA 1Z7EA 5J23A 5AUOB 3Q8KA 2W6ID 5B36A 1O6ZA 1X80B 1ZOOA 3O93A 3PQ3A 3W5BA 2LCFA 1J2UA 2DH5A 2JEYA 4TGLA 2R6DA 2Z09A 3TE7A 5FBWB 4AZ0B 1IZ7A 3KJEA 2LW7A 4IINA 2FFQA 1FTYA 4BHTA 2Y71A 4UFPA 3ID6C 2AVDA 3BZWA 1NQUA 4RGYA 3LOQA 4DUGD 4M3NA 3NBKA 2ORVA 3W5HA 1MQ8B 1ISGA 3WGKA 4PG6A 5IJ9B 3VOTA 5KVAA 3MUEA 3N05A 5K3BA 4EI2A 3PUHA 3ADKA 2C88A 3FBWA 1A04A 4GOJA 5EIBD 5JSYA 1R4NA 2QZZA 3IBTA 4EGCB 3JAWB 2G0AA 3GLIA 4W1PA 2FUKA 2ZLBA 3TLGA 1KQPA 4RZQA 1EE1A 2QN1A 4MI6A 1EFRA 3L05A 5D3MB 2IX3A 4BXOA 1JGTA 1RBQA 3CRRA 3IC5A 4EPRA 3NATA 5AFSA 1X1RA 1ZGHA 4YP7A 1WXEA 4Q4LA 2A14A 2KS6A 3WXBA 1O0BA 2OHOA 3MLEA 2JLBA 3QJ5A 3GNTA 1MQ9A 1L4KA 3T06B 3ZGVA 5C8XA 1R9JA 2QOEA 2WKWA 4IGFA 1RJWA 3B5JA 4M87A 5J5AA 4O4IA 3SXPA 2Q29A 1KEKA 5BPFA 1M2FA 1Z0UA 3EQ8A 5I7VA 5P8WA 4MUEA 1W85B 4XYEA 3QE3A 4XCVA 4D26A 4IFEA 4GXNA 5G41A 4IR7A 2F64A 3FTEA 3RVQA 3VPAA 1FNSA 1YZUA 2A4KA 3C3CA 3KB1A 5LYYA 2PCLA 2FOLA 4A8PA 4NH4A 4DZTA 2JK0A 3S44A 4IRMA 1GUBA 1AMUA 3TQHA 4TS3A 1P0QA 2PKRA 2XUZA 3L77A 1CQJB 2C4UA 2HFKA 5ALYA 4KYIB 2JLZA 4J0HA 4HG2A 1QPZA 2J4CA 4RF4A 4NPCA 1TM4E 1D0SA 2RGDA 3B9PA 3IULA 4AZ3A 4EPVA 4BLOA 5JYBA 2JGEA 1W1UA 2RCNA 2AOWA 2LTAA 5ESWA 1WBDA 2R3SA 5CFZA 1U7ZA 1LF5A 4AJNA 5A5GA 3UJCA 1GG2A 4B3DA 4TRJA 3SSMA 4AKIA 4LI3X 3ROQA 4BP8A 1V8FA 1BKDR 1ZR4A 1LDBA 3FX2A 1GV1A 2WLTA 1N2XA 3RDPA 4TKMA 5JDCA 1HDRA 1COZA 4G0YA 3BUSA 2DCMA 5LQCA 1Z3IX 4ZAYA 2QUAA 3M3PA 3TNLA 1R6VA 4NNPA 1W6RA 1MJ5A 2C5EA 3JQPA 4BFVA 5C51B 1UBKS 1UPCA 3L6EA 5JCOC 4EHBA 5MDHA 1D8TA 1G6HA 3R0XA 4ERXA 3P32A 2YVQA 2WMYA 1Z75A 4F9TA 3GFPA 1JEEA 3AY7A 1G8SA 1SUFA 4L4SA 3TPCA 2ISSD 2ECPA 1I1OA 1JAXA 4FPXA 1GXSA 3CVYA 3DCJA 2QZ4A 4C7XA 3Q7TA 1DEHA 4IAOA 2BUBA 2QF7A 1G41A 2QTFA 1P77A 2LBPA 3PZBA 4RHFA 4YJFA 3THOA 2XYGA 3CR8A 2O2XA 4MGZR 3RT1A 2Q21A 4II3A 1OD6A 2BHLA 5LP6F 3PC2A 1VSQA 3NAQA 2QN2A 3E2MA 5ALFA 1C9JA 4BASA 1TFRA 3F98A 4Q00A 1RMTA 2DWUA 4LWZA 1FFHA 3A4VA 4GZMA 4QU5A 4A26A 4XGIA 2GETA 1V3TA 3A6FA 2HIAA 4JN6B 1HE3A 4X1KB 1JPVA 5ANRB 3VR5H 2F1JA 2CV1A 4DQVA 3LQ1A 4ARSA 3PIRA 2R2AA 1S89A 4W1RA 3U3DA 2GFIA 1UAAA 4DLAA 4JXXA 4NSNA 4BAGA 1MFZA 1G8AA 1XLWA 2EIHA 4IS2A 4KO4S 4LJ6A 3EUWA 3GB9A 3G0CA 4N01A 5H16A 5B6IA 5K8JB 1W2HA 1HXHA 3NTUA 1O6FA 1RWKA 2Q9BA 1X8JA 4OHCA 3UOGA 2ID4A 3VTFA 3DMDA 2BGNA 1WNFA 2CMFA 2ZI3A 3DAYA 1ONNA 1CEQA 2FGJA 4UFNA 1KWGA 3LCMA 1TZMA 2FOXA 4H15A 1QYRA 2CVFA 4P22A 4TTJA 5FQNA 3G5AA 1XZEA 2HPAA 4I3FA 2XLBA 4HLUC 5CIQA 4A2QA 4ZFNA 1GAXA 2VNHA 1ZO8A 2D13A 2TMGA 2ZRFA 1DAOA 4LJAA 3T4UA 4CMJA 4TMXA 3FTCA 3JQ7B 4HFNA 3IT0A 1DKOA 5ALKA 1Q7CA 3KQUA 1AF4A 3SAJA 4BKRA 4N65A 2BMVA 1O95D 3HSKA 3MXOA 5JMWA 3EZFA 2JFOA 1PG5A 1P81A 4YRQA 1UC4B 3I92A 2R60A 4EHNA 2YWEA 2PO7A 2ZSJA 5JYCA 3F9IA 1XU9A 4F0JA 3B2NA 4HN4B 4OXIA 2LCIA 2CK3D 5AW5A 4B9AA 2VAWA 3VZSA 2VYVD 3A4YA 3Q2IA 2OT3B 5EWJB 1NR7A 4FS3A 4O4LB 1FRNA 3DZBA 3IP7A 2XNDA 3L6DA 1TC2A 1D09A 4HYQA 3I2JA 1EKXA 3DQPA 4DJEC 1JVSA 1XRSB 5KYGA 5F51A 3L8EA 4HEJA 4ZVTA 6AT1A 1B6SA 1A8PA 3IRVA 5EE1A 1KH1A 4JEMA 5JC1A 4QOFA 3SYRA 4B80A 1A2OA 1D04A 3VVCA 3U5TA 1AKMA 4URXR 4W5WA 5DNDA 3K05A 1JHYA 3RIEA 1POXA 3MJSA 3U4HA 3OWHA 1W581 2D1QA 5F3WB 1K2WA 4O4HA 1BX0A 4MVJI 5CRIA 3T7IA 3G9XA 1G2OA 1XZPA 3EC7A 2AXQA 3ETHA 4B6QA 5CVVA 2RCYA 4OFWA 4BP1A 4DARA 2JGRA 1S4MA 4EATA 5IX8A 1KHHA 2R2GA 4I2VA 3PGJA 1E3EA 4UUQA 1PSDA 2CSUA 3JQAA 1E6UA 2UUPA 4I14A 4WFIA 1ESEA 3LUGA 1WS6A 2V3CC 1GL9B 5GTDA 2J59A 4QOJA 5FUYA 3CMCO 2BR5A 3KYJB 4G0UA 4EAAA 1GPAA 3MOGA 5GIOE 2ZIUB 3RVLA 2JLUA 2G9RA 3VR5A 1OWPA 3BT7A 1Z7WA 4DHWA 1DEXA 1UXGA 1RC0A 5WRFA 4YXWD 1VLJA 2HSWA 3NAMA 2A0YA 4EUKA 1MAAA 2FPGA 1C0IA 2HQBA 5ARCA 4EPWA 5EI5A 3RRBA 4HT3B 1Y89A 1HG1A 3PUXA 1E8DA 1FQOA 3KNZA 4EI8A 3VGJA 1GPUA 1WVGA 4D0NA 2WD8A 4R5MA 3TW6A 3KR1A 4LFBB 2VRCA 3DE0X 5JAHA 3V46A 5ELLA 1YU9A 2D7JA 1N2OA 3FPGA 3CX8A 2BHNA 2K87A 1L4HA 3Q98A 2JIZD 2VDJA 4KI0A 5K6AA 2UXDB 4MLPA 1LQ2A 4FFDA 2PMBA 3L7OA 2BFBB 1LCIA 3MB5A 4ZOCA 3OHPA 2BKXA 3D4IA 3UMRA 1RXSA 3P1JA 4Y2VA 4YJ2F 5AHWA 1FVFA 2QRMA 4RY8A 2WWRA 3DOFA 2CLSA 1OZGA 1OC4A 2DHEA 3D4BA 3AB3A 5I7HA 3ZK9A 2ZM5A 3WAKA 2XX3A 4EHHA 3K0HA 1VPDA 3A1DA 1SXJD 3ABSB 3KSAC 1Q1ZA 1WU7A 1WDMA 2DRIA 4QGHA 5TGTA 3QVGB 4TRMA 2PVPA 3W79A 4OQEA 5M29A 3S40A 5JXWA 1CJUC 4LX8A 1YS9A 5FWDA 4B73A 5C3MA 3SXUB 2QEQA 1GOTA 4OXQA 1VECA 2BOVA 1DKQA 2ZSHA 3MFQA 3O4RA 1KMMA 4UEQA 1RD4A 5FKJA 3GA7A 2D6FA 3OCJA 1WKBA 3Q0EA 4CDGA 3T7TA 1KFBB 4QOGA 4Z4HA 4Y6GB 4XJTA 4W5QA 4RC9A 1U5CA 3LZCA 5FO1A 1YJ8A 3RC3A 1XZFA 3HB4X 4RVHA 1DBQA 2BJWA 1GT6A 1MIOA 2IYSA 4G0OA 3BWYA 4EFKA 3H5WA 4TVSA 5CFRA 2O5CA 3N70A 1U9IA 3GFVA 4JQZA 3JY6A 3GFQA 1ELOA 1GT91 4N7JA 1QHSA 2CXUA 1ZUNA 1CB0A 1RQ2A 2X8AA 4MJLA 3ZBQA 5B4UA 2EATA 3QMMA 1KMHA 1IN7A 4TTVA 3SZ3A 1ZC4A 2E21A 1LPNA 4CQMD 1Z26A 3AYXB 5E3JA 4RY0A 2O4CA 3SE0A 1KY3A 1SR8A 4DILA 1ZWLA 2BI4A 2PGDA 2WWIA 2O07A 2PMFA 3EB9A 1Q1NA 1Y7IA 4BOYA 5EJEA 1CPYA 4X5OA 3LKVA 4ZAGA 1N5KA 1UC9A 1NR1A 2WSLA 5NLLA 4CCSA 1JXOA 3EWAA 3DZDA 2JJ1A 2PZAA 2DT5A 4ZXFA 4DLPA 1X7GA 1C3OA 2E37A 3RK1A 3BZUA 2PL3A 4DAOA 1C3EA 4LE2A 3KETA 5DX1A 3WHKA 1C7RA 2QRVB 2Y2UA 3JATA 4AJ1A 1AQIA 1Z4IA 3NIBA 5KMGB 1X9GA 3M3HA 1JTVA 3SDBA 3N8HA 4MPJA 3W2HA 1BTOA 1DDOA 2GJ8A 3NVMB 4MYRA 2WHPA 1TA0A 1T10A 2WWFA 2FK7A 2P6UA 2XMRA 1TT5B 3O4IA 4BLQA 5FTLA 1WWKA 1G7TA 4ZC8A 5A0FA 1M5RA 1IZZA 3J7TA 3ZU6A 1I2BA 3AI7A 3K0KA 5TQJA 3JXEA 1GQSA 4Q4HA 5AVZA 2WM3A 2HQSA 2GR9A 2QTTA 1ZHHA 4PX3A 2VTVA 5HM6A 1U8AA 1JHZA 1G21B 3BIJA 3HBJA 4I4TF 2Y1FA 1ISMA 3LVRE 4EA8A 4HC4A 3HYLA 2XDAA 3O8CA 4QO8A 1PFGA 3E1GA 4LOAA 3LUBA 3ADPA 4G09A 1AVTA 2EGHA 4CM6A 1G3IA 4JJEA 4QAJA 3JX9A 1GY8A 5E2BA 2FE4A 2NYVA 2HU7A 1QV9A 1OXVA 5IAGA 1HWYA 3W3ZB 1WZUA 1QOPB 2JJ2A 2PFSA 3GLTA 3QV1A 1Y1LA 1YQGA 3D1VA 2RHCA 3BTUA 1NONA 2XMSA 2ZJ4A 1XZNA 1KKUA 1SCAA 1JXQA 2ZULA 3LHIA 5JSHA 2X3FA 1XKXA 1CHNA 1P44A 2OCPA 3TAUA 1NZDA 3TTSA 1BO6A 5BUZA 1U7HA 2IYOA 2W6JA 4HADA 3DKKA 4IEEA 2XZOA 4NENA 1RS0A 1RQRA 2Y2VA 2WJAA 2ORED 4HRYA 1C30B 2YXNA 1PT9A 4C4YA 1NLFA 5BYKA 4IH1A 2EBHX 1HK7A 1VBNA 1O03A 3FBGA 2I6SA 4UD2A 5D3QA 4LRWA 2IHBA 1BX3A 3Q7EA 2OCBA 1F8UA 1RFGE 3M3DA 3RV4A 3UWPA 4KVZA 3SFZA 2VP0A 3IAUA 4M9UA 3B6JA 4HPXB 3R7WB 3OE7A 4UNPA 4RW0A 2IHTA 4XTRA 3BFXA 1HM5A 1W87A 1X86B 2XT6A 1I3OA 3F2IA 1NJ6A 2Q3FA 3CW9A 5ALPA 4CTNA 1VZ3A 3W6OA 3AZPA 5HJ7A 2V7QA 3EXG1 4U2CA 5AVYA 1CJBA 2EQAA 3M81A 4YGYA 1ZGZA 1NFFA 1XXHB 3RS7A 3CB4A 1LBHA 1L4MA 1EXWA 1P4HA 4ZQIA 5E6RA 2E4WA 2H2DA 1PQPA 1XQVA 4OTZA 3WL8A 2V54A 3ZDBA 1L5KA 1UIRA 1NXSA 4RHXA 3VX3A 3C7TA 3E27A 3OLQA 3HP4A 3O90A 1SY7A 4HLDA 1L5HA 1TTQB 4RGVA 4CN9A 4D41A 3O0DA 1EFUA 4ZEXA 2G1JA 3T99A 1MA0A 3LWZA 3DGFC 3NGLA 1JAYA 5DJ5A 4AWAA 2R7NA 5AM5A 4EY5A 4F56A 1GGVA 4F8YA 2J5BA 5EJ5A 3GT4A 4FXOA 2Q6IA 2VDVE 4ZQHA 3EXFB 2DHDA 1F0KA 1MB3A 5FYDA 2QYHA 3AC0A 3R6DA 4BGVA 4NG4A 3SYNA 2GYUA 3DZFA 1E1YA 3PEUA 4Y18A 1UBOS 1KDVA 3VR5D 4BYGA 4CMIB 2P6RA 4QUGA 1E4OA 1JYFA 4V2IA 4XVHA 1ONOA 4RQAA 4BX8A 4WBNF 5KSPA 1KU0A 3TQRA 2YV2A 1X9HA 1CR1A 3NB0A 4U6NA 2Q7OE 1IQUA 2H52A 3SEAA 5ALUA 1U11A 3DPIA 5EMMA 5FWXB 2CLHB 2HBZA 2JGKA 3EGDB 3QVSA 2WJJA 4N9WA 3SZUA 4ZYUA 2W48A 4NP6A 1H4SA 3DBHA 1EXVA 1UMBB 4GI2A 1U3VA 1G21E 1ODSA 3WFJA 4BYMA 3QU7A 1J9EA 3VNRA 5LXTB 3NWBA 3KXIA 1Z2CA 2KSQA 1USVA 1XI2A 1RTKA 2IYWA 1OU4A 3HPRA 4LSWA 4BEBA 4ZYWA 5FNZA 3WP0A 3PTAA 1CUFA 1E3IA 1IY0A 4AK9A 3K2BA 3MS2A 3Q0TA 1QMGA 1JHUA 3DJYA 2ETVA 1AXEA 3U4DA 3KJIA 1FP4B 3H5TA 5CG2A 3VI3B 5IYZA 2O3UA 4M36A 4G0PA 4WPGA 2IK8A 3DCYA 1GJRA 5AKLA 1GRNA 5JQWA 3S3TA 4HK4A 1BE6A 3ZHQA 4C7MA 3OT5A 4BQNA 4GLLA 5C35A 2O59A 3C97A 3OOEA 3QWAA 4PN3A 1UFOA 4PCAA 1P9RA 1V8PA 2YIVX 4JUAA 3SLGA 3T12A 3UJ7A 3WNVA 2HFJA 3L8HA 4TYYA 1DIAA 1YL7A 3QU2A 4CV2A 4DEYA 5ICMA 4PXYA 5EEHA 2WJ3A 1V9LA 2J48A 1O95C 2AN9A 4GBED 5TV2A 3JWPA 4PC3A 4CM9A 5JAUA 3I6ZA 2PJDA 1MOQA 3AV3A 3VJRA 4CR7A 1L5VA 1IMOA 3KKLA 1GSHA 4UEOA 1H0HA 2R86A 3P0RA 2XTJA 4ASUA 1A8QA 4DG5A 1P9OA 3ONNA 1N4AA 1CF4A 1NTRA 3EOAI 4WFKA 4XYGA 5CH3A 2X8BA 4F8JA 2AUTA 1DXHA 4RZXA 1TCUA 1OJ7A 2EJTA 1BMDA 1W1WA 5L3QA 1E9VA 1S6YA 1WZ2A 3LGAA 4N5NA 4P4LA 3AJ8A 3WGLA 4O3FA 4EABA 5C7LO 1XTQA 1DNPA 1XXHE 2IVFA 3LF1A 4Q7LA 1XN1A 1XK6A 3DL7A 1MJNA 4R2WA 3AHIA 1E6MA 3KWLA 3PFGA 4WA8A 2Y68A 4IW3B 2Q1SA 3WLLA 3OCXA 2CD9A 2Q2VA 2H1CA 2QN3A 1AQUA 1KR5A 3NPMA 4P4SB 5AW2A 5JEEA 3T9FA 5JSZB 2AX4A 1Z2PX 1G16A 1LBSA 4AY2A 5A04A 3JTMA 4Q1DA 1YVDA 3BB1A 1FP7A 2Q3HA 2PYIA 5CT8A 2F3UA 5DYIA 2TSYB 3HB5X 3OQIA 2PT6A 1M6HA 2ODEA 2ONCA 2W71A 4YHHB 1WIWA 4BFYA 1A9ZA 2Q4EA 4LHSA 3ZHXA 1BEZA 5HKAA 1BIFA 3T15A 2I2FA 1UDWA 2ZUFA 4F4JA 1Y82A 2WPDA 3VC3A 1J7JA 1ETHA 2R5WA 3RT7A 3AM1A 4EYSA 3F5MA 5J2UB 3FTPA 1E9BA 2ETXA 4HDRB 3R5XA 4CMHA 3ZJYA 1FUUA 5THKA 1PEDA 2N1BA 4EG3A 1H4QA 1JBKA 2BSQA 4G5XA 3LK6A 2MOKA 5I9BA 1ZH6A 3PIDA 2M6SA 3BB3A 5C34B 4RMNA 3H5OA 5AK0A 4CQJA 4EQ6A 3WLJA 4DMMA 1XV5A 4LHWA 4MAMA 5I7FA 5DRYA 3ZGZA 4X8MA 1NW7A 2IIVA 4AY6A 1A50B 1NNUA 1ZI9A 2BM9A 4CCWA 3HA7A 3A7DA 1UXHA 4YQEA 1IH8A 5IF3A 2PUGA 2TMDA 4I5FA 4BLUA 3F3MA 3GELA 3G23A 4TS4A 3KOOA 1ZG3A 1ZSNA 3PXDA 2C7PA 3SVLA 4XE5A 2HF9A 2QQ5A 4UVDA 1POWA 1O3YA 4PHHA 4WTOA 1U8XX 4UCFA 1FXSA 3A6PC 1VSTA 3FHJA 2FPSA 2B92A 3IPXA 3NJRA 3OG9A 4P80A 5IAEA 3SYKA 4CM1A 5CA1B 1UFKA 2LR0A 5CVDA 4EKEA 2IYAA 4H0NA 4BNDB 1NX9A 1HFJA 5DCYA 4J07A 3D02A 2UDPA 2FI1A 1YWGO 4X3CA 4BNLA 1C9DB 4YRNA 1YFZA 5CDTA 5A9TA 1BD4A 1ECJA 2JHAA 4MGEA 2H1FA 4QUDA 1JBQA 2VJMA 1ZOSA 3O84A 2BJVA 4JB3A 1XGKA 2CCGA 4MUNA 5ERYA 4CU2A 2NP7A 2M6LA 2XGSA 1G3QA 3BEDA 2X5NA 4XGRA 3M34A 1F4LA 1MW9X 3L7MA 3FWPA 1P8JA 4YT5A 1LK0A 5B2EA 1SNYA 3PJFA 4BZXA 1VG0B 2VKQA 2GBCA 2HNAA 3N2GA 3HKDA 3O31A 2E3JA 3TBHA 5LQMA 2BI8A 1IBKB 2XXBA 2AOTA 5JDCC 3U4AA 1TJYA 3GLIE 4FW8A 2WDZA 1QVZA 3KR0A 5LM3A 5FFMA 2Z3ZA 5ADHA 1PKXA 1RLMA 3G82C 2F43A 3A4LA 1T5IA 2VK8A 2XMDA 1JG2A 1P1JA 2WV7A 4IYRA 1XPUA 1KEWA 1X1CA 3IQIX 4MTLA 1DI0A 1WZNA 1X1BA 4ZI7F 3HKCB 4PX9A 1S7GA 3GLVA 1U8ZA 1P31A 1W5AA 1T1RA 2IW1A 3IAS1 4V0QA 3U81A 4WJLA 3DDSA 1C1XA 2AFRA 3ODPA 4Q9HA 1WDTA 3HY3A 4TT3A 3IIJA 1SOMA 5DM0A 1PYGA 4OM7A 2VHWA 2I4RA 2ZZKA 4UBOA 3GGPA 4XRGA 3OZDA 4PZYA 3DJFA 4Q1FA 4EUNA 5KTYA 5DYNA 2C1ZA 3JCZA 1IEQA 2BTQA 3F7TA 3OMWA 3OPNA 4H4CA 4Z0HO 1OLXA 2BRUA 3C8ZA 3JR3A 1N5LA 4MS3B 2GBFA 3O8OB 1B0PA 4Q15A 4ZXPA 5C3UA 3Q4GA 1IDN1 3HBAA 2QLMA 2H1WA 2ZRLA 3TQTA 2PLAA 2JIDA 1KPHA 2VUHB 4QATA 1E5DA 4REMA 4BZWA 4D79A 3ZU2A 1SU6A 2BEWA 2DX7A 1W88B 5L53A 3FUWA 2GM9A 2XUDA 4PZ0A 1TIKA 3UWDA 4ZDKA 6NULA 4J1NA 1FU7A 2PGOA 3F4KA 3R5JA 3LFUA 1Z33A 3LA6A 4RY2A 4P0TA 1NNI1 2OL4A 1NA5A 1KQNA 4R1NA 3KD2A 5EP4A 1FFXB 3H9UA 1J20A 1MB0A 4H27A 4M83A 4RPCA 2GFHA 4FOSA 3SDSA 1VGQA 3F1LA 2CDBA 4WLFA 1GHTA 1DQYA 4ZVOA 3WV5A 4DLTA 4BP3A 1KY5A 5C80A 1KO8A 2H17A 2XOKA 4PLVA 1GQFA 4TL8A 3UG7A 4WN9A 1IBMB 3QA9A 4KE6A 3ZDFA 1J5EB 2XCRB 3DBRA 1I36A 3BQ9A 1QHGA 1N7JA 2DBZA 4RD3A 5D8DA 3RVMA 3RRXA 3VAZA 1SQ6A 2W2QA 2ZJ2A 4ENUA 2WHXA 4DDHA 1Z5VA 3UAGA 3UUGA 2PUJA 3PNMA 2OLKA 2Q5LA 2H1SA 4OMCA 4DLXA 1N5OX 3SQWA 3I9KA 1UBCA 2CJWA 2GD0A 3OJLA 1FMTA 3SHOA 3E8MA 4JGBA 5HDQA 3WZMA 2VEOA 1EWYA 1XYYA 5KX5B 1A7AA 4RU1A 1EFVA 3PJDA 1BVYF 1U2TA 4YP1A 1NVVR 1VFNA 5AVOA 1RW4A 3B6ZA 5SY6A 1Z7YA 4PTZA 1EJ0A 1Z8DA 5BOVA 5MGNA 3GP3A 3R6TA 2F9FA 1WY7A 2OCAA 2ZJ8A 2VDMB 2WZQA 3UAWA 1H05A 3M1AA 2JIOA 3NHUA 5AW1A 3K9FC 1A95A 3E03A 4BNIA 5CA0B 1C80A 3BMNA 5KJCA 4WOJA 5IWAB 5EHNA 3M33A 1IN5A 3JYLA 4JJIA 1L5SA 4G41A 2OWDA 3SC2B 3B1WA 4MITA 1KS2A 3PHGA 4HYYA 1S8NA 4CLDA 2FDCA 4Z4GA 5KAMA 1TPZA 4BE7B 2QP3A 3H2BA 4OMUA 1Q15A 3JRXA 3KQMA 4JA2A 3FI0A 1T13A 2PXCA 1QNFA 3HEMA 1MCZA 2QKYA 3N2KA 2QMZA 3DBLB 3G1TA 3K30A 1V11B 3D0RA 3MTQA 3USZA 3MPUA 5CDUA 4DM7A 2CNNA 1XU4A 3HI6A 2FW0A 3F8SA 1M1YB 3QPAA 4AJEA 2C5FA 2XMZA 2RK4A 4RH0A 1A9PA 5A7FA 2MSNA 1LNQA 2WUFA 2P9HA 1QVVA 4PS0A 3GLUA 3FOBA 4R1QA 3ZHSA 1SVSA 2RAPA 1AQ6A 2J3MA 1UJBA 4INJA 5CJJA 3TB6A 3D3EA 3RYIB 1QK4A 3L5KA 5ECDA 1XQ9A 5B7PA 4HYEA 3HB9A 4ETWA 2A9PA 1KERA 1AUQA 4LJLA 5HA5A 2EJWA 2HBYA 5AHOA 3MMZA 3V97A 1VMDA 2VP9A 4E4TA 2G82A 2J9ZB 1KA9H 4UM9D 1OI4A 2CYCA 3DPSA 4JU9A 4CIVA 1I14A 2NZ8A 3N0XA 4WJZA 4CM7A 3QJGA 1RYNA 3S8MA 4NCIA 4RTQA 4LNUA 4JBYA 1XRQA 4ZJPA 1KAMA 4I19A 4BNKA 1V2HE 1RXEA 1YJCA 4R2JA 5FPHA 1B3BA 3ROXA 1MW8X 4DQXA 2XAAA 4GKJB 1SBQA 2ZT7A 4AMGA 4YMVA 4PZPA 3M2TA 1G55A 3DWGA 4AX4A 5CIYA 3I2KA 1CZKA 3Q0IA 5FXMA 2GESA 4K9KA 2G9NA 2OEPA 1SBZA 1Y4UA 1JEDA 2V7PA 3P71T 2CJYA 3VKWA 3FVRA 4K8OA 1DTWB 1QGZA 2CMHA 1JYSA 1P4SA 1QPGA 1DJOA 2Y27A 1H85A 2WYUA 1R9MA 2PANA 1KRHA 4N7BA 3SOZA 3U3KA 4JVNA 5EHQA 5K2OA 1Z36A 1J23A 4KG7A 1ABEA 3VPCA 2WNSA 4R98A 5E1OA 1CUUA 4G86A 4WH0A 5IMSA 5EYPA 2XCSB 4C4TA 1W0JA 2C2OA 1UEIA 2ENWA 1NC3A 2C96A 1YF3A 2WFMA 1E2IA 2Y1WA 5CT9A 2EQBA 1P3JA 1BXRB 3KJGA 4R1LA 4TV9F 4E21A 5IK2D 2R00A 5JV5A 3UK6A 1Z5WA 2ISQA 3AHEA 3GHHA 3LRTA 2PM8A 3F49S 3ELBA 2FFJA 3EEFA 3WDMA 1OH6A 3NEPX 3MG9A 2IGTA 2VF4X 2Y1KA 4IMRA 3U1VA 1I0IA 2PTGA 2D06A 1IUNA 2GEDA 5FPYA 3FRJA 1QTIA 5BWNA 4EECA 3CZRA 1LTKA 1SIUA 3O4GA 1T3ZA 2B1GA 4Z8YA 2XWQA 4Y1GA 4CTOA 2FMTA 1RCTE 4RYLA 1C81A 1GKIA 2G80A 3LKZA 4WXMA 3ZY2A 3B70A 4P3PA 2VZLA 2X22A 3VNSA 2GNPA 4E1BA 1HLGA 4XM2A 1UXOA 3X1WA 2O8DB 1E32A 4XM1A 2QT0A 5AVQA 4HZUA 2Z2YA 1SA0A 3M6IA 4GQIA 1LW7A 1Z07A 2PWZA 2RC6A 3EYWA 2C8VA 3UMBA 3ADCA 2Q5HA 1ZIYA 1R6DA 1CXZA 3O74A 2Y66A 3D7LA 4Z86A 3EVNA 5CT5A 3U80A 3IAEA 4MYHA 3KZOA 3Q3GE 4POAA 4D0LB 2UYQA 1MOZA 5K4AA 5G4KA 2VG8A 5ALHA 3DHYA 4LC9A 3ZWQA 1Q20A 4A2WA 3V2GA 1UFVA 1A7KA 1F5NA 1M1YE 1NJFA 2FHSA 4Q03A 1F0NA 2KB0A 5HNKA 4H77A 2QYTA 4D5EA 1SULA 2OMKA 2B8NA 2HK7A 4J0QA 2BDTA 5IJ0B 3IP1A 1T9GS 1D2HA 3LSYA 3PDWA 5HF5A 3DWIA 2X1HA 3RUAA 4CTKA 3C85A 5F1YA 1ND5A 2W43A 1T3LA 1U28C 1CLEA 2GWRA 5IJZA 3MD0A 1PJLA 2XRZA 3WYNA 5AR1A 3F8TA 3NEYA 1JALA 3MVEA 1NUTA 3ZKWB 4OH1A 2Z8YA 1RHJA 1JXAA 1DB3A 2GKOA 3UICA 2PRYA 1E0SA 4YO7A 3K96A 5LNK1 4GWKA 1V7ZA 1GTZA 2YCLA 4R8VA 1I4EB 3PC8C 3EFBA 3ZH2A 1RRFA 1FMJA 1PEKE 1PBTA 2YFHA 2PXAA 3OOWA 1VP3A 2C2MA 3O95A 1T8YA 3G0DA 2FAXA 4Y9SA 4P35A 3AR7A 1V5WA 2QPOA 2WSYB 3ZE0B 3RQSA 2PWBA 1C8KA 2J4FA 1GKKA 4EIWA 4I2NA 4X8HA 3RU9A 2OZVA 3SVTA 1SUBA 3TNJA 1WW8A 3BDVA 2KI5A 3QF7A 5KDLA 4Z4EA 1LS1A 3CH4B 2G28A 4YASA 3EVFA 4ZVLA 1R8SA 3A27A 3TLJA 4O5OA 3ZGNA 3O8NA 1NE7A 3NONA 4GIBA 4YP9A 3QPUA 4LS3A 4Z53A 3OQPA 3MMXA 3NW9A 2H4HA 4N5LA 3W77A 2Z3WA 5L4NA 1TQHA 4RY9A 1Q5PA 1FFEA 1IOWA 1PGOA 2FWNA 1MC4A 3CPEA 3DL0A 5EXEA 3WIUA 4EF6A 2DLCX 3A4MA 3T7DA 3N39C 1P3Y1 1ZNZA 2ZUBA 4FDMA 3B20A 3L41A 5AIBA 2OLEA 1GUDA 2ZYHA 4ZGWA 1IJEA 3GBPA 3PLNA 4CV1A 1L8OA 1BFDA 3TUZC 3KO8A 1UMKA 2PRSA 4GLJA 4ETMA 1HYEA 1TMYA 4BWFB 1W8DA 3IHLA 1HKUA 1PFKA 1R4ZA 2NVOA 3LF2A 3VTKA 3KLNA 2NQ8A 3ASZA 3GLHA 4Z0NA 3TZLA 1DJMA 4JP1A 2VTDA 4BECA 3NG1A 1C7IA 3AVQA 2GCNA 4IUCS 4XJXA 2XGMA 3H19A 3AG6A 2FK8A 4BO4A 2GQ0A 3P5BA 4EDHA 4ER3A 3I2FA 1NUHA 4ZAXA 1BJKA 4QGBA 4RA9A 4X1KA 8ATCA 1B0UA 1XHFA 4LDQA 2HJGA 2XQKA 2PZKA 5IARA 1JNXX 3R2JA 1RZRD 1U1GA 1VDZA 3FNHA 3QP9A 4D3XA 3PICA 1GTMA 2HXGA 1EP2B 1QVAA 4GVPA 4B6GA 3RK4A 4D6XA 1P74A 3I5YA 3PX7A 1QOQB 1I5EA 4IIXA 2X77A 4IOMA 5MN4A 4Q7JB 3SKYA 3UAZA 4W8GA 5KJ1A 1KH2A 1XG5A 3H5NA 4O4JF 1OX4B 2HLPA 3FYHA 1TF2A 5JZ9A 2PKYX 3RD5A 3NAGA 3BK7A 1D2RA 4EGSA 1RI5A 3HP7A 5SZJA 1DQPA 1NYTA 3KVVA 2YXBA 3L8CA 4WK6A 3W2IA 4F7WA 1QYXA 4ZT7A 2IH5A 2B2NA 1AS2A 1K1EA 2PBZA 2ZDHA 5LYJF 1IRIA 4KITB 1EA5A 4FINA 3C5HA 4O2LA 2B8EA 1T2AA 1OXSC 1KEPA 2P5TB 4EHAA 3T5BA 2GJKA 4CIYA 1XZHA 2EFJA 4Q9NA 1JA9A 4J3FA 3OLWA 3KJZA 5G0VA 2CNWA 2IHJA 3MBIA 1RZ3A 1QVRA 1ADBA 2XBMA 4GO1A 1TCVA 3CYFA 2P8JA 4MXDA 5KU1A 1UBSB 2QD5A 2VSQA 3A6LA 4I46A