2WJ6A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n- acetylanthranilate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj6A01
2RGUA 3QVMA 5AKXA 2JEYA 3YASA 2QRUA 3H17A 3EBLA 1ZIXA 3ILSA 3GBSA 4BCCA 3QMVA 3WL6A 1XLVA 4BDTA 4I4CA 4OB7A 3BJMA 1LGYA 3G0IA 4H7KA 5CXXA 5A7HA 5HKBA 3LIIA 4C87A 5KREA 4E14A 4CCYB 2VT7A 1WHSA 2D5LA 5ALNA 5LZ4A 1UFOA 1ZIYA 5CTAA 2X5XA 3IDAA 3VKFA 4X93A 2JIDA 1EA5A 3F67A 5T4EA 2ACEA 1BRTA 2UZ0A 5FP0A 1SOMA 1XRLA 3AINA 3DYVA 4YPVA 2PSDA 3O4GA 4E46A 4X97A 4LXGA 4P93A 1EI9A 3WK5A 2I3ZA 1E8MA 1I6WA 4UFPA 3WQHA 4X91A 1MAAA 2DHDA 3GELA 3D59A 3WI7A 1XZEA 1QOZA 1ZOIA 3M3DA 3IB3A 4G5XA 1K6EA 1Q0RA 1HL7A 4Y2VA 5E4YA 4Y2XA 4U2EA 1IMJA 5ALMA 2HRRA 1CUDA 1YS1X 4YASA 4H7HA 3HSSA 4D9JA 4M0FA 1UOQA 4Y9SA 4BAZA 2HA3A 1LPNA 5AM4A 4BB0A 1EH5A 4KEAA 1TIBA 5BV7A 3S8YA 1HPLA 3HZOA 5EGNA 1FFAA 1H2YA 2XMCA 3NGMA 4QE3A 4X3CA 4JYPA 4FOLA 4BZWA 1CUJA 4QDUA 2AJCA 1P0PA 4CCWA 3GA7A 4WY5A 2GZSA 3G8YA 4X71A 4DNQA 4QLAA 1EINA 5A7GA 2HFJA 1W1IA 2HRQA 2G5PA 2X76A 4GHWA 3WWDA 4BC0A 1ZD2P 3TRDA 1BCRA 5D7BA 2WHRA 1E3QA 4P92A 1ODSA 4FKBA 4U2BA 4AO6A 1JMYA 4PV7A 1R3DA 3FVTA 1GPNA 4BZZA 4B80A 1YA8A 2J3QA 1AUOA 1Q83A 2WSLA 5ALYA 3VDXA 2V98A 5ALHA 4FMPA 5LLSA 1Z68A 2V96A 5AKLA 2OCIA 4S0XA 3I2GA 4BVLA 3AIOA 5AM1A 3V1LA 1Y7IA 1XKLA 5AKJA 1MTZA 1ZJ4A 3WKDA 4U2GA 5CBKA 2H7CA 4FNMA 5AOCA 4P08A 4DMKA 2J4FA 4G4GA 3O0DA 4UHEA 1R9MA 3QH4A 2GYUA 2WG0A 4HVTA 1TKRA 3N2ZB 3DQZA 1L7RA 2P8SA 4MEAA 4L72A 4ZRDA 1IZ8A 3WIBA 4BCDA 1ETHA 4JYMA 1QIIA 3WKBA 2QOEA 5AKHA 2ROQA 2XUGA 1UK9A 3FWHA 1XRNA 4AB1A 3C6BA 4G8BA 4W63A 3NWOA 3LS2A 3I1YA 5JAOA 2GBGA 2XQFA 4I3FA 5AOBA 1LPOA 3G0BA 2Z3WA 5JIBA 4BTLA 2K2QB 2JBWA 4G9EA 1R4ZA 4H0CA 2BUCA 2WIFA 2AJDA 1F0NA 1GQSA 2WU3A 4F60A 4KRYA 5HZGA 1BS9A 5AKZA 1XQVA 2XUFA 1QIJA 2XMZA 2IX9A 1EDDA 5LIPA 4DMHA 4QDZA 1MO2A 3D3NA 2HIHA 2GZRA 4DMCA 1GPKA 3OC0A 3WYNA 1EDEA 3WL7A 2VF2A 3IUQA 3W06A 1BCSA 4UHBA 5SYNA 2XUQA 1GXSA 2QUAA 3BWXA 2PKYX 1PFQA 1TRHA 3VJLA 1ZD4A 3LP5A 2QXUA 2HA2A 1QGED 2G4LA 4DNFA 2VAVA 3QPAA 4X00A 3ED1A 2ONCA 2XQJA 3BDIA 1QO7A 4LYDA 3G9ZA 5LKRA 4G9GA 1CV2A 3R40A 4C4ZA 4EY7A 2WUGA 2RIPA 4Y2PA 1VZ2A 4OU5A 1CUWA 1W6RA 4E15A 1RYYA 1W52X 5BWBA 3FLBA 4HS9A 1SCQA 3DKKA 1TAHA 3GROA 2WFZA 3DEAA 4XWGA 4CG1A 4GXNA 3F8SA 4M0EA 3UMJA 5EIEA 1BU8A 4BRZA 2JGKA 4FTWA 4OSEA 1CUUA 2HA0A 5AOAA 1AC5A 1C4XA 1MT3A 5K3EA 4PO3X 4HAIA 5CRIA 3B12A 3HXKA 2PVSA 4W1RA 2VATA 3G02A 2Z3ZA 3A2MA 2Z8XA 2O2HA 4BBZA 5IVHA 4J0KA 5K3DA 3ZI7A 3WWCA 4B0PA 4AO8A 4MWTA 1EB9A 1XQXA 3I2KA 4Q3LA 1DU4A 2DHCA 1FJ2A 1SC9A 2RI6A 2VQ6A 3GUUA 1AKNA 4Y2TA 4Y2UA 3C8HA 1R50A 5K5EA 1UWCA 3CN9A 3FSGA 1MU0A 2QKYA 3H04A 5A6VA 1GKLA 3AJAA 1YR2A 3A70A 1SCIA 3JW8A 3AZPA 2B20A 4YX9A 4LYEA 1JI3A 1DINA 4GWLA 4G4JA 4BP9A 3L1HA 4KAFA 4QEKA 4E11A 1E5TA 1ORWA 1TQHA 4KACA 4GI1A 5A62A 4J7AA 3FLAA 1WCYA 1CPYA 2BUAA 2VJAA 1KU6A 5BWCA 2EDCA 4UBOA 3NUZA 2QXTA 1K63A 5CT9A 2QM0A 2XUOA 1XRQA 3FCXA 5AI5A 2AJBA 4WY8A 4DMFA 3K9BA 3ESBA 5HK9A 1J06A 2GYWA 3RARA 3AUKA 2B61A 4WFIA 2Y2UA 2GYVA 2ZYSA 4DTCA 4N8EA 4WFJA 2ORYA 4PNZA 3F9CA 5ISMA 5CT5A 5E2IA 2QMQA 3TGLA 1K8QA 1XLUA 2H1IA 1X2BA 2WFLA 3IUNA 2QS9A 3R3UA 4GBGA 4Y2QA 4B81A 2QT9A 4XX1A 3STTA 2OQVA 1BEEA 5AK6A 2JGFA 4ZWNA 3C70A 1QIGA 4J0DA 1DT5A 4LKOA 2PSJA 3PUIA 4PF1A 5EHQA 1QONA 5K3FA 4BP8A 1ZI9A 2OCGA 5T4FA 4J3JA 2R8BA 4AXBA 2W6CX 3ESDA 4BDSA 1A88A 3K6KA 4N8SA 2WJ6A 3ESAA 1GZ7A 3H2IA 2DHEA 4PSCA 2XUPA 2RONA 3R0VA 1D07A 5ALDA 1CLEA 4ZV9A 1GPLA 3RM3A 5C8ZA 1F0PA 3V9AA 5C8VA 3BL8A 5CH8A 4ITVA 2BGNA 2YH2A 2CEKA 5JANA 1LZLA 4MEBA 3V1NA 4RPCA 1J2EA 1C7JA 5ALJA 4Q3OA 3U0VA 1UOOA 5IKXA 3JWEA 1IUPA 1QJ4A 3IURA 3PE6A 4NZZA 2BAGA 3IBTA 1MX5A 1N1MA 5JAUA 1DQYA 5AO9A 1CUGA 3DL7A 4CFSA 1JJFA 5I7UA 4U2FA 2BUBA 1YA4A 4GLBA 4EA6A 3F96A 2WJ3A 3FYUA 1N5RA 1VA4A 2JGMA 2PSFA 5LZ9A 1EHYA 3WK4A 3ANTA 2JF0A 4L3WA 4C4YA 1VXOA 1DWQA 1HLGA 1X70A 3K2IA 2FUKA 2DCMA 1OXMA 3QM1A 2WG2A 3QPDA 3WKAA 3SX4A 3MUOA 2ACKA 2LIPA 1VA5A 1N5MA 1JU4A 2VJDA 5AM5A 4ZGBA 1WM1A 2BKLA 5AP9A 5FPQA 2FJ0A 1BN6A 2YXPX 1DX4A 2I3DA 4HRXA 1UXOA 5DNVA 2Z8ZA 5FDFA 3KWFA 3DS8A 3UUFA 5JYCA 4KRXA 3MVEA 4QDOA 2IITA 4BVKA 3FVRA 4N8DA 1QIHA 4KYVA 1U65A 3D2CA 3N0TA 2R11A 1OCEA 3ZLUA 3WK7A 2Y1KA 2Y2VA 3WK8A 3ZLVA 3DLTA 4INZA 5LYYA 2Z5GA 4W1QA 3VISA 2PBLA 2CZQA 1ZJ5A 1USWA 2XUHA 3DNMA 1LPSA 3QZUA 1CUIA 5JAHA 1B41A 3FSGD 1O6FA 5HFAA 1TCCA 1QLWA 4A23A 4KE7A 1DX6A 1XZFA 1W75A 3L1IA 4F21A 1UK6A 5D6OA 3H2GA 3QBJA 4EUSA 3SWWA 4JH0A 2ZSHA 5AK5A 1MX9A 1FFDA 1TCBA 4X92A 2WHQA 1XKTA 1GGVA 5ALOA 3T4UA 1N8SA 5AKIA 3AIMA 2XLCA 4EY6A 3HC7A 1K4YA 1UKBA 5AM2A 3H2HA 4L9AA 3H18A 4RNCA 4BE4A 4DLNA 1F8UA 1MN6A 3O4HA 1AQLA 5ALIA 3STXA 1THTA 1CQWA 4PW0A 1ISPA 4MQMA 1XFDA 4WFKA 4H7JA 4KE6A 1EX9A 1LZKA 5LZ7A 1CUCA 2BJHA 3W9BA 2ECFA 4GEGA 1XROA 2WLSA 2PUHA 5ALGA 3MGAA 3BXPA 3VVLA 3FBWA 5I9IA 1CFJA 1WHTA 1QIFA 3TEJA 3E0XA 5ALLA 3WWPA 1ZD3A 4Q1VA 5AKGA 3STYA 1XZIA 2C58A 2ZJ6A 1QIEA 4LIPD 5CMLA 5DTJA 5ESRA 4UHDA 5AI4A 3L1JA 4JUIA 4OB6A 3SK0A 3M82A 4OCZA 2I03A 5K3CA 3T52A 4QLOA 1XZCA 3V1KA 2WG1A 1O6GA 3M83A 2OGZA 3WKCA 4FNGA 4OUKX 1ZGBA 4BTVA 2HA7A 1LPMA 5CT6A 4KJXA 4IH9A 4H18A 2PM8A 3H19A 3RK4A 5JARA 1ODTC 3H1BA 5AM0A 3F98A 5DNUA 1XLWA 5ALZA 1R88A 2XE4A 5CH5A 5ALFA 1MAHA 5AIBA 5JALA 5HQ3A 2OGTA 2O7VA 1VKHA 5HF9A 3I2JA 5IVKA 3E1GA 1BEZA 1WOMA 2WIGA 5ALRA 2AJLI 5EHNA 4GECA 5AIAA 1DTEA 2C0PA 2XQGA 2ZYRA 5A71A 5ALXA 4H77A 1XZBA 1H2XA 3IUMA 3G0DA 2XUAA 3OURA 5ALUA 2XLBA 2RHWA 4EB0A 1J07A 4QDXA 1VLQA 1CUAA 2QJWA 1YB6A 1QO9A 2JGIA 2OCKA 2VA9A 3H2KA 2X8BA 4HXEB 2ZJFA 3EIOA 5I8PA 3OPMA 1UOPA 1CUXA 2QR5A 2PU7A 1VE6A 4UBIA 1G42A 1YCDA 1XZHA 5DWDA 4DGQA 3BJRA 4K6GA 4UPDA 3UUEA 1LBTA 1CIJA 1ZI8A 4A16A 4J03A 4OB8A 1JT2A 1Q84A 4X6UA 2H7YA 3I6ZA 2J4CA 2DFPA 5H3HA 2C5FA 2RAUA 1JKMA 4G4IA 4K6KA 4LHEA 4WCVA 5LP1A 1ACLA 4B0OA 4TGLA 1XZJA 1E66A 4FFWA 5ALTA 3IA2A 3D2AA 4Y2YA 3CN7A 1IUNA 2XDWA 4H7FA 3WK9A 4C88A 5CT4A 5CH3A 4H7DA 1XRRA 2CMFA 3HJUA 3R3YA 2BFNA 1MPXA 1U8EA 3O9VA 5AI6A 2D0DA 3S2ZA 4UFOA 5AM3A 4OYYA 3I28A 1HBJA 4EBBA 2H7XA 3E3AA 5AJHA 4CIAA 1E89A 2OCLA 4QDTA 3RLIA 4Q34A 4LXHA 5HK8A 2OAEA 3BE8A 1QIMA 2WKWA 4MQLA 3WJ1A 2QVBA 5HKAA 2ZJ7A 2CUTA 3H0CA 3ZV7A 1UK7A 3BF7A 1YAJA 1W76A 2HA6A 3D2BA 3CXUA 1UK8A 3WIOA 4BVJA 1XZAA 5EIAA 2ZYHA 2J3DA 5FUMA 3BDVA 4Q3KA 2HU8A 5EHXA 4C01A 3F97A 4H7EA 3KDAA 1QFSA 2DR0A 3PF9A 3QITA 3PFCA 5AI8A 2C7BA 3KXPA 4QZVA 3WZMA 4AN1A 4ZXFA 5JD4A 1LNSA 4BAUA 1K5PA 5DTIA 1XQWA 3R3XA 3G7NA 1JJBA 3VXKA 2C4HA 5AI0A 5JASA 5FV4A 4C4XA 1H2ZA 3D7RA 1ZI6A 2DSNA 1LPAB 5DYTA 1QE3A 1WB5A 4C6HA 1XRPA 3C8DA 4KE9A 1Y37A 3QMWA 1ZICA 2VTVA 4W1SA 4FBLA 4XJVA 1GT6A 2VEOA 3PDCA 4NS4A 3LIPA 3G9TA 1IZ7A 3W05A 5FPPA 4B6GA 1U2EA 5T4HA 1KU0A 6YASA 3M81A 4BAGA 5JATA 4FLEA 2XUJA 1P0QA 4K6HA 1E8DA 1QIDA 5LZ5A 1BN7A 4MYSA 5T4BA 4B85A 2V97A 4AN0A 4W1PA 2WFLB 3P2MA 4WDRA 4G8CA 1JMKC 3OM8A 1F6WA 2I78A 1YS2X 4JEIA 2WIJA 2WHPA 5AKYA 4QWMA 5CXUA 1S8OA 2O2GA 1XZKA 2WTMA 5IVIA 1QIKA 1YASA 2HHAA 2WQZA 2ES4A 2XMRA 3HYSA 1UKCA 3STUA 2XQIA 5K3FB 1VE7A 1WB6A 2XQKA 1H23A 1EVQA 1G4HA 3O95A 2JGJA 2GBIA 1TCAA 1CQZA 3WWEA 4UBLA 5ALSA 3D4LA 1EB8A 5C8XA 4FLMA 2EDAA 4AX4A 4FHZA 4BYMA 4Y7DA 2AJ8A 3PICA 1ODCA 4UBJA 1HDEA 1XQYA 2WIDA 1FFEA 3R41A 4HRYA 3OG9A 5ALQA 3R3VA 1E8NA 2OG1A 2OPHA 1CR6A 4B9AA 4FWBA 1BROA 4L0CA 3IVMA 1CUBA 4KAJA 5KWJA 5JADA 1XZLA 4ROTA 4CI9A 5K3AA 4A5SA 1W4LA 3ICWA 5KBYA 4MYDA 5JZBA 4FLFA 4CCYA 2B9VA 4J0IA 1WB4A 4AMYA 3Q0TA 3WWOA 3ZWQA 1XZGA 1H2WA 1IVYA 1CVLA 2XI4A 3HACA 3O4IA 4UHFA 4WDQA 1SCKA 3FYUB 2BCEA 3WK6A 2O2IA 3W9UA 1HKHA 3PF8A 4O08A 3AFIA 3IULA 4UBMA 4B83A 2HDWA 4DYHA 1TK3A 4I19A 5ALWA 5LZ8A 1L7AA 3WKEA 1THGA 1RP1A 3U1TA 2OLEA 3G9UA 5J3JA 4J0JA 3O9MA 2HU5A 3HI4A 5DYWA 3WA6A 2Y6VA 3PUHA 3STWA 4WJLA 5FXMA 4BC1A 1T4MA 3I2FA 2HA5A 5BOVA 3ESCA 1A8UA 3WL5A 3TJMA 1BE0A 4MJ3A 4C89A 5ALPA 2FX5A 4HXGA 5CURA 2Q0XA 3E4DA 1DWOA 4OYLA 3EQ9A 2VJBA 3HLKA 4B7ZA 4XVCA 1YSCA 4F5ZA 4X85A 5JZSA 3I6YA 4LXIA 3FCYA 5JAPA 4Y2SA 5ALKA 1HQDA 1CUVA 3C45A 3I2HA 1UKAA 1P0MA 1X2EA 1MNQA 2VT6A 2OAGA 3KSRA 3G9XA 3KD2A 4Q82A 1FSSA 4DM7A 3QPCA 2PUJA 2Y6UA 1ACJA 4UUQA 1A8SA 3X3HA 2V9ZA 3FLEA 1AX9A 4ETWA 4G1FA 3BIWA 4W9RA 4TVKA 1MX1A 3W2TA 4UHCA 4CIBA 1EK1A 3RKSA 1QZ3A 4CG3A 2PL5A 2WIKA 2CBGA 1EK2A 1WPRA 2VJCA 3C87A 3QMMA 4G8DA 2OQIA 4Q05A 1KEZA 1AMNA 3C6ZA 4ZV7A 2WUEA 1VZ3A 1L7QA 2JGLA 3DL4A 2C5GA 4B84A 5AHXA 2GBFA 3G0CA 1PV1A 1EXWA 2DQZA 1EDBA 1A8QA 4FDMA 2B4KA 4QWWA 1U4NA 4KAAA 5D3KA 2QZPA 2XMDA 4KE8A 1CUYA 3STVA 4V2IA 2G5TA 3DOIA 1VJ5A 2QJRA 4TPKA 4IH1A 1T2NA 4HXFB 1R1DA 4J0CA 5F4ZA 3R3ZA 3WZLA 4P9NA 4J0HA 4IQ4A 1NU6A 5HF8A 3W04A 5EI5A 3QYJA 4AMZA 4NVRA 1ZD5A 1CUSA 3KWJA 2IIVA 4Y2JA 4UHHA 1JFRA 4UFNA 5CT8A 3BF8A 3EQ7A 1CUEA 2O7RA 2RHTA 4RE5A 1XRMA 5HQ3B 5CW2A 4HTAA 3C6XA 5HF5A 2NW6A 4GDMA 2ZSIA 3ANSA 2XUKA 3DOHA 2ZYIA 3I1IA 4NMWA 5LKAA 1NX9A 1JJIA 4X6XA 1QFMA 1ORVA 4Z49A 2CJPA 1UT6A 4BCBA 1GQRA 1DQZA 3LCRA 4N5IX 1MNAA 4DNOA 2BGRA 3A6ZA 2XB6A 3HEAA 3WJ2A 5IH7A 1CUHA 2OGSA 2XMGA 1SFRA 1LLFA 1EVEA 1UZAA 1CRLA 1G5FA 1H22A 3AIKA 4EY5A 1CUZA 4H35A 4HZGA 3D0KA 5HFNA 1FFBA 3EQ8A 3FAKA 5FLKA 4UBKA 3FOBA 4M0MA 4OPMA 1P0IA 1DWPA 2DQYA 3H2JA 3OTQA 4KR0A 4JNCA 3VJKA 3KOOA 2G63A 1JU3A 3WA7A 4Y2RA 3IUJA 3VJMA 5EHZA 3WYDA 3A2NA 4OU4A 5D3ZA 3FYUC 3ZPXA 2WU4A 3BIXA 3JYHA 4X6YA 4PSDA 5SYMA 2FJPA 4H7IA 2JEZA 2AXEA 1C7IA 3HRHA 3G0GA 4IH4A 5ALEA 1LBSA 2PSEA 4BATA 1QTRA 2GBCA 2HFKA 5ALVA 2EEPA 1XZDA 2YYSA 3WLAA 4ARBA 7YASA 3EF3A 4PQEA 2PSHA 4DNPA 2XMSA 4CG2A 5JD6A 5EIHA 5KWIA 3O4JA 4F0JA 4YK7A 2C0QA 3AILA 1Y7HA 4FBMA 5HCUA 3PFBA 2HU7A 2CKMA 5IVDA 3SC2A 2WTNA 5AKEA 3C5WP 4U2DA 1YAHA 3FYTA 4EHBA 5DYYA 5LZ2A 2QTBA 4QA9A 1B6GA 4X95A 2PPLA 4U2CA 3ICVA 5JZ9A 4EY8A 4BRSA 1NU8A 2VAXA 3DDUA 4EZIA 1Q0ZA 1WPXA 2HADA 3DJYA 5C81A 1LPBB 5DJ5A 5FRDA 5AI9A 4PSUA 4MWSA 2HM7A 2XUDA 4XIIA 5C7YA 3ZLTA 3C6YA 3Q8WA 2JGEA 4AZ0A 4ARAA 4X7BA 2XT0A 4OD0A 1AURA 4B82A 3DD5A 5A2GA 3AZQA 2YASA 3GFFA 2OXEA 5K3BA 4RE6A 4AQDA 3DYIA 5A7FA 1VOTA 3FNBA 1DT3A 5E4JA 1MJ5A 1XZMA 4ZREA 4GW3A 4EY4A 2QUBA 3MUNA 3C43A 4B9EA 4DSAA 4IO0A 2PU5A 1QTIA 4ZI5A 1CEXA 2WFMA 3OOSA 2WUFA 3PI6A 5AKKA 4K2AA 1FFCA 3D5EA 4IHAA 4X94A 1AZWA 5AICA 1YB7A 5DLPA 4QNNA 4K5QA 3AZOA 5E4TA 1PJAA 3I2IA 4AO7A 1R9NA 1LPPA 2WILA 5AK3A 1OILA 1G66A 3HABA 2PX6A 2HA4A 2WM2A 2WJ4A 1ZGCA 5EFZA 5AH0A 4FFVA 4N5HX 5FOQA 4RGYA 3LLCA 3I6MA 4AZ3A 4MXDA 2XUIA 1A7UA 2W22A 2WHPB 3WL8A 5DNWA 2E3JA 1AGYA 5YASA 4J0GA 3CCCA 4DIUA 3H1AA 3V48A 4BE9A 3DCNA 3GZJA 1M33A 1VXRA 5FKJA 3A2LA 2ZVDA 3C5VA 3NOXA 1GKKA 2VSQA 1J1IA 2XMQA 1IUOA 2CB9A 4X90A 3WMRA 4DSZA 2WUDA 3B5EA 1CUFA 3CCBA 2HL6A 4UBNA 3B3QA 2XMBA 1RWQA 3DKRA 5JD5A 3R3WA 3VVMA 5HF6A 3V1MA 2H9YA 5AK4A 3IIIA
chains in the Genus database with same CATH superfamily
2X0FA 1OH6A 3LBFA 2I29A 2I7XA 2AEFA 3O8DA 3QVMA 1BSVA 2IA5A 4YP1A 2L82A 3TFOA 2ZUFA 4MX8A 4BNXA 3K1ZA 3FNIA 4PU0A 4QOSA 3QU9A 4QU9A 3AVYA 4HUQA 3DVQX 1FBTA 4WN9A 3IQGX 4KPGA 2M6KA 1QRSA 2J6BA 1FJGB 2GERA 4FC7A 4M7PA 5KNCA 2DU8A 2I4OA 2XDQB 3ILSA 1OTYA 2VHWA 3GBSA 4R01A 2ZXUA 1PFUA 2OORA 2G80A 4A8HA 1KVTA 1NBOA 3F3MA 3TEFA 4XI9A 2W2PA 2JANA 3N2KB 4OB7A 4DQUA 5ERXA 4HNVA 3QEBZ 1LGYA 1ISJA 2LKCA 3LY9A 4F56A 2PE5A 3JVUA 4G1VA 4BJHB 2D59A 1G64A 2FN8A 3KXDA 4IMRA 3FMFA 3KFVA 1CF4A 2ZW9A 1M1NA 3LTNC 2VNJA 3UENA 1NE7A 3SJBA 5EJEA 2W42A 1YZQA 1PQYA 3MOGA 3NHPA 1SD1A 3EVTA 1J24A 1EP3B 1W4ZA 1QHHA 1NJ5A 2I8LA 2P9JA 4K9KA 4R81A 5DE3A 3NT5A 4TLDA 1YQDA 5CFNA 4QVGA 4P4SA 4A8JB 4FYYA 2R1TA 1OX4B 3DKPA 4Y0AA 5CTAA 4F5WA 4NDZA 3VKFA 4XYLA 4X93A 1RRKA 4RCVA 2YDXA 3F1LA 4XGNA 5EESA 4RGQA 4C4OA 2AOTB 2ESRA 1EA5A 3F67A 2QE6A 4J4TA 4NU0A 4R2LA 5FBRB 5JJCA 4ND5A 3WS7A 2QQ0A 3QU2A 4J0EA 5C1DA 1N0WA 1F60A 1SHLA 4ENWA 1RBMA 4Q9JA 3ON5A 3ZH9B 3RS9A 5B1EA 1FXSA 1AV6A 3QFHA 4MV6A 2AK2A 1YKFA 3IJ5A 1IEXA 2X3YA 1GAEO 1MO5A 1DKQA 2XT6A 3OA0A 1VGVA 2IJGX 2P6MA 2PN1A 1A8PA 2F1HA 4H3KB 1XNRB 3M4ZA 2FPRA 4BBAA 2WQ6A 5U4XA 2R7NA 4WKGA 2M6RA 4BUZA 4UU7A 2REOA 1QFZA 2COUA 5E6UA 1QDEA 3MF4A 1I7DA 5C1BA 4IYJA 1OI2A 3RJMA 4AF8A 4RTPA 4HGQA 4EPVA 1VLLA 3WQHA 3IP3A 4J9UE 4RTNA 2ZIAA 3E5NA 3WXMA 4R9VA 3FJOA 4RESA 4BNHA 5EHGA 5LUAA 3R6DA 1SXJD 5KX5F 3AHHA 2CK3D 1EIWA 3GELA 3QE4A 3I0NA 1XZEA 2RG1A 3F74A 3SDSA 4TV9B 1E0JA 3FMPB 2I99A 4DWVA 1YIOA 3SXUB 2QLBA 2YFHA 2H00A 3DCYA 3AERA 5E4YA 5ECYA 1A9OA 4EW3A 1U0JA 2JH8A 2XVYA 4UTPA 4DHEA 3QA3E 4Y2XA 1IMJA 5ALMA 1P6XA 3K1AB 4FMCB 1RWPA 4ID9A 2B98A 4YASA 4WLVA 2HF8A 2X0DA 1EFKA 2WNHA 3HSSA 4JODA 2O1WA 4M0FA 2KS6A 5L4SA 2AQIA 1KH2A 1MQ9A 1Y5MA 4N0MA 1UOQA 4DJTA 5H5JA 1FX1A 3HXQA 4IP0A 2VRBA 2HA3A 1CXZA 4IIEA 4N3BA 4C20A 4O2RA 3H0KA 2QBYB 4FEEA 3AJ9A 1YOBA 3QWIA 4JROA 2Z6UA 3EEBA 5JR3A 1GTSA 4BB0A 2Q9UA 3KSBC 1SUIA 1CKEA 1RRVA 1AQYA 1PP4A 3S8YA 1HPLA 2WD9A 3JZFA 3SJCA 1U2GC 2JAUA 1NNUA 2H08A 5T6MA 1JWAB 1QB8A 1R6DA 1R8SA 2CMGA 4WOCA 3V4OA 3B78A 1DKUA 1WZCA 4ONEA 4J94A 4XCQA 3U6BA 4KWTA 1TW3A 2QG4A 3RTAA 1DCMA 2KE5A 2FPWA 1ODKA 1Z4MA 2BFCB 2XJ4A 1WDMA 3JTEA 2VS1A 2VI5A 1IBSA 1CUJA 1R15A 4UU1A 3U19A 1EWRA 1SBZA 2EL7A 4OGKA 1GG9A 3FGPA 3LZDA 1KVRA 2QF7A 3ZXIA 2DEUA 2CLIB 4F5YA 3N6RA 1ISIA 3A1SA 1GNSA 3WOVA 4GSKA 1MUUA 2R8XA 3UKJA 1DDIA 4BFCA 5G3YA 3VPHA 3FROA 1G7RA 2BMVA 3NBZC 2PT5A 4OQ4A 1NVTA 1EINA 1PX0A 1U0FA 3C3CA 3F5FA 3MWLA 4HWRA 2YFQA 1BVYF 4NV3A 1JPUA 1JXAA 4YWHA 2FSSA 3LT4A 4X44A 1Z2OX 4PSAA 1SUPA 2QVLA 4DLZA 4XWTA 3ZW8A 4CKEA 3LQ1A 1S9HA 2C5AA 3HKCB 1O96B 4RD6A 5EZYB 3ZD6A 5CA0F 2H85A 1K7FB 1L7DA 2A7XA 4ESVA 1A9YA 3T9BA 1ILWA 1E3QA 1FLAA 3UBMA 5IXSA 4BFSA 4HOYA 2OMEA 3L9XA 5CIQA 5H4GA 4AO6A 4DFDA 5A0TA 1JMYA 4CMAA 2BKVA 5L45A 3AY3A 3BXGA 3DBIA 1P61B 4B80A 3IDQA 3O6VA 4MWDA 3DFZA 1X9IA 1T2AA 2WPDD 3S3TA 3GEHA 4ALIA 1P73A 3LGSA 2QJOA 5LJLA 3R24A 3F6EX 3H4VA 4MR8B 1KKLA 1DMSA 3O8RA 4EJ2A 2QNBA 1V95A 4ADSG 3PITA 3I2GA 5JCOC 3DMDA 3PDHA 3VMMA 1DEOA 4M8SA 3MINB 4O4LA 4F3YA 3WRXA 5ETJA 2JLBA 5CG2A 4JYZA 1CJVC 1MTZA 1ZJ4A 3W6UA 2VF5X 3QXXA 4HBGA 2WJPA 4P3XA 1SC3A 2H7CA 1EGHA 1T0HB 2JFYA 2OGUA 4P08A 1N2CB 4ZRNA 2WPNA 5G41A 3SSAA 3KZKA 3WL4A 4GYKA 4DCGA 1E96A 2AZMA 3SIXA 4DPLA 4YR9A 2GKOA 2I2BA 4X20B 4DXDA 4UHEA 2IOYA 4JR0A 4W6QA 4RSHA 4HVTA 3U5TA 1R74A 2XB8A 3W3AH 4BLVA 1U2QA 4XVRA 4TYNA 1P2TA 2K7ZA 1UZNA 2ZU0C 4MUNA 1L8AA 4KUHA 2GCOA 3TLBA 4ZRDA 4L72A 3CKKA 2XADA 5JVDF 5MDHA 4GOND 3SKVA 4RWZA 2UUCB 3V00A 2EJVA 5AFSA 2P4UA 2QYHA 3G23A 4LN1A 3NKLA 4R1OA 2GPJA 3E58A 1QIIA 5D5PA 3WKBA 3KCQA 3UMBA 3CF4A 2AMVA 1PL8A 3VYSB 2H48A 1N4AA 1UZLA 4CF4A 4CJXA 2V3CC 2FI1A 3CHYA 3GV0A 3AV0B 3T3MB 1U0EA 1FFXB 3FWHA 4U0KA 3EBPA 1YFZA 4LJLA 1WG8A 1JDSA 2ZRBA 5ENDA 2CFSA 4FC6A 4AB1A 3HCAA 1KARA 2A0UA 3L1KA 4G8BA 3H5RA 2FZGA 2MYPA 5LM3A 1OZAA 4W5QA 2X4IA 2WBLC 5H9WA 4P84A 3DDSA 4M1SA 1JKXA 4I3FA 2Q4BA 5AOBA 4Y1FA 1LPOA 5IABA 4XWOA 2Z3WA 3JQRA 1MJHA 4EL5A 4MIYA 2JBWA 5KHLB 3AR3A 1VIVA 1FX0B 2ZS9A 3OBBA 4JUDX 3I6QA 5B53A 3TN7A 4LFBB 1CR0A 2BCJQ 3C4QA 1GPBA 4AICA 3GZNA 1GQSA 3D0OA 1GA6A 5DHQA 4WBSA 4F60A 1RVV1 3HGQA 5CLFA 3PT5A 2NT4A 4EI2A 2UV8A 2VO1A 3ZTYA 3RU3A 4EA7A 4KXQA 3LBYA 4P5PA 4RVOA 4KIGA 3SX2A 2DULA 1QIJA 1US8B 2QUHA 4ENQA 2JLSA 3LDFA 1OAKA 1R0WA 5LBIA 4TS3A 5LIPA 3CB4A 1U7DA 2IYFA 4ZO9A 4AJPA 4QDZA 3EH1A 5FORA 8MHTA 2EQBA 2IBTA 1SHUX 3QEKA 5T57A 2Z0MA 2DR2A 4Y67A 3GGGA 3ZHTA 1CQIB 4WESB 4D9IA 1BRMA 4DMCA 1JFVA 1O77A 3K30A 5HJ7A 3FCUB 4DWOA 2BMEA 2IYUA 1F6BA 3OC0A 2R5WA 3TW6A 1SD2A 2NO7A 2AYZA 2B7CA 4Q3AA 3BD9A 1GFZA 2D5CA 3IUQA 1KFCB 3LUKA 4BIIA 1MB3A 4BB5A 1ILEA 3HS3A 2C1EA 3C85A 3NC1C 3NMUF 4M9ZA 1J8MF 4LYYA 5D85A 3WDMA 4C5AA 4ER0A 1GXSA 5BV8A 5IXJA 3QKUA 1FPQA 1X1DA 3HR7A 2IKQA 1I13A 2NZWA 1W59A 3FDZA 5TVKA 3NQ41 5DX8A 1DCTA 2XHEA 3SI7A 5IAEA 5EJIA 3OQIA 1ZVJA 3QBVA 1V26A 2HT1A 1IG3A 1C41A 5BW8A 3EWAA 3NTVA 4LKRA 4LGYA 1B0PA 4DNFA 2VH1A 3FOEC 2JKYA 3BQ9A 3L7NA 5CLLA 3IAUA 2ONCA 4JKOA 4I55F 4L74A 1TAQA 4M0DA 4Q9LA 4AJ1A 4DA8A 1EYZA 2H1RA 3E6AA 4PAMA 5F2NA 5ED4A 1R16A 4OP3A 1UIMA 3KXKA 3RAFC 1QQ5A 4LYDA 4WTOA 1BX0A 1CVIA 1NNSA 4HAYA 1AF4A 5EE1A 2P6OA 3UT5B 1ESNA 4O33A 2OR3A 2O05A 4RJ2A 4LGCA 2FW6A 1TZCA 1XCGB 1EVZA 2WD7B 4WNYA 5F4BA 2R8YA 5LKRA 1CV2A 1OUMA 4UUNA 1DIOB 3ORHA 2RIPA 4KUEA 1J8QA 4AJ9A 2PUCA 1NVUQ 1C1HA 1JFSA 1RYYA 3AY0A 5ARBA 1M2VB 1Z4OA 5EXTA 4E2ZA 4CU5A 4NZOA 4LWOA 1QH8A 3O3OB 4WBXC 3DKKA 2JFUA 2HK7A 3IPXA 1V6CA 3GROA 4JQYA 1QAMA 2CZCA 4MLPA 4DQ0A 2ODEA 2ZB8A 4GZ3A 2D1YA 4P34A 4ZVTA 1LVUA 5E1BA 1YR3A 4CG1A 1HFEL 4NY1A 2GESA 4M4SA 3MBOA 1ISRA 4ZYVA 3S2EA 3TLXA 4PYJA 4LCBA 2YXLA 1VMKA 4BRZA 3ZS9A 2WQ7A 1U1GA 2DBYA 2ZUCA 3UKOA 2KLHA 2YUIA 1R12A 2A59A 3NJ4A 3PGKA 4WNCA 2NU8A 4BMYA 1ZNXA 5IJ0B 1FNBA 4CLOA 1KBQA 1VKZA 5AOAA 1QQ6A 1DC4A 3LDGA 5JYDA 1YA6A 2JA2A 1GRNA 1ZGJA 5FLXA 4HAIA 4MWCA 5G40A 2I6SA 3BWVA 3EIXA 5CRIA 2OYRA 5TT1A 4RTQA 4I7EA 4W1RA 1ZIPA 1WEKA 2XIJA 1MPTA 3D4PA 1JHMA 3HA3A 2H57A 4FE7A 1N0HA 3RRXA 4JP8A 1BFKA 2DPLA 2O2HA 2PQMA 2Z8XA 4FHEA 4KYIB 1IQ0A 4EA8A 4ASUA 5LNK1 3AQ4A 3ZI7A 3RWOA 1KI7A 3TINA 1HWYA 4B0PA 5CDFE 2VPTA 3GVHA 2O8BB 4DEVA 3NEJA 5DI9A 4YDQA 1DBVO 3UKDA 2WVGA 4LXQA 1IUKA 3F71A 4AJIA 5E6SB 4P0PB 2OZLA 1GRVA 1UC8A 3PC6A 2IW3A 3Q3HA 4I4TA 4G97A 1NR7A 5CCEA 1FYFA 1O95D 4Y2TA 4LC9A 4RM2A 2R7AA 2H3HA 5G1PA 1P4RA 3DF7A 4MQFA 3THWA 3RIEA 1EVKA 1PT6A 4G2NA 5BNTA 3WLNA 1R50A 4K9NA 2OPBA 3TG8A 2VIIA 3KJZA 4BU1A 1SQSA 4E7OA 1EXMA 4I5FA 4WAUA 1KE2A 1CTQA 3I8SA 3ISTA 5BN3A 4URYR 4LJ7A 3T7IA 2BBOA 5HZHA 3NAGA 4CMKA 2RIRA 1EGAA 1QVAA 2QRQA 1GKLA 2VUUA 3L01A 1J0EA 3CLKA 1Z07A 4RYDA 2VAPA 3MXOA 3T5AA 4W6ZA 1NIJA 2LD4A 3ZHSA 3JYOA 3THYA 3ENKA 4PYKA 4WZZA 3WVNA 1ZP6A 1B1AA 1SQ6A 4LX0A 1CU1A 3KTAB 5H59A 2VCYA 3H5TA 3CUYA 3CFYA 4LOIA 1KK0A 4LYEA 4YXFA 4PHGA 3F0TA 4YBRA 4GWLA 1IBRA 1WMDA 2A9QA 3PDIB 4G4JA 5IK2A 4B3XA 1A9QA 2GHRA 2ZYVX 5CEFA 2J7PA 2ZS7A 1NM5C 1T10A 2YUTA 1NW4A 3F3YA 4HN2A 4K0RA 2J3JA 3L0SA 1S5PA 2JIOA 3AX6A 3L1HA 3H4TA 4OAOA 1RI1A 2GVNA 4QEKA 4BPRA 1P75A 3PQFA 2ET6A 4QNMA 2AFIB 1SKAA 4NZNA 4MVXA 1KEEB 2BGUA 4F6CA 1G21E 2QT1A 4KQIA 2G8LA 2J85A 3NCHA 3PEYA 3G8CA 2RGWA 3FLAA 3QEMB 1VGRA 1PNQA 1O0BA 3JYQA 4JL5A 2VJAA 4UM5A 1KU6A 3KEFA 3ZWYA 3HVKA 1JW9B 2OB1A 4A2WA 2MSCB 2QPOA 5EE3A 2EDCA 1XA4A 1NYLA 5BWCA 4U7FA 2QXTA 1K63A 1K3UB 3PUXA 2QD5A 3DDWA 2I0FA 4HS4A 5FYQA 2JLVA 5AI5A 5TGDA 3Q9LA 2C95A 3LO5A 3ABSB 3FZYA 3ZYCA 1TEZA 3JR7A 4MS1A 1L5GB 4K8OA 3KJFA 2NZJA 3ESBA 1G2PA 3HU2A 4F2HA 4ZJYA 1IMOA 5JH7A 3MMZA 3AUKA 2COKA 3HBLA 3PEWA 2QTTA 4FSHA 1OW3B 2KQUA 5F3DA 3I1FA 4GVLA 4MVJA 2RB5A 2R47A 3OQVA 1QS0B 1B4DA 1W8IA 2WW8A 4XIJA 3C7DB 2HDHA 2FVXA 1Y9ZA 3EZXA 2LGJA 2ORYA 3EIHA 3FFTA 3NO4A 3PIIA 4MRVA 3AVQA 1RYMA 1S01A 3JAKB 1SB9A 3Q3EA 5CT5A 2XZPA 4LI0A 4BO6A 4E13A 2Q07A 5JNSA 1N9ZA 1BJKA 1ML3A 1OPRA 3OUTA 2IV2X 4RJLA 4LNUA 4F9TA 3BGSA 2Z5FA 2HN9A 3IUNA 3DW1X 3LLVA 1DUVG 2Z2ZA 4DRXA 4GBGA 2GM9A 4RD1A 4E5UA 2Z6QA 4G0NA 4B81A 2QT9A 1JG6A 2O14A 3JQGA 3EK2A 3KTFA 4CL8A 2Y76A 4RPGA 3NHWA 1E4VA 3OPVA 3OCXA 2BEUA 2EW2A 3TJZA 1ZM3A 1CF2O 3QWHA 4LVUA 1MTOA 4JLNA 4ZVQA 4R2JA 2JGFA 3C70A 5B1DA 2VSOA 1EFUA 1ZM4A 2A88A 4WWHA 5G0WA 3U7GA 1S89A 1N2CE 1YZHA 4LKOA 4EFLA 1L6IA 3HP7A 3JQ7A 3V7NA 2J1LA 1LDBA 3LT1A 1MORA 5KNBH 3CW2A 2FPIB 1BXRA 2BEWA 1AKVA 1Y9AA 2POQX 3ADPA 2DG2A 4FJ0A 4M1QA 1VSVA 3R20A 3SJZA 3THOA 3FCAA 2C94A 1NMEA 4BTEA 5KTKA 1JBEA 5KSPA 1G0NA 3ZGZA 1ECLA 3DE1X 3PA6A 3MRVA 2P11A 4LBWA 2UXCB 4ZJPA 2B0JA 4YT4A 1MB9A 1WSAA 2HCFA 4J3JA 1CJTC 1G19A 1I7LA 2R8BA 2YWRA 4BY9E 2EATA 2BSAA 4EYSA 3CLUC 3QKWA 4J1SA 5AJYA 5CB8A 4NNPA 3CX6A 3AB8A 1J9GA 2CCKA 3IIEA 3SDBA 1NT4A 1II8B 1N4DA 1TJ4A 3CWZA 4Q7JB 2J67A 4QFDA 1A88A 4WI1A 4GKKB 3U7JA 2M1XA 1BOFA 3AUJB 4D2IA 3SE7A 4F45A 5AT1A 1Q57A 1TVKA 2SICE 1AVTA 2PYDA 3ZW7A 4EW2A 3OZUA 2DT5A 4X1IA 5IAGA 5C35A 4KHPB 3R0VA 1R0BA 1MJGA 1ZRMA 3I37X 2IHJA 4OGLA 4PO8A 1GZHB 5CNJA 3MPUA 4CF5A 4YIHA 4ZVKA 4CTJA 4I9UA 1CS0A 2B5VA 3GJQA 1QTNA 3DMYA 4F9EA 3V9AA 3U3JA 4OLJA 1XC7A 2FEKA 3JWJA 5B58C 3KHKA 3AI1A 1T6ZA 1UBGA 1NQVA 2VJOA 5CR9A 3BL8A 3PXXA 3LX4A 3QV2A 4Z0PA 3GO4A 5CH8A 3OU2A 2BISA 2BGNA 4JUAA 1GN8A 2CEKA 4MEBA 2LKDA 1FQWA 3C2QA 1KJ9A 3E7FA 3ZXUB 4OLBA 4JEHA 2CLFB 2QRVB 2VDRB 2B1QA 4HFJA 2P79A 3CRNA 1M7BA 4Q48A 4OP2A 1B7GO 5IJAA 4GI3A 4ZTBA 3CZMA 3UMCA 1U6JA 5A4FS 1XDUA 2ZJ5A 1C7JA 5ALJA 4FYHA 4MP6A 3UB3A 3KUXA 3OZGA 3U0VA 2JJ1A 4Y6LA 4B6OA 3P0RA 5EUMA 2YXEA 3JWEA 3RREA 1IRIA 2CFTA 3R5HA 3GLQA 3FCEA 2C9CA 3PE6A 5KQRA 4NZZA 3MTIA 1VYHA 3AU8A 3AW9A 3OQHA 3PFNA 3GX1A 3SYTA 1WZ2A 2R9VA 2B1IA 5DPMA 3C98A 1CE8B 1U4OA 5AXAA 3K0HA 2MWMA 4G07A 5DSXA 4E1BA 4RFSA 2P4QA 3T06B 2AUNA 5K2MA 3SPXA 1DQYA 5AO9A 4K9RA 5D87A 4RTRA 3VR3D 4CIXA 4FYMA 3LQRA 4J6FA 3B1YA 1M2FA 1CJBA 2C78A 3RRJA 1L5SA 2Z56A 1O9BA 4CFSA 1JJFA 4HDAA 5JCJA 3WLRA 2P3QA 4ZAWA 4M0LA 5CLIA 1U3WA 2BUBA 2JVJA 3B8HA 2I3GA 4EA6A 2GD2A 2GJ9A 1XAHA 1Z4IA 2Q1XA 3ZVKA 3F96A 1A2BA 2VJQA 3EHEA 4KWHA 3P97A 2DF8A 3HLYA 4RIHA 1M1YA 1ZH8A 2VDUE 2P77A 5LMCA 1YQXA 2F62A 3DTVB 3KB6A 1IK6A 5BW6B 1VA4A 3O75A 4AJHA 4YT2A 1I51A 2A5LA 2B25A 4YRCA 5LZ9A 2GKSA 2PLWA 3VR5H 3QI7A 1PEYA 2R6HA 3PDUA 1WZUA 2HGSA 4UEWA 2JF0A 5KOIA 1B0UA 1ESMA 4YAUA 1T0UA 4FSDA 1T3ZA 3M5DA 4BMZA 3JD2A 1H6CA 1VXOA 3IRVA 2WV7A 4M53A 4LF4B 4IKOA 4GBMA 1X70A 3CIFA 3QXSA 4YLGA 3KSAC 2J07A 4U8HA 3H7AA 2C2WA 3VU9A 4DVGA 1OU0A 5AVKA 4HQ6A 3WKAA 5JJBA 3IBCA 3UJCA 1DTWB 3L04A 2Q3JA 5KMGB 1JQBA 1TXGA 2P0EA 1P74A 4XQCA 2LIPA 4B6JA 4WA7A 1VA5A 3HB1A 5JS7A 3IAEA 1NT2A 1JU4A 1K6JA 4RTJA 1AXRA 2ONKA 3KPUA 2BKLA 4XTCS 4YJ3A 1Y4AE 4PIVA 5FPQA 2FJ0A 1RP7A 2PZKA 3SYMA 1BN6A 2XSZD 3LHDA 1L7OA 5M3BA 4NULA 1S3SA 4FZJA 4RK1A 4HRXA 3I52A 3IRUA 1UXOA 2CWDA 2JKZA 3ETEA 4IDCA 4UMDA 4EFDA 3BEOA 4JP1A 4MLDA 3U37A 2X0RA 2MYTA 4HUQB 4LBYA 2KBFA 2OHJA 3MJTA 4MJXA 2XGSA 3D6FA 3GGOA 4WN9B 3DS8A 1E62A 4YLYA 3WLMA 2BFOA 1VLMA 1MO4A 2ENWA 3UUFA 2N0SA 4BQPA 5GZ6A 5EZSA 4KO3S 5F3RA 2VSFA 3PKIA 4QDOA 5JY1A 2IITA 2D1RA 3MTEA 4L7VA 3VGPA 2OV1A 2IV7A 1P2BA 1ZQ9A 4BVKA 4DA7A 4LF5B 2C88A 2AFHA 1YQUA 3FVRA 4QD3A 2AFRA 3FA2A 3ANYB 2P2DA 3GIWA 1ECCA 1WAMA 1EQ2A 1L8LA 2DPHA 1OCEA 2O50A 1YBMA 1N1DA 4GOOD 5TE9A 3WK7A 3ZXYA 3MNFA 1NR1A 1M1NB 2H59A 4MUBA 2BTOA 4FNAA 2FFAA 3SC4A 3TTVA 1Z22A 1W47A 5LYYA 5JT1A 3LC2O 1OBFO 5JO9A 2OKGA 3TD2A 5EJ6A 4W5HA 2O7NA 4W1QA 3F46A 4LC1A 1QHHB 4IIJA 2HWWA 1ZJ5A 3N2LA 4FXPA 4GI2A 5F64A 4P4SB 2FMKA 4GPIB 2R1TB 5DDIP 1JAYA 4KDEA 4D3SA 1NMYA 3N75A 2FE1A 1LPSA 1OWMA 1TO2E 4I6EA 3ZBTA 3FSGD 2PMWB 4Z9BA 2AOUA 1Y7TA 2QW8A 3ZGLA 1VL6A 3E27A 5E7QA 2H1SA 1L2TA 4CEIA 1QP7A 4P7BA 1DX6A 3CEJA 1GNQA 1G4UR 1LC0A 1TA9A 2CXQA 2ZRFA 4L8WB 3ENQA 1DQPA 4X61A 8ABPA 1C7RA 3U1BA 2JLYA 4LZZA 5EUCA 1JX6A 2VHZA 2B92A 3AUAA 3CINA 1KO4A 3WGKA 5D6OA 3S40A 3VTKA 4OREX 3TSZA 3MWEB 5BW4A 5LQDA 4NOKA 3ZE7A 2KSQA 3UMRA 1DJMA 5FADA 3VFDA 4FZRA 3UBTA 1VJGA 3CG4A 5FTWA 4OEHA 5HIMA 5EXDA 5E6UB 4YONB 5JYEA 2PTHA 2G77B 5DB4A 4CUKA 3QIAA 4YPFA 3I64A 1TJ3A 4G1CA 4JH0A 2DXIA 2AKYA 1C1DB 2FZWA 1V2HE 5CLJA 2PGIA 3IEPA 4X92A 2FDCA 1UC5B 1DJNA 1R9GA 5D84A 4I9GA 4G5HA 3O9ZA 1Z9BA 4WMLA 4AP9A 4CN9A 4RVFA 1GGVA 5ALOA 4Z4GA 3ABQB 3QJYA 2Q45A 1X7ZA 2DBQA 1HNNA 5TLSA 1IWOA 2Q5OA 2D54A 4BP1A 5DLQC 3RSOA 4EY6A 3B3GA 1ZW1A 2HBQA 1LTQA 1ZH4A 1OIWA 2SKDA 4RZUA 1UKBA 4MULA 3PNBA 3RYFA 1M1XB 3KSMA 3IEIA 4G0ZA 5AM2A 3AEQA 3G2LA 1JHQA 2PT7A 4UQLA 5EERA 4IIBA 2IUSA 4KXXA 3MCWA 2X22A 1FDTA 2P9TA 4DLNA 1X1EA 3JXEA 4QUGA 1F8UA 1TADA 1QH9A 2IYYA 4TN1A 1MN6A 2ATXA 2QMOA 4LJYA 4M1OA 4O2LA 2FZ5A 2I4TA 3MSXA 2I65A 2YWEA 1THTA 2N3ZA 3FOWA 1X1AA 5GAJA 3K9FC 1Z6TA 3Q2IA 3HCWA 1P1KA 4K9OA 1XFDA 3GDOA 1Q0UA 2M1ZA 3CLTD 4H7JA 3RBXA 1G63A 4CM6A 6ADHA 2X23A 2IXTA 4OHXA 4ARUA 5KTRA 1RKVA 2I2AA 5LZ7A 3Q5DA 2APJA 3W9BA 3Q8MA 3NBFA 2Q2OA 2F4NA 1KJZA 1YDMA 3MB8A 4DZTA 1AGPA 1ZCFA 2JRLA 3M9XA 3RIXA 1P1RA 2V1XA 1Q3TA 5HM8A 4V0ME 4XVHA 5JEEA 1WHTA 4PFKA 4EVRA 3FMGA 4Y2GA 1MC5A 1VB5A 2HWYA 5L7YA 5I3ZA 5ALLA 3WHLA 5A9RA 2XNHA 4Q1VA 5AKGA 1NJSA 4AS1A 3KAPA 1XZIA 2C58A 4BMCA 1E2FA 1ZIOA 2R1VA 5BYJA 5KVCA 2P2YA 4BEJA 2G76A 1D04A 4UHDA 1HH4A 3V34A 3ZHYA 4CDRA 2C77A 1U4SA 4XZ3A 1E6EA 2A1TS 2P9BA 3PGJA 4OB6A 3SK0A 1EXVA 1JIIA 2I03A 3DB2A 5IEBA 1I3LA 4QLOA 5K3CA 2QL7A 4ISBA 2RCNA 1Q0QA 2QQGA 2YIVX 2VDMB 3IAM6 3LUAA 4KN5A 4OF4A 3TDKA 4CLRB 4DA9A 2X86A 3M83A 4IHJB 2H16A 3RF7A 4EEXA 2OGZA 5FUBA 3PENA 2J0UA 2ZCJA 3TL6A 4DJDC 4HLUC 2X8JA 1Y8AA 2X2EA 1KMQA 3P5SA 4YECA 3FCOA 3KQQA 3TR6A 4F96A 4LE1A 4QX6A 3GG2A 4UNIA 1Z4NA 2ZBQA 4HFMA 2IV3A 3L7MA 4RTSA 1UEXC 2GN4A 1XEWX 1L5MA 3C1TA 3PCRB 1RLJA 4JMPA 4KI7A 5IBQA 3VV2A 1KZ9A 1Q7TA 4H18A 1H3NA 1U2RA 2ZE5A 4NMXB 1BHSA 1QWSA 3H19A 4TROA 5IYZA 5AM0A 2GSWA 3HYCA 4IXDA 4D96A 1CZRA 1UQRA 1NUQA 1KIFA 2JI8A 3ROPA 3SJAA 5BNZA 5F7ZA 4O4LB 5ALZA 4ARIA 1VI2A 2J5XA 2YMMA 2ZSUA 5CH5A 2OBXA 5GZ1A 3Q85A 4CF6A 2A84A 2V7QD 1YE5A 4G5OA 1MAHA 1MO3A 5FUVA 1WXXA 1PG2A 3DZFA 4KIUA 2C1ZA 4RMGA 5JALA 5HQ3A 2PGNA 4LHVA 1XV5A 2FSVA 1WWKA 4LOKA 1R6UA 2EC5A 3SEAA 4XQ0A 5HF9A 4Z4CA 3BH0A 2IDKA 1H85A 1Y6RA 4H17A 3IAFA 4RQAA 1S2MA 2P40A 3IP6A 3GRVA 2JJ2A 2P9CA 3KJIA 4BLQA 4DBVO 1T5TA 1FSGA 3E1GA 1GYPA 2WP0A 1U1CA 1WOMA 2DX7A 1FNDA 1F8XA 2YWJA 3B85A 4N1AA 4QSMA 2AJLI 5ALRA 1N75A 3TMKA 2GCOB 2E1RA 4D4IA 2XYVA 4YUAA 1QF6A 4PZLA 5AIAA 1W48A 4C9BA 1KL7A 4IRMA 5A71A 5E9QA 1JHXA 2Q5FA 1UJCA 4MKXA 1T2DA 1YIAA 3WNDA 2I2WA 1JJAA 3DTVD 4RLFA 1Z17A 3HMKA 3SM9A 2EX1A 3OP4A 2JFPA 4WK4B 2Q8QA 3GLUA 3TPZA 4IO1A 3ZQ4A 1GAWA 1FP4B 1VPLA 3F6CA 4PY2A 2Z1MA 5KTYA 4KGVA 2JCYA 4P38A 3MHTA 1SELA 1OXTA 1QGAA 5F7OA 2B0CA 4OHVA 1SHKA 2XLBA 2RHWA 4HYQA 3M6WA 1WP4A 3D54D 4EB0A 4L02A 3RVJA 5DTMA 3QUQA 4TMZA 3U61B 1NFFA 5AJUA 3VOTA 1T6BY 1MKYA 3BRWD 3MGGA 3O2SB 2I2DA 4AG5A 1CUAA 1P8JA 1Q0HA 2DH5A 3AEZA 4GP6A 5KU7A 1QO9A 2JGIA 1SBTA 1KERA 1ODJA 3LKBA 4XGIA 1NZDA 4M99A 5GGYA 5CVCA 3RS3A 4B48A 4EUKA 2FH5B 2ZYWX 3GZNB 4FSXA 4RQTA 4TUYA 2RGCA 3LCVB 5JLAA 4DY4A 5BXQC 2GCIA 4YMSA 5CCDA 5CJPA 3S2IA 1BMDA 3CPHA 4RUKA 3P9PA 4L15A 2PCLA 3OPMA 1D2AA 4FILA 5FX2A 3RNLA 1RPJA 2IOFA 3KUDA 5KAMA 4L4XA 1JQDA 3N8GA 5B2ZA 4OBBA 1U7HA 1JFFA 3N1UA 3LV8A 5ESXA 5CDSA 4DGQA 3KT8A 1O6BA 1U80A 4BUJA 1NJ2A 5KNCD 2CHGA 2QDXA 4R16A 3HA7A 5J2UA 3K5IA 2O8VA 3REQA 1JT2A 1XNHA 4ZAFA 2WAXA 1YB1A 5K99A 5BR1A 3RVNA 5K3SA 3VR0A 2XB9A 5AVSA 3E9CA 4D82A 4DIDA 1ABEA 1T9AA 3GAZA 3OZCA 2NP6A 4GUAA 1XYVA 2LTAA 5H3HA 4QGSA 1E1MA 1GCOA 2CXSA 2DGDA 4MRRA 3VSAA 4DDTA 3IT2A 4J4HA 4LYJA 3G3EA 2PGXA 1C0KA 2PKXA 1DIAA 1GXSB 4KQXA 1INLA 1RXVA 5EJ7A 3VUFA 5LP1A 4WRRA 3IVCA 3FDZB 3BMXA 4IUDS 721PA 2PEZA 4LX8A 1KS9A 1E66A 2DB3A 3OQIB 3R77A 1EM6A 2X7JA 4HHEA 5JXIA 3AVPA 4O4HF 4M9QA 3FUUA 4F4IA 5TSDA 1SBIA 2HNAA 4RSGA 3THXA 2I67A 3MQ2A 4JVLA 2CE7A 4H7PA 4A03A 3W79A 3QLVC 3W78A 3I92A 1ARZA 1HTTA 1YMVA 1L8OA 3IMCA 3NG1A 3ROGA 1O3YA 3OC6A 2C2MA 3WGJA 4HN4B 2VL7A 4OJNA 1QORA 1CD5A 4H7DA 1QHYA 3DE0X 4GSYA 3GLGB 4FOSA 3S55A 3MCAA 3BSSA 3HJUA 5EIBC 1AKRA 3R3YA 1JYFA 2BFNA 3PZRA 5K9ZA 4OI1A 4JT4A 4TM7A 1YO6A 2P1ZA 3WY9A 4QASA 5M5BA 1TVMA 4BRUA 4MZDA 2HSEA 2AW3A 5COBA 4KDCA 1PNRA 3WGIA 1V4BA 2XA2A 5AI6A 2D0DA 1QFJA 1E6KA 1QH8B 3JQCA 3G88A 4MPTA 5LBUA 5IXYA 3HNPA 3NASA 1P2UA 1QLJA 2MR5A 2JIZA 5G1OA 4UQPA 1PJ4A 3UMMA 1MG0A 3IT1A 2P4HX 5DKFA 3VAAA 1E89A 4W7SA 3VO1A 3JD1A 1IL0A 1OLSA 2W2NA 1K4KA 2FVYA 3PPWA 4L5JA 3WMEA 3I72A 4BQFA 4GX1A 1RAGA 3JQBA 4Q34A 2AR9A 4NFLA 5EOVA 1KJYA 3AEYA 2CFCA 4TZKA 4KK4A 1SURA 2NU8B 3SFTA 3PVCA 4CLOB 1Y9JA 2V9PA 1I01A 1QKKA 1V9SA 5HK8A 3QXCA 4HMPA 1LJUA 4OKSA 5KNDA 3R5KA 4P31A 2ZSEA 4BGDA 2WKWA 3WJ1A 4C05A 2QM3A 5JUWA 4GGPA 4V0SA 9MHTA 1DIBA 2CLEB 3NR2A 4R54A 4YQZA 4KFCA 2I6QA 1Y1PA 3CEMA 2F1KA 3H16A 1CULC 1FTYA 1QZZA 2X2OA 3HL0A 1W96A 5FBLB 4F92B 5K7SA 1Y8ZA 2QRZA 1N78A 3QELA 5BN4A 1M34A 1YAJA 2I7DA 2YY6A 3FYDA 4FQ5A 3UWPA 5ITWA 1YBHA 1AA9A 1L0BA 1JBKA 3QOYA 2VUIB 3ZE1B 2NTNA 1GUYA 1UT8A 3GGDA 4DRZA 4BVJA 1A9RA 3LQ4A 4C0BA 3CF4G 1OAOC 1GTJ1 2ZYHA 4YO8A 3VR4H 3HFJA 3BDVA 5TEWA 1M6HA 1V5EA 2EYUA 1T0PA 3I8XA 5JPDA 2OZLB 5L6LB 1W7AA 3D4BA 4UAUA 3TECE 4RPLA 5J4KA 2VQEB 4I4TB 1AG9A 3L05A 5EHXA 5KCMA 1BX3A 5BURA 3BULA 1GRRA 2IXDA 3GH3A 4PC3A 3D4NA 2EBHX 4MQFB 5FBHA 3THWB 1L7VC 1P19A 3QWAA 4TZTA 3ZQJA 2FQ1A 2CNBA 4G2TA 1EVIA 1NX6A 1VL2A 3KDAA 5C2JB 1PL0A 4IJUA 3A10A 3FPEA 1S4QA 4OHWA 5DP2A 2IS4A 1E94E 3PFCA 1PZEA 3QITA 1V8PA 2GOYA 2DCUA 3SLRA 4GRIA 2C7BA 3KXPA 5BN3B 3ETJA 2KI5A 3GLHE 1Y1SA 4A6DA 4JXZA 5JD4A 4K3VA 1Z6ZA 3LW7A 4BMDA 3BMOA 1KDYA 4B8YA 5I7RA 4CQJA 4DLBA 3RBAA 3THYB 1NE2A 3CUWA 4L6IA 1C0LA 2ZBPA 4H60A 1J8DA 1BYUA 4WASA 3K5HA 1Y8RA 4LDZA 3EG5A 4WOKA 1IN1A 4Z86A 1JJBA 3V4VB 1FXUA 2NUAA 1XN1A 4BKQA 1E2UA 1E7SA 1I8TA 3KHTA 3H8VA 1H9CA 4JQCA 3N07A 1FZTA 2CW5A 3U26A 5K6AC 1YWGO 3RIYA 1IQUA 2G08A 2X5JO 1GEEA 3FKJA 4JU9A 5CDGA 4MW2A 1NI3A 1XWFA 2YV4A 2DSNA 3OICA 5SZKB 4DYVA 5DYTA 5JEDA 4ND8B 4UARA 1HG1A 4RFVA 5KPDA 4OMDA 1XRPA 3T7EA 3S2SA 1UP6A 5F98A 2MIIA 3QMWA 5LQNA 3RO7A 2H2IA 2VTVA 2WAMA 3RAPR 1T0BA 4C78A 1E79A 3UPTA 1MVOA 4ILKA 4NWIA 3VKUA 1N5LA 2FFBA 3NGXA 3ADOA 4DIOA 2E85A 4JJ8A 2OBNA 4XJVA 1I32A 2L69A 1GT6A 1YQEA 3EZ9A 3Q3JB 4KXWA 1PI3A 4NE7A 4AJNA 5CFLA 1AA6A 5TEVA 1JDZA 1TAGA 4X60A 1WCV1 4MS1B 3GLFA 4QRHA 2JLUA 4FGKA 4C0AC 1ZOOA 3W05A 5CPFA 3MS7A 2QD3A 2KHZA 3LQKA 4IEIA 3SR4A 4CMEC 5EQFA 4KQKA 5KYUA 1P7CA 3OAAD 3TSCA 4HRVA 5T4HA 1MJNA 2P7IA 2IYSA 2NWQA 4RV9A 2NU6A 2LXNA 4D98A 1C81A 4WJZA 4CFZA 3W5CA 4YDRA 1I7QB 1VG1A 2ZYTX 4BNVA 1E8DA 2WICA 1BHO1 5HZKA 4RK6A 4MW6A 2PS1A 4EI8A 2P9ZA 1EBBA 3E48A 2HWUA 3IQDB 1Z34A 2A7QA 1P4JA 1U2SA 4ZIRB 1UEIA 4W5OA 1GLVA 1S3GA 3EZYA 2CJYA 3FTQA 4Y6OA 3E23A 4LNUB 5AWFC 3UAZA 3K1YA 1JEYA 2CY0A 1H2BA 1W4AA 4LZNA 4EHJA 4KYTA 2MINB 4DRXB 3EGDA 1JHAA 2J48A 3H1PA 3BAZA 1JMKC 4F2GA 3JQGB 4LVCA 5IM4F 2WHPA 4LG1A 3DSRA 3OD1A 2W0MA 2ATIA 2BEUB 2GA8A 5CLQA 5A5VA 1GHTA 3PYLA 3L8MA 4KO4S 2BD0A 3LLUA 4YP5A 5BQ5A 5CXUA 1E1LA 3NHAA 1JL3A 2W8ZA 2WTMA 3HXMA 1Q7EA 4JVSB 1HE1C 4ZO6A 3UK7A 2ES4A 2XMRA 4L2IA 3INGA 3IQZA 4OKNA 1XNJA 2ZIUB 1RWKA 2BFBA 1BQ3A 3STUA 3PD0A 4Z9FA 2X9QA 1KYWA 2FFRA 1TLLA 4ALKA 1BXRB 2BEWB 2N75A 3EQ2A 4WZ6A 5K3FB 1NVVQ 1YKSA 2GD0A 3BXXA 2XQKA 2TMYA 3C4JA 1G6Q1 2QAIA 1E5QA 3PS9A 4ZQGA 1V35A 1VFPA 1TA0A 3KPVA 2XNKA 2XD4A 3KZVA 1GFSA 5CGZA 5DEIA 4BX0A 3PP8A 1EVQA 2YC4C 3IIJA 4C7JA 3O95A 4AXXA 4HKTA 3URKA 1O9HA 1I2BA 2ZRCA 1XTJA 2QQFA 4CF7A 1TCAA 4M9CA 1OBOA 1CQZA 2WA2A 2E4XA 1QHSA 5JPIA 2GPBA 4FP9A 3TFQA 1A9PA 3WWEA 9ABPA 1X39A 2IYOA 1N6HA 3PQ2A 1Z0UA 2GEFA 4TXJA 4F4HA 4C2UA 4TV9F 2XIQA 3R9IA 3ZUPA 1Z83A 2C5LA 1I1HA 1Q6ZA 3HFGA 3V32A 2XNDA 5A1TA 1GU7A 4P98A 4AX4A 1RI5A 4ZPJA 1ODFA 4X1IB 2O48X 3M34A 1R8YA 4XYBA 3EJ6A 1RWXA 3BX1A 4R1UA 3BJZA 2FEOA 1XWIA 3E5HA 1KAGA 2IPXA 3QVXA 3HNRA 2EG9A 1RM4A 5FBZA 1C1XA 2CZGA 3DUFA 1ODCA 4PLTA 3TQHA 5JISA 3BWDD 2UTGA 1QCDA 3RYCA 1T1GA 2IUFA 4ZMSA 1C9NA 1SCUA 3NYWA 4OQEA 4BBPA 1HSOA 3R41A 3DVLA 4ZCTA 3R7BA 3INRA 4HUTA 1TD1A 2F1IA 4IV8A 4AJKA 2OVBA 2P9HA 4IDGA 4A6EA 1GG8A 4HP8A 3W8RA 3ZCPA 2HLPA 4U2KA 2OO7A 4PG7A 4N6NA 3A9CA 3O2NA 1E8NA 4TT3D 5ALQA 5IH3A 2OG1A 5KSZA 2OPHA 1CR6A 2WWFA 4B9AA 3IUYA 4FYJA 1KHHA 3HM2A 4FWBA 3PGLA 2E4WA 2FP3A 3WGNA 1USIA 1RLTA 3KKEA 3I61A 3BL5A 1Y9DA 3OUZA 1A9XA 3MJEA 5JLJA 1N5IA 5MN6A 4J3FA 3LXRA 4F4UA 5CAEA 1G3MA 3CVUA 5C0OE 3H75A 1Z4KA 3FN4A 2UYYA 3FG9A 4YJFB 1GZ3A 1R7RA 1BVUA 3EMDA 2B34A 4ROTA 4TRRA 4CI9A 5DNYB 2VR1A 4JC0A 5BSHA 2HF9A 4BGUA 4CCYA 1UIRA 4OAQA 4WLFA 2Q6LA 2YNMA 3ANMA 3G2KA 4D8XA 1WB4A 3L92A 2VZ0A 2YHAA 3H9CA 1JLHA 1TD9A 1YJ8A 4HNGA 2WWHA 4WXHA 3WTBA 3WWOA 5IANA 4R5HA 1HV8A 5F1KA 2HSGA 3LVQE 1JGTA 1NRJB 3IS3A 4MS3A 4MW9A 4LHSA 4L8FA 3TLKA 1PDOA 3C7AA 4QYTA 5F5XA 3UVEA 2F8TA 5K05A 2RGGA 4OXNA 1IJEA 1PF7E 1MT0A 1TUBA 1KJNA 4D1YA 3LT5A 2H5JA 4I2NA 3IIKA 1SWWA 4PM4A 5EZYF 1FMLA 1SCKA 3M6IA 4QUIA 4G36A 3ZE0B 3U7FB 1NNLA 1J6UA 2ERCA 4PQYA 1U8CB 3ZU6A 3OE7D 4MJLA 1MFZA 1UOEA 3DWIA 4M49A 3EXEA 4PGFA 4TYYA 1JA1A 2OXRA 2WVJA 4FHDA 4B71A 4D46A 2GCGA 1U0BB 2H4ZA 4I8IA 1QGYA 5CB4A 1UXKA 2I8CA 1U04A 1R0ZA 1ZHHA 1N3YA 2D1FA 4O1HA 2GF9A 4P82A 2PZEA 1XN4A 3KQTA 3TLGB 3B3FA 3WOHA 1F9EA 1XZPA 1JVBA 1PVVA 3D8UA 4LJSA 4HADA 4PR3A 4BO2A 1JEOA 4OXQA 4ASUD 1VIDA 2CLDX 2G9QA 3VU9B 1WY5A 2VNHA 2R97A 1FSPA 3E9NA 1RP1A 3HDVA 5C4IA 1Y4SA 3IMKA 5JCZA 2YHUA 3H1FA 5IBPA 3OOHA 3DDHA 5AR1A 5J3JA 3RVMA 4D8UA 2GEJA 1WUKS 1U81A 4TVBA 5LA6B 4YJ3B 3O9MA 3UTCA 2ZZKA 2HU5A 2XJ9A 3V6LA 1GPH1 1GRCA 1H66A 2WYUA 1TTQB 3T12A 1U94A 2Y6VA 3EFOA 3PUHA 5BYBA 3Q2KA 4UEQA 3STWA 1AQJA 3TNYA 1D4ZA 4ZCLA 1T4MA 4WKNA 2HJ9A 4KKVA 3PFIA 1Y81A 3GQBA 2JLQA 4N7JA 2JHGA 2NQTA 3ESCA 1ONSA 4KWCA 4UVHA 1OU4A 5F21A 3WL5A 1Q7CA 2VBFA 4ZO4A 1ECFA 3FUTA 2F6RA 1HEYA 4DARA 4DSOA 1IY9A 3TJMA 3PU6A 1JNYA 1L5HB 1A2OA 1PJLA 1TUIA 2IZ7A 2FX5A 1PYDA 2QVYX 2IXGA 5EP1A 2AFHB 5IN5A 5J58A 2RKWA 1RR6A 3E4DA 3D81A 3IGFA 4XVQA 5FOXA 3W1WA 4H08A 5HDBB 1MOQA 3S8EA 2FRXA 1B8UA 1BWSA 3GOQA 3KLPX 3IBFA 4GR4A 4OYLA 3WBJA 4XRGA 4HDMA 2V4UA 5JU6A 3TXXA 4B7ZA 1D2HA 2I7VA 3ZWBA 1YSCA 2B37A 1NHGA 1U0SY 2A92A 2QV0A 3G13A 3LTEA 4F5ZA 4G1BA 4LXIA 5AUPB 5K0CA 1Z8FA 3OF3A 2XA1A 4IIJB 3C6QA 3K73O 1CIPA 2GZHA 3L3BA 4OA5A 3X1DA 1Z5UA 4HRAA 4LHXA 1LLCA 3KQNA 1ENPA 3HY4A 4NKRA 4A8TA 1KWKA 5EJGA 1E61A 1WSWA 2AOUB 2VG8A 1KY3A 4PAWA 1NONA 3MQFA 4EPTA 5LQAA 4QU8A 3ZVNA 4I1OA 3RB8A 4CEIB 3SEFA 4CLEA 3DEIA 2V7TA 4G01B 4P54A 5D5QA 3R5XA 3KD2A 2V54A 2Y93A 3KO8A 2PUJA 3RDPA 5BUQA 4O2BF 2POCA 2CNOA 3F2IA 3NWPA 3CXRA 4KIWA 1JIUA 1JDBC 1JXOA 1BAPA 4UUQA 5KI6A 3PPVA 3L4JA 1AN9A 3WGOA 3MW8A 1A8SA 4LSGA 3P0IA 3N8HA 4GMFA 4ZOLA 3ACDA 3ER6A 2Q28A 4MV0A 4Y2HA 4KQWA 3M6LA 1NASA 1DKPA 1XHEA 2NQ8A 1PR1A 4MVJD 3TKAA 3W2EA 4D9MA 4RZHA 2PGJA 2X5NA 3NIFB 1UTRA 3G7SA 1ZK2A 1Z2NX 2W6MA 4M1TA 2Q1WA 4PRKA 4ETWA 1XTBA 3BIWA 2OSVA 1NKTA 1I9GA 2GVDC 4W9RA 4HPXB 3AM5A 2YMLA 2ZAIA 3PTLA 5AVYA 4DYDA 2ASVA 4NCAA 1X7ZB 2CLLB 2EX0A 1Z4JA 1USVA 4FS3A 3NZEA 1WUHS 4HH1A 3V8VA 3DMNA 2P2ZA 1EK1A 2A5YB 3KYDA 3QUBA 1WW3A 1Z7EA 3EXHA 4JJGA 1R5BA 1HDCA 2F9FA 1QZ3A 1ULUA 1CF9A 2PKWA 5DM70 1TKAA 2WIKA 3AEQB 3EGIA 3GNQA 4MWOA 1CJSA 4ER5A 1WPRA 3HYTA 1EP2B 2WJAA 3NORA 4I66A 3EY9A 4PLCA 2FZ4A 3C87A 3QMMA 3ESYA 4G0XA 4G23A 2IBSA 4Z0HO 5FHQA 4US1R 4XH9B 5G2OA 4G8DA 3AVVA 1PWXA 1X42A 4FN4A 1RXIA 3ICCA 2G25A 1CRWG 5M34A 2W6ZA 1P6QA 1QDUA 4CR7A 3HZZA 1N2HA 4P53A 1N34B 4E51A 3A6KA 3ISJA 5C37A 4EGQA 4FZ5A 5G4KA 3G0HA 3GVIA 2WUEA 1AHHA 4E5MA 2D4HA 5HX7A 3Q4GA 3AVWA 2JGLA 1XFAA 4NG5A 3TAXA 5L7WA 2VK8A 1Y98A 5DHSA 4ZJUA 2NG1A 4AP6A 4KSBA 4NZMA 4EMBA 2J9YB 3EUEA 3HWWA 1U1IA 3D2LA 5FBWB 3R76A 3T35A 1S2IA 3NP9A 1EXWA 5JXGA 4L85A 4JENA 1KYYA 1T35A 1DKMA 2WKSA 4QWWA 4CMIA 1CG6A 2DPXA 1JQJC 1WF6A 3OT1A 2G8NA 5EEHA 1DZ3A 1WHTB 1O8CA 3KCNA 2OFPA 3O94A 3AYZB 2HMUA 2CLSA 3CLRC 4KE8A 3AB3A 1DARA 1FQJA 2DOKA 2ZKLA 1KGDA 4IOKA 1PE0A 4V2IA 1XHFA 1GVHA 2R1VB 4M36A 2G5TA 4PBTA 5TARA 2QJRA 3FRIA 3Q10A 1VCIA 1DIGA 3KBOA 1C7EA 1B6TA 1XPOA 3LKDA 3NJRA 4JJ4A 2P67A 5G3ZA 1BD4A 3ZHUA 1RRPA 1XVTA 4U7PB 1M6YA 1XELA 4I1YA 5BWOA 3R3ZA 5E2BA 1GTG1 3GNTA 2BGLA 1NW5A 1NU6A 1J9EA 3K53A 4R6XA 4LTDA 2FKNA 2J0UB 4LYHA 2IUYA 2MSNA 3CZQA 4HLNA 3I9FA 4L16A 4QBFA 3I6IA 4GM4A 4RXTA 1UP7A 1S2OA 2LWIA 2X8JB 3DVAB 4ER6A 2XVAA 3B1XA 5KHAA 3X0DA 2DHQA 3ZY6A 4C4SA 4IGIA 2Q4RA 2VJYA 1U7WA 4Z8XA 2WSSA 4NVRA 4FW8A 3FDFA 4ZZIA 4D97A 5K0FA 4Y2JA 3ZDQA 1ZAYA 4EK9A 4U63A 1KSFX 3U16A 3AF3A 1DC3A 1V5IA 1NRWA 4EG5A 2R7LA 5IYZB 2EV9A 2QTZA 1NOJA 4AKGA 2JJ1D 4IDOA 4KN6A 4HX9A 1EKXA 4ZCPA 5ADHA 2CF5A 1N6IA 1MHPA 1KQPA 3I9V1 3LJKA 1SUCA 3F5SA 1MF7A 3DZHA 2CSXA 2HC9A 1KFEB 4MKFA 3CG0A 5EZ6B 1GTVA 4F4CA 3CR8A 4N47A 5HQ3B 4LJ4A 1DCKA 5FNZA 3WFIA 3EVDA 5DP1A 4HTAA 1U6IA 2NW6A 5EJ4A 4CLHA 4GDMA 5JSYA 1FYVA 5BVGA 1DMRA 1D6NA 5DBHX 4KQHA 2OL4A 4C1NA 1QRUA 2R60A 2VAMA 1S3FA 1Q0PA 4ZC1A 2VSYA 3K9LA 4W8GA 4KX5A 5FWYB 5HM6A 1X15A 3GDWA 4US0R 5LKAA 1H1TA 2G83A 4HNUA 4RSRA 4N4AA 1W5AA 3ZE9A 1P2SA 3E3MA 3OM0A 4OM8A 4F1WA 1F8GA 1MIHA 1T36A 2LE0A 4HL6A 2JLXA 3VPCA 1D0VA 3FWKA 1A76A 1ORVA 3O90A 3W8DA 2C8VA 3R09A 2QLLA 2XX3A 1GL3A 4MVCA 4QECA 4EPRA 4BCBA 3REOA 5JAIA 4MITA 4D99A 1GTZA 2VTBA 2FGKA 3TIGA 1VDZA 5LSAA 2BGRA 3OEHA 4OLFA 1THMA 1ZCZA 3W5UA 4FONA 1WU8A 3L6CA 2HUNA 3W5AA 3EXFA 3CU5A 3ZJYA 2H92A 1R8XA 2GRJA 3G17A 4CKZA 1OXKB 3EEOA 1K7CA 3Q72A 3COWA 1TNDA 5HILA 2XR1A 5AVVA 1RKXA 4TLCA 5IH7A 2JHAA 4L27A 5TQJA 1UZAA 3EMVA 2HPVA 1U3UA 4TUYB 1CCWA 4IXWA 1H22A 2BMJA 3AIKA 1CUZA 4Q9HA 3HB9A 4MV5A 4HZGA 4Q18A 1VCNA 2J5QA 4PAOA 4UMVA 5JQWA 5A02A 5HFNA 4AMVA 4B4KA 4EGCB 1T2CA 2PUWA 4LJKA 1FU4A 3HVHA 3KRTA 2IWHA 3ZK8A 5K51A 2QZSA 4QYWA 4D9CA 1CS4C 5FLKA 1TQ4A 1IXZA 3LK6A 4MTLA 3FOBA 4M0MA 4UBKA 1J90A 4EO7A 5IPFA 3KK0A 4YRBA 1NZFA 1JFFB 3IXQA 1LDMA 2C82A 1U7OA 1VJTA 3BK1A 1DWPA 1SUBA 2I7CA 3CUTA 3TVDA 4DE5A 2DECA 3TKLA 3R9KA 3ASYA 3IA7A 4ZCMA 1M1YE 4OQQA 2AZTA 5E95A 3SNHA 4CM4B 3EC2A 1BGWA 3WA7A 2HNBA 1XVIA 2VRNA 4Y2RA 5J2UB 1RPAA 1UTGA 3QFSA 3RS0A 1XL0A 5GV7A 5EMNA 3REQB 3U3ZA 3AY6A 3QJGA 4WCVA 3V1UA 4ACBA 2UUAB 1Z6QA 2FW7A 2Q5JA 5DSTA 4W9MC 1QV7A 2IU4A 1EFPA 5EXXA 3DHVA 2WYIA 5PGMA 3HO6A 1G2QA 1U7XA 3BIXA 4TM8A 3H6KA 1IHDA 2Q29A 1J9ZA 3JYHA 4PSDA 1M5TA 5SYMA 4LY6A 8AT1A 3OEEA 2JEZA 1RE0A 2FWRA 3TIIA 1GPAA 3EIQA 2HCBA 2DTDA 1Z6GA 3SQDA 3FUVA 4FU0A 3DKIA 4KRFA 1KYVA 1IE3A 2FSHA 2P3OA 1PJCA 4NNJA 4XB6B 4A2CA 2NP7A 2CXHA 3C48A 5DOZA 4AWXA 1UBKS 4BZQA 1YRBA 4Q9IA 1J00A 5JNTA 1RQLA 2IHZA 2JK1A 4YRQA 3THXB 3A4TA 3L6BA 3O3CA 5NULA 3PNLA 4A0QA 3FFWA 2V0GA 5JQGA 4DJFC 2VKTA 2NX2A 1SUAA 4U7HA 3NBXX 5LDGA 4D8WA 3SXPA 3C24A 3IUEA 3WGUA 3TL3A 4LTMA 2BKUA 2QP4A 3SIWA 4DMLA 1ITZA 2WWWA 4RETA 1PJSA 4QM7A 4CW7A 1HETA 3G2IA 1G291 2C3UA 4TWRA 3W5DA 1NFRA 2IEZA 3KSUA 2MSKA 1HZJA 1SH7A 3N2EA 1RC1A 4P0TA 3D8SA 3BM5A 5FA6A 3ZGNA 4IDNA 3P9CA 2NZXA 2PFGA 1ADBA 2JCVA 2BFFA 2HI0A 3AKDA 3K31A 4O4JA 1TDJA 2JFWA 5L3VA 1U9IC 1FLVA 4X0EA 3H5LA 1XEXA 4KFRA 4DUGD 4F0JA 1PZFA 1EWTA 3NEPX 3JATA 2PUTA 4RA9A 4YP6A 1P39A 1OMOA 3FHCB 1M2KA 3I4FA 2OV6A 2XOEA 3D3JA 1O5TA 1G8MA 1UPUA 2Z30A 3LXMA 4ME6A 3UOAB 1QYVA 2BEVA 4NABA 2WTNA 3ZDXB 1OLSB 1HM5A 4G1EB 1WUTA 3C5WP 1YAHA 4ZPXA 2O2ZA 2AKAB 3FYTA 4RORA 5DYYA 4B87A 1YU6A 5LZ2A 1RQRA 2X14A 3BB3A 1THZA 2A1IA 3A0RB 4U2CA 4DLKA 5JZ9A 3H9UA 2CYCA 2F1JA 3RBZA 3PX7A 3OKFA 1VQ1A 1XU4A 1XXHE 3CZ5A 4GMGA 2O3SA 4Q7MB 4WZBA 5MFPA 2VAXA 3L7BA 3PQ7A 2C4TA 1LW7A 3RAJA 1Q0ZA 1J97A 2WHXA 4BNMA 3NRBA 2H4YA 5AVRA 5C81A 3QVLA 1YVUA 1J0BA 4RVDA 1CEQA 1B14A 1RFGE 5JRJA 4I1PA 1LPBB 3QELB 4JUCA 1RPTA 5GJVC 2HZ7A 4YAWA 4QLBA 5ILOA 4JB3A 3QVTA 4WOPA 4MWSA 2O3TA 4RANA 3ZCVA 1D2RA 3ETNA 4PZ9A 5BV1A 5F9HA 1FY2A 1VFNA 1EZZA 2XUDA 1RKUA 5CUQA 5JCOA 1GQOA 1IZZA 4HAVA 3WGVA 3CH5A 4QPDA 5LD2B 3R4VA 1FYWA 4RXMA 5C18A 1EWQA 1M8FA 2FWBA 1AB6A 4F2PA 3MK31 2FXVA 1HYHA 3OFJA 2BFDB 1KH3A 2GO7A 3P2YA 4Z9AA 3KJXA 3C6YA 4BX3A 5DM60 4J7XA 3KR0A 4JI4B 3OQNA 1JHUA 1JLLA 3U49A 5HOQA 4MV1A 3OX3A 5DGXA 2HHCA 1KGSA 3CA8A 1TMKA 1AURA 3BMQA 4R7GA 3NFYA 3PZBA 1P5HA 4CKBA 4CCSA 5KYYA 2I66A 2YASA 3FW1A 3U4QA 3CLUD 3GFFA 5F5LA 4B47A 4QARA 2VDNB 5CB0A 4PHHA 4HGNA 2OXFA 2WABA 3JSAA 3I09A 2GF2A 5K3BA 3HEMA 4IDAA 4GVPA 3T54A 3VSEA 4AQDA 3BMOB 1OIVA 4E2FA 1KSGA 5BMVA 1ZVVA 3TIXB 1XTSA 5I01A 1DC6A 2C9YA 4CT5A 2VP2A 3AGQA 4KREA 2W6IA 1JLRA 4O6VA 4B4WA 1VOTA 4B44A 2W98A 4KTVE 3E7WA 2VNKA 3U5ZB 4CEHB 1D0SA 1QE0A 3UAVA 4LZJA 2NUAB 1UWKA 2R86A 2ZSKA 1KJJA 4DDMA 3BRSA 3LHSA 2QUBA 2E6KA 2HNKA 4DSAA 2H52A 5FNVB 2ZRQA 2YJTD 4AZ0B 4D9NA 3U9TA 5EMMA 2QRGA 4EZEA 3B3AA 3KWLA 3T0FA 2GN0A 1FB5A 3BZBA 3E9QA 3EVNA 4TLEA 3T3GA 2DKNA 2O1XA 2RBKA 2RCYA 3G2HA 3AM3A 3AJEA 3CT4A 1P3Y1 4C7VA 1E2DA 5DWVA 3VDRA 1KTVA 2ICAA 5LLTA 1H1LA 3E35A 3EZ7A 1VB3A 2W2KA 4C0SA 3W90A 1Z13A 1V96A 4IDFA 4HWSA 5AKKA 2QQ5A 2H29A 1P1JA 3B6IA 1C3OA 1II0A 1UAYA 2CVFA 5A04A 1J20A 4LF9B 2IYPA 4RXUA 1F5SA 4KI0A 2NSLA 3GLFB 3S28A 1LDGA 3VOSA 1CZLA 2JJ2D 3IO3A 3QLEA 4Q47A 1QYXA 3L4BC 2X0JA 1ISFA 4WH0A 3FM9A 5KYUB 3O26A 4Q0MA 1TGVA 1OSNA 4L08A 5E4TA 2B2XA 2BRUA 4Q3CA 3DNFA 4ML3A 1T9KA 1Z6AA 1KKMA 4WPGA 1I7SB 4V02A 3IEUA 1SU4A 3FYSA 3TNJA 3L6UA 1V3TA 2ON6A 1Q1BA 3L06A 3NM5A 3I2YX 5IEJA 4QTTB 4C7OA 3QTTA 2QN6A 3TFWA 4BMNA 1LPPA 5A3VA 1H4VB 3O47A 3CJQA 4NZ9A 4ZQFA 2ZFUA 2Q1TA 3VGJA 2YZ7A 3D8HA 3MOIA 4IOJA 4YUXA 4HO1X 1LU9A 1JEYB 3DV0A 3MRTA 4L6AA 2O5VA 2C31A 2Y3IA 3IX7A 2DQ4A 5LJIA 1BOOA 4BIMA 1MGOA 3EGDB 4QDJA 2W83A 1G6KA 1MOSA 4RADA 2O2SA 4NH4A 4O8CA 1E7WA 1U2DC 2HJHA 3A14A 1E3EA 3RIMA 4EB6A 1ND6A 2WHPB 3VPBA 1U0RA 3WL8A 4KMSA 3J81k 1F14A 1H4QA 4IF6A 2QPAA 3ASVA 3JV7A 1XIVA 2H5IA 1NVFA 5CXSA 1AGYA 4M1MA 4FGSA 1Z5VA 4J0GA 4DIUA 5GQSA 1U0LA 4TV8F 3V48A 1KQNA 4Y6PA 1QG2A 2ZB7A 4L2IB 4AWBA