3NCTA

X-ray crystal structure of the bacterial conjugation factor psib, a negative regulator of reca
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
LNVLQTMNAQEYEDIRAAGSDERRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQVQRRFASEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein psiB
publication title X-ray crystal structure of the bacterial conjugation factor PsiB, a negative regulator of RecA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein, chaperone
total genus 40
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06290 PsiB Plasmid SOS inhibition protein (PsiB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nctA00
3NCTA
chains in the Genus database with same CATH superfamily
2QYHA 3H04A 1IY8A 3ILXA 5E1DA 3I34X 1XV5A 4NFSA 2AJCA 1HH4A 1I33A 1LPMA 3QUSA 3TQCA 4URVR 3GFVA 2XNDA 4WY2A 3SX2A 4BFLA 1IBKB 2MR6A 1F0PA 2AR7A 1M6HA 3ANMA 4R8KA 3OOWA 4U0JA 4LPKA 3D3KA 1A5TA 2DFKB 5CIYA 1CJTC 1XZBA 4IDHA 4JMLA 3WMEA 3I9MA 4QHTA 2A33A 2X4IA 3VJRA 3E9EA 4X1YA 4RVGA 5T4BA 4EYEA 2C31A 3H65A 2DHEA 4F91B 1GL9B 2ZSUA 4FZVA 3KQKA 3A1CA 3DE3X 5U9CA 2DKOA 1J8MF 2CNLA 2FSVA 2AN4A 5EI5A 4BRZA 4RTRA 1T9GR 3UIEA 5GZ1A 5I8WA 1BA2A 4N40A 2CKDA 4EM6A 3WGIA 1EJ0A 2IUEA 4WZAB 1B7GO 3A06A 3H2HA 5C1IA 1Q3HA 1J07A 1OREA 2VPPA 3KZOA 1H1LA 4OHZA 3VKFA 5BT8A 5JJKA 1JW9B 3WR5A 3W04A 3AYZB 5BWMA 4DSUA 3E7WA 2E89A 1ZVJA 2ZIXA 3CX6A 4A82A 5I4BA 2IHVA 1KJ8A 2BPOA 3NOVA 3H18A 1RPAA 3VR6H 4ZHQB 1T29A 1ZS9A 1F8XA 5B6PA 2YXPX 4KBGA 4MHSA 1PL8A 1A8QA 1QR6A 4BWVA 1NBMD 2YYYA 4PG4A 4PYKA 4UAUA 3W6OA 4LJRA 1U65A 3UBTA 4E46A 2RHOA 5DRTA 3AEUB 1CNEA 1ZUHA 3GUVA 2OBFA 1C8LA 2OXIA 1NXVA 3SLGA 2HJHA 1VM6A 2BE7A 1NXWA 1CZLA 1QYXA 1SN7A 3DV9A 3KWJA 4R8RA 1S0UA 2BW0A 4MDHA 2R2GA 2D4HA 1N6PA 2PKWA 2HHHB 3CKMA 1NUAA 3RYHA 3LHKA 4I9NA 5LBTA 1I51A 1DBWA 1FYDA 1AKTA 4EHBA 5JSQA 4K6KA 1IY9A 4NLLA 3PKJA 1E61A 3ASUA 4W5JA 3TCXB 2GEFA 4P3XA 4EEXA 5LWQA 3GV0A 4NMXB 3NTQA 4ERXA 4EKIA 4X71A 3QKSB 5AKLA 1EDZA 3IV9A 3DR3A 3DAFA 2XY4A 4FD2A 3RVSA 2OOKA 3PC2A 4Y18A 1Q84A 1N57A 5ALWA 2B83A 3P71T 3R7NA 4G0MA 4DF3A 2OXFA 4CG1A 4OK6A 2PFGA 5AVVA 1M2KA 3QLJA 1ORDA 1Y81A 4IDOA 2JFZA 1NXXA 1YGYA 2PV0A 1NM5A 3QLUC 2QLBA 4ESHA 2ODBA 1W96A 2P8SA 2JLCA 4Q9JA 3CXUA 1K66A 4PC2A 1M10A 2VSNA 3W1WA 1M66A 4PCAA 5IAGA 1TJYA 4RESA 3RWOA 4CIWA 2W6NA 2PXAA 4JYZA 3HLTA 3BFJA 4LYDA 2OCIA 2WU0A 4TL7A 3UEOA 4ZAFA 2R6ZA 5JAZA 4CQLB 3OKPA 2FHSA 1HLGA 5K8LA 3NLLA 5J63A 1WUHS 2A0UA 4BMSA 4PLGA 3QMMA 4AS2A 1PT6A 1YS6A 4H1HA 1A1SA 1D8TA 3F97A 3DEAA 2JANA 2Y0PA 1POXA 1OT3A 1WF3A 1YRYE 4OXXA 4OH7A 5ALKA 3SIPA 2JLXA 3BK7A 2XRMA 1WD7A 1H8EA 4B81A 3GJSA 4QLBA 3GJ6A 4OJYA 4G9EA 1U8XX 4JJ8A 3KU4A 2CWDA 1YDMA 3I6BA 3EMDA 2HFJA 3BICA 1FE8A 4CMIA 5CT9A 5BOVA 4PFKA 2CE2X 4HUJA 1HFWA 4M1OA 1PEKE 3OX1A 2N46A 4D92A 1F0YA 3TBKA 1EVKA 3MMPA 2IP2A 1KSHA 1I2DA 3FPEA 1QNLA 2QQGA 3DL7A 4X6UA 3VI3B 1G8AA 4BC1A 4DILA 1WCXA 1ZJZA 4BL5A 1W7AA 2CV2A 1V7QA 3L1HA 2COEA 4F0JA 2EKLA 4LYYA 1SKBA 2HA4A 3GLTA 3N9IA 4TTVA 3N7UA 1XSEA 3FCYA 3QFSA 2DY1A 1FX1A 3V4FA 4OSEA 5J58A 1I24A 4D4JA 3LUKA 2W6OA 3TVDA 1GAQA 2WA1A 1KJIA 2ZATA 2ONJA 1K27A 5K0NA 2ACVA 3J81k 1QZ3A 4FJ2A 1L4HA 2FPGA 2RGNC 2WUFA 5BN5B 2CV0A 3AUKA 4IV5A 5KPDA 4KNYA 1MVNA 4KQJA 1FDWA 1GPJA 3RSQA 1YQQA 3V34A 2AHRA 3TB6A 1E2DA 4P92A 2YRFA 1XZCA 3O75A 2FUNB 4QL3A 3F9RA 2HMWA 3WIOA 3UO8B 4KN9S 5K2OA 3YASA 1CKEA 3KZXA 5E1OA 2E5FA 1TJ5A 1F38A 1P5RA 1XJWA 1G20A 3K0AA 2YIDA 3WFIA 1K5GA 1TLLA 4PTLA 2YXBA 3D5EA 3DAHA 2ZBDA 3HU3A 4YP9A 4K8RB 5KU1A 5GY7A 1C2YA 5A5FA 1EXWA 2QVCA 1FLDA 2J09A 1P3DA 1PJRA 1SXGA 2KWIA 3II6X 4R2MA 1QVAA 2QNIA 4I8DA 4CL3A 5T64A 3LPDA 1AN9A 1ND5A 3LQFA 4M9UA 4BX9A 4NS4A 3NJ4A 1DPGA 4IIEA 1YD7A 3F6RA 4NEGA 3FMOB 4U8HA 1XROA 2QU7A 4GPD1 4KC0A 3VNBA 4DPMA 4EG7A 5BNWA 4RA6B 3L41A 1M6WA 2I4NA 4XVRA 2HWWA 2IYPA 5JAQA 4CKBB 5BUSA 2B8WA 1KK0A 4D8TA 1XRPA 4E09A 4Q7MB 4RF4A 4OP2A 1GU0A 1XDDA 3CQ9A 3WQRA 1HDCA 4DADA 2Z4TA 4AX4A 1J2UA 3DBVO 5CEJA 2IE8A 5IASA 4PAOA 4L0CA 4RZ2A 3SFZA 2P9YA 2FWRA 4GD3Q 5KEIA 2HSJA 3K35A 3HSSA 3PUJA 1G5HA 1XJ5A 4Z9FA 1KAQA 3AVOA 1KK1A 3KQOA 4IY1A 3NHUA 3W6NA 4DWJA 4II2A 1YJXA 2AKAB 2AK3A 2AFRA 5CTAA 3NIFB 4PGMA 3WK4A 4XGRA 4EITA 4OXKA 2QAGA 2XQVA 1XEFA 5A3QA 3KDPA 4OHPA 3NNNA 3MJVA 1YBHA 1YZFA 1T2DA 4EGFA 3TAHA 4NYMR 3RIMA 3TOXA 5KNLA 4U2KA 5LQJA 1ZEMA 2IXDA 3LXMA 4CL2A 4MWBA 1QQTA 2AG8A 3ESDA 3OVMA 4KWCA 2RGAA 3DAPA 3N2IA 5REQB 4MP3A 2YJNA 5T3YA 1QMGA 4GBED 4IIHA 2GFIA 4G4SP 1WKCA 3L07A 4D9IA 3QUAA 2DBVO 3NTXA 4NIMA 1T36B 1Q20A 2JLBA 2PTGA 3DONA 4P4NA 4JJ4A 1UMDB 1V3VA 1WXHA 2AMLA 4UNNA 3A4VA 3F73A 1DAMA 1VIDA 3NGLA 5EGSA 2Q3JA 2W6CX 4OOEA 3UV6A 3HB0A 2HN9A 3QEJA 3FDIA 5DM60 3HFJA 2JIPA 5KJCA 1SBTA 3QVOA 2J85A 2G80A 4J03A 1O0BA 1GD1O 4IHQA 3KDSE 1QIDA 1K2WA 1P6UA 4ZO6A 5L53A 1T8YA 1L1FA 5B3JC 2C9MA 1JBQA 1JJVA 2PVPA 2VHQA 4YYZA 1CLEA 4BPRA 3ABOB 4ZCPA 5TR9A 4A0GA 3RG8A 5JJBA 3SQXA 3Q41A 3UWSA 4CQMA 4DNPA 1M2FA 1E8DA 1KH1A 1YZVA 2O1EA 5IKEA 3HHPA 1V8ZA 3TG2A 5TQVA 4A7PA 3VKWA 5EJ4A 2ZVPX 1MB2A 4C43A 1JKMA 2ZR9A 4IOJA 4JCOA 3LPAA 2UVPB 4L0QA 4Q1FA 5AW0A 3NPAA 3W2FA 1ZSYA 2OFFA 1RYEA 2JI7A 3SKYA 4OGKA 3T0IA 2MSKA 3BAZA 1YBFA 4J3FA 3F7NA 4J94A 3UOWA 4ZK6A 2H8KA 4ZKDA 2OK8A 1FW8A 1K8XB 2O06A 5H4HA 2XNSA 2QM8A 7YASA 4LTDA 4M55A 5HA5A 2GJAA 3F46A 3X1MA 1DBQA 4Z0NA 3WDKA 3DOJA 1OTXA 4AM8A 4BP9A 3IOYA 3CUEF 2I2XB 4ZO9A 1UBJS 5JZOA 4L72A 1QLHA 4ZVNA 4B6OA 3IR6A 1Y4SA 3ABSB 3KT8A 4C0XA 1TEXA 3I05A 4D0SA 2ANCA 3CH6A 1DOHA 5A4DA 1RHRA 1EVEA 1WUYA 4WK6A 3RTCA 2F4VB 8ATCA 2PWYA 1LDBA 5GGYA 4YRAA 5GVSA 3DBRA 1AHHA 4P0PB 5HUJA 5ITVA 4DJEC 5LIRA 1IWBB 3IVRA 5D5QA 2ONZA 5FPTA 1W5FA 3TD6A 1AF7A 2V96A 2ZJBA 1DEAA 4UFPA 1UZAA 1ENYA 4ARUA 1XELA 2XVMA 2I65A 2I9KA 1JMKC 1ORHA 3HI6A 2PYIA 1SCIA 2BI4A 2P4QA 16PKA 3CLTD 4BX2A 1IJEA 1IMOA 5G0WA 3URKA 1OV6A 2XLBA 1XC7A 4G5YA 1HMPA 4RM2A 3BB1A 1R4NB 1LBQA 1KDTA 5D7BA 3ED1A 1F4LA 2AS0A 1WV0A 3NR2A 5AMXA 1RQXA 4MIKA 4N7BA 4D5GA 4RHUA 5JMPA 2WAXA 2VPWA 4FEAA 4ZOLA 3T54A 4QASA 3ISTA 1KXZA 4WLNA 1GUZA 2D1RA 3SE0A 5DASA 4EDFA 3HCFA 5H3HA 4L78A 5LXTA 2NYVA 2J0EA 4UW9A 4ZALA 4G0PA 3U1BA 1TC1A 1US8B 2D5BA 2YWHA 3KXPA 4RZ3A 1G21B 4YACA 1K7CA 3FNQA 4EG5A 5CDTA 1CY1A 3DHVA 2WFAA 2RMKA 5ALJA 3C4VA 3EGIA 1Z8FA 2GXSA 5EZ5A 4GE3A 2PX8A 1HDGO 2IPLA 1VA5A 1YZLA 3R8XA 3A4LA 1SHZA 1U9ZA 3WISA 4EKDA 1U94A 2IBTA 3ETHA 2QHXA 5IJWA 1BXZA 2GZDA 4YWHA 1QCYA 3DMHA 4ALJA 2W2PA 4NDAA 4FMDB 3RVDA 5FWNA 3AM3A 4EUFA 1ZRNA 1NJSA 3L6UA 2ZI9A 2JLAA 5IFKA 1U63A 3MIIA 4B47A 2YOFA 4RH1A 3V4PB 3OQIA 1GV1A 4NABA 1EFUA 5IXJA 1TK9A 6YASA 1H2YA 5B57C 2G9UA 1E2NA 2AOUB 2V0NA 3CVJA 4W1SA 4OHYA 2Y1GA 2I9PA 3NRJA 1FUYB 1WY7A 5FB3A 5JNVA 1Y4UA 2FPKA 3OZEA 5EJ9A 5HNKA 3NNSA 3IBGA 1NI4B 3NP9A 3WSWA 2W98A 2TS1A 1BHO1 1T1IA 3HJHA 1E2FA 2CMHA 2EWVA 4IUBS 4MROA 5I9BA 2WV9A 1JAZA 4O63O 4UULA 3T7IA 3MRXA 1OAKA 3GZNA 3OC0A 3GJ7A 3Q3GE 4KHZA 4QGHA 4RIIA 1YVPA 2HU8A 2ZZKA 3QF4A 2RKBA 4UEJA 1A04A 2G1UA 2Q2WA 1RAGA 1E2PA 3PX3A 5HK8A 3B3QA 1UBRS 1ZN2A 2PS9A 4NPCA 4ETIA 4EJSA 4FM9A 5BQXA 3KZKA 2QAJA 3K9LA 3R3XA 1OTYA 3S5JA 3MHTA 2VDKB 1FRVA 4HQ0A 2NO1A 2GILA 3W06A 4BRSA 1YCHA 1G5IA 4KMSA 4PFJA 1UBUS 3IRVA 1R4MA 4J3NA 2IEDA 3SXUB 1TIKA 3OQNA 5CHYA 3MJFA 1MX3A 5BVHB 2QRLA 5DW0A 4S04A 2BM0A 1QQ6A 4QBTA 1MEJA 4PO3X 1CQXA 1FU8A 5K3AA 3SSMA 2WJVA 4ZCTA 2DT8A 4PZLA 2M6SA 1IN4A 4JI1B 2AD1A 4HUQB 4M7OA 4HPWA 3JD1A 5K3EA 1V0JA 1W46A 3BXXA 1R6UA 1XQVA 3IBYA 4B71A 4YRIA 4YONB 4D74A 4EQ6A 3AT1A 2IV3A 1NYRA 2UUOA 2ZYDA 1RSZA 2XA1A 4RSMA 1HRKA 1GARA 5GM1A 3SZ3A 3SYKA 1BGVA 4B32A 4D6XA 1TPYA 3MNFA 1GEGA 4P54A 1Z8HA 5LFAA 4TKVB 4RELA 4AIRA 2VYFA 1FCJA 1G6HA 1LH0A 4M7PA 4KRFA 1DJMA 1C3JA 2Q28A 5DEOA 1CVIA 1QH1B 2I78A 3ITKA 5G4KB 1F4PA 2RGXA 1MPXA 4FC7A 1N25A 2W2QA 1MJGA 2QTFA 3H1FA 3LDAA 3OE4A 3BMOA 4LNUA 4LQDA 4DDUA 2ZUVA 3D0KA 2N47A 1RJ9B 4OV6B 1M1NA 1T0JB 1F2VA 3BWDD 5HZGA 1PL0A 4GMGA 1JT2A 1UQRA 4AY6A 3Q6MA 5SYAA 4A8PA 1WS6A 4O2RA 3IQFA 4GRIA 1TZKA 4L1KA 6LDHA 2VAVA 4FYXA 4KQWA 4YECA 1XTPA 2XHEA 4GVXA 4O3MA 2P8JA 2VDOB 2ZYRA 4JX9A 4P08A 1YQ9A 2ORVA 2PZJA 1WLSA 3L8MA 1XU9A 4JLJA 2F1HA 3UFBA 1EG7A 1ZUIA 4IHJB 3WBFA 4MDEA 3UAZA 1Q92A 4WT7A 3EGXA 5COAA 2R1TB 2PLAA 1IK4A 2XB4A 5C46F 1RABA 2ZDGA 1BVHA 3INNA 1E89A 1PR3A 4L5JA 4NONA 3SK0A 3S70A 4REQA 8GPBA 3ENKA 1GZUA 4BZQA 1SQ0A 1XZIA 3MRVA 2OGSA 3OTHA 4Z4FA 3UCEA 3UGQA 1TRKA 3IBFA 4H6XA 1WX1A 3MEQA 4XCQA 1SMKA 2OR3A 3DPIA 1P5ZB 3HDTA 4KUGA 3RSLA 1L5OA 3UF0A 5AUNB 1D2EA 3RVRA 3VR3A 4Z9YA 4EELA 3EUWA 3AY0A 1H4QA 4Q12A 1CC1S 3H75A 4IILA 2DQYA 4JI0B 3THWB 3LU1A 3PUIA 2VWGA 3QA3E 2NVOA 4LRXA 2YWDA 1PUIA 3GBPA 3HP7A 3HFSA 2NGRA 4TV9B 1M5RA 3CIFA 1V11A 3I1IA 3L84A 4JYPA 2G5TA 4M0KA 1DPFA 2WU4A 1W0JA 2QTWB 2XUJA 3ESZA 4C3VA 1YFLA 2HADA 4MYSA 1AX9A 2VRBA 3FUWA 4NJEB 3W3ZB 3K94A 4OQQA 3OH8A 3KK0A 4RLSA 1B14A 5HJ5A 2XWJI 1GL6A 4F5ZA 3ORRA 4W9NC 5KJ6A 1JA1A 3V8NA 3VSDA 4UXHA 3Q11A 4D4GA 1E79A 4YQZA 2KMLA 4Q1BA 1SKMA 1SG0A 2PD4A 4KCGA 4ABYA 1U7UA 1Y7PA 2VBCA 1RMQA 4CKEA 2CZCA 3JVDA 1RXUA 2DFDA 1YHNA 3PQ2A 1JHOA 5HMMA 5F3DA 3TOVA 3ZDYB 4B7ZA 1PK8A 1NVUQ 2D1YA 2VT2A 3V8PA 4LY6A 1YE5A 3DGFC 2CXXA 3AVQA 3JAWB 4UNPA 1T9BA 3SCZA 4WZBA 5B53A 4KFRA 2M1XA 4HX5A 4V0KA 1O96B 4LSMA 4DVGA 3TTYA 1SG6A 2NTNA 3RU9A 3OMXA 1E2IA 2QK4A 3VMMA 1UOPA 2CL0X 2JBAB 2HRDA 5T4FA 4ETMA 1U0RA 5BPHA 3H9BA 3GPIA 4MQFA 4GBJA 1MH9A 4AJ1A 1M2VA 2OV4A 1AQLA 3TUJC 3F74A 2ZAGA 2CXQA 1ZONA 1HT1E 3WBKA 1MAVA 2EJTA 4WTOA 4LKRA 4LXTA 1CQZA 1NUHA 1MFPA 3D6NB 4QGAA 4N47A 3DMNA 3I0MA 2OC4A 4JSYA 4WBXC 4HLNA 5AVRA 4HJXA 2IYZA 1XA4A 3QBEA 4P31A 4BE9A 5C7OO 3C3YA 4FX5A 2QD2A 1NBIA 2EC5A 3MFQA 5HKKD 3O7WA 4WXYB 2ZRBA 4EI7A 3RIGA 3Q98A 4PZYA 4UCWA 4CM5A 2NNWB 1Q95A 2UAGA 3FWNA 4A0FA 1UK6A 1LPBB 3ESCA 1T6BY 2RAFA 3KOUA 2PJZA 3K92A 1W0JD 2E5WA 1KC3A 2XUFA 1EFKA 4P93A 1XDUA 3IESA 3K1YA 2VAMA 1BS1A 1XJ0A 3MWYW 5HRCA 4PLTA 3ROKA 3PIIA 1B15A 1XPJA 1XVVA 4OYRA 2FZGA 1W88B 3S8EA 3F9CA 4IS3A 3I92A 1AZWA 5I5GA 1E79D 1RAAA 3K5WA 3N74A 3CBQA 2EU8A 4WJKB 4DYHA 1VPLA 2IYYA 4RACA 5IJ9B 3NORA 2PUFA 3U7QB 1VGVA 2G6TA 2WJPA 4QTTB 3IMKA 4A2WA 5E2AA 4QU5A 4XVUA 3OCYA 1I3MA 2CW5A 1JILA 3SQWA 3TLCA 3WNVA 4BKMA 1NQUA 1V5EA 3A37A 3FAZA 4IINA 4NAHA 4G41A 4OBEA 3N2EA 2I4LA 4DMHA 3U3JA 2CD7A 5HUHA 1N4AA 2ECPA 2WTNA 3W6UA 3WRWA 3LLCA 3OZIA 3A4MA 2ORED 2Q2NA 2VVTA 4EY4A 2PLNA 1WXDA 3G0CA 1T2VA 1THTA 4XUGB 4YLEA 4TZTA 4OQYA 2C4HA 1RCFA 1AQJA 1Z4IA 5ALSA 3QG1A 3PK0A 1T0BA 3ZDXB 3FRHA 4B9EA 5L3QA 1XQ1A 2FFBA 1TQ8A 4Q19A 5CRIA 1KOLA 1UT6A 3ROEA 2VEOA 3WJAA 3VJKA 1RAEA 4NE2A 3OZWA 4O2BB 1N2CB 4YJ3B 4ZI3A 1NBEA 2C04A 3PFHA 3ELWA 5A5GA 4ZOLF 4BOYA 1S3SA 3G7NA 2Y1XA 4M8SA 4BV8A 4BNGA 5FFMA 4O4IA 2FY8A 5LXTF 4KLAA 5IYZB 3B2EA 2G06A 521PA 3JATB 2YFQA 1XALA 3W2GA 3ZDQA 3H17A 5AKIA 1N9KA 2GTPA 2LV8A 2PRJA 3P9NA 3RE1A 1UWKA 1QX3A 4UD2A 2Y92A 2PFSA 2YXLA 4D25A 1P0PA 3GY0A 5EIHA 1QLJA 1YNSA 1GSOA 1Z25A 4PZ0A 5G0VA 4L2IB 2OO7A 4HP8A 1NJ8A 2XMGA 3DZ8A 4I36A 2XUIA 1E5XA 3UHAA 2EBHX 3ZY2A 1GAXA 3S40A 1GTG1 2KW5A 3FWHA 4YR9A 3WAGA 1C3OA 1Q1GA 1LK7A 3VAYA 1NW7A 5BSTA 4AJNA 4OJKA 1I36A 3G5TA 3HKEB 3CZCA 2IU0A 1N6RA 4RIEA 3TNYA 5JS7A 1KAMA 2QD4A 1YSCA 3Q4GA 4JU8A 4BKUA 3B7WA 2POQX 3W5DA 3HXLA 2NTJA 3EVZA 1R6XA 2BP7B 4AC9A 1FTYA 4D9JA 2G63A 3CT4A 5JNRA 2QUAA 4IIVA 1KDYA 5I8PA 1XCBA 1A4RA 3BGOS 5J4VA 1L8LA 4W8HA 2WJHA 3VJLA 2E4AA 2Q3HA 3AF6A 1WU8A 1TZMA 2GHQA 2GPSA 3JYNA 5EYPB 3TWOA 4EHDA 3DKKA 4GOLD 5DLYA 1MCZA 2C61A 3FYHA 1ZNYA 3EC7A 1VCIA 3EXHB 2Y2UA 3ZDBA 3DEJA 1HR0B 3BD7A 3STYA 3HDGA 1AQYA 2C5FA 4IO1A 5IKOA 3H13A 5E3IA 1DU4A 1QS0B 3FDJA 4GQIA 3W34A 1Z2PX 2V54A 2GNOA 2QN3A 2E4YA 4M1WA 4UE2A 3G2QA 4KW7A 1KEVA 5C1BA 2BHTA 1HSZA 1MZVA 1RJGA 4GO1A 4KAXA 4RCZA 1ESNA 1JLMA 1U8UA 1G7CA 4X20B 3KCNA 2BHSA 1E62A 1ZAYA 4HFMA 4YRCA 3PT5A 2V7EA 1NI5A 3OJOA 3P2MA 1EGHA 2JK0A 4G84A 3KYCA 4O4HB 5FPYA 4H77A 4MRNA 4B5KA 2QRVB 3SICE 2AFHA 5LSAA 3WMRA 1VLQA 3I5UA 4JLVA 2BE9A 2H85A 3OOHA 4U4AA 5EJAA 1ZWLA 2CXNA 4LFCB 3WLSA 1PR2A 4UOEA 2A67A 1OBFO 4EUEA 3IVAA 4RHTA 4F9GA 2HOQA 4LYGA 4X24A 2QW8A 2VHUA 2H06A 3AJAA 4GPBA 4QPPA 5K01A 4ENWA 4J0FA 4V02A 4PSAA 1DJLA 3LZDA 5B4VA 2BFNA 2GZ1A 3OLCX 1QQ5A 4MI9A 1LNZA 4E5DA 2Q1UA 3CRVA 3QI2A 3AKEA 4QAQA 2YCBA 1PTKA 2G9QA 1F6WA 5DT2A 2PY6A 3L05A 2DUNA 1GTVA 5CNMA 4PYNA 3OOJA 3PEUA 5F4BA 3WJ7A 1B0PA 1N8TA 4CM9D 2O8BA 2IEIA 4K6FA 3JR3A 5A5VA 5B1SA 2R25B 2WNSA 2GBGA 1RHJA 2VXOA 3D31A 4I50B 4M53A 3CUTA 4TQGA 4UOQA 1FFWA 5F5LA 3NVMB 2XW6A 5LOVA 1TT7A 1KERA 4ZDIA 5LQRA 1XO1A 1E9VA 1ACJA 2ZUCA 3EG9A 2F3TA 2WZQA 3PQFA 4EI9A 1FJXA 2WHPA 3RYFA 1IE3A 1L4YA 5BQFA 3ACCA 4UHCA 3P1JA 4DIFA 2FSHA 3HXKA 3RNOA 5JFOA 4RF2A 2BFFB 1PJ3A 1VJ1A 3BJZA 2YWGA 3C98A 4KQ6A 4WECA 1OX5A 1YJQA 1N2CE 5DYIA 4UUMA 1G0OA 2P40A 2ZIWB 5BOSB 3IDSA 6CHYA 5IVIA 5THKA 1HQDA 5F35A 2H92A 3HVHA 3S1LA 3UVEA 4EI8A 1G6Q1 2NVWA 1URPA 3FKQA 1O8BA 2W8BB 4CODB 1XRNA 2VBGA 2LWIA 4RPJA 1JAXA 2PTHA 4GUAA 1NQOA 4GZ3A 3N2GB 2QENA 5DBHX 3OUTA 2RAPA 3E3NA 4DS3A 2EJUA 4I4TB 3U56A 4Z49A 2WOJA 3B5IA 1O77A 2BC9A 4P5EA 1QTIA 1H5UA 1VRWA 3GDOA 5C7LO 5KQPA 4DCTA 3FJ1A 2QX7A 3DDOA 3BD9A 3DLHA 1KAEA 1KY5A 5LWHA 2KB0A 5ELLA 1N77A 1Y1TA 2ZI6A 2DLNA 4FYYA 4TRRA 3GFQA 2ZSAA 3ESYA 4UAGA 1EFPB 4B8WA 3B52X 2Q9BA 3RSHA 1SUIA 3RVOA 3Q0TA 5HIAA 3BXHA 3GQBB 4EA8A 3P2KA 2JHPA 4GYWA 4OP3A 4QULA 3AR5A 3OPNA 1IVSA 2P6NA 2C7OA 1GN9A 3AHHA 1L5VA 1QDLB 3VBCA 3ZKWA 2EP8A 4NMWA 5LUAA 3IJ5A 1T6ZA 4BO2A 1YVRA 3VDMA 1RHQA 1ULSA 1XFAA 4QVKA 3HTXA 2VT6A 1Q57A 5HRAA 1ZU5A 4QHSA 2F1KA 1E58A 1ODJA 3COYA 1S3IA 1IUKA 5CEFA 4Z1MD 1U1GA 1OAOC 4HTAA 4U1RA 4PR0A 3T9BA 4BUJA 5C8DA 3PUXA 4EUSA 2R5WA 5BQ3A 1EVIA 2BSXA 3DF7A 1ZDMA 2B7BA 2RK6A 2QLMA 1T9GS 4IF4A 4DC0A 2HQBA 4G63A 1W2GA 2M32A 4C5AA 4Z4IA 3QX7A 2O8EA 4Y9SA 4ZOCA 2GEBA 3CLUD 2QE7A 3BMQB 1DEHA 3LGAA 3PHGA 1V48A 1Q19A 4D2IA 3I76A 3UH0A 1ZBQA 4EY8A 3U3DA 3M6LA 4XGNA 1ZWKA 1UBFA 4KEAA 2DWUA 1JXAA 2YRWA 5JJ5A 2ZS9A 2OVBA 4DA8A 3FGNA 3FOZA 4H16A 3MUFA 4WFIA 3G0GA 4JJGA 5EZYB 3ZY4A 1XRJA 4A16A 1CUVA 3B3FA 2V7XA 1ZZGA 2IUYA 3QWHA 1EQ2A 3IUBA 4QTYA 2J6BA 2A9FA 1C7FA 3IRUA 3NEYA 5AKEA 5THXA 1OH6A 2NUAB 3FLMA 5LB4A 3LBAA 1W5AA 1K6EA 4FINA 2IE0A 2CCKA 4RD3A 2NU6A 4WY5A 1E5VA 3ELBA 4ZD6A 1JEYB 1GRVA 2H08A 2F55A 3LBYA 3BUSA 5JNWA 1Z3IX 3SJAA 1HEYA 5F9HA 5JR3A 3PEFA 3THYA 3M4YA 4HDSA 5EHNA 1I4DD 4R83A 1RZRA 1LY1A 5F78A 2C20A 4A4DA 4OHUA 3NBAA 3MLAA 2H7VA 2QUJA 3KZVA 5CYOA 1XQ9A 2UZAA 3M9XA 4DLNA 3BQMB 5L45A 3LKDA 3H4MA 3U40A 5JHHB 3DC2A 3GIDA 1MZPA 2UDPA 2X2PA 1VHQA 4JODA 1QNFA 2EJWA 1LCIA 3LLVA 3R1IA 4M1YA 4WUVA 5I7WA 3KXLA 1NQAO 3TS1A 1K3FA 4BGEA 1UKCA 3UAYA 4D9FA 3AB3A 5LYYA 1Y3DE 1V3UA 3LSTA 4FGZA 5CAEA 5KTOA 4C0BA 4LF5B 2ARKA 5EIAA 4P7BA 2X19A 3H6KA 3T5TA 4F93B 1H23A 3AX6A 3G88A 2WF9A 4PC3A 1AQNA 4YUVA 3A70A 3QQPA 5EJFA 4EK9A 5LQKA 1XZDA 3L7BA 1WXIA 3CNLA 3OEYA 8ABPA 2FQQA 1Q50A 1OYWA 1HLFA 4P80A 5IT5A 6GPBA 3KV3O 4O4IF 2RFLA 3MXTA 5DF1A 3AHFA 1KO5A 1VBFA 2XOEA 2LD4A 4ND4A 3RWBA 2W00A 3WLMA 1ZK2A 1NJ1A 1ZZEA 1S1MA 3C1AA 3D8BA 3MTDA 4D45A 3P45A 1I7DA 1UP7A 5MN6A 1N36B 3GA7A 1P7PA 1U2GA 2PZMA 3JX9A 1GPKA 5KBYA 3CN9A 3D3WA 1UAAA 1KJWA 2GKGA 1UDRA 2X6TA 5FCDA 3OM9A 4AO8A 5BV0A 2JD0A 3D02A 1A69A 4RVOA 1YI1A 2DFNA 1L8QA 1RQRA 2Q5CA 2R1ZA 3FOAA 3GQVA 4YJHB 4B8YA 3BYZA 5I7EA 4AY3A 4KE6A 3C14C 4FMBB 4G0XA 5HEKA 2J9FA 1ZHOA 3LFHA 3JQFC 3B2QA 4Q7LA 3U4QB 4B84A 1NASA 4NAVA 1A97A 2YHBA 1AHIA 3CPJB 3NEJA 3LW7A 2DTDA 4I3HA 4E2WA 1YB4A 2O0MA 4HN4B 2IPXA 2OYSA 4UCFA 3K9WA 1AF4A 4KXXA 5F7OA 1KYTA 4G1FA 5J4LA 1IZZA 5HCUA 1OIWA 4DXAA 4D3FA 3AOEC 3I37X 3LVRE 2PUEA 3UJAA 4KR9A 1MT3A 1U99A 3B1FA 3B51X 4X7MA 4AMGA 4TROA 1SY7A 1PG5A 3C3EA 3UMMA 1EZ4A 2I2WA 1HKHA 1Z62A 2BLNA 2IEZA 2PZAA 2ZT8A 3QUQA 4O8CA 1UXJA 3TQTA 1KVSA 3F47A 4YRPA 5B1DA 1DAPA 3RREA 5EN4A 3VYWA 3BT7A 2ZXUA 1QE5A 5KTSA 3DH0A 2B21A 3GBSA 1F5SA 1ES9A 1E2KA 2HU5A 5E9QA 3DBHA 1X74A 4MPRA 1H8HA 5ED4A 4WMLA 4CM8A 2YJTD 3Q3EA 1AG9A 3I3SR 5FR1A 4JWKA 3MAAC 4F7DA 2SCUB 4CT0A 5EUCA 5SYMA 1XKQA 1DBVO 2YWEA 1H9CA 1IEWA 2I4IA 3SXPA 1IOZA 3V8RA 4F9TA 4P3OA 3RS2A 1VLHA 3TUIC 3U7IA 4PQRA 2GYVA 3A9TA 1G1AA 2CK3A 3N0VA 3OJCA 2ZJYA 4JQSA 4LY9A 5FV7A 4ER5A 1K08A 4YRZA 4EVRA 2XEDA 1GG5A 2ODNA 4UC0A 3LQYA 2NT3A 3P0IA 1RWOA 3I5XA 2UXCB 3W2IA 2DFTA 1XPRA 1TVKA 3IYLW 4QFCA 1E4EA 3EQ9A 4MAFA 3K6SB 4RD4A 1YHYA 2XAUA 4L4ZA 3WYAA 1LA2A 1U1DA 2DYKA 3N2NA 4TN1A 2F8LA 2JFNA 5FADA 3U26A 3DT9A 3I9LA 1XMJA 1IWOA 1FXUA 2OP0A 3H5TA 2MDTA 4G5SA 3JS5A 4HO1X 1TD9A 5BQPA 2H17A 2BM8A 2H2DA 5DVZA 3ZW7A 2RD2A 1I01A 4OUDB 2I2FA 4XDYA 1A8SA 3DMFA 3N05A 4P58A 4AKTA 3EWSA 4DHEA 2FCRA 7ABPA 1P39A 1C1XA 1X7XB 1AXGA 3OJFA 4UM9D 4EO4A 2YRXA 3HN7A 3Q8XB 5B2FA 4K9SA 1Y7TA 2IGBA 1W47A 2H5EA 4BIIA 2B6NA 4HEHA 3PC6A 4WL0A 1KJNA 3VHQA 4WKCA 5ECGC 1N0HA 2O50A 1XTUA 2XVZA 1XHLA 3M3HA 4YRDA 1HG0A 2V4ZA 4HTFB 1P17A 5LOVF 4LECA 2J6HA 3T35A 5JD4A 3W8DA 4C5BA 1F8FA 3EVBA 3OPXA 1ZNQO 2A5GA 3S68A 5JAUA 1USIA 5COBA 3VR4D 3WL6A 1E1CA 1TM2A 1NUSA 1V9LA 4MVJM 4OHMA 4BS9A 3IA2A 3LX4A 4XR4A 4E5NA 4LJ4A 2PUCA 2VYVD 1K7XB 1YS4A 3FPBA 1G60A 3UN1A 1ZUNA 5I47A 3NFRA 3C3WA 4KR6A 3KKOA 1H8HD 1OBVA 1ULUA 1L5WA 4GSKA 5AKKA 5EP4A 5JALA 2R5NA 3EC1A 4PG5A 3ONFA 1G8FA 2Q0XA 3GAMA 4GP9A 4LC9A 3RLIA 2XAAA 2ZAIA 3EASA 4XEHA 4WASA 3CW2A 1PNQA 3RF7A 2TECE 3K9CA 3AUJB 5HG0A 4YALA 3W9BA 2NZ8A 3T5PA 2G25A 1XQWA 4M1SA 4EGAA 3ZWQA 5BXYA 4H4CA 1ZQ9A 3VDRA 1DWQA 2CK3D 1XF1A 4TXLA 3PFGA 3NYQA 4BWYA 4UU7A 1P3JA 3THRA 5FUWA 3QBJA 3W3AH 4W1RA 1ZJJA 3V1NA 1M83A 2HRQA 5HPYB 5IVPA 1PDVA 3GCDA 3IQDB 3ZE0B 3RC2A 3SZUA 3EVDA 4BXOA 4L3WA 4N9QA 1VFPA 4HAWA 4PHTA 4DIMA 1IHDA 4LSGA 4Y7DA 5JXWA 3V4RA 4UM5A 1RBYA 1SR8A 2BCGY 3B2NA 3TLGA 1RLMA 1J9EA 3EQ2A 2FUG1 3AEKA 5ALHA 4EMUA 1O87A 2UYHA 3I1JA 2AI1A 3VJMA 2CZGA 4C76A 2Y8EA 1LTQA 1YDFA 4QYIB 3ZNPA 2EBWA 4DDVA 3R3SA 3UMJA 2DECA 2OUIA 1O6GA 1NW6A 4JYCA 4OUKX 5CXQA 1PRYA 3CNHA 2PKQO 1NVWQ 1TLFA 5HQJA 5KTTA 3KLMX 1S2IA 4FDUA 1EJ6A 2WNHA 1ST3A 3QU5A 3DVQX 3KEQA 5DNYB 4EG0A 5JI3E 3HWSA 5CA0B 1MX9A 2EJCA 4IM7A 5I5EA 1RJDA 2ZKIA 4FDVA 2XWSA 1HETA 2YKGA 4Q47A 4KFTA 3ZS9A 1O6ZA 1TYZA 1I5RA 4LVUA 4MS3A 4S1PA 2FF5A 2VF5X 4JLBA 1JFSA 2J08A 4HFNA 4G5GA 4KK4A 4TMTA 1VL0A 4YJ2A 1PJCA 2FQXA 3ABZA 3VVBA 3I73A 4DARA 5LYJB 2DKFA 2VHVA 2X7XA 5KSWB 2JASA 3WC4A 1F3LA 4OQDA 4PSKA 5JOQA 1JEOA 3A6FA 4HNGA 2YZ7A 3EH1A 1LX7A 3KS9A 1XZAA 4MK4A 4OX9Y 1P1RA 3WXBA 4F4HA 1M0SA 5A5DA 1U3CA 2ZRGA 2H2WA 1CD5A 3ET4A 4UHFA 3N58A 1QIKA 2A94A 1NLFA 2BFDB 1SU4A 4KNVA 1CNFA 4TWBA 3B1JA 2WG2A 4B1FA 5TNXA 2V7UA 5A03A 3LF1A 1KZYC 1BRTA 1E6UA 3EQ7A 4QRHA 2WB4A 2VQFB 3VUFA 1G8GA 4R2LA 1OIXA 5DM0A 2GCPA 1CS0A 2PSHA 3PNPA 2G8NA 3BK1A 4QQFA 5ECYA 3MRTA 1KIMA 4UZFA 3E6AA 3I9FA 5I6DA 3BF8A 3DZKA 1GL7A 3TZQA 5C4MA 3RU3A 1KWKA 4B8ZA 3Q6IA 1OFHA 1EIZA 4MDYA 4TKUB 1JHYA 2Y9PB 2GZRA 4CMGA 3ZGYA 4DAOA 1LU9A 2XEXA 4XDGA 1OWLA 1W59A 1XNGA 4LF4B 1N5RA 1UDWA 4PE5B 1C8BA 3TIFA 1NDUA 1KO8A 3BIWA 3L18A 4JJKA 4I5EA 1Y8QA 4N82A 4WADA 1ZITA 5C53B 4IW3B 4N8SA 1SB9A 1D2HA 4OEHA 1JG3A 3B5EA 4BQPA 2I2DA 2J3LA 1YKGA 2RCYA 5AVQA 2C2WA 4MNTA 3E5MA 4D6YA 1GR1A 4Y6RA 1NQ5A 2Z3WA 2BUAA 2F3QA 4XXHA 3E4DA 2PKXA 1SCBA 3LRPA 1C1DB 1UMCB 2AUNA 4MUKA 4RZIA 4UVDA 5K4AA 1HSOA 3SYNA 3O8OB 4K2HA 3RU7A 1ZD5A 3AVPA 1LBHA 4P5DA 3CY6A 2MINA 2FW7A 3IEIA 1V41E 3E7FA 3MGKA 1N6OA 3S0JA 3I9V6 4DKJA 5TT0A 1Y8AA 3A3OA 3CJTA 5CH3A 1S5PA 1Y5MA 2O59A 1IY2A 2PGJA 3K8ZA 5H16A 1P31A 5CB4A 1PEYA 1KSJA 1XZHA 3ZWBA 4TZ0A 4LRTB 4ROSA 1QZUA 4FFLA 2O2IA 4G25A 3FF4A 4OFXA 3RBVA 4RFSB 3OPQA 1OYVA 1JKJB 3Q7TA 3CF2A 1XRMA 4GKJB 1X70A 1C3LA 1W4AA 2A9RA 4Q9IA 3QENA 4IXDA 5JZVA 1YMUA 1EJBA 4G5QA 3ELYA 4C7MA 1HUQA 4MUAA 5HOQA 3L6EA 3E22B 1M34A 3SJZA 5CLLA 1DCTA 4TMZA 1FU7A 3GOHA 1J7JA 2W2LD 4IKEA 3QEKA 3ZXYA 2O19A 1E9DA 2FLWA 2CXRA 1L7DA 4HPJB 3L02A 4ZCIA 4F4CA 1W29A 3TX2A 4ARBA 4DG9A 1JQKA 4ER7A 4ZOEA 1W35A 3GUZA 1JG1A 3ZC3A 4BDSA 2YL2A 2QBYA 3EX7C 4DIEA 2RE8A 4JXKA 4MR9A 4HT3B 3Q6NA 2ZT7A 3WGVA 2D5CA 1BKDR 1ZOPA 4RD2A 4O4JB 1ZAKA 4LJLA 5K3BA 3HH8A 7MDHA 5LR6A 1NPYA 3E3OA 3F9IA 2ETVA 3BTVA 2ZUFA 1F2TA 1WAMA 3ADOA 3I01A 3HADA 4Y2SA 4EB6B 5HQ3A 1Y3IA 2H57A 3KHTA 1Z7BA 4ZMSA 4LY3A 4TWJA 3T99A 3DL0A 3QY0A 1W0KD 1O5OA 2H54A 2JFWA 2WF5A 4CCAA 2ZIUB 2CMFA 3P0HA 3RVNA 3SF0A 1TCBA 3I8OA 3Q9NA 1UFOA 1NYTA 1KFKB 3HL0A 1IG0A 1D8AA 1AU9A 2CZQA 5G2OA 3AGPA 1QP8A 2VP5A 4I4IA 1XT6A 3VTFA 3FYDA 1M0TA 1Y33E 2Y1FA 1JEAA 1N2JA 3SQMA 2P9CA 3DMGA 2OMEA 2PCLA 3HCOA 3DWGA 5DI9A 1ZNWA 2RG7A 2XWPA 3PXGA 3VO2A 1SQ6A 1CZKA 1U0TA 5IS2A 1RHMA 3ZS8A 1XXHA 2D06A 4LC1A 1ZUWA 4AKIA 1XK6A 3AK4A 3PNSA 4L08A 1JEEA 3W2TA 4IKOA 3WAJA 1NF2A 3KKKA 1VKJA 4CUJA 4IEIA 3Q40A 5B7NA 3BBLA 5GOZA 1AKMA 1SKUA 1C14A 2FN9A 4J0JA 2IHYA 5JG7A 1ZISA 3WB9A 4DT1B 3EY9A 4OHFA 1C8VB 4QD3A 5DIZA 4I4CA 4NBKA 2O7RA 1ZL0A 1QPBA 3MS2A 3RABA 2IV2X 4Z2AA 1BKSB 4R8LA 4LZWA 3QVMA 5CYFA 4TS3A 1A9XA 4QG3A 4C87A 1DDIA 1MHTA 3JVUA 3KCQA 4K9QA 1PFGA 4JLPA 1JBKA 2QVLA 3IXMA 3KEGA 3HPQA 4CHGA 2J31A 3A36A 3HQ4O 4Q3CA 4Z8YA 3E05A 1UIRA 1W5BA 1JECA 3HHEA 3LBHA 2XV1A 5KYNA 2WJGA 2QSZA 4BMPB 1JQAA 3SSOA 4DUGA 1DIBA 3AHGA 4F71A 3FX2A 2WRZA 1B0UA 4ZAGA 1T8SA 2X13A 5CCBA 4KMRA 4LOHA 4YS6A 2VRWA 1HXHA 2PL5A 4IIGA 4HYEA 5CG1A 2B9EA 3W4KA 3NRCA 3O74A 2WTEA 2XQFA 4C7KA 4NFHA 3UWPA 4TS4A 2GVNA 3CMCO 1OFIA 5A5EA 1KAHA 4HDNA 3EBLA 1U0SY 2K6GA 1L5FA 1MUUA 3HWWA 4GH5A 1T2UA 3CJRA 2WD7A 2ZSEA 3EZ2A 1X3SA 2VXCA 4LJKA 4DC1A 1GL3A 2E0IA 4WDRA 3EWAA 1JT9A 3VPCA 5J3JA 4BN5A 3LT0A 2X2FA 1FNCA 4ED9A 3BREA 4Y98A 4CV1A 2IX3A 4C4AA 1ECLA 2IEGA 2C8LA 3FHLA 3GNSA 3WLNA 2I87A 1PWXA 4BFYA 3AH8A 6NULA 4DABA 2IHBA 2XYGA 1Q6YA 1M2WA 3C5CA 3X0DA 1S2LA 2JJ8A 2B0CA 3CPHA 3EZLA 3LH5A 4BO5A 3NAMA 2X7HA 1QZTA 4Q39A 3WIBA 4A5OA 4D6PA 5IABA 5KSYA 2XNHA 3IKVA 5KYGA 5EUMA 1JALA 5AW4A 5KPJA 2X5NA 3RT9A 5JRZA 2C96A 2HYIC 2F8SA 5BRNA 5B58C 4FQ8A 2UUCB 5EXXA 4I1OA 1KOJA 4H18A 4IMJB 2WWVD 3RUFA 2GXUA 1CW2B 2VHXA 4HAZA 4DLSA 5JXGA 3OZUA 2ZVDA 3VNQA 1CRPA 5J47A 1J25A 2ZE8A 4CKWB 2J3QA 4JOSA 2VNIA 1SQ5A 4DR4B 2EJVA 4D5EA 3HB4X 3IAM1 5C5DA 1VMEA 2R79A 5D84A 4URUR 2VTKA 2GO7A 1YQEA 3L7OA 1RLTA 3LM8A 4H7PA 2X0RA 4MXDA 3FNBA 4MGHA 3VU1A 1NMQA 4EQZA 9LDBA 1H4SA 1SCJA 2NSHA 1YVDA 1MOQA 4FWIB 3B78A 4DUGD 3QLVA 1JR3D 2HT1A 1D2CA 3K20A 3GCGA 3ZY5A 2OENG 5FI3A 1BYIA 1NFFA 3FCOA 4U6SA 1WV1A 1UK7A 4B34A 2HEIA 4U63A 4PRZA 3AIKA 2Z5LA 1PUJA 3NWOA 4FSDA 1NE2A 3LVFO 4H59A 4KYIB 2CLMB 4JVMA 2Z58A 4TQUS 2CNKA 3LY5A 2IX9A 3CR3C 1NP7A 1B42A 2C9BA 4RJIA 3LX8A 1R74A 3BWMA 3O3CA 1JJFA 5EL0A 1XBTA 1NI3A 3LCCA 3NC0C 3BQNB 5J23A 1LW7A 1CZRA 1IEVA 2FX2A 3M2PA 2WIKA 3OJ0A 3QX8A 5IP5A 2ASVA 4HEA6 1AA6A 1XDGA 2AW3A 3CISA 3GJ4A 1X8LA 4Q3LA 4YJ2F 5EGNA 4MVJI 2DBZA 1CIPA 4DLXA 1SZCA 3UMGA 3W05A 1BD4A 2A0FA 3DMYA 3GT4A 4CLOA 4K9NA 5A9RA 3T34A 1F51E 1I0LA 3PS9A 1W75A 4KN5A 3ZCQA 2EOAA 1RRGA 2IU4A 3K6KA 1Y89A 2L17A 3QNWA 2C7BA 4PCUA 3OJLA 1LBIA 2IP4A 5B36A 4TTQA 3ZTWA 2CJFA 2JLRA 3WQHA 5EWMA 3ETEA 2MSCB 1QVZA 3AUXA 3IIIA 4JI4B 5JV5A 1EM6A 5DLEA 2PPLA 3UGJA 4RTLA 3DZFA 1CJKC 1SXJE 1C4WA 3A7EA 3ID6C 3DHYA 2BDEA 3PFKA 4PYIA 1QGUA 2FSPA 2PMKA 1SHJA 3C15C 3AF2A 1AVTA 4WE3A 2O52A 3A6DA 4IJWA 3N0WA 4RHEA 4BJ5A 1Z0IA 1GV0A 2HEGA 4ZIRA 2H2GA 4P35A 4CV2A 1I2MA 4AS1A 4GDFA 4F3TA 3Q2KA 1GYPA 1EVYA 3PC8C 4DV7B 1Z68A 4NQRA 3RSFA 4FFVA 1VZ3A 1D2NA 2YZMA 4W6ZA 3KKLA 2JAXA 5AJHA 3QRWA 3RV4A 1LI7A 1NQWA 4AKGA 3QV2A 3FN4A 2WQZA 3EXEA 5DTIA 2QUZA 4DLKA 2XCOA 3TR6A 3K0EA 3WB0A 1S8OA 4Y6PA 3UG6A 3L01A 1PZEA 3PUZA 3COJA 1LFAA 2YOHA 2WHXA 2WFMA 5C7IO 1PG2A 3LWBA 1DBRA 1PZHA 3VX4A 1PZNA 2QR5A 2GEUA 2UVDA 1YRHA 2A5JA 1WHSB 2C4NA 4QZVA 4HG2A 2ESRA 3U19A 1OXKB 3CYFA 3HNOA 3UK0A 3K1AA 2XBLA 2NO0A 4RW0A 2HIGA 3P9XA 5A4IS 3JD3A 1WF6A 2VPTA 1QG6A 3GCXA 3MMNA 4EKNB 5HE9A 3E53A 1UDXA 3NHPA 1WLYA 1EVJA 3BHMA 4EMTA 5AJZA 5ALYA 4PZAA 4KUHA 2QXYA 1ZOIA 3KQLA 3FHTA 5LIPA 3DOHA 5CB4F 1JPJA 2R48A 2I7XA 4HGQA 2B5WA 3QU9A 4M2LA 3DTVB 3FNEA 2OM2A 1ZCAA 1WRBA 2GNPA 2AD5A 2EQAA 1YBVA 2JAQA 1WP4A 2EBUA 2JB9A 1P61B 1V6SA 4DWVA 1EEHA 4X1IB 2H2AA 5CVUA 5SZKB 3CEHA 4EUKA 1VJRA 2BTQB 4FFBB 4V39A 1X7ZB 5DGCA 2NVUA 4FR2A 2XUGA 4IX1A 3ASZA 2RC5A 5FTJA 4I6JA 4BLOA 2HLDA 2FPWA 4TTIA 1QQAA 2VHTA 3RBZA 4AAYA 5BN3B 1BW9B 2GK6A 4PG6A 3E9ZA 3PXDA 4Y9DA 1TCAA 1JYFA 4G67A 3VNSA 1T2AA 3WFZA 1DKLA 3ADKA 1IJFA 5GADl 2G08A 2EYQA 3FPJA 1KH2A 4K26A 5BR7A 2CN1A 4TXHA 5HS6A 5C8XA 1FW6A 4QLOA 1W8IA 4QTZA 2CHUA 3IQXA 4P0TA 1CUAA 4AI6A 3S29A 3PV0A 5TF0A 3RS0A 2G71A 2IS6A 4F85A 3D6HA 2YQ4A 1TZJA 1W4LA 4U7WA 5DGHA 4GX0A 5CFMA 3RGWS 4QM7A 3WLFA 4EARA 1MC1A 4LQCA 1LNSA 2FU5C 2OC9A 3R6TA 2JH9A 3GJRA 2PBLA 4QE3A 4GW3A 3RYIB 1JHQA 1XA3A 4RA6A 4TMYA 4ENQA 4ALMA 4IZOA 1FYXA 3LT4A 4PX3A 4IFBA 4QJIA 3G2LA 1JVNA 1VYUA 3CUSA 3UATA 2AXNA 5KJ1A 1A50B 1Z4JA 4RFVA 2MCFA 1YI8A 1WY5A 2FEMA 4DMGA 5JEDA 5JLJA 2QPAA 4CMHA 4XX0B 4X9XA 1JDZA 4A5SA 3H99A 1XQXA 1ZP6A 1PVDA 2AOXA 3J7AC 1J99A 1VJCA 3DMPA 4ECAA 1NBAA 4YQEA 4CI0B 1Q14A 4HAUA 3VUEA 1ODTC 3KYIB 1JHMA 1SB8A 5CT6A 3B85A 3CM0A 5TT1A 1UJCA 2VJDA 1LBEA 4KIFA 3SKVA 2DH6A 3FCUB 2J6CA 2HGSA 3ENWA 2LIPA 3WB2A 4ITRC 5HCNA 3H5OA 4HB2A 4M1TA 5FUXA 3K53A 5I7FA 2QRKA 1T9CA 3RRBA 3IKMB 3VR5H 2HLDD 2YIVX 3JQBA 1KMNA 4JLSA 4JP2A 4DB2A 2MWMA 2I71A 4F2HA 4KIGA 4FQ5A 2BLLA 2XQKA 2RAUA 3ZTYA 2Z2IA 2C0QA 2VDPB 4FGJA 1CYEA 1KAGA 2IU6A 5BSHA 4H7JA 3OCXA 2YWBA 4HH1A 2XZLA 4B6SA 4LBZA 2ZBEA 3FFWA 4W4TA 1FA9A 2H59A 4OFWA 4KPFC 4ZZIA 3FETA 3MA0A 4JROA 3GDGA 4Z9XA 5FA6A 3GFSA 4B7UA 3HFGA 4NNOA 4MQEB 5IAKA 5FO1A 4RH0A 5L3ZA 4RIGA 2C9ZA 4HLUC 3QJ5A 2F43B 1FVHA 2CVPA 4IHAA 2YJ4A 3TVYA 1NPTO 2RGDA 2LKDA 2JDIA 5E9AA 1D4FA 4BATA 3ESAA 1YT5A 4CIAA 1YV9A 2P1DA 4P86A 1FLVA 3ENVA 2QYOA 1JZTA 3DPSA 3IFSA 4TSFD 3IE1A 3EHEA 3DFUA 4PRYA 2F90A 4Y6OA 1PSDA 5E95A 1GNVA 4PXSA 2QTTA 4LCJA 2JVIA 4R1OA 3WGNA 2D2EA 2DCUA 3WGYA 1YB6A 2Z8ZA 4NZPA 5TE9A 1FFAA 3NX4A 2NO6A 1Z4KA 3V1UA 3C7AA 4ACAA 3KB8A 1FQOA 1UBEA 4Y2UA 1J23A 2I3BA 2AG6A 2XCRB 4WD3A 4X91A 4Y9RA 4CLEA 5LJIA 1WNFA 2IOYA 2J5QA 3G6KA 1S7GA 5DN6A 1S89A 4O1IA 1C2TA 1J33A 1SOAA 4J0HA 4YMWA 3UK1A 3ER9A 3EFBA 3A9WA 3P9YA 1QRDA 3M6MD 2ZETA 5DGXA 5LBUA 4YCJA 1KJYA 5EJGA 4HX2A 4QJ5A 1EM8B 2FV8A 1LF5A 1G9XA 2PK3A 3I04M 4M8LA 3O8QA 2DH5A 4LJ8A 3W9UA 4D9HA 3BXFA 5C4IA 4L8YA 3PGKA 1PFVA 1FU4A 1HZZA 3JSXA 3O4VA 3OAAD 4LWPA 4OLBA 2VA8A 3D8SA 1V37A 3AC0A 1KMIY 4WZZA 3STXA 4UNRA 4MO9A 2RHRA 2HXGA 2IEYA 4CM3A 3ZI4A 1XEXA 3ZZTA 3MWDB 4AP6A 1NW3A 2P7IA 5ALIA 2I4MA 1GCGA 1QCCA 3HU1A 4PBTA 2PKRA 2FMXA 4BECA 1Q0LA 5DDIP 2HBRA 3BH6A 3WL7A 4UJ3A 2DHRA 2EWWA 1O4WA 1U8ZA 5FA5A 3ECSA 2YJ3A 1JHRA 1ZRSA 2BUCA 1GKLA 3HPRA 4OD0A 3FYSA 5DBIA 2NQ2C 3T5MA 1H2FA 4A91A 2C07A 3DW3X 1K9SA 1BCRB 4RGYA 1QU2A 2VNAA 5FT9A 2FRVA 4S0XA 4LDPA 2BFPA 4HB4A 4DZTA 2W83A 3DDSA 3TLJA 4WBNA 4Y2JA 1GGKA 4KV7A 2QQFA 5F51A 1IZ8A 3EEBA 4K9RA 4C14A 2PXHA 4DGQA 4S2EA 5LNK6 2L82A 3PA8A 1OX4A 4QYMA 4X94A 1O89A 2BMAA 4KO1S 4HDMA 1ABEA 1TGYA 2OMKA 2W2TA 1TMKA 3LSYA 2VZ0A 4YMTA 5I4KA 4AKHA 4G4SO 5DM2A 1US8A 3ER6A 5DX0A 3OZCA 1I4EB 1UK8A 4FONA 1B43A 2UZ1A 3E1GA 3OQBA 4O2LA 3AONB 1JV2B 2D5AA 2I67A 4Y0VA 2UXDB 1AK9A 1XK7A 3SHOA 2HI0A 5JIBA 2RK4A 1BEEA 4DPKA 2UZIR 4REOA 5DHSA 1K4MA 1SZJG 1SO8A 1VE3A 2VH1A 4JLDA 3GEGA 2OUKA 1UWCA 2X5XA 1DWUA 3NHFA 4NBUA 5KJFA 1KEKA 1X86B 4ARIA 4J7XA 1U11A 3GD5A 4KE9A 1KVUA 3EZXA 1CQIA 3KTFA 5FLYA 3C16C 2F1OA 2D3TA 2FDRA 2C2BA 2EIXA 1Y5NA 4KV9A 2H11A 5FI1B 1VMDA 2Q27A 2A1UA 1T13A 4FE3A 3WVNA 3H83A 1NLZA 2AC2A 3TTVA 4KH1A 5K1ZA 4IDPA 1EFTA 3Q12A 1EBBA 1SD5A 5KTKA 5E7JA 1JFVA 1QHXA 3IDZA 4YQFA 2Q1XA 3F2IA 3VHXA 1P91A 1DG3A 3HBNA 1D5WA 3O2QB 5IZCA 3EUAA 3E5HA 5CH5A 1X8KA 2IZZA 3NHLA 2Z8XA 1BXRB 4MV8A 1FYWA 4IJ6A 1KEEA 1MXHA 1FY2A 3CRRA 3ISVA 2XCSB 1ZD3A 2ZRCA 4G1MB 1AGNA 3U31A 3P9IA 2OXRA 3KQMA 5MGNA 1ZR2A 3IUJA 3MWGA 1Q5PA 2C9CA 1RYZA 3USZA 4EYQA 3G89A 5JNTA 1CUEA 3VNRA 4F3NA 2BKAA 5LZ8A 2JCBA 1AURA 1EINA 3SG0A 4BNDA 4AG3A 1X2BA 4H35A 2J3EA 1A27A 3N3AC 3ZJVA 4QEDA 1WZUA 5CT5A 1SPBS 1R0WA 1VKOA 1XDSA 2GPNA 2QTZA 3N2ZB 2ON6A 2A7XA 3RRMA 4R5MA 3IL2A 1AGXA 4ZYVA 4BMCA 3IEUA 4WNAB 1GQRA 3KVRA 2BM9A 4HZUA 1Q83A 4S3MA 2PMEA 4CN8A 1J5XA 4BQEA 4LNHA 4E7PA 4QUKA 4JS0A 2IDKA 1VL8A 1L1RA 5SY9A 3K5PA 1Y8RB 1E1LA 3WOHA 1XMQB 4GX1A 3LJKA 2WLTA 1XAGA 2J7PA 1XCPA 3U09A 4LG1A 4R2JA 4EKEA 3QU4A 1GKYA 1HDOA 4EGCB 1OFVA 5G4KA 3ELUA 2I91A 2XXAA 1E6KA 5KMGB 5TQ2B 3CRQA 2K5UA 1R66A 2BHLA 2H4XA 3EVCA 3NHMA 3Q3IA 5F77A 4NS1A 4C6TA 1PZXA 5EE5B 5BSVA 3USCS 2ZM5A 1TUBB 3AUAA 2ZTUA 4R8VA 2WSIA 2OB2A 4M1ZA 2H7CA 1M2HA 3D7KA 4W9RA 5HFNA 3SM9A 3JYLA 3T41A 3TTSA 4B7XA 4XRGA 2PQMA 2R8PA 4NSNA 3E7XA 3GXOA 1U9IA 3R5FA 2FG6C 3M33A 2HPAA 1N5KA 4RVFA 2WTXA 4BYMA 3OEHA 4RS3A 3ZWYA 3OWHA 2QNBA 1FJ2A 4PX5A 5AI9A 3JD4A 4R69A 4UPVA 1ODKA 3A3KA 4MI3A 5FRDA 2A0XA 3UHFA 2AZMA 1DL5A 2L0XA 3V8VA 3HLYA 4E94A 1MEEA 3SAJA 3HBLA 3RVQA 1MRZA 3OCCA 2Z9BA 3T06B 3BRQA 2NYRA 2E1RA 2QG4A 2VO1A 4YFYA 1LVGA 4XD7A 1NC3A 1X7YB 2O2ZA 3MJDA 1GFZA 1KMHA 5EE0A 2VXYA 5LZ7A 4JEIA 3WRYC 3H7AA 5B64A 1D6JA 1OLXA 1PV2A 1E7MA 2RBKA 3OZRA 2O5VA 2C59A 2WU8A 4MJLA 1XQYA 4C88A 5EXDA 1GPYA 3B6MA 1EHCA 1J09A 2OCLA 3ONEA 3AI1A 3WLRA 1PT5A 2F3RA 3EGWA 3CURA 2WIJA 1V39A 5F1PA 2AQ8A 2WAOA 2V0GA 2DTEA 4L5BA 4OO3A 4HWRA 3FCSB 4OKSA 4FOOA 3GOQA 1TT5A 1GZ3A 1UBKS 2B36A 2WAMA 2ZW9A 3DAOA 2JFUA 1SHTX 1P7CA 1Z0UA 1BMFA 2RK3A 4B43A 1AKUA 2IOQA 4C4YA 3HXMA 3P8ZA 4UEOA 3VTZA 1TCUA 4JSRA 1R12A 2V3VA 4DCMA 3UK2A 5HJ7A 2ZSBA 5KDLA 3ZVLA 1U8AA 1CETA 3LA8A 4GGMX 4GUDA 5CXUA 1PFKA 5KTYA 3U5TA 5AOAA 5KOHA 2NZXA 4LMRA 3FLBA 4BWGA 4AS3A 3DT6A 1QV6A 2YASA 4JBHA 2GPBA 2B9VA 1R3DA 1PWYE 1T5DX 1X1EA 1TFRA 2A2ZA 3H8SA 1SA0A 2VDLB 4MV5A 3MWEB 4MVJG 2BEWA 1SK8A 2C4VA 3DYBA 4IBOA 4AYXA 5DHPA 1CX9B 3BXPA 4AIIA 1RXYA 1KI6B 5FOQA 3OEHD 5JS2A 2XF2A 3QHPA 1P4RA 3BL8A 3O47A 4Y2TA 5K0SA 1WU7A 4PICA 4X61A 4XX1A 1DC6A 4J9UE 3NBZC 3U3RA 3V46A 4MGYR 4W5OA 3GEIA 1M7BA 1OH8A 5BSWA 5H68A 1U2TA 1GWNA 1MIHA 1Z26A 1E2EA 2CNDA 1Z5OA 2DULA 1PBNA 4M36A 3L7MA 4XD7D 4EO9A 5J43A 5JZBA 1KWGA 3JWGA 2J5XA 4DBLC 2ZBPA 3FOBA 4E0BA 1XP8A 4X8HA 3TQOA 2ZCJA 2GUWA 3V48A 4EFMA 2VJPA 1CQPA 2Y68A 1Q0HA 3OTIA 4Q9AA 4WGGA 4DV0B 3AVUA 3TW8B 1FDRA 4FDLA 2GK7A 2QX9A 4N49A 4RVCA 3SFTA 4EY5A 5EQDA 5CXXA 2H1VA 2YTZA 1OJLA 5I3ZA 3U7JA 4F5YA 3PEEA 5GAJA 3GH3A 2BISA 3RIYA 3IDAA 2A3NA 5C52B 3BFXA 4ILKA 4UBOA 3IOCA 4I4LA 4Z0HO 4F1JA 4WIAA 3ZGZA 3H5VA 1AGRA 2R68A 3HYNA 3ZUGA 2G4LA 1P4HA 2A57A 2NU7A 4C0KA 1IHYA 2P6OA 4HRVA 4XGQA 5LD2B 5IM4A 3G8DA 3OO1A 1HK7A 3QFTA 5TF4A 8AT1A 3QFHA 4TVSA 4G0UA 2OFOA 5JPCA 3MT0A 5ARDA 4E07A 1E5QA 3AVTA 2E7ZA 1Q7EA 3F67A 3IIKA 1R10A 2QP4A 2A84A 4ZQIA 1AT1A 4RDCA 4NDNE 3IUPA 4QBFA 5JWRA 4DDTA 1J0CA 2AYZA 2FSSA 3B3JA 3GLHA 4RWEA 5KZMB 2UXBB 4KWTA 1E7WA 3FMGA 1FQKA 4X1YB 3AQIA 3EDCA 5F4ZA 3KUXA 5AD1A 4BMOB 3CVUA 4Z7OB 2IY9A 1F5NA 2JJ2A 2VL7A 4N6OA 1FB5A 2R1VA 4UNQA 2ZJ0A 2QD5A 4WUTA 3WBBA 4D3YA 4CTNA 1OPRA 3M82A 5TDHA 1CEQA 2WM8A 2X6QA 1IIBA 5TJHA 1GA4A 4AJ9A 4CT4B 3AFHA 4DCJA 5K6RA 4DR5B 4D8UA 1GR0A 5C18A 5BR8B 1H1LB 1NRIA 1ZM9A 3EW7A 3ICPA 3AFNA 5ESXA 1SM4A 3BEDA 3MTIA 4NZZA 4WBNF 4ZZ3A 4GWKA 1SUWA 4BGUA 1P4GA 2ZIXB 4X41A 3A1VA 4Q3DA 2NV6A 2XGGA 4ESVA 3VTAA 1MAHA 4FHFA 3R3VA 1AN0A 1MV8A 3PXCX 4M6WB 4N0DA 3WO1A 1ZOLA 2FJUA 3PQ7A 2V7BA 4KDRA 4NFLA 4BO9A 2YYAA 4L8LA 3STVA 4OF4A 4UBIA 1P4SA 4NMMA 2V5AA 5AKYA 1X42A 3CWQA 1CIVA 3JYHA 2DRIA 2ZBVA 3ND8A 1RACA 1G55A 3K0CC 3M6UA 3AIOA 3PC7A 3S7ZA 4BNLA 3AM1A 1U7ZA 5AOVA 3FE2A 3V3TA 4BBJA 4DSNA 3FPCA 5KS2A 3RYHB 1CDDA 1DJQA 2G0NA 1ZH2A 4FMDF 5D85A 1ZX1A 4OBXA 5K5EA 2ZTVA 2CLKB 3ADPA 1L5YA 3NHZA 2ODAA 4RD1A 1G2PA 3L9WA 4IO0A 4PIVA 4PZPA 1SIOA 2XSZA 2VG8A 2BP7A 3RUPA 3PDJA 5IJZA 1C29B 1GNLA 2NQ8A 3AO0B 1GKUB 3D6JA 3ROXA 3TOCA 2HIAA 1U7TA 2EHJA 1ECPA 3OCUA 1KEWA 4LMPA 3M4JA 1AUQA 2JGDA 2EQBA 2YJ5A 2YV4A 4NZOA 1OGIA 5JWHA 2C97A 1SKYE 2X14A 2O57A 3EXHA 3TRKA 4YHHB 4V38A 4CLRB 4F04A 1FNBA 1XU4A 2R6DA 1X7HA 3U0BA 4KE8A 1A8IA 4IIBA 1NKVA 1R5NA 4K87A 2AX3A 3RYCB 1OH5A 1E2GA 3H2SA 3NBQA 2BKXA 4GMHA 2BGWA 1NF9A 3E61A 2QT9A 5JC1A 1IJBA 3T3EA 1XMOB 2EL9A 4BGVA 4H0FA 1G4HA 1EX6A 3BWEA 1ZGAA 5FPHA 1AS3A 3PPVA 4IDBA 3VVCA 3I4FA 1QTNA 2VQ6A 3WADA 2VWHA 3GEEA 1TEVA 3K32A 4C89A 1TKCA 1J8VA 5CB8A 2ODEA 4IS2A 1KZ6A 3GLSA 4ZT6A 3S1AA 1BWQA 3WYFA 3QEBZ 3FBGA 4KXFB 1NBME 1LRKA 4C6RA 1OA1A 2J3IA 2WJWA 4CKCA 1OFUX 4EA9A 5H81A 1SIBE 4CMIB 4URZR 5J4KA 3L4EA 1F4VA 3BCRA 1CFZA 3K9QO 2FSIA 3HDHA 2AZDA 3N7AA 1MH1A 1UC8A 3RVJA 1W6UA 4YLGA 2DZDA 3FFXA 2OP1A 1S2OA 2Y27A 3ETGA 4WJZA 2YVQA 4XWOA 1QWSA 4WCFA 2Z2YA 3FR8A 5L8VA 2H1RA 1ZO8A 2QB5A 4FS8A 3B7GA 4R84A 3SYMA 4LDAA 1GGHA 2B3DA 3LK7A 1DXHA 1PLKA 1GT91 3K5HA 3UAWA 5CU7A 4V2IA 2CNOA 5H83A 4JVLA 1PAUA 3L0CA 4MCJA 1UAGA 3VZBA 4NPHA 1QDEA 3FDZA 2D2VA 4KO4S 1LDGA 4G26A 2JHFA 3EWNA 4PG7A 3HCCA 3E3AA 1KQGA 2WEKA 2PT6A 4DQLA 4UKDA 3U1VA 4BEVA 1BFKA 4DLTA 3V4VB 4ZDJA 3KQQA 2P2GA 2FPGB 4GM0A 5IK2D 2AK2A 1MDBA 5GWXA 2ATIA 4MLCA 3LXRA 4KQCA 3HN6A 1JA9A 4QX6A 1OQAA 4G4GA 4XCXA 3FH0A 3FTCA 4KYUA 2FW8A 2GAIA 2I55A 1QV7A 4MYUA 1NBWB 4KFCA 2KBFA 5DNDA 4Q24A 3ZWPA 3ADCA 1XEWY 2FPPA 4CDMA 2IEAA 4GWGA 2FUG6 4E1BA 3O93A 2ZRKA 2NOAA 3IOBA 1DZ3A 3VAAA 3WMWA 1G20B 1C7QA 1ID1A 1Z12A 1ENZA 3K0AB 4J1TA 1Z13A 4MPTA 3MJCA 3QKIA 3ZHTA 4EZIA 2ZYIA 4FS3A 5KVVA 5K0ZA 3DQZA 3HY3A 3N0TA 5LBIA 2O8NA 5IDXA 3CX4A 3EYWA 1JJIA 2P3OA 3HO8A 1ADCA 2PGOA 1FK8A 1NZDA 1ATIA 1Z6XA 1MJFA 3PWTA 1A4UA 3DOFA 1T3LA 3O94A 3O4JA 4YP1A 1OY1A 3Q7IA 5AJYA 5B2EA 1JLKA 3ZLBA 2BKLA 3L7JA 3PL5A 4JD5A 4YTEA 3BBPA 2BHRA 1OXSC 1GTZA 4GBMA 5G02A 3A9SA 3RK4A 2PQ2A 1EHIA 2OB1A 4J90A 4U39A 2D7JA 3L7DA 3OJXA 3SBXA 4DMRA 5B30A 4MKGA 4A23A 4BNZA 2WUGA 9LDTA 1CCWA 2J9RA 3NVAA 4XQ9A 2C42A 3DDWA 3ICQB 1PS0A 5FR2A 4DA9A 5LKRA 3G9TA 1NA5A 4RPKA 1RQ7A 1YS9A 1I13A 4E13A 5GIPE 2BKUA 5KOYA 3BULA 3NKLA 3RT1A 2ATXA 1RZUA 1NE7A 2GBCA 4YR7A 1HNXB 2HLHA 5FD8A 2K7ZA 2VPZA 4OK3A 2WK1A 1Z2EA 3OLWA 5JCPA 2FN7A 4KX3A 4KPGA 1IPEA 1RIIA 2H9YA 2QAGB 4X00A 3GLFA 1IBRA 3REGA 2DVMA 2J1LA 4ZI2A 4TTRA 3GLIA 3NXKA 2I76A 1ZOOA 4UHEA 3D3EA 3CSUA 1X19A 4CCYB 2Y6VA 4N18A 4BU1A 1V4VA 3LY7A 2ZYWX 5CX1A 3KPUA 1X80B 2YH2A 4PIMA 4BTVA 2JCYA 2ZREA 2QV7A 4Y2YA 3SLRA 3MTGA 2UZ4A 1JPUA 3VH1A 1CUFA 4HMPA 1GTJ1 1MB3A 4IDCA 5H4GA 2I2CA 1UM9A 3L2OB 4N5LA 4PNPA 4RHYA 5HS4A 3MB5A 5E3HA 1QWOA 4WKGA 4ENTA 1S2DA 5BW8A 2GAFA 4BO0A 3DLTA 5DCYA 3T5CA 3B8EA 2AMFA 3KR2A 3ZQJA 4LV8B 3RW9A 1L7OA 2IW3A 4YMSA 3WKCA 3TLKA 3MJRA 1RXCA 3CS3A 3HDVA 2OM6A 2X40A 3L8ZA 2P67A 3KX2A 4ER6A 1T24A 4L51A 4XDHA 4F2DA 4N12A 2CFIA 1S4QA 2P5UA 2V8BA 4CQMB 4MYTA 4Q1EA 3H3XA 5HJ2A 3TLXA 3THXA 1GLVA 1PJQA 2RHBA 4P32A 5C5EA 1EWQA 4KQMA 2VDWA 4NWIA 4PR3A 1E77A 1K8ZB 1CVRA 4JP5A 3KJGA 5MHTA 5J4HA 1NN1A 1OXTA 3HZHA 5DHUA 1KFBB 4WEQA 2IDJA 3PTLA 4AJKA 2JBHA 3GLRA 3I45A 5IM4F 5LDHA 1B6GA 2A35A 3KJNA 4KITB 3OU6A 4ZHSA 1G5RA 1NYLA 4I1YA 1XHFA 4NCIA 2ANBA 4FMPA 3NJ8A 2AIRA 2I0FA 4G5XA 1YONA 3S99A 2GM9A 1GPLA 4HYYA 3WK5A 1OPXA 3ZWWA 1VKNA 5ECWA 5DP1A 1DDGA 1OASA 2G9ZA 3HXPA 1JNXX 4X97A 1IBMB 3D3NA 1N33B 2E21A 1Q11A 4HGPA 4BBAA 1EDEA 5D6OA 4C29A 3H05A 5MF6A 4UQLA 1IDOA 3DD1A 2GF9A 2DBQA 4E3ZA 1X7WB 4CM4A 2H4ZA 2LDXA 1U28A 4LRSB 4OK5A 1N2IA 1CZNA 5JBNA 1L8OA 1YB2A 4LBWA 4EYGA 3D1VA 3NXSA 1EBFA 4RY0A 4YRNA 5HE8A 5JBIA 3ST7A 4IJ5A 3G9UA 3SZGA 4YMIA 4DBZA 4L7VA 3DBRB 1UZNA 2A5LA 4TWAA 4B40A 1XZGA 2HJWA 2OD2A 3PA6A 5IF9A 4NCXA 5KNBA 5JH7A 5LD2C 1SOVA 2C9DA 1G20E 4B33A 4Q66C 4JFAA 2G70A 2YUTA 5AM5A 3VR1A 3FY4A 5HKBA 2SKEA 1EB8A 1PFUA 1ZJ5A 3QUCA 1BROA 5INTA 3R09A 5DEIA 2O3SA 1Z3CA 1FVFA 3IAS6 4JQZA 3KKEA 3DDZX 2VP3A 4TZ6A 3G1UA 3ZQKA 1X1BA 4Y30A 1KORA 4V0RA 2D13A 5GP1A 4H4EA 4CN9A 2R86A 3LHIA 5JTUA 1FFDA 2V45A 4D43A 4KXNA 2ERYA 2WUEA 1DFGA 4BKRA 5LMUB 1C4OA 4MLPA 4A6EA 1E2BA 3MPOA 5BQOA 5GJBA 2M1ZA 2FSVC 4ZOLB 1HMYA 4MJXA 5TJ9A 4PPNA 2REQA 3USES 1WCV1 3BD6A 3K9HA 3O1LA 1A5ZA 3S2EA 4ZT5A 2FFHA 4IGEA 4LPSA 5LXTB 3DVLA 1ZMTA 5CVDA 1DUSA 5GQSA 1J0EA 1IHUA 3FWYA 5JCJA 2IL1A 1NUQA 1VCNA 3BIJA 2PRKA 3PXUA 5H5JA 2PDAA 1QK3A 3O4HA 3HY6A 2WKSA 1FMCA 2VBIA 2JS7A 1L7EA 4LHVA 3IPLA 1AB5A 4AZ3A 3VZPA 1E0KA 1V2GA 3E8XA 3L1VA 3DLBA 1I2AA 3ZZ0A 2BEUA 3KQVA 1G3MA 1AB6A 1YCGA 2F4NA 4HL6A 4LZZA 4OXQA 5K8CA 2JLYA 3QMVA 1PKEA 1CU1A 3R6GA 4RKRA 3KFVA 3CH5A 2QTGA 3PJEA 4OQNA 3ZD9A 3AVWA 4UXJA 4Y2QA 3V4ZA 4PX9A 4XKJA 4BFWA 1XTTA 4GM1A 5IBPA 2A9OA 2BFBA 3PLRA 3R8FA 1E3MA 3LDUA 4L4SA 1DAIA 4TMVA 2F67A 1GQQA 3RRNA 4AZTA 3S2YA 2FSFA 2ZE7A 5ERGB 1SRRA 2DG2A 3LS2A 3FD8A 3EIHA 2Z3ZA 2FZ4A 1DIHA 2XB9A 3OCZA 4AXBA 4D81A 1X1SA 1J20A 3DFZA 2JCXA 1FP6A 5A04A 2LXNA 1GQFA 3BD8A 2HRCA 1MNQA 2PYDA 3LFTA 3L8HA 1DKUA 3QF4B 3GB9A 5BP7A 1PJZA 4EPWA 1AV6A 1IULA 3QXSA 4EJSB 2MTBA 1Z2OX 1Z2AA 1NMZA 3GZJA 5I01A 1JDPA 4QECA 3W78A 4CV0A 1E7YA 2QUBA 1NM5C 5DWDA 5G3YA 3U3KA 3FZGA 1KR2A 1R4MB 1U0HC 3V1KA 2O2XA 4II3A 3IB6A 1M1UA 2ZYUX 3ETCA 3PE4A 1LB1B 3KTDA 4LFBB 4C30A 4BP8A 5A0TA 3IURA 1YVEI 3W7BA 1K98A 1OI3A 4N5MA 5HDQA 1GPNA 2HUPA 1VJDA 3D0OA 3M81A 4HLQB 5JCJD 1T8UA 2XCUA 4EQ6B 1MOSA 3ND5A 5DTMA 4YEDA 3TF5A 3F98A 5EC8A 4F1KA 4CTKA 3R3WA 1D04A 3KQPA 1TYAE 2OZVA 3IHWA 4BNTA 1IZ0A 2BMWA 2QVBA 3F6BX 2Q6OA 4PZUA 4CDRA 2IHNA 4GG1A 2Z4RA 4NBVA 5FI5A 5IC5A 3PZRA 2H2HA 2XMRA 5EHIA 2YFKA 3FSEA 1LZKA 3L4BA 2FX5A 5K09A 1J42A 1JKIA 1SBNE 3JQAA 4QT0A 3IAM6 3SSNA 4EHLA 1JMYA 2ATVA 4G0ZA 3IEKA 3RRXA 4ZJZA 1H2WA 1H5NA 3OKAA 2REOA 4LNUB 2V6JA 4E5KA 1V6AA 3SF8A 4Z7JA 1M1NB 1X0VA 1Z88A 3S2FA 1QHYA 2ZPUA 1FX0A 4Y1RA 2FETA 2YIJA 3DZDA 1VMIA 2X8AA 5JCXA 4GRDA 1QHNA 3WWCA 1M2OA 1Y9JA 2J3MA 4JJIA 4AP5A 1DBPA 2XJ9A 4L6AA 2PAFA 4GOJA 4KXYA 4GIBA 2VFAA 1PD1A 2I33A 2WDPA 3H0EA 3L7IA 5CFNA 4DB4A 1PJ2A 2Y1OA 3X2EA 1T1JA 4QATA 3DEZA 3TIGA 4AZSA 1LK5A 2AYYA 3EGXB 3JPYA 4NFYA 4P4GA 2BFOA 3JWPA 3RQIA 2Q0HA 4MWDA 1PDWA 3IQGX 2QX6A 2PL3A 3AF5A 3DFIA 1CUBA 4H7FA 1E8MA 1G2QA 2F59A 5KX5A 4G8DA 3P52A 5E1BA 2H1WA 3A28A 3R3ZA 4N3CA 2GD1O 5CMLA 4P7KA 4H3SA 3W9YA 2YMLA 3BXOA 3PSHA 3T4PA 3TZCA 1P29A 4IIXA 4M3NA 1ORRA 5K7SA 1A9YA 4PNEA 1Z4QA 2GVZC 2VHJA 1WUIS 2QT0A 2ZRDA 4PF1A 2B0JA 2VHEA 3N2LA 3COVA 3U7RA 3CZ4A 3WG9A 1RJWA 4JYAB 4ZVKA 4MQMA 1UFQA 1V11B 3T4XA 3ESRA 3O5AA 3BZWA 4DLBA 2W37A 1V8PA 2FR0A 2GN0A 3QW2A 1WSBA 2ZU0C 2B5VA 13PKA 2QSUA 4OQPA 4J07A 4EKGA 1HEIA 1SVMA 1VYTA 3ZNOA 5H8WA 2CEAA 4X7RA 5DMHA 3BG5A 5CDHA 3U37A 2GCNA 1OXVA 3B1VA 2DU8A 4P9NA 2J9XB 1J2TA 1E4OA 2GTHA 2XZTA 3BMXA 3EFHA 1F20A 3KSUA 3PFNA 4G9GA 4ZO7A 1T6YA 4QUIA 4V03A 3W5UA 2X8BA 3RO7A 4RENA 2AG0A 1TW3A 5FX2A 3TAXA 3KRTA 5CA0A 3MD9A 5EG5A 5ERYA 1Q7TA 1JR6A 1D6SA 3CZ9A 2OZLA 3K8YA 5ALOA 3BA1A 2W6IA 1OU4A 1FRNA 4WZBB 1SXHA 4A10A 2VP0A 2VDVE 3H5NA 4NL4H 1CULC 1U2DA 2PMFA 1OIVA 1TVCA 4QRDA 5F2KA 3CLRC 2RHMA 3DLIA 1EX1A 5DCUA 4EJ6A 5C80A 3G7UA 3L0OA 3EGVA 2K4MA 3DOUA 4GR9A 2AEEA 3PGLA 3B3GA 4YNBA 4MQFB 2FKNA 4I46A 4IRMA 1L5KA 1FJHA 1M2VB 1QYIA 3EIUA 4JUAA 3TTXA 2I7VA 2QAGC 2GBLA 1FQJA 4GPAA 5LP6A 1RVV1 2WOOA 4FJ0A 2B8TA 2ADFA 5DLPA 4P98A 1Z5GA 1ILEA 3ZDCA 2JFVA 4C7BA 3QY9A 2ZJ4A 1NSFA 3B36A 1A8PA 2WE8A 4YCSA 1Y63A 4GMKA 5DSTA 4WA8A 3LUJA 3U3XA 5ALZA 3U9LA 4YQYA 3W6PA 4A9AA 4TSKA 4IYJA 2VSQA 4WOKA 4DCGA 1XZEA 3BTUA 1DQRA 4X7PA 4ND2A 5DH9A 4BE7B 4QBKA 3SDSA 3LUHA 4B3MB 3T3NA 2OD9A 3D2LA 4LDRA 3ODGA 3FVQA 3HJCA 4FGSA 1SQFA 4D7AA 2E49A 3WNDA 4MQ6A 3AP3A 3PGA1 2OHVA 1Q1ZA 2QL9A 4RMHA 3W5SA 1D9ZA 4FHEA 1EFDN 1S9HA 3MG9A 4JJAA 4QXMA 2EG5A 3H2YA 1E6WA 4I5FA 1Y9AA 2V5VA 3MUEA 3AI2A 3Q8WA 3ORSA 2ZLBA 5KVQA 1Z34A 1TJ4A 4DG8A 4DLVA 1KAOA 1SCUB 1TQ4A 3QVXA 5D6NA 1B0AA 1IUOA 2FUKA 3I2IA 2MHCA 2ZE6A 4QDXA 4UMFA 2WB2A 1EGMB 2ILVA 4W8GA 3ZGXA 1ESZA 1PVOA 3I62A 1Y0BA 1YZYA 4OHWA 1YZTA 4DHWA 3AJRA 1ANKA 2ZTLA 1E3WA 3U3ZA 4TYWA 4KFUA 3L7LA 3O8OA 4P82A 4ZVPA 4OFZA 3VOSA 1FYVA 3VQTA 2ZI7A 5JFTA 5LZ9A 3FW1A 1ODLA 1V9SA 2VP9A 4US0R 4HBGA 3TJMA 2DQSA 1RM5A 3Q5EA 3NT4A 4EKYA 1GNTA 2WW8A 2G5PA 3W79A 1P45A 3DOOA 5D86A 1Z37A 4H7DA 1W9MA 4KZKA 4H3KB 2JHAA 1K63A 1YK0A 3CLSC 2D62A 4L5YA 2JH8A 3NDIA 1XZ8A 2QUKA 2P2CA 1KTVA 1A2KC 2G67A 2IZ7A 4NR0A 4XIFA 4GL2A 1FLNA 3T15A 1WJGA 1A9PA 2VLBA 2Q50A 4COOA 2GM3A 3ND7A 4GI5A 3S81A 1U1EA 4RULA 1PQWA 1EVZA 1VPTA 3JYOA 3OZGA 4WN9A 5L3QB 4LYEA 3PTAA 3CKKA 3MT8A 5IDQA 1A96A 2X0EA 1UJMA 2OXEA 3OE7A 4R41A 5GVRA 1DO2A 421PA 4MVJA 2Q29A 4D4LA 4R0VA 1FYFA 1CUSA 1JYEA 1KP2A 2OFXA 1WUTA 3OJWA 3D7MA 4B46A 2UUBB 1E2JA 2XKBA 3T1TA 4O4IB 3DHEA 3R4VA 4NU0A 1KA9H 2VAWA 4UVEA 4ZARA 3FOEC 1MC5A 3I72A 1NG1A 2ZJZA 3PICA 1EP2B 3DULA 3S2ZA 2Y4OA 1C1HA 3ZBQA 4CKXA 2AT1A 1WCWA 3OHMA 4UM7A 5JYDA 4KQIA 4YB8A 2BBWA 3PUKA 3ZE9A 3HB7A 3C5VA 3RS3A 3OE1A 1M5UA 4G4IA 5TRTA 3NHWA 4P0QB 5JD3A 4I14A 4ND3A 5HF8A 5M7EA 2NZ2A 2C3PA 2YWJA 2P35A 5HILA 4EW3A 1DDOA 3CTMA 2D1SA 2OXCA 2VDJA 3ROPA 4HVLA 1C3OB 2PSDA 2VKTA 3DTNA 1G0NA 2PD3A 3CSDA 3MGCA 4CMJA 2BDUA 4GVPA 2R1UA 3RRJA 5IDWA 1ZXXA 2VP6A 1KY4A 1FOEB 1ZH6A 2L69A 4LS3A 4MKFA 4HWKA 5AW3A 5AM2A 4HDKA 4YFVA 1P2DA 2ZBUA 1SQSA 4DNOA 4JB2A 4IX9A 1X9HA 4LRUA 1TC2A 4OGFA 1GDHA 3WS7A 5HCIA 4I99A 5TIIA 2ZROA 1PL7A 4M4SA 2PGAA 2HBQA 4WZBE 3G49A 3P27A 4TYNA 3KZ1E 3ZWVA 4MIEA 3EJ6A 1KPIA 1JJ7A 4LZLA 4QIHA 1HM5A 4ME6A 4OREX 3NC1C 3AL0C 2EATA 1JSCA 2IHJA 2W43A 3OT5A 2GESA 1A9QA 3AKYA