2WJ6A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n- acetylanthranilate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
b'TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
molecule tags Oxidoreductase
source organism Arthrobacter nitroguajacolicus
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj6A01
2YH2A 5I7UA 4AO7A 1TIBA 2I78A 5CURA 3DYVA 1QONA 3A2LA 1BCRA 5AK4A 2BFNA 4IH4A 1CUBA 2QXTA 4OPMA 4OUKX 3PF8A 2CEKA 3NGMA 1MX5A 2HHAA 4B81A 3D2CA 3C70A 5LZ4A 3BXPA 1GT6A 3H17A 1LPOA 3K2IA 3EBLA 3CCBA 1UK9A 3TRDA 2VJCA 1U8EA 4XX1A 2WUDA 4RNCA 3ESAA 5ESRA 2BCEA 3IIIA 1UT6A 2XI4A 1WHSA 2WUGA 5T4EA 4Y2RA 4K6HA 5SYMA 3D0KA 3AIKA 3N2ZB 4HRXA 4BZZA 1CUJA 5J3JA 1AQLA 4G5XA 3SK0A 1ETHA 1XZKA 1BN7A 3WKEA 3G0IA 3V9AA 4AN1A 1ORWA 5ALIA 3SX4A 3IUNA 5EIHA 3DLTA 3BE8A 5FPPA 1SCIA 5CT6A 2GBGA 2ZYRA 3AINA 1P0IA 5LIPA 4Q3KA 3RLIA 4BTLA 1MAAA 3PFCA 5ALOA 2VA9A 1H2WA 1EK1A 3STYA 2JGJA 4JYMA 1IMJA 2ZJ6A 4NMWA 5EHZA 1DWOA 2OGSA 3HZOA 1OCEA 3CN9A 4KRYA 2K2QB 3O0DA 1AC5A 5IKXA 3WWOA 5ALTA 4RPCA 5AO9A 5JZ9A 4DMCA 2XMDA 1NX9A 2C0PA 5C8XA 2YASA 4I19A 5D3KA 1ISPA 4K6GA 1EB9A 3BIWA 4BB0A 4AX4A 2BGRA 3QZUA 4Y7DA 2VQ6A 4DMFA 1G4HA 2GYWA 2XMGA 5CH8A 5AK5A 1XQXA 4UFNA 3L1IA 1DWQA 2V98A 2QS9A 2OCLA 4U2BA 1LNSA 3VKFA 5A2GA 3WK9A 1X2BA 4UHEA 1P0QA 2JGEA 4DTCA 4X92A 2OLEA 4AZ0A 2QRUA 3L1HA 4MEAA 1Y7IA 4HTAA 2P8SA 3M81A 4ARAA 2HA2A 3I2IA 1SCQA 2UZ0A 5IH7A 5JANA 3ANSA 4F60A 1ODCA 1G5FA 4FTWA 4QDXA 1ODSA 1E66A 3DYIA 5HFAA 5HK9A 4ZV7A 3DJYA 5K3FB 1GPNA 1F8UA 4F0JA 2XUJA 2PUJA 4B6GA 3D5EA 3EIOA 2D0DA 1GKLA 1LPMA 3F97A 3STWA 1ZI8A 2ZJFA 3RKSA 1U65A 4WFIA 1XZLA 5K3BA 3FOBA 2WFLB 3H18A 2X76A 3D4LA 3R3XA 1CR6A 3H2GA 4X7BA 1E89A 1FFBA 1GZ7A 3WL6A 1CEXA 4U2DA 5ALVA 4MWSA 1WB6A 4X71A 3O4IA 1SCKA 2BUCA 5JALA 3DOIA 3Q0TA 5HQ3B 2YYSA 4UUQA 5AI6A 3YASA 3H1AA 4ZREA 1E8MA 3PDCA 4CCYB 4INZA 1T2NA 1YCDA 2AJDA 5JAPA 5A6VA 1IUNA 5ALXA 3ZV7A 5AM2A 2NW6A 1W52X 4XIIA 4BVLA 4JH0A 3GBSA 2WG2A 3WQHA 1QIIA 4OD0A 4ZV9A 3AZQA 5JZSA 4EY5A 3EQ8A 4W1RA 4KRXA 5AI8A 1XKLA 4UHHA 4CCYA 2GYVA 2CKMA 4CG2A 1QIFA 4X97A 1X70A 4X6YA 1ZGCA 3WA7A 4OCZA 3WMRA 4FWBA 2EDCA 2HU8A 4H7FA 3WKBA 4QWWA 3G0BA 2RHWA 3A2MA 3A6ZA 2XMZA 4W1SA 5AOCA 2HA5A 2OQVA 3CN7A 3QVMA 1DQYA 4QDZA 1QIGA 5CT8A 4LIPD 3VJMA 4J0GA 1J2EA 5CH5A 5CBKA 1Q0ZA 4DGQA 3RK4A 3H04A 5AH0A 4C01A 4Q05A 4CFSA 3B3QA 1IUOA 4Y2VA 3KXPA 4GI1A 1L7QA 1VKHA 4QZVA 2O2HA 2JGFA 4C89A 4HS9A 2DQYA 3IUJA 5FUMA 2Y6VA 2CUTA 5AJHA 1USWA 4M0FA 1YAJA 4AXBA 2B20A 4HRYA 2XQIA 3U1TA 4QLOA 5EIEA 1LZLA 2XMCA 2CB9A 1UKCA 3QYJA 3FYUC 2ROQA 1LZKA 3G9UA 4AMZA 1OXMA 4MEBA 1CUWA 4UBJA 4GLBA 3R3VA 2IX9A 1QFSA 3DD5A 4AZ3A 1PJAA 1H2XA 2HA4A 4DM7A 1YB6A 4ETWA 1YA8A 2VAVA 4WDRA 1DWPA 4UHFA 1CUSA 1EX9A 2RI6A 1MAHA 5AM4A 4J0JA 2WLSA 1N5MA 3G0CA 3NOXA 4CIBA 4BE4A 1JMYA 3V1MA 1NU6A 1JFRA 1YASA 2XUQA 1P0PA 3WYDA 2QVBA 3HJUA 2BJHA 1J1IA 3H1BA 5FXMA 3T4UA 4IHAA 5JATA 3I1YA 1ZJ4A 1ZJ5A 4U2FA 5AKXA 1N8SA 1XRQA 3NWOA 5ALZA 1S8OA 4B7ZA 2QR5A 4EHBA 1H2ZA 3FYUA 2YXPX 4FFWA 3W05A 3WKCA 3VVMA 1TAHA 2XDWA 2O7VA 4GDMA 4BBZA 3PUHA 5BWBA 3E4DA 2PKYX 3FWHA 1NU8A 2XUFA 5AICA 1MTZA 3O9VA 2C7BA 2I03A 3KSRA 3VISA 5AKJA 1XZFA 2WTMA 5FDFA 5JAUA 1F0NA 1K63A 4MYSA 3UUFA 3LIPA 5DNWA 3OPMA 4FMPA 2PUHA 4G8DA 5CW2A 1UOOA 5K3FA 4QDUA 1N1MA 2RGUA 1CUFA 1R4ZA 5AHXA 4Z49A 1P0MA 4UBNA 2LIPA 4BRSA 3WKAA 1DINA 5HK8A 3BJMA 1W76A 3I2GA 1MT3A 2ES4A 5YASA 4KYVA 1DU4A 2Y1KA 5KBYA 1E8NA 1VA4A 2XQKA 3JW8A 1QO9A 2ZVDA 1B6GA 5CT9A 4ZRDA 4F5ZA 2VAXA 3FSGA 2OGZA 3G0DA 5JD5A 1AZWA 4G4GA 2C5FA 4S0XA 2JF0A 4MQLA 2JGKA 4OYYA 5ALPA 1Y7HA 3GROA 2PU5A 4QWMA 5H3HA 1XZIA 1UOPA 2QUAA 3BJRA 4HVTA 5T4FA 4KE6A 5EHNA 3O4GA 1H22A 4BCDA 1EVEA 5HZGA 3O9MA 3BF7A 5AOBA 1N5RA 1TRHA 1DQZA 4LKOA 2QMQA 4B0OA 3BDIA 2QJWA 1WCYA 2H9YA 3C43A 2FX5A 1CIJA 1IZ8A 2ACEA 5HQ3A 1W75A 5DWDA 1QIEA 1DTEA 2GZRA 1O6GA 1XLWA 2WHPA 4A5SA 2BKLA 1K6EA 1HPLA 4IQ4A 1T4MA 3S8YA 3H2KA 1A8QA 1CPYA 2GBCA 2OAGA 2H7XA 3DNMA 4EY8A 3ZWQA 4TVKA 1AX9A 4Q1VA 4DMKA 5AM0A 1GPKA 4H77A 1XKTA 3ICVA 4L0CA 2B61A 5F4ZA 5K3CA 1JMKC 3ICWA 2X5XA 4G4IA 3TEJA 4BDSA 5ALUA 3DOHA 2HL6A 4BZWA 3MVEA 4E14A 3R41A 3IB3A 5HF9A 4KE8A 5ALEA 2ZYHA 2WU4A 2W22A 1MO2A 5D6OA 3WKDA 4U2GA 1C7IA 1R50A 3D2BA 4TGLA 2JBWA 5ALHA 2AJLI 3QH4A 1JJBA 3HEAA 3MUOA 2DHDA 5A7HA 1AURA 3C6BA 2BUAA 2XMSA 1EA5A 2G4LA 2VSQA 2ACKA 4DIUA 3B12A 2IITA 3F9CA 3OG9A 1CUVA 3IBTA 5AIAA 3WIBA 2AJ8A 1W4LA 1LPPA 2QJRA 3ED1A 1H2YA 3ZLVA 4E46A 3BF8A 3F8SA 3EQ9A 4BVJA 1XLVA 4F21A 1BE0A 3HXKA 2I3ZA 3A2NA 4DLNA 2XQJA 3EF3A 3VVLA 2XT0A 1GGVA 2VT7A 4PQEA 2PL5A 4UHCA 3FSGD 2XLCA 5AKKA 1HDEA 2ZYIA 3QMWA 3R3UA 4WCVA 3D3NA 3QPCA 4GEGA 1VZ2A 2RHTA 5ALFA 4PF1A 1F6WA 2WFMA 3A70A 5IVKA 4ITVA 1R9MA 4ZXFA 1AMNA 3ZLTA 1SOMA 2O7RA 1LBSA 4H18A 1XRMA 4J0HA 4M0EA 5EFZA 2DSNA 5IVIA 3PFBA 4C4YA 3LIIA 2Y6UA 4EZIA 4X94A 2PSEA 3H2JA 3PE6A 1IVYA 2HU5A 2QZPA 4CG3A 1VZ3A 1CUZA 4ZWNA 5FOQA 1Z68A 3V1KA 3LLCA 1WB5A 1B41A 2HA7A 4FKBA 5K5EA 1WHTA 4YPVA 5LZ7A 3PUIA 1XRRA 3HLKA 2WHQA 3WL7A 2VEOA 1HBJA 3O4HA 4OB6A 5DNVA 2XUPA 1ACLA 2Y2UA 1ACJA 4RE6A 4XWGA 4UFPA 1HQDA 2WJ3A 4G8CA 4PV7A 1EHYA 4W1PA 5DYWA 4Q3LA 5AM1A 5LZ5A 4MQMA 1VJ5A 2C58A 1QIHA 1AGYA 2QT9A 4FBLA 2PVSA 4KE7A 3PF9A 1EB8A 4J7AA 4G8BA 2HA3A 1JU4A 2G63A 1QTRA 1DT3A 2WJ4A 2ZSHA 5CXUA 1XRLA 3F98A 1ZIYA 3FCYA 4Y2YA 2WIJA 1XROA 2OCIA 3LP5A 2BAGA 2GZSA 2C4HA 1YR2A 4Y2TA 4UFOA 2WSLA 2PSHA 1UK6A 2C0QA 5CH3A 2C5GA 4Y2PA 4AO6A 3WIOA 4DNFA 5I9IA 1ZI6A 5HCUA 3FBWA 3AUKA 4J0KA 4BCBA 3WK4A 1A8SA 5JYCA 4UBOA 5AK3A 1VOTA 3AFIA 4FNGA 4UBKA 2O2GA 3UUEA 1FJ2A 4MYDA 2WIKA 4M0MA 1G66A 3R0VA 2JGIA 3JWEA 1CUDA 3R3YA 3ZI7A 4B82A 1O6FA 2WTNA 1FFEA 2PM8A 1THTA 4KR0A 1CFJA 3H0CA 2DCMA 4QEKA 1FFCA 4GW3A 5HF5A 5T4BA 3I2FA 4G1FA 2CJPA 1BEEA 5JAOA 2G5PA 3DDUA 1CUIA 1UOQA 2VF2A 2WG0A 1R9NA 5EHQA 3QMMA 4QDOA 5HF6A 5DTIA 1PFQA 4K6KA 4BATA 3VJLA 1W1IA 4KE9A 1XZEA 5FRDA 4O08A 1Q0RA 1XZCA 1CLEA 2VJAA 1J06A 5AOAA 4KAAA 2Z3ZA 2XUDA 4H7IA 3KD2A 4OB8A 3VXKA 5E4YA 1GQSA 4AO8A 2Z8ZA 3AILA 5ALKA 3IA2A 1VXOA 4EY4A 1R3DA 1QZ3A 3G8YA 5K3AA 5ALDA 2JIDA 4UBMA 2OQIA 4LXGA 2AXEA 5AK6A 4C4ZA 5EHXA 4C87A 1YS2X 4W1QA 1H23A 1HL7A 4Y2SA 3WJ2A 4N5IX 3VJKA 4KAJA 3GZJA 1UKBA 5KWIA 2WFZA 1BCSA 2XUGA 4KACA 2R8BA 4BP8A 5EIAA 3WL8A 5E2IA 4C4XA 2AJBA 2CZQA 3P2MA 5DYYA 1VLQA 1TQHA 3F96A 4X91A 1UZAA 3HI4A 2PX6A 4P93A 1CQWA 4LYEA 3I1IA 4IH1A 2WUFA 1D07A 1GPLA 2PSFA 5AI4A 1QIMA 3DL4A 1VXRA 4W63A 3W9UA 1ZOIA 2HFJA 1MN6A 3ESCA 3C6ZA 3HABA 1XZAA 1YAHA 4B83A 2J4FA 3CCCA 3N0TA 1FFAA 3QBJA 1XFDA 4X90A 1MPXA 1BU8A 3BDVA 2ECFA 1QFMA 4J3JA 3QPAA 3WWEA 3K6KA 1EDDA 1F0PA 1CUUA 3C5WP 1YB7A 1LPNA 5C81A 3QITA 4W9RA 3MGAA 4PW0A 5FPQA 4J0IA 1X2EA 3D59A 3QPDA 5JAHA 2OCKA 3T52A 1JJIA 5A7GA 4Y2XA 3X3HA 3BWXA 3BL8A 4NZZA 4OU4A 4I4CA 5JADA 4G4JA 5LZ2A 5ALRA 3V1LA 3WWPA 1ZI9A 1A7UA 4OYLA 5EGNA 4OB7A 3FAKA 4WFJA 4IO0A 1XLUA 2EEPA 2B9VA 4DMHA 3KDAA 3RM3A 2BUBA 1UK7A 5LLSA 4MJ3A 4NVRA 2ORYA 2XQFA 1XZMA 1EI9A 3O95A 1K4YA 2XUKA 3GA7A 4PO3X 4JYPA 4DNOA 3I28A 4A16A 5DNUA 1EDBA 2HA6A 3E0XA 1EDEA 1EK2A 4Q3OA 4L9AA 4KAFA 3M82A 5LP1A 1L7AA 3IUMA 3WK8A 5ALNA 3LCRA 1E5TA 1CV2A 4GXNA 2WHRA 5I8PA 4OSEA 3DCNA 4WY5A 4AQDA 3G9ZA 3JYHA 4Q34A 5ALWA 4P92A 3W2TA 5K3EA 3DQZA 1JU3A 1UK8A 1CUAA 1UFOA 1E8DA 2JEZA 3QM1A 4QDTA 4H7EA 4C88A 2GYUA 1UWCA 5IVDA 3SC2A 5JD6A 5A71A 1A8UA 4J0CA 1ZIXA 2R11A 3DKRA 2HM7A 3HSSA 4EB0A 2HU7A 2ONCA 2QXUA 4B0PA 4P9NA 4GWLA 2CMFA 1YA4A 1BEZA 3I6YA 4V2IA 4XJVA 3G7NA 5CT4A 4PSDA 1Y37A 3Q8WA 3G02A 2ZYSA 2FJ0A 3C6XA 4QA9A 1BS9A 4AB1A 1KEZA 4B9AA 3GUUA 3G0GA 4PSCA 1CQZA 4HXEB 3IURA 1ZD2P 4X6UA 1UXOA 4X00A 2OCGA 2J3DA 2VJDA 4K5QA 5C7YA 3AZPA 4DNPA 4G9EA 2DR0A 4H7DA 2VTVA 2QUBA 1GKKA 2WIFA 3W06A 1R1DA 4MXDA 1AKNA 2OAEA 4HZGA 5AI5A 1VE6A 1XZDA 3WK7A 4B9EA 2W6CX 4CI9A 1Q84A 2Q0XA 3E3AA 1IZ7A 3H2HA 4GBGA 2XUHA 1MX1A 5A62A 1TCCA 1FFDA 3FLBA 5ALJA 4Y2QA 1WOMA 5ALMA 1CVLA 1THGA 5AP9A 3ANTA 3B5EA 3FYTA 4FHZA 2RAUA 4FBMA 1E3QA 5D7BA 1TCAA 1TCBA 1U4NA 1MU0A 4CG1A 3C6YA 1CUCA 3I2JA 2BGNA 1J07A 1ZD4A 2XUOA 3C8DA 3OM8A 5DYTA 4FLFA 2I3DA 4A23A 1VE7A 3RARA 3HC7A 4LYDA 3ESDA 3F67A 2XE4A 3IVMA 1CUXA 4UBLA 1OILA 2FJPA 1A88A 5AM3A 2JGMA 1GXSA 2WIDA 3EQ7A 2DQZA 4CIAA 3ZPXA 5AKZA 5T4HA 4CCWA 3KWFA 1XZJA 3W9BA 1QTIA 4UBIA 3PICA 5D3ZA 4Y2JA 2WG1A 1R88A 4YK7A 4MWTA 3DS8A 2X8BA 3I2HA 4DYHA 4U2EA 3WZLA 1ODTC 4Y9SA 5JZBA 1YS1X 3WK6A 1MNQA 1AUOA 2H1IA 1KU0A 1RWQA 3I6MA 3C87A 5ALLA 1YSCA 5ISMA 3C8HA 1IUPA 4ARBA 4UPDA 1QIJA 3AZOA 5LYYA 2WHPB 2OPHA 4DSAA 4WY8A 2V96A 1MNAA 1SC9A 4BTVA 2E3JA 3LS2A 4GECA 3G9XA 1K5PA 5DTJA 1XZHA 2PBLA 5CTAA 4J0DA 1QO7A 3E1GA 2HDWA 1ZGBA 4BVKA 5FP0A 4WFKA 4B84A 3HYSA 2HRQA 1DX4A 1LGYA 2VJBA 2GBFA 3FYUB 4LHEA 4JNCA 1XZBA 4GHWA 3ZLUA 2XUIA 1XRPA 4EBBA 1LBTA 3OC0A 1M33A 4JUIA 4ZI5A 1WB4A 4BDTA 3NUZA 2D5LA 1UKAA 5JIBA 2JEYA 3WLAA 1QIDA 2Z3WA 4N8EA 4DSZA 3STVA 2Z5GA 5HKBA 5FLKA 3DEAA 3W04A 1I6WA 3O4JA 4J03A 3KOOA 5A7FA 4YX9A 4X85A 2CBGA 1EH5A 2VT6A 4KEAA 3FCXA 5E4TA 2H7YA 4RE5A 1QJ4A 3V48A 1WM1A 2XMQA 4X95A 3K9BA 1CRLA 1C4XA 2ZSIA 2RONA 4BRZA 5LKRA 2WM2A 1HLGA 1W6RA 3CXUA 4ROTA 4L3WA 3QMVA 1RP1A 3WWDA 1DX6A 1LLFA 1ORVA 2VATA 5C8ZA 1CUHA 3DKKA 3C5VA 3H19A 4E15A 2V9ZA 2GBIA 6YASA 5AKYA 5LZ9A 1XQYA 3IUQA 3DL7A 3MUNA 2RIPA 4N8SA 1JJFA 2O2IA 3HRHA 4L72A 2Y2VA 4PNZA 4FOLA 4XVCA 4FDMA 2XUAA 4IH9A 3WYNA 2QOEA 3V1NA 3ESBA 5CRIA 1RYYA 5AM5A 5AKIA 3WK5A 2WILA 3I6ZA 4YASA 4JEIA 4FFVA 3GELA 4FNMA 4B85A 1G42A 4H7JA 4X93A 4HAIA 5E4JA 1CUGA 3PI6A 1BROA 2ZJ7A 4X3CA 4EY6A 3WA6A 1LPBB 5AKHA 5ALYA 4WDQA 4BC1A 1XQVA 2PSDA 3AIOA 5LZ8A 4BAGA 1ZD3A 2OG1A 4D9JA 1QGED 4U2CA 2WQZA 2G5TA 4N5HX 5AKEA 3S2ZA 2JGLA 3I2KA 3M3DA 1CUYA 4EY7A 3C45A 1BRTA 2HADA 5KWJA 1DT5A 3R3ZA 3FLAA 2HIHA 5DJ5A 5DLPA 5BV7A 4BP9A 4UHDA 4ZGBA 3OURA 4N8DA 1U2EA 3WJ1A 5AKGA 2WFLA 4LXHA 2HA0A 5JD4A 1CUEA 1KU6A 4QE3A 5HFNA 2PPLA 4C6HA 4DNQA 3OOSA 3L1JA 2WUEA 1Q83A 2QTBA 3U0VA 4UHBA 4P08A 1MJ5A 4Y2UA 2QKYA 2QM0A 4QLAA 1C7JA 2PU7A 2H7CA 1GQRA 1LPSA 4TPKA 2DFPA 3VDXA 2HFKA 2WKWA 7YASA 4X6XA 1VA5A 5CXXA 4BAUA 4BAZA 4AN0A 2XLBA 2FUKA 3R40A 4K2AA 4H7HA 4RGYA 2HRRA 1PV1A 3G9TA 4B80A 3ILSA 3WZMA 3M83A 2XMBA 3UMJA 4AMYA 1JKMA 2OGTA 3STTA 2Z8XA 2IIVA 4Q82A 4BYMA 5LKAA 2XQGA 4HXGA 3FVTA 2J3QA 1FSSA 1K8QA 5HF8A 1QOZA 1EXWA 3WWCA 1QE3A 2EDAA 4H35A 1ZD5A 3SWWA 4H7KA 5FKJA 2PSJA 4H0CA 4HXFB 2B4KA 2AJCA 1LPAB 1TKRA 2WIGA 3D2AA 5ALQA 1JI3A 5CMLA 3IDAA 5JARA 4BCCA 4KJXA 1XRNA 1QLWA 5BOVA 1TK3A 3GFFA 3KWJA 4OU5A 5KREA 5ALSA 4BC0A 3AJAA 4QNNA 1BN6A 5JASA 1WPRA 3FLEA 2WJ6A 5IVHA 1EVQA 1HKHA 4FLMA 2XMRA 3OTQA 5ALGA 1MX9A 3IULA 4LXIA 5BWCA 4EUSA 5HKAA 4I3FA 3STXA 4NS4A 2XB6A 3TJMA 4E11A 4G9GA 1EINA 5C8VA 1ZICA 3FNBA 3HACA 3WI7A 1L7RA 3BIXA 5K3DA 3D7RA 2V97A 5CT5A 4EA6A 2J4CA 5SYNA 3TGLA 3H2IA 4BE9A 5AI9A 3AIMA 2OXEA 5AIBA 2WU3A 3WL5A 5AKLA 1WPXA 5AI0A 3STUA 5FV4A 3R3WA 1XQWA 4PSUA 4WJLA 3FVRA 1XZGA 1JT2A 1SFRA 2DHEA 2DHCA 4FLEA 1QIKA 5EI5A
chains in the Genus database with same CATH superfamily
4C3UA 4S2UA 3I64A 2FDXA 4L02A 1C1DB 3FFTA 1YKSA 1E1QD 4H16A 2RCNA 2P68A 2Y0PA 2HMAA 1GNQA 3ADPA 3K15A 4KZPA 2OM2A 2VHQA 1YC5A 2GOYA 5TT1A 3VUEA 4B46A 1T1RA 4TWBA 1PHRA 2I2XB 3LNCA 2QROA 4JB8A 4ZKEA 2EKZA 2MSLA 3DYVA 4Z4QA 3TLYA 3A2LA 5FBQB 1V95A 2CVPA 5ARCA 3WMEA 1KYXA 1PGJA 2QXTA 4XRRA 5LVAA 5E1DA 3KPUA 3K6SA 3GP3A 2IE0A 3QV1A 3OZBA 4B4WA 1VPWA 4C7OB 3VYUB 4YRQA 4F3RA 1PK8A 4D4IA 1GT6A 1UZMA 1Z4MA 1NMQA 2C5BA 3KSZO 3U3ZA 2Z2JA 3K2IA 5KWVA 1OH6A 4LJ8A 2IQIA 1EYZA 3TI9A 3G82C 4QAJA 4AP9A 2GGSA 1UK9A 2Q5QA 2VJCA 2ST1A 3HCCA 1U8EA 2N1MA 1WPQA 1XCLA 3A9CA 3OUZA 1K3FA 3JARB 4I4TF 4KQ9A 4Q93A 2ZU0C 4XX1A 3VOSA 4YMGA 4ZGGA 2VHWA 4KWHA 3RC2A 5LL6P 4DV4B 3D3QA 4Q9JA 5BMVA 2Z98A 3NX4A 2Z2ZA 3QJYA 1UT6A 3MUFA 3UATA 1KEKA 4G41A 3IJEB 4DJDC 4HADA 3LPAA 1GN8A 4WZBA 3RR2A 1QV7A 4Y2RA 3JQFC 3QF4A 1FFXA 3DP7A 1UH5A 1MT0A 3FFXA 1U3CA 4OUDB 2VTBB 1JG1A 2W71A 3D0KA 3AFMA 1MZPA 1LFAA 3AIKA 2IUFA 1XQ6A 1V1MA 4G2NA 4DG8A 4HRXA 3FZGA 5KTPA 1FNNA 3RG8A 4GD3Q 3ZG6A 1T24A 1C8VB 1WMSA 3MOIA 1T4DA 1P0CA 3VPAA 4ZOLA 4NJEB 4BNXA 5KJCA 1PK7A 1F17A 1VPVA 1SU7A 3R5SA 4G5XA 1F9EA 1KWGA 1JG7A 1T5HX 2ZYGA 5L3SB 4G86A 1VIMA 4FC7A 3ENWA 1NNUA 5LCXA 1MABB 1XZKA 1ZITA 1ADGA 3EXHA 4P7FA 4DMLA 1NG9A 1L7XA 4LY9A 1I2AA 1O8BA 1ORWA 3J81k 1VHLA 3SX4A 3IUNA 5A3RA 1L6IA 4I1YA 3KQVA 5EIHA 4C7BA 3KC2A 1OFGA 4AWAA 3KYDB 3MK31 5H02A 5FPPA 3IR6A 4D1YA 4BO8A 2XIQA 1WAMA 4J1SA 1O6CA 4Y6GB 1EEHA 4MK4A 5CT6A 4EDHA 2ZB3A 3C8MA 4KL8S 4KZKA 4LWQA 2RGDA 4Q3KA 3RLIA 3PD1A 4BTLA 1K06A 4M99A 4L28A 2DWUA 2VHTA 1XCGB 4KXNA 2W2OA 2PUGA 4OL0A 4HDAA 2JH3A 2ZTMA 2VSXA 4MQFB 3TECE 3FB1A 3HJBA 1IMJA 1EHIA 1ONNA 1PWXA 2NZUG 4WNYA 2QN3A 3UW3A 2NAFA 1E9VA 5M3BA 4L15A 5A1TA 1OCEA 1PQUA 3OKPA 4RYLA 2Z9BA 2PZEA 5IF3A 3QKRA 3DZBA 1OXKB 2Q5IA 4NATA 1KMMA 3VAYA 4GMXA 5LM3A 4YUVA 2ZVPX 1N5KA 5AHRA 4BVHA 2XGJA 3TB4A 5CDFA 2E89A 3GHHA 3WTCA 1AC5A 3OZSA 2PE5A 1I51A 2ZS9A 1BS1A 1HLPA 3VC7A 4DVJA 2Y93A 1ZRHA 1DOAA 1RMYA 2FNAA 1E62A 2ZOSA 4JQZA 1UUFA 2IXDA 3BHMA 1N5JA 3M6WA 5D3MA 2HYIC 4UVDA 3VH2A 2E6KA 4NQZA 2NM0A 1SVKA 3CRNA 1HYEA 4FX5A 4IS3A 3IPXA 1Y4AE 1WULS 3UAZA 3OIFA 1M2WA 4MRNA 1L5ZA 1XDSA 4G09A 4G1EB 1G8HA 4K9QA 4L78A 1KQFA 1MB4A 3CFYA 121PA 1CDOA 4HGZA 4BB0A 4M21A 1E9BA 5BYAA 1GPMA 1WU8A 1PD0A 2ZSJA 3O0TA 2JFNA 4DMFA 1G4HA 4FW9A 1A9PA 4NIMA 1I1OA 2LBPA 3K8ZA 3ORQA 2C8LA 4Q15A 4ZARA 4ZVPA 4JITA 4MWCA 2Q2QA 3T54A 4B6OA 1D2RA 1SKQA 2R8ZA 2C3YA 3BWMA 1FU8A 2A0FA 2V4UA 3IOCA 1O95A 4RS3A 4UTOA 1ZKMA 1JDJA 2F1HA 1LNSA 2UUOA 4EUFA 2O8BB 3CPEA 3D8UA 2ZSEA 3RUCA 1PLJA 4HEQA 2WRZA 4AZ0B 4UHEA 1EVZA 1RJWA 2JGEA 1KY3A 4EA8A 4PAWA 4NG5A 2IYVA 2WJJA 2OLEA 3RV4A 4NOJA 4BNZA 1VKJA 2E4ZA 4C4RA 5BT8A 3QY9A 5JOQA 1EGQA 2HCTA 2VLIA 2WPDA 2Y1OA 2PVPA 4MMYB 1M67A 1NLFA 2QL9A 2Y0CA 2VUSA 3IE0A 3JWGA 3PQ6A 5DTEA 3KTOA 5A9RA 2HA2A 5HUJA 2A8YA 3KVNA 3NRJA 4B4KA 4MYTA 2YWRA 4MYUA 4YS6A 1E3JA 1H6AA 5IS2A 4HH0A 5KU7A 4LYAA 2P79A 4ZPJA 3ZHZA 4D41A 3PDUA 1UANA 4LI0A 1G5FA 1QHEA 3GX1A 4XD7D 3PJDA 3MQ2A 4FTWA 2NZXA 4JUAA 5EJGA 5EE5B 3V3KA 2RKWA 4EKDA 2ZSAA 3DB2A 4DV7B 1EBBA 1S7GA 1Z7BA 4G26A 3VH4A 3LCCA 3DYBA 4BQPA 3L49A 2YHSA 4RQTA 3KWMA 1BD4A 4HPWA 4QU8A 2IYFA 1Q6ZA 1XP5A 3G5AA 2QIOA 2V7QD 2J3IA 4CT4B 3CZRA 5K99A 2UXBB 4V38A 4AMGA 2RBKA 3V00A 3LZDA 2GF2A 1FVXA 1N5IA 4FEGA 4F0JA 4UHJA 2IZZA 1FNCA 1W59A 2QUZA 3ZHSA 4ZIRB 5JRDS 2VF7A 3GLGA 4CV3A 2IHBA 5EWMB 3R7FA 2D7DA 3KTDA 5HIKA 2PUJA 1WOYA 3GA5A 3ROEA 2B99A 2CVOA 3EZFA 3KV3O 1VCOA 1H93A 4DMRA 3GBPA 3GF4A 2D0DA 2ID8A 5BSWA 1UDAA 1RABA 5D3MB 2ZWMA 4HSEA 3STWA 1ZI8A 2ZJFA 1TZ2A 2ZDQA 3LO5A 4J2HA 2N0SA 4RVFA 2V8BA 2X8AA 1U65A 4UE6A 4OM8A 3TIVA 4C2AA 3KZXA 2YW9A 1SBQA 5I9SA 1C14A 2VP2A 4B7UA 1L9KA 4CCAA 2X76A 1Z5GA 3D4LA 1E32A 1WQ1R 1QB8A 1BXGB 5CFZA 1CCWA 1LS6A 4F9TA 2HGSA 1E89A 3CT4A 2I7DA 1HQCA 4FEYA 1BJRE 1V41E 2RGGA 4B4DA 5ITWA 5AVXA 4B32A 3TVTA 5DX1A 3U4QA 2HCFA 5K8VA 4W5QA 2HDOA 3DR3A 3VI3B 1L1EA 1PNQA 5G40A 3W5JA 1CZRA 3CG4A 1SCKA 4P4SB 4CM9A 2DU8A 2DBRA 3PQCA 2ACWA 3OHSX 4ARZB 1CF4A 2GEVA 3A7EA 5E6SA 1YWGO 3QHPA 2PMCA 4BV2A 3O7WA 3FNIA 5KWEA 1J2TA 1FL9A 5T3YA 1GTRA 5TPWB 4W5JA 5AI6A 4JXZA 4EL0A 4XDZA 5BWMA 5JWRA 4AUKA 3I0NA 3I52A 1QQ6A 2XTZA 1W36D 2V3CC 4Z1MD 2D7CA 1AH2A 3WNVA 1M3SA 1I4WA 3H1AA 4ZREA 3JYOA 3KQWA 3H4IA 3ITDA 3VKWA 4INZA 1JQDA 3Q0EA 4DLKA 5B58C 1HUQA 2QGNA 1T2NA 1YCDA 3E3OA 3Q98A 4MVJM 5JH7B 3VR3A 5JAPA 3C6QA 1O0CA 4CMEA 3NDJA 4QIHA 2B7BA 3SSOA 3AFNA 1A7JA 4P3OA 3PTZA 3NALA 3ES9A 2VHZA 1MIOB 2RJ3A 4J4HA 4RKWA 2HIMA 1TQ6A 3OIUA 3HJGA 5J63A 2MJLA 1TTTA 3GEBA 5A05A 1GPWB 1AF7A 2WF9A 2NU7B 2C2BA 2VJNA 4XIIA 4B8YA 1YI1A 3KR2A 2NMVA 2O5CA 1VJ0A 2C9OA 3FMOB 5TMPA 4LBVA 2F9FA 3GBSA 3LUGA 1EIWA 4FW8A 3LT1A 1KK1A 1NVFA 5H16A 1ZXBA 5ARBA 4D97A 2ZJ3A 2ZRQA 3MMNA 4JS0A 3PV0A 5CM8B 3WQHA 1TA9A 2CW5A 4KV7A 4I81A 5C2JB 1UBNA 3MMSA 5EXEA 2CJXA 3OLXA 3PGVA 4QGAA 3IBFA 4M7RA 3RF7A 2DFKB 2JH9A 4YGYA 2WSMA 1BFDA 3QOFA 4OD0A 4LPSA 4LQ4A 4LHSA 4YJGA 3DLHA 4TRNA 2R44A 3AZQA 2C4NA 1UT8A 3GIWA 5JZSA 3KQMA 1T9HA 5CHYA 5JPDA 3R5FA 3X1JA 3GN1A 2IT1A 4W1RA 3C3MA 3VNRA 3KR0A 1ZJ6A 1DP4A 3C5EA 3HCAA 4LS3A 4NBTA 2H00A 4UHHA 4DCGA 4B17A 3FPCA 3MWLA 2FPXA 2CKMA 4YCLA 2HNAA 2HTEA 1U0RA 5IM4A 1P80A 3HA5A 1NQWA 1I0IA 5FBRB 3DBHB 3BE5A 3NASA 1XL0A 3QIVA 4DLYA 1DAGA 1L5GB 4ZJUA 2EDCA 1OZ0A 4JN6B 1UXGA 4A0FA 3LHIA 4M1EA 4PYJA 1YR6A 5F3WB 1UMDA 1H9BA 1P3Y1 3MGCA 3L06A 4UAUA 1LQTA 4H1WA 2NO6A 5EJ9A 2RHWA 4ENVA 3FRIA 1VLMA 3A2MA 4UNSA 4QGGA 1NOKA 1XMSA 2XMZA 3IQWA 4KI0A 3CPSA 5CR9A 3AESB 4WK2B 2B2CA 1OZFA 3UFXA 4HNVA 1GPJA 1XVTA 5CXSA 1O1YA 4EAAA 4R9VA 4GOLD 3EEYA 5I7SA 1Z82A 5DGXA 4QDZA 2ZREA 3EZ9A 4IDHA 1XMJA 5IT0A 4QEZA 4YA6A 4YP6A 1Z0AA 4XEUA 3PPVA 4ND1A 3V2GA 2FWMX 2IYSA 4L8VA 5E7IA 2QENA 5B1IA 1IHYA 4JBWA 4OBWA 2FKAA 4J0GA 1FTYA 4L5CA 4DCPA 4UZEA 4B3XA 2QA5A 3UWPA 4KO4S 4KW7A 4A6PA 4HAUA 1NULA 1M2NA 4BJ1A 4HX2A 2FCAA 2R65A 3GD7A 4RIEA 3LXXA 1VSUA 2WTXA 4JL8A 4RD6A 1IUOA 2YDYA 5KTMA 4EM6A 2Z83A 2PKXA 3KVOA 4LECA 1CR2A 4UEQA 1OXSC 2Q3MA 2OV1A 2VWHA 2OXTA 1UADA 4FOSA 2IXFA 3ABZA 4K3VA 2NU7A 2UXCB 1Q5PA 1VE9A 1G16A 4JP5A 4YTEA 1DAKA 4UVHA 1NVTA 2PQ6A 2WVAA 5EZ6B 2R1TA 5CCDA 4E5UA 4LY0A 4G1UC 4WN9A 2C96A 1USWA 2G6TA 2XZPA 3W5IA 3OPYI 4M0FA 4F6RA 2GM5A 3WNQA 3KG2A 3GLIA 4AXBA 2J6HA 3HV2A 1EE2A 2IP1A 3DA8A 5IDWA 2I91A 3GQBB 4R8LA 2FPIB 4H6WA 4LSZA 1LWOA 1WCV1 2JKVA 5T8KC 3EXFA 1LI5A 2E4XA 3NBMA 2F7SA 4JFRA 1DTWB 4IG4A 4RYDA 3FWZA 3IEVA 3ZZTA 5I7WA 1R4NB 3SC6A 4JJEA 4YAEA 2ADMA 4YMIA 3MHTA 1OXMA 4MEBA 1NC1A 2GXAA 1WTAA 4N12A 3TZKA 3OEHA 3U7RA 4IOMA 5JAMA 3G5MA 3I2YX 2WSYB 2WSSD 1QFSA 3L0BA 4G36A 4L7VA 5AVOA 5FTMA 3DD5A 4BU1A 1OJLA 4HWTA 4RELA 3D7KA 4O4HF 1DEXA 4Y3UA 3IE1A 1PJAA 4CKZA 2W43A 1H2XA 2Q1SA 4F38A 3AG5A 1Z07A 1YB6A 4DJTA 3DVLA 4Y6PA 1OFHA 1RQPA 3L8CA 1YA8A 4WOPA 3RJ5A 3T1OA 1CWUA 1XTRA 3KD3A 1NI3A 1UTGA 1B1CA 2LDXA 4YQYA 5T5QA 3WIUA 1YK1A 3A8TA 3GZTB 4JLUA 4WDRA 3T41A 3H6GA 2XITA 4YO7A 1RBYA 2A1IA 2RGNC 3P20A 1L3BA 1ZCFA 2KJQA 4C29A 2PUBA 3U80A 2H4YA 1WSWA 2PD6A 2WLSA 1N5MA 4L4SA 3VYVA 1HNXB 4C07A 4EX7A 3I1JA 2QW0X 1UC5B 2UZAA 2RK6A 2EGHA 4CIBA 1JMYA 2WU8A 5E3IA 2HSDA 5DSZA 1MMFB 5F35A 4BLQA 4CKWA 2FJUA 3WISA 2ZITA 3LUJA 3PC8A 2EBWA 3TLBA 3O1LA 4HV4A 1YASA 3MF4A 2XUQA 1L5QA 3HJUA 4LYFA 3R76A 1J1IA 2Z8YA 3TI7A 3EZ7A 2BM8A 3VPFA 5DCLA 4AL4A 3KBBA 1IN7A 1R7RA 3W1EA 4WLNA 5HX7A 4AY4A 5HJEA 4BZQA 1H2FA 2X13A 1WP9A 4I9UA 2ZKLA 4ID9A 4ZD6A 3RBAA 1U28A 2CF6A 1I6LA 3T5GA 4CMKA 1X8KA 2BBSA 4LZWA 4F86A 2NSLA 3PVCA 5E1BA 4GXQA 1QVVA 3FYUA 3PX7A 1C7FA 1ZJZA 1ILWA 3NM6B 3VVMA 4S0ZA 4WZ6A 2HWXA 3VZPA 4JYAB 1KMHA 3FG9A 2J87A 2QDXA 1P9LA 1E0JA 2CLDX 4EH1A 1IATA 5FNVF 3TCKA 2EGGA 1K7CA 3PUHA 4PYOA 2OO5A 3C24A 3ICOA 3IP3A 1C3EA 3PCRB 4FONA 1G55A 5I45A 1BQEA 4HAZA 3MWJA 5LNK1 3FROA 3WWYA 1RHQA 4OGGA 3LK7A 1WVMA 1F2DA 4F1KA 1MTZA 3O9VA 3ROXA 3TPZA 4J3FA 3W8EA 4GS5A 2GCIA 1V5EA 3PFHA 4K9OA 3UB2A 4JI2B 4MV4A 3WXBA 4BGEA 3H2BA 5AKJA 3WJAA 5D85A 4EMUA 2RGRA 1J39A 1PTJA 1OIXA 4JWKA 3R5KA 4LOHA 3T3MB 5FUXA 3AGQA 4UUMA 1OIWA 2EOAA 2ZSFA 1G59A 5F5NA 3RFXA 5CDGA 2E1RA 4Q4JA 2JCVA 3UUFA 4M8LA 3JATA 4MX8A 4V3BA 3VHRA 1BH6A 5DNWA 2BFMA 2PUHA 2CJWB 4GMKA 5CW2A 5GJVC 2WJGA 3J7AC 3IKVA 1GG5A 4NV1A 1L4GA 3PZRA 2B4RO 3VOTA 3COSA 5K3FA 1NHWA 1WXIA 2ZM5A 1N1MA 5BXQC 1E9EA 2D6FA 2IYZA 2XCLA 2H48A 3LX8A 4R1SA 3IOMA 5DEOA 4JWTA 3LVFO 5ERYA 3S40A 5FB3A 4MJXA 5IW8A 1Z4JA 4URUR 1XX6A 5B2FA 2CHVA 5CFNA 3BHJA 2JZNA 2VZ0A 3WB2A 5TPZD 4DR4B 2IS1A 1Y3DE 2NPOA 1HDCA 2YXDA 4OLBA 5CCEA 5K0ZA 4AQ7A 1P5HA 1W36C 7REQB 2G9VA 2IXTA 4E21A 2NO0A 4YREA 3P96A 3SYTA 4AG3A 1QCDA 3JD1A 1AQ6A 1SXPA 1BRMA 2I4IA 4ZVKA 1DINA 1ZIOA 2C92A 2HJGA 2VJQA 2HI0A 4KXXA 4WECA 2X3YA 4GYJA 3K2EA 4IXTA 4Q5IA 2BE7A 1AA9A 2WV9A 2Q07A 3R0ZA 2O20A 1OFUA 3PT5A 4CUKA 1ZCAA 2C99A 4BBJA 1NDQA 4GVPA 3OCJA 4URHA 3DWGA 3VBEA 4LK2A 5HP4A 1EK6A 2EFDB 2ILTA 3JW8A 4UZFA 4TXNA 4EG3A 2G25A 4YRAA 1WJGA 2QDKA 3IUPA 3F6EX 3PNMA 4RJIA 4TSFD 5CT9A 1GLGA 2J5QA 5LP6B 3Q72A 4HH3C 5CP8A 2QRVB 4QNRA 4IHJB 4ZRDA 2XX3A 4W5RA 4C21A 3KJNA 3FSGA 3WHIA 3GLHB 3HKBA 2ORED 5CEEA 1L5RA 4F8EA 1D2CA 2YY7A 5L40A 3R23A 1ZA2A 2IDJA 1FLDA 1ZGGA 3L8MA 2QI9C 3DV0B 3PPXA 5ALPA 5FFMA 4EKIA 2OC4A 3FJYA 3GROA 2NWQA 5CA0A 2YV4A 5H3HA 2GHQA 3NBFA 4C0SA 4D4KA 4FFPA 2QUAA 1A8IA 4B7XA 2QT1A 3KJZA 2EYQA 1NVKA 2H1FA 4U7FA 4ZT3A 1RCUA 4CMBA 4JEUA 5KYYA 4WBSA 4P58A 5TXGA 5C5EA 3CSSA 4RJKA 5JJBA 2I1LA 2Q9BA 1G19A 2BBOA 2FWAA 5HIMA 4QLBA 4BQQA 5FV7A 3AOEC 4EA9A 1IG0A 3CB2A 1F1BA 1GY8A 1I10A 2IUUA 4MUIA 1VJDA 3RGGA 2CVHA 4WZAB 3ZUPA 1EWRA 1IXRC 1FVFA 5L7WA 2MMCA 2RGXA 1ZK2A 2GR9A 2UZ4A 1YRYE 4C78A 4WOKA 3OT4A 1DQZA 3NHJA 1DAOA 4IKPA 5DXJA 4DPLA 3BDIA 3KVYA 3LGSA 2P1DA 1WCYA 3FSRA 4KXVA 4NS1A 4OXKA 4PQGA 2B1RA 4BMPB 1E3DA 2FX5A 4JJAA 1JDBC 2J7PD 4IRUB 2RH9B 1KFKB 2XWBF 2QORA 1KY2A 4QC2A 4UQOA 4D56A 4KHZA 4BGVA 4KDCA 4BLPA 2GT1A 5DKFA 2I22A 3M1YA 4GPAA 4LF4B 1XDBA 5HTOA 1TB4A 1ZLYA 4EGAA 3TO5A 2I87A 2Q1YA 4U6SA 4AKTA 1NXPA 1L0BA 1N2CB 3QUAA 4KO3S 1QDLB 4BRUA 3N6XA 2WHPA 1JHOA 1AVTA 4CLDA 3BB3A 4U8GA 1E9CA 3GRPA 4Z4IA 3EPRA 1EX1A 3JVVA 3OKCA 2R7AA 2P2LA 4IQ4A 4OJKA 2WVJA 3UK7A 4ALKA 2QRZA 2FXIA 2M32A 3BH0A 3SBOA 3WAJA 1VE1A 3DE6X 4HRVA 4PWYA 1JLLA 1R0RE 1WQ3A 1R6AA 4O0LA 5KNDH 1P6UA 1OTYA 2YX1A 3C41J 4GGPA 1CPYA 2GBCA 2F3QA 3NUGA 3UWSA 4F2HA 3OOEA 5CFLA 4I99A 4I1IA 2WZDA 1BVUA 1CU1A 1MB9A 2L2QA 2G1JA 2CLHB 3QNMA 4ZRMA 3S44A 2OE2A 1DAMA 1TF5A 1AHIA 3DNMA 2WI8A 2ISCA 4GOKA 4TLBA 2MSCB 4RO0A 3FYCA 4ABYA 4BU0A 4Z9BA 2FK8A 5DH9A 4QQNA 2YZNA 3IMEA 4O2BB 4AS1A 2NO7A 1KJZA 2YDXA 1OQAA 4HQFA 4Z4GA 5F64A 4LVUA 3FTFA 4QD3A 1RC8A 4BMSA 1Q7TA 3ET4A 4AZSA 4Z4CA 3MAGA 3SYRA 3QW2A 2Y27A 3GI1A 1NYRA 5ANRB 4B3BA 3BTOA 2NQTA 4REQB 1LW6E 2VH5R 3JD3A 1NTOA 4TS1A 1JMKC 4ARVA 1M1YE 3AR5A 1Y5NA 2OMKA 2VP9A 4YAFA 4KQEA 5EUCA 2W7TA 5EXDA 3S55A 3WNBA 4E2FA 2KW5A 2AS0A 3LDUA 4AIRA 1F3OA 4KC0A 1JHYA 4TYPA 2Z4RA 1H65A 2C00A 4MKIA 4DV0B 1XZQA 1E4EA 4XYGA 5DGCA 5EMLA 4UU1A 2Z04A 2YZMA 3I45A 2JJ2D 4NOKA 2A7QA 4E88A 1BQ4A 3TAHA 3CY6A 2PWZA 2JFUA 1SBCA 2PAAA 1XJCA 3IB3A 3R41A 2VXCA 4MUGA 3UT5B 5JECA 4K7JA 3UMGA 4KE8A 2RHHA 3QA9A 4EJMA 3SF0A 3UHPA 4X9XA 4NDZA 3DW3X 2ZYHA 1E58A 2VF4X 2WU4A 2XRYA 4XDYA 5FOTA 1PJ2A 3OE7D 1Q0TA 2NVUB 2XKKA 3GP8A 1K3TA 1MO2A 3LBNA 3NHZA 5D6OA 1OXXK 3JPWA 4IJUA 1C7IA 2CD9A 1RYMA 2NUAB 3RSLA 1Y6QA 1U0FA 3L0YA 5JXHA 1K66A 3UMRA 3PLAE 2EF0A 3KZKA 3DMFA 1GGJA 1BHJA 3NBUA 1IRIA 4MUJA 4LF5B 1EGMB 1DAFA 5GGXA 2PA3A 1DX9A 4DXAA 1ECJA 1Y63A 4CU2A 2FMHA 1MP0A 5AXDA 3AB8A 2V7PA 4KQJA 1TMOA 4GT1A 3HEAA 1G20E 4JLAA 2PH5A 2QQ5A 4I1UA 4XSVA 1GKYA 2DHDA 4N47A 3R7DA 3NBYC 3NPAA 3ETCA 3GAZA 4OHZA 1XZPA 4LJ7A 4CT5A 1DOZA 2H5IA 3IO3A 4DNXA 4B3TB 1OI7A 3T9BA 1IXSB 1JG6A 3NHRA 4WK0B 1TKCA 3ZQKA 2H54A 5BUSA 3SQMA 5I5EA 1SOWA 2YXBA 2G4LA 2HUPA 3DBHA 2FW9A 1VPTA 2VSQA 2ODEA 3PI7A 2R00C 3CUTA 3JWJA 3D8RA 4ZYUA 1IONA 4DIUA 2YHUA 1CEQA 1RZ3A 1YS7A 3ENVA 3P9RA 4YALA 3SX2A 1TUBA 4CM3A 3WLNA 2V65A 1M8FA 1S2DA 1ZPDA 1YJBA 3EAFA 3T5DA 3NAGA 1K9SA 1KYYA 3EIQA 3ZZUA 3W2EA 5AIAA 2FSUA 4H3KB 2BDUA 3OLVA 1YDFA 1W4LA 2XOEA 4N7BA 3SC3A 3HCEA 4RJLA 4HXYA 4K40A 4W6QA 1JQJC 4M9XA 3JALA 1PEKE 5EG5A 2PY6A 3MIIA 4F4UA 2C61A 1Y8AA 1NM5C 4BN5A 3D6NB 3DE4X 3GVHA 4PIVA 2FW1A 4YQZA 4D6YA 4PC3A 2BJVA 4BJ3A 4QOIA 1C80A 1VJCA 2W83A 3T5PA 1XLVA 4L08A 4YUXA 4IEFB 2FN9A 2H4WA 5JNTA 5TV2A 3T3GA 5L6MB 2I3ZA 1D4OA 3VPGA 1JR3A 4Y2HA 3IP9A 2EBUA 1G4UR 2V6IA 3RBVA 2XE8A 3EF3A 4GQAA 3VVLA 4PXAA 1QRUA 2GK6A 2GFIA 4BKPA 2GPJA 1CE8A 3NWEA 3RTBA 4BLRA 5KOHA 3B20A 3Q3JB 4HO1X 4F85A 1PX0A 3LG2A 2H2WA 3BXGA 2BT4A 1B8OA 3OQ6A 2WT4A 1N2OA 3DKPA 2GZAA 4D02A 7MHTA 4QVGA 4I9FA 1RYDA 4EB8A 1ORHA 3TDNA 1Y9DA 1S2NA 5LA6B 1NF9A 5TQ2A 4ZOLF 4ZTZB 4JSTA 3N87A 1V5IA 1PGPA 1AGXA 4DRXA 1N32B 4JBYA 1HDEA 4ZI7B 4IXDA 3BWYA 5DSTA 3S3TA 3MEQA 3AVOA 2GI4A 1GAXA 4F71A 4S12A 1ZN7A 4LYHA 2VIIA 3NEAA 3D3NA 4WCVA 4I4TA 1FP4B 1VIYA 2OESA 5MFPA 1E7YA 1DQSA 5K0NA 3C15C 3V8VA 1YFKA 3HU5A 3TFQA 4XTRA 1W94A 2I1VB 3H99A 2ERCA 2QMYA 2O8EB 2V74B 1ZL0A 1RM4A 1F6WA 2I1WA 3IEIA 3X43A 3C7KA 2WB4A 3A70A 3LZ6A 4KI7A 2WLTA 3RUEA 3ZC3A 4NHEA 3JVUA 4ITVA 1P5FA 3DZDA 1H4VB 1YRHA 4JC5A 5EQJB 5JYEA 4XCXA 1SXGA 3SLRA 3T1TA 5D86A 3D7SA 4IKOA 3KSAC 4NDAA 2FZCA 1SOMA 2JB9A 3W4JA 1ADCA 1O5IA 2O7RA 4M8NE 3TOVA 3N3BC 1GQFA 1XRMA 1COWD 2ANBA 4J0HA 4N39A 2AFRA 4AYXA 3FPLA 4UAJA 1L5NA 3UJ3X 3LQQA 6REQB 3W9YA 3T1NA 3RC3A 2OCPA 2DSNA 2XA9A 4Q7QA 2P3QA 5IVIA 3IP7A 3N07A 2FGJA 5DFAA 2I66A 3PFBA 4W5HA 2FPLA 4N0MA 3LLMA 5DWQA 2Y6UA 3V55A 1M2JA 2AFHB 3AVVA 3GEPA 1EHCA 1T3SA 4ZZ1A 1DIGA 4V03A 3PE6A 1SVSA 4LW8A 2P65A 5LOVA 1IUKA 3GJSA 1N9KA 5F9FA 2B8EA 1FLVA 1Z68A 3MGKA 3LLCA 2BE9A 2IOFA 4DPMA 3DMYA 4FFDA 1ZH8A 3ZJYA 2HA7A 4C1NA 2PXAA 4EFDA 3HWX1 1PZMA 2YUTA 2HNBA 1R6VA 3T3NA 1W0KD 3F6BX 2COEA 3IHLA 1I3MA 5LZ7A 1J2RA 4WLUA 3RHFA 1SCUA 4P6VF 2QTFA 2CNNA 2WHQA 2JIBA 2XA2A 4JLKA 1EE9A 1UXHA 4UEOA 5FBZA 1GU1A 2VYVA 4DREA 2XGMA 3OQIA 4B2IA 4BX8A 3O7MA 3ZDQA 3TPFA 4ZVNA 1ACLA 1QHNA 2GTIA 2Y2UA 2JI6A 4OXXA 3PHGA 4P5PA 4RE6A 2ATCA 3ZWWA 4OXIA 3CO5A 2GN8A 4E5DA 2ZUWA 1NLYA 4C7VA 1INLA 4IXMA 5DF1A 1N1EA 1PJ3A 2AKYA 3LNTA 3NI2A 4YACA 1XCBA 4OQPA 4AF6A 4Z0TA 5HRAA 1SKMA 3WFJA 2QAGC 5EZYA 1MG5A 2PH1A 2FQXA 3DLPX 1JAXA 2RC6A 3SIRA 4O63O 3I6IA 5B58T 4DRXB 3REQB 2XYQA 4Z99A 3WK6A 2ZJ2A 5B7GA 1AGYA 1XD8A 2YWGA 5A4KA 1CULC 1HSOA 1XC7A 3O38A 1NPTO 2QV7A 3AEQB 5CLHA 3W5HA 4MW5A 2HA3A 4HFRA 4ZHSA 4U02A 1JU4A 1KK3A 2G63A 1SUDA 2IOQA 2V6MA 2VNIA 1R8QA 3RYTC 2O0JA 2HQRA 2Y92A 3HBLA 4EQZA 3ZE0B 1E9SA 1NIJA 3TW0A 3IPAA 5CB4B 1EJ6A 2WJ4A 4ACBA 3IEPA 5DHAA 5KNLA 4QBHA 3EMDA 5EIOA 3UMYA 3JQ9A 3L4JA 3S2FA 1RLJA 3QFRA 1ZIYA 2P8JA 3F7TA 1TM5E 2H17A 2IYEA 3G8CA 2G1PA 2ZZMA 4K03A 4ON9A 4A6EA 4JR0A 3UV7A 2ZI9A 1X1CA 4PE5B 4DQVA 3KWLA 1EFRD 4R2XA 1XROA 2CNWD 3MUEA 4OI4A 2GZSA 3RWMB 4XIGS 3SHVA 2WV7A 1TJPB 2HEIA 1U9YA 2QPOA 4AF8A 4BLUA 4MCHA 5KSZA 4YRSA 3PPWA 1L7DA 4HB2A 1K7EB 4L0MA 4QUAA 4TTSA 4UFOA 3V8QA 1KBQA 4Q00A 1NSFA 1A04A 4CYMA 5EUBA 4PG5A 2Y77A 4YJKA 4MCIA 2C0QA 3IR5A 1Y5RA 1PK9A 1J42A 2IU0A 1RDFA 4A7PA 4DLTA 2C5GA 1UJ4A 3GP5A 4B8ZA 1VL6A 5ELXA 3QW4B 3FMPB 1XTIA 3WIOA 3FNGA 4MINA 1IBCA 1QLHA 3FBWA 4B6PA 1L3CA 2CUZA 2CXTA 3OTHA 3WDSA 5C8YB 1AB6A 5LWQA 4BMDA 2ZXUA 4MS4B 1ODJA 1NZDA 3EC1A 3LLSA 3A1TA 1D4FA 2PX0A 1A8SA 1G8MA 3PDWA 3W6NA 3F90A 4NAVA 4AP5A 4S1VA 2R7KA 2JLQA 4L6AA 4XASA 5TQ0B 1MH9A 1RZRD 2FSFA 1NC3A 1W8DA 4OI0A 4FNGA 2F8TA 4JGIA 2H2AA 4D4JA 7REQA 1KDRA 1N6OA 1AO3A 2DBVO 2NSJA 1ZWLA 3NNNA 2RIRA 2BLLA 2W58A 1G8JA 3PSAA 3DTYA 4GNKA 2OO3A 3O47A 3RS7A 1ZR4A 1CZLA 4BNUA 4ZJZA 2WIKA 3TJZA 5E4FA 2QUKA 3RVMA 1P7CA 3EXG1 3BCUA 4DLZA 3EPPA 1JA9A 4IQ0A 3UQYS 4C76A 1QPZA 2PT6A 3GNSA 3EBPA 2IHZA 3JWEA 4K05A 2RFLA 3EZYA 4M4SA 3ME5A 3P7MA 5H3CA 4E31A 4NBWA 4QM7A 1NWCA 1WW2A 4ENUA 2WM3A 3EW7A 3R3YA 2IF0A 3LC2O 1GL7A 2O0HA 1E4YA 1OTXA 3ORRA 4HNQA 1FFEA 2I62A 3RUFA 3DZJA 2AYYA 1FSFA 3PHJA 3TQCA 1KERA 3HCBA 2PM8A 3PWKA 3U31A 3GLHE 3ZDEA 1JQ5A 3DE2X 4BLSA 5LR6A 1Y8RA 3ZGXA 2WKPA 4YP7A 5LDGA 3KUCA 1RIFA 5G0WA 3DFKA 2HPVA 4QEKA 3CWCA 4GW3A 3HPQA 2IUEA 3I34X 4Y1EA 4QSHA 4XEHA 4ZQHA 4RTNA 3EBOA 5HF5A 5DN6D 1N2IA 4WSOA 4OJMX 4P82A 3UB4A 5AUQA 3I2FA 5BSTA 2EJTA 3BMCA 2IYAA 3FCEA 3KFVA 4NBSA 3F47A 1S5PA 2BGTA 1W88A 1D0IA 4FSHA 2BGWA 4P0PB 4HSGA 4M36A 3PIDA 4QTTB 4MCJA 4Q9AA 1CUIA 1UOQA 3ZU2A 3JR3A 5CG1A 5TEVA 4A8JA 4GH5A 2WG0A 1R9NA 3W7BA 1RHMA 2PANA 2VYNA 4PLCA 3RYHA 5JR3A 1BDJA 4NG4A 2ODPA 4Q4HB 2BC9A 3T3HA 5EMKA 3KQYA 3QKSB 4EG0A 3M4XA 4FI3C 4UU0A 5K8LA 1T2VA 1MDBA 3DMHA 4OHFA 4ZQBA 1EUCA 2EWMA 2FMTA 3P1JA 1C0KA 1W47A 3TZHA 1Z4KA 3HXTA 1D2EA 2QR3A 1LA2A 3W0LB 2VJAA 1J33A 1KSHA 4DLRA 4LSMA 3K0CC 1PJCA 2NXJA 3UJAA 1MOSA 3VXKA 5C4IA 4G0MA 1OBFO 4CLEA 5JEEA 4CR8A 2RE8A 1BA2A 4HHEA 1IPHA 2R86A 1UFQA 3DF7A 3IOEA 3IVRA 3I58A 3QVGA 2CMHA 1VXOA 5M7EA 3OD5A 1E1RD 3VC1A 4UM8B 3ILYA 4UDYX 5E6SB 1EMDA 1IAVA 3D4NA 5LYJB 1NSYA 1X9HA 3G8YA 2VH1A 1B6SA 1CJKC 4AFNA 5BORA 1ZVKA 3HUUA 1CRPA 2OG2A 3QXSA 2CV0A 3KTAA 1LVHA 4L7QA 4FDUA 4IRXA 4L22A 3TNYA 2AXEA 2B8NA 3T35A 3AEYA 4M1SA 5EHXA 4NYMQ 2BFBB 1X9IA 1V6SA 5F52A 4W1QA 4WNAB 1XJ0A 1XO1A 5BSEA 2P5TB 4JMPA 4Y2SA 3GT0A 3IDQA 3EPJA 1AXEA 5JEDA 2QX6A 1Y3BE 1ZW1A 1J20A 2GH1A 3E3MA 3NWJA 4UD6A 3K31A 5GADl 2X6TA 2YMLA 2ZIXB 4RH0A 4KAJA 3SBDA 3ONFA 2WFZA 2XMPA 4ITRC 4DG9A 4EK9A 4AULA 1Z5UA 3E58A 1DBVO 2XUGA 4KACA 4G0YA 4Y6OA 4DEYA 3TTSA 4XI9A 3CISA 5AOVA 3ZJVA 2QQEA 2Y67A 2AJBA 3KQQA 3JQBA 3KSDO 3K05A 2VYFA 2IYXA 5DYYA 2FFJA 2F3RA 2INGX 2ZRMA 4NYMR 4X62B 5A0VA 3G7SA 1LRJA 3PTAA 1ULBA 1XXHE 4K9RA 3KT6A 3B85A 2G72A 4Y0AA 2W2LA 4X91A 1KP9A 4LWPA 3LRPA 1GG8A 5K45A 2JK0A 1M1YB 5KUTA 3SSAA 3RH0A 4DR7B 3QUSA 1M7GA 3MGBA 4KQFA 4PYRA 1IHPA 3TNFA 1JTEA 4UE3S 3OFJA 3MAJA 4N3AA 1NVGA 2GPWA 3OTIA 1D04A 3W78A 4M49A 1XE3A 4MKZA 5H0IA 3HXQA 3C3KA 3G2QA 1PZEA 2WUVA 3MNFA 1A9QA 2B82A 5KINB 1UM9B 2GERA 4LWZA 1MOQA 3UH1A 4DR3B 2PSFA 2G9QA 3BOSA 4CM1A 3KQOA 1OTHA 1ZUIA 1RKVA 3BTSA 4W63A 4DY4A 3EPKA 1U0JA 4P0TA 1JIUA 2JGAA 4LJLA 3OOYA 1KKMA 1MN6A 2XSZA 2F2TA 2JJ1D 4W82A 3QE4A 1JG4A 1DUVG 5JCXA 4B83A 1RRGA 3LU1A 3TQOA 2V1UA 1CQJA 3CUUA 2TMGA 1FJHA 3CCCA 3OCYA 5E95A 5G2OA 3PFFA 5K6TA 1CY6A 4NCHA 2IS6A 3DHVA 3QUCA 4G97A 1MPXA 1FRZA 1KE2A 2CHQA 4RMHA 1SBZA 3WGOA 5LU9A 1PNRA 2H51A 4J7CA 2R0QC 3BDVA 2ECFA 3F8TA 3QK7A 3PFKA 3FYHA 2DYKA 4XFDA 2C0CA 2YHAA 3GCXA 3SJBA 1OIVA 3CWZA 4DA9A 3P32A 4PGHA 3C7CB 1YB7A 2Q2WA 4D45A 4BIMA 3HCOA 1R37A 2XTNA 1KEEB 3K0EA 2Q3HA 4G1BA 4G25A 3MGAA 4W9RA 1WO8A 4YR7A 5FPQA 4J0IA 1QVWA 1RXYA 1X7ZB 1H0RA 1F0KA 3WMGA 4C0KA 1M83A 2GK3A 1W2WB 2W9XA 4AVYA 4B43A 1XPOA 3TW8B 3S70A 2R6CA 3KUKA 2FEPA 1I01A 2ZIXA 2RCYA 3L79A 2OENG 3VZCA 3A9TA 3C1TA 1E2HA 4AJOA 4CVNA 3H2ZA 5DSXA 5IVPA 3AONB 3BWXA 1JEYB 3LPLA 1E2GA 1Q0UA 2AVDA 2GM3A 2R7MA 4K0RA 3IQHX 3RSSA 3A04A 4HLUA 4MP6A 3CNLA 5MGBA 1D2AA 3AWDA 4MQEB 4Z7NB 2B1JA 3LQKA 5ALRA 5GMOA 2IYQA 2FPUA 1WB9A 1ZI9A 1A7UA 1RTKA 3DAYA 3GJYA 4OM7A 4ZIRA 3A3OA 1JZSA 3KAQA 1MHTA 4B4OA 3QQPA 2BHNA 3P5BA 4INOA 3CH4B 4OL9A 4TXJA 2G28A 5FQOA 3RVPA 1J7KA 3U39A 4YR9A 3EAQA 3GPIA 2M98A 3KR9A 5JAQA 3DLBA 4TTTS 1UBCA 4BN4A 3AOGA 4E5PA 3RM3A 3HHEA 2AOVA 2VHXA 4IEEA 4MJ3A 5LLSA 3S7TA 2ORYA 2ZSBA 3H5OA 4LVNA 1XDWA 1XZMA 1EI9A 2YJNA 1G3MA 3KE9A 4UASA 4PSAA 3PFNA 1EG2A 4A8HA 2HR1A 1FXWF 4GLLA 2XUKA 3LKDA 3QY0A 1SJ9A 2ZUCA 4JYPA 1L8AA 4PO8A 3I28A 3TTYA 3UICA 5DNUA 1SXQA 2W5UA 1NV9A 1LKZA 3QXXA 1DRJA 2PUWA 1IDN1 4Y6RA 5FBWB 2OFWA 1IRXA 3LO8A 3HDJA 4IDFA 4KJZA 2WF8A 3FR7A 4OFWA 4EW6A 4FNOA 5IBRA 3OQMA 2JLSA 1JIIA 1E7SA 2WAOA 1DRUA 1JE1A 1XK7A 3IUMA 5TY0A 3WK8A 3OU2A 5IJ9A 4JUCA 1E5TA 1URPA 2PEYA 1RWOA 1XD2B 1ZL2A 1I4OA 2I33A 1X0XA 4OSEA 1QM5A 1T3TA 3ZDZB 4I5IA 3KOWA 4O4HB 1OPRA 4GLOA 3AF5A 3OFKA 4G0OA 3V8BA 4CBVA 1AS3A 3L93A 3PC4A 1JVNA 2QYHA 3GN2A 3P4YA 2D54A 2EP7A 4OSOA 4KPGA 4OJYA 4WY5A 2B94A 1SUFA 2BJWA 1U5AA 2O07A 2VUTA 4QHSA 1LTHR 13PKA 1XAIA 3VA7A 1RI4A 2OV4A 2FWPA 4PRYA 1PWHA 3T5AA 3VQTA 1YRQA 2IDMA 3WRVA 3I39X 1R6UA 5J1TB 3UUGA 3AEUA 3CHYA 3LOUA 3UC9A 4E5SA 2J85A 2I6UA 1QX3A 2JLWA 5GZ3A 3RU9A 5H68A 4FB5A 4MITA 1OVMA 1OLSA 1V9SA 4WT7A 5EGSA 2M6LA 3BD7A 3W2TA 4BNMA 4BMVA 3OPVA 4JLMA 3RC9A 2O23A 5F2OA 2QTVB 4KREA 2C03A 1K8RA 1UK8A 2B5OA 3FPAA 3LC7O 4P7BA 1WP4A 3QG5A 1X8LA 2BW0A 3R5JA 4NE2A 3I4LA 1F48A 1WXGA 1PQYA 1MX3A 2O8VA 3GV0A 2JEZA 4O1HA 5HG0A 4DSNA 2ZS7A 4A36A 4I5FA 3L7YA 5LOVB 1EU1A 4C06A 1RPAA 3L7LA 3Q3IA 2I2BA 3LKBA 1DEKA 1Y7PA 4XSHA 2JAPA 1UBLS 3LUKA 1CVIA 3KPJA 1UPFA 4N3CA 4YRJA 5TDHA 2VDLB 1Q44A 3CF6R 3U3KA 3ZV5A 4LCJA 2R11A 3SEQA 2IPMA 1IY2A 4R1PA 3NHAA 4B79A 3OWOA 5EP3A 4F3KA 1M6VB 1A2BA 1IH8A 2D06A 3SE0A 4PZPA 2HHJA 4LDRA 4KTVE 1YS4A 1S96A 1Y9JA 4GWLA 2C4MA 4W8GA 1PO7A 1OLXA 3BRWD 3ER8A 1KI9A 1UQTA 5L7TA 1PD1A 5DLYA 1MV5A 3OJEA 5EYPB 4K86A 1U99A 1MAWA 3G7NA 4BO3A 2YS6A 3OHPA 2ZPTX 1QSGA 4BEBA 5JROA 1Y37A 3EWAA 4I50F 4QNMA 3WRXC 4RW0A 4ENSA 2FZ4A 3MT9A 3U9SA 1SULA 4EGJA 1AKWA 2Z30A 1HG1A 2FCRA 3D6FA 3MB8A 3FMIA 3CH6A 1L7BA 1RWXA 2PK3A 2RGBA 4QATA 5K2OA 2Q5CA 1KEZA 3ANLA 3KCNA 1JRLA 2H31A 4MLCA 3V9PA 3GUUA 4EHJA 5BN5A 2XHZA 3QI7A 3G0GA 1SG6A 4PSCA 4YMTA 5ABPA 4GC5A 5CPBA 3N6RA 4Q01A 2JFWA 4FDLA 4PPGA 4X1IA 4X63A 1H0KA 3GNQA 3IURA 3VOBA 1J5EB 2JJ1A 3K4QA 4AU1A 4X00A 8ADHA 1LX7A 2UTGA 3V8RA 3D0OA 2Q4OA 1VGVA 1Z0UA 3GDGA 4FT2A 4JP2A 1XMPA 4KB5A 2WSBA 4PNHA 3CVWA 3N2GB 3EWNA 3AZPA 4M8SA 2EBHX 1N5DA 2M6SA 4G9EA 1NUSA 4P1ZA 3UJ9A 1XF1A 3VDMA 3Q5DA 5DI3B 1DL5A 4G65A 6ABPA 2P75A 2GO7A 3ON5A 3EB9A 4NYJQ 1M8PA 4UDNA 3FGPA 1JG3A 3IP6A 5EWLB 2QUBA 5JMTA 1B23P 4JUFA 2I4OA 3SG0A 1X80B 5IAEA 3LPMA 1JKIA 4WKGA 5SZJA 1LC0A 3SZ3A 1R5NA 1SBTA 4ANFA 1ES9A 3ED5A 3HV0A 3CRZA 3W8NA 3E8XA 4FD3A 1YDHA 3QWIA 5EJMA 1AKNA 2VZLA 4DHWA 2F9LA 2J3LA 5AI5A 1A9XB 1LNZA 2C29D 1PGQA 2PYDA 3L77A 3ODGA 4B9EA 1KYTA 1GPYA 2W6CX 1M6HA 4M83A 4MDHA 2CDNA 4CI9A 1M5RA 3PDHA 4B76A 2Q0XA 4PCAA 1YIDA 4NRDA 2BHSA 3BZBA 1BHO1 2WF7A 3E9QA 2W0SA 1QCCA 3LP8A 3B8HA 4MGIR 3I6QA 2PUFA 5ILQA 4GMDA 4OUDA 1IQRA 2WYIA 3O3NB 4IHJA 4HQOA 1HV8A 3FLBA 4POAA 4XQCA 4F5EA 1CW2B 1WOMA 1BX0A 4Y2QA 4RDIA 1THGA 3ANTA 3KEGA 4X41A 5ALMA 5AP9A 3UHFA 1M6VA 3B5EA 4FS8A 2WJVA 4HYTA 2A0UA 2CYAA 2VAWA 1GFSA 4O2AF 1YRAA 3O03A 2W00A 3PFIA 3TTTA 3JASA 4MLDA 4MUBA 1NGSA 1LVGA 4LC9A 1LDGA 4FBMA 3FUWA 2KE5A 5TGZA 5BR1A 1X7WA 3EIEA 2GEFA 4G81A 4OQQA 1ZJWA 1IOZA 1M10A 2AZDA 4RVHA 3RTAA 1DJMA 1XA4A 3OU6A 4FOPA 3EXIA 1WBJB 3GARA 4PSVA 2QVCA 2FX2A 2QZZA 3Q9LA 4KXUA 4PAOA 4ZODA 5G1NA 1HDRA 3UHOA 4BX0A 2AH5A 5JQGB 1EFVB 3I3OA 5JDIA 4CG1A 5BP7A 1EM8A 3UPUA 4L6CA 5CM2Z 4DC0A 4I66A 2AZTA 4N49A 1DADA 1HY3A 1FNSA 1J07A 1ZD4A 2XUOA 3MG9A 4FLFA 5DYTA 5GVRA 1NI4B 1VE7A 4YC7A 1U7HA 1ZAKA 5LP6F 1E96A 1IAQA 3O8BA 5BV1A 1CSEE 4G85A 3TKLA 3ZKAA 3CLRC 1KDOA 1B8VA 1ZD9A 2DT8A 1QE5A 1RI5A 1ZGZA 2ZUUA 5T67A 1KSJA 1ZHFA 2XE4A 3IVMA 3I23A 1IPFA 2PO5A 2ZSDA 2FJPA 3T3EA 3QRWA 3OT5A 5DVZA 1ZLXA 1KMCA 4MV7A 3S8EA 4CEHA 1NXQA 4CE6A 1OU4A 1BWPA 1RVDA 1TDJA 4IZOA 4MAAA 2DFDA 3EPHA 1Y1RA 3V80A 3QYPA 4N7JA 4NU8X 4KYTA 4WLFA 4TKVA 1AQUA 3LDAA 3TMYA 4KDFA 2FFBA 4FGJA 4RORA 4B4VA 4CCWA 4B3SB 2IELA 1WUYA 3R24A 1XR3A 5EN4A 4ZXPA 5ESXA 3KKEA 2PBFA 1PFKA 1L8XA 4IO1A 3TOSA 3FGZA 3QTBA 2X15A 1QYIA 5EWJB 5KNBA 4CT0A 1M34A 2GK7A 2ZAGA 1MB3A 1WLYA 1R0WA 2O7SA 1F06A 3PXGA 3RC1A 2I67A 3TQTA 2A1UB 1EXDA 1YCFA 2ZTHA 4R8SA 4Y2JA 4DCTA 4MV0A 4H7PA 3CVJA 2QZSA 5GJBA 3W5AA 1U3TA 3E82A 2GPYA 3KHUA 4RWEA 1R88A 3RUDA 1QLJA 4IUCS 4DYHA 3I2HA 4QU5A 1UBKS 421PA 1ISMA 5ENDA 5DE3A 4UREA 4U2EA 4QULA 3WZLA 5BRNA 1DBIA 3WNCA 1WHSB 3U40A 4I4NA 3L0OA 2YQZA 3TLKA 3X0DA 1AUOA 5LA6F 4EL5A 3IFSA 9GPBA 3ZGOA 1DIRA 2C7GA 2JCYA 1EGVB 2W8ZA 3ZBQA 1YBMA 4UTRA 1DC7A 2Q3CA 3A6GA 2EWWA 1D0VA 8LDHA 1IUPA 1NXXA 2R68A 3NDRA 1JHDA 3SYMA 4ARBA 2JASA 3D4BA 1FDSA 1GGFA 3AZOA 4G3XA 2UVDA 1L5LA 1CF2O 3A4IA 1ODFA 2RI0A 2C8KA 3QU2A 2ZROA 5JCJA 3J81A 3WIDA 1MNAA 1SC9A 4DY6A 4KNWA 3R0IA 1JECA 1OKKA 2IVZA 3U17A 3H86A 3CLKA 5I9MA 1P9NA 3OU7A 1K5PA 1H4TA 4GUDA 3OKFA 3RE1A 4XUGB 1G41A 1BD3A 1LBQA 4J0DA 1DIOB 3TLGA 1U2RA 4E12A 4F6LA 4RC9A 3VNAA 4J49A 4YLEA 4KIGA 3PNYA 2PT9A 3NNSA 4I5EA 4A2CA 4WFKA 5ULLA 3D6TB 2UUCB 1N75A 1YVEI 1D5CA 1G6Q1 1DX4A 4CN8A 1NYQA 5IPFA 3U62A 2BGGA 3JQCA 3FA2A 3DDNA 1C2YA 3KZOA 4IZHA 1ATZA 3ZLUA 1KJIA 2NUAA 3DZCA 3WYFA 1KYIA 1FUUA 3EUEA 1TLLA 2EP5A 1DG9A 2QTWB 2PS1A 3GCGA 4IIDA 4RXTA 5JSZA 4EBBA 1LBTA 4HDMA 3OC0A 2D1SA 2Q62A 1N6RA 1QPGA 3ZE2B 4DR1B 5HBGA 2C1EA 3GLFE 2QD1A 4N03A 2CCJA 2WY2D 1DKOA 2X0NA 2JZCA 3RCBA 2VHYA 3O82A 1VHDA 3WQQA 3BQ9A 5B2EA 2C77A 4MIOA 1PJQA 1FC0A 3DOCA 4BX3A 3GZNB 3L3BA 4RFSA 3I1FA 4H9GA 1G7RA 1UM9A 2WAXA 3ILXA 2ZRLA 3AL2A 1VBNA 4L1KA 1YL7A 3VJRA 2FTKE 4K46A 4RLSA 5DGIA 1CD5A 3W7VA 4O3MA 3EVDA 1ZM4A 3ZZ1A 5E8RA 1T5LA 4AMBA 3HSKA 3KOOA 5AXAA 3U4GA 4IUYA 4J1QA 1O94C 3HM9A 2A9OA 4HQ0A 2ZZKA 4OEHA 1KEVA 3E1SA 3OPYA 4MR8A 4AAYA 5JNWA 3Q3GE 1JMVA 1ZMRA 1JDSA 1N0HA 3FOEC 3HCPA 3VO9A 1DO8A 4IV0A 5E1OA 5DW0A 3ELBA 1WW3A 1VIAA 5H9VA 3HJHA 5E4TA 3UK1A 4FZ5A 3V48A 3JD0A 3RNOA 1IN4A 2XMQA 1QVRA 1CB7A 3RSCA 2Z1NA 1CRLA 1PJTA 1QHHA 3K6JA 4LE2A 4ND8B 5D2CA 2CHEA 1KBOA 3OZVA 3VVBA 3HYLA 5F23A 2RONA 3JWHA 4Y0VA 3V7WA 4BRZA 4WH0A 1ZRMA 2WM2A 3M4JA 4O25A 3PXEA 4LBWA 3RKRA 1UPXA 2KQUA 2YW2A 4G84A 1CHDA 1O9GA 5I7AA 4A03A 1HLGA 3C97A 2Q4DA 4PCUA 3ZOKA 3FKSA 1DMRA 3R5HA 4L3WA 3OPQA 1JHPA 2JCGA 2XGSA 1RP1A 3M6AA 4LJSA 1F1JA 3R3HA 4OHXA 5EINA 2DAPA 2VNAA 5IASA 2HTFA 5EE0A 1KQGA 1LLFA 5A9SA 5CLGA 2OXCA 5AHKA 3IHWA 3VZDA 2YFQA 3BRSA 3DVAB 1FTGA 2OSBA 5FLYA 3PC7A 1AE1A 3W3AD 3DLIA 3LHKA 4JJGA 1RE1A 4WOJA 3I5YA 4EGCB 1L8LA 1RFLA 3VAZA 2GBIA 4RACA 4LXTA 5EMHA 6YASA 5AKYA 4F3TA 1Z6YA 2Y05A 3JQBC 2YRWA 4KOAA 1XQYA 2IXEA 2NO4A 3DL7A 3PYXA 4MVWA 1QDEA 3LC0A 3MBOA 1Y82A 2GKSA 4GFDA 4N48A 4LQCA 2PGNA 2B21A 4RADA 1Q91A 3BMNA 1UKZA 3UAWA 4FOLA 1NP3A 3ZI4A 2JVIA 3DXXA 3E7DA 3OZAA 4FDMA 3TJRA 3V42A 4XVCA 4DZRA 5B57C 5E9QA 1GR0A 1XF9A 4RVUA 5IC6A 3W2IA 2B30A 3QKRB 1E3WA 1QUEA 4U4AA 3U3MA 5LBUA 4QFMA 2X8WA 3DPIA 4GI7A 5CRIA 5A1JA 1OA1A 2B34A 4OSPA 4RHYA 4TWJA 4TVSA 4EZEA 2DF8A 5AM5A 4QARA 1YOVB 2AG1A 5ESDA 2VZ8A 3THRA 5H1YA 2CXPA 5JHHB 1VI2A 2YOHA 3ORSA 4KIFA 1UIRA 1T13A 4K81B 3DDWA 3GELA 4FNMA 2DPXA 3NATA 2C95A 1N6KA 4FYMA 5CA0F 2K2WA 4EKGA 2NP6A 1JDUA 2BHRA 5DNDA 2BVNA 1FS4A 4H15A 2VT3A 4RLHA 5FR1A 1XNQB 3M6XA 4EHIA 2XOKD 3PI6A 2BGIA 3TR6A 1QGYA 5JVDB 2V54A 1BROA 2JJQA 4FMDB 4X3CA 3ZU3A 3AETA 3ZHOA 4RGQA 1SVNA 4OXNA 4PYNA 2SKEA 5KOYA 1U9IA 2ZAOA 4D9HA 1SHLA 1LPBB 1NF3A 1V4NA 2JZOA 5KI6A 3V32A 4DL9A 2DECA 1ZNQO 2UZ1B 1XPRA 3UO8B 3JQAA 4FGWA 2BGUA 4JHLA 4US0R 4AJPA 3VMMA 4O2AB 2OG1A 2EL7A 1KJQA 5DCYA 1Q0QA 3HJAA 5LMCA 1QNLA 2VK1A 3U4IA 5CJ2A 2ETXA 3FGOA 1QGED 4U2CA 1UKVY 1BTOA 1YJ5A 3QEMA 2AW5A 2DT5A 2JGLA 2RAPA 3PEFA 2CE7A 4KQHA 4XJSA 4QXOA 3OJCA 4PXSA 3WHPA 3I2KA 3RTEA 5KQLA 2WYVA 3N7UA 1ZN8A 1EQAA 1GV0A 2RGEA 2EEZA 3ENKA 3GCWA 3OZTA 4ZOBA 1OHHD 4LYGA 4X0EA 2QUJA 1BRTA 1XWFA 3O4RA 4ZOCA 2HADA 4GPBA 1EFRA 1G98A 3HVJA 4FHEA 1YTLA 4H59A 4LNAA 2HU2A 3KUUA 1PR2A 2Q4BA 5DJ5A 5DGTA 5BV7A 3LPDA 3UJPA 1F4LA 1ZXXA 1H5QA 5SZIA 5A4FS 3ANNA 2PZGA 5DK6A 2Q1TA 4BP9A 3TUZC 1HI9A 2CL6X 2GJKA 4QQKA 4X8LA 5SZKB 1FK8A 1E5XA 2IPNA 1QGOA 4KK3A 2VCEA 1FFHA 2VKTA 2PR2A 3U09A 2QPLA 3K9FC 1MC1A 2CDBA 2EARA 2PMEA 5C8DA 2Y71A 4QOGA 2FFAA 3EHEA 4HQNA 1LD3A 1A7AA 5JQWA 3W3ZB 4HNTA 1Q1BA 1WTCA 2JCSA 2QK4A 5AWFC 3RSQA 5HFNA 3GPLA 3VZBA 4ASUD 4JJFA 2PS9A 4RGVA 3TNDA 1NYLA 1ZH4A 2HO5A 3VYRB 3P0JA 4O1IA 3WSWA 3I12A 2WUEA 1Q83A 1TUGA 3ZX5A 3EJ6A 4DDWA 2I6SA 4M9QA 3ZDCA 1M1NB 1N7HA 2HWKA 2C94A 3NB0A 3SYKA 2AXQA 4C9BA 4Y2UA 2XRZA 5A6SB 3LDGA 4BFWA 3ZTYA 1JGTA 3EXEB 1TX4B 2W70A 4FD2A 3LOPA 2O7QA 4JQSA 5TLSA 2A0XA 3L4KA 3OQHA 3K30A 1COWA 3I3SR 1GQRA 2XWSA 3JRWA 3NFRA 1HRKA 2CXNA 2HFKA 3LYUA 4KR9A 3SJZA 3THWA 1UBHS 2ZRGA 4QXMA 4MSUA 4U63A 2GXUA 3BWVA 1D2NA 2OQ2A 2Y0BA 2QRLA 3W6OA 1VBMA 2G8LA 1VA5A 4JA2A 1JVBA 2J9GA 3KKNA 4IIXA 1W44A 5CXXA 2P77A 2QT0A 3K09A 4ZV4A 1M5UA 4QECA 4AN0A 2VP4A 1BE6A 5KDOA 5BT9A 1SCBA 2ADOA 4MW0A 4H7HA 3LLUA 4XARA 2X0FA 8MHTA 3SU8A 4NK4A 1PV1A 3G9TA 4MRPA 2WJHA 3NBQA 3JYLA 1XELA 4GLFA 4MKHA 1XTBA 2ECKA 1OGYA 2GD2A 4IBOA 2V4ZA 5B1YA 4IMIB 4K87A 5L3ZA 1JQBA 4X1IB 1PSWA 2Z8XA 5F76A 4DE5A 2H5JA 4Y30A 3BAFA 2YWBA 5J5CA 5LKAA 3QEMB 2P6NA 4OK6A 3S6JA 3TIFA 4LRUA 2JFQA 4ZU3A 2PJUA 4TLCA 2Q3EA 1EX7A 3C3BA 2VPPA 1FSSA 4X1KB 4I1PA 3UKDA 2A86A 3WWCA 5JWOA 1TW2A 5LN1A 2OO7A 3D8TA 3RAEC 2M9MA 2P69A 5FPYA 1ZVMA 4OJQA 3IXLA 4H7KA 3GLQA 1U1EA 2KI5A 5I6DA 1K1EA 2PSJA 2AI3A 1YQTA 4C0LA 4MHTA 3IQEA 1NVMB 1LPAB 3CXRA 4FCCA 4IFIA 4RD4A 5KMGB 1Q1AA 4BWFB 3MQFA 3NGLA 3PGLA 4EATA 5CMLA 1HF3A 5D87A 2R97A 1XRNA 1UJ6A 4XYEA 4B3CA 4D9NA 2RGNA 3IPCA 4ND6A 3AJ8A 3QEKA 3BFVA 4RANA 4C5CA 5B7QA 5HXAA 1HC7A 1VCNA 1KSFX 3DBRA 4OXQA 5AVQA 1M2OB 3RYCA 3IUSA 2JNWA 3E8MA 4RUKA 2G04A 3K8OE 5JCJD 4EJSC 1PR4A 2G8NA 3B53X 4IIEA 4M46A 3ZS8A 1SHTX 3KFLA 2P90A 4QASA 3BQNB 1ENZA 2DX7A 4CLHA 3PRHA 1NUHA 2YIJA 4P7JA 5EXSA 5KREA 1X6VA 1O9HA 1OOEA 5B1HA 2WM9B 3QVKA 1I7NA 4BC0A 4OHMA 4CKEA 1C9NA 4TZ0A 2NUBA 3B5JA 1BMQA 1I8TA 2QM7A 3QE9Y 1Q2UA 3CF2A 2PUAA 1G21A 1S02A 2PUCA 3I61A 3M34A 2Q2OA 4BV9A 2WJ6A 1IEQA 3KJQA 1SWVA 1EUYA 1RYEA 4G0PA 4DXDA 3TXAA 1E1CA 3A4TA 4MS1B 5CCXA 3JU3A 3SF8A 5U4QA 1VLJA 2WTEA 4G23A 3G79A 5DTMA 2FRDC 4CW7A 1CY1A 1Z12A 3ZNNA 3KHKA 3REOA 4D8TA 2ENWA 3TQIA 2C59A 5HKAA 5LMZA 1A8PA 1PR3A 4I3FA 2EJBA 5KCMA 4LX0A 5J2UB 4ER0A 4BNHA 4NS4A 3SS9X 2XB6A 2AYZA 4JA0A 2H2DA 1R5BA 4A15A 2EYUA 2EW1A 2FN3A 4J1TC 2CJWA 3IJPA 4E11A 1WZ2A 2PQ2A 4MDFA 3ICCA 4XXHA 4N7MA 3GRZA 4WA8A 1SUAA 3U7GA 3FNBA 2PL3A 3IAS6 3SM9A 2FSGA 3O2NA 1L7RA 5E7MA 2REOA 2LIVA 1UOEA 1RLTA 3LK6A 2DWCA 5IZCC 4OBEA 5K3DA