2WJ6A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n- acetylanthranilate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
molecule keywords 1H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
total genus 103
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wj6A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wj6A01
1QO7A 4GWLA 2XUQA 2PU7A 4X7BA 3ZLVA 4AMZA 2CBGA 3L1JA 5EHQA 4GHWA 1CUSA 1XZHA 4AZ0A 1K8QA 3FVRA 2V98A 3OTQA 1GKKA 4TGLA 2QRUA 5JAPA 1XRNA 3QH4A 3UMJA 5LZ4A 2O2IA 3WYDA 1E8DA 2DSNA 1ZIXA 5K5EA 1UK6A 4A16A 5SYMA 3A70A 2RHTA 3DDUA 4BRSA 2WSLA 1EB9A 2VJAA 2WKWA 4NZZA 2XMQA 1ZGCA 1LBTA 2B20A 2WHPB 4GI1A 3IURA 3H2JA 1CVLA 3BF7A 2H7XA 4FNGA 4HZGA 1ACJA 2XI4A 3BJMA 3I6ZA 1Q84A 2OCIA 3AZOA 2XE4A 3BL8A 3FLBA 4B0OA 4AX4A 4EZIA 3DQZA 1EH5A 3F97A 2WUEA 2HL6A 5AH0A 5AIBA 5F4ZA 3DKRA 3SWWA 3F67A 1WHTA 2BCEA 4DSAA 2WHPA 2ZJ6A 3PF8A 3C8HA 1ZI8A 4LHEA 2Z8XA 4C01A 3IUQA 3W04A 1FFDA 4J0KA 2JGMA 3PF9A 2QS9A 1GQSA 1P0PA 1CV2A 4QE3A 1CUHA 1T2NA 1EDDA 3DKKA 5ALEA 1Y7IA 2WTNA 4U2DA 3UUEA 1N1MA 4J0JA 2ES4A 3GROA 4Q3OA 4ZXFA 4G4JA 1MAAA 3H2KA 4B81A 5CXXA 5KWIA 1OCEA 5DNVA 3FCYA 1CUFA 1CUZA 4G5XA 4DMHA 5E4TA 1LPOA 5T4HA 3WWCA 3DCNA 4OU4A 4P08A 3F98A 2RAUA 3IVMA 4M0MA 3WKDA 4FFVA 1N8SA 3ZWQA 2V97A 3GFFA 1R50A 4O08A 5FPQA 5CMLA 2HDWA 1U65A 1VJ5A 2WIJA 3STTA 1TKRA 3H2GA 3ESCA 1UOPA 3H19A 1XZIA 2OAGA 3WK6A 1AC5A 1DWOA 1ZD5A 1UK8A 5HZGA 4DMFA 1G66A 3R40A 2VJBA 1A8UA 2XLBA 4J03A 2ZSHA 2AJDA 1NU6A 1LBSA 1FFEA 5DJ5A 4X97A 3K6KA 4X85A 4Y7DA 4ZGBA 2B4KA 4G8CA 3QBJA 3WA7A 1EK2A 2OCLA 2XUOA 3HEAA 1ZIYA 1EHYA 5DYWA 3WJ1A 2JGEA 3S8YA 3LIIA 5IVHA 1XKTA 1QFMA 5HFAA 3EQ8A 1CRLA 4L3WA 1FFCA 4AXBA 2C0PA 1LPNA 4C4XA 3QVMA 3AFIA 1H23A 3M81A 3OOSA 3STUA 3VVMA 2I03A 4W1PA 2H7YA 3H17A 2JGFA 2HFKA 2AXEA 2HU5A 3C6XA 5IVKA 4ARAA 4UBLA 1O6FA 2GZSA 2WFLA 4IH4A 1R3DA 2BGNA 5HCUA 4CCYA 2YXPX 3C5VA 2FJ0A 4Y2XA 5FV4A 5EHZA 3QMVA 4EY5A 4KAFA 4EBBA 5BWCA 4CFSA 2I3ZA 1JI3A 2PX6A 4JYPA 1QE3A 2I78A 3WLAA 1AX9A 2WJ4A 5ALRA 3FOBA 3I1IA 4PSCA 2PUJA 5JAUA 2XMBA 1MT3A 3M83A 3WKEA 2WFZA 4EY8A 2LIPA 4E15A 1THGA 1NX9A 1VA5A 2K2QB 3I1YA 1BCSA 3DLTA 4DM7A 4N5HX 5AKKA 3R3WA 1IMJA 1XZFA 2XMDA 2C5GA 5CT6A 5DTIA 4QDTA 5ALLA 4DNOA 1JJIA 5EI5A 2ACKA 5CW2A 3ZPXA 1DWPA 2OCGA 4FNMA 2ACEA 4J0DA 3WWDA 4Q05A 5JARA 4H7EA 1CUJA 2WJ3A 5K3FA 3PICA 4MYSA 5CH3A 2OPHA 3VJLA 5AM3A 2IX9A 4U2CA 3G9UA 1GZ7A 5FPPA 5LZ5A 4NVRA 4CCWA 3O0DA 5AICA 1QZ3A 1TQHA 4H35A 1CUIA 3O4GA 4INZA 1PFQA 1W52X 5JZ9A 1YSCA 1XZEA 4KJXA 4QDZA 4KR0A 5DYTA 1P0MA 2W6CX 2PVSA 4H7KA 4IH9A 4GW3A 1R88A 3RK4A 4KE6A 2XMSA 4LYEA 3S2ZA 2W22A 2EDAA 1IZ8A 1CUVA 4MWTA 5JYCA 3P2MA 1BU8A 2QXUA 1DU4A 5K3AA 2C58A 4KE7A 1H2XA 5D3ZA 3AINA 1R4ZA 3JW8A 3WKCA 2YASA 4AO6A 5LZ2A 4LXGA 2DR0A 3A2MA 4W1SA 2WG0A 5ALTA 3D2BA 2XQJA 1ZD3A 3HLKA 2C0QA 5YASA 3FLAA 4BE4A 4BBZA 4DGQA 5J3JA 4QZVA 4AMYA 4MEAA 5HF5A 4GBGA 5CURA 3ANSA 3HABA 4QLAA 1MO2A 1UKCA 1BEZA 2OG1A 3WKBA 4DNFA 4UBNA 4KRXA 1B41A 3WL5A 1IZ7A 5C7YA 5EIEA 2XUPA 4RE6A 4UHHA 4ITVA 2GYVA 3GUUA 1XLVA 5ALZA 3TEJA 3CN9A 4Q82A 3F9CA 1X70A 4AB1A 3C43A 1SCIA 1JKMA 4N8SA 3KDAA 3F96A 4KYVA 3WI7A 1AUOA 5AP9A 4EUSA 3ESBA 2VJCA 1CIJA 1H2WA 2HA5A 3W06A 5ALIA 3BIXA 1HLGA 5LP1A 1BEEA 3FCXA 2HIHA 5EIAA 4HRXA 5A7FA 4Y2PA 2QZPA 3LCRA 4F21A 1RYYA 2O7VA 1THTA 1T4MA 3NGMA 1QTRA 4BYMA 3N2ZB 2PU5A 4FMPA 4LYDA 3Q0TA 3WWOA 3WK4A 2VEOA 4X93A 2J3QA 3KSRA 4YX9A 5HF9A 2HRRA 2QUAA 2HA2A 4YK7A 4AN1A 3V1LA 2FUKA 2Y6UA 4BCCA 1J06A 2RHWA 1VE7A 4UUQA 2NW6A 2XUKA 4H7JA 4OCZA 3HC7A 1XLUA 3QZUA 2R8BA 4ETWA 3IULA 4FFWA 3G0DA 2HA4A 2WU3A 3BJRA 4GXNA 4MXDA 2XUGA 2O2GA 4X71A 4DIUA 4PSUA 2DQZA 1CFJA 4AO8A 1TCBA 2XUHA 5E2IA 2ORYA 4K6KA 1AURA 1VZ3A 1R1DA 4KAAA 5HK8A 2JGJA 3R0VA 1UWCA 2HU8A 2WLSA 3ZLUA 4U2BA 5EHXA 4J0IA 1CUAA 3LP5A 4BDTA 1C7JA 2PSHA 5JD6A 1JFRA 4Q3LA 1U2EA 1YAHA 1ZD2P 4UBJA 2QKYA 1CPYA 3EF3A 2XMRA 1E66A 2OAEA 1IUPA 5D7BA 2FJPA 3ZV7A 5FKJA 1ORVA 4BZWA 3MGAA 1EX9A 1JJBA 1YS1X 3YASA 5AKHA 1LPSA 1DX6A 3VDXA 3SK0A 2HA3A 4NMWA 5JALA 3IBTA 3WJ2A 5AM4A 4Y2JA 1XZGA 2JGKA 1YA4A 2JGIA 3W9BA 5CH5A 5A71A 1Y37A 1I6WA 3TJMA 2RIPA 1K6EA 2CZQA 1UKAA 2GYWA 2BUCA 5C8VA 3FAKA 5K3FB 1QOZA 3STXA 2HHAA 3L1HA 4GEGA 1XRPA 3L1IA 3VKFA 4OD0A 1E5TA 3R3VA 3A6ZA 4H7DA 1G4HA 1IUNA 2WHQA 1WHSA 1GPNA 4OU5A 1G5FA 3DEAA 5DNWA 4BC0A 4XWGA 1CUXA 4G4GA 4MYDA 1QIKA 3WK7A 1E89A 2CKMA 4BZZA 1UXOA 4XX1A 4C88A 4OB7A 1ODCA 3AIOA 3A2NA 4LXIA 4BRZA 3AJAA 5CXUA 4HXGA 1F0NA 1UK9A 3WMRA 4BVKA 3C70A 4NS4A 2R11A 3QPDA 5FLKA 2ZSIA 2D0DA 1AGYA 2VT6A 1ZJ5A 4AZ3A 4ZREA 4OB8A 3HRHA 2V96A 5JIBA 2XDWA 4X6UA 3FYTA 1USWA 4HXFB 2Z3ZA 1AZWA 2BGRA 2Z5GA 3FNBA 5HKAA 3VJMA 3G8YA 4PF1A 5CRIA 1DWQA 2WFLB 5CT9A 2AJBA 3IDAA 3M82A 5AHXA 3IUJA 3HXKA 5AOCA 5JASA 3DNMA 2XUAA 2QJRA 3H2IA 2G5TA 2PKYX 1MX9A 3ZI7A 4WFIA 4OYYA 1K63A 1XLWA 4ROTA 5FRDA 1Q83A 1R9MA 4CG2A 2WUFA 1QIHA 2DQYA 3PUHA 4FWBA 4K6HA 4L72A 5ALFA 2GBFA 2VAXA 1IUOA 4I19A 5CT4A 1XZAA 3C8DA 3WK8A 5AI5A 1J2EA 4N8EA 1MJ5A 3VVLA 2ZJ7A 4B9EA 2WILA 3ESDA 4JH0A 3BE8A 4HRYA 2XUFA 4BB0A 3I2HA 4L0CA 3GELA 4ARBA 3I28A 1UK7A 4BCDA 1CUUA 4EHBA 4X3CA 2CEKA 3C6YA 4P9NA 3DS8A 3FVTA 4UHEA 2VAVA 2ZYRA 3D2AA 2G5PA 3W2TA 4QLOA 4CIAA 2UZ0A 1GXSA 2DFPA 3MUOA 5JZBA 3EQ9A 5IH7A 2RGUA 3D0KA 4QEKA 5IVDA 4FLFA 4B7ZA 5ALVA 1XZCA 5EIHA 1QIJA 1BCRA 2D5LA 3B12A 4FBMA 2RI6A 5AK3A 3DJYA 2WJ6A 2I3DA 3IUMA 4B84A 3ESAA 4AN0A 4UBIA 4K6GA 3RLIA 1W4LA 2XQKA 4BDSA 4Y2UA 3T4UA 1P0IA 4I3FA 5FDFA 3WA6A 3R3ZA 2VTVA 1EB8A 1C4XA 1TK3A 1YR2A 1JMKC 1CUYA 1JT2A 5ALMA 2C5FA 5HF8A 1FSSA 1VXRA 2Z3WA 4ZRDA 3PUIA 1W1IA 3STYA 1QTIA 1ORWA 4FTWA 1BS9A 4X95A 3W05A 4CG3A 5ALPA 1UOOA 1QIEA 1MNQA 1W6RA 4CIBA 5K3BA 5IVIA 3V1MA 4H7IA 5BWBA 1AMNA 5IKXA 1UFOA 4I4CA 2GBIA 2JBWA 1M33A 3LIPA 1ZJ4A 3FLEA 5ALJA 5JD5A 2WTMA 5K3CA 3FSGD 5T4EA 4JYMA 1A8SA 1UZAA 1F6WA 4A5SA 4XIIA 2V9ZA 4ZV7A 1ODTC 5AM5A 4J7AA 4BCBA 1BRTA 1LLFA 2QXTA 5KWJA 5D3KA 5ALQA 1EINA 3KWFA 3HI4A 4JEIA 2ZJFA 2ECFA 3I2KA 4N5IX 4BATA 3I6YA 3D59A 2ZVDA 5T4BA 1QO9A 4TPKA 2JEYA 1GPLA 3U1TA 4BTLA 4PNZA 1W75A 4G8BA 1ZGBA 4DSZA 5FXMA 1KU0A 1CUDA 1JU4A 3C6BA 2XB6A 1VA4A 1DINA 2VT7A 3H0CA 4UHBA 4PQEA 3OG9A 5DLPA 2AJLI 3O95A 1DX4A 2QMQA 1MX1A 2BAGA 4EY4A 5ALGA 5HK9A 5JZSA 3I2GA 4MJ3A 2OLEA 2BUAA 3D4LA 2EEPA 2JF0A 1KEZA 3WZMA 4W1RA 5C81A 1XRQA 5I9IA 1MTZA 3D2CA 3HYSA 3GZJA 3PDCA 1QIDA 1K4YA 4C89A 1LPMA 3O4JA 4X94A 5ALOA 3ILSA 4W63A 5E4JA 5LZ9A 4HXEB 4G9EA 5AM0A 2XMCA 3G0BA 5CBKA 3FYUC 2X8BA 3DD5A 3WQHA 1ACLA 4C87A 2CMFA 2ZYSA 5EFZA 4UHFA 4Y2QA 1LNSA 3FYUB 2QUBA 1EDBA 4L9AA 4DNPA 5AKJA 1ETHA 5AK5A 2B9VA 5HFNA 4FOLA 1Q0RA 2XLCA 5JD4A 3G9TA 4MQMA 5AKEA 1SCQA 1XKLA 3BF8A 2IIVA 1MAHA 1UT6A 4UFPA 1CR6A 1XRMA 3X3HA 2G4LA 4B6GA 2HA6A 3C6ZA 4FLEA 3UUFA 1H22A 3SX4A 2ZYHA 4BVJA 3AIMA 1HQDA 5AM1A 3KOOA 1QGED 4J3JA 2WQZA 5AK6A 4H18A 2Y2VA 5A7HA 2WIFA 1QIMA 1DT3A 2XUJA 1PV1A 1A8QA 4KRYA 1VLQA 3WWEA 2OQIA 4CG1A 1CUWA 4IH1A 2J4FA 5FOQA 5AO9A 1GKLA 2BJHA 3D7RA 1YB7A 4WY8A 3R3XA 5T4FA 4U2FA 1WB5A 2PSFA 5HKBA 3I6MA 1CLEA 2VQ6A 5AI4A 1QIIA 1LZLA 1E8MA 4Y2TA 4KE8A 1QONA 4H77A 5AKLA 4OYLA 3ICWA 2WG2A 1L7QA 5K3EA 3CCBA 3G0CA 4OUKX 2C4HA 5EGNA 2OGTA 4LKOA 4UHCA 2QJWA 3H04A 2WUGA 3WZLA 5CT8A 3VISA 3HACA 3KXPA 5AKYA 3E1GA 1CUEA 4UFOA 4WFKA 2DHCA 4P93A 4C4ZA 3FWHA 3BDIA 4Y2YA 4WJLA 5AKZA 1AKNA 1XQYA 1N5RA 2WU4A 1GGVA 2VA9A 2HA7A 1TIBA 2G63A 2P8SA 4X6XA 5LIPA 2AJ8A 3BIWA 3G9XA 4BC1A 1WM1A 1SOMA 3LLCA 4H0CA 1LGYA 5ESRA 4Y2RA 1X2BA 2CJPA 5ALUA 4IO0A 1F8UA 1MPXA 1XQWA 4GLBA 4N8DA 1D07A 3DL4A 2XMZA 1G42A 1EXWA 4E11A 3HSSA 4UBKA 4CCYB 4RNCA 3WK9A 1UOQA 4UPDA 3RARA 2BFNA 4QNNA 2HU7A 1XQVA 5LKAA 3ZLTA 1J07A 4OPMA 5CH8A 5AI6A 2PSEA 4X92A 2ONCA 4ZI5A 1HL7A 3DOHA 4FKBA 4DYHA 5ALSA 1E8NA 1XZBA 5ALKA 3CN7A 2J4CA 4HTAA 1QFSA 4XVCA 3TRDA 4K5QA 1CQWA 2VF2A 3OPMA 4FDMA 3CXUA 3RM3A 2XQGA 2DHEA 3D3NA 4AQDA 3I2IA 5CT5A 5BV7A 2AJCA 1OXMA 1SC9A 3D5EA 3E4DA 4Q1VA 4LXHA 3C5WP 4M0EA 1BN6A 4J0HA 1EVEA 5AKIA 4B9AA 2OGSA 5AOBA 4A23A 1OILA 4U2EA 2ROQA 4RE5A 4QWMA 4YASA 2H7CA 2Y1KA 2WFMA 3OM8A 4WDRA 2GYUA 5C8XA 2B61A 5LLSA 3BXPA 3AIKA 1HBJA 1BROA 1YB6A 4KE9A 1O6GA 4DMKA 3MVEA 1CUCA 2XQFA 3KWJA 3PFBA 4J0GA 5EHNA 3LS2A 3O9MA 1XROA 3FBWA 4MQLA 3WL7A 1ZD4A 1RWQA 5DNUA 4KEAA 1MX5A 1N5MA 1VOTA 2PPLA 3QMWA 5ALYA 1BE0A 3CCCA 3R3UA 4G9GA 4C6HA 2XT0A 1W76A 2HFJA 4K2AA 4CI9A 1XZDA 3EBLA 1H2YA 5LZ7A 1JJFA 3R3YA 5AI9A 4WDQA 1JMYA 1K5PA 1EI9A 5I7UA 1ZOIA 3STWA 4Y9SA 3QMMA 2FX5A 1FFAA 1WOMA 1XRRA 4DTCA 2OGZA 2J3DA 1EA5A 5LZ8A 3E3AA 2BUBA 4PSDA 1EK1A 3DL7A 3BWXA 4X6YA 1CUBA 1Q0ZA 1VZ2A 5SYNA 5E4YA 1FFBA 4HAIA 3STVA 1MN6A 2Y6VA 2PUHA 2QT9A 3V1NA 5DYYA 4B83A 4BP9A 3O9VA 4XJVA 3VXKA 4QDOA 5FUMA 1GT6A 2XUDA 2PSJA 3G7NA 3I2FA 4W1QA 2CUTA 2WIKA 4G4IA 1CUGA 2JIDA 3N0TA 5A7GA 2PBLA 1WCYA 4TVKA 2CB9A 6YASA 1QJ4A 2H1IA 3JWEA 1WB4A 2EDCA 3AZQA 4S0XA 3DYIA 3QITA 1MNAA 4MEBA 1L7AA 1XQXA 4BE9A 1YASA 4UHDA 4BTVA 3GA7A 7YASA 1YA8A 1GQRA 2VATA 1TCCA 3TGLA 4B82A 5ISMA 3M3DA 2QR5A 3C45A 2Y2UA 3DOIA 3PFCA 2VSQA 3IIIA 3H2HA 4PV7A 2GBCA 2PM8A 2YYSA 2O7RA 3WWPA 5ALWA 4BP8A 4B0PA 3HZOA 3GBSA 1B6GA 2DCMA 1UKBA 2O2HA 4OSEA 3G9ZA 3BDVA 5KREA 2X5XA 2QVBA 3QPAA 3FSGA 5JAHA 4JNCA 4P92A 1WPXA 3O4HA 4PO3X 3IB3A 5AIAA 4Y2VA 5JAOA 4JUIA 2XUIA 3H1BA 1WPRA 4X91A 1JU3A 2WM2A 2JGLA 4IQ4A 2ZYIA 1XZMA 3IA2A 5AKXA 5AI8A 1PJAA 3ICVA 3R41A 4EY7A 2Q0XA 4H7HA 1L7RA 4LIPD 5D6OA 1XFDA 2E3JA 5K3DA 5JATA 1S8OA 1HPLA 4B85A 4Z49A 5BOVA 3E0XA 2DHDA 1ISPA 5HF6A 5A62A 2BKLA 1A7UA 5ALNA 4Y2SA 3SC2A 1TRHA 5HQ3A 1YCDA 4KAJA 4BVLA 2GZRA 3OC0A 4HS9A 4Q3KA 5LKRA 3DYVA 2QTBA 3QM1A 5H3HA 4DNQA 4HVTA 2OQVA 5AK4A 2HADA 4QDUA 1LPPA 1SFRA 5I8PA 1TAHA 3WL6A 3H1AA 1DTEA 3OURA 4Q34A 3K9BA 4X90A 2YH2A 3B5EA 4GECA 3AILA 5AOAA 3NWOA 3WK5A 2OXEA 5CTAA 1MU0A 1J1IA 3EQ7A 3B3QA 3ANTA 1WB6A 2JEZA 1GPKA 1VE6A 3EIOA 1HKHA 4MWSA 4F60A 4OB6A 4V2IA 4BAZA 4DLNA 3MUNA 4U2GA 1BN7A 2H9YA 5KBYA 3W9UA 4D9JA 4WCVA 4EB0A 1CEXA 1LPBB 1AQLA 1NU8A 4WFJA 4UFNA 3RKSA 3WIOA 1ZICA 3ED1A 4E46A 5JANA 3Q8WA 3G0GA 3V48A 3AUKA 4UBOA 1CQZA 5A6VA 1U8EA 2C7BA 1ZI6A 3IUNA 1YAJA 5AI0A 3HJUA 4FBLA 1C7IA 4KACA 4IHAA 5A2GA 3NOXA 5FP0A 4RGYA 3O4IA 1LPAB 1DT5A 1XZLA 2XQIA 2Z8ZA 3V9AA 1XZKA 4F5ZA 4QA9A 4UBMA 1SCKA 2WIDA 1QIFA 2PL5A 5JADA 3FYUA 2QM0A 4PW0A 4ZWNA 1YS2X 5AJHA 1ZI9A 4EA6A 1QIGA 2GBGA 4G8DA 3H18A 3AZPA 1IVYA 4FLMA 4B80A 3QPCA 5ALXA 2VJDA 2XMGA 1ODSA 3WKAA 2HRQA 3VJKA 1R9NA 4M0FA 4W9RA 4C4YA 1F0PA 2WG1A 2WUDA 4QWWA 3KD2A 1VKHA 3A2LA 3G02A 5ALDA 1DQZA 4YPVA 3F8SA 3PE6A 1X2EA 3JYHA 4QDXA 1QLWA 3WYNA 4BAGA 1TCAA 3NUZA 1XZJA 4FHZA 1LZKA 2HM7A 1VXOA 4GDMA 5AM2A 1Z68A 5AKGA 2QOEA 2WHRA 3V1KA 3U0VA 3WL8A 1P0QA 2HA0A 5LYYA 1U4NA 3C87A 4X00A 5C8ZA 4EY6A 4DMCA 5HQ3B 1EDEA 1E3QA 2PSDA 3G0IA 4AO7A 4E14A 4H7FA 4BAUA 1HDEA 3QYJA 1EVQA 1Y7HA 2IITA 4ZV9A 2OCKA 5DWDA 3T52A 4RPCA 5ALHA 3WIBA 4G1FA 4F0JA 1FJ2A 1DQYA 4J0CA 1RP1A 3K2IA 1A88A 2RONA 2WIGA 3I2JA 1XRLA 4WY5A 2X76A 5DTJA 1KU6A 1H2ZA 3PI6A
chains in the Genus database with same CATH superfamily
1HTWA 1QO7A 1Z33A 2ABWA 3TVTA 1CJSA 3IQWA 1HNWB 2WZDA 3ZLVA 4JGBA 5F78A 2CBGA 1F2TA 1K6XA 5LQSA 5JU6A 1G64A 1SK8A 1U7ZA 1KJ8A 2J3EA 5FTMA 4NU8X 1NXQA 5JCOA 4DLKA 3C1OA 4PPFA 2QVGA 3Q0IA 2P3SA 3CZAA 3REQB 5BRJA 4XD7A 3H99A 1JHYA 3H4VA 3OLVA 4KGVA 5DNDA 3L1JA 1FLVA 2BF7A 4BNUA 2WT4A 3O21A 1QBGA 4O29A 1QRAA 2V7XA 3G2OA 3H65A 1K6JA 2KM1A 2VOEA 3C16C 4FFBB 4L4ZA 4MJ7A 4WFQA 4YP9A 1EVIA 3T3NA 3THOA 2I91A 3LGSA 4DZTA 1UZLA 4N5LA 3JV7A 4AZ0A 2RCYA 4E5UA 1BU5A 1VE3A 3DV9A 3JPWA 3ER9A 3GF4A 1XAJA 3EHDA 1AMOA 1HYHA 1D6JA 2QZJA 1Z8FA 1U3CA 3PFGA 3WJAA 3DOOA 2Q6IA 3FSEA 3AOGA 4B5LA 1J09A 2GESA 4AY5A 1E0AA 1QYIA 4Z9YA 4K40A 1KIAA 3OWOA 2FOLA 2O8BB 2CLEB 2HPHA 4G6ZA 2H3HA 1B76A 3LDUA 1T25A 1E9VA 3KBOA 3L7AA 2VNJA 3EDOA 4HNGA 2H85A 3EZ6A 4KDCA 5LD2C 3KXKA 4I1OA 4V02A 3LOQA 2Y1EA 4OOFA 1JX6A 1C30B 2QR3A 1G8YA 3A70A 1F9EA 3KM0A 1LCIA 3TW0A 3QYAA 3UJ7A 3J80A 1QR6A 2WKWA 4C3UA 3U3OA 4LX0A 2XMQA 1IB6A 4K9DA 4OJYA 4ZI3A 2G3YA 1CZLA 1UIRA 4QXOA 1BFUA 4XDHA 4EVRA 2EKZA 2OFOA 5EIXA 1LBTA 1OV6A 3FNRA 2WHPB 3NU1A 3PIIA 3ELUA 3VYWA 4JLWA 5TGTA 3GBVA 3ND8A 5CGQB 3NC0C 3HK2A 1Z3CA 3E3MA 2QW8A 4KB5A 4OREX 1RKBA 3B8HA 3FUXA 3UA4A 3VH3A 1A9OA 1NUHA 4FFPA 1UMBB 2BEWB 2YC2C 5TQVA 3TTSA 4HZGA 2IZZA 1YH3A 2CVOA 3IHWA 4KK3A 3KQPA 3M2TA 1F48A 2XI4A 3BJMA 2J45A 4MDYA 1Q84A 1KAQA 1RACA 2IOFA 1VI6A 3EDQA 3PHIA 2ODAA 3PT9A 4IIBA 4LV6A 4MPDA 3TQRA 3ZJVA 4YXWA 5GAJA 4J90A 3IT2A 4FUQA 2RGXA 2H4ZA 5K2MA 4YYZA 2PWAA 4I6GA 1MPTA 1IHPA 3RI3A 1F3LA 3S2FA 4MWOA 1HWYA 4NC9A 1XPOA 4F1WA 2ZCVA 3IP9A 2PXHA 4HQNA 2G88A 2VHTA 3GG2A 3SOPA 1DTWA 1OBFO 2EARA 1I4LD 2ID9A 4JJ8A 2A59A 3GCZA 2JJ1A 4U9UA 3RUEA 2IZ5A 1FTWA 1HDGO 1T2UA 2PKCA 5JEDA 4FI3C 5JBQA 4MV6A 2REQB 3E84A 3FPBA 4QGSA 3DZCA 2DU8A 2SCUB 4KFUA 4BLOA 4TV9A 2I34A 3W8RA 1WKCA 3F67A 1WHTA 1N2HA 2OMEA 4ACBA 2UV8A 3AX6A 4DSAA 3I5YA 3H05A 4MCHA 4EG7A 4X61A 3ECAA 4FIDA 4FMBB 1YK0A 4QU0A 2ZJ6A 2RB5A 2PLRA 4FT2A 4JLDA 3U7FB 4WZAB 5DU2A 4TQ9A 3T12A 3FTCA 4UCXA 3CLRD 3P9XA 2P62A 1ZI8A 3WGLA 3OQIB 1JAZA 2BFBA 3FDFA 3IDFA 3WMGA 3GZNA 4YIHA 1E3SA 1HE8B 1JPJA 3D1VA 2YVQA 3RK1A 4LZLA 3PQ5A 3LW7A 4MP3A 3GCXA 1JEJA 4N65A 5DWVA 1GQSA 4QE3A 1W5AA 4KJZA 1CUHA 1Y3HA 3TLGA 1TIKA 5FOSA 1NWCA 4CTKA 2JZNA 1SRQA 5BUQA 3GLRA 1ENOA 1N8NA 5GY7A 3MFQA 5E1MA 2DT5A 2X23A 4TSRA 5BWNA 1G2IA 1O96B 5D2CA 2YWXA 1AKYA 3UUEA 1H5QA 4RGQA 5C0OE 4TWJA 2W98A 4B4KA 1R12A 3WAKA 4J76A 3VI4B 3UPTA 3UK2A 2Q1TA 1DJNA 1Z5GA 4GLJA 4G4JA 4ZXFA 5C51B 2PZGA 3H2KA 3WGZA 2RGWA 1MVLA 2BHNA 2XA2A 5A4IS 1HURA 1QQBA 3I9LA 3OU2A 5KWIA 3PGA1 4MVJF 5BXQC 1JQLB 4MGEA 1OCEA 4MUBA 4Q21A 4CM8B 2I4NA 3Q7EA 2ZWIA 4UCFA 1T2DA 1V25A 4PVDA 1PAUA 3MA0A 4G5XA 2FPWA 1SGWA 1VPEA 2PGDA 1SVWA 3NWBA 4QOIA 2W71A 2YXLA 2Q45A 4ZD6A 4ILKA 4DMHA 4LCBA 1K5HA 3DCNA 1MHTA 4WLNA 3KLBA 3ZHXA 1E4EA 1DHRA 1N1GA 2JFYA 5KC9A 1G6Q1 3R7AA 5DM1A 1C9DB 2CFOA 2IDKA 3N1UA 4HDMA 2RAUA 3G0OA 4Y2HA 5M04A 3LYAA 3BWMA 4FOTA 4Q48A 2EFYA 2OECA 3HI6A 1IK6A 1LXCA 1TAUA 4JVSB 3AV0B 2L82A 5HVNA 1PYDA 1ULSA 5SY4A 1ZM4A 4ZFNA 2B99A 4EDFA 4DB4A 1ZVQA 3NYRA 1NONA 2C9YA 2CY0A 4HWPA 4BGDA 5I4IA 1QU3A 3GN2A 3JQAB 3PWSA 5KHLB 1SQ5A 3STTA 1A27A 5JEEA 1XA0A 1VRVA 4OBEA 4RD6A 3H2GA 4C0XA 2RGYA 3NGXA 3IALA 5FWXB 4NE2A 1WNFA 3IQHX 1G4AE 1L5FA 4QSMA 4MZDA 2PWPA 3GQVA 1Y9ZA 5HWSA 2JFBA 1PUJA 3WK6A 3DTVA 1R5OA 4DG8A 5B3AA 3MCTA 4G5FA 1AC5A 3M6LA 1DWOA 2XKAA 2H1FA 4E7OA 4IFIA 3BAFA 3HM2A 4DMFA 4JP8A 3PHJA 4WZZA 3QEBZ 2AG1A 4P98A 2ODBA 3NBMA 4KG7A 1A7AA 1SWWA 2XF2A 4EA9A 2WB2A 3ESRA 1OH8A 3GX1A 1Z08A 1PNTA 3HHEA 4NDAA 5HKKD 4KPYA 3FPGA 2GK4A 1QYVA 2VL7A 4X97A 4ZVUA 1TMYA 3L4KA 1ZCJA 3K6KA 3ONWA 1RQ2A 4Y7DA 2QD3A 4BX0A 3EXHC 4JUCA 4G84A 4AJPA 3WDSA 3RADC 4G8CA 5JTTA 3DOEA 3FPHA 3L07A 3B1WA 3F7OA 4XFKA 1W35A 2IGBA 1ZIYA 2YWBA 3HEAA 4R1NA 2HB6A 2XA1A 2IIBA 5DYWA 3TQCA 3WJ1A 1G9SA 4EMBA 4JLUA 4CF5A 1JIUA 1RZUA 2ONYA 3GLHE 3TJZA 4QNMA 3LC2O 4U00A 1J8DA 1HZZC 3CGGA 4LRXA 3CW2A 3EQ8A 4WZBB 5B2ZA 3SEQA 4HDSB 5B3KA 2X0KA 3T7DA 4FQ8A 4KBYA 3H13A 4V1CI 3WLFA 5CX4A 2IKQA 3M6AA 4AXBA 3IE2A 2Q5QA 2Y1CA 3MC1A 3FGOA 4V0SA 3SXPA 2CYAA 3C7TA 1ZD1A 3FFTA 2I03A 3OT4A 3VMMA 3UG6A 2VRCA 3AHHA 3CVOA 1FTYA 3FMGA 1HDCA 3INTA 3K1JA 3H1GA 4KYUA 2GN2A 3B51X 2H17A 4C6TA 1M8JA 3UVEA 3F6EX 4KR2A 4OQFA 1RHKA 2AXEA 1Z17A 1J33A 4OFXA 4E2FA 1IQUA 2QBYB 5EIBD 3A1FA 5A3QA 1N57A 1NXWA 1IY0A 2QK4A 4H60A 5JAQA 4LC9A 1Y8QB 2IYLD 1E79A 1WL8A 3QVTA 4H1HA 4UBLA 4RTPA 5AR1A 1LBIA 2GZSA 3JQAA 5CYFA 5K8TA 2VZEA 4GUAA 3CLRC 1F2UB 3E7PA 3FUCA 1HE3A 4IPTA 4L5AA 4MWBA 3SJBA 1KZ6A 4O4IF 2FJ0A 2DQKA 2QLNA 1Y6ZA 4HB3A 1U7XA 2D7JA 2GK7A 1A95A 1PEAA 4P3NA 1U94A 5CVVA 5BQ5A 2D74A 3X1JA 5A1TA 2QL9A 3L8HA 2VDWA 5FTWA 1ZOOA 1QU2A 3NANA 1ITZA 4RJKA 3SYTA 4DN6A 1E2FA 2YVUA 4EGQA 4IJVA 4R0VA 2PX6A 1Y33E 2X9NA 2YZGA 2ZUBA 2GWHA 2OR3A 3FOBA 1RQ7A 4DMMA 4RM2A 1PSWA 1ZP6A 2OHGA 4HVAA 2GAJA 3CE6A 4IDEA 4KWCA 5I7FA 3A06A 1S1MA 1MIHA 1GEGA 2G9ZA 4MUMA 4UMVA 3KKOA 3NNSA 4ALIA 4PYIA 3OHMA 2TYSB 3UMYA 1YACA 1N6KA 2V7PA 2YRXA 3EXHB 1M7BA 1UXJA 1BCSA 3VA7A 3GLHA 3TQTA 1DIBA 1Y5MA 1Q0PA 1QRRA 5AKKA 2OXIA 5B36A 5HFJA 4YLEA 3DUFB 1YS4A 1XMXA 1DKOA 2SNIE 2ZIGA 3UWOA 3R3WA 2XMDA 4AROA 3HB9A 3ETGA 5CT6A 5DTIA 4QDTA 3BEDA 5ALLA 1SCJA 3TRIA 4OQDA 2CE7A 2ILTA 3KIPA 3NETA 1K3UB 1HZZA 3I0MA 1H0SA 4P31A 5F9HA 1NQOA 2FGKA 4J0DA 1WB9A 1C9EA 1NAHA 2C3PA 3A58B 3PNYA 4OXRA 4OL0A 4QYWA 1Z6ZA 1GV0A 2PRIA 3PICA 3OT1B 4JYCA 5CH3A 2OPHA 3WGJA 2IX9A 4ACAA 4EQ6A 4U2CA 1T1EA 2GEJA 3Q3IA 3QV2A 5FPPA 4MRSA 3GJTA 2XKBA 2YDXA 2WWXA 4G1EB 5LZ5A 2AN5A 3LQQA 4HDCA 2D59A 5MGNA 8MHTA 1LLDA 1ZDMA 2NSJA 1VPDA 4B3SB 4DV3B 4CCWA 4Q4CA 3HYTA 2BFFA 3EGDB 3C5HA 3SQMA 5CXSA 1TF5A 2YMLA 1NJ5A 4DCNA 1JUDA 1QZ3A 1S2IA 4N1AA 1QK5A 1PTJA 2Q2VA 3MYRA 1XDGA 3AL3A 4ESOA 5P21A 1QK4A 3T3PB 4INZA 2XOKD 4ITRC 3RFTA 2IP1A 3FKQA 5CLHA 1D4ZA 3NHFA 4MW7A 3BWBA 4REOA 1MBZA 2WVJA 3FJ1A 2H7VA 3ZE0B 1VIDA 2W6CX 2CD9A 4MWZA 5E2AA 4J8PA 3A10A 1PR3A 2EG5A 4H7KA 2P6NA 4GW3A 3GLIE 5JD3A 1PJZA 4C06A 1XMPA 3FYCA 3UWMA 3KZ1E 2FEXA 2FCRA 4MW1A 1R2QA 4TRMA 3GT3A 5IN5A 2VPPA 3HO6A 4FP9A 4K9KA 9LDBA 1AQNA 4I1SA 5HBGA 4LYYA 3UMMA 4ARCA 2QMEA 1T3LA 1U1EA 2NAPA 3QEMB 4I1VA 3ZHYA 3S2ZA 4LFAB 4ND4A 4YNBA 2NSLA 3K0FA 1KAOA 3KLNA 1KO4A 4MWTA 2IHTA 5JYCA 4M1YA 4FGUA 4RJJA 1BU8A 1DU4A 1S3FA 4ZO4A 1O9GA 1SBZA 1BX3A 3QLTA 4N82A 5LDGA 3BQ9A 2H9IA 1PFYA 5TSDA 2DCUA 3I39X 4DJEC 5ERXA 4RLQA 3JWPA 3JW8A 3WKCA 4LFCB 2YASA 4NENB 4WEQA 3U1BA 3B6JA 3MW8A 4HQKA 3HCRA 4KNVA 4XEUA 1X42A 2ZVJA 3DMRA 4CIXA 9ABPA 5IHPA 4JEHA 4D44A 4W1SA 5CDFE 1KY2A 2CL5A 1W85A 1BE6A 4E2XA 5AYVA 3C7CB 4Q7JB 3UV6A 3HLKA 5CVDA 5YASA 1GL7A 2O5CA 1IUKA 4IWNA 4BE4A 1ANKA 4KXUA 3AHGA 1VPTA 1SVOA 1P1CA 3CQ9A 4YCBA 1JKFA 1PWHA 2AYYA 3PUWA 2DFNA 1ZOPA 4ODIA 5KIAA 3ZJ5A 1GFZA 1YBMA 4XGQA 4WLVA 2HLHA 4PX2A 5L3SB 1KY4A 2Q7OE 1Q91A 3R75A 4RW0A 4C0BA 1NKSA 3HJHA 2FK8A 4G01B 5CB6A 3OE7A 3KQVA 4P38A 2V5VA 3OESA 2B5OA 4GBGA 2CNBA 4EJ6A 1DXHA 1T5BA 1X87A 2XBLA 2C8LA 3FB4A 4OLHA 4TKVB 1MFZA 3ANSA 4QLAA 1MO2A 1T1JA 3JQAD 3HRKA 4ERNA 3UT6A 3CZ4A 4EMSA 2WWVD 2OBXA 1JHMA 2R1TA 4KZPA 3ISTA 4RK0A 3ZX4A 2OG1A 2EJVA 3AQ4A 4C0QC 4DNFA 4UBNA 4OHXA 1ECGA 2JLAA 4NZYA 4BGVA 2Q28A 3HKCB 3VPHA 1EVLA 2ZJAA 3MBKA 1P0FA 3E1SA 1S01A 5FTLA 2XOXA 2HSEA 3B52X 2VPWA 3FA2A 3IP6A 1TU3A 2DPXA 3LFUA 4J2OA 1JF8A 2GXSA 3NBAA 4RPIA 1PEKE 3OHPA 3CWZA 3PCTA 4RE6A 1JDBC 2ZBRA 4CKWA 4UHHA 2JKZA 2KWIA 2Q6OA 4ML3A 3V5NA 1XK7A 3AY6A 2VUIB 4ITVA 4KQXA 3PLNA 5KYVA 1ISRA 3O8QB 4KDRA 2B4TO 2DFDA 2J9FA 5ALZA 1XEWX 3CN9A 2D1RA 3K72B 4Q82A 4YMWA 1AS3A 2HJHA 1TM4E 5H68A 4CM7A 4MKFA 1FP2A 2ARKA 3FG9A 3C43A 3OQPA 5CGZA 5BW8A 1CDZA 4AN4A 5DT9A 4CM6A 4TZ0A 1DL5A 1F60A 4FOOA 2PL3A 3L6OO 3WI7A 2Q1XA 4B3CA 3EZYA 4J7UA 5CFNA 2IHVA 5AP9A 4B7CA 1RAEA 3ESBA 3BSFA 2G06A 2Y3IA 4PO8A 1KPHA 5JFTA 1SXJD 5IDYA 1DXYA 4LGVA 4BB9A 1IBCA 2IBMA 2MMCA 5LP1A 4CPDA 1DRJA 1CD5A 2P4UA 5JY1A 1W5SA 3MWEB 3KKLA 4U7GA 2PD4A 5TMBA 2V6GA 5ITSA 3AVYA 2QG4A 1NXTA 3I9V6 2QZPA 4O33A 4HGRA 4YAJA 1G7TA 1OWLA 1RYYA 2NQTA 4HAZA 4ZQFA 1P4AA 3UMFA 3WGIA 1LBEA 2XB8A 1T4MA 4RFVA 5FX2A 2BFMA 2GASA 1UC9A 2ZJ0A 3NGMA 2P5TB 2GLTA 2JEOA 3N2ZB 3NHZA 2CKDA 1R9JA 2X41A 5LXTA 3QKIA 4QXQA 1TFRA 2Z09A 5AVKA 3BRWA 4FYYA 4GICA 3DR5A 2V7TA 4X93A 3TSAA 4CKCB 3GRZA 1FFYA 4Z5XA 4CT0A 3KTAA 3KSRA 4YX9A 1E5VA 5A04A 3I6BA 4OHMA 3V00A 2XKJE 4KR3A 4HD8A 4UAJA 5JRDS 5KJCA 1U2DC 1EE2A 5D1NA 5FUYA 4MVWA 1N9GA 3VYUB 1QQTA 4XEHA 3PK0A 4XYBA 2H5LA 3TYXA 2VHQA 1FS5A 3UAZA 3WV5A 3MGKA 2XUZA 1OFIA 2IYUA 2G4CA 3GJXC 1YB4A 3PC4A 3ZBQA 1DBQA 3Q7SA 3TX6A 2C82A 4RY2A 4EZEA 7ADHA 5KJFA 4RK7A 3WIEA 1J06A 4Q3AA 1E3EA 2UTGA 2RHWA 1VE7A 2OXCA 4PWZA 3TI7A 4CF3A 1TUEA 2XUKA 4ISCA 2YWDA 1ZHOA 3UW1A 4FYKA 4ZMSA 2P2GA 1ZG3A 1OWNA 4B8WA 4EYGA 3EA4A 1N33B 4JX8A 4CJXA 2JLUA 3CR8A 4PYLA 2P2YA 2PRSA 4I9FA 1UQTA 3M70A 4TLDA 4F5DA 5AVWA 3I0ZA 4K6MA 1E6KA 4GXNA 3RJTA 4JR0A 2JASA 3N8IA 4KMMA 5CHEA 4B4VA 3VI3B 3RNOA 3TN7A 5IJ0A 4JOCA 1Q7EA 1UDRA 1U8UA 4AO8A 3TRHA 5H3LA 3GN1A 4KTTE 4Q37A 3ZEIA 3DPIA 5JR3A 2GI4A 2CJXA 3Q3HA 4UNNA 3JWGA 4WI1A 3MJHA 4MQ5A 4BKPA 4HEQA 5EZYA 3R7LA 5EKDA 3C1TA 1VIYA 1DCMA 3CVWA 1L5SA 1I3CA 2JHGA 4RY8A 3OX3A 3CUUA 4TKZA 4TTJA 1JHPA 3QUCA 3RVOA 3TLGB 3JR3A 3OJLA 2R6DA 3C6MA 1UWCA 5CLGA 5CUQA 4P34A 3QLUC 2I1VB 1QHSA 1DBWA 5GONF 2HU8A 3NCHA 3U7QA 5LQDA 4NNPA 1I6MA 4DA9A 4F85A 1GZ5A 2D2FA 5C4GB 1RYHA 1KMHA 4NS1A 3L8ZA 2ZIXB 3SDBA 1E2BA 4C1NA 3FCUB 1EGMB 3TBHA 2VR1A 2OV4A 4XDGA 5TXGA 1CUAA 2EJTA 4YJFB 4OG2A 1H1TA 1C7JA 2JH8A 4TRRA 1I33A 5HZHA 4G86A 4G0OA 4MOWA 5E3IA 2B30A 2PLNA 1DXQA 1GDDA 4GAEA 4BNKA 4UM5A 1NW6A 4NZOA 5NULA 2AFIE 1GPMA 3H6KA 5B4TA 1X7WB 2PZEA 3U6BA 4NK4A 1WHTB 1CRQA 3N0XA 2QEQA 2G09A 1RAAA 2ZVPX 4UBJA 5JNWA 2R68A 3N8HA 2ZGVA 2DJIA 1E5QA 4A8JB 2DQSA 2ZT7A 4FFDA 2Z9CA 5J1SB 1Q77A 1Z0JA 4FOPA 2NU8B 4IIHA 2ZAGA 2A84A 3AJRA 3EF3A 4NCXA 4II3A 5THXA 4ZHQF 4AY2A 5JRJA 4EPVA 4LOHA 1NUPA 4O2AA 3RVSA 2HJSA 2OAEA 4JXJA 4BMYA 5B57C 2OV6A 1KXZA 2VYQA 3A4TA 5KQSA 2YWHA 1DG1G 5DLEA 3U44B 2ZIUB 2DLDA 2WVAA 2Z2JA 3IEUA 3OQ1A 5D7BA 4MUIA 4TWZA 1YUNA 3V7YA 3ZV7A 1Z7WA 4TT3A 4CKZA 1OI3A 3FBTA 4L27A 1UXKA 2E5FA 1NP7A 1UC4B 4YJGB 3T1HB 1EWQA 2R8ZA 2ZJYA 2ZR0A 2ZUWA 5FPTA 4BZWA 4WK6A 1A2OA 1EX9A 4LV8B 5TS2A 1XT6A 3JVVA 4U3JB 1FRNA 5BN5A 4N18A 3ZJUA 4KQFA 1AK2A 1XK6A 2ZRIA 4Q1AA 3R5JA 3SMVA 1P2TA 4IX9A 1JKJA 1DX6A 1MF7A 4FW8A 4KXWA 5DSZA 1OW3B 3PRHA 4NMWA 1OUMA 3UT5B 4G0MA 1KIFA 4CKYA 1K66A 1PNOA 3WHPA 5JUWA 5DW0A 3OMLA 2JHPA 3PS9A 2Q2NA 4FEEA 4JNKA 2VP5A 3ETLA 2JGIA 1E2MA 5A71A 3ZHZA 1MCZA 4YCJA 5AT1A 1I6WA 2O48X 2PL1A 3CVYA 5TLSA 2GCNA 4F3NA 2QQFA 4MV8A 1RM3A 3THWB 1BGWA 1D7AA 3M5PA 5DLQC 1QB8A 1P91A 2EX1A 1NVGA 3MWKA 4GFDA 3L79A 3S2SA 2CZQA 2VK1A 4FS3A 3EVCA 3REGA 2QD4A 3BAZA 5DLYA 2X2FA 3E3LA 4D6XA 5CEJA 3NWPA 2R2AA 4JZKA 2XE7A 1TJ3A 4NOKA 4TV8F 4LXYA 2FPKA 2X77A 3TOZA 3FAKA 4BMDA 2QENA 4YMSA 4NLLA 2GVZC 3I2YX 5J2TF 1OR8A 2BV3A 4CTOA 3NORA 5L6MB 1AVTA 4UE3S 3L1IA 1ZM2A 4M0PA 4QECA 4MVJP 1WMBA 4YJ2B 5BORA 1PP4A 3DEZA 3MJTA 2GFHA 4RXTA 1U4OA 3AVOA 3GRUA 2E18A 2GPWA 1CIPA 4OD0A 4QL3A 3R3VA 5K8LA 1YL5A 4LN1A 4M7OA 2BKEA 2FSVC 2FRVA 1KZHA 5JPCA 4LRYA 1MRNA 1NR1A 1CETA 1FMFA 4NJMB 5B7GA 1WHSA 3ZOKA 2F1HA 2BR5A 2DULA 2HCRA 4REQA 3TDMA 3T9FA 1RKUA 4I3GA 2YJTD 4TLMB 2VLIA 2I7XA 3S28A 5FWDA 1ZVJA 3A1WA 3CBGA 3SX0A 1H9AA 2PS9A 1P33A 1U2PA 3VV3A 1U0FA 4E4YA 1E89A 4UU7A 3SEZA 1DLJA 4C88A 4PANA 1OI4A 2G1PA 4QUHA 4UM9D 2ZTVA 3FIJA 3GRRA 4KNYA 4KO8A 5B53A 4NCHA 2ZRAA 4F12A 1KI8A 3ZHQA 2YVAA 1QRSA 5LC1A 4C6SA 1LSJA 2CFCA 3L4SO 4C78A 5B7PA 2PUFA 1VP9A 1GILA 2ZRJA 3FZEA 1QRUA 1NBOA 2P9JA 2SKEA 5LYJB 2REBA 4NS4A 4R69A 5KSPA 3DJFA 4H0FA 5FLKA 2G71A 1WBBA 1OF1A 2BL4A 1QFJA 2C7VA 2V9CA 2ZSIA 4JODA 4LXTA 2VZ8A 4UDNA 3CRQA 2ZFUA 3OT5A 5EXTA 4GPBA 3NASA 5H4GA 1FUEA 2OMKA 4OBWA 2I5PO 3RWBA 5EJ4A 4LPKA 4GZ6A 1QGAA 3WGOA 4GYWA 2FK7A 5ENZA 3CCFA 4BFSA 4UXJA 5FBVB 1J42A 3KVRA 4OB8A 1Y1PA 4AX8A 1VJRA 1TF7A 1GTJ1 1N2SA 4AF7A 2DBRA 3LMKA 3IUBA 4JR1A 1C0PA 3ABZA 3FB1A 2XDWA 2XRMA 3FNGA 4RQBA 4X6UA 5ELMA 2QTGA 1BMDA 1NW5A 2BGRA 3C41J 2BGIA 1AKVA 1TO1E 4I1IA 4XA8A 3HNOA 5C4MA 2Q8NA 1T0BA 1VKNA 2TS1A 4PXSA 5J2UB 2HR1A 2YQZA 1G5HA 1NLMA 4CXMA 2F59A 2AJBA 3IDAA 1WY5A 3ZWXA 3IDOA 3NHLA 3IUJA 4HAVA 5HKLA 4L02A 2D4AA 4UM9B 5JASA 1BDIA 1HX7A 3KCQA 2FN8A 2MHCA 3H2IA 3VTAA 2PKYX 3FRHA 1ICEA 4WFIA 1LLQA 4YN3A 3X0DA 4BVGA 4XWOA 2VIIA 4KR6A 4HUQB 5TIIA 1OH5A 2FFRA 5FRDA 3WB1A 3WFIA 2TRSB 4CG2A 1H2HA 2WUFA 4HMQA 4OQXA 3R5SA 1WDWB 5L40A 3JYNA 2AMJA 4L72A 4G07A 1DFIA 2FW8A 4RVHA 4PG8A 1A1SA 4M22A 3RRFA 3P1JA 3PFWO 4G89A 5CT4A 4BV8A 3GEDA 3TD9A 1XZAA 2Q3EA 2SHKA 3RQSA 3WK8A 1J2EA 3UGKA 1EFDN 4YFYA 3DOFA 1ZOLA 3TLAA 2I65A 4Q9IA 2D1QA 1YI1A 3BB4A 4B9EA 4ZVTA 2YMMA 1T10A 1WABA 3ISVA 3VJRA 4RX1A 1E1YA 3NEAA 4H08A 3MAGA 2WD9A 1B74A 1G5QA 4EFDA 3FJYA 2QRZA 2BTQA 2XUFA 4RK1A 3TLKA 2FPRA 2QTLA 3LW8A 4HLNA 4XVRA 1P31A 3MUEA 1P5ZB 5JRZA 2VAWA 4J1NA 4HG2A 2H2IA 3RQIA 4K05A 2DPGA 1F51E 3AWIA 3FNQA 4KQHA 5A9SA 2O2CA 1SCAA 4JUDX 2K87A 4O63O 1HNXB 1DAPA 3T35A 4D7AA 1AMUA 2PL9A 5BOSA 3K2EA 3HV0A 4RPKA 1B8OA 4HYEA 3PQ4A 2L0XA 5K7SA 1JFLA 3DFMA 1T8SA 4JX9A 1AV6A 1NC1A 3C6YA 2GZ1A 3KELA 1PU2A 4GU5A 3BH6A 1ORIA 3T61A 4UHEA 1JBKA 4A91A 2AXNA 4D96A 2G5PA 1DBPA 1L3CA 4QLOA 3H7AA 2YIVX 2PYIA 4TKMA 4A6DA 3I05A 1YR8A 1GXSA 4UTPA 1UDBA 4EO9A 4PX3A 3OPQA 2Q9BA 5JZBA 3F46A 4MHOA 4UOQA 3GWZA 2FHPA 1HETA 4I5EA 1JG4A 5H1YA 4E88A 5CG1A 3L7KA 3AVVA 3HDTA 3TM5A 1QDUA 3Q8LA 1AZSC 2VTBB 3D0KA 1XELA 2OUKA 3TAXA 3X1KA 5ALVA 4OTZA 2GKOA 3LHKA 4YUYA 1RSZA 4RTQA 5EIHA 1Z35A 1BCRA 1M0TA 4U9IS 3ABRB 3AM1A 2D5LA 1YR9A 3G5UA 5G0VA 2RD2A 1LA2A 1KDYA 4MDEA 4H9GA 3HXTA 4MYTA 2AXQA 1QCZA 1SUPA 5ELXA 1Z0SA 3K0CA 3CIFA 4CEJB 2VDPB 1KJWA 1SEVA 3FCAA 2FQYA 3COYA 1YBHA 3HDJA 4UVGA 3VR6A 4ZKDA 4G0ZA 1I7SB 2OHOA 3DNPA 4ICIA 4N3NA 3VZSA 3PUVA 3ZWOA 2DX7A 3QELB 5E6RA 3TNJA 2PXAA 4IJUA 1K3FA 4Q1FA 1RS0A 2O3TA 5EUMA 2IW1A 1USIA 2IEDA 3EA0A 2XGMA 3HJAA 4GX0A 4YCAA 4BDSA 5CB0A 3P9KA 1NLFA 5DISB 2GPYA 3T4UA 1Q92A 4ZGGA 5MN5A 4R7ZA 4LS3A 4X62B 2GCOA 2B1IA 3G2NA 3FF1A 3LWDA 3MQ4A 5E0OA 5FDFA 3H2BA 2EIXA 3NV9A 4RMIA 3RU9A 1GAJA 2DRIA 1IY9A 1EG7A 1LQTA 1Z4QA 2NXNA 4FPXA 2VTVA 4P2BA 5LJIA 2AZXA 3QWFA 4GUDA 1NC3A 5I9LA 1L4MA 1I7DA 3WRXA 1OY1A 4D5GA 5BSVA 3G5LA 3M6VA 1HEIA 1M2FA 1O96A 1V8OA 4FKMA 4JBYA 3A28A 4BFTA 1RPZA 2UUCB 2R9VA 3S55A 4RBNA 1ZFNA 2NSYA 1QM5A 3HFRA 3PEYA 2BONA 3FGPA 1W1IA 3L9XA 4BNJA 3STYA 1QTIA 3I8OA 4CL8A 1E0KA 1SBNE 3HUFA 3PFNA 2HWUA 3G1UA 1I2AA 4F06A 5B3JA 1BS9A 1TLFA 2EZ4A 4DLVA 5GTDA 4LOIA 4NJMA 3D7MA 4YT2A 2YJ5A 1Q2XA 1KFBB 2PZMA 1VSUA 3BMQB 2YN0A 4KQ1A 3CH5A 3GQBA 3U6KA 1RI1A 4ENUA 4CG3A 1N2GA 3IEPA 5ALPA 4ZCLA 4GZLA 4FB4A 3JZDA 1LVUA 3VVCA 3GT0A 4B7UA 3SHVA 1E2HA 1MNQA 3EMVA 4YRSA 4CIBA 1KIMA 3PKIA 3PXUA 1NN5A 4M8SA 5K3BA 3D6JA 3U7EB 1IHOA 1PL8A 2NMVA 3WQBA 4TYWA 4HI0E 1RLOA 5JHGB 1A4XA 1V5FA 3IUYA 4NY1A 1YQGA 2HAEA 4N0DA 3ZXSA 1Z37A 3U19A 5ITVA 5A03A 1E99A 3INYA 1N2EA 2PX8A 3T5GA 2BW0A 3N2IA 1PZGA 5I9MA 1RI5A 2RHRA 3V8QA 3I37X 1SQFA 4X9XA 4KP7A 3JARB 2W2QA 2ZANA 3L93A 5KWVA 4CR8A 3D6NB 1RYNA 4DCVA 3WVNA 5IFKA 3FLEA 4UVIA 1WBDA 3BQNB 5FI3A 1WTCA 2C0CA 2X9GA 3IKLA 4I50F 4IYRA 4MAMA 2CLHB 3HA2A 4NWIA 2D5IA 3NR2A 5THKA 3VC1A 3ADBA 1M2WA 2QYHA 5H9VA 1KKUA 1YGPA 3BWDD 4J1TA 5REQA 3SQWA 2OLKA 4LRSB 4NOJA 4E7PA 4JSTA 4JYMA 3L5OA 5EWLB 5JXGA 3E9ZA 4D4GA 1TQ4A 1WULS 4R81A 1G3RA 2QN6A 3GJSA 3GPDG 4D3SA 2CK3D 3CVUA 1NY5A 4D43A 5FWYB 4C0SA 2RHLA 2FZ5A 1GCUA 2H00A 4L51A 4GLOA 4M0KA 1M5TA 1ODTC 1ZU5A 5AM5A 3O8RA 4LMPA 1U3WA 1UIMA 3ECSA 5TRTA 4YYEA 4B74A 2B1RA 5L7TA 4HBZA 2PR7A 2A0KA 2HMAA 1U98A 2EV9A 2NUAA 3G59A 3IVRA 2ZRBA 3DKPA 4E32A 4TKLA 5JNTA 3N9IA 1TK9A 3EFOB 3UMVA 4O0MA 4DQKA 1EINA 1GTMA 2LPMA 3A04A 3KWFA 3R09A 1EPUA 5FR2A 2ZXUA 1UDXA 4JEIA 2EKBA 4WGFA 1LS6A 1PZNA 1Q19A 4DAOA 4N5IX 2G1JA 4BATA 4F04A 4A3SA 2JVIA 4H1TA 1YU9A 1EP2B 1VJCA 3D59A 1KYIA 2GB4A 1GD1O 2XGGA 3HB1A 3Q12A 4IJQA 4LSWA 4TTQA 5ARCA 3RWMB 3V4FA 1TM1E 3X2SA 4N0PA 1GKUB 3VR5D 1CRWG 1Y8RB 1INLA 5K0NA 3I9V1 5TVGA 2QYOA 2DR3A 3KQWA 2A4MA 2P30A 5AJUA 2RHJA 3AFGA 1GFSA 1W75A 4MB0A 2XWBF 1I1OA 2YV5A 4MWCA 4PZAA 2BZGA 4CLRB 4DMGA 1F8GA 2OZLB 5B2EA 2LTAA 4B3HA 2HXGA 1GAQA 2YCLA 3G8CA 3ZWAA 5ER6A 1U90A 2QN9A 3U4QA 1V37A 2A3RA 3QVSA 2QN8A 3V7NA 2D4HA 2R84A 1ZJJA 2FKAA 4PG6A 4ZRMA 1JU4A 3BRCA 3OEYA 3JWIA 1AKMA 2Z1NA 2AOXA 4BYGA 5ICEA 1S2MA 5LMUB 4K2HA 2C7QA 4YASA 1YZVA 5CVEA 2YNMA 1DINA 3FH0A 1N0WA 2VT7A 1II9A 4FVTA 1EZ1A 2RH8A 3HKCA 1EESA 4DQUA 2Y1LA 3DO5A 4HLUA 1JTFA 1F4PA 4XGIA 4ENTA 3TPFA 5EJ2A 3JRXA 1N4DA 4FFOA 2GKSA 4UHBA 3ICOA 2IKSA 2QIPA 3AKEA 3BSWA 2VF5X 5DLPA 5HUQA 2X19A 3AYZB 3FUVA 3A4YA 4X1KA 4EY4A 5DK6A 1K7SN 1QF6A 3TGWA 4WOJA 5HK9A 2IPMA 5JZSA 1UJ5A 5ABPA 4PQGA 4W99A 4QYIB 1WPQA 4Q5IA 2WYWA 3AGPA 3DHWC 3LC1O 4MJ3A 3LM8A 2VDJA 3KXLA 1XVUA 1OX6A 1LLUA 4LSZA 1C7QA 4NBUA 3SSNA 1ZCAA 4L2IB 5HTOA 2JF0A 2A9OA 1XC7A 4BQNA 2CK3A 1Q7BA 2NNWB 4W1RA 3MWFA 3JVDA 2IYSA 1I3MA 2OAQ1 2NO6A 3DZ8A 2UVPB 5C81A 2PPVA 4RSRA 2QE7D 2ZT8A 1H4TA 2PFGA 2CSUA 3TTUA 2ZWVA 4D97A 1YQ9A 1YT5A 1TEVA 5ADHA 1XYYA 1EAMA 3L02A 4KV9A 2P4QA 3KKKA 4QULA 3QK7A 4H27A 3GEGA 5IH3A 2PTHA 1K4YA 2B0JA 1XDSA 1SBYA 2ONZA 3A37A 3E2IA 4C89A 4ZCTA 1Q1BA 1QX4A 1O97D 1NFRA 1MRZA 3MT9A 4X94A 3UPUA 3A1TA 3B2EA 3TOSA 2Q21A 3ZVNA 1EXDA 4BN0A 1JWLA 2JIQA 1DTWB 1WUTA 4W63A 1G59A 3A3KA 4HXEB 4NEHB 4PE5B 4TN5A 3V80A 3C7KA 1U0LA 2WWGA 3CNBA 3RIGA 5LR6A 4XB6B 4KL8S 3G0BA 1A5AB 5AXDA 3GRVA 3F3SA 1OLUB 4A0SA 1IG3A 1FDTA 2X2PA 3PDHA 5FO0A 3ZGNA 2OOSA 4HZUB 3MCUA 3BE5A 1HYQA 1KI6B 5B1HA 3ZU4A 2CMFA 2ZYSA 4AMVA 5EFZA 3BL5A 3QXJA 3R24A 2YX1A 4KKVA 1F8FA 1UP4A 4UHFA 4CM9A 3ETDA 4FYIA 4YY3B 1LNSA 1H6BA 4B7XA 3E05A 4GR4A 3ZLBA 3AUXA 2VYNA 3QVGB 3Q2KA 1AY0A 3L6EA 3QLVC 4P4LA 3PXBA 4DNPA 3VTFA 2R4QA 3DEJA 3HJRA 5JJIA 1NNEA 3VNBA 1OU0A 3GR6A 4XCXA 4NCNA 3H5LA 3G0HA 3OF2A 4ZOQI 4ZAVA 5ITZB 4TSFD 1JBEA 2XMPA 3B6KA 2AGVA 3OIGA 1G20E 4PAMA 1UFKA 2VT2A 2PUVA 3W3ZB 4HDRA 2ATVA 1W5BA 2I4RA 2I1WA 3EVGA 3ZY5A 3OQ6A 3PEFA 3VR6H 2J5KA 4Q4JB 1OAAA 5EEGA 2JDID 2W48A 2XXJA 1U0JA 1L5NA 2C7OA 2JCBA 3QFFA 2J0QA 3SJUA 4UU8A 1AGRA 1PJTA 3AI3A 1T4GA 1PR0A 4DBLC 2HBQA 4ENRA 2C61A 2Z4TA 1ZC3A 1LRLA 1P6UA 4UFPA 2NU7B 3U4CA 3TLMA 1ZINA 2NN3C 3CISA 3PDUA 4X65B 1ISMA 2NU9B 4ATNA 4RGBA 5LP6A 1OROA 4MCJA 2X0FA 1SD1A 2F64A 3AI7A 3CSSA 2ZWPA 3CS3A 3P0IA 1H22A 2QNRA 4J1QA 4C14A 1U3UA 3ZD6A 2EZ9A 3SX4A 2DERA 2J5QA 4ZCPA 3BN3A 4F11A 5FNZA 3OQHA 3MWDA 1D2RA 1PZHA 2GAOA 1H2RS 1I0LA 3IC5A 3KOOA 3W4IA 5FI5A 1CJMA 1HRKA 2FQQA 3OZDA 1JHUA 2HHLA 3VBCA 3NYQA 2QW1A 2I2AA 1XVAA 3M2PA 4AMBA 5EQTA 2FZCA 1BMQA 2DR2A 4HRVA 2NX2A 1DDIA 4H18A 1N0VC 5A7HA 1M2VA 3IO5A 4YRLA 1XI2A 4JT2A 1IVNA 1HQCA 2JI7A 2P1DA 4QU8A 5COBA 5AJYA 3REQA 5KSOA 5GINE 1U1CA 2DM6A 2GHTA 1NXPA 1ZGJA 1BQ4A 1Y48E 2HMSA 1U5BB 4V0LA 1J0BA 3GH3A 1ZAKA 3SC3A 4YONB 5IMBA 2C7GA 3DLBA 1MJHA 4RCYA 1PV1A 2GAIA 3B1VA 1LV8A 4YT5A 4WKNA 2J09A 2AOVA 2Z5LA 3CLTC 1A8QA 1SUEA 3EUAA 5EMLA 1UJBA 2VDNB 1QH1B 2FZ4A 1VLQA 4C0WA 3LV8A 5IJWA 2CNWA 3G2IA 2HQ1A 1H66A 4CHGA 4ZJZA 1U6KA 3QJYA 1ZK4A 1GPDG 1TVKB 3IQGX 4QAJA 2EKPA 4GOOD 4G1BA 1EXVA 1MOZA 4FGKA 5T41A 5BWLA 2P9CA 3RJMA 5AO9A 1CS0A 3JSXA 1IZ0A 2I3BA 4N7JA 4RH0A 5JNSA 3K1YA 1P19A 3WFZA 5CB4A 2JFOA 3NQ41 4B76A 4V0NA 2FP4B 4ZK2A 2A0YA 1WW2A 3RC8A 1NUAA 1CFZA 5KWEA 2UZ1A 2DBZA 5KNDH 1JFSA 2OYSA 1KA9H 1M6YA 1UPAA 1ZIOA 3RUIA 1V2GA 1ADGA 2BOVA 3JYQA 1GYPA 1GU1A 3GXOA 2O2JA 3HJCA 3OIDA 4IFBA 2CXHA 4O4LA 5JWHA 3L4EA 2XD4A 3TXAA 2VQ6A 5KX5F 1E3WB 3PL1A 4G5QA 1N5JA 1VRCA 1SIWA 1ZRNA 5MFPA 3V55A 2CHEA 1QAOA 5H82A 2NU6A 3QOFA 2ZYAA 3K09C 2C2KA 3KP1A 1PD1A 2ZI5A 2P91A 1G8MA 1EFCA 1D6SA 3L49A 4TZKA 3F71A 5AHRA 4CRWB 5AVVA 1R3UA 4FFMA 4UE2A 2D2IA 4HUQA 5C8YF 1QONA 2H5JA 1JHXA 5AKLA 5AVOA 2BI8A 4OYLA 4LKRA 2WG2A 4Y1RB 1M2HA 1TXGA 3Q4GA 3Q2IA 1OX4B 3SDZA 4ZZ3A 1FX1A 1OPXA 3CCBA 4Z0NA 5HM6A 5K3EA 1CCWA 3GJ0A 2JHCA 4OUKX 4PYRA 5AVJA 3ABQB 4WCFA 1EFLA 1EUQA 4JI5B 1GDHA 3FWZA 3BUSA 3VYSB 3QNMA 5IBCA 3H04A 2FEMA 4MDHA 3ACBA 3HDGA 4IIDA 2AOTB 4FFSA 2B82A 2OV2A 9LDTA 3L6DA 2V7BA 2XYGA 3C3BA 1D3AA 3DBHB 3L0CA 1V8ZA 2ZBDA 3L2OB 1Y7LA 2HCTA 1LDNA 1TEHA 2YMPA 3L9WA 3LZDA 2UAGA 3QX7A 2O20A 4FCTA 4FI3F 4IILA 5EP3A 3SDSA 3B9BA 4L9SA 4WJLA 1KI7A 2YOHA 2W6ZA 4RKWA 1UP6A 1BKYA 1XCLA 1F1BA 4YDHB 4CMKA 4EHHA 5KTNA 5B1IA 5CVCA 4L8GA 1AKEA 5IAAA 1REQB 3PR3A 2A5LA 3HJFA 1B00A 1R0WA 1N5RA 5HEKA 2QF7A 2OESA 3LK7A 3SKVA 2J7PA 2WOOA 2LCIA 4EJ2A 5JJKA 5KYYA 5G0TA 3U9TA 2HA7A 1UP7A 4EG1A 4DDUA 3HUTA 4PTZA 5FCDA 4BU0A 2AF3C 2PJDA 1R0RE 2IHNA 4M7RA 2P8SA 1R8XA 4PAOA 4WTOA 2CCKA 3ITKA 1EX6A 4IIFA 3URKA 1NBMA 1XQ6A 4L76A 1GA6A 3MS7A 1PJRA 4PCAA 4F71A 1ID8A 1SOMA 3IE1A 1X1CA 2VHZA 3E22A 3SC6A 5JNRA 1NVEA 5EP1A 3QIVA 4AKTA 4WBNB 4EDHA 3ZHUA 4WJZA 4OJQA 4N3CA 2XWJI 1DZ3A 5ALUA 5SV2A 2ZE6A 1GSHA 3K1ZA 3BYZA 4JT9A 3VC7A 4AJLA 5BUZA 1WXEA 1BD4A 4ONEA 5JH7F 1HO3A 2X4GA 2XWPA 1PGNA 3CF4A 4JITA 4N8DA 3U26A 4CTNA 5KQPA 5EJGA 3SSAA 5KKAA 4RLFA 2XMZA 3FKSA 3NV7A 4KQJA 4Q03A 5JH7B 3HSSA 3P0RA 2CJWB 4U63A 3ZHBA 3S68A 3ZS8A 3FX2A 3OWXA 4LVCA 5EJ5A 3PC6A 4RNCA 4ARSA 4YV7A 3F7MA 3P7MA 4G0XA 4ND7A 4ZV4A 1BA3A 1H8HD 4GPIB 2HU7A 4TTSA 3K0KA 3NBXX 3MCAA 2XXBA 4JFRA 1R27A 1J07A 3PWTA 1FBTA 1ZISA 4PS1A 5LP6C 5E6RB 2Y1OA 5LXTF 1JXOA 1GKIA 2INGX 2QORA 2XTZA 4CQLA 2XKKA 4WCFC 1IFXA 1R5NA 3TLEA 5ICSA 4DUZB 2PSEA 4MUEA 4R2KA 3TFOA 4X92A 2ONCA 3ZV4A 5CA1F 5FI0B 4FKBA 1RTTA 1H6AA 2BGMA 2B7BA 2GD2A 2Q5EA 2W6PA 2XGSA 3OU6A 4L85A 5ALKA 3UM9A 1Z5UA 3DBHA 5KAPA 1NVDA 1H69A 4IP0A 3CN7A 3OTWA 2BEJA 5EY5B 3V4ZA 1OOEA 4Z4HA 2C5EA 2EP7A 4LCJA 2J4CA 4BNNA 4CIDA 2WC1A 1RMYA 3LPNA 4ZU6X 1C8BA 3FXAA 3T3EA 3HXQA 2X15A 4S24A 4LHVA 5FEUA 3TFQA 1J8YF 5DASA 4K5QA 3ON5A 2FMUA 4PHFA 3ZUPA 3COSA 4M83A 2J67A 3KJQA 1B0ZA 1CQWA 4RHCA 1VLLA 2JAWA 1TJ4A 1V26A 2VF2A 3V4VB 4IVNA 3NHBA 1RDFA 4Z4CA 3NGLA 2GTPA 3VKHA 5GJCA 3N7UA 1C8LA 1FCJA 1TTQB 3AK4A 5AVSA 1M2EA 2AK3A 3SQLA 4DR3B 4DC9A 3TNDA 3D3NA 2I4LA 1Q21A 4AQDA 1Z0DA 4KWHA 1DKLA 2NYRA 2B8EA 2IIPA 4V3CA 1TQDA 3ZV6A 1OXMA 4EW6A 3D5EA 1OI2A 3E4DA 1ADBA 5CLQA 4YP5A 1BXGB 1ZXLA 1Z8NA 2QTMA 5A9SB 2ZZKA 4K86A 2D1TA 2I2XB 4GSLA 4IAOA 2XB4A 1PZMA 1BN6A 2KW5A 3KYCA 4RM3A 4I2VA 5IARA 4BX9A 4CN8A 1TO6A 3K9QO 4L74A 2P9QA 3HMKA 3IJEB 2OKGA 5L95A 3SVLA 4U2EA 4GVPA 1TM7E 3MRVA 1DQRA 4RE5A 1YKGA 2HRZA 4FEGA 2ZB8A 1E2EA 4FXOA 1D1SA 4ZOBA 4ZK6A 2ZQ5A 3FOAA 3K0BA 3WLLA 2IYVA 1IJBA 2Y1KA 3P5SA 4DWOA 4LHXA 1IXYA 1L5KA 1YB1A 2W37A 1G9XA 2IOFK 4K28A 4DKJA 3KOUA 3ZHVA 5G1NA 3AW9A 4ZHSA 3UIEA 3HN2A 1E2QA 3KUCA 4EHAA 2NV0A 3NDIA 3Q7PA 3CKKA 4DJAA 4X1OA 5LLSA 1I9GA 4JI6B 1IM5A 5MDHA 1K27A 3EIEA 1NY6A 2ZRCA 4MCIA 3RD5A 3RHFA 3AIKA 1N6RA 4F6LA 1HBJA 1NW8A 3MB8A 4LNHA 4ZVQA 1BROA 3CLSD 4FMDF 4G25A 1GZHB 1G18A 3ITDA 3CA8A 5F1KA 1MB3A 2QGFA 3HDYA 2H4JA 1J39A 4JROA 1D6NA 1F4LA 3DHEA 4CM3A 4DMKA 3G2QA 3OE7D 1K8RA 1N0UA 1XE3A 4M76B 1YZUA 2JZCA 4IBOA 5H81A 3TKAA 2AFIA 4WUVA 1CUCA 2QYTA 3KUXA 4A0QA 1VBKA 1RR6A 3ZQKA 4LOLA 2TMKA 1Y6FA 4UC0A 1E18A 1NMXA 3JX9A 3N2GB 2WF7A 1TCUA 3CRMA 1NUUA 3NYWA 4PN7A 3QU7A 3G9QA 5GM2A 3WLEA 1XRJA 1KC1A 4PGFA 1HORA 2CNOA 3E1KA 4KEAA 1SOUA 4TM7A 1NJSA 4M88A 3SKXA 1X6VA 5K8VA 4WPGA 3AB8A 4HNAA 3MJRA 2H06A 1QORA 2J9GA 1XEFA 2MTBA 2YINC 4R8KA 1F5SA 5BYKA 1NMEA 3DE1X 3HLYA 5L3RA 4Q3CA 5JVDB 2HFJA 3VAAA 5KI6A 1U7WA 1RAIA 4Q7LA 3KQNA 4K2AA 1QX3A 1V1RA 3WICA 2OV3A 4RSMA 2R5NA 2XCUA 3BZBA 2XNKA 1VLHA 2RHMA 3EBLA 3NIWA 2MYPA 3IT0A 4XYEA 4ZOAA 2ORIA 1UKEA 2IWRA 4E4RA 2QX7A 1Z6GA 3VX3A 1XLTC 3WQRA 1K5PA 1EI9A 2V59A 4JL5A 3IOBA 3G7UA 4KSCA 4Y9SA 2AR7A 5EP2A 2FX5A 2WR8A 2C57A 3ZX5A 1FFAA 1FTNA 1Z0ZA 1WOMA 1XRRA 4PYNA 3ZDBA 3Q41A 3W6ZA 4B3TB 3R7BA 5F3DA 1RCUA 4Y98A 5F2NA 3CJRA 2IY9A 3ZYZA 1RRCA 3ENNA 1H94A 1OAOC 3CZ9A 1ZWKA 3F2VA 1OE0A 1GTSA 4GM1A 3DL7A 1YZKA 2ZG6A 3G6KA 4UD6A 1BW9B 5EUQB 1Q0TA 3F49S 2FDRA 4X6YA 3R6TA 1Q0ZA 4LAFA 4Z54A 3SMQA 4CLDA 4OHYA 5AXCA 3VYTB 3W9YA 5M29A 1XMVA 3QEJA 4N40A 5EE5B 3UJDA 1LI7A 1QNLA 3DFUA 3T7AA 3G68A 3PE4A 3W90A 4BQIA 5LQAA 1MN6A 1R66A 3AYXB 1M8PA 2WEKA 1SH7A 4RXMA 2GXAA 4OBXA 4HWTA 1CJBA 1VL8A 4ON9A 2C3UA 4R2LA 3Q8KA 2GO7A 2QM7A 4NR0A 3O9VA 1FYXA 1GQFA 1L6RA 5K9ZA 1CNEA 3LG2A 3LHDA 4J1TC 3VXKA 3WLOA 2X1LA 2OVFA 3PXAA 2WJWA 4O1HA 4QVIA 3NHKA 3UBTA 5EXXA 1FP1D 4J94A 1DTSA 4YP0A 4R1LA 3Q1LA 2H07A 3TTYA 4M60A 3FAZA 5T3YA 3QX3A 3BG5A 4RVGA 4MPPA 3WJ7A 3HE3A 3HM9A 2R7LA 3N0TA 1TJNA 5A7GA 3RC3A 3RU7A 5A5GA 5I5EA 2PBLA 1T5IA 1PEYA 3DTVD 2CB9A 4TVKA 5T3UA 4A0RA 1R64A 2BC9A 1OXSC 2NZXA 1LV7A 2DT8A 3FDXA 4FZJA 4F1KA 3FMVA 1NYTA 2QTVB 5DCWA 3T3DA 2XNDD 2OZKA 3B3FA 3EMBA 3KOMA 4PPNA 4II7A 4UAVA 5LOVA 2ATIA 3MBIA 1OIVA 2KJQA 3EB9A 4JUFA 2I22A 3RVRA 2YWRA 4DT1A 3AZQA 1KS9A 2EWMA 2WSYB 3EIHA 4O2BB 1NVFA 3VNQA 5LOVB 2Z1DA 4HAXA 4KOAA 3DYIA 3ZWKA 3QITA 5CD1A 2Z6AA 3F7TA 1L7AA 2RI1A 3C6QA 1M3SA 1YASA 1Z88A 4UHDA 3VNVA 1UKZA 1EK5A 1XXHB 7YASA 4X1KB 2HF9A 1GQRA 2VATA 1T6BY 5EQFA 4F4DA 3HKBB 5K0EA 2O19A 3PQCA 1XTTA 4WOKA 1TL7C 3K4HA 3MTQA 4KREA 1NKVA 3AR4A 4BMZA 2GXQA 4X1IB 3EZ9A 4DQVA 1Y5RA 2O8DB 1YUBA 4GD3Q 1RRVA 2DUMA 1D2AA 2WTBA 1W1WA 1X38A 1UM8A 1VG0B 2BMAA 2Y2UA 3C45A 3DOIA 1KH3A 1GNSA 3PFCA 4RIGA 4RH1A 2I6FA 3I6IA 1EGVB 3H5WA 4BX8A 3IIIA 4PEVA 3H2HA 4C20A 2JW5A 4PVCA 2B4QA 2YYSA 3JQGA 3ZEAA 4P3KA 5CDHA 2JI9A 3IE0A 1QG0A 2AV6A 3IQEA 1ISIA 3QFRA 5HIAA 1Y3DE 4FSHA 1R0XA 1QHHA 4MI1A 3SHOA 4XIFA 5IWAB 1TM5E 1NTRA 4ALJA 3PVZA 3EJWA 3GBSA 1RZVA 4QYIA 4EK9A 2DCMA 1UKBA 1ZIDA 3SIRA 1UAAA 1I14A 1KMQA 3EE6A 3AHIA 3W4KA 3AR6A 4LE1A 5J4VA 1Z3IX 3QE0A 3ULKA 5JDCC 4Q1DA 1Y63A 3G9ZA 2QRJA 1TAQA 3NAGA 4UNRA 3ZWWA 1U5CA 2BBSA 1XAGA 2QQGA 2QAGA 2X5XA 3JQ6A 3MB5A 3VKVA 1HLFA 3GPIA 4LEIA 2H6EA 2QU8A 3ENZA 1JBQA 3VTKA 4GLFA 3F6YA 4HB2A 1J6UA 3M6FA 4PO3X 3IB3A 2LVBA 5JAOA 4LFBB 3MINB 3RTGA 2RGGA 3K2QA 2XVXA 5HE8A 2A9JA 3DWEX 5EKUA 2VQ3A 1VIAA 4FDTA 1KH2A 5AVTA 5JLJA 1CQJA 4PG7A 2WM2A 2JH9A 4NBNA 4TYMA 2H1OA 1COZA 1YE5A 3ADPA 3LQFA 4OM7A 2ZYIA 3TO5A 2ZT6A 5DGXA 1ZM7A 4GH5A 1CB7A 4G5OA 1Y3AA 3BWYA 5AKXA 2C7RA 3DONA 4PPYA 2VF4X 3QFSA 4F3TA 3R9IA 1GR0A 4EY7A 3KZXA 2AFVA 1TTPB 2Q2OA 3AHJA 5C80A 2CJYA 1JGTA 2PGXA 1L7RA 4H7HA 4LIPD 1ZPDA 4M9QA 5LBTA 2W70A 1XU4A 5D6OA 4RYLA 1XFDA 1KDOA 4KFTA 4NONA 5K3DA 4DLSA 2F3UA 1OZGA 2QG9A 3UNXA 5M2QA 1S8OA 3PGJA 1HPLA 2XSZD 2ZRPA 4BO1A 3PG5A 3U5TA 4W9MC 2ZBFA 1Z73A 2HO5A 2ODQA 1BKSB 1XPJA 3H75A 4GX2A 3LYHA 3SZ3A 4MLPA 2C4KA 2ZT5A 4AWAA 4B31A 2WSIA 4FZVA 4IOJA 2HW8A 1JPVA 3EXFB 2X8AA 3GUZA 3F3YA 4RJIA 4YRKA 4O0LA 2NUAB 2Z95A 5TMPA 4WRRA 3CXRA 1HE2A 4F7WA 2NUTA 2PO5A 4AUNA 4BBJA 3SC2A 1N75A 1TRHA 2GRAA 2QP3A 1S5PA 5CCBA 1ILWA 1NLZA 3WZ2A 3JALB 2GZRA 4O4JB 4AKEA 3IQZA 1WP9A 1RHJA 2CJFA 1YDMA 2ODPA 2B92A 2ZP1A 1KPIA 1JALA 3DYVA 4MUKA 1SQ6A 4R9RA 3IMCA 4MJLA 3RC1A 3H4IA 5TQ2A 4DNQA 2I87A 3WGKA 4J2HA 1C3OA 3OEEA 2EATA 1T0PA 5AK4A 4ID3A 1C3LA 4I46A 4QDUA 1LPPA 4RJLA 5C37A 2QD1A 4DQXA 4PS0A 2EFGA 1M6VB 3H1AA 1FNCA 4CGYA 1GHTA 1Q0QA 4BO7A 5DF1A 1OLOA 5LU9A 4WNCA 5CA1B 2P7HA 1E2GA 3CMCO 3P27A 4D79A 2R3SA 4Q34A 3SBXA 5AJXA 4U6NA 4YA6A 5CVUA 3T1VA 2H1CA 1T43A 4KO4S 1ODJA 2QM3A 2GPNA 3AILA 1FRQA 1HZJA 3ONEA 2HRDA 3EZ2A 2E4ZA 1YIAA 1J1IA 1RLUA 1SOWA 2GXUA 5FA5A 3B3QA 4BMCA 4CR6A 1T9CA 2O8EB 1WB6A 1R6AA 2C2MA 1S3IA 1FRZA 3BJZA 1GPKA 5FHQA 4DXDA 3EIOA 4QPPA 3B8EA 3T8YA 4F60A 5A6SA 3N6XA 2X2OA 1SVSA 2JK0A 5I6DA 3G82C 1C3EA 1EX7A 2YV3A 3GJ5A 2B7CA 1OBOA 3QPUA 4TMYA 1LF0A 3H11A 3QKTA 1IWPB 1E9FA 3KXIA 5HJ7A 3UAWA 2AC7A 5KBYA 3W9UA 4LYFA 2F3RA 3L1UA 2Z9DA 1YOBA 1IMOA 1O87A 2Z8YA 3M4NA 4EB0A 5JI3E 4YTEA 5J2TA 4MYCA 1AQLA 2J9FB 1NU8A 2QZ9A 2VZ0A 1PNQA 2H2HA 3JQFC 2FF7A 4I9HA 3GEBA 3ILXA 4OL9A 4WFJA 5LA6A 3ZKAA 2WNHA 3GVIA 3WIOA 1FNNA 1MA0A 1KOJA 3NAZA 3PRKE 4PRLA 1PFWA 2R96A 3ED1A 3N39C 2CUZA 3COPA 2V7VA 3A14A 4PG5A 4AIIA 1PS0A 5CFRA 5L53A 4YRAA 1EWRA 1RLIA 1FS6A 3Q8WA 5CB4F 1B93A 3MXOA 1H42A 4LPSA 4TZ6A 3EMKA 2B4RO 1RQNA 4AYTA 2Q4BA 3V48A 2V7EA 1PDVA 1RPAA 4O4HF 1FUUA 4ISBA 1A5BB 1OZHA 5JBNA 1UBLS 3KO8A 4DCUA 1JQ3A 4TV8A 3ZNPA 2C7BA 2ESRA 1GGNA 1UL1X 3D7LA 3DXYA 1WNTA 3ND9A 2BHSA 1HDZA 4C4AA 4PIPA 3VOAA 5B64A 2AMFA 5AI0A 5ER9A 3CRW1 1RAFA 3QYFA 1GZVA 4KACA 2PLAA 4H4DA 3CO0S 3GEPA 5KQGA 5J9FA 2R00A 4ZT2A 4K6OA 1CY0A 3CBQA 3BD6A 4UXHA 4WCDA 1AQUA 1NV9A 3CJTA 3RG2A 4Z51A 4ETIA 5FO1A 4HNAB 1TGVA 2QVZX 5A5FA 4BOYA 2VTEA 3V9AA 3B2QA 1GUDA 4CIYA 3PDIA 4ZANA 4FDLA 5EC8A 721PA 1AO3A 3S1AB 2ZATA 2BM1A 4S1TA 4DGSA 2JI8A 2HGSA 4KLZA 5JADA 1OMOA 1Z34A 4G56A 3VKUA 3EGCA 3PNLA 3USCS 5K6TA 1YS2X 4TZTA 1GZUA 4LC1A 3E22B 4TYPA 1IHYA 4G5YA 4BZQA 3OBIA 4EPYA 3OUUA 1QIGA 1WZCA 3DAOA 1UJ6A 4EYKA 2GBGA 2VH1A 4BQSA 2O0HA 4ZVRA 3C3PA 1Z2OX 1IVYA 4FLMA 4B80A 1WKBA 3RGWS 2XX3A 4ENVA 4FNAA 4RK5A 5KOHB 1U0RA 2HRQA 4FINA 2ID7A 3P2IA 2GD6A 3KRTA 4NSNA 3VJKA 4YR9A 1R9NA 2EG9A 3AV3A 2J33A 1I3NA 2RFLA 1XJWA 1REQA 3IRUA 1BWPA 4QWWA 4LJSA 2J3MA 1NJ8A 3LVQE 1CS4C 1EGAA 4JWKA 4DLXA 1YMUA 5IXSA 4DLWA 1MQSA 2WSMA 3K9WA 4P86A 3S1LA 2VUHB 3UHOA 3HCEA 1DG3A 1YB2A 4XSHA 1HTBA 3PGVA 1E3IA 1KAMA 2CFSA 1QLWA 4L8WB 3EFEA 2H51A 3BMOA 1J00A 3EXFA 3NUZA 1YZQA 3GA5A 4JQCA 3HVUA 1IOWA 4C7XA 1NHWA 3B48A 4FBGA 4EGFA 2J5BA 4JENA 2HM7A 2P9YA 5TGZA 4C2UA 2WDPA 3B7PA 1Z68A 5AKGA 2OV8A 1JRLA 4ETNA 1ZN7A 3CPHA 1WF6A 4RZ3A 4RFSB 3UMSA 5BQ3A 1DARA 1NM5C 4UHKA 3JSAA 1Z7YA 1P0QA 2X4IA 3JYPA 4XVHA 2ORED 3WL8A 1V9LA 4XB2A 5DM0A 4CKBA 2P9BA 5JPIA 4EY6A 3FRIA 4DMCA 4JR2A 4EKGA 2NP6A 1R8YA 4XM2A 1RHRA 5AW9A 2I6TA 3K30A 4RKEA 2XF8A 2GWRA 4Q9KA 2Y1XA 4Y9RA 3FPEA 1QHGA 1XA4A 1ZQ1A 1AKWA 2PSDA 1PDOA 4RTSA 4EJSA 1K08A 3OX2A 3KG2A 1PVOA 3HR7A 4MIKA 1JDSA 2Q29A 2V7QA 3JCZA 1H6CA 1P1BA 3MTAA 3P9SA 4YQYA 4CLXA 4WV3A 1HDEA 3GNLA 3QYJA 3WB9A 5LYJA 4JT8A 4ER6A