2WJ6A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n- acetylanthranilate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj6A01
1ZD3A 3U0VA 3H2KA 1YAJA 1QZ3A 3W9UA 3JW8A 4DMKA 2IIVA 2HM7A 1QIGA 3G02A 3DKKA 1BEZA 5ALYA 5AKHA 3IVMA 5E4TA 1WPRA 4K6KA 5AM5A 1EK2A 4FFVA 3WWDA 3A70A 4JUIA 4W9RA 1BU8A 1U8EA 1LPBB 2HADA 5CH5A 2HIHA 2WJ3A 3LCRA 5HKBA 4EY7A 4FHZA 3KWFA 5JANA 1MO2A 5AK6A 3IURA 3WKEA 1K8QA 4K6GA 4B7ZA 5FXMA 3WQHA 3QM1A 4C01A 4ROTA 3T52A 1EHYA 3I2FA 2PSDA 5HQ3A 5LKAA 1FFDA 1XRRA 1UFOA 1IUNA 4JYPA 2XMBA 4MYSA 3JYHA 4UHDA 2WHPA 2V96A 5E2IA 3BJRA 2CBGA 4BCBA 4WFKA 5AHXA 4H7JA 3MUNA 1DX4A 5HFAA 1KU6A 5AIAA 1W6RA 2QUAA 4DMCA 1DWPA 1X70A 5ALNA 5A7GA 4UHBA 3I6YA 2JGEA 4F0JA 4UFNA 3C87A 1T2NA 4RPCA 1JKMA 2ROQA 1OCEA 4QDOA 2OQIA 3E3AA 3FSGA 2J4CA 5AKYA 5E4YA 1ZD5A 3I1YA 1EH5A 2XUGA 4Y2JA 4ZREA 1PV1A 1VLQA 3FOBA 1X2EA 2OCLA 4E15A 1ZGCA 1F0NA 3IUQA 2WFMA 1TCBA 4J7AA 1W1IA 5EGNA 2X8BA 1RWQA 4XIIA 1U2EA 1F0PA 3H18A 4IH4A 1TQHA 2Z8ZA 1YS1X 3DS8A 3ZWQA 3FNBA 3WKAA 1G4HA 1TRHA 2VATA 5A6VA 3WK5A 3BE8A 4FLEA 1TAHA 4GWLA 5T4EA 1FFAA 3DKRA 3BIWA 4ZGBA 5AM0A 2XT0A 1IZ7A 2GBFA 2Y1KA 3STTA 5ALVA 2XE4A 2HA6A 2JGFA 3WZMA 2HRRA 3ILSA 3SWWA 3WK6A 5HF6A 2C5FA 5AI9A 4M0MA 5C7YA 4H18A 1DU4A 1XZHA 2BCEA 5AKEA 4EZIA 1XQXA 3WYNA 4C6HA 5C8XA 4WFIA 4OB7A 1A8QA 1R3DA 2E3JA 5HZGA 1XQYA 2YXPX 2AJLI 5AK5A 3DCNA 3KD2A 3EQ8A 4BTVA 5AOCA 3HI4A 4DMHA 2QJWA 4B83A 3D7RA 2QM0A 4M0EA 3MGAA 3UUFA 1VE7A 3C6XA 4H7IA 2WTMA 4G4GA 3G0IA 1JT2A 5K5EA 4GDMA 2Z3ZA 1WB5A 1XKTA 4BC0A 1YR2A 3QMMA 1VKHA 4BE4A 3V9AA 3OPMA 2OGZA 2OGTA 5DYYA 3VDXA 5AKZA 1TCAA 5LZ7A 3G9TA 4PNZA 4TVKA 4X6XA 2DQZA 5K3FA 2ZYSA 1E89A 2XMRA 7YASA 5D6OA 2D0DA 5AP9A 2OXEA 4BZWA 1GKKA 4H0CA 5HF5A 5AK4A 3AILA 3BDIA 2VJBA 4U2EA 1XRPA 2VA9A 3FVRA 1IVYA 4DLNA 2DSNA 1JI3A 5C81A 4X92A 3H2JA 2PSJA 5FDFA 4HRYA 3GA7A 4EY6A 5IVDA 1XRLA 4B84A 1XZJA 2BGRA 1EDEA 3HABA 1AUOA 1UOOA 4GEGA 1AC5A 1BN7A 4YASA 4HS9A 4DYHA 5HKAA 5JAUA 4BP8A 2C7BA 3D3NA 2XMDA 3O4HA 2PKYX 1YA4A 1YASA 1UK8A 4AZ3A 1SC9A 2GZRA 3BWXA 4FNMA 1P0PA 1BEEA 1FFEA 2XMZA 2VJAA 3ICVA 1A8UA 1VJ5A 2NW6A 1XZIA 5AM2A 1H2ZA 1PJAA 3ED1A 4BC1A 4HRXA 2DR0A 2C4HA 3GROA 1YS2X 3R0VA 1WPXA 1H23A 1Q83A 2WIJA 3OM8A 1B41A 2XMGA 5AM3A 4H7DA 1ZICA 4V2IA 1E3QA 3M82A 2VQ6A 1XRMA 2WHRA 2XMCA 4UFPA 4I4CA 3E1GA 3WWEA 4WY8A 1LZLA 4BAZA 5ALZA 5AM1A 3QMVA 4GW3A 4B9EA 2XUPA 1D07A 1XZMA 2GYWA 2YASA 1CPYA 2PL5A 1SCQA 3TRDA 4EA6A 1WHSA 4FFWA 1HL7A 3HYSA 1XZDA 3ZLVA 3HZOA 3RM3A 4QLAA 5CT6A 2B20A 4X6YA 4EB0A 1UT6A 3WK4A 1N5MA 3AFIA 4MQMA 4CG3A 5ALMA 5AJHA 4F21A 1R50A 2BGNA 4PQEA 4UFOA 2RGUA 2GYUA 3AZQA 1THTA 1W75A 3W04A 2XQKA 3FCXA 1VXRA 3H0CA 2XUHA 4KAJA 1LPOA 1XRQA 4HZGA 4KEAA 3G9UA 4MWSA 3HJUA 4X00A 1R1DA 1UXOA 3I2GA 1J1IA 4Y2YA 4U2BA 5ALFA 1U65A 2XQJA 3H17A 3PUIA 3HC7A 4CFSA 4DTCA 3H2GA 3E4DA 3ANSA 1E8MA 3AINA 5JATA 1CVLA 2OCKA 3PF9A 4B85A 1LZKA 3CN7A 4DM7A 5I8PA 4Q3LA 1GPNA 1QIJA 3WWPA 2Z8XA 1JU3A 3FSGD 2WG1A 1WCYA 2HA4A 3WA7A 2AJ8A 3D2AA 4AXBA 3I6ZA 2XI4A 3DNMA 4LXIA 4FLMA 4ZXFA 3O9VA 1L7RA 1ISPA 1MX5A 3R41A 3GELA 5AIBA 5HF9A 3EF3A 1QJ4A 1GPKA 1YB6A 4B6GA 4P92A 3F8SA 1BN6A 2VT7A 5I9IA 1ETHA 5CXUA 4ZRDA 4J0DA 3SK0A 1YA8A 1W4LA 4J0JA 4GLBA 3G0DA 1N5RA 1QTRA 5K3BA 1BROA 2PM8A 2QR5A 1HKHA 1VA4A 2CUTA 2I3ZA 2OCGA 1BS9A 3RKSA 5CTAA 2Y6VA 5DNVA 4IO0A 1CQZA 5FPQA 4JH0A 3WI7A 4KAFA 3WL6A 3M3DA 1WOMA 4X7BA 4L3WA 3BDVA 5ALIA 1XQVA 3F96A 4I19A 4N5HX 3JWEA 1CUAA 5ISMA 2PU5A 2WIKA 1YCDA 1J2EA 5ALXA 3G0GA 4G4IA 2JGJA 4Q05A 1YAHA 1GQSA 4PF1A 3WJ2A 2B9VA 3WKDA 3IB3A 4C4YA 4ARAA 2PPLA 4LXGA 5F4ZA 1NX9A 5LZ4A 5JD5A 1XZAA 3VVMA 3BL8A 2HU5A 1FFBA 3R3ZA 1MJ5A 3FYTA 4E46A 4K2AA 3G0BA 4FNGA 4UPDA 4WY5A 1P0QA 1CFJA 2XMQA 3ESDA 3QZUA 3S8YA 2ZJ7A 1MN6A 1GPLA 4AX4A 3WK8A 4LYEA 1H22A 5FOQA 3O0DA 4QE3A 4G5XA 1ZI6A 4U2CA 1XZLA 2B61A 5JD4A 3WL7A 1MNQA 1ACLA 5AK3A 1CUSA 1UKAA 4QWMA 2V97A 3F97A 1ORWA 2DHCA 4JYMA 2BFNA 4ETWA 5AOBA 3IIIA 5CT4A 3I2HA 1DX6A 3AIMA 4P08A 1CUGA 1W52X 4G9GA 2DHEA 1VOTA 2Y6UA 3EIOA 2XUFA 1JMYA 4GHWA 2DQYA 1DQYA 1TKRA 1CUIA 5K3CA 2GBIA 3K6KA 4UBOA 1P0IA 1PFQA 4IQ4A 4GXNA 3AIOA 3C5VA 2V98A 2WFLA 4AMYA 1UKCA 5KWIA 3ESCA 1UK9A 3WMRA 3STUA 4KE7A 3IBTA 1XZKA 5EI5A 4DSAA 2X5XA 3F98A 5ALPA 4A16A 5AKLA 2QZPA 2H1IA 1LGYA 2QS9A 3B3QA 1EVQA 1TCCA 5JZ9A 4JEIA 3X3HA 1ZIXA 4CIAA 1R9MA 5AKIA 1QONA 5ALWA 4B0PA 2JBWA 3PUHA 2AJDA 1QGED 2ZYIA 5AM4A 5AKJA 2XLCA 1HPLA 3ANTA 4XJVA 2Y2UA 4X71A 1EDBA 2WTNA 5DTJA 3YASA 5ALQA 5A71A 1K63A 5HF8A 3QBJA 4BP9A 1GT6A 5D3KA 5C8ZA 1LPAB 3LP5A 3I2JA 1EX9A 1JJFA 2C5GA 2XUOA 4BVLA 1ZD4A 2WIDA 4UHHA 3AIKA 4RGYA 1N8SA 1SOMA 5HQ3B 1FFCA 1WB6A 3WL8A 5LZ5A 5EHNA 5EFZA 1QLWA 4DNOA 2ORYA 2PX6A 2WHPB 2Y2VA 3Q8WA 1LLFA 5FPPA 3WL5A 3TJMA 2XQIA 5FP0A 5A7HA 4X91A 5T4FA 4G8CA 5CT5A 1E66A 1ODCA 4PW0A 1L7QA 2WFLB 5LZ8A 1AGYA 2QJRA 1THGA 3L1HA 3NWOA 5D7BA 2WKWA 1QO9A 4DIUA 2PSEA 2DCMA 5FRDA 4X97A 5ALSA 2VEOA 4X85A 2WG0A 4KE6A 2ZVDA 4CG2A 2QVBA 3BF7A 1F6WA 4AB1A 1DTEA 5LLSA 4U2DA 3HXKA 1X2BA 1E8NA 3STYA 1XZCA 1T4MA 4BATA 3CCBA 4PO3X 4A5SA 4FBLA 4WJLA 4N8DA 4OYLA 5CBKA 5BOVA 5SYNA 1R4ZA 1O6GA 4HTAA 4ZI5A 5AICA 2VJCA 3L1JA 1XZEA 3WKCA 1UKBA 2OGSA 3VXKA 1L7AA 4OU4A 1CUVA 3QPAA 5K3DA 3FCYA 5EIAA 3WLAA 4BVJA 5A7FA 1MAHA 3D59A 1GZ7A 4LYDA 1EDDA 3DQZA 1O6FA 1SCKA 3WYDA 4GECA 4Y9SA 5AKGA 1UK7A 2WM2A 4G1FA 4ITVA 4Q3OA 3MVEA 3FYUA 4WFJA 2RONA 2Z5GA 1QIKA 3LIIA 1U4NA 2WSLA 3DL4A 2ONCA 1EK1A 4KACA 4UBNA 4QA9A 2XUAA 1CUWA 5HCUA 4UHCA 4C4ZA 4J0HA 4B9AA 4UHEA 4RE6A 1ODTC 2GZSA 5ALUA 1LBTA 3DEAA 4EY8A 5JARA 3HEAA 4Y2UA 4BB0A 4ZWNA 2R11A 5ALJA 5T4BA 4FLFA 5KWJA 5SYMA 1MT3A 1UOQA 4H7EA 5AOAA 3SC2A 1A88A 3RLIA 1E8DA 2JGIA 4X93A 2AXEA 3ZPXA 5EHZA 1BCSA 1CV2A 1OXMA 1M33A 1NU8A 1QO7A 4KJXA 5K3FB 3G8YA 5CXXA 5ALKA 3VJMA 5ALGA 1E5TA 1EXWA 4NZZA 3A2MA 5JAHA 3DJYA 3OOSA 4K5QA 3C6ZA 4UBKA 1Q84A 2VAXA 2QKYA 3VJKA 2HA7A 2XDWA 3QPCA 3G9XA 4E14A 2PUJA 2QOEA 1YSCA 2QUBA 3OTQA 3H2HA 5CMLA 4XVCA 3PFBA 1H2WA 4PV7A 4LXHA 4DNPA 2ACKA 2BAGA 5ALRA 2H7YA 2WLSA 2C0PA 4BBZA 4H7HA 5AKKA 4B81A 1JFRA 2HU7A 3TGLA 3DYVA 3P2MA 3FYUB 3UMJA 5IVKA 4FKBA 2P8SA 2WJ4A 3RK4A 3BJMA 4Y2VA 5AI0A 2CB9A 4N8EA 2OCIA 1MX1A 2G63A 3STXA 2ZJ6A 4GI1A 2HFJA 4PSDA 4KYVA 3PI6A 4OPMA 4L72A 1AURA 1KEZA 5KBYA 2HL6A 2JGMA 4HVTA 1A8SA 3D0KA 1ZGBA 2YH2A 4MEBA 1WHTA 3DLTA 4LHEA 3PE6A 3ZLTA 1GGVA 5DTIA 6YASA 4HXGA 5EIHA 3S2ZA 5ALTA 4CCYA 1XLVA 5JALA 3CN9A 4Q34A 4KE8A 5ALOA 5JASA 1IUPA 5A2GA 4FWBA 4C87A 3G7NA 3PDCA 3VISA 4W63A 3PF8A 4B80A 3FAKA 4A23A 4OUKX 2CZQA 4QLOA 2VJDA 1CUEA 3IUNA 5IKXA 1ACJA 5ALHA 4AQDA 3E0XA 4QWWA 1W76A 1HQDA 2J3DA 4Y2TA 4AN1A 1ZI9A 1MNAA 5FKJA 3CXUA 1QIEA 3ESAA 1RP1A 1TIBA 4BE9A 1CUUA 1MTZA 1HLGA 2PUHA 5K3EA 2ACEA 4H7FA 2HA2A 2HA3A 1QIHA 3R3VA 4PSUA 5FV4A 2OLEA 2CMFA 3FWHA 5HK8A 5ESRA 4UBLA 4AO6A 1XZFA 2WU3A 4IH9A 4BRSA 5ALDA 1UK6A 4KR0A 3KWJA 3L1IA 2XUJA 2FX5A 4KAAA 3EBLA 5KREA 5LP1A 4MWTA 1CQWA 4Q3KA 4QZVA 1FSSA 2OPHA 3C6YA 3R3WA 2ZYRA 2H7CA 3KXPA 1CUCA 5BWBA 3EQ7A 4UBJA 3WA6A 4H77A 2RHWA 1H2YA 1JU4A 3WJ1A 2WUEA 5C8VA 2FUKA 2XUIA 3QITA 4X3CA 2JF0A 3R3XA 4W1PA 3D4LA 4IH1A 5JD6A 4CCYB 2W22A 4DMFA 3STVA 3ZI7A 1LPSA 3M83A 2QXTA 5AI5A 2ES4A 1VZ3A 1BCRA 1XFDA 1DINA 1GXSA 3FBWA 3R3UA 4EY4A 1B6GA 4J03A 2PSHA 3FLEA 5AH0A 5AKXA 4B0OA 5I7UA 1VZ2A 2ZYHA 2J4FA 4OB8A 2C0QA 4AMZA 1VA5A 5YASA 2V9ZA 4B82A 4YX9A 1UWCA 1G42A 4BZZA 3AZPA 1XZGA 1N1MA 3FLAA 1LPMA 3O4JA 3AUKA 4BVKA 1MAAA 3O95A 1ZIYA 3IUJA 3BF8A 3TEJA 4C89A 3V48A 4LIPD 2O7RA 5FUMA 4PSCA 2AJBA 3BIXA 4AO7A 1YB7A 2HU8A 2WIFA 1C4XA 4N8SA 4J0CA 1GQRA 1QFSA 2BKLA 1A7UA 4FMPA 4AZ0A 4BTLA 3LLCA 1UZAA 1C7JA 3KDAA 4QDUA 1Y37A 3QH4A 2W6CX 4X6UA 1QOZA 1VXOA 2OAEA 2RI6A 1WB4A 2BJHA 4Y2RA 1SFRA 3D2CA 4BDTA 3NUZA 3FVTA 4O08A 4BCCA 2QMQA 2RIPA 1G66A 2CEKA 4Q82A 4OCZA 1QIMA 5JADA 5DNWA 4BYMA 1ZJ4A 1LNSA 3AZOA 4Y2QA 4JNCA 2G4LA 2YYSA 2VSQA 3HRHA 1ZOIA 4QNNA 2WJ6A 4BAGA 4MXDA 4EY5A 2HA0A 3C5WP 2XUDA 5DLPA 1DWQA 3I28A 3HSSA 1MX9A 1CEXA 5CH8A 1XRNA 4KRXA 3K9BA 4XWGA 3C6BA 3I6MA 1QIFA 5LIPA 3BXPA 5EIEA 5JZSA 1QFMA 5IVHA 2Q0XA 5CT8A 4FBMA 1CUXA 1K4YA 1JJBA 3O4IA 1XROA 4INZA 1IZ8A 4E11A 3DOHA 1AMNA 3PICA 4UUQA 2B4KA 2CJPA 2XQGA 3PFCA 1CUBA 1DWOA 1ODSA 5IVIA 2WG2A 4H35A 3ZLUA 1BRTA 2GYVA 1QIDA 2XQFA 1AZWA 4Y2PA 1TK3A 1VE6A 3A2NA 4F60A 5BWCA 3HACA 3IUMA 4D9JA 4FOLA 4MYDA 2JEYA 1XKLA 3C8DA 5DJ5A 3WIBA 5ALLA 4IHAA 2G5TA 3QPDA 3UUEA 4X95A 4C88A 5FLKA 4Z49A 5JAPA 1Y7HA 2XUKA 4L9AA 1P0MA 1R88A 2QXUA 3C8HA 2WIGA 1CR6A 5E4JA 2XB6A 2WQZA 5DYWA 3B5EA 4WDQA 4P93A 4H7KA 1CUDA 2BUBA 3F67A 1XLUA 2BUCA 4LKOA 3GBSA 1J06A 5EHQA 1QTIA 3A2LA 3R3YA 5DWDA 2JGKA 3IA2A 5LYYA 1AKNA 5JZBA 4AO8A 4MQLA 1EVEA 4CCWA 4ARBA 5BV7A 1DT3A 1MU0A 2IX9A 3MUOA 4OB6A 2PVSA 4C4XA 3K2IA 3Q0TA 1R9NA 2WUGA 3W06A 4HXEB 4RE5A 5JIBA 1EINA 1K6EA 2R8BA 3C45A 3AJAA 3OURA 4MJ3A 4TGLA 4UBIA 4XX1A 1XLWA 2HFKA 2D5LA 3G9ZA 1S8OA 1EB8A 3KOOA 4EHBA 5DYTA 2O7VA 4YPVA 1XZBA 3DDUA 4S0XA 3R40A 4KRYA 4WDRA 4EUSA 2OAGA 5CT9A 4Y7DA 4DGQA 2ZSIA 1RYYA 2FJ0A 3D5EA 4L0CA 3H1BA 4BCDA 2IITA 4EBBA 1UOPA 2VT6A 5LKRA 4OSEA 1ORVA 4OYYA 2EEPA 2X76A 1JMKC 1QE3A 4HAIA 1Q0RA 3W05A 1DT5A 3WZLA 2ECFA 3I2IA 2HHAA 3O9MA 2WHQA 4W1RA 2VF2A 3N2ZB 4NMWA 3FLBA 2K2QB 2C58A 1MPXA 2H9YA 2QRUA 4TPKA 3VKFA 1J07A 4ZV7A 3C70A 1QIIA 4I3FA 2XLBA 1NU6A 4N5IX 4HXFB 2WUFA 5AI6A 3DL7A 2RHTA 3WKBA 3H1AA 1C7IA 3V1KA 4BAUA 5K3AA 4U2GA 4X94A 2XUQA 2GBGA 4KE9A 2O2GA 3H04A 4NS4A 5CH3A 3WWOA 3D2BA 4Y2SA 3CCCA 4WCVA 2WU4A 2DFPA 1LPNA 3WWCA 3C43A 4RNCA 3U1TA 1IMJA 1AQLA 2I3DA 3OG9A 2O2HA 2O2IA 4ZV9A 2AJCA 2OG1A 2WILA 4Q1VA 3VVLA 4BRZA 1CUZA 1LBSA 5DNUA 2Z3WA 3N0TA 2RAUA 4J0KA 2I78A 3V1NA 1SCIA 5JAOA 4QDTA 3DD5A 4J3JA 2H7XA 3W2TA 2WUDA 3ZV7A 3V1MA 5AO9A 3WK7A 2VTVA 2OQVA 4AN0A 2EDCA 3H2IA 4M0FA 1EB9A 1K5PA 1LPPA 3FYUC 5J3JA 5CRIA 3QYJA 4DNFA 2BUAA 1CLEA 1I6WA 2JEZA 3G0CA 5H3HA 1Z68A 4QDXA 2PBLA 2EDAA 3QVMA 5CURA 3O4GA 4GBGA 3V1LA 3IDAA 4UBMA 2WFZA 3ESBA 5HK9A 1CUYA 2CKMA 4QDZA 4CG1A 3OC0A 1EA5A 1H2XA 2QT9A 4DSZA 1HBJA 1FJ2A 4W1QA 3RARA 3B12A 5CW2A 1ZD2P 1CRLA 4MEAA 1CIJA 4CIBA 3GFFA 1ZI8A 3H19A 2VAVA 5IH7A 1WM1A 5ALEA 2JGLA 5D3ZA 2LIPA 3NOXA 1CUFA 1BE0A 2HA5A 1G5FA 1DQZA 2PSFA 4P9NA 1USWA 5A62A 2G5PA 4G8BA 2J3QA 2HRQA 2XMSA 3I1IA 3ICWA 4X90A 5AI4A 3DOIA 3GZJA 4U2FA 1IUOA 1ZJ5A 2QTBA 4K6HA 3I2KA 3T4UA 3A6ZA 3NGMA 4G9EA 3SX4A 1JJIA 4W1SA 3LIPA 4BDSA 2PU7A 1KU0A 3WK9A 5LZ2A 2DHDA 2JIDA 1CUJA 1Q0ZA 3HLKA 4Y2XA 4J0IA 2ZSHA 3M81A 4F5ZA 2GBCA 3DYIA 4YK7A 4OD0A 3W9BA 5T4HA 4G4JA 1XQWA 1CUHA 3F9CA 1EI9A 4UHFA 1GKLA 4J0GA 3GUUA 2FJPA 3WIOA 2HDWA 2UZ0A 4OU5A 1AX9A 3VJLA 1HDEA 3IULA 5EHXA 4NVRA 3STWA 4CI9A 5HFNA 4QEKA 5AI8A 1OILA 3EQ9A 4G8DA 3LS2A 1F8UA 4FDMA 5JYCA 3KSRA 2ZJFA 4DNQA 4FTWA 1Y7IA 2I03A 5LZ9A 3QMWA
chains in the Genus database with same CATH superfamily
1ZD3A 1KQNA 3U0VA 3ODGA 1AHPA 4BFYA 3HN2A 4NPAA 5HBGA 3OEHA 4DR1B 5DPMA 3M6IA 1S2LA 1VJ1A 3WP1B 3FHTA 2CVQA 5EE3A 4EBFA 2HCFA 3DKKA 3JZFA 4NFSA 1Y6QA 2P0YA 2QRKA 2IP2A 1Z7WA 3IVMA 1MZPA 2B36A 1KBZA 1CZLA 1RMTA 4Q37A 3Q3VA 3DC7A 3QXCA 5CR9A 1NWCA 5E4TA 4AKSA 4D9MA 1J97A 4ZEMA 3DUFB 2H52A 3DE0X 4MIKA 4U7GA 5AM5A 3TX2A 5AW6A 1GNTA 1PEDA 3W8EA 4F11A 4MARA 4MULA 3V7WA 2BELA 1CY4A 3ZHRA 1E6UA 1WG8A 5L53A 2WM9B 1KOLA 4X65B 2C77A 2IHUA 4YI3A 5CH5A 4QOJA 2OORA 4M55A 5JFOA 4BIMA 4JSRA 2WJ3A 1AS2A 2VSXA 2VXOA 3GRAA 5HKBA 4YBZA 1RM3A 2GEJA 3O7MA 4KBGA 4FHZA 3KWFA 2YFKA 3E23A 4LSWA 1AN0A 3NP7A 1N0UA 3PQCA 2YZGA 5AK6A 1VLJA 2GX6A 1TU3A 1Z5WA 2VYNA 2Z4TA 4TTPA 4ZQCB 1S8AA 3B3AA 2JK1A 3HB1A 1LX7A 1N9KA 4FD2A 4B7ZA 5IFKA 4XKJA 2W8ZA 4N82A 1MT0A 3QM1A 4ROTA 3S5JA 1JQJC 1YTLA 3FTEA 2YKGA 5JU6A 2R1VB 1XRRA 1QFJA 5IKPA 4G0XA 1DG1G 4YMIA 2VHZA 3OY7A 1WXEA 3BHMA 4KH0A 2AZXA 3Q15C 4QPZA 3IAAA 3N5KA 3GJ0A 4JYPA 3CV3A 3OIDA 1UWVA 4FFMA 3TH5A 3OPYA 3PRYA 4RCZA 4FYMA 9ATCA 2FFQA 3FKJA 1T13A 5JSFA 3B9RA 3VZQA 2A0FA 1RKXA 4IG9A 1NVFA 1ONNA 1ZESA 5C31A 1LS6A 2V96A 3VZCA 5E2IA 1NMXA 4F38A 1ILEA 2NPFA 1S7GA 2ZBRA 3WGZA 3O3OB 5FYDA 4BCBA 4ZVMA 4WFKA 3SKYA 3NWBA 1ZM7A 4LSZA 5AHXA 3MUNA 4JA0A 1DX4A 5TC4A 5IZCA 2YWDA 4E2YA 3LG2A 2Z98A 3L43A 3TE7A 2G36A 1V6CA 1PR4A 3DOOA 1E3LA 3KFXA 4ARCA 5KU1A 2B30A 1BQ4A 1PVDA 1XJQA 3CVVA 1C3EA 3U81A 3GG9A 4GGMX 5BP7A 3LAWA 3OCWA 4C0SA 4LRQA 2OBLA 5A5EA 4P53A 4L4SA 5EESA 5F1PA 4W82A 1FLDA 1MQSA 1JKMA 3CRRA 2QR2A 3KBOA 5G1PA 1GZSA 3U7GA 1YZUA 2EWMA 2ROQA 1W36C 1UTRA 3GQBA 1Z2NX 4AU1A 3HFRA 2GOYA 4L76A 3FSGA 1LBHA 2VNIA 9GPBA 5GV7A 5E4YA 1W2WB 1RYZA 2CL6X 2Q1WA 3ZE8A 4AJ1A 2RGCA 4KREA 4C6RA 4Y2JA 4OBEA 4ZU1X 2XVZA 4AUEA 2PGIA 1VLQA 3FOBA 5LXTF 4PTZA 4D45A 1NSFA 4K26A 1NNI1 4BNKA 4RJTA 1VL1A 2AW3A 4RK7A 1WVIA 4M22A 2XVMA 1B73A 4XWYA 4NFLA 2Y1LA 1NZDA 3GX1A 4QFDA 4Q9DA 4R7GA 2ZTUA 3IERA 1F0NA 2KWIA 1BCRB 3IUQA 3QFHA 4FZRA 3IC5A 1UMDB 2SKDA 1TCBA 3C6MA 4J7AA 5K0SA 1YVDA 4FYPA 1CQJA 2EIHA 2JC3A 3LUPA 3LX4A 2PWZA 3ZWWA 3KQLA 1XSEA 2X8BA 3CC8A 2BH9A 3JATB 4PVCA 4QUIA 3W4IA 3BVPA 4FYKA 3OEED 3TZKA 2J6IA 2ON6A 4Z1MA 3ZK7A 4NR0A 2Q5JA 1L8XA 2R44A 1A9ZA 2WRZA 2ZT7A 2CVPA 5B53A 3WMXA 1A2BA 5DWQA 2W5UA 4GUAA 1XMOB 1OWLA 3VPHA 5FUXA 3CO0S 3T7KA 1R9GA 4YPOA 3AEXA 1NXPA 1TQHA 4Y9RA 4QRDA 2XD4A 1P6XA 2Z8ZA 3H87A 4BGUA 4OIFA 2GPWA 1YS1X 1RJGA 1UMBB 4DLLA 1KMHB 1RJWA 4HD8A 1R4NB 1FYFA 3ZKWA 2I2XB 2X9QA 1AY0A 4TRMA 2OE2A 2NGRA 4MMXB 1CNFA 5L3VA 4J2HA 4IDCA 1TRHA 2H8KA 3WB2A 1BSVA 4YCCA 4HDAA 2VO1A 3ZZ0A 1TAHA 3OM9A 1H5QA 5BMVF 3C5EA 2GRUA 4ZEVA 1Z0AA 2IKSA 3DNPA 3EDOA 1G20B 2A9QA 1EGMB 5CK5A 4L9WA 1CY1A 3LHFA 3FGZA 3OBBA 1Q0TA 2XGGA 4NBWA 1IM8A 3K9FC 2YVUA 1UXJA 3HDVA 3BIWA 2W6PA 4CM8B 4EUNA 4ZGBA 3IAEA 4JP3A 4DUZB 2MMGA 3STTA 5ALVA 5EJAA 3H99A 5DM70 1NP6A 3NTUA 5ANRB 3CEAA 1XMJA 1OFIA 2ZRJA 4J1NA 1W2HA 1F5NA 2IY7A 3GFOA 4B3XA 5EXEA 3ZDDA 4OMUA 1JW9B 4P82A 1XDZA 2NZWA 4PY2A 3AUFA 1S2OA 4G26A 3RUHA 3TZ6A 2F64A 4V0SA 1P45A 3Q12A 5JPDA 3ISJA 3LFUA 5REQB 2AFHA 1DJNA 3U13A 4TZKA 2RSLA 1GQQA 2NUTA 5C7YA 3OZVA 3GCZA 2HPHA 2IUSA 2IV7A 2NVUB 4AZ0B 3L6CA 3QE4A 1GZVA 2R7LA 4MPPA 1KMIY 4MR7B 4WERA 2X5JO 3TZLA 4C6HA 1OIXA 2FN4A 1FP4A 5C8XA 3CU5A 4OB7A 2E3JA 2RHHA 1IZ9A 2V65A 5IDQA 3COJA 1XQYA 2EV9A 4GBED 2X4LA 3JRWA 4ZYUA 1GYQA 2W2VA 5JHHB 5ILGA 3LDAA 4CV2A 5AK5A 5AJTA 4LGMA 4P86A 3KD2A 4TV8B 4JJEA 5J58A 1LCIA 5JRJA 3U7HB 3NQ41 1RYMA 3OX4A 5FUWA 2DPXA 3JQGB 4HWOA 2CNLA 5C4IA 2DWCA 3FOAA 4MV6A 5GTDA 1X1TA 2XCQA 2J41A 3HI4A 3K2EA 5HX7A 4IIDA 2REOA 4GPTA 1G7RA 1RWVA 2FJUA 1DVRA 3HPQA 2JBHA 3GGOA 1RJDA 2A33A 1EVKA 3I9NA 3MCTA 1FA9A 3NG1A 4LE1A 3UUFA 2EKDA 3ZWDA 4P4TA 1PL7A 2WTMA 4AF7A 4LWOA 2GLUA 3GXBA 5E7JA 3G0IA 2J1LA 4WKOA 1JT2A 2BEJA 3FN4A 3U4AA 3GP3A 4K9LA 4MZDA 1P8AA 1E3DA 1LVUA 3FMVA 2PQ2A 4MI3A 4YUVA 1WB5A 1XKTA 5F4BA 5HQTA 1YR2A 3FWNA 1LBIA 1MBZA 1PDVA 4Q4AA 1V26A 3OZDA 1YZLA 3AHCA 2D1FA 3C1TA 4I9NA 4UC0A 1IL0A 2JLWA 3RJ9A 4PZAA 5D5PA 4BNXA 4WACA 3P97A 3NXSA 5LQUA 1JG4A 4KQMA 4BL5A 1KEEB 4AMGA 2WK1A 1PG2A 5JNVA 2O1XA 4YRQA 1G2OA 1TZJA 1GCGA 1TO1E 2CKDA 3KVVA 3R5JA 3EG9B 1L5LA 4AS3A 5FAKA 2GCNA 4G37A 3SZUA 2C82A 3QJGA 4G5GA 3SJZA 4S1WA 3VDXA 4CM1A 3RRNA 2GZMA 4US1R 3K0AA 1BQ3A 3A1DA 3UXMA 3K8YA 3H5AA 1VCMA 4MQUA 3KQSA 5BSUA 1DEAA 4TVKA 1KAMA 2BSAA 4KN6A 2DGDA 4Q93A 4DCNA 1Y8ZA 2DQZA 4GOOD 5B12A 3JD2A 2QP9X 5KYVA 4B3GA 4MYHA 3GAMA 1E89A 4ARZB 1ZRHA 2H63A 3LQYA 4Q9HA 4J76A 1UBMS 4KBFA 5BN5B 3VUFA 4JVSB 4C0HA 1OSNA 3FVVA 2D0DA 1G8PA 3G3EA 2NQTA 3D6AA 3Q8KA 1GADO 2M9MA 2YWRA 3IV9A 1E1RA 2QMOA 4UULA 5KC8A 4KR9A 4Z4HA 3TFWA 2BPOA 1PK8A 1WUTA 2Q2WA 2ZE5A 5AK4A 2RK4A 3SDZA 4JJ7A 2I7CA 2VJBA 1T9BA 2C5AA 2HTFA 2QV0A 3R0IA 4LMRA 1NAHA 1GCOA 1JP7A 1XRPA 1S96A 2VA9A 4CMEA 4JEHA 5EPEA 1SB8A 1IVYA 3A26A 4ZC1A 1Z37A 3RSZA 2DSNA 2OD2A 2B2XA 4I8XA 3VMMA 1AA6A 5ELXA 1OF1A 4X92A 3H2JA 4FINA 4NYMQ 1PZGA 2I7TA 1H0SA 1XVIA 2FZCA 2SECE 2Z58A 3N8DA 4U4AA 3OLYA 5IVDA 1ZUHA 4JELA 3QW2A 3N2LA 4QG7A 1YD7A 3QF4B 2WAMA 3DEJA 5F23A 4B84A 2I1QA 4NDAA 4QGSA 3D6NB 2BGRA 3PT5A 1W47A 3ZWYA 5LXTA 2GXUA 2EBFX 2I4RA 3IO5A 3THRA 1KKUA 3U48A 4BFLA 5H80A 3GLGE 2HD4A 1BN7A 5L7TA 4GPD1 2O1WA 4Z99A 1K27A 3P27A 4HS9A 5DO9A 4DYHA 1W4BA 1LUAA 2CEAA 1NPYA 2ONZA 2C95A 5CLLA 2X86A 4DCCA 3DSRA 1JR3A 1MJGM 3OT1A 4BMXA 4D9NA 4EKNB 4UVGA 5EIWA 4CKYA 4OQZA 1YA4A 2ODPA 2IE0A 1UK8A 4BN0A 1OLSB 1SC9A 3OLWA 2ZXUA 1HI9A 4TTAA 5FUVA 1GARA 1QCDA 2GZRA 1GZDA 2PYZA 3BWXA 3DO6A 4FNMA 4ND5A 4YXWA 2FR8C 1F20A 4KDFA 2Z30A 1P0PA 4RF3A 5KHLB 1L9XA 1M6VB 4UOZA 4EYSA 2QMUA 3VNUA 4P3YA 2AUMA 2EHDA 3ICVA 3JXEA 2VTBA 4WUVA 2JFYA 2P6RA 3DTVB 3AU9A 1EQAA 1V8PA 3OM1A 1H2ZA 1PJAA 1P5ZB 2LP4Y 1TKCA 3Q7PA 3WGYA 2V0GA 1R8QA 4V1CA 3FNFA 4RETA 3ED1A 2GNOA 1I0LA 3VPGA 4UHKA 1FFYA 3P9CA 4V3CA 3W2IA 4Y0VA 4ZT5A 3UMBA 1M6YA 3UUWA 4PQFA 3NOVA 4X3OA 5BMVA 2RHCA 2ZAOA 3NPMA 3TRKA 3NKFA 1PR0A 4R16A 1D0IA 1H9AA 1H23A 1Q83A 3R3SA 1JBQA 2ZBDA 5DV9A 5U4XA 3C24A 1G8YA 1CQIB 4A7PA 4CQLA 1KRXA 2IYSA 2ZJOA 3LCUA 4RLHA 5LMZA 4QNMA 1L7EA 2C1XA 4MUJA 3QELA 3FFBA 1QX4A 4CTKA 1ZICA 2YBEA 3L7NA 4V2IA 4DLVA 2B3DA 3QTLA 4ENUA 5L6MB 1E3QA 2PXXA 3M82A 5AT1A 3TW4A 3DBHA 3A9WA 2ZUVA 3QX9A 4WI1A 4FCCA 4RVSA 4R0NA 1V7ZA 3IOCA 2YUIA 4L22A 2WMNB 1HTWA 4JUDX 4I4CA 1Q5PA 2I4IA 4BNGA 3ID6C 2JL1A 2Q1UA 1ISJA 4XGIA 4CM5A 4E2WA 5C37A 1Y5MA 3HUEA 2YWXA 4BAZA 6LDHA 4FHEA 4G01B 1F48A 2E5LB 2IHTA 4D8WA 2EKZA 3CNHA 1L5KA 1LJ8A 4HDRA 1JQ3A 1ULUA 5B57C 1IHPA 2XUPA 1BWQA 1B1AA 3ORQA 1CY2A 4FIDA 4NU5A 4LJKA 3GV0A 3MJFA 3OEHD 4HNQA 5IZ4A 3RGGA 4BLQA 1FRVA 4M4SA 1JLRA 4KDEA 1X8LA 2XPCA 5LR6A 1SCQA 2A5JA 4OJKA 1YDFA 3W2FA 3GC6A 4BKUA 1SVOA 1LDEA 1S2DA 2FB9A 3PU6A 4JK3A 1L4YA 4OHVA 4E5SA 4EP1A 3QFTA 4IVRA 2HMVA 2KMLA 4DJFC 2F3PA 4UUBA 1XZDA 3JZMA 4PICA 1J1UA 1QZTA 3AYZB 2CF6A 5FBLB 3RM3A 1YRAA 5LBTA 2L69A 4L8LA 5KVCA 4GSKA 2W48A 1X1EA 2HNAA 5CT6A 4TXNA 4V03A 1TUIA 2BEKA 1GQFA 2AMYA 1LV8A 3MINB 3B3FA 4EB0A 1PZNA 3T95A 1ZGHA 2QQFA 1G9SA 2FW8A 2VVTA 3V1YA 1UT6A 4JXXA 3S27A 1FYDA 3MIIA 1QK3A 2SCUA 4M8IA 3IQEA 3HB9A 4M9SA 5JPCA 1N2CE 4WVLA 4CEIB 3E6AA 4I1SA 5H8WA 4A91A 4YAEA 4MQMA 4CG3A 2IVFA 1DP4A 2HQOA 3N75A 3NH9A 3QBDA 5ALMA 2VYND 4KOEC 3T5BA 4KXNA 5AVVA 1WB9A 2C2ZA 4J16C 1U2ZA 5EMHA 5IAJA 2ZJ5A 5A04A 2RGUA 4YJFB 1PUXA 3WGOA 3PJGA 1E7YA 4QQFA 4OH1A 3O8BA 4IUBS 3Q7QA 2ZUFA 4NKRA 1P17A 4P35A 4CXMA 3QG1A 3COSA 1CZUA 4O59O 2XUHA 4KAJA 1IY0A 1QSGA 1X80B 2FF7A 2WP0A 3U4HA 4EQ6B 2AXQA 4G5FA 1WZ2A 4JBGA 2VHYA 3OZBA 3IH5A 4TVOA 4ML3A 3IDSA 4MWSA 4F7WA 4ZGWA 1TGYA 1M34E 4X00A 4WBNB 5C52B 1DRWA 2ODWA 4ZU3A 2WWHA 4TTQA 5HMLA 1SY7A 1YQQA 4U2BA 3B3GA 4RKRA 3T99A 1XJCA 4AY3A 3M9XA 4H1WA 3VYSB 3WLRA 4BWGA 4DFDA 3UMYA 3ZVNA 4W5NA 4Z7JA 2UYHA 3CJQA 2WB4A 3OI7A 2ZT5A 3D7KA 1UPBA 4MIEA 3WMEA 3ONDA 4RY0A 2QTVA 1OTYA 1DFIA 2N75A 1EM6A 3LTEA 4H7PA 4RJJA 1NV9A 1OQAA 4MVJM 1QR2A 3IAFA 4JDUA 4ALKA 2YW9A 1RTKA 2TYSB 3E81A 2GO7A 1TUBB 4HDCA 2OCKA 1EA7A 1F4VA 3EXIB 3L4SO 3N05A 4FYYA 4E32A 1SJ9A 4NSNA 4EKDA 2HWXA 3L4JA 4MZXA 3FFAA 4C4SA 7AT1A 2BGTA 1QDEA 2NAPA 1LWNA 3RVQA 1L3BA 1CDZA 1C1DB 3A7EA 1H3NA 2X77A 3W8FA 3ISVA 2GZ2A 2VAWA 1C7FA 4PAQA 3BJEA 1HYGA 5I8PA 2V5AA 2Z8XA 3FSGD 2WG1A 1BOFA 2P67A 2Z56A 3G85A 3WL4A 2QRZA 2XVYA 2AQIA 1TPYA 5ECWA 5A4KA 1YKFA 1FNMA 2AJ8A 2IODA 4EITA 1GFZA 1PW5A 1QHFA 1LV7A 1R6TA 1VMAA 2HDNB 2C8VA 2Q9AA 4AXBA 5I9BA 3M3HA 2O8EA 1AKYA 4BP3A 4FILA 1AZTA 3G2PA 4RPLA 5IM4F 3B8HA 3I6ZA 1B2LA 1FK8A 2O8VA 3K6RA 2A57A 4LXIA 4QDJA 5DVZA 1W87A 2CMKA 4YQEA 5A5GA 1EVIA 1Q3HA 1ZQ1A 2KW5A 1L7RA 3BQ9A 3O9VA 3HKBB 4Y1GA 5F2EA 2ZRLA 3Q9LA 4D25A 1IBSA 2C5BA 2OV1A 2XGMA 3KKZA 5J59A 1P7ZA 2Z2YA 1Q57A 3ZDYB 5HF9A 1RXUA 2X0RA 4U7TB 4YUYA 3PLAE 1KIAA 2E0IA 3UJ9A 1E0KA 3LUKA 4MAFA 4BLSA 2IDKA 4YP6A 5F5LA 4YAFA 1E2NA 4K03A 3UH1A 1V43A 2H5EA 4DDTA 3K9QO 1GQ2A 4ZGGA 1WHSB 1VDZA 3JQ7B 4OOFA 3LF1A 2GEFA 1T9CA 3BDAA 1QHXA 1KY4A 2B35A 1JHRA 2R6R1 3G68A 3W90A 4ZOBA 1L7OA 3SK0A 4FDVA 4DEVA 4NU0A 4BASA 3ZZUA 4NQZA 2IPLA 3DE5X 3HWRA 4XFJA 5FPKA 4ZALA 2D1RA 3QV1A 4DJ5X 3KSMA 1ORIA 3LLSA 3MJTA 4PE5B 4UHJA 4H6PA 4QVKA 4DCOA 3BJZA 3FJYA 3HB0A 4WBSA 4KR7A 3O1HB 4EHDA 3TAUA 2N1MA 2QRGA 2PM8A 4QELA 4K9NA 1V1MB 3TS1A 1FUKA 2OCGA 1HOTA 2FEXA 1SHZA 3I64A 2Y6VA 3SJ7A 2PJZA 2ARKA 1UWKA 2HF8A 1J0CA 5BO5A 3VNSA 3IFSA 2RC5A 3TDMA 3I4LA 4JH0A 3BE5A 2YIDA 3K92A 3OWXA 4YEDA 1P91A 4LMPA 1KE1A 4KQ9A 1WX1A 4KYUA 3OECA 3BEOA 1POXA 1JSZA 3DEZA 3COWA 1DC5A 4L3WA 1XL0A 2EF0A 4M0UA 1J23A 3WBBA 4JC4A 1D1SA 2H4ZA 2R3SA 1XQVA 2A9OA 2Z2ZA 1VHJA 4FWIB 2HMWA 4I19A 4L7QA 5IDWA 2Z09A 1ZINA 1HFKA 3AHGA 4NY1A 1UPAA 2PU5A 3OQBA 1GGEA 3MCVA 4GUDA 1D8AA 2CE7A 4IRMA 1FY2A 2EG5A 5GOZA 3PEYA 3UNXA 3TNDA 5KWEA 4QXAA 3OSZA 3IELA 2W4QA 4GL2A 4HV4A 4HBGA 4PF1A 1RXWA 3WJ2A 4JC0A 3KXDA 5IT9A 1JL3A 2QMYA 3NYQA 1TOAA 4RK1A 1J2YA 3AESA 2J46A 4YRDA 3DV0B 3WKDA 3PPYA 4HLCA 3B6IA 1N7HA 2BL4A 4ZIRA 3O73A 5F4ZA 3GUYA 2QL5A 4HUQA 4URVR 5J5VA 1KDVA 3WTBA 1NX9A 2YJZA 4WH0A 2F2TA 3ZV6A 1JPVA 1XZAA 1HO3A 5T41A 1BMTA 5CA1B 1P62B 4AUMA 3LY7A 5AYVA 1TK2A 1HQKA 2J9ZB 2ZUBA 4M38A 4DM4A 2OR3A 1PAUA 3R3ZA 2MYNA 2YNMC 2O0JA 2YC4C 3V4FA 4QNRA 2QVYX 2HJHA 2W2KA 4KN8A 1MJ5A 3BH7A 1KK2A 1W85B 1TZ2A 3FYTA 5CLJA 4K2AA 4HX5A 4YYEA 3G0BA 4MLDA 1UM9A 4XLTA 3RSFA 3EPKA 5A4JA 2PX2A 3GCXA 4OQNA 1Z6XA 4NZYA 2BFPA 4C21A 4WY5A 3KHTA 4N49A 5AWFC 1K66A 2I4OA 1MTOA 4A27A 1BKSB 5ED4A 3EH1A 4DR3B 2OUIA 2PGNA 1L4EA 3M4NA 1OV4A 1KKMA 2CE2X 1Z5GA 2EZUA 4BX2A 1Z83A 3ESDA 5L8VA 4RXUA 3S8YA 3ENZA 3TOXA 3Q8MA 4YJ3B 2PS9A 3SY8A 3ZNQA 5CFRA 4OYRA 1ENPA 1USGA 2Y99A 3BM5A 4TSRA 2WF6A 4V0NA 2K7ZA 3GN1A 5L4NA 1A9SA 5BWLA 1MN6A 1AK9A 3EAFA 1GPLA 1R4MA 2FZVA 3WVNA 1M67A 3WK8A 2V3VA 1DO2A 2JAOA 1TQ4A 4Q02A 3ZZNA 4DWJA 4DBZA 1MORA 3JQ9A 2R5NA 2ZWVA 4UM9D 4CHGA 3KOXA 1BHO1 4JLVA 5A4AA 3ZWKA 1CERA 2ZQ5A 1M6WA 2A7QA 3LGAA 4U2CA 5I8WA 5UKDA 3E3MA 4PIVA 2FMTA 1JECA 4W6QA 2J87A 1OXUA 4PYMA 1MNQA 1YC5A 2J5QA 2NU8A 5JD4A 1XMQB 5AK3A 2ZJZA 4CKBA 2XIJA 5DTRA 3U16A 3ETDA 1L2TA 2JKZA 1T26A 2Q41A 4MTLA 4O2AF 3U31A 3V4ZA 5ICCA 2Z6QA 3EQ6A 2ZE8A 4GAEA 1ORWA 3KELA 4GI2A 4EJMA 2CYAA 2DPLA 1H9CA 1E1RD 3MTIA 4R71A 4ZZ0A 2WNHA 4A0HA 4MWGA 3T9EA 1MFPA 5AOBA 3BOSA 3MQ2A 2ZYGA 3AV0B 3P5BA 4M9QA 4JLDA 5H3CA 5HFJA 3VHLB 1UC5B 1Y3DE 2JLZA 1ZMTA 2H1LA 4N0EA 1H2EA 1CUGA 2D62A 2O7SA 1W52X 2HMUA 4MUXA 3PEWA 5TS2A 2R66A 4HB2A 1CTQA 1G8KA 1NVUQ 1DO8A 4EMTA 1LDMA 3QKRB 3B2NA 3EIOA 4TKVA 2XUFA 4Z6KA 3I1JA 4GHWA 4LV6A 1TKRA 1YOBA 2B8NA 3FDJA 1RCUA 3IOBA 3IR5A 5DFAA 3JQAD 5F3RA 4G81A 3VHXA 3VX4A 1CUIA 5F35A 5JNSA 3VTAA 5CJPA 2GBIA 2XSZA 1R5OA 1A69A 1FLNA 3T5PA 4BECA 4WKNA 1BWPA 3TXXA 5IM4A 2IEYA 2ZIGA 1MV8A 4JJKA 2JAHA 1FSGA 2JANA 2RGNA 1Y3IA 1ES9A 1PW7A 3EVAA 3GAFA 1S1MA 3UQYS 1BQEA 2BONA 3WX0A 5BSHA 3OZAA 2HRCA 4O4HB 4L5BA 1C4WA 2V3WA 2FEKA 4PEVA 5ADWA 1Z0DA 2R47A 1DJMA 1X77A 4ZJPA 1DJLA 1JR3D 2AOXA 3OHPA 2B3TA 2ZIVB 3EFBA 1Y8QA 2V98A 1SZCA 2V55B 1H2FA 3A9TA 1WXGA 3D1VA 3IODA 1WNFA 3MIZA 3FRJA 4ZT3A 5KWIA 4Y30A 4FEEA 2MSEB 3BKWA 3STUA 3ZGLA 4GX0A 4YXWD 4TTVA 3IBTA 1WE2A 2A9RA 2XHZA 2FDCA 4FMBB 3RRMA 3WIDA 4DWVA 1FDWA 1XDWA 1DC6A 5BPFA 1DBQA 1UR5A 4EEZA 3D6HA 2O2EA 3AM4A 4XUEA 5EI5A 1P1FA 2OUKA 2C88A 4UOQA 1FTGA 3F98A 4QSMA 2JZCA 1Z38A 1K4KA 7ABPA 1GPWB 3PC6A 1TJNA 3EAQA 5AKLA 4ZCMA 2XKBA 4CDMA 2AXPA 3L7KA 1E62A 5EZQA 1QOQB 3TYXA 2H1IA 4MS4A 3NHLA 4QAJA 4EOGA 1C8VB 3JARB 3B3QA 4O4IF 3T0FA 4IP0A 5JZ9A 2VQDA 4YT8A 3X3HA 4V0ME 1WW2A 1G6KA 2XX3A 1R9MA 3RS5A 5AKIA 5AFSA 5B3KA 2ZSJA 1QONA 4OKSA 4RAQA 1XTBA 4GMFA 2JBWA 1K2VN 4GVPA 4ZARA 5MGNA 2O7QA 4YCSA 1TJ5A 2AJDA 3FNEA 1C1XA 4BBPA 1P9LA 3ZQUA 5SICE 1ZG3A 2PUDA 3MRVA 4TRNA 3TOSA 1T5IA 4NYIR 3SYLA 3EIWA 4RADA 3K8OE 5BR7A 3HSYA 4ANFA 4K46A 4R41A 3RVPA 3QVOA 4QUAA 4RA6A 5JDIA 1U2PA 4XJVA 3R9XB 1DI0A 4X71A 4TYWA 1I6KA 4MICA 4MW0A 1G59A 3I72A 1Z45A 1ZN8A 3QWAA 4QFBA 8ATCA 5ALQA 4RZHA 2UU9B 3WYEA 4WXHA 1VYUA 3KVYA 2FLVA 1JG3A 2HEGA 2EJCA 5FNZA 5FBVB 4Y6QA 4M49A 2QX9A 1P3DA 1ZXBA 2DFDA 1MB0A 3T3HA 1T2AA 1GT6A 4BP9A 2PXCA 1LPAB 1NQTA 1RRVA 3UXHA 3NBYC 2DB3A 3ZCUA 2JIQA 2F8SA 5EMJA 1GRCA 3UAGA 4C7OB 5G41A 1O7JA 2J3KA 4O2BB 3SR3A 3A2KA 5DHSA 2P27A 4HCJA 2AD1A 1VE9A 4RMHA 3A36A 1QG4A 2OB2A 4YFVA 1O95C 3CRNA 4UHHA 2Q3FA 3DNFA 1KOFA 3EZFA 3RHTA 2OGWA 1DARA 3ABOB 3B2EA 1RJFA 2A58A 1SOMA 1NXWA 5HQ3B 2NUAB 3CH6A 3A1SA 2VZ8A 4C0WA 2C84A 2X3UA 2VEDA 3USES 3WL8A 4NV1A 3ABIA 1W0CA 2OESA 1LTQA 3FXAA 5EHNA 2DUJA 2W2TA 4M0KA 4CQJA 1LEHA 3W6UA 4HGRA 1ZR2A 1QLWA 2Z0MA 4KXUA 1OA0A 4EJ0A 3LVQE 1OLUA 2ORYA 4HMPA 2ODAA 3QLVC 5KNBH 2IQ5A 5BWCA 2CXOA 5LDGA 2E4YA 1FXSA 5A5FA 5C51B 2VP5A 1UXGA 3IAHA 4LC9A 5DGIA 3JZAA 1AK1A 1GZ3A 1N5LA 2RHLA 2WHPB 4IZOA 3I5MA 3RIHA 1A96A 4Z54A 1P1RA 3ZX4A 3Q8WA 4Z7OB 1LLFA 5BORA 4ED9A 3PNBA 5JNLA 2D1TA 1ABBA 2XODA 1JSCA 2NYRA 2XQIA 3SQWA 4TL6A 3TSAA 4P98A 3H5TA 1NW3A 3SS7X 4EW6A 3OPQA 5K8UA 1YQDA 1DIRA 3AWIA 3HUFA 2G4VA 3PNMA 1E66A 2XCLA 3EFEA 4TLEA 4ZO8A 3SICE 3ZZMA 5I7OA 4PZLA 1AQJA 4R1LA 3QYPA 2CLOB 3RYHB 3ZOKA 2QN1A 1N0IA 5LZ8A 5THQA 1J9EA 2FRDC 1JYFA 1XCOA 3L1HA 4FX2A 5K0BA 2EW2A 4ZRMA 3ELUA 4I1UA 4DCMA 5SZHB 3CQ9A 6REQA 2P6UA 2OYRA 2DT5A 1GPBA 3UJ6A 4FEAA 5G0UA 4GR4A 1FSPA 1H0KA 2PSEA 2DCMA 5FPSA 4UTPA 2G9RA 2QRNA 2IU4A 4N40A 4V0KA 1WMFA 3QGMA 2VEOA 4HAOA 4PWYA 2V7EA 5HZKA 2EFGA 2HGZA 2ZVDA 3LI2A 5KDLA 5JW6A 4O2AA 5DE3A 5HZHA 1CR4A 4QX6A 3TNJA 1QQAA 2ZCJA 3BMCB 1ITZA 2V45A 4GZMA 1SUDA 3W3ZB 4YUWA 5D87A 1V41E 2CLEB 1OAOC 1SZDA 4J49A 2EZ9A 2JFNA 4HVLA 5LJLA 3Q98A 1MVOA 1XA0A 3IP6A 1YZFA 2QGFA 5CDHA 3KT0A 3AX6A 3DWIA 2FSVA 4RL4A 5ABPA 2KS6A 2CWWA 2QU7A 3P9QA 2NU6B 4MAAA 4CZ2A 1YJAA 4IS2A 4C5AA 4FSDA 3O8QB 4GIBA 4TKZA 4MVJP 1WSWA 3HXKA 2AK3A 1X2BA 1JBKA 5DB4A 1X7YA 1JEOA 2VUSA 3WXBA 3HPRA 1SWVA 4P54A 3GIDA 1XZCA 1CS4C 4LVCA 1T4MA 3NNDA 3EAGA 1MO6A 3O8CA 1U9CA 2WWIA 4HHEA 2YZ2A 3M34A 1ZRSA 5C1BA 5D3QA 3A4IA 3DZ8A 4NNOA 4XQ0A 4WJLA 2C78A 2QQ5A 1G1AA 2ASEA 3FOEC 1R4ZA 2A0YA 5JDCA 3C14C 1WLYA 1O6GA 2VNAA 3K1AB 3CLTD 4Y6GB 4WL0A 3ENVA 3UGQA 4IDQA 4B4KA 1EX6A 1U8CB 1YL7A 2OGSA 3EF1A 2CXPA 5AJVB 3SXUB 2ISQA 4U9HS 2IPMA 4ZMRA 2OYCA 3IBFA 4NPCA 3THWB 4BNDB 1NC3A 1T0JB 5JJKA 2UZAA 2YYAA 2PRYA 4YDQA 1U1FA 2P2NA 3EVDA 3O2SB 3WLMA 1KPHA 2WM8A 2ZE6A 5LL6P 1QE0A 3H84A 1AXRA 1UQTA 4N0PA 5IJXA 1KARA 1UC9A 1Z56C 4K05A 4P3XA 3C0KA 3D6MA 1ONSA 1NNUA 1RNLA 3PFHA 5K4AA 4BX9A 1U0BB 3UV6A 1MIHA 3H4MA 5BSRA 1RJ9A 2O3RA 1EDDA 2G8NA 1O6FA 3W7AA 1P19A 3AVWA 4GECA 3R7WB 3TIVA 3FFTA 4J7UA 4K9DA 4EHJA 2TMKA 4O4IA 1P74A 2RK3A 4RVNA 4U9IS 3VTZA 2B37A 3V7YA 4Q39A 5KSYA 1X7ZA 1AKTA 4ITVA 4Q3OA 1BD4A 3WFZA 2VDUE 2W43A 2OHOA 3B3JA 4EG8A 3H6HA 4YAKA 3NVKI 2VPZA 3FYUA 1XQ9A 4R3NA 2OHJA 5ERYA 2ZBUA 1OAKA 3SF0A 1XN1A 4DTIA 1B0PA 4IJUA 2BM0A 2UYGA 3CE6A 4LI3X 1WV0A 3G8CA 4D3DA 5FH9A 4ZICA 2Q0HA 2ZUTA 2Z5GA 3N2NA 5KAPA 2DFTA 4URWR 4M1SA 3HKEA 1CKEA 4KWTA 2YXBA 3TCXB 4A73A 3KEFA 3DL4A 2ONCA 1EAYA 4XASA 5B58C 4KACA 5HE9A 4KPYA 3ZU5A 1L7PA 1Y9ZA 5AVYA 1PNRA 2G0NA 1DKNA 2P9CA 2ZI6A 4WOCA 4DCSA 5DZSA 4BBAA 1DKRA 5AHRA 4ODIA 1MFZA 5HCUA 1W36D 1RRCA 2UZ3A 2H65A 3OVMA 1XTRA 4RUKA 5F51A 4AZSA 1I13A 1UIMA 4OY3A 3MK31 4EVQA 5KYGA 4HYQA 2YQ4A 2DFLA 5ALUA 2V4MA 4B43A 1E9SA 1QPGA 3HP4A 3K6JA 1N75A 1XVLA 2IHJA 1SCDA 2EVWX 2O23A 2HSWA 5K20A 1XHFA 3GO4A 1LFAA 4ZP1A 4OAQA 4UQPA 3Q11A 4N48A 4D8TA 5IHPA 4ZWNA 3KQPA 3KYDB 4Q9JA 2O2YA 4KMMA 4MMZB 2JVJA 2A78A 2VWHA 3WYAA 1QQTA 1I01A 3CINA 3D64A 4JX8A 3TQFA 5ALJA 1DUSA 2AUNA 2B9EA 2YYYA 3RHSA 4A2WA 3RUFA 4BNMA 1KDYA 4RL6A 3LK6A 3DB1A 1FJHA 2GZ1A 1MT3A 2NV2B 4L0QA 1JNYA 1G9TA 4B75A 2QAIA 3RS0A 4L78A 3SC2A 1TEXA 4XVRA 2Z9BA 3MXTA 1E8DA 1OE0A 1H94A 2JGIA 4FFBA 1P2BA 4AS2A 1BYIA 3KCQA 4NJOA 1S02A 4FZ3A 2AUTA 4EK9A 1RLMA 1M33A 1EJ6A 1E1KA 1LBQA 1QO7A 2A1UB 1PWZA 1XCMA 5CXXA 4Q7LA 2OQRA 5ALGA 2CLSA 1E5TA 5TMDA 3A2MA 4BUCA 2IZ5A 4HQNA 4RSHA 4QOFA 2DC1A 4JVLA 2EXXA 3OOSA 5AOVA 3N3AC 3PJRA 1U1EA 3A4YA 4K5QA 2EGGA 5JOQA 3F2IA 1T3ZA 3C6ZA 3ZY5A 2P6PA 1Z26A 2VAXA 1ISGA 4K28A 4WXYB 5DHAA 3AF0A 5FPTA 3ACCA 1KSFX 1G8HA 2HA7A 4MVCA 4XDZA 2EP5A 1S2MA 2CZGA 3KNZA 1L5WA 2XDWA 1TL7C 4EPWA 2A0XA 4TOIA 1J22A 3QPCA 4P4LA 3OU6A 1H93A 1H69A 4RHUA 3ZHCA 4KPGA 1RRFA 3VH3A 2QOEA 1M2WA 3ZVLA 4XVCA 1OWMA 5CMLA 2W2MA 4B3RB 4D46A 2P9EA 2FQYA 4HRAA 4IG4A 3D43A 3HCNA 4EA7A 3LQKA 1NBMA 3JQDA 4ZA2A 5BT8A 5A5VA 4N5MA 1NN0A 3B7GA 3ESYA 4ZYTA 3C15C 2JIRA 5IHXA 4BNHA 4DIFA 3QG5A 2WWVD 2FSIA 1Y4AE 4FYXA 1C9EA 1TYDE 2JLCA 3IX7A 5F7JA 1T43A 3AONB 4C7XA 3J81A 2C0PA 3M1YA 2AN4A 2JI8A 4Q9NA 4DV3B 5CXQA 3NO4A 1GPJA 1DRVA 1I3LA 3KZCA 4MWEA 3O2JA 2UYQA 1JIUA 3DAFA 1HG0A 1Y3HA 4NCHA 2O0LA 4U63A 3NETA 1E5QA 5FHRA 3RK4A 3UWDA 1WMEA 3VZPA 3HFSA 2AR9A 4TQUS 3SR0A 1KNXA 4XUCA 5JZOA 2WVGA 1OYWA 4II3A 1E5DA 3RC3A 3DVLA 1Q7CA 4DG9A 2R00A 1MX1A 3F6PA 2QIPA 2XSZD 3R0ZA 4DYDA 3ZDQA 4GI1A 3TJZA 1YE8A 3PE4A 4R8SA 4JB3A 4DXHA 1R6DA 3L8EA 5IP5A 2DBZA 1AURA 1YB4A 1FYVA 2I65A 3HO6A 4KH1A 1Z8NA 4RH0A 4XYMA 3O8LA 1FS4A 4M1QA 3LP8A 5KBYA 1D1TA 2JGMA 2NTJA 2PO5A 5EP1A 3TTTA 1XP8A 2PLRA 3UAVA 1IOVA 3D0KA 1ZGBA 1UZNA 4Q4HB 1WHTA 2WYVA 1J70A 3JQFC 5KEIA 1U2QA 1DIOB 4RK4A 1P4GA 3A6LA 4AJKA 1YQWA 1DELA 5EYPA 3S8EA 5JUWA 4IMRA 4EMUA 6YASA 3R0JA 2WKSA 1M1ZA 5DNDA 2IELA 1LRLA 4TS1A 4EG6A 4AIRA 3UMRA 4BRWA 2O0KA 1XLVA 3OA0A 3U44B 2X0NA 3CN9A 5DLYA 3JWPA 1DQRA 2NZJA 4MQ4A 4Q34A 2G88A 2JKVA 3E9CA 4XYLA 3E05A 3EFOA 3L5KA 1W6UA 2RIRA 1FJGB 1N2OA 2QT0A 3FKQA 2J9FB 4OP1A 4TM8A 1RHMA 3NW9A 4JX9A 3F78A 4B35A 4FWBA 1G7TA 1ZEJA 3BD6A 4ZQHA 1T6YA 2F1RA 4J0QA 1GSIA 3UKJA 3KLMX 4C87A 4K7JA 3G7NA 3VISA 1BCSB 4H1UA 1PYGA 1VCIA 1Y5LA 2APJA 3FSEA 4W63A 5EP3A 4B80A 4HGOA 3USZA 3U17A 3IO3A 2ACVA 4A23A 3DFUA 4RF2A 3NYWA 1QGUB 1QO0A 4CQMA 2X2FA 1WXQA 2YJNA 3B82A 4MA4A 1OPRA 1XQ6A 5JXIA 3FPJA 3GPIA 1ECGA 3PPXA 5FWXB 3HNOA 3RRBA 3IAM6 4AQDA 2AI2A 4CNBA 2WJIA 1HKUA 3ETLA 1XJWA 2WYIA 3KAJA 3GFSA 5DX1A 2MCFA 3D7MA 2MR5A 4MDFA 3NX4A 1FTQA 1P39A 2BBSA 2ORIA 4PSVA 3H2SA 5KKCA 1ZI9A 3F9IA 1IN8A 1OREA 1MNAA 4GOND 4L1KA 3LLVA 4RS4A 3CXUA 3T3EA 2G1PA 3ZEIA 1TIBA 3SS9X 4BE9A 4AXXA 3LC0A 1BXRA 1CUUA 2HRDA 2Q49A 4NOMA 3R77A 1KS2A 2VDWA 3QKIA 5FOUA 5HOEA 1PJ8A 4QM7A 5T67A 4PLVA 2O8BB 4H3SA 1WD5A 2QIOA 3K6SB 3E03A 2VDJA 4IKPA 3R76A 3G82C 1PS9A 3IKLA 2IIBA 2DUWA 1CR1A 3JZDA 3QE3A 3R3VA 4J90A 4KOAA 1IB6A 4M6WB 1GTVA 2NXWA 2Y05A 4PSUA 3T3DA 3UQZA 3HXMA 5FPYA 2Q62A 4J9VA 1I2AA 2P2GA 4HWPA 3FZEA 2X2PA 1HQCA 1KYZA 1Q2XA 4UBLA 5FI3A 5HK8A 1FYWA 2R4TA 2QTAA 3C98A 3CO5A 4IKEA 4ARSA 4G0VA 2O2ZA 2QI9C 4K86A 1XO1A 1Z4QA 2NZUG 4HDMB 4L75A 5ALDA 1T6NA 1XRJA 1HZZC 2JFGA 3FNIA 3OU2A 3L1IA 3SFVA 4G86A 3K2QA 1JXMA 3E9ZA 3L7BA 1WBJB 4QT4A 4KIUA 3KG2A 1I32A 5KOJA 3AI7A 3VR4H 3AKZA 2CF5A 2I1WA 3CZCA 4YVFA 3UHPA 1P1JA 4FFLA 4YJDA 1CQWA 5K05A 4IDPA 4QZVA 1YXMA 4PYIA 1QH8B 3C6YA 1E7WA 3W5BA 3TB4A 2ZJ0A 4AKIA 1P1CA 3UFXA 4YAIA 2XEDA 3VR5H 2R8EA 4HQFA 5BWBA 2Q4RA 4UBJA 3HJRA 1B8UA 3FGPA 3I8SA 1KDZA 2HW8A 4I9UA 1VJRA 4ZEXA 2RHWA 2QZSA 1KAQA 4AUKA 5DMXA 1E2EA 3LUGA 5H9VA 1O3YA 3NDBB 2IZ6A 1J2TA 2XNHA 3B51X 1E2HA 3QA3E 2WUEA 1LLCA 2JCYA 2X5OA 1RM0A 1TM7E 1LDBA 3ET5A 5KHOC 3CZ5A 4HMOA 1C3LA 3RVLA 1KRWA 2EC5A 3F46A 4PR0A 2CSUA 4HSEA 3P9NA 3PDHA 4YRZA 3RG2A 2G5CA 2XF2A 3R3XA 3TN7A 4PCAA 5K8TA 3L07A 4W1PA 3AEYA 3VC7A 2WUVA 1DKOA 1EFLA 2FFAA 4KN9S 3AEUB 1TEVA 5TV2A 1M7GA 5BXQC 5HPYB 4WE3A 1RZRA 1G0OA 3C7CB 4PGGA 4MV9A 1NMYA 2PWAA 2W22A 4DDHA 3T8YA 5KQSA 4E94A 1DQPA 4LJRA 3GY0A 2IW1A 4DMFA 1TAGA 3QX3A 3INTA 3ZD6A 3UMMA 1PCXA 3W3AA 1PFVA 1RS0A 3ZI7A 1LPSA 4HP8A 1T1RA 2W6JA 3QYFA 3GJ6A 4IMIB 5AI5A 5DW0A 4XFKA 4FQ5A 2RH4A 1VZ3A 3VR2A 2G04A 1DINA 2Z3VA 1E3JA 2PZKA 1ZOOA 3SIPA 3P9RA 5DHTA 1OU0A 4R51A 1D5CA 1DEHA 1ZLYA 2I91A 3WNZA 1NBOA 4KO4S 4MUGA 1PIWA 4J03A 4CI0B 3P8ZA 3KSBC 5AH0A 1H1TA 3KQWA 3Q2OA 5AKXA 4UVHA 3U7QB 2HHLA 3W79A 1S3GA 1ZN7A 5I7UA 4RD6A 5IYZB 5DX8A 1W0KA 3ZWBA 2JI4A 2UAGA 3OTHA 1RD4A 1F8XA 3CEHA 4OO3A 2REBA 4LTDA 1WCIB 2PBRA 5YASA 1TGVA 3IJRA 4D97A 4YX9A 3OKCA 1MAUA 4FT2A 2WY2D 1N8TA 3VU8A 1QCCA 4WHMA 5KSZA 3ZHTA 2JJYA 3W34A 5LNK6 3RWMB 1KMCA 1N2SA 4AWXA 4BZZA 1Z16A 3QLVA 1VE1A 3AZPA 4G0ZA 3C3KA 3M6FA 4I2NA 2BFDA 4EQ6A 3CVOA 1TTHA 3WGNA 1O58A 3VNVA 2CWDA 2EYQA 1B0AA 2RMKA 3TNLA 5KYUB 5TPWA 3HA5A 4MVXA 1NJSA 3KR2A 4UJ5A 3FUUA 4OUDA 1MAAA 3O95A 1DCTA 3G2JA 3C8UA 3EXFA 4RZUA 3IUJA 2V4UA 3RFTA 3MTEA 4M60A 5I7WA 4IF6A 4ZAGA 1M1YB 3G6KA 4GPIB 4WZBE 5HP4A 3BF8A 4C89A 5B64A 1K9VF 2GPTA 5FR1A 3V48A 4LIPD 4MRVA 4TRRA 4G6ZA 4G0NA 4TWBA 2O7RA 4B4WA 2XZDA 4DVJA 2L82A 1P3JA 4LNUB 4F5WA 2VSOA 4AS1A 1N78A 5H1YA 4OIMA 2AJBA 1XDBA 2FSSA 2Q2NA 3MMXA 1GIAA 2ZB2A 1E69A 2IFTA 2OZLB 3DKVA 1T0HB 3HBLA 3D3WA 3INYA 1E61A 2WT9A 2Z1NA 2HCJB 3CWCA 3MRSA 4XXHA 3NTRA 2QUKA 2YWBA 3WRWA 4C7JA 2WVHA 3U3MA 5IKEA 4F6RA 2VPIA 4FX5A 4ALJA 4PRZA 1E3WB 2LCFA 1MDBA 2UVPB 1PQWA 2RHDA 2TMDA 4X20B 5EIBD 3T94A 3F7MA 4PYNA 3RREA 2H1HA 4U1RA 4CV3A 4PX3A 1ZEMA 1M2NA 4X24A 4EJSC 1UBNA 1I36A 4WKPA 2IL1A 1JILA 1SQSA 1KOGA 3RT7A 4OFZA 1OAOA 1Z07A 3NDIA 5K6AA 4X84A 3GR6A 2XRYA 3KR9A 4D9HA 3WRXC 3X1JA 4QTXA 4P84A 3NIGB 1OXXK 1WB4A 3Q41A 1YB2A 5FA5A 1GRVA 2H57A 1SM4A 1PEAA 1TU4A 2BJHA 2CK3A 3GRCA 3H13A 5ITVA 2ZRDA 4RTOA 1SEVA 3A27A 1U0LA 1GG5A 1R12A 4QYIB 4EPYA 1FJXA 5JS1A 3DFZA 1LC0A 4RVUA 2G17A 1O94A 2YW2A 1QIMA 3DTNA 4Q82A 2I7DA 3DQPA 3AI1A 2R0QC 1H4TA 3PUKA 3BL5A 4UVEA 3L1UA 1UDCA 4IZIA 2FVXA 4B44A 5KKNB 4Q7MB 1ZJ4A 2R1TA 4QM6A 1LNSA 4M7OA 2C83A 3EDMA 1U1GA 3AZOA 1Y80A 3SOPA 1PG0A 4MW4A 1NUQA 3T7RA 3T1TA 1ZHFA 2VIIA 1GA4A 4D9CA 3LLMA 3W1EA 4G0PA 3OQIA 3ZGXA 2NXNA 3ZW7A 3VAZA 1AV6A 4IZ6A 5C8YB 1H6DA 1YRLA 4EY5A 2E48A 2YHIA 1Y9AA 2XUDA 2ZI3A 1ZZEA 4MW5A 5DLPA 4CU5A 5IJWA 3MSCA 3B6MA 3ROTA 2ZAYA 2A9VA 1U3FA 2PQMA 2W11A 1KO5A 2IHKA 3JWJA 2X4DA 1SCUB 4WINA 1MX9A 4DHWA 5DULA 1JQLB 2FV8A 4D74A 4KRXA 5JC8A 3ADCA 3I6MA 2OVFA 2QRVB 1PJZA 1O08A 3BXPA 3PJEA 2BEUB 3E9EA 2E87A 2IKQA 4KXMA 4YJHA 4D4KA 2Q7DA 4FW9A 2QF7A 1JALA 2QWXA 3SZLA 1HT1E 3GEDA 1CNMA 5AVTA 1CUXA 1FSZA 1K4YA 1EESA 1BE1A 1N5JA 3AFGA 3DZFA 1L7XA 1RXSA 3NNSA 1B93A 3PPVA 1I4WA 1U0OC 4LWQA 1NUAA 4B74A 1CS0B 1EUZA 2V5VA 1AG9A 5TVKA 3PFCA 1OY1A 1M2EA 4JJIA 4UTZA 5EP2A 3VYVA 3DMNA 1XAGA 2GN8A 3N2KA 3ILVA 4QQKA 3RIMA 4C20A 2GEKA 4QGAA 1SUFA 5D7NA 4YV2A 1QB8A 1T8PA 3DE2X 3P4UA 1SHLA 2INGX 4EYKA 5T64A 5KNCA 1HNZB 1XRSB 4PLCA 5IVIA 1Y1PA 4CKWB 2LE0A 3SJCA 2XVAA 2FGJA 3E2IA 3ZLUA 2YXDA 2ZUSA 4AUNA 4E70A 1AB6A 1P5HA 1GV1A 1XCBA 5JJIA 1RCTE 4F93B 1WTAA 4WZAB 5J23A 1W48A 5H68A 4P38A 4Q1AA 4MQ6A 1T9KA 1YHNA 1PQPA 2JIOA 2JJ2A 3LA6A 5HA5A 1NBMD 3EGDB 5IJAA 2JIMA 4FFPA 1IRIA 4DA4A 5KQGA 4CLRB 5JBNA 3DM9B 2OECA 3VSBA 3SNHA 2J85A 5IT5A 4JYAB 3D0OA 2CFOA 1VE6A 3Q85A 2ONJA 1SR8A 2FW6A 1WQ1R 3TW0A 4PYLA 2F62A 1RBZA 2GHQA 3OTOB 3MN1A 3IUMA 4FOSA 4D9JA 3S4YA 4A0FA 3PK0A 5JSKA 4MYDA 4XPIA 2EQ5A 5AXBA 2Q5OA 5KAMA 3M1AA 4OM7A 3X43A 3TAHA 4IGIA 1VRWA 1WDMA 2PMBA 4TLCA 1NN3A 1R0YA 5BXYA 3O94A 4AZVA 1UKVY 4I36A 1JHOA 1XPRA 4LXTA 2VUHB 3ZCRA 1ZK0A 1ZRMA 4PM4A 1E9DA 2VPPA 2NZ2A 5DM0A 3VPAA 4A92A 4BGDA 3L01A 4Z49A 2MU1A 4IJWA 1RWBA 3SMQA 1DLJA 2FQWA 4E88A 1IPEA 4Q9IA 1XPJA 4DADA 1ACMA 4O1MA 3CHYA 3VU3A 2GVNA 1MDFA 3IEPA 1NONA 3RYFA 2L2QA 5CPBA 1N7JA 3KB8A 5CX1B 3NHBA 3F73A 3RAFC 2F48A 2YQ5A 1P9NA 2VYCA 2C0CA 2EGHA 3DOCA 2XUKA 2X7XA 1WVGA 3QLEA 1D4AA 1HGXA 1R0XA 2BE9A 1CSEE 1TVKB 5CG1A 4KFCA 2H1SA 3UMCA 4MRNA 1NMQA 4DCGA 3T35A 2WIGA 4EKGA 2BT4A 5FI5A 2D2FA 4Q03A 5DYWA 3AVPA 4EX6A 3QEMB 1KDPA 4CJXA 3M7IA 2QG6A 2ZREA 2YFQA 2IOFK 3H97A 3ZJ4A 4P8RA 3VZDA 1B0UA 1GZHB 4DMMA 4H7KA 1V3VA 5AD1A 1V7CA 3MMPA 2QB5A 1HLFA 4UAVA 4FFDA 3UMFA 4AF8A 3FIUA 2FEAA 2W83A 4RM2A 4HR7A 2ZJ8A 2CLLB 2XB8A 3PJDA 2OFFA 2YZNA 1QRTA 2Q29A 3MFQA 3KOWA 4M7WA 2A35A 4EARA 5TMEA 3FYHA 3V4SA 2BUCA 2FEMA 2X8WA 1SMKA 3IHKA 2ZXFA 2XT6A 3UWOA 1J06A 4KVGA 5IUKC 3UUGA 4MROA 1LSOA 1KKLA 4HG2A 1HSOA 1VLZA 4Y6LA 3GDWA 4HY3A 5FCDA 3CF2A 4RV5A 3DPSA 2GYYA 1WZIA 3AOGA 4FCTA 4ENVA 2FWJA 4JB0A 1UMKA 5JZBA 1NVMB 2JAWA 5IBRA 4AO8A 2BOVA 3OICA 2QX7A 3L7LA 1T2CA 2JCBA 4GWKA 4JGGA 4CCWA 4ARBA 2UZIR 5BV7A 3MEQA 3UW1A 4CQMD 1QO0D 2H06A 1MU0A 1I1NA 2IPAB 4N3CA 3L8HA 3RFXA 1XXHA 1V8ZA 2NN3C 3DMPA 2PVSA 2WINI 4C4XA 4ZT6A 3ZJUA 2VPQA 2Y27A 4YT5A 3Q0TA 4KQ2A 5HIMA 4BX0A 2CXQA 4JI7B 3HV0A 3CZPA 3H1EA 3FBTA 3W06A 3L0YA 3RFCA 3UWSA 2UUBB 5CK4A 1G0NA 1FFSA 1UMCB 3HCFA 1GCUA 1N2HA 4RE5A 4O3MA 2QGNA 2QSUA 3KJQA 2WOJA 2XCIA 1KP9A 4HFMA 4MH0R 3NHZA 4EB6B 4KJZA 5CAEA 1GL6A 2A5DA 3BMNA 4DPLA 4ACBA 1U1DA 4QOGA 1VB3A 1NF9A 4LS3A 3TIXB 1V2GA 2FPSA 1J9ZA 1NJGA 3T4PA 1E9BA 4INJA 1OH8A 1DB3A 2B0CA 3N59A 2ATEA 4HS4A 2GJSA 2HFKA 2EZ8A 4ON9A 2V54A 4NNJA 1SNYA 1G3MA 1GUYA 1NI4B 4OHRA 2IYVA 4BMSA 1EB8A 5CCEA 2IYZA 3KOOA 3NVAA 1IDN1 1DIGA 3BKXA 1SBHA 2Q0SA 4WKCA 1TZBA 3RUCA 3U7FB 2FRXA 3F6CA 1P9OA 2GB4A 2B94A 3JU3A 2JCXA 3DDUA 5DBHX 2QP4A 1LLUA 1BYUA 1F9AA 1SO8A 2GHIA 3LWZA 4JA2A 2ID4A 4PYQA 2M6KA 1U8YA 1Z2EA 2WVAA 4BMVA 5FTMA 3WJ7A 3JQFA 3R8FA 4ICIA 2PGDA 2D7JA 5FBZA 3GRYA 3H86A 3EUFA 4OHCA 3VRHA 5DSZA 1QX3A 1OFUA 1CJVC 3H4TA 2B4AA 3KTOA 5TDHA 3W1WA 1FUUA 1SU6A 1Z36A 2AL7A 4AJPA 3HXOA 1C4KA 3KQOA 3GUZA 1UQRA 3CRVA 3D5EA 1KJWA 4LK3A 4X7MA 5FOVA 4N01A 4EBBA 3K4PA 5DM60 3FAZA 3V4LA 4ES6A 3LF2A 1I6LA 4R5MA 3W5SA 4D56A 3C8MA 4OL0A 4XJTA 4YS6A 1QNLA 5LKRA 1ORVA 1ODLA 1VJGA 2PTGA 3RIXA 1RAGA 5EWMB 4HAIA 2GXSA 1XALA 2GEUA 4UEKA 5E8RA 5TQ2B 3W05A 1XF9A 3R09A 2BMEA 1KI2A 3FZGA 4ZFNA 3A9SA 3ZQKA 1DT5A 1IJBA 3WZLA 3DHVA 3E9RA 3HWX1 1QORA 3IIMA 3KXKA 4MMYB 3HJNA 3I2IA 4RFSA 2ZUUA 3BFVA 2OHGA 1BVUA 3H0KA 3O9MA 2PMWB 1SVNA 1UBLS 2VF2A 2KSQA 2X9LA 3MLEA 1ZCZA 3HE3A 3ZIDA 3CTMA 1ZJZA 2QYSA 2R1UA 4R6XA 1A4IA 5ARBA 2EWWA 1WD7A 1I3KA 2Y93A 3ESXA 3Q3HA 4NZPA 2EFCB 1IWBB 2PGAA 3KUDA 4CLOB 3K0BA 3OLCX 2HJRA 2DECA 4FMCF 1Z06A 4AN4A 1JPUA 3W8DA 1RZRD 3C70A 2N46A 4TXJA 1W96A 3EDCA 1P2VA 4AW9A 1BDIA 1GPH1 1OD6A 4BVEA 3RGWS 1FRQA 2ZI9A 5C18A 5K3OA 5E6SB 3W3AD 1K97A 2O6HA 2VDNB 2MOKA 4GS5A 1MCZA 1OIWA 2ATVA 4B76A 3BIFA 2GM5A 2W6JD 2G1UA 2BZ0A 5AJWA 3TE6A 3V32A 3VR2D 1Q7RA 3MELA 1Q1GA 1SVSA 2AG1A 2IGBA 2V6GA 1NP7A 1Q0LA 3UT0A 5F98A 2YWJA 4Z0TA 2DYKA 5EOVA 2ZJ1A 1J8MF 3ICOA 3V4PB 2WB2A 1C7IA 3L0IB 1J25A 1C3OA 3LVFO 3KWMA 4G2NA 4JEMA 1DZIA 1JQ5A 4KG7A 4NRDA 4Q24A 4WK0B 3RVNA 4US2R 1MB2A 4X94A 1ZNWA 2IS1A 2PLAA 4JB8A 2BGIA 5JAZA 2ZSFA 1UDRA 1XK7A 1XEFA 3LT2A 4KE9A 4DG5A 5L51A 2JLUA 1ZD9A 2NXEA 5AW0A 3TD9A 2Q9UA 3ECCA 2POQX 4DC9A 3BCHA 2GCEA 4GNRA 2QBYB 1NDQA 1FXUA 2ENUA 1JS1X 3HY4A 3TO5A 4RQTA 1RMQA 4WZBB 3QE9Y 2DFPA 1SAYA 3AJEA 2LTAA 2XITA 1GA6A 1LPNA 1NG9A 1TADA 5IUNC 3VZBA 1T2UA 3OQ1A 1ADYA 2AKAB 5E7IA 4J6FA 5LA6B 5L4SA 3S5UA 1G6Q1 4RNCA 2WZDA 4LJ7A 2NSLA 2V7GA 3GJ7A 1Z63A 1IMJA 2VL7A 2WA1A 4NYJQ 4AMUA 5LU9A 3RLFA 3QXXA 4BV9A 5JH7F 2I3DA 4CM9A 3QYAA 5LP6B 4ZV9A 2GAOA 4C03A 4EW1A 1JEAA 2B1JA 2O50A 4XQ9A 3G1UA 1B8PA 1JDSA 3B2QA 3ILYA 4RJIA 4AT1A 5LSAA 3SBOA 3DGFC 4HT3B 2JFOA 5DNUA 1G38A 2Q9CA 2RAUA 4CU2A 2CXSA 2I78A 2RHGB 3V1NA 1SHJA 5A0FA 1KXZA 2OMEA 5JAOA 2Z5VA 3DH0A 4JAVC 1EVJA 2AOTA 4QDTA 3ZE1B 2AG5A 1P7VA 2NQ2C 3IOMA 2QU8A 1WABA 5AO9A 3WK7A 5KYXA 1EHIA 3IR7A 3CLRC 1ENYA 2VTVA 2VLIA 1GKUB 2Z5LA 3VU9B 1E79A 2X15A 1Z4KA 3BZWA 2V7TA 3H2IA 4KIFA 3UY4A 1E63A 4O5OA 1PQ4A 4M0FA 1N7GA 3JRNA 4RMGA 3TW8A 4DC1A 5I9SA 3CR3C 3S2UA 4RGBA 2HLPA 5ITZA 2IZ7A 3AIIA 2GCOA 2YS7A 1LI5A 5JS2A 3E3OA 1JRLA 2I8CA 2JCSA 1VPDA 1K7SN 2I80A 4NH4A 2Y1EA 1DIBA 3ZBUA 5E1BA 2R96A 3FDZA 3N3BC 3ZZ1A 1GUZA 1WUHS 2O1EA 4LY6A 1YBMA 4U0JA 4ABYA 1PD1A 2X14A 4TN5A 3QVMA 2H1FA 1JDBB 3LDFA 3TOZA 1GUAA 3JPYA 3O4GA 4IFIA 5FQNA 5BYBA 5A9TA 3V1LA 1NRIA 1T10A 3BXXA 5JSUA 1L5QA 1O94D 2BLNA 2DERA 2V7UA 3ESBA 3A0UA 2J3HA 2V7VA 2B1IA 1OV6A 2Y1WA 3C6KA 3L6DA 2YJ5A 2OPBA 1CIPA 1E6MA 2COKA 2GCIA 2P9JA 3I09A 3P9IA 3QUAA 5WRFA 3UJPA 5HJEA 1T2FA 1K5HA 3VO9A 1IY9A 4NICA 1EFVB 1QQBA 4MV0A 4K8OA 1W2GA 2ETVA 3ENNA 1E9CA 4MA0A 4R54A 3VA7A 4MEAA 4Q15A 2QN9A 4BO6A 1J5PA 1Q6ZA 3R3HA 1JN0A 3H5NA 1JWBB 2FVYA 3AVTA 1XAJA 3P9PA 2VTKA 3MT0A 4GYYA 1ORRA 3FPBA 5T7BA 3DUFA 3P2IA 3KX2A 5KJ6A 1UJCA 1DXOA 2Q27A 2ZVQX 2A9KA 2C31A 3CMCO 3TPFA 3U61B 2PSFA 4P9NA 3HB5X 1USWA 3AXTA 4G8BA 3DOEA 2HRQA 3G59A 4L02A 1N25A 4GMGA 4MPRA 1Y42X 3NYIA 5U9CA 1IZ0A 5AI4A 3CUSA 3GZJA 4U2FA 1IUOA 1P6UA 3F5DA 3PUVA 1TZCA 2PD6A 2HH9A 3WZ2A 1G7CA 2HWYA 2I2CA 4QC2A 2C29D 4KRFA 1Z6PA 1B3RA 1D9ZA 3N8GA 3I23A 2FY8A 3FOWA 2WR8A 1CULC 1TFUA 3PR1A 1E18A 3A6ZA 3KTDA 3B70A 5C8DA 2VYQA 3NGMA 3B48A 4FHGA 1ZITA 4KNVA 2ZRBA 5ED0A 1YL6A 3DAGA 1ZXLA 2OYSA 2X2OA 1ORTA 3DBOB 1RHUA 2PWYA 3EPHA 3MTGA 1JJIA 1ZNXA 2YRWA 3NYRA 1Q11A 3ZU2A 3EISA 1F8FA 3JYNA 3RU2A 4BDSA 2FMFA 3IPAA 4TLBA 4QBKA 5KNCD 4LC1A 1RQ7A 2MJLA 1M5TA 3OLQA 3TLMA 1RC0A 4DQUA 2DHDA 3T3PB 4YR9A 3QLUC 2JIDA 3L49A 5TMBA 2F3TA 4EJSA 1S8NA 2CNKA 3HLKA