3NCTA

X-ray crystal structure of the bacterial conjugation factor psib, a negative regulator of reca
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
LNVLQTMNAQEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQVQRRFASEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein, chaperone
molecule keywords Protein psiB
publication title X-ray crystal structure of the bacterial conjugation factor PsiB, a negative regulator of RecA.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06290 PsiB Plasmid SOS inhibition protein (PsiB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nctA00
3NCTA
chains in the Genus database with same CATH superfamily
3L8MA 4CTMA 2F43B 1B2RA 1E63A 1Y5NA 3BD6A 3GAZA 4D8XA 3KWFA 4ZCIA 4BCDA 1RBYA 4PZZA 1CFZA 1QQ7A 3MBIA 4OA8A 4QNRA 3ZX5A 4B3DA 3P26A 1BXKA 4GR5A 1IMOA 1NNI1 2FWPA 1U2EA 3CKMA 5K7SA 4BMXA 1Y1LA 3S70A 5FBQB 2O2GA 1DDIA 2PTHA 1JR3D 4ZFNA 4AC9A 3M6FA 2JFHA 5F76A 5JHGB 1U04A 5BVHB 5F77A 1U9CA 3VNVA 1S96A 4KFCA 4PBRA 1HETA 3CR3C 5B3KA 3IALA 4ZDJA 3PTAA 2BDTA 2H1HA 4L7VA 1JHUA 1Y4UA 1II9A 3AY6A 4RKQA 4YV0A 2EFHB 5BOVA 1ADFA 1CUWA 1TUIA 1YE5A 3L8CA 3RU9A 1EDEA 1EE9A 1K66A 1QF9A 5BSTA 2H9YA 1M2NA 4D9JA 1TA0A 5EJIA 3QH4A 3RTCA 1Q11A 2WUFA 4ZAYA 4P4SB 4YCCA 1YFKA 3G88A 1UZMA 1GG5A 4MRAA 5AO9A 4RTLA 4XUGB 2GBGA 2HDOA 5A5GA 4TRJA 2Q50A 3EHEA 1J5PA 2AEEA 2YWGA 4Y2VA 2EBFX 4KQ2A 5ALQA 2Y0PA 4ASUD 4CW7A 5JZOA 3CA8A 4MVJP 1E4VA 4BPBA 2QQGA 2HCTA 3OUZA 2IKQA 4P34A 3DEZA 5EFOA 3SQDA 1BYUA 2YVUA 1W7AA 4CG0A 3BICA 4M38A 2XYRA 4Q9IA 3BDIA 2VUUA 3DEJA 4A2CA 3FWPA 2R8OA 4PCAA 4TRNA 3F78A 3TYXA 5FNVF 2HJHA 2BMDA 1Z6YA 1E9VA 5AK5A 1G19A 1DWPA 4QXRA 1B8UA 2PRSA 3REGA 1A8IA 4RNCA 5EWJB 2VHEA 4ZICA 3ZDEA 3ORYA 2IZ7A 2FJPA 2PXAA 4O1HA 5FUYA 1G4HA 1JMYA 4K8OA 4ECAA 3Q10A 2P0AA 2W2VA 2ZSBA 2J0UB 3B6JA 3TW8A 4QG3A 1VOTA 4OXIA 1CUAA 1Q7BA 2WICA 3C3JA 3FX2A 3SF8B 1K3FA 2W5UA 1LPPA 1PJSA 3QG5A 4CKWB 3LQRA 2INGX 3WBJA 3OU2A 2HR1A 2DQ4A 3ADBA 4O63O 3W4KA 1R9MA 3JQQA 3FPAA 1P4JA 4OXQA 4UCFA 2NU8A 3QMWA 3W5UA 1N32B 5C9ZA 3OC0A 3N0XA 3IAFA 2VDVE 3DTTA 4GP6A 1H8HA 3NJRA 1M5UA 4UHEA 3TTSA 1E0SA 2PFSA 1NFFA 3PQEA 2B4YA 1CUZA 2LP4Y 1PEKE 3T8YA 4KO3S 5EJ7A 3BHIA 4O2BA 1UWCA 3PI7A 4E03A 3IJPA 1EFUA 2I99A 3NHRA 4GBMA 5IDYA 4YX9A 3OBIA 1CZHA 2FETA 3AVVA 4Z0NA 1ST2A 5I3ZA 5FHQA 4JH0A 4HQFA 4CKCB 5KUTA 3ZE2B 3SYKA 4NMMA 2RGEA 2KW5A 4PC3A 5LKAA 1GKYA 1GGHA 1I7SB 1HEYA 3LFTA 4LJAA 5TARA 1JG4A 3OZBA 1U2GA 3M6LA 3EGCA 3TXXA 2DJIA 1MR3F 1GZ3A 2JD1A 4ZHSA 2VAVA 5KMGB 2P6PA 4C2TA 4MQ5A 2CLCX 1BWPA 3KUUA 5GQSA 3WRVA 5JTUA 1D9ZA 1AUQA 2PN1A 1ODLA 1DB3A 1T5TA 2CD7A 2RKOA 1JHMA 2JGMA 2QRPA 3QWHA 4RORA 4UBKA 2GEDA 3EF1A 3GDOA 4B3BA 3ZU6A 1OAKA 1ZK0A 4A3SA 2R60A 2PA0A 2PSDA 3FPGA 4YV7A 1UODA 2J3JA 2MT9A 1SOUA 2WFLA 4E7PA 5CXSA 2CXNA 1DBPA 1P77A 1QNFA 2DECA 4URUR 5BVGB 5BSGA 2J6IA 1N2SA 3H3JA 4G5HA 2BZ1A 2C0PA 5BV0A 2P9QA 4M60A 5E0KB 2JS7A 5KKNB 3T94A 2V5AA 4YLGA 4Z4CA 4BTEA 2V7WA 3R2JA 4BAGA 1G0OA 1IY9A 2GN2A 4QYWA 4QYMA 1UJMA 2E4ZA 2PGOA 2HQ1A 4XWGA 3WFZA 1LPNA 1BD4A 3R7SA 2C0QA 3I2FA 1ZKDA 4X63A 3EPRA 2WAMA 3VKFA 3DR5A 4V3BA 3LECA 2QD5A 4UVIA 1BHJA 3IAUA 3L01A 1URPA 1QGUB 1QS0A 1IB0A 4C0WA 2QZJA 2H4JA 4AB1A 1VIDA 3HVRA 4YHHB 3SZOA 1IZ8A 1CXZA 1JTEA 2VP6A 1QP8A 4N54A 4W4TA 4YDQA 3AJRA 4XJSA 4B09A 2VQ6A 2AXNA 3W06A 4ZN6A 3O3OB 1E6EA 2JB9A 2H31A 1IC6A 4ON9A 4B6PA 4I6EA 1N6RA 3C2QA 3IVCA 1VPLA 2I4OA 5TVKA 3G3EA 1JEQB 3VNAA 1VXOA 3OOEA 4GD3Q 4LRYA 1ND6A 4HNAB 4F5ZA 2CMFA 2DPHA 3TB6A 5J23A 1JI3A 1HZJA 1TJ5A 4K6OA 3OFKA 1NHGA 3PL5A 2R1VA 3ELYA 1YACA 4QYIB 2O8FA 2PKXA 3A05A 1QV7A 3A9RA 3C3AA 4F5WA 1KWGA 2EDAA 2PV0A 2Q41A 2BTQA 3UMJA 2X7XA 4PN7A 5SY6A 4AM8A 3GFSA 3HP4A 4MV9A 2DTDA 3BL5A 5TR9A 2J9FB 1YVPA 4MV7A 3KVYA 5AKZA 1KYZA 1YR2A 2VIIA 4I1UA 3PLAE 1XVTA 4JCOA 2IBMA 4GP7A 1DU4A 1DQPA 5AESA 1DPGA 1YDEA 4KTTE 5TT0A 1J2UA 4P5DA 1ZN9A 2XNCA 2N42A 1J09A 1JPNA 1SFRA 3OKCA 1QF7A 1K5GA 2FGJA 2IDZA 1QKKA 3BD9A 2FW1A 3EIEA 3G2QA 2OQIA 4H6PA 1QLJA 3NBAA 4TS9A 3VU3A 2B0CA 1QXSA 2HMUA 3IOCA 4GR4A 1SOVA 2JHAA 2NTEA 2XGMA 3DC2A 3U3ZA 4I19A 1FRFS 2GEVA 3OE4A 3IQIX 4BNLA 4WXRA 3K6SA 2IP1A 3IEPA 3UJ8A 2GN9A 5LKRA 4ZVPA 5EZQA 5CB0A 2PX3A 5B2ZA 4EJ0A 2JI8A 3CH6A 3JZAA 4HSGA 5JATA 1Z28A 3RUCA 2ZUDA 1UBCA 4MAMA 3BGSA 1IOVA 3GRZA 2A6PA 5AVJA 5HYVA 2FE1A 2PU7A 2PVSA 3UAOA 4BYMA 4LQDA 3T4EA 5F2NA 3WE7A 3QSGA 2EKPA 3Q3CA 3GO4A 1VKJA 3HWX1 2P9CA 3SZ3A 4Y6GB 2WJVA 3B2QA 4LC1A 4Q3BA 5TJ9A 4UM8B 3TUZC 1DO2A 3W9SA 4AURA 1Q0HA 5B3JC 1ZRNA 1R16A 1UOQA 1ZBDA 3PRYA 1U3DA 1N77A 3NYRA 2BM9A 1LV7A 2CNWA 1NLUA 3NH6A 3FUUA 4LJRA 1GSOA 4CQMA 5JZMA 1P72A 1CJKC 3DONA 1ZD4A 4JBHA 4DIMA 1Z62A 5EE0A 1E94E 5CCXA 1T25A 1OSNA 2C7VA 3IDQA 1OREA 3P9ZA 2EX0A 4V0QA 4OBBA 4BEJA 4DW8A 1WSWA 2OBYA 3BMXA 5HE8A 1A97A 4A10A 1Q3KA 2AF4C 2BJWA 3SK0A 1TUEA 2IZ0A 3FJOA 3OURA 3STTA 2A1UA 3BSSA 3K8YA 4M54A 1V1JA 4NMHA 1CRWG 3I09A 3L82B 3IAM1 3PXDA 2V0GA 4IWNA 8MHTA 1JDTA 3NO4A 1OVMA 1TE2A 3ROEA 1MT0A 4DSAA 1RPTA 3KDAA 1V35A 2BPOA 1LQ2A 5C32A 2Z6QA 3EQ2A 4XIGS 1FFYA 4WLFA 1GGFA 3DSRA 4RTQA 2OHXA 3SQOA 1XTZA 2CMKA 3V8RA 3ORQA 2WG1A 1ORTA 1AN9A 4MKRA 3KV1A 4HH0A 4RADA 4HGOA 1Q91A 1WCV1 1WHTA 2I66A 1GNRA 2VEOA 3DOUA 4CHGA 1KY2A 5CAEB 4CMEA 1OB2A 5M2QA 3DP7A 1NOIA 1Z2NX 3IV9A 2NZWA 3EZXA 4P98A 4XR4A 4EABA 1CD5A 2NPIA 1J8MF 1JDPA 3RRMA 4GWLA 2QL6A 1E3QA 3PR2B 4MP6A 1CJVC 4TYYA 4CLHA 4P9NA 1GA1A 4I4TB 2WV7A 4KAFA 3AUJB 2HJSA 4HTFA 1UKVY 4NS4A 3O1JC 2REQB 5JW6A 1X42A 2FR1A 1GHTA 4JJKA 4RGBA 2R6GA 3P19A 4P3KA 2Q1YA 1KBOA 2DYKA 2YJ6A 4QREA 2IC5A 4N01A 4RW0A 4FBGA 2OO5C 3T95A 4K03A 3EWSA 2O2ZA 1IJFA 4I1SA 3W78A 1TU3A 4MLDA 4WBNF 4EYQA 4TMYA 4U7HA 1QZ3A 5FBZA 4ZDWA 3SFTA 1XVUA 3PSHA 4WASA 3B6KA 1KPIA 3HYRA 1E1CB 4BNZA 2YV5A 2VXYA 3ZGVA 2V98A 1NJ5A 4X84A 5FL7D 3RIHA 5LU9A 3ZXUB 3C70A 4JUDX 4LMRA 1XWFA 3S2EA 3D2AA 1XYGA 2IXTA 3WHIA 1MEEA 5EG5A 5A3VA 4JWKA 4LFBB 2GZ3A 3GCZA 1AQUA 3CG0A 3CF6R 5E7MA 5AR1A 5A6SA 3RKSA 3PGKA 4G4IA 4N3NA 1LRKA 2VAWA 1QAMA 2IVZA 3CVYA 1I9CA 2EX4A 2X2FA 3ZV3A 4DKJA 3HRIA 4UNSA 1OJLA 3LVBA 4PN3A 1QTQA 2IYSA 2ZCVA 4FGSA 4UM9D 2YNMC 3QU4A 1VI2A 5KIAA 2CDRA 2BFWA 2BHLA 4TXLA 3X1KA 3K6RA 3ZWDA 2GN1A 1JIXA 1UMCB 1IM2A 1TB4A 3I58A 2FLVA 3B38A 4MNTA 5E4YA 5TEVA 1OLUB 2E9SA 3BULA 1XUOA 3HO6A 4LKRA 5IN5A 3ZHCA 4W9NC 3CVUA 1U2QA 2RB5A 1MTOA 3RTAA 1KDVA 1WPQA 2ZIGA 3V1TC 3E58A 4LDZA 3ZE6A 3LHFA 4NZ9A 1SKBA 2EFJA 3A6KA 3NT4A 4D4MA 2E0IA 2J45A 1PN3A 2P4EA 2WLTA 3ZLTA 3CLUD 2Z4RA 1S8NA 3DOOA 3GT0A 1BE6A 4HY3A 2C4TA 3B85A 2O4UX 4Y67A 1R3DA 1E1LA 5D3KA 2HL6A 5A0VA 3DKPA 4PVDA 3N2NA 5GJCA 4CNBA 1D6JA 1KEPA 1OU4A 1L4LA 4J76A 1YZLA 2IVFA 4BKPA 2ZRDA 3K9FC 1T15A 1V25A 1XMXA 3MGKA 1PTJA 3T1VA 1F0PA 1OXUA 2FOLA 2DHDA 2SKDA 2A9PA 2P2LA 1OWNA 4D3YA 5E2AA 2ZG6A 1T3LA 1ZBQA 4OG2A 3L1IA 3CNHA 3FJ1A 2Y0EA 5AM2A 4WZ6A 2JIZA 5CDFA 1XZDA 3SHFA 4MYRA 1SU8A 2VK8A 3UFXA 4I9GA 2JCSA 2JA2A 2WLSA 5LM3A 2X86A 4G65A 2ZSUA 4ZYYA 1RPZA 1LF5A 3C8UA 5KVSA 1BH6A 4NS1A 1CVLA 1RWMA 3TEMA 5E2IA 4ND8A 3OWOA 1G2OA 2PHZA 3LIIA 4CQLB 3DMTA 2YRXA 1U3CA 4OQPA 1O9BA 4KNWA 5HMMA 1LDGA 5AJZA 4NXMB 2QX7A 3RVOA 1VP9A 4X44A 3HLTA 3NV9A 1G5TA 1X1QA 4FOSA 4KNVA 4R1SA 1PQ4A 3QLVA 4BNXA 2AKYA 3PQ7A 4GXQA 4KR6A 3G82C 3TLMA 3VPGA 4LCEA 5EIOA 1A2OA 5LXTB 2LVBA 5IDQA 1R5NA 1J0BA 1G0NA 2AA3A 2CLSA 2XUZA 1D0SA 1KGDA 1BHO1 3H99A 5FAXA 4ZXFA 4N7BA 4X8OA 1U7TA 1N6OA 3LUKA 4GMGA 4XSGA 3TUJC 2WU1A 5IRCD 5E4TA 2ZJ6A 1T6XA 4B75A 1E9EA 1LQUA 1BD3A 4PBTA 4ZAZA 4U2FA 1VSQA 2ZRPA 1NQXA 4MW4A 2DB3A 3CZCA 5H02A 3DE1X 4FYPA 2RHCA 4TPKA 3KP1A 3KQUA 5ELMA 4EY8A 3KYDA 2ST1A 3ZHVA 221PA 1V8OA 2IYFA 2Q2WA 4FDMA 1SG9A 3FMIA 4PTYA 3ZHUA 1KFKB 5EE5B 1WW8A 4ZGBA 3BS4A 5DBGA 3EVFA 1MV8A 2ZTLA 4PGMA 5E1OA 3TK1A 4AUMA 4CV1A 1O7JA 2N75A 2VYFA 3PIDA 2D74A 4UFNA 4AJ1A 1MC8A 5DNCA 3V8NA 2QTZA 1TYEB 2PYDA 3MT9A 2ZGVA 3UJPA 3LBHA 1USUA 1Z0JA 2BWJA 2JCVA 2OFXA 4R81A 3WL3A 4IOMA 1XDDA 1UQUA 1EP9A 1XTVA 1E6UA 3RVMA 1GUDA 2WMDA 1I8TA 1YO6A 3CEHA 1GAQA 5IUNC 3F4LA 2H29A 3FCUB 3MWEB 1E6CA 2O2DA 4PSKA 2JEYA 3P2MA 3WMXA 1FS6A 1UM9B 1ZGGA 2I2XB 4FC7A 3Q3VA 1M5TA 1XEFA 2UXDB 1K8XB 2HRCA 2JAPA 2I03A 5F78A 3MRSA 3PPVA 2JFGA 1ECBA 4G0UA 1YR6A 3GN2A 5AUQA 2Y67A 4P5EA 2XWSA 2F90A 1AS0A 1ZLYA 1RSZA 2DFVA 3OTWA 3VSCA 1WR8A 1M8JA 4ER3A 2AVNA 3E8SA 1U7OA 3GAAA 2AYXA 3R7LA 1B14A 4JX9A 1N1MA 3VHQA 4IJMA 1YFLA 1IBRA 2V74B 3EXEA 1BX0A 1JU9A 2FFRA 2J9YB 3LLMA 3EWNA 2JLRA 4BWGA 1CSEE 1G8GA 1QE5A 3R0ZA 3CY6A 5CBPB 5KYNA 4ZJUA 1KMHB 5KKCA 1UBNA 5FOWA 4MS3A 4NPHA 4K81B 4PLPA 1W1UA 3VRHA 4BL5A 5I9SA 4CIXA 2F3QA 2B20A 4LYAA 2W2KA 4ALNA 4JYAB 1E6WA 1BG6A 4GL4A 5CA0A 1JLLB 3C5HA 3T3NA 4U7GA 3I9JA 3FYDA 3LHDA 1NJGA 5KOYA 3CRVA 1G8FA 1E1QD 5J63A 4O02B 3QXSA 1YS7A 2QRUA 4TWIA 1ORVA 3ANLA 5T8KA 1SKQA 1KQPA 2NO5A 1LD3A 3LXMA 1JAZA 1MAAA 2G5TA 1O03A 2C5HA 1INLA 3KSMA 4ITVA 4P35A 1XL0A 1NRIA 4QYSA 5EUMA 4X1IA 4ARCA 3ABOB 1IOZA 2AG1A 1MXFA 4S24A 2QTHA 3LQKA 1LLDA 1UJ5A 2FSVC 4G41A 3WP1B 2JI4A 4P4UA 4GMKA 3LCUA 4P83A 5LBUA 2EL9A 1Z5GA 3NJ4A 1WMDA 4IF4A 3SFZA 3VOBA 4DCPA 2ZUSA 2YWJA 1KE2A 4M6WB 3GP8A 2PJDA 2BFMA 2R8YA 1US8A 1FMJA 1L4BA 1NQAO 1CF9A 2VKQA 1SIOA 3HFJA 3KQYA 1J23A 1E3LA 1NVFA 2JK1A 1JLHA 4XDHA 3RHSA 3IHWA 1HMPA 1WUKS 3AI3A 5IJXA 2GERA 3PQ4A 4AYXA 2HYIC 3KBOA 2TMGA 4Z3OA 1T2CA 2ZU0C 4UM5A 3S3TA 1XC7A 5A7GA 3TL2A 3U16A 4DSOA 1B3BA 2DUMA 3BOSA 3VHRA 1GTZA 3L0OA 4PONA 3ZXYA 4I4IA 4AS3A 4NPCA 5LMNB 4RQBA 3OQ1A 4HB3A 3H2YA 3RTDA 4ENQA 4UFOA 2QJWA 4FHDA 3WFJA 2PU5A 2NN3C 3M2PA 3OEYA 4NJEB 5K0LA 2A5FA 1GNLA 3W6ZA 3MS7A 4E5DA 1WAMA 3R20A 2XZDA 1XIVA 4IX1A 4LE1A 3WLIA 2ODQA 1NUTA 1RYDA 2X4GA 4DCSA 4ZTUB 4YALA 4ETIA 1T3TA 2YWRA 2CL7X 3FYUB 1NVXQ 3EZ6A 1SVSA 1VLJA 2C2WA 3TLCA 1LPAB 3H1FA 3B13B 1XCBA 4J43A 3EHDA 4IDPA 4FN5A 5BYBA 5LB4A 3HZHA 1ZJZA 4JI7B 4M1OA 1C9YA 4PAGA 2WWWA 3DXYA 2D1FA 1UFQA 2BUAA 4DUZB 1KQOA 4E4YA 2ZZMA 2IHNA 5CDUA 2GBIA 2V54A 2P67A 4U1RA 3H0CA 4OHBA 4KHZA 1EGMB 3G0DA 1A04A 1SA0B 4RX1A 3YASA 3F5FA 1U0JA 5D5HA 4EMSA 4ZYZA 2YYYA 1F4VA 4OF4A 4XX1A 4EA7A 4CETA 5AD1A 4XTCS 3LO5A 1O5OA 4I66A 5J43A 4QBKA 1K8RA 4FONA 4Y2PA 3QXGA 4IJKA 4D96A 1GDTA 3QM1A 4H16A 1JR4A 3JALA 4TWJA 1LDYA 1E0KA 3AUXA 3OFND 3AEQA 3E9NA 4BNHA 1I6KA 1SIUA 1N4DA 1YMUA 2D8AA 3EVCA 2QRMA 4HB0A 4HQKA 2H1WA 4UDNA 5G0WA 1ZL2A 4YO8A 4HVCA 5EPEA 2A67A 2CDAA 1V7ZA 2ZYIA 1N2GA 3EXFB 3AY3A 1DUVG 3RM3A 1GFWA 1YAJA 1T2FA 1FNCA 2NXCA 5DULA 1Z88A 3F6YA 4QOSA 1PFVA 3BD7A 4B84A 1KKUA 1WB4A 3FFBA 1SUIA 3LY7A 4LVOA 3TKLA 4QBIA 2VC2B 1L9KA 5CHYA 3OIFA 1GPJA 5GM1A 2NSDA 4Q7QA 3PEFA 3DWGA 2FG7C 1OYWA 1CJMA 1UKAA 4AZ0B 2VYVA 5BQ3A 2EG5A 2VDOB 4RIGA 2R44A 4YP6A 1E18A 4QPPA 5EP1A 1U9IC 3HMQA 4OHUA 1FFSA 4WKOA 3BMOB 2QD2A 1T5HX 3DBIA 3D5TA 3Q0EA 3ZE1B 3R3ZA 4GQAA 4GUDA 4PY2A 4KXLA 3MAJA 4EHKA 5I7UA 3Q9NA 3NOOA 2BFPA 3EVAA 4PYNA 4W7SA 4GI2A 4I4TF 1EFAA 2A84A 3F71A 4EPRA 1Y5IA 3M5DA 3EAQA 5LWQA 2ACVA 1EB8A 4M1YA 2OC4A 4RJIA 1V1MB 5TS2A 4WY5A 3DZFA 2XPCA 3D3QA 4R0VA 7MHTA 2JVJA 1PQWA 5CB4A 3QPBA 2A59A 5C8DA 4AX8A 3Q6NA 1JEOA 3EGVA 4BJ1A 3DVAB 3I5AA 3TVYA 2CSUA 3I52A 2SICE 4Q1DA 4ZMRA 2SKCA 5HKKD 5KAPA 3BSYA 3EVDA 1SD5A 3QW4B 3QPVA 1NYTA 1GTG1 1QG2A 1POWA 1VMDA 2LKDA 2FW6A 3BAFA 4HEA1 4I2NA 4H15A 2C5LA 2PSFA 2FUG1 2CYCA 3PNQA 4LSMA 1WTCA 5DWVA 4BFSA 4I55B 5IN4A 4OXNA 4FLFA 5AVOA 3I23A 1M34B 2C4KA 2X5NA 4KVFA 4RVSA 1K63A 2GN8A 4N0EA 3V97A 2XYPA 1UWLA 3H6HA 3LC2O 1E58A 4H18A 2IZZA 3IPAA 4IUYA 4PSDA 2VHWA 2WWFA 3IA7A 5CRIA 4H08A 2AFIA 3W2EA 4B0OA 1PS9A 2KB0A 3GARA 2H07A 3KELA 3VHXB 1U2TA 1CB0A 3KE9A 3TZEA 1ONOA 3GUVA 3H2SA 3R44A 1G60A 5G4KB 4XRRA 4RVFA 3PHIA 4QFDA 1LSSA 3GLSA 3FGNA 1PZMA 2VATA 4J0FA 5FF9A 1Q57A 2IEIA 1GZ5A 4E5YA 2VHXA 3AY7A 1NJ6A 3UQYS 4OHMA 4ZPJA 4B6EA 1Y5MA 5KYYB 3OF2A 5SYNA 1Y8QA 2CJXA 4CF5A 3KALA 1QRDA 2YQZA 4PEVA 4LRSB 1P8AA 2WFMA 4BWVA 4TV9A 5K1ZA 3NC1C 5JJ5A 4ZJYA 1EBBA 2C1XA 1RMQA 1DQYA 2FFBA 2NAFA 2R7LA 1O94C 4X3PA 4AMVA 5AVQA 5LQUA 1N9GB 3UK0A 3AUSA 3NHYA 1TZJA 1F0YA 1YZVA 4HRYA 4EWLA 1E3DA 4QQ8A 3MWDA 3W6OA 3N8HA 1QZZA 4MQBA 2W90A 2M6RA 3RSLA 2R1TB 3C8HA 4PQEA 3U7EB 2P3LA 2JG3A 1ZN2A 5K4GA 5E9QA 3U7FB 4YPFA 4A23A 1WUYA 3IAS1 3MTAA 4R84A 5JI2E 3U1BA 2WWXA 1HFJA 3JQ7A 1P18A 4FPXA 1KP2A 3HSKA 3T7KA 4AG3A 1UBUS 3IUNA 2O0JA 1CU1A 4DGQA 5BWCA 1ECCA 3DC7A 4LZWA 1TTPB 2BGNA 2I67A 4Q5IA 4F12A 3KQLA 2C7RA 1Z25A 1TT7A 5AKYA 3NUQA 3GGPA 2VDKB 2OWDA 3KPVA 4HR7A 3ZV6A 2BSAA 2YIVX 5EMNA 1I7DA 3HDGA 5CIWA 1G4UR 3EIQA 4B85A 4BTLA 3ET5A 4WKGA 4ZIRB 3MCWA 2QTWB 3QYPA 4JD5A 4CKBA 1LA2A 1YZYA 4IIJA 1CQJA 4TLCA 3TDKA 2GAOA 4B3MB 1RWNA 1F2VA 2BFEB 1XMIA 3LCVB 5GJBA 2DVMA 4FR0A 4JB8A 2DBRA 4HZUB 3HM9A 4YMHA 2WM3A 3QVUA 4ZVKA 1T36B 5LXTF 2OENG 2EC5A 3DQPA 3SC2A 4S12A 4BMYA 1I1HA 2O54A 3TIVA 2HTFA 4JA0A 5BUSA 4PANA 4PFKA 1R1DA 5AVVA 2QZ4A 2ET6A 3EFOB 1G20B 1M66A 4FQ7A 3IVAA 3OQHA 4AICA 5BT8A 5KVCA 3BPSA 1ULUA 5F23A 3A0RB 3GC6A 1X19A 2WF5A 4BX9A 3R3SA 3WISA 4CL2A 5BPHA 4YRCA 1LPBB 2CN1A 1V7QA 4ZCLA 1LNZA 2JLXA 1WBDA 2A0YA 4PYQA 2O3JA 3WGGA 1GO2A 4A0RA 2QTTA 3LA6A 4EB8A 3KOUA 5BMVB 5LQDA 1V8PA 2O2IA 3FSEA 1N2IA 3FMFA 3E61A 2WDPA 4XX0A 1H5UA 3KKEA 5AM0A 2XECA 2G8LA 2VJMA 4R6WA 3X2SA 3OTOB 4WHMA 2FE4A 2JLUA 1P1CA 4B8WA 2AFHE 4QRHA 1EK6A 4FFVA 1MX1A 2H1OA 2O8BB 4MS1A 1DMRA 2J5KA 3FRJA 3WDSA 2YRFA 1G5QA 2C03A 1FE8A 1Z82A 3S55A 5IJ9A 1QGZA 2ZE6A 3DW1X 4TTTS 5KNBA 3ZHYA 2YW9A 1EFRA 1CQIB 3CNQS 1NLYA 4JS0A 5FB3A 3HXPA 5G0SA 3WYDA 4QDJA 3RVDA 1W0CA 2VZLA 5TQ2B 3SZLA 4IDFA 4O8CA 2EZ8A 1NBME 2ZVDA 1PX0A 2ZAYA 3EIOA 1W87A 2BGTA 4MVJF 4P36A 4Q4AB 4QT4A 4R71A 3TGPA 3EIXA 1MEOA 3PTZA 1HO3A 1ECGA 1CEEA 2C8JA 4EVQA 1UBJS 3GLKA 3OZ7A 4KBFA 4GXNA 4OJTA 4XD7D 1WY5A 3RDPA 4A26A 3ENKA 4A15A 1FTSA 2BCJQ 1UT5A 1HSZA 1SBCA 1Z6TA 1ZW1A 2XMDA 4MV6A 2J7KA 3BFXA 3IB3A 2EARA 4PZAA 2OBBA 1E4EB 3AERB 5EJ2A 4ZVLA 5KSWB 4MW1A 1IU9A 2JEZA 2XUFA 3PUHA 1QZXA 1Z2CA 3QHQA 4LYJA 3B1YA 1ABFA 1PR4A 4JUIA 1ES9A 3IOBA 3VU1A 4BVLA 4CZ2A 2CLFB 2JLQA 2DX7A 5JNVA 1K4KA 2DJ5A 3U09A 2BEVA 2R8EA 1Z75A 1EFHA 4KIWA 3GEGA 3QVGA 5IC5A 3CR7A 2FPPB 3H75A 5IWCA 5DYYA 4X6LA 2VRBA 5LQNA 4W5TA 1W36B 3FUCA 3IULA 1AGPA 1JLRA 1X74A 4EW1A 1OTYA 2Z3ZA 2PX5A 3WK9A 5K0TA 2VDJA 4F9EA 2G9UA 5BWBA 1CY4A 2EG9A 3CTMA 3G2KA 4MQFB 4QU0A 4B76A 2C3PA 1GPNA 4OYRA 3LX5A 1MC4A 4BLWA 1N5DA 1CUYA 2WA1A 2OL4A 3KEOA 4LJ4A 4LWPA 4EO4A 1LTKA 1GQOA 2DPYA 2VDMB 1BKYA 4X8MA 3W1EA 2Q3DA 1TEHA 2YFHA 4PYLA 4CNQA 2PUBA 1JEAA 3A3PA 3ASUA 3CLTC 1V95A 2YWXA 3KD2A 4FDUA 4NZPA 3TW4A 3BKWA 4UCWA 4FNGA 3VSAA 1MZVA 5HQ3B 3TRHA 1L5FA 1GPLA 1WIWA 3QOFA 1RPNA 2HH9A 2XUAA 4JYBA 4M98A 5A4KA 1JG3A 1NKTA 5HCNA 1Y8CA 1YRLA 3RLIA 3WIEA 1ADJA 4F9FA 1BKDR 1Y3BE 4W1RA 1L8OA 4EPYA 3F1LA 4LBWA 1TPZA 3O7MA 5ICEA 3KQWA 4G09A 2NQ2C 5AI0A 3KSBC 4FYKA 1DXHA 1U4NA 1L5WA 2JGLA 4R01A 2F9MA 3VDXA 4D80A 4H4DA 1YDHA 4EAAA 3ER9A 5EJFA 1JQ5A 1K6IA 4QU9A 4L75A 5K0CA 5KQMA 3C98A 4YP9A 1EIWA 3B5EA 3QA3E 1IG0A 2AK3A 3QVWA 4K28A 3T3IA 5A9RA 2DKFA 1X7DA 4TT8A 5EERA 3SXJA 1NUSA 4BO9A 3KBBA 1SVLA 2IHKA 1EXMA 3B3JA 1HYEA 4QTUB 2ZULA 4PGGA 2PAAA 3FG9A 4MPRA 1QZTA 5BPFA 1LDMA 1E1RA 1P1FA 1H93A 2H5IA 4QOGA 2WSIA 4PZYA 1K8YB 4MKZA 2YV3A 3QPWA 5KYWA 4XGKA 1O4WA 3CTPA 3VNRA 2C97A 2VPTA 3T99A 1D04A 2CJWA 2ZUWA 3OZUA 4M99A 3BDAA 3ZLVA 2OUKA 2NUTA 5CCDA 5CVDA 4M7WA 5DM2A 5FPSA 4GSKA 1Y98A 4F92B 3D4NA 3DCIA 1HOTA 1IY8A 4MQEB 4QJ4A 3TW8B 2VT3A 5B1EA 2NZVG 2GYYA 1VM6A 1UBLS 3OM0A 3OPYA 2M2IA 1O4VA 3AW9A 3CRW1 5ANRB 1L6IA 1V0JA 5BSKA 1ZW6A 2XJ4A 1CDZA 1SXJA 3OFJA 4QXOA 1JEJA 3AETB 3BBLA 2OD9A 3HU1A 3NLLA 4JLOA 3VZSA 5IS2A 2O06A 2NU8B 1UBTS 1O5TA 5KNDD 1Q1AA 2GSWA 1I2AA 1A69A 3AI2A 1UXJA 4MGIR 3IP3A 1X7ZA 1AQJA 2XCIA 1K7FB 2JH3A 1I4LD 4V03A 3SXUB 1OBCA 2HZBA 1X70A 3ICQB 2ZSEA 1CP2A 4BRWA 1C1XA 4KQFA 1FUKA 3EJ6A 1VLMA 1GPBA 3H9CA 2FUKA 4C30A 5H59A 2FJUA 1Z4OA 3JQ8A 2NYAA 4KK4A 3GD7A 1L5VA 4X5OA 1RZRD 4B47A 2XI4A 3I32A 1DDGA 1JMVA 3GLQA 3M6AA 4IHAA 4JP5A 5KSYA 2CEKA 2KBEA 1KJQA 1VG1A 5DPMA 4OJKA 4JI5B 3BFPA 1C3JA 2ES4A 3WAKA 1BX1A 4BMSA 3FWHA 5IX8A 1E1DA 2IPMA 3RT9A 3ODPA 4RVGA 5ERYA 3A1TA 3O82A 2GPNA 2BMEA 2EATA 4E2ZA 2FZWA 2BOVA 3PCTA 5HDQA 3UB4A 1JPUA 2DQKA 1V26A 1VPDA 2WVHA 3IR7A 4ZA2A 1XQYA 2BSQA 2H92A 3OP4A 2A5GA 1CCWA 2AHOA 2ZT7A 2W98A 1IONA 1UPTA 3L6EA 3SX2A 1JTFA 3CUUA 3TAUA 4KYVA 4QTZA 3D5QA 4EG5A 2WFLB 1NBIA 1CIPA 2WOOA 3EVGA 3OAAA 5K20A 1DV2A 4DV5B 4KFTA 2XNHA 1HYHA 1TO2E 3LSYA 4LZNA 4XIYA 2MSDB 1Y8RB 2HMYB 4U3JA 3JATA 3KLPX 3K6JA 3MRXA 3CCCA 1QNLA 4AP6A 1SPBS 4DA8A 4RCZA 1VLHA 3I34X 1BGWA 2CL5A 1FYWA 1RI1A 2K87A 3RYFA 4EA6A 4R8KA 1C3XA 4H1VA 4OMUA 4I55F 2QN3A 1DHRA 2WWGA 4B2LA 1TUBA 3VKGA 4LDPA 3GELA 1XNGA 3EN0A 4G3XA 3KJNA 2BZGA 2OYRA 4RY8A 3SNHA 1QS0B 2Y9MB 1WXGA 4MKXA 1THTA 1A9SA 10MHA 1FX0B 1C8BA 3ETLA 3IVGA 3IIKA 4G9BA 1E4OA 4IWYA 4HO1X 4ESEA 4F5YA 3F7MA 4B3RB 4MARA 1ZXXA 4GC5A 3HA2A 5DEOA 1O97C 2QN9A 3KWMA 4OOEA 4RPGA 1RFGE 4RZSA 4TKZA 2ERCA 5CJPA 3QJYA 3F96A 3U31A 5FAKA 4KQIA 1VYUA 2ECOA 1Y80A 4IQ8A 1IUPA 4UVHA 2F1HA 1YBVA 3BHNA 1NDUA 2H2FA 2ZCJA 4ML3A 4OYLA 2J0QA 1U0EA 2VJBA 1N2CA 3P4XA 1X8JA 3AI1A 4NVRA 2ZI3A 2ZYAA 2N46A 5EZYA 2JEOA 1KC3A 2LZ0A 3W8EA 3REOA 1F14A 2I2WA 2HRZA 2JCBA 3EFBA 2QTNA 1X2EA 2R1VB 4A8JC 4YR9A 3NEPX 1PJQA 2O8FB 5AVWA 1IN1A 2BM1A 2HA3A 1QYXA 3BX1A 2ZQ5A 3QKRB 2XYVA 4L76A 2LIVA 2WSSD 4OIFA 2BTQB 4ROSA 3WIVA 2R6CA 4OOFA 1YJ5A 1OWOA 2C9BA 2IW3A 3NPMA 5EJEA 3BHMA 4KVAA 1XK7A 3BJMA 5K3FA 4R51A 1ESCA 1JWAB 1BGVA 3PUZA 4ITRC 1AXEA 3WLPA 1AKYA 4DMLA 1B8VA 2PZMA 4XARA 3UAGA 2NVUB 1NW9B 1KH3A 3GEIA 4BB9A 3A2KA 1AF4A 1J0CA 1NUPA 4ND1A 4TUYB 3Q9SA 3QITA 2P35A 3CE9A 3DMDA 4CDNA 3DE0X 4Y6RA 4D5EA 1QO7A 1FNSA 2HGZA 2Q99A 2RHWA 3HMKA 2AZXA 3NG1A 3KPWA 2W2QA 4JI3B 2VP0A 1XMPA 2HIGA 2GK6A 3OLVA 4UBOA 4B43A 3G2MA 1MRZA 4FFLA 4ZI7B 1QQ5A 1KMQA 2JHGA 1N9KA 5JBIA 3IE2A 4BB0A 3ZZ0A 2HXSA 3K6SB 1S3IA 1EDBA 1JQJC 2A3RA 3T0IA 5AOBA 1RM3A 4S1VA 1Q17A 2NNLD 1GQQA 1IE3A 4NCKA 1MJGA 4D4IA 4OHRA 3KB2A 4Y2UA 4DHEA 3M70A 2MSWA 4BFVA 4HQRA 5IAOA 4MITA 1IPFA 1T3GA 2PMEA 5CLHA 1LDBA 2F9LA 2O7SA 3C7DB 1DMSA 1LBTA 4OL0A 2CCGA 1DIHA 4TROA 2LKCA 4Q16A 2FSHA 3F6EX 3Q3HA 4ZI2A 2Y76A 2DHRA 2XNDD 1ZI8A 3SEZA 1M7BA 2OD2A 3UB2A 1NM5A 3HVJA 2WZBA 4BE9A 3NTXA 4P81A 3EOAI 5A04A 4U2GA 5BORA 3EWAA 3QEMA 5EMLA 4D0RA 2WMYA 4CKEB 1IPEA 1K6EA 2EL7A 2YMMA 2ZTMA 2GFIA 5EKUA 1ZAYA 1Z9BA 1ZFNA 4CQMB 5I7SA 4WSOA 3KAKA 2X9LA 3CRNA 2YMQA 3LQ4A 2QN8A 4M83A 3ZCXA 1YZTA 2G88A 3IUBA 5CHEA 2I54A 2ZJYA 2HC9A 4PW0A 3ZXSA 4U6NA 4QFBA 4B2IA 3V4OA 1LBIA 1XZHA 2IV7A 4TVKA 3QPDA 4F6CA 8AT1A 1DC3A 1WMFA 2BKVA 4JENA 3BMQA 3FWNA 5LFAA 2PRZA 4Q4JA 3PC8C 1PR1A 1E9BA 1UP4A 3F74A 3ZYZA 1O77A 1DRKA 4BNNA 4PQGA 5KTOA 4AJHA 1KP9A 1NP3A 1U81A 5BMVF 2OM2A 3O94A 2YHSA 4B74A 4HWGA 4Q7MB 1O54A 2BP7B 3K70D 4NYJR 3FCSB 3TLKA 1JA1A 2IHYA 1J6UA 1WSBA 5HK9A 5DHRA 3LM8A 2AYYA 3OJLA 5CDGA 5GVSA 4LIPD 4UDXX 3CT4A 3LWBA 2YWBA 1RYZA 4X95A 1LLQA 4DDTA 5ALIA 5IK2D 2F1JA 2VF8A 4J6EA 4ZC1A 3TW6A 3C7KA 3FSGA 3P9KA 2J3MA 4FGUA 3A11A 3NWJA 1SCNE 1NULA 2AV6A 2V97A 3EQZA 4LFAB 5EWMA 4Y9TA 3K20A 4HPJB 5JU6A 1HEIA 2NLOA 1DBQA 2OOSA 3GLVA 4TTAA 1VMIA 2BR5A 2R66A 3AF4A 3JQFC 5KS2A 1M1YA 5F5XA 3EXHB 5BRAA 3PKIA 2J6HA 2JJ8A 3TLZA 4R4JA 3DAOA 4KG7A 3O83A 2K4MA 1I3KA 5KJ6A 4C7KA 5TPZA 3IOMA 4Z86A 1E2IA 2QM0A 4BGEA 3AR6A 721PA 5HOEA 2OORC 1FFHA 5CLQA 3H05A 4U39A 2NP6A 2ZYRA 3RYIB 5F1YA 1F38A 1M0WA 2FX3A 1SGWA 3M9LA 3QEOA 4IV0A 3DM9B 4A0GA 4ENWA 4MS4B 2VQEB 1VLLA 3THYA 3IUPA 4Z4FA 1AKTA 1BW9A 3PXBA 2GPWA 1CR6A 4RO0A 2X0FA 2W6ID 3A0UA 4YFYA 2HPHA 4L0MA 1XDBA 4M0PA 4QASA 2KPOA 1VCNA 4OO3A 5JAMA 1AHNA 3HXQA 1KEUA 1IVYA 3DEAA 4D0SA 2VPPA 2F64A 2QP9X 4KP7A 3AVWA 3BWXA 5AW1A 3ESCA 2JJ2A 3K31A 2WT9A 3NU1A 2JAUA 4MUXA 2FEPA 5A6SB 2ZJ7A 4B4KA 4M87A 2JIBA 1YGYA 5JG7A 2VS1A 3MK31 1RE1A 2A94A 1F8XA 4A8PA 1TLFA 2WDZA 3NP9A 5BQ5A 5KNCH 1A72A 2D59A 4FR5A 2PMDA 1OY1A 2EKZA 4EO9A 4ETNA 4KSYA 5DSZA 3K35A 4MPJA 1I7QB 1Y33E 821PA 4YRSA 4M22A 1N3IA 3GFPA 1MJ5A 1W59A 5KJ1A 4QM6A 2BE7A 3ES9A 3TIXB 4BVJA 2FN7A 3GEMA 5B57C 2BEKA 2PS9A 1T9HA 3L7BA 3WLAA 1FP1D 1RCFA 3T1YB 1EYZA 3BFJA 3LXXA 2PZFA 4FMPA 1O6ZA 2H1IA 3K09C 1D4ZA 3RS2A 5ARBA 1S6YA 1Z6ZA 3FFAA 4J0DA 1THZA 4LOHA 3SEFA 5JNRA 4QXPA 4CM1A 4BKOA 1Z0UA 3A9UA 4IVPA 1E2BA 5LUBA 5EJ6A 1PUIA 5H70A 5CEJA 1HZZC 1GPAA 2QUAA 2YZNA 2JJQA 3VXKA 4PSCA 2NX2A 1PL7A 2XYQA 2XSZA 3TSCA 4B87A 2OZLA 5AH0A 3FETA 4Z8XA 4AROA 1EJBA 2UVPB 2NU6A 1G6KA 3TLGA 3DT8A 4Q3CA 4JELA 4PIVA 4Q1FA 3SJUA 3STXA 5GZ3A 4PYMA 2V3WA 5I3CA 4EI9A 1IBCA 3CNNA 5PGMA 3SDBA 3AHCA 3QLUA 4HQ0A 3OSZA 4G4GA 2G5CA 2RC5A 3JRWA 3MAGA 4ZV4A 4LXXA 1TC2A 4FFWA 4MKIA 1JHYA 3OPQA 4X1KA 5LA6A 3RAFC 4B3HA 2HLDD 1E59A 3KVNA 3R5XA 2YV2A 3P2EA 4MV0A 4UMFA 4RLFA 2YINC 3HKDB 5DTRA 4ENTA 4RPJA 5HS4A 4L7QA 4DE5A 2Z2XA 3QFRA 4I6GA 1M8FA 1NBEA 2YJ4A 1GVNB 2PXXA 2O2JA 4PGHA 2JHCA 4V2UA 4ZWNA 5IWAB 3EDCA 5DSXA 3OECA 4QQKA 4RU1A 3F9IA 4LJLA 5AM5A 5AP9A 3HY4A 1PQYA 4L22A 3VR4A 5C4IA 5KX5A 2CJYA 2SCUA 1H0KA 1JXMA 4YR7A 1YQTA 5A4MS 3PWZA 1T0IA 2LNDA 4GBED 4CXMA 2GKGA 1QV6A 4MPPA 1FLNA 2P41A 3ND8A 3WNQA 3TFOA 1BEEA 3F6SA 4U2DA 3UTDA 5CG2A 3EEFA 1WCXA 4PRYA 2X8BA 4RE6A 5TMPA 4LF8B 4NG5A 3TLXA 4YBZA 1KK0A 3J80A 1LJ8A 3K8OE 1J7JA 1NWHA 2Z1MA 1SM4A 4M1ZA 2G7ZA 2Q3JA 3UF0A 5B1YA 4KPEC 5TV2A 1G1AA 1N6LA 2B7CA 4EKNB 4J4BA 2B1RA 5SY9A 2H54A 5BT9A 2KWIA 3JWEA 3UGTA 1QK5A 1RXVA 1WCWA 2MHCA 5GAJA 5L8VA 2JIQA 3ETEA 4H7JA 3KHTA 4IHJB 3IQXA 4Z0HO 2HAEA 2D8MA 1G2IA 1QQTA 4GPAA 3PB3A 1XKTA 1NYLA 1SZJG 3UWSA 3RQIA 1UR5A 3OP1A 3EPPA 3WMRA 1S5PA 3Q8KA 4YI5A 1WZEA 3GXOA 4CGZA 3KYDB 4NBWA 4CWAA 1RE0A 1I2CA 1QHHA 4DBLE 1T26A 2EWVA 5JXHA 1RAIA 3KYCA 5ARCA 3RVLA 3GZNA 4OHOA 2X0IA 3EOBI 2NAPA 3X43A 4E94A 5CFPA 1M6VB 2WF9A 1V39A 4K9PA 4JLSA 2R7KA 3T7CA 3DHNA 2R5FA 3DXXA 4AJPA 3BH6A 4J6FA 4K6HA 5KYGA 2C2GA 1JIQA 4FT4A 3WHKA 3OZTA 1D6MA 4HDRA 1A76A 1MORA 3OZRA 3T9AA 3W79A 1VP3A 3H8WA 2ZETA 4I14A 4J4HA 1JX6A 2HD4A 2P7IA 3AIMA 4PQFA 3WMEA 5EQJB 3OD1A 2PQ2A 5HEKA 1GXSB 4QDTA 3LUHA 3IP1A 3ZGOA 3IR5A 1U6JA 1V4BA 4FNAA 1P0MA 1X3LA 1AQLA 4D42A 1JXAA 1QFYA 1Y7TA 1XL1A 2C00A 4IUCS 5DHQA 2O19A 2BKEA 2QP3A 3BZWA 4B6OA 2Z3VA 3CCBA 2D00A 3NTRA 1AZWA 3CVXA 4MJ7A 3ITEA 4B1FA 3B36A 5LIRA 3WK5A 4JJAA 1YBHA 1V8ZA 3IBYA 3EXEB 5KINB 1G7CA 2FQWA 2XA1A 5L4SA 1Q0QA 2BFDB 4JBGA 3WJAA 1X7YA 3VAZA 1MH9A 1M2VA 4GRAA 5BV2P 1D4FA 2VJKA 1DCMA 2D06A 4RIIA 3B7PA 5JDIC 2J9ZB 1LI7A 1VA4A 5KOHB 4MS3B 4D3ZA 4QUKA 1S7GA 2GJ8A 2W2KB 4GEGA 4HAUA 1XTSA 4P3YA 5F9HA 2Q7OE 2QENA 4UEKA 5CA0B 3WFIA 3BRCA 2FPWA 4LRXA 4MROA 3RGGA 4BNFA 3Q0TA 2YICA 3TTWA 4ILKA 2P90A 5DCLA 3TPFA 5MFZA 3SXPA 4RAQA 4H35A 1GGVA 3W3AD 1KU6A 2BFFB 4BFXA 1F0NA 3SYMA 4HFRA 5IVIA 4BDTA 4P4LA 3GAFA 2VJCA 2W11A 3DF7A 3LBYA 4KPGA 4X1IB 2BAGA 3OICA 1NMEA 4NAHA 3O8RA 1QH1A 1VBMA 3M2TA 2F62A 2JA1A 1TEVA 1FVHA 3ISJA 3HBAA 2ATEA 4D99A 1VL1A 5E1MA 4XWTA 2I4TA 4Z0TA 3A9WA 3QEJA 4NWIA 2R8BA 4TUYF 3RD5A 4AY3A 3S8EA 2GZHA 3ONNA 3A26A 1XQ6A 2QY6A 5BN5B 2VHTA 3ZK8A 1VB3A 1H6AA 1AK1A 3GF4A 3PK0A 3FTFA 1SEPA 2IHZA 3V1NA 2FLWA 4ZI7F 1L5OA 1X9HA 4OXRA 5GONA 1ABBA 2JGKA 3UJDA 4FCTA 2VWHA 5LD2C 1CBUA 1TK9A 1U0RA 3OZIA 3R23A 2J46A 1RWBA 4FZ5A 2W48A 4HXYA 1GNVA 4I9NA 5E1DA 5ENDA 1FPQA 1RXIA 3V7WA 4GYKA 4XVUA 1SMKA 4ZU1X 5AW5A 1Z2AA 1RVDA 3CIOA 4YREA 2RJNA 3E48A 3NAQA 2XXAA 4J75A 4OGKA 3L4BA 2PA3A 5HM8A 3MB8A 4WA8A 1RYHA 2X41A 1RWXA 3JZMA 4MGHA 4BLOA 4MYDA 3DMRA 5IVDA 2G70A 3IEUA 2RCYA 3FRHA 3DBLA 4JT4A 5FCDA 3PDCA 4ODIA 2CB9A 1MQSA 5C31A 4QECA 2PMCA 4LNUA 1CERA 1TO6A 2FN4A 4M1TA 1NQ5A 4GYJA 4IY1A 5KKAA 3U5TA 3FZEA 3AFIA 1T5DX 2V9PA 4FI3F 3WLHA 4O4JA 4IJVA 2PTGA 1OZ0A 2OZKA 2X8JB 3FPFA 3I2KA 3ELBA 4GNRA 1UEIA 1GILA 2JAWA 1C9JA 1W1IA 4GOMD 1XD9A 3AOEA 4B4WA 5J1TB 1GDDA 1F5NA 1PLLA 1H4QA 4BV9A 2QUKA 3C7TA 4ZEXA 4CEIB 1GVHA 4PX2A 2GHTA 2QMEA 5E3IA 1ISSA 1PRYA 3D4IA 3JALB 3MHPA 4RHEA 5HPYB 2H7CA 5GJVC 3CH5A 4KRFA 2VQ3A 4O4IB 1UWVA 4XUDA 2RH8A 3UK6A 1YKSA 1P80A 1FS4A 2P91A 3JTEA 3LPCA 1OXVA 3I6IA 3BIXA 3UPTA 3NOQA 5HTOA 4HDOB 3IMGA 4JJ6A 4E5KA 1B1CA 3KSDO 5LMUB 4C6RA 5ECWA 3G59A 3WV4A 3T34A 4NBNA 2M9MA 4KWIA 1U0SY 3SHOA 1QBKC 2EKLA 3JQRA 4NZOA 1M1UA 5ITZB 1ZK2A 4HFMA 4UHKA 3THRA 1QIHA 2Q9CA 4EHFA 4UBNA 1BTOA 5C8VA 5J4HA 2IXDA 5KTPA 5GIPE 6ABPA 2EOAA 1OI7A 3VJMA 4IOJA 2VN8A 5JJBA 5F4BA 2PJZA 4JOCA 5E2BA 2WINI 3A6DA 2WG0A 2FZLA 3IV7A 3RKRA 2QRLA 1JDBC 2AG8A 1TRKA 3PEEA 1F6WA 1MF7A 3KLOA 1FSSA 4FFRA 1ODTC 3RVJA 3ZZTA 2CUTA 2QRGA 3MBOA 5BSUA 3RV3A 4Z1MD 1Y1QA 4PPGA 5EHGA 4Z9YA 3K72B 3KR0A 3OOHA 2ZYVX 2CVFA 2JDID 2WB4A 1I5RA 4WH0A 4BB5A 2C7QA 1QJ4A 1SKMA 1QIFA 5LDHA 2FQYA 5LB2A 5JJLA 4FQ8A 3JRXA 3HR7A 3UEOA 1X15A 5AKIA 1M1ZA 3OFVA 1QO9A 3RS4A 4MUYA 5D6OA 5CB4B 3V4RA 1YUMA 4FGJA 2A33A 2IQIA 2OBLA 3WXMA 2GN0A 2C9DA 1GNQA 4YVFA 2DUNA 3CLUC 1ZJ5A 3GLTA 1NFQA 1S8AA 3EEBA 4FIDA 1OZGA 4FEYA 1U3TA 3R0VA 3JQBC 4MTCA 4AJEA 3BDVA 1WETA 1I10A 1TRHA 8OHMA 2Q45A 4YCNA 3IL2A 5SZJA 5E4JA 5JXWA 1ID8A 1G9SA 1LW7A 2GESA 4N3CA 2XDYA 4QSHA 1B6RA 4F96A 2Z6UA 4UE2A 4OV6B 4EUHA 3G79A 3OU7A 1FXUA 4LJ8A 2IE8A 4XEHA 1SBIA 2FLKA 4JU9A 4BX2A 2C4MA 4KBGA 4R5MA 3VH4A 3CV3A 2KLBA 2H08A 3M8KA 4DMFA 1JYEA 3OY2A 2A9QA 2IU6A 1DAEA 2Z0MA 3VNUA 3GRCA 4DIUA 2O8DA 1L4EA 2DWQA 2JVKA 4IEEA 2QL9A 2Z56A 4G0NA 5K2OA 2FKNA 2DWUA 3L0BA 3ESBA 1JF8A 1SURA 2P27A 3G9UA 4ACBA 3BMNA 1CZNA 2GJ4A 2PLWA 1ZGBA 3NHKA 4HGPA 3T41A 2XZPA 4U7WA 1LY1A 2PX4A 1XRJA 2OXFA 2QYHA 3OHPA 9GPBA 4RAOA 4DOMA 1M1XB 2GXSA 5A4DA 1XLTA 4JVNA 5IH3A 4EYEA 4CF3A 1OHHD 4XPZA 1V5EA 5A0TA 5IBQA 3S28A 2C2ZA 1A8PA 5HCUA 3EASA 3HXLA 3CX8A 2HBQA 3OTQA 1Y8QB 2UZIR 4U7PB 1U31A 2VAPA 3I72A 1TEXA 3ZNPA 3OTHA 1JJIA 2ZBPA 3GGOA 4IUDS 4BLTA 4OK3A 4V1CA 3EPJA 1ESDA 4TV9B 2IPNA 3EYWA 5HK8A 2WKWA 1ZM9A 4RL6A 4RMNA 4RYLA 4B6SA 4DABA 1Z34A 4ZQCB 2YJTD 3TF5A 2H1SA 3L4KA 5DNYB 2HV9A 3UTCA 3DMHA 2QTRA 4GYYA 2GILA 4DBLC 4OX9B 5J9FA 5EHNA 1QIIA 3BXPA 1LDEA 3LH5A 3IXLA 3PDIA 1T4DA 3O8BA 3BRWD 1L7XA 3ONDA 3JSAA 4XDYA 3VNQA 1PR5A 2IDMA 4DFDA 1VB5A 4X7RA 4DYVA 3KU1A 5C7IO 3PJGA 3SM9A 2CL6X 3Q1KA 5BSEA 3H1TA 1B23P 1H2AS 2XNKA 4HWTA 5E8JA 4D79A 1ZJWA 1OWLA 3HYSA 5IBCA 3U3JA 2R25B 3ADCA 4Q34A 4J9UE 4NE2A 1KJIA 2W6QA 3N6XA 2WTUA 5EIXA 2IXBA 4KYTA 1JQKA 1Z4PX 1JDNA 3GLGE 3CB4A 2L2QA 4J0GA 1S7CA 1YRBA 2P8JA 3RS9A 3S5UA 4YPOA 2AW3A 3DO6A 2DE0X 2IBTA 4KV7A 2ODTX 1ZINA 4UAUA 4X6XA 1XPRA 4CKBB 1XP5A 4Q1CA 2YY5A 5FBKA 4XJVA 3P7MA 1TIPA 4IIJB 1CQJB 1V43A 1X80A 1RXEA 1TA4A 2NUAA 4A82A 4BQQA 1C7FA 2MCFA 1U2ZA 1WP4A 2E55A 2WW8A 4ESHA 5JRZA 1CYEA 3BEDA 3C97A 4HD8A 1KP3A 1O95A 4RMHA 4GEKA 2E4AA 2QP4A 1T10A 1SBZA 3PC2A 2ZSJA 3SC2B 3ZY3A 2CHEA 4CM6A 4OLHA 4ECEA 1II8B 5BW8A 1L7MA 3UV6A 1WCIA 1E79D 4K9NA 4PO8A 2VXBA 4KR0A 4EECA 4L9AA 3V46A 3EA4A 1X6VA 1MQ9A 4IHJF 2ENUA 1UKYA 1KVQA 3MJSA 3P27A 4UMEA 1CF4A 1PSZA 2HA6A 3PQDA 2EDCA 4YJFB 2AN4A 1EFPA 2W93A 1L5YA 5JJKA 5IC4A 2JJYA 2VNSA 1WUJS 1YU6A 1MX9A 1Y3HA 2HEGA 1ODCA 2YHIB 3UKJA 2RBEA 5DCYA 2BT4A 3VVBA 4J29A 5AMXA 1U2DA 2K5UA 1YR8A 1W47A 2Q9UA 4XGNA 4QPDA 2VJMB 4PQYA 3FCOA 3TLAA 2OD7A 2I71A 2FMTA 3E1GA 2H8GA 2FFQA 3KXDA 2O0KA 3EXG2 5GP1A 1UIMA 1IM5A 1DKOA 2PPVA 4JLUA 4EKEA 3ZCPA 4G8JA 4MS1B 3K0CC 1SG0A 4QJ5A 3LBFA 4BGDA 4W5RA 2PBFA 3NM6B 4PF1A 1NSYA 3BWEA 5D5QA 4BLSA 2R6AA 1IY0A 4PQRA 2GDZA 2JGJA 3HCDA 2ZWAA 3FPLA 5C0OE 3KQNA 1YQEA 2QMOA 1V71A 3IPXA 3S2FA 1DOZA 1G7TA 4NLLA 3DTVA 1JGTA 5B6IA 2EFYA 2G83A 4PLYA 4CMAA 2I9KA 5IEJA 1U0TA 4O59O 4QDKA 1ISPA 1CE8A 5FR1A 3GXBA 2HMWA 3N7UA 1GTSA 1ZS9A 1CJUC 4DLZA 3UMYA 1NVEA 1MO6A 2ODWA 2V7QD 2PNJA 2GMWA 2PCJA 3QPAA 3INTA 1H1DA 1TQHA 3RRJA 3GLIA 1XRQA 4RQAA 4FD2A 4WCFC 3TIIA 3N86A 3ZJVA 3ETGA 4IIFA 5CA0F 2P9YA 2VH5R 2IODA 3TZCA 4AY4A 1MABA 2BEVB 5IDVA 5HX7A 4GOLD 4YAOA 1ZH8A 1ZHFA 2GPAA 2ILVA 3ON5A 1RRMA 3QE3A 4A2WA 4WK6A 4EGSA 1HX7A 3W6UA 3VR6A 4CUJA 3KQMA 1JFSA 2G0NA 2V7GA 5FUBA 1IOLA 2XVMA 2W2LA 1QJCA 4DY6A 4UTNA 4WESB 2QVZX 2VG8A 4TSFA 5B58T 4YFVA 1J39A 1IWBB 3GBVA 4I1RA 5K6RA 3GFTA 3GRYA 1SBQA 1QRAA 1SUFA 4FDLA 5KHAA 4AIRA 1WZIA 3BTVA 2FOIA 3K2IA 1TA9A 2ZTHA 3UW3A 2BCGY 3NM5A 1MX5A 1YE3A 2ZTSA 1I01A 5EOVA 3VVLA 3ZWVA 4ER7A 2O3TA 3R9WA 4Q7KA 1K6XA 2GHRA 1K7YA 3VR0A 4C6HA 3G2IA 1AKNA 2WYVA 3NHUA 3B3AA 2DT5A 3G0BA 1P4GA 4PC7A 1DUSA 4IMJB 4J0EA 4N0DA 4PE5B 4BS9A 2JLSA 5L9AA 2HT1A 1GQYA 2BHNA 4L2IB 1XZLA 5ENZA 1IRXA 2J48A 5IPFA 1H3NA 2VPIA 4DGSA 3TCKA 4BQIA 4E09A 2B9EA 3A3YA 1T9KA 5FI5A 3Q87B 4BVKA 2PSSA 1H8HD 2QTCA 1MB0A 1U9YA 3BTOA 4GPZA 4MV4A 4A1OA 3VZBA 4ADSG 2HDWA 4KI0A 3GP3A 4DKXA 4Z7OB 4X65B 3F6CA 3L8EA 4OHVA 4UPDA 4W1SA 1WOMA 1S2NA 1SULA 2AQHA 3AJ8A 4CIDA 1E2KA 3PQCA 5I01A 2C7PA 5B7NA 4KW7A 3ND9A 4DREA 3MD0A 4LWQA 2YZ2A 1C7ZA 1RAEA 1Y7HA 2CGEA 2XUGA 3I3OA 4TVBA 5CU7A 2IY9A 2VAMA 3DLBA 3G49A 2D1TA 4H4CA 2WYIA 3AZQA 3WY9A 4NDZA 3E9MA 3A4YA 1GRRA 3MWYW 4JT2A 2YZGA 5GV8A 4JVLA 5LZ5A 3BF7A 1QH9A 3U17A 5KYWB 4H3KB 5AVSA 1Z7BA 3EFEA 4UE6A 3VM6A 5JJIA 3CG4A 5J5AA 1VZ3A 1A4RA 4QNNA 3ROFA 4EM6A 2NUTB 1F48A 4OQNA 3SJBA 2BM8A 1IHUA 3R76A 1LXCA 1KMCA 2N1BA 4BVEA 3WWPA 3LUAA 3MSXA 2JKVA 3KJIA 1RHUA 3N1UA 3NBKA 1AY0A 1UBEA 3PSAA 4RSGA 2P8SA 3OPYB 3HGQA 4JBYA 1IXKA 4US1R 5CYOA 4CCYA 3S2SA 4O4IF 5IHXA 1SXJB 1G21A 2QLBA 3TEFA 3OA2A 4RCYA 3TR0A 3V1KA 2HK7A 2WJ4A 3AZOA 2XWPA 2FZKA 2JGDA 2NZ2A 3N0TA 2HRRA 5KNCA 5BUQA 2RHMA 3WRXC 4X6YA 4WCVA 1ISMA 3ZWOA 1H5NA 1C1XB 1II0A 1ZJJA 1KF0A 1X1RA 1SVWA 3R0JA 4RH3A 1F3LA 1H6CA 2HJVA 3GUUA 3IIIA 3FBGA 2FDCA 2V3CC 4Q01A 5HKAA 3A4TA 2FP3A 3CLKA 3EQ6A 4KIUA 3WQBA 1JZTA 3OTIA 2XDAA 2VT7A 1AGXA 4TL9A 4X92A 4DF3A 3HDYA 1CS4C 2CVOA 4ND4A 1QHNA 2PRKA 4N12A 4NFYA 2PUEA 3VKVA 2DR2A 3TBKA 2YZMA 2ZKIA 1MC5A 3KB1A 4F6LA 3FI9A 3AF0A 4Q4DA 1VMEA 3KV3O 3TOZA 3FKQA 2AR0A 1VGVA 1LPOA 5LQMA 1PZGA 1XF1A 1MN6A 5NLLA 4WZBE 3WWCA 4Q48A 2GO7A 7ABPA 2WU8A 3ELUA 1YZQA 3V4ZA 5CB4F 1PR6A 1TT5A 3M6IA 5C80A 1JE1A 1T0JB 1TM1E 1VHLA 5DCWA 4B3SB 5KVVA 3KJGA 4HPWA 2O14A 3U3MA 4CLEA 3NC4A 3CISA 1T8UA 4HB4A 4COKA 1NR1A 2O0HA 2VF2A 2VO1A 4GBJA 4RJLA 1PV1A 2GDJA 4B8YA 2CHVA 2JI6A 5HG0A 4BNGA 5E95A 1V3QE 1LWOA 1U0GA 4KEAA 4U3JB 2Z8ZA 5DNDA 3BA1A 5CM2Z 2X5KO 4MB2A 1S01A 2D13A 2VUHB 4PCVA 2QD1A 4LVNA 5G41A 5T3YA 3TDNA 1ULSA 4EHAA 4DCVA 1K0UA 4RENA 3C7AA 4ZVMA 2PZ8A 1Z0ZA 4JSRA 4YACA 1MHPA 4TKMA 4ZQIA 2MMCA 4PTZA 3UJBA 1E4YA 3WOVA 2WHEA 3O0TA 4UHCA 1KL7A 1LJUA 1UFKA 4TYQA 1N2OA 5I4BA 1XTTA 1S9DA 2PPLA 2X6QA 4P4TA 1GN9A 1S9HA 4UHBA 4WL0A 5BQFA 1XROA 1PNQA 2RK3A 4LN1A 2IWRA 4PO3X 1L1QA 3BIOA 2ZWVA 1GT91 3GOQA 2W42A 4RNDB 4EQ6A 1CLEA 4OBWA 3ZN2A 2Y8EA 3DWFA 3EZ9A 1USKA 4JT8A 1UPXA 3I05A 3ANSA 3L7AA 2RIRA 1PG5A 2XMBA 4PPFA 4O2AA 4YMUA 1JJ7A 3JD0A 1C9EA 3UK7A 4GWKA 4E07A 4Q9NA 4QTYA 2XWQA 4Z6KA 1NT4A 5AW0A 1KWKA 3AEYA 5LP1A 3OKFA 4K1XA 1UBHS 2PWZA 4M1WA 3L0ZA 1J9ZA 1Z4JA 3FOWA 4UQPA 2RHTA 4IXTA 2NQTA 5FYQA 4BO8A 4D92A 4BXOA 4TYWA 4M0EA 1F9AA 2W6ZA 2YVAA 3BGWA 2D5CA 2CBGA 1DAGA 1JJBA 4FUQA 4HLQB 4D9EA 2RARA 4PPYA 3JAWA 4WXYB 4TV9F 4C76A 2AHRA 3WXBA 3B82A 5JXIA 3SLKA 5K3FB 1M2FA 1GUBA 1WWKA 2PANA 4Y9SA 4TKLA 5AK3A 5DXJA 5CLGA 4XWOA 1USIA 4ZYVA 3DW3X 2CFSA 4FJ2A 1ZZEA 4M86A 1OH6A 1KERA 3E9QA 4CIWA 5EYPA 2NO7A 3FB4A 2WP0A 5DYWA 2QYTA 4PS0A 2P9GA 1XD8A 4EJ2A 4KBYA 4QJ3A 2D6FA 4HLDA 4L5IA 3I1YA 4DLNA 2XLCA 1ISGA 5H81A 4E70A 2DXIA 1P19A 3H5NA 4RV9A 3L8FA 3AESA 1F2DA 2I6GA 5BYKA 1Q21A 1L4GA 1QLWA 4QGFA 4BMZA 1EFKA 1P1IA 5T57A 4DM7A 1SJ9A 1HE5A 2XA2A 4K0RA 5B3JA 2NO1A 3NS7A 1XXHA 2R85A 2WZDA 3IKVA 2POQX 1SZCA 4XOIA 1YRWA 5TB5A 1OFTA 3C8ZA 1ITZA 2A9JA 3UJ9A 5IXJA 4IDCA 4IIJF 3UMMA 1KSFX 2NSLA 2YN0A 2IV2X 5CT8A 2H51A 1ADCA 2AUNA 4B73A 3GJ4A 4G56A 3QE9Y 1TD1A 3JZFA 1NIJA 5FD8A 3TG8A 4D98A 3ZG6A 2BGWA 3LKDA 4YRMA 4K40A 1W6RA 2I7CA 3EGXB 1A82A 3HNOA 1FLVA 5EP3A 2P4HX 3QEMB 4TGLA 5AHWA 4QJBA 3TWOA 3VDNB 5K0JA 2PZAA 3AHGA 1JLMA 4TV8A 1GSHA 3C4JA 1V5FA 3WL8A 5A62A 5KZMB 2O2YA 3V6LA 1N8NA 1IY2A 3L8HA 2O7QA 1KU0A 4AUEA 2JC3A 4Z53A 2R1UA 3BFKA 1ZIPA 1Z68A 3AU9A 2DMRA 1N2XA 3H8VA 1N92A 4KLZA 3HS3A 5ALOA 1J2EA 5JH7A 1YL7A 2BBOA 2PH3A 3GJSA 4UE3S 4LZPA 1BWRA 3P0RA 4FLMA 1QIKA 2A14A 2D0OB 2PL9A 1RQRA 4WXHA 2JFOA 3EPHA 1N7IA 5ULLA 5LQSA 2B34A 1G6HA 1PNOA 1Y9JA 3WK6A 1G9TA 3LRPA 1LKZA 4KFUA 1WXDA 1E0JA 2YVKA 1KEVA 3COVA 3KL2A 4XD7A 3I62A 4EX7A 3BMCA 1YMVA 2G0TA 4RTSA 1C7QA 4JJGA 1XWIA 5E7JA 4B33A 4UTPA 1DRWA 3GMDA 2QR5A 1YA4A 4H7DA 1WW2A 1EX1A 2O8EB 2ZRNA 3L7YA 1J8FA 5K9ZA 3DKKA 3O9ZA 3TOVA 2FU5C 4UULA 4CEHA 3WLEA 2L42A 2O3SA 3L7OA 3G7NA 2XB4A 3SIWA 3EX7C 3LDAA 2CE7A 5JJCA 5HP4A 1B4DA 3PUIA 3C74A 4NC9A 2FZGA 5L3QA 3G6KA 5EWMB 3HN7A 2QUIA 1FSGA 1A7AA 2OO5A 3DWEX 5TIIA 2OXRA 3G8DA 2Z6AA 1R4AA 1BMDA 1Y1KE 3RVNA 1AQ6A 4Q6BA 3H4MA 4B79A 1M1YB 1UT8A 4RFSA 2JJMA 2GYUA 2WAOA 1B43A 3G85A 2HFKA 4NNJA 1KZ1A 3GOHA 1YIDA 4ARZB 4GECA 2FQQA 2QTVA 2JZNA 3R6DA 5ILQA 5P8WA 1QDUA 4OP2A 3RVRA 2QAJA 4FGKA 2GCIA 3KG2A 1LK7A 3I76A 1EVLA 4G85A 4IHQA 3DB2A 1ZD9A 3AFMA 4WJZA 4WZAB 5DOVA 5DRTA 3RUFA 4F5EA 1BW9B 1DDOA 1ECFA 3FUVA 2B6HA 4DEVA 4DL9A 3DBRB 4NP6A 3W04A 4RLHA 4KZKA 2QMUA 4QBFA 1RNLA 1N5LA 1QG4A 1E64A 3CRRA 3R77A 4FYYA 2QORA 5EEHA 3U3DA 3DZBA 4BO2A 5B37A 1G41A 2YNMA 4IG9A 3KXKA 1SUSA 2HQBA 4YCAA 5DM70 2Y1CA 2QAGC 3T1QA 4H7PA 4A36A 1SCAA 3DKRA 3E7WA 1L8QA 3WMFA 4L95C 1VE6A 2LW7A 4PX3A 5FUMA 1MRNA 2YWEA 3NBZC 5JTTA 3DDCA 1ZD3A 5IM4F 4IDBA 2X76A 5BN4B 4HDSA 3U4IA 5KYUA 3W5IA 1R15A 1VCHA 2PH1A 2OXIA 3ZVNA 1Y9AA 4YCDA 4UNPA 4XYLA 3HK2A 3EEQA 2Z2IA 3QOWA 1GCOA 1W0JA 1SIWA 3NHBA 2OK7A 5AJUA 2NVOA 1X2BA 4A8HA 1LPSA 4IO0A 4BTVA 4J3JA 3HJAA 2ZWMA 3BWCA 3JQAA 4ENPA 3WNCA 4JUAA 4EG4A 2CVHA 4PLTA 2B0JA 1J2YA 5JSYA 1E8DA 2ZDGA 4P33A 2XOKA 3JXEA 3KAPA 5DX8A 5UKDA 4BVBA 3TINA 4FLEA 1EA5A 3Q4GA 1TVCA 3ZBPA 2LDBA 2X0EA 1MOZA 4AN1A 2R87A 4PXSA 2HLPA 3OMWA 2HF2A 3IQHX 4LSZA 5FIUA 3V7YA 3WWZA 1R6AA 3K9NA 4CM9D 1NNUA 3O4RA 3PNPA 1MVOA 2R6JA 3GPDG 1G2PA 5IAEA 3PKJA 1EQUA 3CH4B 4HC4A 3R8XA 4DQVA 2XDWA 2NU6B 4YH1A 5C4MA 2FEMA 2PQ6A 3TLGB 5DOZA 1C9NA 2WJ3A 4NOKA 3UT0A 2G1PA 2CNNA 1HE4A 4C14A 3JVIA 1CB7A 4P3XA 5DASA 3RUIA 4E7OA 2H0RA 2GBFA 1EZZA 2J87A 2PRYA 4C4XA 3WI7A 3R5TA 1FB5A 1GRVA 2SBTA 5H3CA 3WL4A 2I2AA 4CLDA 3FOBA 1OR8A 1T2UA 4ARUA 5JNWA 3TFWA 4D43A 1I9GA 1ML3A 5LA6B 4X1KB 2DWCA 4S05A 2V6BA 1Z33A 2IF2A 2ZIEA 4NY1A 5LMZA 4JI4B 2CFRA 4KXYA 2WILA 3C3BA 5B53A 1RJ9A 1N5KA 3KOXA 3ACCA 4Y2SA 3A1CA 4GZ5A 1DHTA 2XZLA 1GAJA 4IMRA 4U7DA 4XM1A 3ABZA 2ZR9A 4XVQA 2WIGA 1BVUA 2AOUA 4L9RA 4Z3KA 2DTXA 1VIAA 3MB5A 3S40A 2XRZA 1HM5A 1SC3A 2UYHA 4RZ2A 3RUEA 1ZU5A 5JD4A 4GI3A 2IEBA 4BNVA 4CI9A 5KX5B 1QYRA 3F8SA 4UOZA 3KYJB 3NRCA 1D2RA 2WI8A 4NEGA 5CX1B 3OZEA 5J59A 4UEQA 4U0KA 3WP0A 1WBBA 3JYHA 3O95A 3LDUA 1PNTA 5K8VA 5EMMA 4NARA 2OQVA 4C4AA 3AR8A 3NR2A 4YRBA 4FYMA 4PO9A 2CMDA 3QWFA 3F46A 3G7UA 4LHWA 4XVHA 4AK9A 1AX9A 1BXGB 5CD1A 1NG9A 4PO1A 2NV2B 5IVKA 3WIBA 1U7PA 4M76B 1IK4A 2WWIA 1Y3IA 3IS3A 1P62B 4LV5B 1I6LA 5A9SA 4A91A 1JFFA 4HNHA 3K5PA 2UYGA 1UBRS 1JHQA 3RFTA 4BZQA 2OHFA 3HWRA 1N5IA 2HUPA 2VZ8A 5LZ2A 1SCIA 1U98A 2GEKA 1M5RA 3H5VA 1UMBA 2QU7A 1S3SA 2BONA 2QI9F 3KKZA 4IYJA 2QWXA 4QUJA 4YJDA 3TIFA 4TKUA 4MR8B 1SVIA 1QHHB 4P7FA 4L16A 5JSZA 4U8GA 4C2AA 3I9V1 4MVWA 1I3NA 3KYCB 2H17A 3GZNB 3T54A 3PXEA 3RT7A 1UPCA 5HE9A 1G8AA 3K05A 1RWKA 4IILA 4QUBA 2PUFA 4LHXA 3M6XA 4BE4A 1ZRHA 2FWMX 2CCJA 4JCCA 2OFFA 5IKOA 4JJFA 3OM9A 16PKA 2JLBA 3JQ6A 3PEUA 4I5GA 3UO8B 1W5AA 5IAGA 4KLNA 2ILTA 3OMLA 5JMWA 3DUFA 5AOVA 2Q28A 2R5WA 1GQFA 1LB1B 3D6TB 1E2MA 2IXAA 5KYXA 1R4MB 1FJ2A 4FOLA 2W4MA 1LNSA 3ZNOA 5ALNA 2BDUA 1GT6A 2WTNA 5E3HA 2IX9A 4M9QA 2VF4X 3KR2A 2PFGA 4H7HA 3B8EA 1XB2A 2VUSA 5CB6A 2WSLA 1PS8A 2ZTVA 3G9ZA 8GPBA 1S2OA 4TM7A 2G0AA 2NTYC 3LT2A 2IUUA 4BBJA 3BT7A 3V1LA 4W63A 1UZUA 2VHZA 3U9SA 2VDRB 5FTKA 4TS1A 3AMVA 1Q0SA 1YKFA 1Y37A 2Y99A 3GI1A 3H4VA 2X42A 3IMEA 3R6LA 4HWOA 3WB0A 4TLLB 4UHJA 2AOXA 3U5ZB 3KFVA 3UENA 3I0MA 1NRWA 1X7YB 1QHSA 2ADMA 3FZQA 2C3UA 2HO4A 5FPYA 1XGKA 3UXEA 1T3HA 3AHFA 3CRZA 4JASB 4ZQGA 2RAPA 2GJ9A 1VRCA 3EQ8A 1AZSC 4FJ0A 3WGQA 5B36A 1XJWA 1CZLA 2CY0A 3DHYA 4UTZA 5I4KA 2VDQB 1KMIY 2QVBA 4WACA 3KS9A 5EAIA 3EGDB 5H9VA 4CF6A 3H11A 1JMKC 3QFFA 5HF9A 2QMYA 1ZD2P 4JR0A 3C0KA 2FN9A 2ZITA 3AILA 1F8FA 2NVWA 3H2ZA 3PVCA 3TKAA 3VPFA 1Y6JA 4OEHA 1NUQA 2RKWA 2WD7A 1JKFA 2X40A 4YRKA 3AHEA 4JWTA 1RR6A 4QX6A 3B6MA 5JXJA 2AI1A 2FPIA 5AI4A 3WSVA 4M9RA 4H1TA 4TUYA 4EHLA 2CUNA 3IDFA 2ABWA 2VP2A 3MCVA 1S4QA 5CFNA 2CV2A 4KI7A 4L74A 3ZTWA 3WVNA 3DAGA 1LX6A 3TAXA 3ZHQA 2UYOA 1K4MA 3AF3A 3AM5A 1FXWA 2FR0A 2AXPA 3QI7A 3N58A 1XLUA 1RKBA 4IDEA 4ALIA 3NBYC 1IQRA 3C15C 3IXMA 4I46A 5GONB 4CV0A 5ILGA 1SK8A 2C94A 1UQTA 2J30A 3W5AA 1ZL0A 4X8HA 4G24A 2DFLA 4YRJA 2CL0X 1BYIA 1OPXA 4HQLA 4S2EA 3H0KA 1ESEA 4XI9A 3L1KA 5DIZA 3K70C 3RYTC 2O3RA 2GTPA 3TCXB 4MP8A 4BEVA 3BB3A 3HEAA 3S1AA 3I12A 2QG9A 5G0VA 3HU3A 3O9MA 3MOGA 1TU0A 2H06A 2Z6VA 3DBLB 4DDWA 5FDFA 1VL2A 3BJRA 2IU3A 2B94A 4BC1A 3UJNA 4LNUB 4ALLA 4DQUA 2HHAA 2BEWB 2C77A 2E5WA 5HZHA 2F59A 4MUGA 1XDUA 5AXDA 4S1TA 3TSAA 2G82A 3AI7A 4BFYA 5HZGA 1LFAA 2Q1TA 2WQ6A 4O0LA 4O4JB 4L0DA 5AJTA 3FRIA 4CKXA 3L7DA 3VPXA 2OHHA 3ZQ6A 2QV7A 2B4RO 1Z13A 4BKMA 1RLMA 3A6ZA 4JC5A 1F2UA 1IIBA 1Q1GA 1KC1A 1SWWA 4MR7A 1V2GA 2C31A 3ONWA 3I9FA 5J2UA 3MUOA 4KOAA 1RMTA 2G77B 3FVWA 4MEBA 1MENA 1NR7A 4HDCA 4R1PA 4KKXB 4URWR 4O25A 4U7FA 2RE8A 2OG2A 1GM5A 1YU9A 1A9TA 1IATA 1DAFA 5KHLB 2VKTA 2ZIXA 1T6BY 3FKJA 4C4PA 4E11A 3H1AA 2VDWA 2QPTA 3A58B 4Q19A 3UMGA 4ZTBA 4EG8A 1B00A 4XKJA 1H42A 2FR8C 4NHEA 5I9IA 1NAIA 1U9IA 2XXBA 3PWKA 3DZ8A 4RBNA 5K6AC 4J0QA 3KZMA 4G0PA 4JB2A 4JR1A 3HV0A 1I33A 5HM6A 2YJ3A 4EA9A 1YASA 2GPTA 1C0LA 1Z5WA 2Q1WA 3E3MA 2WYHA 1NN0A 5C1DA 5F1PA 1YS2X 3QHPA 2Y6UA 3VR3A 2FW9A 2YASA 3GX1A 2HHJA 3GRFA 3LDHA 2DEUA 5JAPA 4ZAVA 3T3EA 1IZ9A 2PWAA 5C3UA 4JVOA 4DANA 2WWYA 3GRUA 1NI4A 2EBUA 1FTWA 1I3MA 3EDOA 3HE3A 1UDCA 1Z8HA 3OG9A 5FTLA 4COOA 1IN5A 1G8SA 2E5FA 3CX6A 4KKVA 4EHIA 4BHTA 4JBLA 1GNPA 1MPXA 4W9MC 1R0RE 3NAMA 3RU3A 4U2EA 3N70A 4MULA 1YXMA 4RPIA 4C4YA 2VA8A 2IZ1A 3BWVA 2WMNB 4H3SA 1EWYA 1UFVA 2CXUA 2MU1A 5ALSA 1DAIA 1PVDA 3TRIA 3A6HA 1F8GA 1RAAA 3Q12A 3WGUA 2G28A 3NRBA 3RF7A 3EVEA 4UZFA 2BEUA 1C9KA 3KOZA 4YJKA 3FYTA 3JD4A 3QOYA 3JYQA 5D3MB 2PRIA 4N5HX 2LCQA 4CTJA 4LHYA 3H6GA 2HJ9A 4HRVA 4RYDA 5ILOA 3KKLA 3SZUA 2QIOA 3PJFA 2J59A 4CHTA 5C1IA 1KSJA 5CX4A 4OHCA 4D45A 1U0FA 2XMCA 1J90A 1NIPA 1R5BA 3E6AA 3QUQA 2R4QA 3V8PA 5CCBA 4US2R 5EESA 1ZMBA 4FOTA 3TBHA 4QXAA 3AVTA 3G2LA 2AN5A 1SHUX 2JI9A 3ANTA 1PYDA 2VT2A 1B1AA 3IOYA 1EU1A 3C87A 3F7OA 3Q3EA 1HL7A 1OTHA 3JYPA 3FA2A 3P2YA 4OYHA 1OFGA 2C5BA 2O8DB 2AZDA 3N5CA 2H52A 1ODIA 1FNDA 1Y34E 4R9UC 5ECYA 3MXTA 3I01A 1F5SA 3KTAB 3NIWA 3OLCX 2FK7A 4NJMA 5HW0A 3BXZA 1S2MA 4UMDA 5TF0A 4P4SA 2HO5A 2XXJA 4DY4A 2JIRA 2V6MA 3JD1A 5B3AA 5HUQA 1F20A 5GIOE 5AJYA 1E5DA 1WLSA 2RGAA 1NC1A 4F8EA 4G5SA 4GM0A 3LDFA 3ID6C 1D2NA 1O94A 4E1AA 3TE7A 1J9EA 1V4NA 3BH7A 5IMSA 3K5IA 2IYEA 3L8YA 3PC4A 3NOVA 5FUQA 2B8TA 3PU6A 2V6FA 1UPAA 4V1CB 4GX2A 1SVNA 4TTSA 3QVTA 4DMHA 1GPYA 5E6RB 2WJYA 4TSRA 2Z30A 3WLQA 1RZ3A 2FPOA 1MB2A 3FZNA 1PJ3A 4BQEA 5EUBA 3D6AA 3FPJA 3DE3X 4TLBA 1BQ4A 1JQLB 1L3CA 3GLUA 5EWJA 3URMA 2B8NA 3Q5GA 4GE3A 4X8LA 3PFBA 1EZ4A 2GD0A 3NM4A 3PS9A 3INRA 4R5HA 1UK7A 3H9EO 1PEAA 2OHJA 3ZHBA 2IX3A 2C4HA 2D3WA 5BSMA 5A5DA 2C88A 2WM9B 1W6UA 3EBOA 3HXTA 4ROTA 4YAEA 1OH8A 3NWPA 5LA6F 4V0ME 3USCS 4C5AA 4CKWA 1XFDA 3T3HA 1RQ2A 3QTBA 5DT9A 3V2GA 2FPSA 4II3A 1SD1A 4V38A 1ZCZA 2D5BA 3CJTA 4JC0A 3T5TA 4IH1A 2ACEA 4JLMA 4BNDB 1L3BA 2ZEJA 4S35A 4DG8A 3TZKA 1UOPA 3HKCB 3L7LA 4X71A 2MOKA 3T3GA 4WVLA 1IXZA 1CY2A 3MQ2A 2HSDA 3F7NA 3CUYA 4X20A 3MUEA 5KX5F 1PZNA 4FNMA 3M4XA 5E9AA 3ZYCA 3TZ6A 3HYTA 3S5JA 2XKAA 4AWXA 4MCAA 5IU6A 3PEVA 4OB7A 1O08A 1XMSA 3AEZA 3ZCRA 5COAA 3F90A 2NUAB 4V0KA 4B4VA 2QVGA 4FSDA 1DAKA 3NHJA 2B61A 3VNSA 4NIMA 4ILEA 2HRQA 4XDZA 3VR5A 4KWEA 2RGCA 3CBGA 4DA9A 4YIHA 4EFMA 3DFIA 4RPLA 3WIUA 1L8XA 4BLRA 4F1KA 3SMQA 2QT1A 5F7OA 5EEGA 3E15A 2XQKA 2OPBA 3M33A 5KMGA 2IZ6A 3QI2A 1I1OA 3CF4G 3U7HB 1DEXA 4C03A 3GP5A 2IS1A 1Q0TA 5COBA 4KH0A 4L6AA 4WGFA 1V6SA 1WQ3A 5DYIA 3UKOA 4U5XA 3IIEA 4LDJA 3VOSA 5EIEA 1P7YA 3SR3A 1QCDA 3N5KA 4LVCA 5AXAA 1R6DA 1FMLA 3ENWA 4BRUA 1PZXA 1ID1A 4NTZA 4P93A 1EFPB 4TWAA 5BVGA 2VFAA 2ZI4A 1DTEA 2FPMA 4IDGA 4BN0A 5KQLA 5FBHA 2Z2KA 4GM4A 1OFHA 4OHPA 5BSFA 4EI8A 4OP3A 5T5QA 4MZXA 1ORWA 2Q21A 2R00A 1S4MA 1PJRA 1QQ6A 1V2HE 2E6UX 1GV0A 1GFZA 1LPMA 2JL1A 4PRZA 3DR3A 4W5NA 5E7QA 3IJEB 3NHFA 1XN4A 2NSHA 2Q2QA 3LIPA 4JLVA 1Y6FA 2WE7A 4BGIA 3I42A 4WKNA 3VMFA 4LZAA 3CKKA 3IDAA 4UXHA 4ISBA 3GH1A 2ZTUA 3UUWA 3VU9A 1KEEB 1KPHA 2VA9A 5AOAA 2OO7A 1ZGAA 3LNCA 1KY5A 1KYVA 2HADA 4AZTA 2ZJZA 1TCUA 5AVTA 2P40A 4Y1GA 3QXHA 3RPEA 1VRVA 4XSVA 1Y3AA 5DK6A 4AT1A 1KVUA 3RSSA 4PG6A 2I3AA 4CYMA 1NBHA 2Q07A 3MTDA 1JEQA 2EX1A 3O2JA 3LHIA 3OZSA 3LT4A 5DV9A 5AI9A 4HGNA 4TS3A 1J8DA 3DAFA 4J1TA 4YRPA 4X91A 4KR9A 2DGDA 2QUJA 3CO5A 3L5OA 1SU6A 2DBYA 2AD1A 2Y4OA 3OT5A 4QYIA 4XYMA 4YNBA 2QD3A 5GOZA 3M6VA 3GLIB 1FW8A 3L6CA 5FYDA 1ESMA 1SB9A 2WU3A 3RSHA 2WVJA 3KKKA 3O4HA 4CV2A 3H3XA 3WJ7A 5REQB 2GKSA 1JIJA 2J9FA 4GLOA 2YY6A 2A9OA 2MYNA 3WLSA 4CM3A 1Z38A 3X3HA 1MABB 3C3DA 4OI1A 2P3QA 1IUNA 3TG2A 3GFGA 1R0BA 8ADHA 4BZPA 3GRRA 1E1RD 4FKZA 2IOFA