2WJ6A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n- acetylanthranilate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj6A01
2OCGA 1QTRA 2PM8A 3LIIA 6YASA 5ALNA 3AILA 3VDXA 3QPAA 3QMVA 5CRIA 4IH9A 2YASA 2PPLA 1R1DA 1ODSA 3LP5A 4QE3A 4X3CA 1CUCA 2BCEA 4B0PA 4UHBA 4AB1A 3R40A 2ACEA 4BP9A 1HKHA 1TK3A 3I6YA 3WK6A 2AJDA 4FBMA 3G0GA 4H7KA 2OAEA 4ZV9A 3DOIA 4DGQA 4MXDA 2QKYA 5HF8A 1EDBA 1DWPA 2VT6A 1GKLA 4BYMA 1LPAB 5D6OA 2XUHA 1ODTC 5ALQA 4C87A 4HS9A 2BUBA 3I28A 3C6XA 2JBWA 3ICVA 1EDEA 3H2JA 1MX5A 5IH7A 1K6EA 3EQ9A 3V1KA 2H9YA 1U8EA 5ALZA 5CT8A 5EHXA 3FSGA 3JW8A 4FDMA 4S0XA 2WUDA 4NS4A 4GI1A 4HXEB 2EDAA 2HU8A 1P0MA 4CI9A 4OCZA 2RHTA 2Z3WA 4NMWA 3I2FA 1WCYA 2J4CA 4B84A 4X92A 4OB8A 5DWDA 1EB8A 4OUKX 1IVYA 5HK8A 4QDXA 4QLAA 3DJYA 3WK5A 3ZI7A 2VA9A 5AKIA 1R9MA 4F5ZA 5JALA 3WIOA 2IITA 3S8YA 3IA2A 3RKSA 2XLCA 2DCMA 2OXEA 1QO9A 4L3WA 1EA5A 5A71A 1CQWA 5EIEA 4BVLA 2VEOA 2YYSA 3C5WP 1NU6A 2XUOA 5AKGA 2G5TA 2PBLA 2PSJA 5LKRA 1JJIA 4C89A 1YAJA 4XWGA 3HSSA 2AJLI 3BJRA 1CV2A 4OYLA 1QOZA 4PSCA 2QR5A 3BF8A 1CFJA 2R8BA 4QZVA 4Q3KA 1NU8A 4H35A 5IVKA 2Y2UA 5JD5A 2FUKA 2HA6A 1QZ3A 3C6ZA 4C88A 5FKJA 2V96A 1ZGCA 5CBKA 2IX9A 5K3FB 1CUUA 4BATA 3GELA 1MPXA 4UHFA 2EEPA 2HA7A 4PSDA 4FMPA 2XT0A 1Y37A 1CUVA 1XKTA 2QM0A 3C8HA 2QS9A 4G8CA 2AXEA 2WG2A 1VA5A 1ZIXA 4JNCA 1CIJA 5A2GA 1ZICA 2B61A 4H7HA 2PSEA 5K3DA 3WJ1A 3HI4A 5ALOA 4LXHA 2BKLA 5AK6A 3O0DA 4IO0A 3WWEA 4I4CA 3G8YA 1KU0A 2D0DA 2ZYSA 4CCWA 3ICWA 1UWCA 2C0QA 1UKBA 5EHNA 3K2IA 5SYMA 3B5EA 5K3CA 1QE3A 2OQVA 3H2KA 5YASA 1SCKA 3QM1A 5KWJA 1G42A 1J2EA 3WK8A 4GEGA 5DJ5A 3IULA 4UBOA 1DTEA 1HLGA 2AJCA 5DTIA 1EX9A 3FAKA 4YK7A 4F0JA 1BEZA 4WY5A 2X76A 3FVRA 3H19A 2C7BA 3QBJA 1XRMA 3G9ZA 5CMLA 1E89A 1RP1A 4A16A 2WFLA 5EHQA 3A70A 3C43A 1QIHA 1XZCA 1IMJA 1B41A 1LLFA 2JEYA 4M0EA 1T4MA 4OYYA 4DSZA 1QIFA 4IH1A 4RPCA 3CN7A 1EB9A 4Y2RA 3FVTA 1QTIA 2XMDA 2WM2A 2E3JA 1XLUA 2HA4A 3PFBA 1EH5A 2CEKA 4EHBA 1DX4A 3ZWQA 1DQZA 3GZJA 1D07A 4E14A 2BGNA 4XX1A 4CIBA 1SFRA 3F9CA 1R50A 4BDTA 1DX6A 1LPNA 3HEAA 1AURA 2AJBA 2YXPX 4QDTA 4DYHA 2Z5GA 4I19A 1LNSA 4H7EA 3R0VA 2XMGA 1RWQA 2HA0A 1CUSA 4DNFA 1A8SA 1JJBA 3MUOA 5CW2A 3WL5A 3DS8A 1THTA 2LIPA 1X2EA 2V98A 1XQXA 1ETHA 4IQ4A 2FJ0A 5CT4A 4X6UA 1QFSA 3OURA 4C4YA 3C45A 4EZIA 1XFDA 4UBMA 4BC0A 3W9BA 4J0JA 5E4YA 3ESDA 1Q84A 1OXMA 1N5MA 4P93A 1GPNA 4FLMA 1ORVA 1MX1A 5JIBA 3WKCA 1IZ8A 4BAGA 4LIPD 4Y2PA 1UKAA 5CT9A 5BWBA 1G5FA 3G7NA 4RE5A 4JYPA 3KSRA 4H0CA 5D3ZA 4BCBA 5JARA 5LZ5A 4ZI5A 4G8BA 1UOQA 3G0IA 1C7IA 1CQZA 2O7RA 1AQLA 3RK4A 3W06A 1DT3A 4PO3X 2RAUA 2VQ6A 2WHPB 1LBTA 2VJBA 5HF6A 4OU5A 3VJLA 1XZMA 4DMKA 1N1MA 1ZJ5A 3D2BA 5AI8A 3CN9A 1CUGA 4PW0A 2XUFA 1CUHA 3BIWA 1DINA 4C6HA 1XZAA 3STWA 2XMQA 5LZ9A 1R88A 1YR2A 1WB5A 4HRXA 4B85A 1UK9A 4UFPA 1XZEA 4N5IX 5D3KA 2JGKA 5ALXA 4X93A 3E3AA 2XUIA 2AJ8A 5FRDA 2HU7A 1GGVA 4JUIA 3WMRA 2JGLA 3AFIA 1QJ4A 4QWMA 1XZFA 2VTVA 5CXXA 1E8DA 1IUPA 4J0IA 1TAHA 5JADA 1GPLA 1OILA 1PJAA 5CTAA 4AO7A 3DEAA 1E8MA 4BRZA 5A6VA 1EI9A 2DHDA 3OG9A 4H7JA 4KYVA 3EF3A 3NWOA 5AHXA 3V1LA 1JMKC 2I03A 3ANTA 4K2AA 2OGZA 3E1GA 4B6GA 2WTNA 4HXFB 1BROA 1AC5A 1UKCA 4EY4A 2WIJA 5AKYA 1CUIA 1P0IA 3H04A 4YX9A 4BVJA 1BRTA 1Y7IA 5T4BA 5T4HA 3ESCA 4ZXFA 3ESBA 4F21A 4ZWNA 5HKBA 2ACKA 2GBFA 4X94A 3WL7A 2ZSIA 3E0XA 1EVQA 4C01A 3IB3A 4GDMA 2ZYHA 3QPCA 5CH3A 5ALWA 2XDWA 2HFJA 2OCIA 2OCKA 3WJ2A 3LS2A 1CUWA 5D7BA 4J0GA 5HFNA 1FJ2A 2HU5A 4BTLA 4PF1A 1UK6A 1JU4A 2G4LA 4X00A 2ZSHA 3AZOA 1L7QA 2XUGA 3FYUA 1MX9A 2CB9A 3WKDA 2GBCA 5ALGA 2PVSA 4AQDA 4P9NA 5DYTA 3FLBA 4U2EA 3M82A 5LZ8A 2GYVA 5ALHA 4B9AA 1KU6A 1IUNA 5AKXA 4JEIA 2HDWA 2QXUA 1WHTA 2BUAA 3UMJA 4N8SA 1LPBB 2JIDA 2O2IA 5DLPA 1YS1X 3N2ZB 1ZD2P 3JWEA 2B20A 2QXTA 5JD4A 2J3QA 4KE9A 4EBBA 1XQWA 1PFQA 1VOTA 2DFPA 5HF9A 4C4XA 5DNVA 3AIMA 3WA7A 2X8BA 5AKKA 1UK8A 4UHCA 2XMRA 4X95A 2WKWA 3O9VA 3AUKA 2C4HA 1QGED 3BIXA 2H7CA 1Q0RA 2VAXA 5BWCA 4G4JA 5LZ7A 3R41A 4V2IA 2ZJFA 1U65A 2V97A 1USWA 1FFEA 3HJUA 2WUEA 1WOMA 4ARAA 1LZKA 4KRXA 1JT2A 4J3JA 3DQZA 4DTCA 4FWBA 4WJLA 2R11A 1GXSA 4W1RA 5AM4A 4FLEA 4DM7A 4BZWA 5AM3A 3VVLA 2WJ4A 4FHZA 2Z3ZA 3K6KA 1GZ7A 4G9GA 4H77A 2GZRA 3G9UA 1WB4A 1W4LA 1ZJ4A 3WIBA 2VJCA 4Y2QA 3MGAA 4OD0A 3B3QA 5ALUA 4LXIA 3H2GA 4FFVA 3UUFA 1GT6A 2I3ZA 2Z8XA 2GYWA 3W05A 4EY6A 4UBLA 2J4FA 3HC7A 2OG1A 2Y6UA 1VA4A 3IUQA 3C8DA 4BAZA 3NOXA 1EINA 1ZOIA 5LZ2A 4KACA 2ZVDA 5CURA 2VJAA 4DMFA 5JAOA 2DR0A 2O2GA 4G1FA 4Q05A 5HQ3B 1MO2A 3WA6A 4GWLA 5JASA 4MWSA 2WSLA 3I2HA 3BXPA 5AKZA 2ZJ6A 1EDDA 2OCLA 1XZIA 2CJPA 1BN6A 4BE4A 5C8VA 4B82A 1HDEA 1UK7A 3DD5A 5AI6A 5AM0A 1SC9A 4P08A 1GQRA 1E5TA 3R3VA 1A8UA 2BJHA 4OB6A 2RONA 4DNOA 1DT5A 4L0CA 3LIPA 3DL4A 2FJPA 1TIBA 5AJHA 4KRYA 3HRHA 4W1PA 5FDFA 5FUMA 1XZKA 4FTWA 3H2IA 1ZD3A 1MU0A 5AOAA 5FLKA 2H7XA 4Y2UA 2CMFA 1CUAA 1E8NA 3KD2A 2WU3A 4X71A 2OGSA 3U0VA 1QIKA 2WG1A 4L72A 5EI5A 2ONCA 1LBSA 3DLTA 3B12A 3L1HA 1L7RA 3R3WA 4E46A 2WG0A 1ORWA 4MYDA 5CT5A 4D9JA 4MQMA 3VISA 4UFNA 3V9AA 4WY8A 4WFJA 2PSHA 3R3UA 4LYEA 3WZMA 1YA4A 5FXMA 5C8ZA 4FNMA 3GBSA 4B83A 2W6CX 4B0OA 2CUTA 3RARA 2JGFA 4PSUA 4TPKA 2RIPA 1GPKA 4Y2VA 3WYNA 3R3ZA 4Y2YA 2XE4A 1EHYA 4BDSA 2WHPA 2HA5A 1CUJA 4PNZA 2O2HA 4B9EA 2DQZA 2XUPA 4K5QA 1ZD4A 1W52X 4DMHA 2XUJA 3STXA 4OSEA 5AK5A 4XVCA 4M0MA 1CUFA 5AICA 1RYYA 5E4TA 4EB0A 3FCYA 3I1IA 2XMSA 5DNUA 4KEAA 3FOBA 3FLAA 1CUZA 5ALKA 3DL7A 3STTA 3C70A 2DHCA 2ECFA 3R3XA 5ISMA 4ARBA 3IBTA 1AKNA 2JF0A 3EQ8A 4H18A 5IVIA 1VZ2A 4QWWA 4X97A 1XQYA 5EFZA 1UOPA 4FOLA 4LHEA 2DSNA 3W04A 4B80A 1EK1A 3WQHA 3IIIA 5I8PA 1G66A 1YS2X 5EIHA 3ZLUA 4ZREA 2VAVA 3F96A 3ESAA 1JFRA 1F8UA 4A23A 3FYUC 1IUOA 3WKEA 1TCCA 2HRQA 2WILA 2WJ3A 3PDCA 3CXUA 4ITVA 3O4GA 1KEZA 3OM8A 4I3FA 1DWQA 5ESRA 3I2IA 5J3JA 5T4EA 2XUQA 5FP0A 5CXUA 1G4HA 2I78A 2QZPA 4UBIA 1THGA 5FV4A 1CEXA 1BCSA 4HRYA 1BU8A 2I3DA 3H18A 1MT3A 5C7YA 2FX5A 3WI7A 1TCBA 1R9NA 4FBLA 5ALYA 4UBNA 3D5EA 3OOSA 4IHAA 4AMYA 2CZQA 5BOVA 3STVA 1YASA 2C58A 3WYDA 2QJWA 4QEKA 2HM7A 1VLQA 1EXWA 2WIGA 5EHZA 3VJMA 3EQ7A 1MTZA 4PV7A 5HFAA 3PICA 4P92A 3L1IA 1ACJA 3FSGD 3KXPA 5AOBA 4MJ3A 5IVDA 1W75A 2VF2A 2J3DA 4QDZA 4QLOA 3HACA 3V48A 4KJXA 4G5XA 5ALVA 3WZLA 3A2NA 1AGYA 2CKMA 3ZLTA 1UZAA 3DKRA 3FNBA 1P0PA 1LPPA 4AZ0A 3C87A 2XQIA 3DCNA 1XRRA 4KE6A 4QDOA 5CT6A 1QFMA 4HAIA 5AKLA 4RGYA 3BDIA 3AIKA 1X2BA 5HCUA 3WL6A 1Q0ZA 3WK9A 5ALEA 2XUAA 1XRQA 1N8SA 4QA9A 4BTVA 2WIDA 3ILSA 5JD6A 2JGEA 2XQGA 3PI6A 5JAPA 1F0NA 3LLCA 4MYSA 3FWHA 3BE8A 4F60A 1BS9A 1CRLA 4X7BA 1CLEA 1H2YA 5FOQA 1K8QA 3IUMA 1BCRA 1HPLA 5LIPA 3BF7A 5AM1A 2ROQA 1XRNA 4CFSA 4AXBA 4KE7A 4DLNA 1FFAA 1J1IA 3KDAA 3T4UA 1YB6A 3E4DA 4E11A 2HL6A 3GA7A 4EY8A 1VE6A 1W76A 4K6GA 1ZD5A 2IIVA 4Y7DA 1QIJA 5KBYA 2ZYIA 1QIMA 2B4KA 1SCQA 4FFWA 1HL7A 2RGUA 1BEEA 4C4ZA 5HZGA 1QONA 1PV1A 4GXNA 3BL8A 4YPVA 1X70A 3PF8A 3AZQA 5F4ZA 2OPHA 3C5VA 3EIOA 1R3DA 3IUJA 2K2QB 1ZI9A 3MUNA 5ALIA 4H7FA 4GECA 4BC1A 3O4JA 3YASA 4EY5A 5LKAA 3H2HA 4TVKA 1S8OA 5C8XA 5FPQA 1TCAA 1XZDA 1VKHA 4XIIA 1E66A 1C4XA 2DQYA 1WHSA 4LYDA 1ZI8A 2PUJA 5AP9A 1GQSA 3EBLA 5CH5A 2HHAA 3FBWA 3QYJA 3G9XA 3R3YA 1CUYA 2PKYX 1GKKA 1W6RA 1MNAA 4BBZA 4KE8A 1CVLA 3N0TA 4W1SA 5AI5A 4BCDA 2XLBA 4WDQA 4N8DA 2H1IA 1QIGA 5AKHA 3O9MA 4XJVA 2WUGA 1SCIA 4Q34A 1VXRA 3ED1A 2X5XA 5K3FA 4ETWA 4ZRDA 4CG2A 4OPMA 5SYNA 5JZSA 5HKAA 2O7VA 4MEAA 4X91A 2VT7A 2WHQA 1K63A 4X85A 1YAHA 4OU4A 4TGLA 2PU5A 5JYCA 3WWPA 4HZGA 2Z8ZA 1FFCA 5AIAA 4N8EA 2WJ6A 4K6KA 2OLEA 3D59A 3SC2A 5ALTA 5CH8A 3WWOA 5AOCA 1JJFA 1OCEA 3WKBA 3M81A 3OPMA 4H7DA 4AN1A 4UHDA 2JGMA 3A2MA 3UUEA 4G4IA 1H22A 1TQHA 3STUA 3KWFA 3TJMA 3VJKA 1UOOA 2ZYRA 4GHWA 4DMCA 3V1MA 1P0QA 3H0CA 3KOOA 5ALRA 4B7ZA 2WQZA 4BVKA 3ZPXA 4U2DA 1XRLA 5E4JA 2HIHA 2VATA 1LPSA 4X90A 1H2XA 3AIOA 4NZZA 5AK4A 3K9BA 4DNQA 5LYYA 1JI3A 1C7JA 1EVEA 2QT9A 2PU7A 3ZLVA 2C0PA 2PUHA 3A6ZA 5HK9A 5AI9A 1ZIYA 3G0BA 1F0PA 4ROTA 5HF5A 4UUQA 3O95A 3C6YA 3D4LA 2WFZA 4BB0A 3QH4A 5DYWA 2JEZA 4CCYB 3IVMA 1CR6A 5K3BA 1HQDA 1F6WA 1E3QA 1XZGA 7YASA 5IVHA 3PE6A 1W1IA 2XB6A 2OGTA 1CPYA 5AI0A 1Y7HA 3FYUB 3X3HA 2EDCA 5LZ4A 2ZJ7A 1CUDA 1QLWA 2GZSA 2H7YA 4YASA 4UPDA 3ANSA 3G9TA 4U2CA 1QIDA 4QDUA 2Y2VA 3I2JA 1BE0A 4W9RA 4W63A 3T52A 3IDAA 1MAHA 4U2BA 1O6GA 4Y2SA 4INZA 4U2GA 2BUCA 1ACLA 1R4ZA 2G5PA 3Q0TA 4N5HX 1J06A 3M3DA 3LCRA 3AINA 5AM5A 4UHEA 3VKFA 1XLWA 1A8QA 4UFOA 5H3HA 1XRPA 2BGRA 1O6FA 2PSFA 3D7RA 1XZJA 4MQLA 5C81A 2WFMA 3BDVA 3DOHA 4GLBA 2V9ZA 2XUKA 3D0KA 4K6HA 5T4FA 2HADA 1XZLA 4PQEA 3G0CA 1U4NA 1H2ZA 3ZV7A 1AMNA 1VJ5A 2RHWA 2QUBA 5JAHA 2GYUA 3H1AA 1SOMA 5AKEA 5ALMA 5DNWA 2BAGA 4H7IA 4FLFA 3HXKA 3G0DA 1I6WA 5LP1A 1WB6A 4GBGA 2QMQA 4DNPA 4HVTA 2XI4A 3F98A 4W1QA 5DYYA 2WU4A 5K3EA 4WDRA 1A7UA 1ISPA 2QRUA 5ALDA 3PUIA 3TGLA 3GFFA 2Q0XA 1FFBA 4Q82A 2QVBA 2C5FA 2RI6A 3VVMA 1YA8A 4HTAA 3M83A 2G63A 1TKRA 5A7FA 5ALJA 5AO9A 1VXOA 2JGJA 4DSAA 1XKLA 1XQVA 3WK4A 4CG1A 2WUFA 1LPOA 3QPDA 2XMZA 2WLSA 4WCVA 4J0CA 1B6GA 4J03A 3L1JA 4CIAA 1XZHA 4HXGA 1LGYA 2JGIA 4Y2XA 4LKOA 2QTBA 2YH2A 4E15A 3WL8A 5AI4A 3WKAA 4BZZA 3D2AA 4BRSA 1YB7A 1ODCA 4Y2TA 3CCCA 3I6ZA 1QO7A 1H23A 1K4YA 3OTQA 4Q1VA 3BWXA 3QMMA 4X6XA 2OQIA 3AJAA 2HA2A 4BP8A 2WTMA 1EK2A 3D2CA 3PFCA 1UFOA 3I6MA 4KR0A 5ALLA 4J7AA 4AMZA 1XLVA 1BN7A 3STYA 4IH4A 4MEBA 4AN0A 3RLIA 5AK3A 4J0KA 1JMYA 1DWOA 4M0FA 3AZPA 3DDUA 2OAGA 3H1BA 4EUSA 1T2NA 5EGNA 4UHHA 1CUBA 1AUOA 3SX4A 1FSSA 1WPRA 4FKBA 5DTJA 1MNQA 4KAJA 3PF9A 1TRHA 1QIIA 2D5LA 3S2ZA 1K5PA 3WWCA 4EY7A 4G9EA 4J0HA 3TEJA 1WM1A 3SK0A 1AX9A 3HLKA 3NUZA 1JKMA 4KAAA 3HZOA 1DQYA 4WFKA 4U2FA 4AO8A 2XQKA 1U2EA 5IKXA 3QVMA 2XUDA 4X6YA 1CUEA 2WIKA 4Y9SA 4EA6A 2CBGA 5AIBA 5KREA 3F67A 3HABA 4BCCA 3VXKA 3DYIA 1MJ5A 3IUNA 3O4HA 3MVEA 2GBGA 1DU4A 4AX4A 5FPPA 1UT6A 5A62A 3FYTA 3WLAA 3FCXA 4FNGA 1M33A 4Z49A 3CCBA 4MWTA 2WFLB 1HBJA 1N5RA 5E2IA 1FFDA 4A5SA 1JU3A 2VSQA 2HFKA 3Q8WA 5BV7A 4NVRA 3GROA 4CG3A 3V1NA 3H17A 3DYVA 5A7GA 4RNCA 3I2KA 3D3NA 4GW3A 1LZLA 2DHEA 3GUUA 4OB7A 2XMBA 3FLEA 3IURA 1YCDA 4G4GA 4Y2JA 1AZWA 2PSDA 3C6BA 5A7HA 3QMWA 2ES4A 4Q3OA 1Z68A 3OC0A 3JYHA 5LLSA 1IZ7A 4WFIA 3F8SA 4JYMA 2HA3A 3NGMA 5I9IA 1VE7A 4RE6A 5JAUA 2PL5A 3I1YA 5JZ9A 5AM2A 4J0DA 5ALSA 2W22A 4O08A 2XQFA 4LXGA 5ALFA 2HRRA 1YSCA 2Y1KA 5AH0A 5K5EA 3WWDA 1ZI6A 1ZGBA 2ORYA 1WPXA 3HYSA 2XQJA 5ALPA 3G02A 2BFNA 4KAFA 2GBIA 5HQ3A 1XROA 3I2GA 3BJMA 3QITA 2VJDA 4JH0A 3PUHA 1Q83A 5EIAA 4AO6A 2PX6A 4QNNA 4Q3LA 4CCYA 1UXOA 3U1TA 2UZ0A 2Y6VA 1MAAA 3TRDA 3W9UA 1A88A 1LPMA 2WHRA 4ZV7A 3P2MA 4ZGBA 1QIEA 4DIUA 3RM3A 2QUAA 3F97A 5JANA 3KWJA 1MN6A 4AZ3A 1VZ3A 4UBJA 3WK7A 5JZBA 2P8SA 3SWWA 1L7AA 4BE9A 3A2LA 2C5GA 4L9AA 4G8DA 2NW6A 2XMCA 3DNMA 3QZUA 4BAUA 5JATA 3DKKA 5AKJA 2QOEA 1J07A 1XZBA 2QJRA 2WIFA 2B9VA 1CUXA 1H2WA 1NX9A 5KWIA 4UBKA 5K3AA 4B81A 5I7UA 3O4IA 3W2TA
chains in the Genus database with same CATH superfamily
1ZRHA 4DCNA 4WBSA 4E1BA 3CSUA 4A1FA 2PYDA 1E6UA 1WXXA 4JGIA 1OFUA 1BXRA 3PD1A 1JHAA 3SHOA 6YASA 3OQIB 3GA0A 2FEOA 4Q4JB 3TLJA 3QPAA 1Z06A 2GM3A 3DC7A 3W6ZA 1T1IA 1PG2A 1ZMBA 3UMBA 1ZNXA 1ZCZA 2HREA 4ZAXA 5K3SA 5FPKA 4LXYA 5ICGA 1FUIA 1FLAA 3L92A 3PNYA 2DETA 2WC1A 5CRIA 3ZDYB 4IH9A 4LJ9A 1ZJJA 3DLIA 4DC9A 2W2OA 2A9OA 1CTQA 5L3SB 4O2BA 1U0FA 1OBCA 4E3WA 2BR4A 1ODSA 4MRMA 4TROA 3ETEA 1C50A 4DEYA 3LP5A 1ADJA 4BKQA 3C98A 1P7WA 5E6SA 4X3CA 3DOCA 2NV0A 2H4JA 1Z0AA 3EWNA 5B1IA 1ST2A 2BCEA 2PUAA 4UHBA 1JH8A 2ONKA 4I8DA 3R40A 2YZMA 2BEKA 1U9ZA 2A4KA 3AFNA 4MUXA 2YFKA 3WGYA 4Q47A 3IUSA 3NNNA 4EHAA 3NWPA 2R85A 4I08A 2E21A 3COWA 3I6YA 3SVTA 3E8XA 1HF3A 1BG6A 4V1CB 3BIJA 2WPDD 1NJ5A 4Q7QA 5K6AC 1M2FA 2GF2A 1NJ8A 4FFPA 1WSAA 2FWPA 2GNOA 2X8LA 4LJLA 4H7KA 1N2CA 1QYDA 3ABIA 3WSTA 1TA9A 3F5DA 4TN1A 4YMTA 4FGKA 3EOZA 1JA1A 2OKGA 4MXDA 3AIIA 4ZVRA 4V0LA 2CFSA 1JJ7A 1K9SA 1ZN2A 5EN4A 4MUYA 3RABA 3OEEA 4I5IA 1UJ2A 4B3DA 3O3NB 4YRAA 1XALA 1F60A 1LNQA 1WXGA 1YOBA 3V3KA 4PR0A 3IP1A 2FWBA 4AZTA 2IUEA 5TX7A 1ULAA 3C48A 2XT6A 3TS1A 3UHOA 2XD9A 1I0LA 4CM1A 1ECLA 3AETB 2JZCA 3A1NA 3HPQA 3LUAA 1GSHA 2DM6A 3RC9A 3PEFA 1J24A 4CF7A 2XUHA 1P3JA 4MSUA 2F4VB 2BRUA 1BO6A 3R3JA 4OFWA 3TTTA 3WAKA 4HS9A 2BUBA 1BDMA 2BI8A 3AWDA 3M5CA 4D4MA 3KSUA 1GKUB 3C6XA 1T9ZA 5FQNA 3KEGA 3K6SA 3ZBQA 4A8JA 3TE7A 3FTNA 1BHQ1 4U00A 1Q95A 3FYSA 1E3WA 1IG3A 2L2QA 3AM5A 5JQWA 1MX5A 1ZK4A 4NOKA 1K6EA 3A28A 2PZ8A 1H3EA 4DM4A 1DWUA 2CLLB 5JNLA 3TRJA 3V1KA 4C2AA 4P4SA 1KEPA 4KGZA 3PC4A 4D92A 3DKPA 3PNOA 1DXOA 1BKYA 4IQ8A 3FCSB 2DCUA 1M66A 1RWWA 3LBNA 4KLCA 2CL7X 4U7TB 4BYGA 5CT8A 2KB0A 3GC6A 5DEOA 4ERXA 1E32A 4FDMA 4HPXB 3U3XA 2PVPA 1LCIA 3RSCA 4PSAA 1KSJA 2R47A 1L7VC 3ONEA 4LYJA 2ID7A 5E2BA 4LPSA 1ZKDA 3AKDA 3UMCA 3B1VA 4HXEB 4XLZA 2FQYA 2MU1A 3GF4A 4RA6B 2GCGA 3LLMA 3AR9A 4KNVA 1P0MA 2PA0A 2Q2WA 3CLRD 1JHVA 3GUYA 2RHTA 2Z3WA 3DJFA 3EFOB 3FUXA 3I2FA 4NMWA 2FF7A 3EIWA 3OIFA 1SXJB 1OFVA 4MB0A 4RELA 5DWDA 2P2CA 2DBZA 5JSFA 1ZZEA 1MZVA 2R8RA 2AKAB 5DVZA 3KSDO 3ZCPA 4BLUA 2WA1A 1FNNA 3DJYA 4NCAA 2GRAA 3WK5A 2JFYA 3G2IA 3QHPA 3O74A 5KI6A 1XIVA 3TXXA 3TX2A 1Y5RA 1KORA 1N0WA 3ZXSA 1R9MA 4DSNA 2R4QA 1ZITA 2VHWA 3NIBA 4FP9A 3KB8A 2IITA 1J0EA 2QJFA 3A1CA 4MS4A 3WIOA 5BSVA 1QJCA 4G0XA 1JEYB 2OXEA 4TZTA 2VP4A 1QO9A 4DOMA 2CKDA 2QBYB 5K6RA 1J99A 4HFRA 3SU8A 2IKSA 1BMQA 5FUYA 2VEOA 2YYSA 2ZLBA 3LH5A 2H9AA 3MFQA 4PC2A 2JIZD 3K71B 4LWPA 1HK7A 4NJMA 2HWKA 3TAUA 4EO7A 1SA0B 4R9NA 1HOXA 3ESZA 5E7QA 4OKSA 3KVOA 4L8GA 2ZTLA 1JJIA 2VUHB 4MUJA 4C89A 5I7WA 1YAJA 3U4GA 4LRWA 5KAPA 4A26A 2AJLI 4D9BA 1WV0A 1AJEA 1O87A 4WSOA 2UXDB 3F1LA 5BT9A 5CBPB 5D3MB 1U3UA 3O7MA 4EJFA 5BSKA 4QG3A 2QR5A 5MGBA 3K9WA 1KR5A 1VHTA 2HRZA 2JCVA 4V0NA 4X63A 3E9ZA 1QCZA 4DB2A 2PJDA 3FVVA 1ESZA 2F55A 3VH4A 1BEUB 5F5NA 2R97A 4CIDA 5IVKA 3W5BA 2ZJ3A 2ZDQA 4JR1A 4RL6A 3SY8A 5DT9A 2O50A 4KXLA 1ONSA 3BMQB 3TH5A 4HNRA 2A78A 3C6ZA 1IBSA 1GZHB 2C2BA 4FQ8A 4C04A 1OV4A 2ZIUB 2BFPA 1T1RA 4HY3A 1PEAA 3K0EA 2HJRA 4XA8A 1E94E 2WAMA 3PJEA 1O54A 3HV0A 3OWOA 4D3XA 2YCLA 4GQIA 3RT1A 4OHOA 4FQ5A 4KDFA 4UHFA 3ZHRA 4EX6A 4Y98A 5GONB 4YRQA 1JPUA 1QAMA 1RZUA 2GBPA 5AYVA 3BGWA 4BWYA 3F7OA 3H5WA 2XT0A 2C2YA 2IHZA 2YC2C 4PFJA 1XAHA 2ZYUX 4NARA 5K4AA 2JH9A 4FX5A 5F51A 1CUVA 4IXMA 1KBZA 2QM0A 2VZEA 3A1EA 1JLSA 2AN4A 1TGYA 2FMIA 3CR7A 3SFTA 1C0IA 3KPWA 1RNLA 2FPUA 1ADGA 2C88A 1RQLA 1YOVA 4MPDA 1ZICA 1R00A 1V96A 2PSEA 3CINA 1LTHR 1SXGA 2RHLA 4CM3A 1GPUA 3ZDQA 3HI4A 5ALOA 5CFQA 2D1SA 4JKYA 4E6EA 1PVOA 4LXQA 3O0DA 1G20E 4IO0A 2G80A 3BMOA 1UT5A 2FV8A 5DNCA 2HX1A 2GPSA 3TNJA 4AW9A 2I71A 3FOWA 4IDPA 1J23A 3T5BA 4X7MA 3ORYA 1Z7YA 3G8YA 2HTFA 3Q85A 1KU0A 2D0DA 4YECA 3UVEA 1NF3A 2CXNA 5FX2A 4U4AA 2GCOB 2V5VA 4DRYA 5CJPA 5SZKB 5C53B 4DIKA 4I4LA 3VDQA 2P65A 3GLKA 1YBHA 2EHJA 3FZNA 1UBNA 2DQKA 4QIHA 1I1QB 1AA9A 3L06A 2SNIE 3H2KA 1GDHA 2BI4A 4RA9A 4ASUA 1XA3A 2V4ZA 4ZARA 5EE9A 5ARDA 3OOJA 4BMXA 4LVUA 3K9HA 4BGDA 4EPWA 1L8QA 3AOGA 1I2CA 3KZCA 4PAGA 1DBQA 1Z5NA 4RDCA 3RAPR 4ZOAA 1DTEA 1HLGA 2COKA 5A3RA 1CR2A 3JPWA 3FAKA 1D1PA 4WUTA 2VJMA 3WYAA 2I80A 4TTSA 1TYAE 2QNBA 2ARKA 3KHUA 3QEAZ 4WY5A 5E6UB 1QTQA 3BZUA 2X76A 3CB4A 4I50A 4GM0A 3QBJA 3GL9A 5CCXA 2VZ8A 2RH5A 4EP1A 1NT2A 4FINA 2ADFA 4Q37A 1Q77A 2F2TA 2PS3A 5A5EA 3I5AA 2PUBA 3HJFA 1N2GA 4MTCA 3H4MA 2VPIA 5HGXA 4CI0B 3QKSB 3UV6A 1A27A 4ND1A 1E89A 1HT3A 4CV0A 2Q1SA 2FKAA 4LDPA 1K89A 2A0YA 1MO3A 4RMNA 521PA 1HDGO 4IJUA 4ZEWA 2OEPA 1DX9A 1V48A 3L04A 1MVLA 3H0KA 3OO1A 4GF5A 3D4OA 3KB6A 3IDQA 5BV1A 3W5VA 4BXOB 5TGTA 3WGKA 1LLFA 3REGA 1Y6RA 2JEYA 3EUEA 3ZQ6A 2EP5A 1FLDA 1YZFA 3C6MA 4M0EA 5F5XA 4M7RA 2H17A 1G2PA 1T4MA 2OOSA 1VLMA 2Y1EA 1L5KA 1EP1B 5GM1A 3W9SA 4YAUA 3CN7A 1V26A 1EB9A 3JAWA 5H02A 3RJMA 3ZGVA 2OHJA 2ZBEA 4KG7A 4Z4EA 4RS3A 1Z88A 2VP0A 1Z7GA 2MJLA 1IY2A 1DQSA 2J6CA 4FGLA 3JQFC 3QVLA 2WYIA 3PDIA 4GC9A 4AU1A 2HRDA 1AH2A 1XZ8A 1WZNA 2I6SA 4LDQA 1OLXB 1H8HD 2OCXA 4XW2A 3KQKA 2HA4A 3PFBA 2FZ5A 1PGPA 2CEKA 1OU0A 2XDQA 5DISB 3ZIDA 4EHBA 5CFRA 4JJZA 1EZ1A 4D57A 1AE1A 1MW8X 3UFBA 2ZRGA 1X0XA 2UYGA 3CIFA 5E1DA 2HJSA 2NQTA 1OZ0A 3B1ZA 1DX4A 1IY8A 2NZXA 3MA0A 4GMDA 4GVLA 3EZGA 1J0AA 2QSZA 4QOEA 3RE1A 2BGNA 3CEJA 3H83A 3SP1A 4BO0A 1W5SA 4JU9A 1IPEA 2E4AA 4CQNA 3AC0A 4R31A 1TO6A 2C4VA 4KX5A 3PQ7A 5JJIA 1KBOA 1LPNA 3NAZA 5BSMA 4Z6KA 1NYQA 3CUSA 4F04A 1QLJA 2FLVA 4LE0A 4UDXX 4V3CA 4JI2B 4M54A 5SZHB 2FYTA 3EGDB 1AURA 4B71A 1KDRA 2AJBA 5J63A 3BD9A 3WO0A 4CNQA 1PHPA 4BJ1A 4CUZA 4MA0A 4B8YA 4DC1A 1NXQA 2CVQA 3HXOA 5ICEA 3FCCA 3GO4A 3BXFA 3PC6A 1KKLA 1Z8HA 3B1KA 4FHEA 2IPNA 3H13A 3IAXA 2E5WA 1P4SA 3LO8A 4ZQBA 4EPRA 3NEPX 3HBJA 2ZTMA 3UJ7A 2X5OA 1MFZA 2IIPA 4P22A 4RADA 5ER9A 2JH8A 3QKWA 2WPDA 3BKWA 3CZPA 1RC0A 2BZSA 3IR7A 4G86A 1E6EA 1DBPA 2I34A 3MJSA 3MUOA 1X19A 2GR9A 4LCEA 2C4WA 1W4BA 1N5IA 2ZVPX 4PICA 3AKZA 4M76B 3AVVA 3H1PA 4DR4B 4LOHA 1ZSNA 2XNSA 2HI0A 3QTBA 1ETHA 4XDGA 2NV2B 4W8HA 2FJ0A 5TT1A 2Z5VA 1PJLA 1RHRA 3FOAA 3Q8LA 1TIKA 2QV0A 4YPOA 3FNHA 2QN7A 3OAAD 3QEKA 5JCJD 2VOJA 2XGSA 4EEKA 4ARCA 3P4XA 3CWQA 3SR3A 4MIEA 2COUA 5E4YA 5DXAA 1OXMA 1N5MA 3MC1A 1ZXLA 1V5FA 2Z2YA 4HH0A 4K8OA 3WMWA 3DOFA 4K0RA 5IM4A 1KS9A 4NOJA 3HO8A 2PV7A 1G6Q1 1UAAA 1Y7LA 1SVOA 5E1MA 2A5FA 1WJGA 2O6HA 4TMXA 1SIUA 1WKBA 1OGYA 4FLMA 5B4UA 4EM6A 1MX1A 3QEMB 1VMKA 3NHKA 5JIBA 2FF5A 1IZ8A 3QLUA 4KR7A 5BWBA 2UKDA 2VH5R 5CT9A 3G7NA 3KAJA 4JYPA 3NBYC 3CCFA 1USVA 2KW5A 1T0PA 1V5WA 2PGIA 2VRCD 4PZEA 5AJVB 4B09A 2Z8YA 3FZEA 4H0CA 1RTTA 1ORIA 2GSWA 1CZNA 3QMPA 4U3JA 4I3HA 3D4NA 1TK9A 1J1ZA 1E18A 3DE0X 3DVLA 4ZXPA 3T0FA 1IBLB 1B6TA 4DVGA 5TMDA 4ZP1A 1UMCB 2WJAA 4RTJA 2NTNA 4XRGA 2OSBA 1V1JA 2WZQA 5L3VA 2D5AA 5FOSA 3RVLA 1DC8A 2RKOA 1ISIA 4RVUA 4F2GA 5DI3B 4LRYA 4IG4A 1MO5A 1YR8A 2IZ6A 1D6JA 4NK5A 3W06A 2PANA 4JR0A 3L9XA 1NVAA 1DT3A 5JMPA 4LQLA 4R5MA 1S4MA 2RAUA 4WAUA 3VNAA 3CBQA 1I2BA 4QGGA 1YZQA 3IBYA 3NVAA 2DUWA 3HR7A 5HF6A 1PNTA 1QH8B 3LX4A 3I30X 3ZHCA 1XZMA 2XGJA 1U9IA 5EZYF 1N1MA 3ZHYA 2YYAA 3JZAA 3QXJA 1IK4A 1NYLA 1HQKA 4WZAA 3AVTA 1CUGA 5BUQA 3PR1A 1SUIA 2GTHA 2I4RA 1N0UA 1XG5A 3OCJA 4QEDA 1XX6A 5EYPA 4I6EA 1S89A 1J8VA 1ZM3A 4B31A 4MQEA 5ITZB 4NAVA 1DEOA 4QJBA 3R9XB 3HU2A 1FNSA 2I4MA 4B85A 1SKUA 1UK9A 1X9HA 4MV4A 1K9VF 1I94B 3CZMA 3F5QA 3D8RA 4UFPA 5BMVA 4G36A 4ENUA 1TL7C 5DM2A 1B3RA 2OXFA 5D3KA 1Q7EA 2JGKA 4XLTA 2Q5FA 4NPHA 2BEUB 5I45A 2BFDB 3N2YA 1XTUA 3PCTA 2GH1A 2P0AA 3GAZA 1M1YE 4PYIA 3T7TA 2PJZA 2Y4OA 1EE9A 3KJIA 3W8EA 1ZXBA 2JIZA 5CDTA 4QO7A 2PQ2A 4B6OA 2FHSA 3RRMA 4XJTA 2ZRKA 4F56A 1Q3KA 2HTEA 3WMRA 3MGCA 1HXHA 4F1WA 2PEYA 4GOXA 1C0LA 1I33A 2IW1A 3ESXA 4PX3A 2JGNA 4MWZA 4RLSA 5ETJA 4JXXA 4QWMA 1N34B 4CQLB 3FAZA 5EQJB 1Z5ZA 2G25A 3QJYA 4N7BA 5HOQA 2IY7A 1KFBB 1IUPA 4J0IA 4O8ZA 4XM2A 5HBGA 2AW5A 4CKYA 4MRPA 3TQOA 2XF8A 3LHIA 3Q4GA 1PJAA 4B6SA 4LPKA 3VPBA 1M8FA 4AO7A 4GGMX 2KYRA 3DEAA 2Y92A 1RRCA 1FB5A 4HWGA 2WJPA 5ESXA 3IAEA 5B3JA 5GAJA 1QRUA 3DBOB 3A26A 3PFGA 1R0SA 4H7JA 3SC3A 1NATA 3I62A 2OBXA 1R12A 3PYMA 4EGFA 2WWRA 1KSHA 5HUJA 2QB5A 3IV6A 3EVCA 3V97A 3EF3A 2Z0MA 2Q7XA 5FV7A 1G20B 1PF7E 2EW2A 3GR6A 2H29A 1DAKA 1NVEA 5TQVA 1YK1A 4CDMA 4FE3A 3FG9A 1OXBB 3CUEF 3QVWA 1R6XA 4L15A 1GTVA 4G1UC 1MEJA 1YF3A 1M72A 4GYJA 3DG9A 3RASA 2AYXA 2R7LA 2C59A 1JQKA 2EF1A 4MDFA 4PZCA 1V1MA 1UBKS 2Z4SA 3KIPA 4RX1A 3VR0A 4CW7A 4XWOA 1AC5A 1V0JA 4G5RA 1PJ3A 1EEHA 1T1GA 1G3RA 4JSYA 4QRDA 5JBIA 2WQ6A 1CUIA 2QYOA 1Y4DE 1ZNQO 2PBRA 4YO8A 5TVKA 1U7OA 5L7TA 2AA3A 3PEVA 2NAFA 4WWHA 5IPFA 5GWXA 1CS0B 1LF5A 4CT5A 3T7RA 2DBRA 4YXFA 4YWJA 1YQTA 3GZNB 1JAIA 5EZQA 3L6CA 1BRTA 4S1WA 4XIYA 2ZTVA 4MGHA 4F21A 2CXHA 5A4FS 1N8KA 4WJKB 1QGDA 2PUWA 5K9ZA 3OHPA 1VPWA 2AR0A 4BVGA 2AOXA 1WXFA 2BDTA 3C7AA 4LV8B 2PNFA 3E2MA 3WBJA 1JLHA 2DR2A 3HVJA 3TQHA 2C1ZA 2X0JA 4GDMA 4O4JB 4AYXA 1JJVA 2Z8YM 2YIMA 5ALWA 4YUYA 2H1CA 1C8LA 3GVIA 5DHQA 2E89A 2X1HA 1BQ3A 4FW8A 4HP8A 4IRUB 4JBWA 2HFJA 1FP6A 2OCIA 2OCKA 1X3LA 3E9YA 3WJ2A 4POOA 4KQHA 4MRRA 2CE7A 2ZXUA 1X1BA 3DM5A 3QJ5A 4OI0A 1H1TA 3LGAA 5H16A 1D1TA 1CUWA 1P2VA 3EFOA 1F3OA 2ZIVB 4YJ3B 1YFLA 4OQMA 5BVHA 4ESEA 1MEOA 2A84A 2CHUA 4BTLA 3W6PA 3G5LA 4I1RA 1TTHA 1EA7A 2ZWVA 2G4LA 2ZSJA 3FPBA 4ZJZA 5AW7A 4Q24A 5DKFA 1FF9A 5DYGA 3RIXA 5AVTA 3Q3HA 3OFSA 4IOKA 4X84A 3ZKWB 4MKXA 3DD1A 4B3JA 5KTMA 2OWEA 2IU3A 1WQ1R 2XUGA 2QMEA 3EFEA 5A6SA 4WACA 1V3QE 2BEVB 2F8LA 1E0JA 1UXKA 2IODA 2Q1YA 3LLUA 4HUJA 4O8CA 2VPTA 3ILVA 2H59A 3Q8XB 1JEYA 4JLAA 3LCMA 3FLBA 3ITEA 3NHZA 4L8YA 3M82A 3LJKA 2NO1A 3RIYA 2QBYA 2BM9A 3U61B 1W0CA 2YBEA 2GYVA 1T13A 3K0HA 4MW4A 2R25B 4NE2A 3F73A 4QD3A 5FWXB 1CEQA 1CRZA 1KU6A 1PVVA 2G76A 3H16A 3UT5A 3VBEA 2PRKA 2CN1A 1PBNA 4R1UA 5AKXA 1TFRA 2QXUA 2IYXA 4DZZA 4CTMA 1WVGA 4ND4A 4XUEA 1T6BY 3JCZA 1F8GA 4YMWA 2JIDA 3R44A 2OC9A 3ZCUA 5LQMA 4POAA 3ENQA 3IAAA 5DOZA 5GADl 1RLOA 2QPAA 3N2ZB 1ZD2P 2O8DB 1Q12A 4B5KA 4LCJA 1UBMS 2DFVA 2J3QA 2BH9A 4RDXA 3VKUA 1YR7A 4HDRB 2FXIA 3V4PB 3WXBA 3NYIA 1KPHA 1XQWA 2HKIA 2JCBA 2FTKE 1ZIOA 2P1RA 2F17A 4OP3A 4P3XA 1CDEA 3AH8A 3KOXA 3MMNA 2GOYA 3F3KA 5HJEA 4Z4IA 1YFZA 1E1YA 2D1TA 3G8DA 1XMSA 1EVYA 4ZDKA 3KAPA 1WY5A 5AJXA 2QN6A 2PKQO 4BNYA 1I2ZA 3GEIA 2A9JA 1DUIA 3U62A 3HNOA 4IIBA 1KMHA 3AU9A 4DA7A 3PEWA 1RM3A 1U0NA 3X1JA 5G53C 1SWVA 1F51E 2XH8A 2C2WA 2XMRA 2D7CA 2WKWA 3BX1A 3E3LA 4IIXA 4IUBS 4X95A 4CMEC 3KU1A 1ORTA 3EK2A 3K9LA 1D3AA 1GNRA 1RI1A 1U04A 4FSHA 3BIXA 1Q0RA 2QTGA 4YQYA 3FPKA 1PU2A 4RH1A 1JFFB 2FFBA 4G4JA 1P31A 2R8PA 5L53A 5LZ7A 1HR0B 4RKFA 3HB9A 3A4NA 3KEOA 3GPBA 4JC4A 4PZLA 3DMGA 1JQAA 2V97A 4J49A 4OQYA 2JFBA 2Q1WA 3EGCA 1PV2A 4EPVA 4F2HA 5D85A 2F1OA 1Y4ZA 3H3FA 5DV9A 1A8IA 4HAZA 3A1TA 4BECA 3ZVMA 1Y1RA 2WUEA 3DV0A 4NYIQ 1GCIA 5KVAA 1Y33E 5FORA 3DSRA 2ZM5A 4D3DA 3S8EA 5HIMA 2C7PA 3DUFB 4HEHA 2Q21A 2PJRA 1HLPA 1VG0B 3MLBA 3L84A 4Z0NA 3D7MA 2VDLB 3RROA 3EGOA 4REQA 1QGUB 3QP9A 5DP2A 1R10A 2WDZA 2BGJA 1KPGA 3A3KA 3TEMA 2YICA 4G5YA 3TLGB 5M34A 2XX3A 4ZT2A 5DK4A 4PPFA 4DTCA 4NRDA 4NV3A 2OV2A 3TIFA 2WJVA 2WAXA 4WJLA 4OLJA 3NDIA 2FSUA 4ZT4A 3ZLBA 3AM3A 2RHOA 4AYWA 1SR8A 1BSVA 1P7VA 2CYAA 3KFXA 4JLVA 5AUNB 2RGAA 4P0QB 4XD7A 3CX6A 3GWGA 4I1UA 3QXCA 5AM3A 3IDOA 4URFA 3WYEA 3K09A 1E9VA 1YQGA 1Y6QA 2A35A 1GSIA 1H66A 3CF4G 3LHKA 4YY3B 2FR8C 2W43A 4R2IA 1IDOA 2AHOA 2V7EA 3TSOA 1ECPA 4FHZA 3VR5H 5KOHB 4F12A 1KFJB 2IGTA 5E7JA 1SY7A 1T2DA 1FUUA 3KT3A 2ORED 4Q1CA 4GOLD 4CTKA 4KMMA 4TSFD 1X38A 4W9NC 2PY6A 5BPHA 2YY6A 1JHYA 1Z26A 3BJEA 3VO1A 4YRIA 1SMKA 3B2NA 3HRKA 3C15C 3FRHA 3L8HA 3IP7A 4Z3DA 2NUAB 4BO8A 2D2IA 3K1YA 4DQUA 1ZH2A 2IF2A 1OW3B 1CWUA 4IQGA 2NQ8A 2AT1A 1A5AB 1XHEA 1SPXA 4MDEA 1P9WA 1SCBA 1YVUA 5ALUA 4FFVA 1LD3A 2RHHA 4N3AA 2VRCA 3M5DA 1DBSA 1S1MA 4HDSB 5A3SA 3L8DA 3UUFA 3RSQA 2F9FA 1U02A 4EY6A 1KO5A 5TS2A 3GH1A 1YL5A 4I0WB 1DIRA 4E70A 1EVZA 3FETA 2Z43A 3HC7A 4YT5A 4XUDA 2OG1A 4CBVA 1GL6A 3AR5A 3V34A 1A1VA 4P0TA 3IEVA 4C43A 1AM4D 4D5EA 4EG0A 2ZSKA 3IUQA 2GGSA 1QCDA 3P7MA 3C8DA 4E21A 2J9ZB 3QOXA 1SB9A 2B8EA 3AT1A 3FPLA 1P17A 4MUNA 4RVHA 4XTCS 5CM8B 2WF9A 2NQ2C 2Q8NA 2ZVDA 3DFKA 1NX6A 3BAZA 3C0KA 4MV0A 5CURA 5DB4A 2IHKA 5JAOA 5CEEA 3ORFA 1JQEA 2DR0A 3W6UA 4Q05A 1JHQA 5GJBA 1RMQA 1ZOOA 1G64A 3DDHA 2YKGA 1ZA2A 3DAHA 4GL2A 3MCWA 1KAQA 4XVRA 2QPTA 1M1YB 1PZGA 3KZVA 1Y1QA 2ECPA 2JHGA 4MO9A 4MUHA 5JC1A 1MO2A 3A9CA 4MS1A 5JASA 3SJZA 1D5CA 2BKXA 2WSLA 2FK7A 3A4TA 3KR9A 3N05A 1YTUA 4YREA 3I2HA 2X42A 3IJPA 4MYCA 5DBFA 1GUBA 3I9KA 2LP4Y 4EFNA 1R6UA 3UANA 5JI3E 2BZGA 2WKPA 3DPSA 1KAGA 3QEOA 3OQJA 4QAJA 1O9GA 3VR4H 4CLOA 3AUUA 1Z0JA 1U1EA 2IPXA 3EUAA 2BELA 2VOEA 4OH7A 3S40A 2PQ6A 3PGXA 4B82A 3QFFA 3A6FA 3CNQS 2XE6A 3ZE8A 3DD5A 4CM4B 3SE0A 2GERA 2OFWA 3MTEA 1QRDA 5AD1A 2WYHA 1GAJA 2H5EA 3ENNA 2QLMA 1DJMA 1P0CA 3COYA 2CUKA 1A8UA 2NVUB 2BJHA 3EAFA 4BNJA 1V71A 2XHZA 1PG5A 2XYRA 2P2SA 1HFEL 3IMFA 1E1DA 4GVPA 1XQ6A 2NP6A 5IK2A 3MWYW 2E55A 5EXXA 4DNOA 2NUBA 4YN3A 4FYIA 4C0XA 1CCWA 1WLYA 3CXRA 5BW4A 4HNAB 1BZYA 3DBRA 2F64A 2ZR7A 5AJHA 3ECAA 4RANA 3TJRA 4OM7A 1T8WA 1KA9H 1G5PA 1Y98A 1HMYA 1I7PA 2PEZA 4EHHA 1N0HA 3O92A 4Z7QB 3IL2A 4FFNA 3BICA 3CVXA 4Y2UA 1VDZA 1PN3A 5DNDA 3Q7QA 3EPKA 1G3UA 4N9WA 2ZJ8A 2OE2A 3DE2X 2IDJA 4DJDC 3GCDA 3CV3A 2IUUA 4TVBA 2OBFA 2P9QA 5JEEA 4FUTA 2PS0A 5EA2A 2OGSA 3ZWDA 3FJOA 5C80A 1GG8A 1P1BA 1IJFA 1OXSC 3BH6A 1QIKA 2J0VA 3VSAA 4D9NA 1CDDA 1FP4A 2IIBA 3T3HA 3FSRA 1A8PA 3A6LA 1Z4LA 4I7EA 4UEKA 3SYNA 3H5VA 5A3JA 1EFKA 1IY0A 3NHMA 1KY2A 2NX2A 2PO5A 3A4VA 4CCAA 5HZHA 1L7RA 1EGHA 1BHSA 1T34A 1VLLA 1QUEA 2HUNA 2JFFA 4YPFA 3R3WA 2GAJA 1GUAA 4KO4S 1MXHA 2A6PA 1SOVA 2BJVA 3V8NA 4F4JA 3T1HB 2ZROA 4E2FA 2WG0A 1PR1A 4A0HA 4EHFA 4UPEA 5CT5A 1H1DA 3VISA 2RGBA 4UFNA 4V0ME 2P27A 2VP5A 2H5JA 3FB1A 2ECOA 3UMYA 1S2GA 1JG1A 3LK6A 4Q4LA 4LYEA 3VO2A 1YA4A 3JAMA 2HB6A 1Y3DE 3H8SA 4TL9A 3RBAA 3EHEA 3GBSA 2R48A 3RG2A 3VQTA 4EKIA 3L1KA 4M55A 4QJIA 2CXQA 5KS2A 3VA7A 1T3GA 1EE2A 3HL0A 1UMCA 3U1BA 3EZ6A 1UM9B 4MULA 4PSUA 3SZOA 4QTYA 4WK4B 4YFVA 4JC0A 2XEXA 1ZW6A 1HDIA 1W5BA 5I7RA 2EJCA 2SECE 3OE7A 2Z9DA 2WD7A 4EFLA 2MSWA 1B8UA 3LQQA 3NOOA 1KDYA 4LK3A 5G40A 5HPYB 5K2MA 3R3ZA 3OQBA 4NZYA 5FLXA 1EHYA 1GPBA 1MVOA 2VSOA 5JJBA 1NUUA 1SGWA 4JODA 4KMOA 4IVPA 4YV0A 2HA5A 4JJGA 4PNZA 3SQMA 1NR5A 2CK3D 1J70A 3SKXA 5EUMA 4V0OA 5C1IA 3FDXA 4MUFA 3J7AC 1YQUA 5LM3A 1TE2A 3BL6A 1KYIA 3OOYA 2MTBA 4IIDA 4K5QA 3TL6A 2C61A 3ORHA 3IQIX 3MRTA 3RRZA 4K9LA 3PQDA 1DCKA 2VK4A 4WHMA 2JJ1D 5FOVA 4XVCA 5AICA 2QY6A 3OPVA 4F7DA 1L1EA 1RYYA 3DMFA 1VGVA 2YINC 4OXXA 3PJGA 4YP9A 3ZU5A 5BN1A 4BB6A 1YJ8A 3SZUA 3FPCA 3FCYA 5B7NA 1DARA 2P2DA 3ID6C 1RWVA 4KEAA 4TMWA 5IP5A 1X15A 1DAPA 2PX3A 1DELA 1QK4A 3FLAA 3C8UA 4MWEA 1IEQA 3A3NA 1A9OA 1FSZA 2YJGA 1SOAA 2B3DA 5ALKA 2BEUA 1DKMA 1JG6A 2REBA 1VLJA 4I5GA 5HCIA 3EPLA 3C3JA 2YJTD 3BZBA 2VC2B 1Q57A 3BMXA 3AB8A 3ZHUA 3CH5A 4J43A 3CF2A 4ARBA 2KPOA 3NANA 4LVCA 3A6KA 3IBTA 2F43B 3CF4A 1QKIA 3GRPA 3RC1A 3NZEA 1ZD8A 5IVIA 2QN8A 1VZ2A 2PDAA 1YZVA 621PA 2IDMA 4O25A 1NONA 2J5XA 4MWCA 1X7ZA 3H8JA 1XQYA 3FN4A 1PEYA 3N2GB 5EFZA 3PEEA 4LN1A 2YJNA 4LHEA 1RRKA 1E0KA 1ZLXA 2FEMA 4NR0A 4JDUA 5FNVF 2JLYA 3Q5GA 3GEPA 4WXYB 4B80A 1YQXA 2HMWA 4FIDA 4HUQB 2VHEA 5IEBA 3RS2A 1IK6A 3WRVA 2FDCA 1W49A 1E4OA 2XWJI 1D1QA 4XCQA 1WSDA 4G5HA 5BV2P 3VR6H 1HEUA 3SX2A 4MQ6A 1YS2X 3OI7A 1P39A 4UZSA 5JHHB 4TV8B 5BQ3A 1SC3A 2VQEB 3DHVA 4Q7JB 3THOA 5C5EA 2PYZA 2R6CA 4QRIA 3M9XA 3F96A 3SXPA 4P7JA 4XD2A 3U40A 5LOVF 1ML4A 3WQQA 1DV2A 4HWTA 4JUFA 2IOQA 3FYUC 3URKA 4A23A 2AUMA 3LYHA 1IUOA 4RH0A 3M6MD 2EL7A 2I2WA 2PYIA 3CZ4A 3ER9A 3N8NA 3QXXA 3WKEA 1B42A 5J47A 1NVVR 3LRTA 1TCCA 2ZE5A 3SKYA 4LJYA 3VGPA 4LHZA 2C96A 5IDXA 3D6TB 2JLWA 4RD3A 5DSZA 1X8LA 4D9FA 2IP1A 4UM9B 2DLCX 5HW0A 4ITVA 1LTQA 4JA2A 4ID3A 2C5SA 3CT6A 1I6KA 3ZK7A 4US2R 4TX1A 3OM8A 4TLCA 3ECSA 2EZ8A 1PNOA 3MBIA 3N6RA 3RIGA 3OM0A 3ZNPA 1HSOA 1UXJA 4TZ0A 2G40A 5KAMA 3AVYA 4LNHA 3L18A 4EYQA 1PKEA 2GXQA 4UOZA 4PIVA 3GYBA 4KC0A 1V8OA 1CS0A 3K96A 3PE4A 4U9IS 4UD6A 2W42A 4B8ZA 5J3JA 3OZCA 3GZNA 3UK6A 4BQPA 1PDOA 3CTMA 3ZBTA 1V8PA 1YHYA 3LFHA 2I99A 5P8WA 2CXXA 5F33A 1UC9A 2X2FA 1LSOA 1E4EA 4TQ9A 1Y7TA 4ZKEA 4FS3A 3GJ0A 4ZC1A 4M83A 5EEHA 1OLSB 1VL8A 2MINB 3JTMA 4RW0A 3HB5X 3W79A 2QZPA 4UBIA 1NA5A 4V02A 4V2UA 5T8KC 4PHTA 5LLDA 1QHYA 4O4JA 3U9TA 4A3SA 3GG9A 3HJBA 3M6VA 1OREA 3D5TA 1BCSA 3UG7A 3ADCA 1BU8A 2ZBPA 1FVOA 1MT3A 1QKKA 3RVQA 1V7QA 3UHAA 4MRSA 1KO4A 4B2YA 1I7SB 3LSYA 2QVYX 2W2LD 1UBUS 2H0QA 1R9NA 3LWZA 4FBLA 2IU6A 4ZJPA 1Z5PA 1Z0KA 5JSKA 2B3TA 1YDMA 2VP2A 1DC3A 1E61A 3W3AD 3OOSA 1KOLA 3L3BA 1SVWA 2CNWD 3B9PA 3LA8A 5D6NA 2F00A 4YRFA 3ZKWA 1J00A 4KRFA 1XJQA 2GNPA 2VPPA 4ZVMA 1LY1A 2W6ID 3MJHA 3BQ9A 3CNLA 5BOVA 3EZ2A 1VJ1A 2O23A 3STVA 1YASA 4AS3A 4YMVA 2YZKA 3NBMA 2C58A 3HA7A 1HZJA 1N5JA 2O2YA 2CWDA 3B6EA 2YVUA 4R3WA 3S2EA 3U7IA 5A5GA 1TA0A 3TW6A 1VLQA 1XE3A 1BWSA 2O1SA 4X20B 2QENA 7AT1A 4G25A 2FZVA 1HE5A 3DMHA 3DLAA 4HF7A 4I4TF 3SC6A 3LYAA 4PV7A 5B64A 4BVEA 1U6KA 1WG8A 3PICA 1ISMA 2X7JA 5GINE 3WB9A 3RUHA 1SHZA 3A36A 3TMYA 5ILOA 3KXPA 1VL0A 2P3LA 1TM4E 4EI8A 4MINA 2Q0QA 4MJ3A 2NZUG 1M0EA 2PLRA 1P2SA 1YIDA 3H9JA 1H4TA 5IT5A 2P35A 5EFOA 1KHHA 3PQ2A 1GGKA 3HACA 3LY9A 1OWOA 1CB0A 1ZOLA 4G5XA 4AJOA 2O5VA 1WSWA 5E7MA 2GD2A 1VPEA 1FFXB 4AZVA 2II6A 4YRSA 2A3RA 3WZLA 1M34A 1A98A 1T9KA 4LNUB 4RPIA 5EGSA 3ZLTA 2DWQA 4WKCA 3S6JA 3U13A 8LDHA 5TPWB 3QELA 1YI1A 2H4WA 3ENZA 1JPVA 2XTNA 1Z83A 3R23A 1ZJZA 4DLLA 1F14A 4RZXA 4I46A 1U11A 1D7AA 5JG7A 5K8JB 2HDNB 3BGOS 3EXIA 3D3JA 3SPXA 4ZEOA 4IQFA 1ZVKA 2YXBA 1UMBA 3DCNA 4M7OA 1H5NA 4RY9A 5KTSA 2QP4A 5JTUA 1A9RA 1PJSA 4DWJA 2OO5A 1A9XB 2ODQA 1UPCA 4HAIA 1CFZA 1EVKA 1YDGA 4UMFA 4DLWA 1TUEA 1V4NA 5IX8A 3AIKA 2Z1NA 4YAJA 3X1YA 4EABA 3L82B 3ZW8A 2BCJQ 4IDAA 4NS1A 3ZK8A 5C3MA 4KQJA 3SXUB 2C20A 4QL3A 3WL6A 5KC9A 4ESHA 2VCYA 5ENZA 2FZGA 1T3LA 5CVUA 5LFAA 1UCFA 1OR8A 1M9NA 3BEDA 4YMHA 2WTEA 3KKOA 3L7DA 3JSAA 3AM4A 1CR0A 1OAOA 3B38A 3IODA 3R5XA 4YBRA 1N8SA 3ZHXA 3TSAA 3GHYA 1MGOA 1LKZA 3CUTA 3IOEA 1KJYA 3CJRA 3IP3A 5FA8A 5AVJA 1ULHA 5TEVA 4BO3A 1ZP6A 3ILSA 5JD6A 3ZGZA 2ZUBA 1NXTA 3EW9A 5JW6A 3EVGA 3SHTA 1B16A 3PI6A 1WCIB 4RMGA 4G1EB 4IGFA 4GI2A 4IS3A 3TLGA 3VC7A 4NULA 3V6MA 4C1BA 1F0NA 3GGCA 1P62B 1NBIA 2GEFA 3KQPA 4B44A 4BGIA 3AG5A 4DADA 5DCYA 1JGTA 1FYDA 3HS3A 3U5TA 4XPIA 2VS1A 2FK8A 3NYQA 1WUJS 5AUPB 5EJIA 2AMFA 4HB4A 1NGSA 5GVSA 4GLOA 4FI3F 3E7PA 5FUVA 5HSGA 2X1VA 5KOHA 4NCKA 3PV0A 3U3ZA 2I33A 2H4HA 1DPGA 1SZJG 4RENA 2IUSA 4TTIA 1Q0LA 5GMOA 2B36A 3EAQA 2VBFA 4K88A 5DRYA 2V45A 3CEAA 2AIRA 1XT6A 2QXYA 4RVDA 2H48A 3RVRA 3SZMA 2R5NA 3U7JA 1OLUB 4G5GA 3B5IA 3T3GA 3ZD9A 1PIWA 3F5SA 2EQ5A 4ZCPA 3IP5A 4LC1A 5IN4A 5KJCA 4HNSA 4HWSA 3S81A 2AEJA 4DLZA 4IOMA 2JCYA 1YB6A 2Q3CA 2LNDA 2OV3A 3CE6A 1OB2A 1KOGA 2BM1A 3RTCA 5JDIA 4BVBA 4EY8A 5F2KA 1VE6A 5I4IA 1W76A 5FHQA 3TIVA 1G7TA 3CPHA 2GZ1A 4FZ3A 1THMA 4HDSA 2IIVA 2RH8A 2UYQA 4K6GA 5FI5A 3PIDA 3RHZA 5JROA 3WDSA 1QIJA 4I14A 1N6KA 4JI4B 5CCDA 3TNYA 2IYWA 1TLFA 2J9FB 1QKJA 1HL7A 3L6UA 1T15A 2CHGA 4JVSB 1QH1B 5HZGA 3ZD6A 1FW8A 2WF8A 3F6YA 3A9UA 1P9OA 2ON6A 2QTTA 1IHPA 4DQLA 4GXNA 5BUCA 4IHJF 1M0SA 1W0JD 3WGGA 2ZXEA 3HQ4O 2ZTHA 3ZOZA 3RS5A 4IIYA 5F23A 2ZUSA 3H5TA 4YR9A 4JSTA 1V7PC 3N58A 2VBCA 4L5IA 3IUJA 4F85A 2K2QB 5JS2A 2ZE7A 3HZHA 1M1YA 5ALIA 3VNBA 2PMDA 2CK3A 3H42B 4QBGB 4BC1A 4TVSA 3TL2A 4FGUA 5EZYA 3RYFA 5CFNA 1O0CA 4TVKA 3OE1A 4DEXA 3DMNA 1T1SA 3TM5A 4E5UA 2A9VA 1IUKA 5C7LO 5AVXA 3CZ9A 1PLKA 4QGHA 1PNVA 3X2FA 1X80A 1OWMA 3HWRA 5DW3A 4XUGB 5G1NA 1SOUA 1BH6A 1XD2A 4ADSG 1PWEA 3ENKA 4XIIA 4BLRA 1NVMB 1U0LA 3PYLA 2CDBA 5G3ZA 1KETA 1HY3A 1TC1A 4KP7A 2YV3A 3U44B 3FOFC 4D02A 1SURA 2XJ4A 1MDFA 3AL0C 1JHZA 3BSYA 2I1QA 3M1YA 4LYDA 1VBNA 2PZAA 5EIBC 1ZI8A 3INGA 3VYVA 5K0NA 5AP9A 1GQSA 5CH5A 5FI0B 1UJ6A 2HHAA 3UW1A 2G1KA 4DMGA 3FBWA 3QYJA 3I9NA 1V43A 3G9XA 4X44A 4Y6LA 5B37A 3A0RB 1E96A 5KTPA 3WAGA 3GWZA 4LW8A 2M98A 1MOSA 2V7QD 3GQVA 2GXAA 3T99A 1PAUA 3BCRA 2BFCA 4PRZA 1FSGA 2XYVA 3IEPA 4YAEA 4GH5A 5FJIA 4A92A 5EJ6A 4QOFA 2BR5A 4C2TA 2QI9C 3HDJA 5KJ1A 3ASVA 1RKXA 2BMJA 2EIXA 2CMGA 3CG0A 4CM5A 3L0IB 1W1UA 4HNAA 1BGXT 1N6RA 4MPRA 2NO6A 4WDQA 5H5JA 4NECA 3FNFA 1WWKA 1JDBC 3V4OA 3ANYB 2QRLA 3BTVA 2ZPUA 3I9V1 2H1IA 3S29A 2XB8A 5AKHA 3V4SA 3VOTA 4ZOEA 3V8VA 3GD7A 1WTAA 1QR6A 2MSCB 5KTNA 3ED1A 4A73A 4DR7B 1OBOA 2PMKA 1N3BA 3NUQA 3JQGA 4HL6A 2CJFA 3BCHA 4CG2A 5FBVB 4OPMA 1WDMA 2XKAA 1N25A 3C14C 3U31A 1Z63A 3HCOA 2Z3VA 1CZKA 4Y18A 1AGRA 5IJ0B 3PTLA 5CLLA 2UZIR 1W25A 3NNDA 5COBA 2VT7A 3KKZA 4OHKA 4B79A 1U1FA 2R00C 2RSLA 2DFKB 2BPOA 4LAFA 5IAGA 4C7BA 4D9MA 1BMTA 2PGXA 3HI6A 1U0HC 2DRIA 1XCPA 1YAHA 5HIJA 3WG9A 4OU4A 3L43A 4J4TA 4TGLA 1JW9B 3LZCA 3DDOA 3U7HB 3KTFA 3LXRA 2O7SA 4FHCA 1K08A 1WXWA 3LDGA 4UVIA 4MV8A 4JL8A 3EVDA 5JVDB 1NW3A 3A14A 4AURA 3HJTA 3TBKA 1QYCA 2HHHB 4DL9A 1LDNA 3KRTA 4MKFA 1SIOA 2RB4A 3H4VA 2IVZA 3AWIA 1ORRA 2R44A 3WNVA 1WO8A 2CBZA 5KJ6A 4EJMA 4FJ2A 4DVJA 3BOSA 2XB2A 3V32A 1S96A 3ZYCA 2YQZA 1AGPA 4UHDA 2DT5A 3W5CA 2D1YA 2GILA 3T38A 4FOTA 1T2AA 5CXSA 3UV7A 3CX3A 4EEXA 3UUEA 1BIFA 4G4IA 4UM5A 4W99A 2OGWA 3V00A 5C35A 5KINB 1B6RA 3STUA 5JCZA 5K0FA 5JQGF 3PXCX 3QIVA 3GDFA 1UOOA 2ZYRA 1LH0A 1FXWA 2DP4E 2W4IA 4GHWA 4OQFA 4EJ0A 2WSYB 3T9DA 2W2LA 3UB3A 3H0CA 1AO0A 3KOOA 4PIMA 4YBZA 5ALRA 5FFNA 5LA6B 5FF9A 4B7ZA 2OECA 4DCGA 2PX8A 1JQBA 5CPFA 3PC7A 1GQOA 5FFFA 4HX2A 1XRLA 1HURA 1NASA 5IJZA 1RHKA 2HY7A 2W2VA 3ZWAA 3B2QA 1L1FA 4DR1B 4CR8A 3B6KA 3OHMA 2W6IA 5DT2A 3FFBA 2VP9A 1KNXA 2FLWA 2FSFA 2PLAA 3LVBA 3R6GA 5K0LA 3IPLA 2EGUA 2ZSBA 3PTZA 1OH5A 2OSVA 4ZT7A 2PUGA 4IP0A 4QELA 2ANBA 2HR1A 3THYA 4FFRA 1WUYA 3RFCA 2CLKB 3ZU2A 3QENA 1ZMTA 2P6OA 2E0IA 1RVDA 1RVV1 3K9BA 4MAMA 3I9OA 4U63A 4Y3UA 4DNQA 3AUJB 1C7JA 2W6JD 2YDXA 1AUXA 3BD6A 5J58A 4ZQHA 2QT9A 3IO5A 4OHUA 3RVBA 3ZLVA 4MPTA 3SF8A 3A6ZA 2AXQA 1UXGA 1ULUA 4WKPA 5T64A 3V8MA 3M49A 1EJ6A 4RKEA 4CKXA 3JD4A 3EASA 3D3WB 3IUPA 3Q3JB 4P6VF 4L02A 3G0BA 5ALZA 2F43A 1FU8A 2ZBQA 3K5PA 3LHDA 1Y42X 4FIZA 1XEFA 3J80A 2VQSA 4HO1X 3O95A 4NBUA 1E3SA 5FTMA 1R6DA 2ZWAA 3D4LA 3BL5A 3ZCTA 1XDUA 4BO7A 4C0WA 5HHTA 3QH4A 4WKGA 3ZWOA 3BJZA 1AV7A 3CRW1 4RD1A 4BWVA 3GUHA 5LPNA 1LQTA 3VR6D 3LMKA 4HUQA 1QC5B 4OLBA 4K7JA 4ITRC 1A5BB 1KJNA 5E0OA 3L05A 3SNKA 1A71A 1ZN9A 3SHVA 3FRIA 1S2NA 5FPHA 1K7YA 1W1IA 1DTSA 5G0VA 2XB6A 3TG2A 5BW8A 2AQ8A 3FYUB 3WS7A 3X3HA 4C1NA 5JU6A 3ZQ4A 4CE6A 1CQJB 3TPCA 4XKJA 4P33A 4HX5A 5LZ4A 3IHWA 2O2XA 1CUDA 1E7MA 3G2KA 3LYLA 4P80A 1QLWA 4Y1EA 5DGCA 4R1QA 4UPDA 1W44A 2HMVA 3GLIA 3O2NA 5AQ1A 1DG3A 3G9TA 4M1WA 1OFUX 4U2CA 1LU9A 421PA 1XCJA 4ACAA 1R6AA 4LBYA 4ISBA 5AVRA 1VYHA 3I2JA 1PE0A 1ZOPA 4PPNA 5I9TA 1RIFA 1BE0A 1JBKA 2ISQA 4U02A 1RTKA 5BRNA 1MB0A 4W9RA 3X1ZA 4W63A 5TJHA 1Z0SA 4Z4CA 1MAHA 1T9GS 2XWQA 4U2BA 4WESA 2J4DA 3B89A 3UJDA 5EXPA 4BZXA 1XNHA 5DHAA 4BNMA 2BUCA 2GLTA 4JOCA 3ELWA 3G2HA 1OVGA 4ME6A 2QZZA 1C3LA 1Y3HA 4N5HX 1TZKA 2AN1A 3RRFA 1MAVA 2QD5A 3R24A 4XSGA 4IDDA 3HTXA 2PCLA 4WVFA 5EE3A 2HWYA 1D2HA 4EVSA 2GAAA 3T1YB 1F3LA 1UINA 3S68A 5AM5A 2OP0A 1KK2A 5AHWA 3F74A 3OWHA 1DQPA 2IXBA 2Z1MA 1K5GA 4R7TA 1GQYA 3VR5A 2JAQA 1XDSA 2AQKA 2NU9A 2GN9A 3GVCA 1XNJA 3BKXA 3HSKA 1SIWA 2DWCA 3D7RA 1S2LA 1XEXA 4CTNA 1KYWA 4MQLA 3G5AA 4RVFA 4DWOA 1C3JA 2HXGA 2IXAA 2R84A 1FP1D 2A5GA 2WNIA 2ZQZA 2BHSA 2WFMA 3AU8A 3FA2A 3A1FA 5DM4A 2JAUA 3V7NA 4GLBA 1M6NA 3DCJA 3DOHA 3CRVA 4L5BA 3E48A 5DHUA 1XWWA 2BGUA 2R1TB 2LVBA 2WICA 1KC1A 2V9ZA 1ZGZA 3D0KA 3L0CA 3LWNA 3QU2A 4CL8A 3SS7X 1XWIA 1IG0A 1QHHB 2CHVA 3F3MA 5T4FA 1YJBA 5K0GA 2IJGX 4A27A 4PQEA 3FOZA 5TF4A 2RJNA 4MDYA 5HRCA 1MRNA 3E9RA 1ESNA 1PJTA 1U4NA 3HCNA 4CM7A 1LEHA 4M53A 1AMNA 3LECA 1TPYA 3OFVA 3V6LA 2WHYA 5EJEA 2QUBA 4JKIA 4X20A 2CYBA 3EPRA 4EB6A 3CJQA 3IVRA 4L0MA 5KVQA 2JK0A 2HLHA 2WW8A 4XASA 6CHYA 5T7BA 4J0FA 5AKEA 5LQCA 3UUGA 3PQ3A 1AUPA 5ALMA 1XVAA 1UUFA 5BR1A 3COPA 3RC8A 1XTQA 3I61A 1JG4A 4N40A 4B3BA 5CCEA 3MYRA 5DTQA 5CA0B 1HFWA 1TCVA 4C5CA 1KQNA 1Q1ZA 4KB5A 3E03A 1VP3A 4XQ0A 3WLOA 1O08A 4KBYA 2QTMA 1I6WA 1KAMA 1TF2A 4BKMA 5LP1A 2ENWA 3PNVA 1U8XX 2RDMA 4M8IA 4FGZA 1Q3TA 4RXUA 4OJYA 1ZH0A 1W93A 1XNGA 4FFBA 2PZEA 4LNUA 3Q3EA 5EP1A 2XI4A 5AW8A 4YRNA 1XAJA 1LI7A 4XYBA 3PFIA 2R1VB 2R8YA 5HJ2A 5TPWA 3DTNA 4F9FA 2J45A 7REQB 1BA2A 1NTOA 1D0VA 3KFVA 1IXRC 1URPA 3ZH2A 3TCXB 3RU9A 5K3EA 1M7HA 3LL4A 1A7UA 4FSXA 1VHDA 1H1LA 1VRCA 3VZPA 1QRRA 2HSJA 2XCOA 2ZYVX 3JASA 4Q1EA 1JEAA 3EVEA 4A2QA 3W5UA 2IYAA 3E81A 1QF7A 3VR4A 2WB2A 4Q82A 2FDXA 1R4NB 4PHGA 2VF8A 4TLLB 5T3UA 5JNUA 1U3GA 1YA8A 4YUWA 5C32A 4HTAA 4OBEA 4RD6A 2WNHA 5C51B 1NHGA 2WAOA 3HEBA 1P8AA 4M0CA 2UZ1A 2JJ8A 3LAWA 1WAMA 5AK3A 2A59A 3HY3A 3RANA 5M29A 3U2QA 4F1JA 4YH1A 1JKJB 1JDJA 5AO9A 4YONB 3PGLA 1UJ5A 3N1UA 3LQ2A 4ZI7F 3ZQUA 5EJ5A 2FSHA 4TSKA 2JGJA 4QTTB 3AEUB 4DSAA 5DI9A 4MQUA 2UV8A 2Q50A 3I5UA 3AEKA 2W9XA 2WUFA 4IINA 3BIOA 3ZGOA 4BO6A 2ZAIA 1ZSVA 3QG1A 1ZO8A 1GARA 3OETA 1Z35A 1WCIA 2XMZA 2ZUWA 3R7LA 3KEFA 2Y0PA 3LL7A 1M0WA 3NBQA 4PNPA 2HWXA 2VDNB 3GFQA 4IIJA 2DKOA 1KJJA 1WLSA 2DLNA 1QQTA 4WOBA 2Z4RA 3O1IC 4CIAA 3MNFA 4HXGA 1AY0A 3NAQA 2GKSA 1LGYA 5ERYA 3DBVO 1G8PA 2IW3A 2V74B 2JGIA 1I24A 2I8AA 2V7UA 4V0MA 2A1TS 3HU1A 3PXDA 4Y2XA 5DF1A 3PD0A 4Z0HO 3ZHOA 3ZHVA 3VPAA 4B5LA 4JT2A 4LKOA 1QRSA 2CD7A 1L3IA 2IYQA 2OCDA 4I2NA 1RZRD 4E15A 3ZXIA 1W36C 4JBIA 1XTIA 2BWJA 3HLTA 3QYPA 4R84A 3WKAA 2WMDA 2XVAA 4AJEA 3NTQA 3OCCA 3E58A 4PZDA 4D3YA 1ODCA 2E48A 1PGJA 4PHCA 5KNBH 4AICA 1DRVA 3CH7A 4PE5B 1Z4MA 3O91A 1JIKA 4ZDJA 2ZBRA 5IC6A 4LF4B 1HYGA 1QO7A 2ZYTX 3OKAA 1K4YA 7ADHA 4KJZA 4R6WA 1U2ZA 3IBCA 1N9GB 1TECE 1WUHS 3IHKA 3KQQA 3QMMA 4X6XA 2OQIA 1T5SA 3EN0A 4FWTA 1LRKA 1UZUA 1MV5A 2LKCA 4JT4A 4LSWA 1E92A 2C07A 4OHBA 4BZPA 4FMDB 1RXEA 4HXYA 5BXQC 1EK2A 3AP1A 4ZVQA 3AY3A 4JHLA 1U0BB 3UJNA 1TZBA 2FW9A 5CVCA 4CMHA 5HILA 3I6MA 3T0IA 2GSDA 2PMFA 4DF3A 4W82A 5LNK6 3MB5A 3Q3VA 1PJRA 1R16A 3GRVA 2Z2JA 3IIKA 1EFLA 5CAEB 3RUEA 3ND5A 5ALLA 4M46A 4D0LB 4IDEA 4DT1B 2HJGA 3C5HA 2V7GA 4PLCA 2RJ3A 1XLVA 5IVPA 1YB1A 1FQKA 3D9QX 1QH1A 2B37A 1VYTA 2EV9A 4HVAA 3C5CA 3NCTA 3RLIA 1RLJA 3ZW9A 2RHRA 4P4UA 1QVRA 2V4MA 1W5TA 5JR3A 3R7DA 1X42A 1FNMA 4LOIA 4JYZA 2O7NA 4DV6B 1RI4A 3KBBA 3VAZA 2ZRBA 1UDRA 3AR7A 1ZDMA 4JBLA 5E7IA 1O97C 1TA4A 5CGZA 4RTNA 3IAS6 2VP6A 4BQQA 3H1BA 3ZR4B 4CNBA 2CXSA 2Y9PB 4EUSA 3G2JA 4F6CA 1FUKA 4UHHA 3D8TA 3NIWA 1Q5PA 1OFIA 2OA0A 1JAXA 1RI5A 1L9KA 3KDSE 2IOHA 2FX2A 4FKBA 1EFAA 3L8EA 3RT9A 3OZFA 5DTJA 1XMVA 4R8SA 4EATA 4M21A 1ZGJA 2J5RA 4ZTUB 4JMPA 5KHOC 3LVFO 4NBSA 3THWB 3ISVA 1E1MA 1U28A 4F5DA 1IRXA 3CR8A 3D8UA 1YQQA 1E99A 1T6XA 2F1IA 4K6OA 4Y6RA 3T4PA 3S2ZA 1K5PA 1ZL0A 1XKQA 3WWCA 3K6RA 1FYWA 1S0UA 4DB4A 4JQCA 3U44A 4FW9A 4L22A 4J0HA 3V4VB 1SXQA 2P6RA 3RSFA 4HAYA 2HN9A 2OUIA 2CGEA 2QNIA 3AL3A 4NYJQ 1K4MA 5CYFA 3SK0A 1GV0A 3FYDA 3NUZA 5KIAA 4BX8A 3U4QB 4N41A 5I7AA 3FBGA 1DO2A 3U4IA 1XTZA 2W6JA 1BVYF 2RGNC 1MOZA 1U7HA 3HZOA 3M4XA 3NP7A 6AT1A 4F9GA 4F5WA 4U2FA 4OHZA 3QHAA 5IARA 2C5HA 3G5TA 3RUAA 3DZ8A 3VU3A 1XI2A 2EXXA 3MTBA 4KR3A 4AKIA 1UJMA 3L7KA 1W5EA 1KZ6A 4L78A 1G4AE 3PFKA 4M86A 3C7KA 5DMHA 3VH3A 2WIKA 1CJUC 2LDXA 1AN0A 2HNAA 4L3VA 3RU2A 3WV4A 1E63A 3E61A 3JR7A 5AIBA 5KREA 2KQUA 1LNZA 1I5RA 2GPJA 3AYZB 4PFKA 3V4LA 4IWXA 1JDBB 4GP6A 4QYXA 4EH1A 4EW3A 3FPSA 4ZHQB 4MR7B 1I4OA 2TYSB 4ZI2A 3TPFA 2PGOA 3KP1A 4I5FA 3E5NA 1ZM2A 4NMLA 5FNVA 1KZ9A 4LZNA 3VR6A 4DW8A 4F3KA 4D43A 4YHHB 1EGAA 2YWRA 3CWCA 3R7FA 2J0SA 2W0SA 2WEKA 4YB8A 1NNUA 4QJ3A 3MVEA 3I4FA 2ZUVA 2GBGA 1LK0A 1P60A 1X8XA 3N8KA 4M6WA 5ULLA 3HUEA 2AG5A 4KZPA 1HO3A 1UT6A 2VF5X 5IMBA 3CNNA 3KELA 4CDGA 4ZEMA 1JILA 3FCXA 3CVVA 3ZLJA 4W5OA 2RB5A 3C4JA 5K99A 2EFEB 3AVUA 3WRXA 4N6GA 1UR5A 3TJZA 2RHBA 5DGHA 4Z49A 5F1KA 5LOVA 1Y1PA 4U5XA 3CCBA 4NDZA 4HLCA 5IJ0A 3F4KA 3V2HA 1HBJA 3JQ8B 4BMOB 4DN6A 1Q15A 3FMVA 1J0CA 4WXPA 1FFDA 2PX4A 4KSCA 1P45A 4BKOA 4TWJA 5A5VA 5PNTA 1AO3A 1FRVA 1RXIA 3GJ4A 3IJ5A 3HM2A 3R6DA 2Q6KA 2QP3A 3L0ZA 4YRRA 3ZV5A 4DSUA 1SUCA 1VG8A 1TYZA 5HVNA 3PDJA 3RBVA 2DECA 2P3OA 2DHQA 2GKGA 2JHFA 3GJ7A 3ASZA 4NVRA 2I6XA 3GROA 4XEUA 4FS8A 4CG3A 3V1NA 5DDIP 1XAIA 3ZGYA 4AS1A 1S8AA 1FL9A 4ETIA 1EPUA 2C0CA 1L7MA 4GW3A 1H9BA 1E3EA 2DHEA 5FBZA 1VI6A 1N6NA 2GCPA 1NJSA 3B70A 3G0OA 4P35A 1Z74A 1ZD9A 2VXBA 4X3OA 1DRWA 4Z3KA 1D04A 1YIAA 1XRSB 1PYGA 3HKBB 1YCDA 1WTCA 4NATA 5H4HA 4CCSA 4S05A 1WCWA 1KDPA 2VRNA 4G4GA 1QRAA 2YVKA 3FDZA 4L7QA 4AIIA 5FA6A 1AHHA 3KR1A 4HEA6 4O2AF 3LTEA 4XDYA 4DWVA 4HNGA 1ZNWA 4NQZA 5ITSA 4F4UA 2VRBA 1SHJA 5AVWA 4FJ1A 5F1OA 5LLSA 3KSZO 4NH4A 3AB7A 1UC4B 4ZQFA 1CZLA 4LJ4A 5TEWA 4CV3A 1IZ7A 2XVYA 3IELA 4F46A 5BYKA 3G82C 4E2YA 2EWWA 3FSEA 2XTZA 4JJFA 1FXSA 4KXXA 2HA3A 4PG7A 4NJEB 5IAJA 2WYUA 3RYTC 4PYLA 4AG5A 5HKKD 4L8WB 4TWZA 1O5IA 3VMFA 1BNCA 4O29A 2IPOA 3QWAA 4PLFA 5G3YA 4PG5A 1NUHA 3W6OA 4C05A 3ZIUA 5KQLA 1RQPA 2AQIA 1GPH1 3EY4A 4RNDB 4RK5A 5EIBD 4ZMSA 3MOIA 4TXMA 5TNXA 2PGAA 5ALFA 1EUYA 2J3LA 1YSCA 2NNWB 5LJIA 3AFGA 4MHSA 1GFIA 1PWXA 1TZCA 3MZ0A 4I4TA 2EAUA 2NU7B 3GRYA 5H81A 1Y3AA 5EUCA 3ROFA 1KZ1A 1G59A 4UNQA 4I55B 4GKBA 2OORC 1GT91 1YZKA 1A5TA 3G02A 1VSTA 4KOAA 4MVYA 3ZZ1A 1ZBQA 3FFTA 3SZGA 1GUZA 1PT8A 1P5HA 1K3TA 4D8UA 3V42A 2YIJA 5B58T 4KAFA 3HXQA 3COZA 2X15A 1EYZA 2EWMA 2GPAA 3JX9A 1O5TA 3P0EA 3EISA 5HQ3A 4C7OB 3BJMA 3Q98A 3QITA 4C7XA 4D9CA 2VJDA 2YC4C 2RGCA 3PUHA 4D0GA 2F7SA 1IPHA 4OLAA 2PX6A 2XR1A 4Q3LA 5TS3A 2WT4A 2WU0A 4KFRA 1C81A 4ND2A 4NYJR 1KRWA 1NBME 2VTDA 3FPJA 3IFSA 2Y6VA 4JVNA 4PYQA 5JY6A 3K4HA 5F3DA 3GLIB 3USZA 3KAQA 4OI4A 4C14A 1ADFA 1U8ZA 4PC1A 1L5SA 2VK8A 4E94A 2IWHA 1E79A 4AM8A 2QL5A 2Z9BA 1QX3A 4ISCA 4B6EA 4W5RA 1RXYA 4EI2A 3HCRA 5A06A 3U16A 3AI3A 2B9EA 3P2MA 1X8JA 1FP2A 4OMCA 4DIUA 4ZGBA 4TQAA 1GAEO 4OI2A 4WA7A 5DTRA 3PNMA 3VDNB 2I8LA 4TMVA 1CQJA 2E5FA 2V0NA 2QUAA 5I51A 2DY1A 4RVGA 3KWJA 4KQ1A 3B2EA 4RETA 5JDCA 3WBKA 2HHLA 3IEMA 4DPLA 2G17A 3GDGA 1ZFNA 3T5CA 1HE2A 2ZSEA 3DP7A