4MQFB

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist 2-hydroxysaclofen
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
415
structure length
403
Chain Sequence
b'SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
molecule tags Signaling protein/antagonist
source organism Homo sapiens
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
total genus 138
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqfB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqfB01
5HKOA 3RH0A 4KFCA 1EAYA 4D6YA 3JPWA 4DADA 3BBLA 1Z2EA 2L17A 1QO0D 4HNQA 4N76A 4N41A 5BQ3A 4IMJB 4KV7A 3ROTA 4N0PA 1A0OA 5IUJC 5JNTA 4NQRA 2LBPA 4IRXA 3OMXA 1SRRA 1K68A 2M98A 3CS3A 3G1WA 3I5AA 3MQ4A 3KLOA 3HSYA 3C3KA 3SM9A 4MQEA 4ZMRA 1RXEA 3OQOA 2JCGA 2IPMA 2PUEA 1WETA 1U2PA 3DLHA 4LE0A 1EWKA 1PHRA 1SD5A 1BA2A 3EJWA 2NT4A 1LBIA 3TD9A 5TQ2A 4MS1B 4MYRA 1PEAA 2PUBA 1FFGA 2RGYA 5KC8A 1USKA 4OG2A 3TO5A 1KGSA 2E4ZA 5DKFA 2VUIB 3EGCA 1H9CA 2JB9A 4EYGA 2H3HA 4UHJA 4YGXB 1QO0A 3KYIB 4NCAA 3N8IA 3IP9A 4Z4HA 1QP7A 3CZCA 3MM4A 3L49A 4Z9AA 5EWJB 1QKKA 5TQJA 1QP0A 5C5EA 5JNWA 3C97A 5FBHA 2O20A 3DZDA 4O1HA 4WXMA 3RVPA 4KVFA 2BGGA 3F7NA 3JVDA 4FB4A 1DP4A 1W9HA 2IDMA 2LPMA 3ILHA 2VK2A 5HM6A 4LRQA 1Z2DA 5FBKA 4RY8A 2CHFA 5TQ2B 3EAFA 5EWMA 3TB6A 3RVSA 4YP9A 1XHFA 2KYRA 3BILA 5BRJA 1NXOA 2FMHA 1GCGA 4DN6A 3Q7TA 4KREA 3KKEA 3IP6A 3SAJA 1ABEA 2PE5A 1DBPA 4CBVA 1YMUA 3IPAA 4KMRA 4M88A 4DQDA 3KCNA 2XDYA 1APBA 4NICA 1JF8A 1PUXA 4YCSA 3P9YA 1I3CA 1EFAA 5IULC 4P1ZA 1JX6A 1M2EA 2FLWA 3O21A 2FW0A 3H1EA 3IDOA 3DBIA 4RKRA 1ZGZA 4PYRA 4YRZA 3JPYA 4IGAA 3OO0A 4HNRA 4RY0A 1DCMA 4RV5A 1LJUA 5IUKC 1SXGA 3LMKA 3N53A 4FE4A 1EWTA 4ETNA 2P4UA 3Q15C 2FQXA 2F8TA 4EY3A 3F73A 3KJXA 1YK0A 2FEWB 1TMYA 2FEPA 4LDAA 4H60A 1QMPA 3A0RB 1M5TA 2H0AA 3H5IA 2I6FA 3RVMA 3LUAA 3JS5A 2PKXA 1QQBA 4YS6A 1JWLA 1DCFA 3O2SB 3NNNA 1NXTA 4H3HB 3SY8A 3URMA 2HJ9A 2GX6A 4QYWA 4S04A 3HK2A 4XLTA 1JYFA 3CFYA 4OTZA 5IC5A 3OO1A 3EODA 4G0OA 3C3WA 1Z25A 3BREA 3CG0A 4Z4IA 4W5OA 4Q6BA 4RWEA 2FMFA 1TM2A 3H6HA 5B3JC 2GI4A 3FGZA 4F06A 1KRWA 4KZKA 2QZJA 4KPYA 3H1GA 2FKAA 4S05A 2NT3A 2HPHA 3HZHA 1LJLA 4O5AA 5B3JA 2RDMA 4E7OA 4F8JA 3DLBA 2FSPA 1LBHA 1ZESA 2L18A 2QW1A 2AYXA 2FN9A 3QLUC 2NZUG 4PE5B 1Z26A 1R8JA 2GBPA 4JA2A 1PNTA 4JAVC 2PL1A 4Z4EA 2CHEA 1J56A 3OLVA 3QLUA 4GNRA 1YS7A 2QXYA 1DC7A 4KNYA 3GA5A 2OQRA 2QVGA 1ZHHA 1XWWA 2PJUA 1P2FA 4RK1A 4EYQA 2QR3A 1LK0A 1DBWA 9ABPA 4YLEA 4L85A 4ETIA 5TPWB 2A9RA 5PNTA 1ISSA 1DRKA 3CU5A 1NXPA 2VYCA 5GQSA 1E6MA 2MSKA 3HJFA 3OQMA 3MIZA 3QELB 5JNVA 3DGFC 3A10A 5D2CA 2AYZA 1P8AA 1D2AA 2LUOA 1K66A 5HQJA 1MB0A 4KK4A 4MR9A 1GUBA 1IIBA 4G0XA 3HUTA 3SG0A 3BRSA 4D6XA 4EVQA 2N9UA 2IYNA 3VNBA 3O74A 1YMVA 2E4VA 3OQNA 3CZ5A 3H75A 1U04A 3KG2A 2FXIA 3W9SA 4LX8A 1CHNA 3RVKA 3Q7RA 4Z4GA 4Z99A 3A0UA 3H5WA 4MR9B 1T34A 4EGSA 2PUAA 1EHCA 3OM0A 1NXVA 3T38A 5KQPA 3K9CA 4MR7A 1QQAA 5FWXA 1BVHA 1TVMA 1JFVA 2ID7A 2FVYA 3NNDA 4ZPJA 3H5OA 4RXMA 3DGEC 4RXTA 4NCBA 3CG4A 3CTPA 3GYBA 4G0YA 2L19A 4OATA 2R47A 4MS3A 3RVRA 4XFKA 5CNMA 4MQFB 1U0SY 4G0ZA 4EVRA 4RS3A 2ZAYA 4W5TA 2HQBA 4H3KB 5FWYB 4ETMA 1EWVA 2NZVG 1SXIA 2TMYA 3LFTA 1L5YA 3G85A 3GT7A 3O1IC 3A3KA 4MAAA 4MS3B 4MLDA 4XASA 1PNRA 1KRXA 1Z13A 4WT7A 4G0PA 3HM9A 3RVLA 2PUDA 3SQNA 2MSWA 1Z16A 2J48A 4NV3A 3CLKA 4QICA 3ROFA 2MYTA 5FWXB 3H5TA 4MLCA 4LZLA 3OM1A 3I09A 5JS1A 1ZY2A 3HUUA 3NHZA 3TX6A 1FQWA 1CEYA 4EYOA 1SXHA 3O75A 2GWRA 2QVCA 1P6QA 4RY9A 1ZN2A 1PEYA 1Y1LA 1BAPA 3I42A 4ZYLA 3CKMA 1MB3A 4Z9BA 4EYKA 4YR7A 1S8NA 3SNKA 2JVIA 2ZWMA 2QSJA 3QELA 3RQIA 1GLGA 1OXKB 3H5LA 1BDHA 3KYJB 5TQ0A 2PL9A 2ID9A 5EWMB 1MAVA 5DLEA 2PUGA 1ZITA 2DRIA 1TLFA 1BDJA 4MR7B 1QPZA 2IKSA 2HSGA 1OXBB 3E3MA 3F6CA 3EQ2A 5ED4A 1BDIA 4JOQA 4MS4B 4LDZA 4XAQA 3GWGA 5EWLA 4RU1A 4Z0NA 2MYPA 3OLXA 4N03A 3JTEA 3M9WA 4MPTA 1A04A 1C0EA 3MMNA 4RDCA 1GUDA 2FLKA 1VLZA 3Q7SA 2JRLA 4MRMA 2IOYA 3D02A 1ISRA 2CD7A 1F51E 3N0RA 7ABPA 5T7BA 2WJWA 1CYEA 3KLNA 4LE2A 5T3YA 3MYYA 2FTKE 2MYUA 3NHMA 1M5UA 3B2NA 4RK0A 1E2BA 3QLTA 3MF4A 1MIHA 2FEKA 4Y9TA 2WJAA 3LUGA 2FMKA 2QU7A 3N6VA 6CHYA 3QLVA 5E3JA 4XARA 3Q9SA 4MQEB 3KHTA 5JNSA 4HYEA 3HO1A 4WWHA 5KQLA 2HQOA 1JBEA 4TMYA 3RVNA 4F12A 2PLNA 4E7PA 3HDVA 1RPJA 3GBPA 3N0XA 2FMIA 3LUFA 4RK7A 4W5QA 3LUKA 4PZ0A 3LUJA 3GV0A 5DGCA 1JFTA 4XXHA 4G0QA 1JHZA 1AB6A 2VUHB 1ZH2A 4RK4A 3HXMA 4OLBA 2E4UA 5HSGA 1QNLA 3OLZA 3LKBA 2CWDA 1DZ3A 2PUCA 5DCLA 2FN8A 5IUNC 2E4YA 3OLYA 1XHEA 1JFSA 2IPAB 5EWJA 2JVJA 2PMCA 1FFWA 3NNSA 4QYMA 3T8YA 3O2QB 1Z12A 1D4ZA 1JH9A 1U2QA 5BRAA 3LTEA 4PEVA 4IF4A 5KI6A 3JY6A 5GOTA 4G86A 3OMWA 1FFSA 1ZVVA 2RJNA 3QEMB 4MR8A 5JNUA 4MS4A 8ABPA 4P98A 4ZMSA 3GRCA 5CNKA 5F64A 2JK1A 1YTUA 1DRJA 1JLKA 5EWLB 1YK1A 2B1JA 3LUCA 4O1IA 5ABPA 3KSMA 5KQMA 4KQCA 4W5NA 2FQWA 4EVSA 5KQGA 3QEMA 1KMIY 4JB2A 5CHYA 2E4WA 4HNSA 4YV7A 3HDGA 3HCWA 1U8TA 3T95A 1URPA 3O2JA 2R4QA 6ABPA 3LKVA 3M6MD 3KS9A 3FFTA 1RNLA 3HS3A 5IEBA 1ABFA 4TLMB 1RXIA 2E4XA 3UUGA 1NY5A 2WY2D 1GCAA 1L5ZA 1D1QA 1JDNA 2YHBA 4MGEA 5CNJA 4Q7EA 4YWHA 1DG9A 2Q5CA 3CRNA 1NATA 3H1FA 3O1HB 1NXWA 4EUKA 4Q6WA 5IBQA 4GPAA 5TPZA 5IX8A 1VRVA 1JYEA 4PICA 3ILYA 5JNRA 4QPJC 1VPWA 1C4WA 2MYNA 3JVIA 3S99A 1USIA 3R0JA 4KK3A 2IPNA 2RJOA 3O1JC 3IPCA 1Z15A 3LUDA 4UHKA 4RSMA 1YS6A 3FFWA 4TN5A 4WXEA 4ZJPA 3CHYA 2L2QA 3H6GA 2LIVA 1DCKA 3UK0A 3L6UA 5C5CA 1JDPA 4TLLB 5TPWA 5FWYA 1W25A 2GKGA 3C6QA 1TJYA 2YHAA 1Z18A 3H5VA 1YIOA 1NXXA 3IP7A 4MQFA 3RVJA 3MA0A 1RZRD 4IILA 2F8SA 1ZH4A 3QK7A 5BR1A 1P6UA 1ZDMA 3QLVC 4WUTA 4MR8B 5TQ0B 4JP1A 4F3TA 2P9HA 4ML3A 5KC9A 4F11A 1B00A 5TPZD 4D74A 4JB0A 4KQ9A 2MSLA 4Z4CA 4FE7A 1FSPA 1VKRA 5KWSA 2WMYA 3EDCA 3N0WA 5DTEA 2OENG 3K4HA 4RXUA 3VNAA 5I4CA 3F6PA 2JBAA 3QEKA 2X7XA 3KTOA 4LE1A 4Z4FA 1AB5A 1NXSA 4MS1A 1E6LA 3CNBA 2JVKA 3RVOA 2WRZA 2A9QA 3NBMA 4IMIB 3GBVA 5IEJA 2M1ZA 3M9XA 4B09A 1DBQA 3D8UA 4N0QA 4L4UA 1Z17A 2NUBA 1NTRA 3GL9A 3LUHA 4WZZA 4RZSA 4YO7A 5JS2A 1RZRA 1JL3A 1QP4A 2B4AA 2FQYA 3HV2A 3EQZA 3OLWA 1ZGGA 2WWVD 4N47A 2IPLA 3FDFA 4OBBA 1F4VA 2HQRA 3LOPA 2LP4Y 1DC8A 3N75A 2A9OA 3TMYA 4W5RA 3QX9A 3BRQA 2PUFA 3IP5A 1A2OA 3C3MA 1USGA 3HEBA 3Q41A 4JASB 3T6KA 4OLAA 2V0NA 4KRFA 2WB4A 4RKQA 1DJMA 1ZAYA 4RK5A 2W42A 1E6KA 1D5WA 3FMVA 3I45A 4MRMB 4RK6A 3EULA 5CNIA 2QV0A 3UKJA 2PAFA 1HEYA 1YVUA 2R25B 2R48A 4G97A 5TE9A 3E61A 3RVQA 1M2FA 4G0MA 3FFXA 3HVRA 2A9PA 1MVOA 2JBAB 1D1PA 3QX8A 1UDRA
chains in the Genus database with same CATH superfamily
1Z4KA 4D6YA 1FSSA 1P73A 4YAUA 1ZGCA 3LYUA 5UKDA 4HNQA 3TZBA 3AF1A 4QEKA 1JAIA 5EG5A 5D51S 4K9LA 1DKUA 3U6BA 1C9MA 1HK7A 3MQFA 2Z95A 2B7LA 1OX4A 2QLTA 3KYCB 1EP1B 4L1KA 3QI2A 2A5LA 1ISGA 1IQPA 1XNGA 3BOSA 1DUSA 4IH1A 4JQOA 1T26A 4UTXA 4KGXA 1SCBA 4QRDA 2IPMA 2UZ0A 4PFSA 4WK4B 5E0OA 1B7GO 3I1IA 2O07A 2RHBA 3EA4A 1MJHA 2AXEA 2LW7A 4NATA 4FWIB 4ZI2A 5CG1A 2ZUWA 1FK8A 3FJ1A 2XCQA 1S5PA 4KYTA 5DNEA 5FBWB 5FYQA 3TOZA 3W7AA 3ZWCA 5AM3A 2WMOB 3IDQA 1Y8QB 4PYIA 5JAIA 1PIWA 5T67A 3OT4A 1Y7TA 3JWPA 3DJFA 3OU6A 2XTNA 1G3IA 4Y98A 1YBHA 1E5TA 4LJYA 3BMQB 3SU8A 5FUYA 5KWJA 1HORA 3IB3A 5IHPA 3D6HA 3FROA 3L4BA 4BFUA 2C3YA 4Z7OB 5AMXA 5K20A 4XWTA 5L3ZA 4R31A 4FQ7A 4X24A 3P9KA 3H1PA 1QOQB 2W2PA 3U56A 1R4MB 1NBOA 4PAWA 5FH9A 4LXTA 2H48A 3EDQA 1ZCJA 4EPYA 4F6LA 2D74A 3ABSB 3WNDA 3TLYA 3GHYA 3PPWA 3E5MA 4BKPA 2GZSA 4DG9A 2XGJA 4PZ9A 5CFPA 5IFKA 1C4OA 1UXIA 1XLTC 2A67A 2W83A 3R9IA 3D8TA 3H18A 2GKOA 2OGWA 3IEIA 3F6YA 2BMDA 2WFLB 4IEIA 5DMHA 1L5SA 3E9YA 4ZCSA 2KYRA 3M6IA 1G9TA 4BZQA 1EINA 5KTYA 2UU9B 2XA1A 3LT5A 1GCGA 3OF5A 3QKUA 2WUFA 5FXMA 4N48A 1AUVA 5FL7D 3TAXA 5BSEA 3LPLA 3P5SA 3PUHA 4JVOA 4XGQA 3AUTA 3SAJA 1D0SA 1I5RA 3W8FA 3DOJA 3PGA1 5DWDA 4AN4A 1I1NA 4ENVA 2WJJA 1S8OA 1CUCA 1F3LA 1UKBA 3LX4A 4FYWA 5L3RA 3TIFA 2UZIR 1HRKA 2D8MA 3GFBA 1U7XA 3O3MB 4LTNA 3OCXA 1YQUA 2V8BA 1JX6A 1M2EA 4H7JA 1H2WA 3R3HA 5TNXA 1C4KA 4G1BA 4ZHQA 3K2IA 3A1EA 4D3YA 4U7FA 1Q7EA 2PBLA 4P4SB 4FUTA 1ZH8A 2L82A 4IXDA 4WASA 3V55A 3B51X 2O3SA 3DDHA 4FE4A 4MI3A 4ETNA 2WF8A 4C5AA 4R2KA 2UZ1A 3V42A 2NSHA 2PA3A 2SKEA 5LXTA 4I50F 2F4NA 1VHDA 4H6XA 4A9AA 3WKCA 1B74A 3G0OA 2CKDA 5JSZA 5JSYA 3IXMA 4YUAA 2A30A 4M9UA 3H11A 5JTUA 1T1GA 3HWRA 1D7OA 1Z34A 4ZC8A 4GOKA 4MDEA 1OB2A 1E2HA 1PLLA 1FLVA 1YH3A 1IONA 4UARA 3WLRA 2OCDA 2O5CA 5ECDA 4PPGA 3RRNA 2WSYB 4P93A 5TJ9A 3ER9A 3TRKA 1YZLA 2Z57A 3C85A 4S04A 2RD2A 5LZ5A 4P4UA 2QG4A 5DBOA 3J80A 1Z3CA 1CLUA 4PSVA 1M8PA 2UYCA 4UHFA 1QYRA 4AUKA 2OCLA 1X7WA 3SXPA 2W6JA 2DFLA 2ZDHA 3H9EO 4DBZA 1TCUA 3CN7A 3PSHA 2ILVA 1KPGA 3FGZA 1IN4A 1M6VB 5DHFA 5B3JC 1GZ3A 2W70A 3MMSA 3ECCA 4JFAA 4WZAE 3T7EA 4UULA 4HBGA 3DP9A 3TNLA 4Q9LA 5F5LA 2B20A 3WKEA 4Z2AA 5AW2A 2DETA 1EG7A 1RE1A 2R6CA 5J59A 1ZIPA 3UK1A 5MGNA 1YZYA 2RIPA 3HABA 4NG5A 1R0LA 5HK9A 5HUJA 1VE1A 3A6JA 1Z26A 1XTUA 2CUNA 1ORWA 3JQ8B 4V03A 4CF6A 3S1SA 4INPA 5IAJA 1FY2A 3MHTA 2O8FB 2QVXX 1P81A 2AG1A 3UT5B 1XQ9A 4DVGA 1G5FA 5JFGA 3FVRA 3QVWA 4QJBA 3Q8KA 2XRYA 3UN1A 5EKDA 4UOEA 1XCBA 2PYZA 2I55A 2WIJA 2P91A 4JXZA 3ZIAA 2BOVA 3LZCA 3N0TA 4YONB 4IHJA 3M70A 5FWDA 1ZVJA 2PBFA 1JBQA 4CG1A 3LXMA 2P2DA 4JU8A 3E8XA 3GX1A 4J76A 1FFCA 3HJFA 2NPIA 3C87A 3QFHA 3LDGA 4BV8A 1EDDA 1NGSA 2P1RA 2Q5OA 1DL5A 3DGFC 4HI0E 4RS3A 5FHRA 4C7XA 1LF0A 5IRCD 1FJGB 2Z3WA 5IDQA 1K66A 4X66B 3PI6A 3AFIA 3CZ4A 4G0XA 4JBWA 2QF7A 3GFGA 3EGOA 1PK9A 1UQUA 2OV4A 5IJ9B 5IK2D 1AKWA 2OBNA 5DTJA 4URUR 1ZD3A 1CHNA 4D9HA 1NJ2A 1XNQB 1P4GA 4BNIA 4E15A 3A0UA 2WHPA 1Q77A 3UC9A 4A1OA 2ATVA 4A2PA 4GI5A 3URKA 4BNGA 1VJTA 4DNOA 3LBHA 1LS6A 1NLUA 4NOMA 3V6MA 1N5IA 1YIDA 4UVGA 1QK5A 4XVRA 1VE5A 2HIMA 2WI8A 3RLFA 1T13A 1U7WA 2P35A 3I6IA 1I1HA 1SOUA 3LF1A 4RA6A 2ODWA 4BTEA 1OYOA 4DA6A 4EG1A 1DKMA 2R47A 2ZRLA 1YRLA 4LJAA 5ES3A 5ESRA 5HXAA 1KI1A 1J09A 4JLOA 4NS1A 5F7ZA 3QKIA 4X1YB 1VGVA 4S3MA 1Q57A 3ASVA 3X0DA 4R1LA 1KS9A 2QJRA 3AG5A 2HQBA 4V38A 3R7BA 4W5TA 5F5NA 5L40A 5LDHA 2BH9A 3DDOA 3ZTYA 1DBSA 1JPUA 2QAIA 4G5OA 2Z2JA 1SHLA 3AU9A 1YHNA 1ZUHA 2B37A 3BTOA 4Q12A 1P31A 3DKRA 5I4BA 2UZ1B 3BDVA 5LXTB 1TOAA 1TXGA 2XGOA 3HM9A 1FU4A 2QNRA 5BNFA 3CH5A 4DRXA 4F72A 4DY6A 3W3AH 1V11A 5LM3A 5FYDA 4AJ9A 3ROGA 3F3MA 1COWD 1E64A 1Q1GA 2I33A 2POQX 4FGSA 4MDYA 2CNKA 4NE2A 3T7SA 1ZCBA 1TCAA 1FP7A 1IHDA 5EE1A 4EYOA 4RTNA 2YRFA 4OXYA 1Z7WA 1BKYA 1FTGA 4D41A 1L4HA 2C4TA 2INGX 3C1AA 2QVCA 3HHEA 2CFIA 3FNBA 3E4DA 2Y93A 1XALA 1XQ1A 2EIXA 2HA4A 4OVKA 3TX2A 4QULA 2QQEA 1S8NA 2ZJ8A 3GGGA 4BNUA 1U1IA 4RADA 3WQSB 2VRBA 2WV7A 4LI0A 1W4CA 1UFVA 2RSLA 1IBRA 1W46A 3E58A 3M2TA 4M0LA 3HP4A 2ZWIA 4AF8A 1NRXA 5JQGA 1H69A 4TYYA 4JGBA 1T2NA 1SHKA 3BEOA 3OJOA 4Y0NA 4AY5A 3U4QB 3AVYA 2QNIA 1L3BA 4IDGA 5ENZA 4EPWA 4YAKA 1QPZA 1LI4A 2XZLA 3OTGA 4FN5A 2KMLA 2IZ6A 1WLSA 1LPMA 2QVBA 1U0FA 2VHVA 3IT2A 5ED4A 4GSYA 1NVBA 1TYZA 4ND7A 1ESZA 1ZI8A 4I1IA 5H70A 5A3JA 1M1NA 1D4FA 2FZLA 4KI7A 2FUKA 1Z5PA 5I9IA 1ZIDA 3PEEA 2UV8A 4KH0A 2LVBA 3L8EA 4KE9A 5IFLA 2AV6A 3MMNA 2ZYTX 5B1HA 2G1PA 5CURA 1HSOA 1FE8A 1OQAA 2F1RA 2Z2YA 4EMUA 3BA6A 4U7JA 1BZYA 1T1JA 5EAIA 2JRLA 2OD2A 4R9VA 2RGNC 1Y1KE 1JIIA 3KXLA 2XKAA 2IDJA 2ZWPA 4LXIA 2AX4A 4O0LA 1B6SA 2B9EA 3SSMA 2AR9A 5CR9A 2R00C 2W2MA 1UMDB 3JYOA 3CEHA 4C89A 3MF4A 2WTMA 3QVMA 1V39A 4NDAA 1BVYF 1L7NA 1JDZA 2OCBA 2QN2A 3OI7A 2VDQB 4MRVA 2WFZA 1XEFA 3G7UA 2KB0A 4XYBA 5C4MA 1M2HA 4OY3A 4DQLA 1A9YA 2D5AA 3HL0A 2HFKA 5BNZA 1OV4A 1Z82A 2APJA 2E87A 2P3LA 2QUBA 2XUJA 1S7CA 3EY9A 3NC0C 2OCIA 3O8OB 3FHTA 1XQXA 4P82A 4R4JA 3UPUA 2QMOA 1I14A 1SUFA 2CSUA 3LHDA 3LP6A 3RKRA 2MR6A 4RVGA 1REQA 4V0QA 5C1DA 2OORA 1NULA 1X7YA 421PA 3QU9A 4FCCA 3MTIA 1ORVA 3JVVA 4F3NA 4KR3A 3LY5A 3IVCA 2ZG6A 3F6BX 3V2UA 3M5CA 5M29A 4RA9A 1UOEA 1VMKA 1JEAA 2P9CA 4I0WB 4WN9A 5JRZA 2JGIA 1BCSB 2CB0A 3CNNA 3D1JA 4PWYA 1E3WA 4RJIA 2IPOA 4CG3A 2ZYDA 3REQB 1QH1B 4TZKA 4A8JA 3CLTD 4B7UA 4CMEC 4YBRA 1XTTA 1NDHA 2BD0A 2DG2A 3KKQA 3AI2A 2RGRA 2YWEA 1O9BA 3PFCA 4IF4A 2Q46A 2UVPB 4I99A 1N3BA 2JBHA 4JEUA 4UEWA 3FRHA 5GVRA 5K6RA 1K4MA 4MR8A 1U9IA 3WYCA 4MS4A 4LPSA 3NH6A 4O2AF 1QANA 3D81A 2Z08A 1T3ZA 4HFNA 4Q0MA 2CVZA 5DBFA 4AJNA 1YTUA 1F6DA 2WG2A 5CJPA 3T9FA 4FP9A 2JJYA 5FI0B 3JR3A 5EIXA 3G5TA 4R8RA 1Q19A 2OLKA 1FFEA 4L75A 1U0NA 5C5IA 3P9ZA 3FNEA 3OJFA 1CRLA 4FBLA 4AZ0A 4OUDA 3VC2A 4QT4A 1HLPA 1C30B 4OP2A 2K4MA 3PUKA 1B8NA 1US8A 2QMEA 1W48A 5IKEA 4QTTB 1CQIA 2V45A 5CU7A 1UF9A 5DTRA 4QOHA 1DB3A 2TECE 1I4LD 3T5DA 2E4XA 3SVTA 4HR7A 4HX9A 3DDCA 2OKCA 3AR9A 3JATA 2YJNA 3S8MA 3T12A 2W48A 2WJIA 4FHZA 4KO8A 2OCGA 1L5QA 4IDNA 1NATA 4X84A 4E3ZA 1LLQA 3LQFA 1DT5A 1TRKA 5EMHA 5YASA 2OXIA 4LZAA 3BMNB 2YVKA 2OMEA 1M7BA 5IX8A 2JFXA 1R88A 4JLVA 4M86A 1QHNA 3MJSA 5BT8A 4NMHA 3LV8A 4WRRA 1N2BA 2VJLA 1YJXA 4JVNA 1OJ7A 4Q7JB 4X9XA 2WIAA 3GPLA 1O0BA 3JAKB 3PDWA 3ELUA 2ZI5A 4HWGA 2QE6A 1XZFA 2WJ4A 1ULTA 4H08A 2P4SA 1JFRA 1Z73A 1GKKA 1SEVA 1YOVB 3AFHA 3OJLA 2PS0A 3R6GA 3RTAA 1BS9A 4TWAA 5FWYA 2ZSKA 2BUCA 4LY9A 1GYRA 4BOYA 1GAWA 1C1DB 3IVMA 5HKAA 2ACWA 5JD4A 4DLSA 5JPIA 1YFZA 1G8FA 4LYDA 4GMDA 1I4WA 2CVOA 2P9TA 2MR5A 1XC7A 4CFSA 2WAXA 3QLVC 1H93A 5TQ0B 4MR8B 4EGAA 2C78A 1HDRA 1UWVA 2V7WA 2AMLA 3NYRA 1S1CA 3ZQJA 4RABA 1Z45A 3MW8A 2A57A 4HXFB 4X6LA 4EB8A 2W6ID 3IBCA 3QWAA 5H3HA 4D6PA 1OKKA 5AR1A 3RRBA 4D5EA 2BTQA 3KC2A 5KWSA 1OROA 3EDCA 2KX7A 2VPXA 2AI3A 2P90A 3ENWA 2X7XA 3G2NA 3M3HA 1QFXA 2II6A 2YDYA 4FDAA 3E3NA 1HYBA 3G88A 3PD7A 4C2AA 2FPXA 3WRYA 3AOEA 4OQMA 1ZA1A 3S81A 2ZB4A 3UW3A 2OK8A 2PRZA 5JEDA 1RMYA 2NUBA 3HDHA 1HLFA 5LJLA 2FQYA 4BMCA 4ZAVA 1O6ZA 2WWVD 2B4RO 1N5OX 2VH2A 1DXHA 1P7ZA 2IPLA 3IIIA 3OTQA 4PAGA 2AOVA 1GGVA 1PGQA 2VP4A 1ZU4A 1BHO1 4O2RA 4O29A 2HSZA 4EENA 5AVTA 1CY4A 3RAGA 3OX4A 4LWQA 3TMYA 3FTQA 1MUUA 1QO7A 1QQ6A 3JQQA 4S2EA 3NTLA 1SXPA 2BEJA 3C48A 3DTVD 5TR9A 4DKXA 4ZI5A 2YJTD 3O2NA 2CE7A 1RI2A 4W7IA 3NTUA 2EBFX 2WU1A 2R84A 3PS9A 3UKDA 5ITVA 2J0SA 5A0VA 2H29A 4YK7A 2EFCB 3TPCA 1ND6A 4RELA 4BBZA 2ATXA 1TQ4A 1EH5A 2C4MA 5TEWA 2YASA 1DQNA 1D5WA 1E6KA 1D8AA 5BMOA 4QLAA 4A0HA 4WAUA 2QJFA 1HDYA 1VKNA 3IO3A 2VT7A 1HEYA 3NALA 4G97A 4REOA 3UATA 1O1YA 1QHHB 2YINC 2DFTA 4LBVA 4JDPA 1GKIA 3RK1A 3E3AA 2EG5A 1CZRA 2IYOA 3MG9A 2A9PA 4M98A 5BVHB 1FVXA 5FBQB 3ZUPA 1N7IA 2QX4A 1ZIXA 3AU8A 3THWA 3FOCA 4I2VA 5D87A 2CZQA 3PJGA 3K2EA 1XA0A 3H3XA 4EUSA 5BP7A 4ZO7A 2WAOA 3TBKA 4HN9A 1TVCA 3P8ZA 5K0JA 3DZGA 4FCWA 1V43A 5IKMA 1EDEA 1ZJZA 3ROTA 1CQIB 2JLSA 4M1TA 2A59A 1G5TA 2J5QA 4IHKA 4L08A 1NWHA 1Y63A 1TC1A 4OQQA 5T5QA 3DDZX 1XVIA 3GFTA 2R6ZA 3TSAA 2GFIA 2Y1LA 4PCUA 1M2NA 1M5RA 1ULUA 4PG4A 1FNMA 1RLOA 5AKJA 1ZOIA 1HL7A 1SD5A 1WZIA 2J5RA 3WGZA 2E6KA 4QNRA 1GPLA 4C7JA 3EPJA 3TZHA 3Q0IA 5ELLA 5TQ2A 5MFZA 4EY4A 3F1LA 2QP3A 4OAPA 2VWGA 3T06B 3AHJA 2QYHA 5B7QA 1YUNA 3B3GA 1RWVA 4C03A 3FNHA 1PG0A 4Q4HA 3BB1A 1Y3DE 2H18A 3V2HA 4TYNA 1UBFA 3VZRA 3L7YA 3N0VA 4TYMA 5DSZA 5IT4A 3ITNA 5EMKA 3Q3CA 3CZCA 5J5CA 1Z8NA 3FLBA 1ISMA 2AWOA 2CYBA 3P2EA 3PA8A 5EIBC 5TQJA 1T9CA 3REGA 3C97A 3COJA 4G9EA 2B8JA 3OAAD 4YIKA 4O1HA 3DVRX 1E9AA 2JKYA 3LG2A 3ZG6A 1Z07A 3I2HA 4CLOA 4JEHA 1YBAA 2A33A 4EHDA 4QE3A 1PUIA 4C21A 5KYKA 2XNDD 2EGGA 3CX8A 1GNLA 2PGLA 4RHCA 2AMFA 5CFOA 5C8VA 4DR4B 1NPDA 3C8UA 4LYHA 3TR5A 3ME5A 5EWMA 3T34A 4MP8A 3AR5A 3EBPA 2OV8A 1DFGA 3A2MA 3HKDB 1N2OA 4B3RB 1S8AA 3VGPA 1XHFA 5EUBA 1VYVA 3FCAA 2NV6A 2WFLA 3IEKA 5IH7A 1XTIA 1ZRNA 2OO5A 4LMRA 3ZH2A 3FM9A 4B3XA 5MN4A 5E1BA 2H57A 4PYLA 5AWFC 1OYYA 4C4TA 1XKXA 3PRHA 4UTRA 4AI6A 2OG1A 2E48A 5G40A 3ZW8A 3GEMA 4ZEVA 2XDYA 4XSGA 1AY0A 4RTLA 5K99A 2JHFA 2QUIA 1QWSA 1VJ5A 2CY0A 3N8HA 2YV1A 4U9UA 4YFYA 2CXNA 1X7WB 2J3IA 1L0BA 4TN1A 1LZKA 5JO0A 3O21A 1JXOA 4AJIA 5HIJA 4LRWA 4NENB 5BUSA 3O95A 1DHTA 4RKRA 4QUAA 1YRHA 4PYRA 1GNVA 2BEKA 4OQDA 2JFUA 5FBLB 5J2TA 4A8JB 3O8QB 2ZU6A 3PWSA 2P0AA 2ZSEA 3LT1A 2QZZA 4KN5A 1YI1A 4J7CA 4HGZA 2A92A 3QLEA 2IHTA 3B6KA 4XYMA 5GP1A 1E62A 4AMZA 1Y8QA 1O97C 4PLVA 3MAAC 4YQZA 2F8TA 5T4HA 5LNK6 1BMFA 2QRGA 2HRDA 2HRQA 4EHHA 4WE3A 5B53A 2P4HX 2XTAA 3VBCA 4YRMA 3O91A 3FI9A 5H68A 3ON5A 2R6GA 4BB9A 1GU0A 2AOWA 2H2FA 4G6ZA 4B6FA 2EP7A 2Z04A 3UOWA 3VR4H 1ADYA 3LHSA 1KL7A 1WP4A 3IT0A 2RFLA 4XTRA 5B12A 2O8FA 1ZYUA 3FRJA 3LFUA 4K40A 3F2IA 3SJUA 3HM2A 4I4NA 1SBCA 3UTCA 2HSEA 4UMEA 2ENUA 3WOHA 1T9GR 3V4ZA 2WINI 1HFJA 1W49A 16PKA 1QS0A 2D1FA 3URMA 1K2VN 5AQEA 9LDTA 4P0PB 5DGIA 1U11A 2O2ZA 3R24A 3WL3A 1M2WA 2DCUA 3OJCA 4QTUB 1GU7A 4XTCS 2NZ2A 5LN1A 2GYUA 5CLQA 1E96A 4Z4IA 4HQ0A 4QO7A 3Q4GA 4DLNA 2VYND 1G4UR 2F00A 3MWDB 4BHTA 2X0IA 2AQHA 1G5RA 1M1YA 1VBNA 3A1UA 3K35A 4F9GA 4MGYR 4X1IB 4KITB 5JT1A 3LC2O 2R7MA 1Y1RA 4OLJA 4MSUA 3HZHA 1JT9A 2XB8A 1A71A 1H22A 2QUHA 1QLJA 4H4CA 2ZT8A 4DQ0A 3B3QA 8OHMA 3NDRA 521PA 3VPBA 2OFXA 1PT5A 1NSYA 1BW9A 4FGUA 4FOTA 4N9QA 2NYAA 2CHEA 1EE1A 2GJAA 2F3QA 4LMPA 1TMGE 1RACA 1UKAA 3A1SA 3DD1A 4GPD1 5FR1A 2I1WA 1WUHS 3LF2A 4HATA 2GBGA 3TAUA 4NU5A 2BBTA 1AN9A 1XWWA 5DCYA 3IULA 3TN7A 4C7OB 2RHMA 3G0DA 3O8QA 5AKEA 5HX7A 4L85A 1CT9A 4ARZA 1FMCA 1U2SA 2IHJA 5TPWB 4ESVA 2WAYA 3H99A 3QE3A 1PS0A 1QB7A 1QIDA 3K9QO 1CP3A 1G0NA 1L9XA 1FJHA 1MPTA 3AMVA 4E51A 1S2LA 1TVEA 4HQRA 2Z6UA 3N86A 2PLAA 4KK4A 4F93B 4H1TA 2WVAA 2O0MA 3GLIB 2O50A 1C7QA 4I5EA 1V5FA 2J59A 1SCUA 1UXKA 2O3TA 3K0AB 4IRUB 1FP6A 2DY0A 4MV1A 4V0ME 3UV3A 3VZBA 5JAPA 4XQEA 2Q1WA 1XFDA 4HWKA 1QQ7A 4ZQEA 1Z2AA 3V1TC 1FRVA 5KINB 1A27A 1QG0A 1TJPB 2NXJA 4ZKDA 1OR8A 1J8VA 1SOVA 1QS0B 3OM0A 3FSJX 3OPYA 4CF3A 1I7PA 3H9UA 4KWEA 1XTVA 2GUGA 5KEIA 2FPPB 1S3IA 5DLPA 2AEJA 1E6EA 3HSSA 1RJFA 1SXJE 4RXTA 4RXMA 3VTZA 2OYSA 3LBYA 3I9KA 2K87A 2PEZA 3GYBA 1E6WA 4OATA 2O57A 4TS4A 5F33A 5C4GB 3A11A 5AVUA 1QP8A 3CE9A 3CIFA 5EJ6A 2VPYA 1JN0A 1WEHA 3NUQA 3EZ7A 4Z9FA 4F85A 4W9MC 1YOBA 2CLKB 3AVXA 1QDLB 1UKEA 2RHGB 3AFOA 4ESHA 4KR6A 3IJPA 1EJBA 2OOSA 5K0LA 4BNWA 1ISPA 1EVZA 1L5GB 2EX1A 2PX3A 4KE6A 4OB7A 4FOOA 4CDMA 2LE0A 1YAHA 1ZOSA 3LDHA 1S8FA 4GPEA 4QTZA 1TKRA 2RARA 3C4QA 1BOOA 4XD2A 3MUFA 4LYFA 3SQNA 2MSWA 1Y1PA 4KR0A 2RHWA 4HGPA 1TE2A 2OBLA 3N2EA 4BFYA 2EBUA 3EPKA 1EUCB 1NSTA 4LSGA 2P78A 4Q4DA 2CHGA 3DB2A 4ZHQB 4CIBA 1OZAA 3RSGA 2F3UA 1V25A 2WSSA 1L5NA 1FB5A 1X2BA 3LBAA 4B75A 2A8YA 1PBTA 4RY9A 4YT5A 2LCIA 4RKEA 2AN5A 4FHGA 4F9FA 5DK4A 1J2YA 1QGYA 5LOVB 4QUKA 1Y1TA 2BLNA 1UZLA 3VKWA 4NF2A 5CB4A 4DIEA 2ZBVA 3DQZA 4O8CA 1TB4A 2PL9A 2IKQA 5ALLA 2ID9A 4DANA 4BGEA 5FTLA 2X5JO 4A6DA 3HXPA 721PA 1X92A 4TKVA 2YTZA 3NHYA 1KEUA 2X0RA 1V95A 3W5VA 4MWBA 5TMPA 2YL2A 4PZYA 1PL0A 5EPUA 4OV6B 4UQOA 3VOSA 3JWEA 1OXBB 2LIPA 1NR5A 1DI0A 4K9PA 3IMKA 5AYVA 3WJAA 1GAJA 1V5IA 2IELA 1R50A 3AESB 3C6ZA 5FV4A 1GCUA 1FP2A 4HJRA 3T52A 3L0IB 1GL9B 4QDZA 5AOAA 3KQYA 1JZQA 2P9YA 3LT2A 3RF6A 3C7CB 2J0UA 1XCOA 4IIJA 2JZCA 3I9OA 2BFMA 1YJQA 2DPXA 1NOKA 5K0FA 3I9NA 4ZFNA 2HTFA 2XQGA 2QLBA 3A27A 3UM9A 2F4VB 1TQ6A 1DVRA 3EEFA 3P96A 3WLFA 4PN7A 3KLNA 3H8VA 1SVWA 3BB4A 3OCZA 4AN0A 3A6ZA 1O0CA 2QT9A 3D6AA 1CUYA 3EUAA 1XI2A 3QXSA 3RWBA 5IDWA 3R5HA 1AXRA 2G1JA 5BSRA 4BQNA 2QU7A 2XQJA 3TS1A 5B3LA 4ITVA 3LTNC 3I61A 1A9ZA 4TWBA 2D7DA 2G3YA 3O03A 5T41A 4LYJA 2OUKA 4PYOA 4PFJA 1UBGA 3GLVA 4ZO8A 2P6RA 1JILA 3ANXA 3G68A 3ANNA 4H4EA 3OFKA 4XWKA 4G9BA 3PWTA 5DM1A 5ALKA 5IZCA 3GBPA 2F1KA 5FAKA 2XUZA 4IG4A 1KVQA 3DVAA 1I3LA 3OSUA 4L0QA 3WL6A 4BZPA 3ZYZA 4QXQA 1T4MA 1GDHA 4TRRA 1V7QA 2RHRA 3RKUA 3M6VA 2QRUA 1W35A 1ZN9A 1BWSA 2H4FA 2NAPA 3NUZA 4BO1A 4CVNA 2E4YA 1SHUX 1HR0B 1U0HC 1KBOA 5DEIA 2DERA 2JARA 1BWPA 4CRWB 4EITA 3M5WA 5AK6A 2XCSB 4FU0A 3MTGA 4KO3S 2ZJYA 3TEMA 3R5JA 3BFXA 4XWOA 3CO5A 4N6NA 4MWSA 5JJKA 4BQFA 3VISA 4M9RA 3ZLTA 2D5CA 4NENA 5TMBA 1XVVA 2ZTUA 4YMUA 2GBFA 1K5DA 1A1VA 4Q3KA 1Y7IA 3PB3A 4GX5A 2O8EA 3VNVA 3HMKA 2ZM5A 5MDHA 1YR9A 4ISCA 1HE1C 4MVJI 5T6BA 4YT8A 1RZVA 2H5IA 2VPPA 1MOZA 4AC9A 3A31A 3OLQA 4AG5A 5FOSA 3EDOA 1VGRA 3ELYA 1DJLA 5KJCA 5GTDA 4CKCA 2DPGA 3OWHA 1G1MA 2FA9A 5G0UA 3FDIA 5BR8B 2WAAA 1PZEA 2OBMA 4IZOA 4W1PA 3R3WA 4RS4A 1A8PA 3UT5A 4QJ3A 1M0WA 2CXQA 3A04A 4RPKA 5ER9A 2AZMA 3QEMA 3VJKA 4G67A 3EWIA 1AQJA 5DRYA 3TLZA 3JYQA 4YV7A 1T2FA 5CD9A 1O58A 1YZ3A 4EI9A 1V4VA 5G02A 3OCWA 1CUZA 3Q9LA 5FPHA 3UAWA 3F7MA 4JMPA 4R1QA 6ABPA 2ZB3A 3C14C 4FFOA 1PG2A 2Z4SA 3E9CA 3EVFA 4UUOA 4OGKA 5IEBA 4G5YA 4KE7A 4M9ZA 2DQYA 1LSSA 4ZOQI 3OCUA 4PZLA 1YS4A 8ADHA 4MGEA 1K6XA 1D2CA 1OXMA 2HC9A 1Q12A 4HOYA 1N0UA 5BOVA 2XGMA 3IE1A 1GKYA 3G0CA 4F56A 3ST7A 1UBNA 3PXAA 4JQSA 4LJ8A 1Y3AA 5EUQB 3HJHA 1TA0A 1A77A 3PKIA 1J1ZA 4L9AA 2FR8C 2VXCA 3ZVKA 2UVDA 1TF2A 1ZD4A 3PNVA 4PICA 2YYZA 4QGHA 4CUKA 3M9LA 3UJ8A 4DA8A 1R4NA 5ALNA 2H1LA 2IPNA 2IUYA 1QRDA 3HVJA 3IPCA 3LUDA 1I2BA 4UHKA 3U0BA 4BN4A 2D2XA 4ZZ0A 4B3BA 1EVQA 2O23A 1WV1A 1K7SN 2GJ8A 3U9TA 2Z6AA 2B98A 2OD9A 3UKOA 3A7DA 1RJEA 4EQ6B 1NN1A 2EDCA 3CPJB 4ZVKA 3V8EA 1GGFA 1SA0A 1CVLA 2CN1A 2HWXA 1ZQ9A 5JI2E 4D4IA 1VA4A 3GLHB 1WOYA 2CFCA 2RHDA 5IW8A 4I5GA 1GG5A 4JSRA 1FCJA 4NBLA 3PGVA 2C83A 4QAJA 2BM9A 1SZPA 3RUDA 3ZWOA 3ZHTA 2XCTB 2ZYSA 3EEYA 1PK7A 1IXZA 1B00A 3VUEA 2Q9UA 5J5VA 2GM3A 2GN9A 1WU7A 4P4GA 1WPQA 3I8OA 3QVGA 4EA9A 4QGSA 3WL8A 5DTEA 2OENG 4RXUA 4Q3AA 3QPWA 4PG5A 4EUFA 3BGVA 2I87A 2Z1NA 3R6LA 4K6CA 4GDFA 4C0JA 2ZE8A 1XIVA 4QG3A 3FLEA 4MW6A 4U7HA 1PVVA 2ZSAA 5LQKA 4II2A 3THSA 4YFVA 2C2YA 2AXQA 4EP1A 4F5DA 1U7OA 1RZRA 4TRMA 4BBAA 2B5OA 3V80A 1A8UA 1RIFA 5BN3B 1TGVA 4O4IF 4CN8A 1O5TA 3DV0B 4IMPA 4RQTA 5SY4A 1QONA 2LP4Y 4DEYA 4IEEA 2XKJE 3LO5A 4JI4B 3IUYA 4LNAA 4EEZA 2DEUA 2O0JA 3AL3A 4J03A 4JUAA 4DPMA 4QM6A 2IYSA 2NQ2C 3C5HA 3MCAA 4P84A 1A2OA 2VOJA 2QE7A 3V4SA 2WE8A 2O19A 5D85A 2H92A 5D1HA 4NE9A 2PMEA 3T9EA 1T24A 1VSBA 4NU8X 4O08A 3WSTA 4GYJA 1NVTA 1SMKA 4GYWA 2AJ8A 2FWMX 3O7WA 1L4EA 3GW8A 3I01A 4F6RA 4OEHA 3S68A 4R0MA 2HCTA 4TL7A 3SLKA 5IDVA 2QT0A 5L51A 2CSXA 5TE9A 1SU7A 4XGKA 2CB9A 2QQGA 2HLDD 2IH5A 1QH9A 1V7CA 4B8WA 4QGAA 2XIJA 1CQJA 2AD1A 2H16A 3FSRA 4DADA 1R2QA 3IEMA 1N8KA 1PJAA 3U17A 1E3DA 4RZQA 3VU8A 1KFEB 1VKZA 2C00A 2NU6A 3KCQA 4IMJB 3O38A 3OETA 4CE6A 4V0OA 1A0OA 5T8KA 1Z5WA 4K28A 3VZDA 1KSJA 1VLQA 4FHFA 4ZEXA 1E98A 4TVSA 1Y8ZA 1YULA 4CCYA 2PGNA 4LXGA 4LC9A 1TT5A 1A3CA 1AUXA 4U7TB 5LOVA 3ICVA 4DIKA 4MVJG 5J43A 5ALGA 4XQ0A 3OCVA 3NVDA 4AURA 1JA0A 4MK4A 1O8CA 1MH9A 2C7PA 4KQ2A 3RVDA 4Y6QA 2C94A 3CLRD 4MEAA 2WA1A 4XWAA 4PQEA 1I01A 2D06A 2XUDA 3ZDQA 1XX6A 1A4IA 4BFZA 3STVA 2PMKA 4MYRA 1ZMRA 3U44A 3WBKA 3FGNA 4J1SA 4XQ9A 4MRNA 2C7VA 3ENZA 4M6WB 3RRJA 3SEAA 1SIOA 2QM0A 2YICA 4F4IA 5KNDD 4QVKA 3MMZA 5AW6A 2SCUB 4HNTA 1QO0A 3KHSA 3GDOA 1A1SA 4DMCA 4Z4HA 2C4HA 2O8CA 4HDMB 3U3MA 4DNPA 4E2ZA 1S2IA 1UM8A 1WQ3A 2JAUA 3E7XA 1K7YA 2PUWA 5FEUA 3KUKA 3WMFA 1QFMA 4DMHA 2IHYA 2LPMA 2ZUSA 2CK3A 4DMMA 3PE4A 4PR3A 1YZKA 3D2AA 3SC6A 2ZT5A 1QZ3A 3CUTA 4CQLB 3SM3A 4ZCLA 1NQOA 2O1EA 3B9PA 4MV8A 2NUPA 2PH7A 4MJLA 2O06A 3FBWA 5AJVB 4JP8A 5DGTA 2ZITA 3DPSA 4UQPA 3IR7A 2DHRA 1M2KA 3W2TA 3X1JA 1NXOA 5J40A 3W4JA 1F7VA 4MKRA 1Z88A 4C1BA 5LIRA 4YUWA 3FZNA 2AW3A 3GPDG 3KO8A 2G67A 4YRQA 4ZVMA 4A16A 3VYWA 1MU0A 6REQA 4RTPA 1B3BA 2BGTA 2JJ1D 2CUTA 4NICA 4IH4A 4JSYA 2PQMA 4N18A 3P9YA 4ZTBA 2G4CA 3FCXA 3SIRA 1A69A 4MUGA 3UWOA 2HK7A 5FPKA 2Z5FA 4EG5A 3KPUA 3E7DA 2GJ9A 1QE0A 3K5WA 4MW0A 2P1ZA 5MN5A 3QYJA 5P8WA 3DAHA 3NWJA 1CJTC 1DEOA 1TIPA 1UJ5A 2IXDA 4N1AA 4PX5A 4TWRA 5EJFA 4ESOA 4XM1A 4LOIA 1N6OA 1C9JA 4I4CA 1XD2A 1CJKC 2HY7A 1JIUA 4MIKA 4ZOEA 5GJWC 2EFEB 3IQXA 1DV2A 5A03A 2P4UA 3EDMA 3DEHA 3K1JA 2QP9X 1FOEB 1M6HA 3DBLB 4E5YA 2Q5EA 2H4XA 4RGVA 5LU8A 1TMYA 3QE0A 4LQ4A 1LPAB 4CTNA 1Z4OA 4FDLA 1YF3A 1I94B 5H9VA 1T8PA 3VMMA 1A9XA 4R1SA 1Z2CA 2NXWA 3F47A 2C0CA 1QXSA 3P19A 4QXOA 5CT5A 3SCZA 3NI2A 1IUKA 1DCFA 2W2KB 4HFMA 3RU7A 3WKBA 1RCFA 1Y4DE 3AZPA 1FMTA 1KZGB 1Y81A 4WLOA 2M6RA 1SXJB 3HCFA 3TKLA 3LA6A 4KLZA 3DDUA 4KCGA 4CR6A 1S4QA 2OCPA 1E0DA 3D8RA 1IZ7A 4QODA 4CQLA 4HFRA 3RIHA 3KL2A 4G5RA 4O02B 4UU1A 1U0JA 3VHQA 2OQVA 1FL9A 1FSZA 4NXNB 5K51A 2GNPA 4FFSA 1D2HA 4UU8A 3HZOA 1UBSB 4YCCA 1H65A 1NKTA 3PUZA 3EYWA 4M99A 2RHTA 1XRPA 1H2AS 1G1AA 1N1DA 2I22A 2VDNB 2VS1A 1II8A 2OXRA 3DH0A 4HDOB 1EUDB 2R0QC 4HVAA 4K2HA 1CR6A 1GZ4A 1CG6A 2AJDA 2DFKB 3B2QA 3IMCA 4LRUA 3K2QA 1YUBA 2RDMA 2XVZA 3O9MA 1PU2A 4HDSB 5HKKD 1KI7A 2XMSA 4B3IA 1NURA 2C03A 2GPJA 1NKSA 3G2JA 5C80A 1VJDA 2FN9A 4OXIA 1WBBA 4LHWA 1O7JA 4M3NA 3UJ3X 2IQ5A 3CBGA 1LPPA 3MVEA 4JIGA 4PGAA 3WP0A 3AHEA 2F43A 1BTOA 4MWZA 4E03A 3JVUA 1C7EA 3FYUA 2PR7A 5HOQA 2CFSA 3EXIB 3MCWA 1A5TA 2BSQA 3UY4A 1GPBA 2JD1A 1NDUA 2TMDA 4D46A 4ILEA 1M0TA 3AQIA 5F4ZA 5GOZA 2VNSA 5E38A 3HI4A 2A9RA 3KHUA 1UMBA 3I64A 4YJDA 3CU5A 4RD1A 1NXPA 3IDZA 4EVIA 2J4FA 2JD2A 4KAAA 3CH4B 1J49A 4BO2A 4JK3A 1WDTA 4LZOA 1QG2A 1S2OA 1O8BA 1Y9JA 2NVBA 4YRNA 3A2LA 3R44A 1ZW6A 1NE2A 2OO5C 2Y0DA 4FFWA 1I7QB 4C04A 4HBZA 5L7WA 1FXWA 2BJWA 1YKGA 4R9UC 4B83A 4F2GA 2EEZA 2H2HA 1B1CA 5KOHB 2GBLA 1KY3A 3HRHA 4XFDA 3E23A 3W9SA 2HMAA 3X2SA 4RTOA 5BSUA 2JK0A 2YWGA 3F4BA 1L4GA 2O4CA 4GO1A 1LDBA 1QDUA 1XU9A 3FIJA 4RVDA 1Z0DA 4G0NA 5E8RA 3PQ4A 2EJWA 3IDAA 4ZOAA 4EI8A 2HLNA 3U37A 3EFEA 3CXRA 4UMFA 3P0FA 5ALSA 5KVAA 4J4TA 3VVBA 2Z8ZA 3DGEC 1CX9B 4MGKR 4Y2GA 4DV4B 4H0FA 2FCAA 5B30A 2W58A 4S0ZA 1ZKDA 4U0JA 4YV1A 5JALA 3QHAA 3O9ZA 3L7KA 4PS1A 1EI9A 1ZZGA 1N2CB 1QC5A 2I29A 1ZINA 3IQIX 4REMA 4RL4A 1RDFA 4GSKA 5K8TA 4IHJF 4PSUA 2AFHB 2NZVG 4RJ2A 4EFMA 2XXAB 4QZVA 4ZQBA 3CR8A 5DHSA 1V8BA 5DPMA 2D3TA 4D1YA 2ALJA 4FW9A 4INAA 3O1IC 4MAAA 4NJEA 3TZCA 2XCRB 1A5ZA 1SN7A 1DOHA 4UEJA 5CX1B 4L5JA 5DCWA 2ESRA 4AVYA 1V45E 2XV1A 3MXOA 1U99A 2A0YA 1GFWA 4ZO6A 2A0KA 1B3RA 1S01A 3ANYB 1ANKA 1TJ3A 2RAVA 3HPQA 4OLHA 1WSWA 4LGYA 3RVLA 2JGMA 4QICA 5CRIA 1FNSA 2NTYC 1MX3A 2IZ0A 2WM9B 3NXKA 3AHGA 3T5BA 1H6AA 3PQ5A 3W5CA 3DCYA 1M1XB 4NNOA 3OF2A 3F97A 1Y48E 4D4LA 1WQ4A 4MVJA 2QM3A 5HHTA 5JZVA 2JLRA 1SXHA 2JIDA 2PKCA 4GHWA 2GARA 3IPRA 4FWBA 4LXUA 5T4EA 2PGJA 1Z75A 1P6QA 3CCCA 3CKMA 5H4HA 1BFDA 1KYYA 3LYAA 1GTL1 3FR8A 3SNKA 1J4AA 3S8EA 1DQPA 2ZIWB 2OHIA 1C9DB 1YU9A 3ZX4A 2D4HA 3ED5A 4CTMA 2JRCA 1M83A 3ZWBA 5ADHA 2BY4A 1Y3FE 1Q3TA 2CLMB 2DQKA 3AGPA 3MWLA 2YX1A 4E1BA 4OSEA 2QLFA 3A8TA 4ZYYA 3OICA 5JBIA 4P54A 3RTGA 3FOBA 4XGNA 5AI0A 2VZEA 3PF8A 5JXHA 4DM7A 1HYQA 1ILWA 4H1VA 2AG8A 2CNLA 1R8SA 1NOIA 3EFHA 4JI5B 1AH2A 4IFEA 4F5WA 3IEPA 1FVOA 3NEPX 3PNLA 4K86A 1QHHA 5B4TA 5JYCA 5EQTA 2PDAA 3AEKB 1HE5A 1KO8A 4XRGA 2HU8A 1PDWA 4BB6A 1K8ZB 3CLSD 1U8CB 5KNCH 5A1JA 2AKAB 2Y1GA 4AKEA 5H3LA 3HCAA 1EK6A 1QTRA 1R6AA 2EHDA 4CL2A 3OWOA 4TVBA 4FFPA 1PX0A 4EW2A 3WHPA 1R0XA 1QAMA 4U9HS 3ELDA 2CD7A 5IP5A 4MMZB 3VTKA 4BNLA 6YASA 4X44A 4L3VA 1TT7A 2G1UA 1SCJA 2ZDGA 3EMKA 4RLSA 2FN3A 1Q17A 1I5OA 3NWBA 1VIAA 3OSZA 3G23A 2HLDA 4OA8A 3R40A 3Q8MA 1UMCA 1WMEA 1QZUA 1XMXA 2IBSA 1MTOA 2IVZA 3QUTA 1L6IA 4EB3A 1XDGA 4X85A 1T3GA 1TO2E 2V65A 4R8VA 1Q84A 2WG0A 4MTLA 1FW8A 4XARA 1FUKA 4YEDA 1XN1A 1DBRA 2NVOA 3HDYA 4EZBA 3GAFA 3W79A 4CEHA 3F8TA 4WWHA 1U8YA 5HILA 3VNUA 1XNRB 2YIJA 3R6DA 2AMVA 2PLNA 5CDFA 2JHGA 3KTDA 4OXNA 1OASA 4Y2YA 1YXMA 2KM1A 1M34B 3JWJA 5T4BA 1WXHA 1OF1A 4BC0A 4DILA 5ELXA 1GQSA 1EIZA 5C34B 4ENSA 3FOZA 3QVXA 2IF0A 3CX7A 4ZAWA 3K09A 4OLBA 3P2IA 4DCNA 2EQ5A 3JQEA 2F1IA 2IQIA 4TSFA 3EGXA 5HF6A 1V8FA 4EHNA 3AV3A 3SC3A 3H1TA 3JZFA 3IPXA 3NOVA 1P8JA 2AEMA 4EJFA 4II3A 4L76A 3T8YA 3SJZA 1BMTA 3E22A 3KPYA 1U2QA 2C5GA 2W2QA 3F9RA 3RYIA 5J3JA 3NOXA 3L1IA 3NMUF 2YJ3A 1W30A 3L18A 4HNHA 4JH0A 4Y3UA 5EFZA 3UC5A 3OMWA 2ODBA 3FHJA 1CNMA 4NVRA 2C9DA 5E95A 1G55A 1YL6A 2RHJA 3NRBA 3PHIA 3VI3B 3KSZO 1DTWA 3ZLUA 1E1RD 8ABPA 1WXEA 1F20A 3O3OB 4KXLA 1U3TA 1O9GA 2H7VA 1GPAA 2JK1A 3SDSA 3PKJA 5HCIA 5L4SA 3DDWA 2VXOA 1ZWLA 1Q7TA 1DAEA 1Y34E 3GUYA 4HAIA 4RX1A 5T4FA 4BFCA 1RP7A 3E84A 1UZAA 4Q34A 4TV9F 5C0OE 5BWLA 5IN4A 1HOXA 5CXUA 1KMHB 3CRVA 3K53A 3PXXA 4IZIA 4AJ4A 3UUEA 5A62A 3FZQA 1NBME 3FNFA 3H3FA 3HCWA 4MO2A 3T4EA 1ZD1A 4JT2A 1EXMA 1NIPA 2Y0CA 4AO7A 1E0AA 4KSCA 4DCMA 3SX4A 2R7AA 4K88A 4KLRA 2NU7B 1NU6A 2CVHA 1ARZA 2FNAA 3AP3A 1N32B 4Q6WA 1EUCA 3C6XA 4KQWA 5EJ5A 3UAGA 4DR2B 2CF6A 3RS9A 4J7UA 3VAYA 3HU1A 1PJBA 2P41A 5CX4A 3NVKI 4HLUC 3CNHA 2Q3EA 3UV7A 1T6BY 2YUTA 2GEKA 3OPYI 4GP6A 4W6ZA 3TG2A 1GKUB 3G17A 1T35A 3R0JA 1ZNYA 3J81k 4F84A 5AESA 5HJ5A 1RWKA 1NBEA 4IDPA 3FFWA 3WRVA 3SS8A 2FZ5A 2WUDA 2IS4A 2QRLA 3EMDA 4IFIA 4TS3A 5DISB 3LYHA 3F3YA 1U8ZA 1OTYA 2OZLB 2ZYHA 1JLLB 3BCRA 4ZJUA 4BPBA 5JROA 3MCUA 1NI4A 3MOIA 3OMLA 2FZGA 3S2GA 3UBMA 1TA4A 1P7YA 4R1OA 4Z0PA 1GZVA 3AF3A 2MSNA 2RH8A 2PWYA 4CXMA 4O2LA 3AXSA 4RVFA 5EFOA 3G9XA 3L4BC 3FWHA 1B0AA 1DIOB 1G2PA 1CZLA 4C7KA 1CZHA 5D84A 4MVJH 1JJAA 3B5EA 3ECSA 4PHGA 5LCXA 4ZGBA 3K94A 1JEEA 1U9YA 5LU9A 1FYEA 2ZSFA 4PLWA 4R5MA 1FXWF 2C54A 4X1IA 5I9MA 3PTAA 4IVPA 4DR3B 1ZICA 3E7WA 1TEHA 2C2HA 4KQ9A 5KYXB 1UDBA 2A5GA 3DLCA 4LEIA 3W6NA 3SXJA 2PD3A 2HWKA 2IYAA 4I5IA 1Z4JA 4AFNA 4P7BA 1MFPA 3ZBQA 4MYDA 5B1IA 1MC1A 3JAWB 5I4CA 1BNCA 3H04A 1KAEA 3FX2A 2ZBDA 1U9CA 2FW9A 2V6JA 4P5DA 1T8TA 4AQDA 5FPYA 3B7GA 4JHXA 5AH0A 4B09A 3OPXA 2DAPA 5C7OO 1QRRA 1QYIA 4N0QA 1R0ZA 1Y9DA 1ST3A 3W34A 5LYJF 1I2CA 2P7IA 2EZTA 2UYQA 4D98A 1UPFA 2GD2A 4UTVA 3ZZ1A 3I05A 1GU1A 3QXHA 5GM1A 2EW2A 3Q6IA 3RV4A 4LF5B 3WYBA 2G04A 1I2AA 4Q18A 5A5EA 4W5RA 4FS8A 1BD3A 1V1MB 5LMUB 2GFQA 4PXYA 3IKLA 4PNEA 2Q9AA 3GI1A 3HYLA 3ZU2A 3TNFA 3BMXA 5H4GA 1WKBA 4O2AB 5F1KA 2IEDA 2JEOA 2WB4A 3BH0A 2I4NA 3OY7A 3WGHA 1ZAYA 1P33A 4DCTA 4FFBB 2DR2A 2BRUC 3FVWA 4K6MA 2I2WA 3DHEA 4NFLA 4KO1S 3KOOA 1BQEA 4RZHA 1OA0A 5C2JB 2VQFB 4G81A 3RJMA 1UT8A 1II9A 2R5FA 4HNGA 5FKJA 2ONJA 3BMCB 4BJ3A 1X74A 2DBVO 4INOA 1FVFA 5FOUA 1M8FA 2XAUA 4OYRA 4GMGA 1QH1A 4JLDA 4KC0A 2JLUA 4TLAA 2QT1A 4RIFA 5K8LA 2VPZA 4MRSA 4AKTA 2C5BA 4D0LB 3ZWMA 2QGNA 5HR5A 1W73A 3HP7A 1RRPA 2UDPA 3A58B 4H77A 3S2FA 1RU3A 4AUNA 4ZDKA 5IUJC 3F90A 1O2DA 1RYNA 3PYXA 4KP7A 2FR8A 4JITA 2OYRA 1JDUA 3WZ2A 1QRSA 3RC8A 4NH0A 5JSUA 2HJVA 3DLIA 4B4DA 1F6WA 2PUEA 1C4XA 3BT7A 3ELBA 3KSRA 2JFWA 4LE0A 1FFXA 2B9VA 4X1KB 3R76A 2HNAA 4DCVA 2ORIA 2V7PA 1BOFA 3RIGA 1ESMA 2GA8A 3FMGA 1HG1A 2IIBA 4LJ6A 1OXUA 1TEXA 3CZQA 3G7NA 5FLYA 4CLEA 2R79A 3TQTA 2QTWB 2RKWA 3PU6A 3UJAA 4F38A 3TW8A 1FZQA 1SCNE 3WIEA 2RB5A 3EGCA 4Y67A 4EFKA 2MSEB 2RAUA 5C18A 4EYGA 1X1EA 1XO1A 4XCXA 4AROA 1Q44A 4JU9A 3I30X 1TF5A 4DV6B 4D3ZA 2MMCA 5FNVA 2JANA 5DYNA 3S2UA 1RBQA 5I9SA 2PNFA 1KZ9A 3GAAA 3OZVA 5GJCA 1LW7A 2Y27A 4RPJA 1K9VF 3IILA 3T1TA 2WKQA 4FYMA 3RVPA 3F8SA 1CQXA 3VZPA 2VP5A 3D6FA 4FB4A 2EKDA 3R0IA 2IDMA 2HRBA 2Z8YM 2OC9A 3ESBA 3NYQA 4JYZA 4LRQA 2I65A 1VXOA 2J46A 4U7GA 3TXAA 5DCUA 1LC3A 4X6XA 4AQ7A 3C4JA 2IEAA 2Q7DA 5CH5A 3LRXA 6AT1A 3CZRA 1K8QA 2EKLA 4LMAA 3WB1A 1DIBA 4JUBA 1C1YA 1LLFA 3IGFA 1R64A 4MITA 2ORWA 4EG6A 2PANA 4UTPA 3GRZA 5BRJA 2Y1FA 5LZ8A 1XRJA 5C8YF 4CEHB 4O2BB 5E4JA 1M67A 3BD9A 3AF0A 2XTMA 2ZRDA 3FZYA 1H8HD 1F8XA 2FWRA 2XOKA 4RMGA 1F38A 3OTHA 3BGIA 4AKSA 1J22A 3EUWA 1Z8FA 2Z83A 3QF7A 4XKJA 5FBZA 1QVRA 4L8WB 4E6PA 3VU0A 3OA0A 4HT3B 2Z0MA 2VAWA 3M6LA 3MCVA 3K2BA 1ESDA 3CRMA 1YSCA 3QMWA 4OK3A 4DIFA 4P1ZA 4DNXA 1OREA 1I0IA 2FLWA 4HB4A 1UDXA 3UVEA 1EUQA 1WG8A 2IP1A 3BKXA 4U2DA 3U48A 2FDRA 3SR0A 5AXAA 1KERA 4CR8A 4DB4A 1EM8B 1ZXBA 4ZALA 3TKAA 5BMVB 2H52A 1G8KA 5K0TA 2FKNA 2QD4A 5JMPA 2ZBEA 3SX2A 2QMZA 4C4OA 4IXTA 3PUIA 4GMFA 4C7BA 1I6MA 2PXCA 3ER6A 1W5EA 1P0MA 2FEWB 4BE4A 1IUPA 3D8BA 3GNSA 4ZCTA 4AF6A 2HSJA 3K4PA 2EL7A 1T2CA 2JD0A 1Z6PA 3GMDA 1JKJB 1WB9A 1MZPA 3AY0A 2Y67A 1IK4A 4ZT4A 1D7AA 3PIRA 3NLLA 5G1PA 1DIAA 2W2LA 2W2VA 3VH1A 3E0QA 1CY0A 3IQZA 2YBEA 3TDMA 3VU9A 1NAIA 2WKRA 2R6AA 2B94A 1BH2A 3EVAA 1N5JA 1Q50A 1SG9A 2OP1A 5JARA 2QN1A 1KYVA 1R8YA 1XXHB 2Q5JA 3Q8WA 2DFDA 4A7PA 1PR6A 3P9XA 2I8AA 5E9JA 1SD2A 2GPSA 3FTNA 3EF1A 3OZAA 4CMGA 2OE2A 3C8MA 3OO1A 1MIOB 4U2KA 2C84A 4LJLA 1UDWA 2VWPA 4B0OA 4RWEA 5LD2C 2FMFA 2IHNA 2PUJA 5DW0A 4RO0A 4ARBA 3ZHUA 1Y0BA 1AQYA 3MHPA 4G65A 5EKTA 3WADA 3LO8A 3OQIB 1CUIA 1H3FA 2QUZA 4ISBA 1MA0A 3X1KA 3C3XA 3DD5A 1F4LA 4IX9A 2AYXA 4JXKA 4JI2B 3FTEA 2I4IA 4XGRA 4W9RA 2XDQA 3A70A 2D3WA 4DIUA 2Q1UA 3AHDA 3C2QA 3JZMA 2PL1A 4K1XA 4B6OA 4GNRA 3PNOA 3L0ZA 4RF4A 4JOBA 4CIAA 3T5GA 1L8XA 2AFHE 3N07A 3OFND 4I4TA 4GD3Q 4FOPA 5EMMA 3C6YA 4L15A 2AG5A 2QLLA 1F8UA 3D4LA 1P5ZB 1LQ2A 2JJ8A 3FOFC 2RE8A 2W6JD 3I6MA 1CNEA 3H2SA 5ED0A 3OECA 2MSKA 2DBZA 3K16A 1NW7A 4EY8A 4YNBA 2QIPA 4KJZA 3WS7A 4CDGA 4E5SA 4PG8A 5BW8A 2AYZA 1VM6A 2I3AA 1JDTA 1QIEA 2QTHA 2R00A 5HQJA 3BD6A 4PGHA 2OB2A 5KDOA 1PJTA 1MENA 4UDYX 5AD1A 3EIFA 2PXAA 3IDFA 3SGLA 3BGOS 4TQGA 3G5AA 5GY7A 2K6GA 3A37A 4AY6A 1W4AA 1U04A 3KJIA 4BU1A 1KIFA 4MROA 1NN0A 3HDTA 2COUA 3KDSE 4IS3A 2Q5QA 5H80A 3H5WA 4ZOLB 2ZREA 1T34A 1FUYB 1JFFA 4YUXA 3T38A 3FYUC 3GCGA 4HXGA 5KQPA 4HLCA 1KF0A 4IR7A 3YASA 2C2ZA 4FDUA 5CT8A 5CTJA 3BERA 1EUZA 1X8JA 5DNCA 2R1VA 4V0KA 3P7MA 3S7ZA 4EG7A 2IIQA 3AZQA 3NRJA 3X1ZA 4XDHA 3UJCA 1KS2A 5U4XA 4CMHA 2AHOA 1YL7A 4JQCA 3TSWA 3UAYA 1JU9A 4A5OA 5ARDA 1EQUA 3HKDA 5B1SA 1UWCA 5KHAA 4EVRA 4KV9A 2CDCA 4GGOA 4J9VA 5CA0F 2C2XA 1MJGA 1K75A 1U3GA 4AS2A 4C0WA 3BS4A 2HPZA 3BWBA 3HVKA 4HS4A 4XWGA 3X1WA 1LBSA 2FPRA 1Y80A 3RS4A 1T1SA 4DG8A 1XAIA 4FDMA 1KZHA 2CF5A 3E18A 4OQ4A 1EFHA 1Z13A 2YHIB 1R0YA 4O4IB 1T5HX 1ZJ6A 2BEWB 2IU3A 4ZIRA 5HS4A 1NN3A 3BE8A 3FPEA 4QDUA 5HZHA 4O8ZA 3BL8A 4LZLA 3AEXA 4P58A 1IM5A 3DNFA 1OZFA 1N2JA 4YAJA 1TUGA 4DNFA 2E89A 3WXMA 2CLEB 4DDKA 4HAUA 4Z6KA 1QIFA 2DLCX 5A4DA 2TYSB 1T2UA 4GU5A 3GLFB 3Q8XB 4BN0A 2DHEA 3WDLA 2OQIA 5I7EA 1E5XA 3KT6A 4CMJA 4EIWA 3U4QA 4URHA 4IIVA 2H5LA 4EHBA 3TD2A 1LPNA 1VFPA 1G8HA 1RQGA 3HFRA 2CV0A 5C8DA 3IVRA 4P3XA 2ZWMA 3WMXA 1TMKA 4NBNA 2ORYA 3TINA 1GLGA 2HADA 3FYCA 3IA2A 5A3RA 4FR2A 5AUPB 3QMPA 3EAQA 2NUPB 3B1VA 5IKOA 1VHWA 4WW0A 4EW3A 5L3SB 4IKEA 1CY6A 3T7RA 1XN4A 1AQLA 3I2JA 1EZZA 3E81A 4NPAA 2A5FA 3C5EA 1V71A 1LJ8A 2WU8A 4M9CA 3TVTA 3A6HA 3E3MA 4B47A 5KTPA 1OLXA 2ZWOA 2YWBA 5CH8A 3UMFA 1BDIA 3MUOA 3GA0A 1A76A 1PWZA 1COWA 3KTFA 3CKKA 5FFMA 1PV4A 4M8SA 4NPHA 2Q1YA 2QAGA 2FZVA 5G0TA 4ZC1A 3TQCA 4DREA 1NBMD 1ZNXA 5FI3A 1YJAA 2AFIA 4RLHA 5CIWA 4P3NA 1GV1A 3RYTC 2C5EA 1TU3A 1G5IA 2BGWA 3RRFA 1UPTA 4ADSG 2IS6A 3LD9A 3GLIE 2P2GA 2DPMA 3C8DA 1N6NA 4NEQA 4C08A 1QDEA 2B6NA 4XIGS 5J4LA 1F9AA 1VQ1A 3N0RA 3V8PA 4ZYZA 1M1YB 4FGZA 4OHOA 4WMLA 3S2YA 5T3YA 1XG5A 2W5UA 2FLVA 5K3AA 1W6RA 2BHSA 3DE4X 3KR9A 4HL6A 1ZRSA 3I6QA 4Q1DA 2XH8A 4EHAA 9MHTA 3B12A 4OFBA 3E2IA 2YR0A 1KOJA 3D6JA 2AW5A 4QFBA 1H2ZA 4Y9TA 1NL3A 2KLBA 5E6RA 2JNWA 3N6VA 4DSAA 4H3SA 4ZYWA 2V4UA 4PPFA 5K45A 3K9LA 4UXJA 1SR8A 1TYAE 1YB6A 3CLTC 3U26A 4KR2A 1WXIA 1Z62A 3L79A 3LZ6A 4DUZB 4OLFA 1NMSA 5ECYA 1YZVA 5HCNA 4YAWA 4GM4A 1ZK0A 3HB1A 2GK6A 5I9BA 1H6CA 2CJFA 3LUFA 3EDRA 3MBOA 4RK7A 4YTEA 5DXFA 5FWAA 3LUJA 1SO8A 1K3UB 3LLMA 2VUHB 3EC1A 2YJ6A 3PA6A 3PHBE 4B1FA 4WZBB 1NVVR 2E4UA 4HC4A 3HYSA 3ZWNA 4KQEA 5BQXA 4FHDA 2A0WA 3L7CA 1VCOA 1XJ5A 3DUFB 4WJLA 5CB0A 1EWQA 3SHFA 3K6SA 4XUCA 4PSCA 5EWJA 1EXNA 1RYHA 4GRIA 3KUXA 3NXSA 4WESA 4JELA 4EI2A 1R4ZA 1EPUA 4ALKA 2BHLA 4CMKA 4E5MA 1BMQA 5BRAA 1B0ZA 4J16A 2IP4A 3BIWA 4PGGA 5AHXA 1QVWA 1GYQA 2YWFA 3UXEA 4LNUA 1HTWA 4R16A 3AVOA 1O96A 1T4GA 5DM60 3Q1LA 5G0SA 3ROZA 3TOCA 1AUPA 3W2EA 2YOFA 3RS8A 1BGVA 4M38A 1J2UA 1FBNA 3ILSA 5CEFA 2PO7A 1IY9A 1CF2O 3AEZA 3BHJA 4H16A 4RVUA 4JA0A 2WU4A 2XRFA 5F64A 3S4YA 3HA7A 5FQOA 3U62A 4DLRA 5ALDA 4ZZ1A 1MHPA 3AIIA 4KTVE 1M7GA 3IA7A 4Q21A 5CLIA 4BX2A 1BU8A 1Z7EA 3KB1A 3QVVA 2IS1A 1WF3A 3IAAA 4LOAA 3ZXUB 3JQGA 1FFYA 1MJNA 4F5YA 4LDNA 1I13A 3TD6A 1U8UA 4RTRA 2H85A 2Z5LA 2GT1A 2ZW9A 1PFWA 1OT5A 3GRRA 3PEUA 4Q4LA 1NLMA 4RM2A 2AVNA 5T64A 2V3CC 4YP7A 3KV1A 3DMYA 3FFTA 2VAMA 3H9CA 3LDUA 3CH6A 2X2OA 4BLPA 1IB0A 2J6BA 4CGZA 4K3UA 3VXKA 2X3YA 2GJ4A 2XJ9A 4YWHA 1P2GA 3VPFA 1WTAA 2WA2A 2P4EA 1PJQA 4CM7A 1JXMA 1WB4A 1YGPA 3AW8A 1VOTA 2NPOA 3ANSA 2BBWA 2YZNA 3PC8C 1CZUA 1XLTA 1C4WA 2MYNA 4BCDA 3KOUA 2VA8A 5AK4A 3DOHA 2LR0A 5EJAA 1LTHR 3AUSA 4IHJB 1OKKD 4YH1A 3RSSA 4E5PA 1SC1A 4ZJPA 3C1OA 5AM0A 3P4XA 3B9BA 3MMPA 3G8BA 2XUKA 1KI6B 3O4JA 5E6UB 4Y9DA 4WOJA 5A71A 1XZLA 3LFHA 1OLUA 4BMZA 1UWKA 1KVSA 3R3UA 3QPDA 3Q8LA 1JLLA 1PEDA 2BFWA 4GI3A 4WCVA 4ZRNA 5F2NA 1U7ZA 3GH1A 1X1CA 1RVDA 3CZMA 3QBJA 4MW1A 4ND3A 4WLFA 1O5IA 5C1BA 4B6EA 4BL5A 1ZLYA 3EZNA 5BN1A 5LQJA 2JLQA 5JY6A 3QK7A 3T7AA 3I12A 2FFHA 4E6EA 2IYWA 1R4NB 3DNPA 5AW3A 1Z9BA 4WOKA 1T0HB 2V98A 4F3TA 1XZKA 3A4VA 2EFYA 4JLNA 1WUIS 5BRNA 5ENDA 1IEVA 1XD2B 3GJZA 4GAEA 2TMGA 3ZK7A 4BXOB 1A82A 2EYUA 2Q3CA 1NFRA 1N33B 4LYEA 4JB0A 1BYUA 1N6KA 2JGKA 4D7AA 4HDSA 4ZQHA 4P32A 5AHOA 4RCYA 5ISMA 4B6QA 2X6RA 4ZI7A 4M9QA 4AMYA 3WICA 1ILEA 4AJOA 1NXSA 1FUIA 3CLRC 3A6KA 3WXBA 5K6AA 3EPHA 2JVKA 2QQ0A 1QYDA 4KVGA 1ENZA 1BFKA 1E1CB 4X8OA 1WCXA 5HUHA 3UG7A 2PX0A 4L0CA 1UPCA 3I53A 2QUJA 5AQ1A 1XZEA 5H9WA 2JI4A 4IEFB 1VHQA 2VDMB 4WZZA 4YO7A 2A1IA 3QF4B 4BVLA 1GTRA 2VSFA 2IBTA 1IIRA 1P9LA 1W1WA 2VJPA 3NAQA 3W6UA 4XB1A 5DNVA 5ADWA 4YPVA 1QK4A 1V1JA 3TQRA 3UCXA 4DCJA 5I5EA 3WGIA 1Q1QA 1F4VA 2HQRA 3G9UA 4UQLA 4DSNA 2BFDB 1QIKA 3INYA 1MO2A 2A7XA 4DZTA 2GA9A 2OWEA 3BRQA 1L4UA 4JI1B 3LWNA 1XQ6A 2CXOA 2IYXA 2ZTLA 1USGA 3I4FA 4PRLA 5DVZA 3GFVA 3OFNA 4RV9A 4OMUA 2WQ6A 4JIMA 1SWWA 3WK4A 5AM2A 1ULAA 4OF4A 3RHTA 3ZHSA 1GGNA 3SOPA 3KQUA 2AN4A 1XE3A 1DAKA 2FSUA 1KP9A 4KSBA 4HHEA 1MF7A 4J0DA 2NUTA 5DT9A 4D02A 3PNBA 4V1CA 1U63A 1TQ2A 3UKJA 1XLUA 3DXXA 4MZDA 3L8FA 1Q7BA 4OA5A 3SYKA 3SBOA 3C3AA 5AJZA 4NCNA 1RP1A 3SD7A 1Q21A 2H11A 2HWWA 3QJYA 3IV7A 2QROA 1D1PA 3B3FA 4TT3A 4QYTA 3UFXA 5AW7A 3ZY5A 4WLUA 2BKAA 1MKYA 3N74A 4FEAA 3RNLA 1EGHA 3G0BA 3UAVA 2VUSA 1IM2A 2XBLA 3GLUA 3Q40A 4KV7A 2HL6A 4N7JA 4JI6B 5A3QA 2VF8A 3NBQA 4NQRA 3HY4A 4AJ2A 1O87A 3DTVA 2J67A 3V8MA 4C3ZA 2D00A 3A3NA 3D3KA 1SRRA 2HT1A 4AKIA 2G5CA 3P27A 3STUA 1HE4A 1NDQA 3WLQA 3E48A 5IJWA 4A2QA 4TTVA 2OK7A 2QX7A 2JCGA 1M6WA 2XNDA 3I9V6 3QU7A 3RK0A 1YB4A 1EWKA 5JC1A 3M7IA 2BRUA 4Z9XA 4BYMA 3H3JA 3MWKA 1DX4A 4UZFA 1KY5A 3L8DA 5B3AA 4ER6A 2IX9A 4DDWA 5IT5A 3GD7A 2H51A 2XX3A 2WJHA 4UCQA 3L7NA 4C2UA 1QRAA 3S1AA 5FTMA 1OFGA 3RS7A 2Z6QA 2NQTA 1KHHA 3T15A 4KRGA 2ADOA 2GCOA 4KQMA 2D1TA 4KXMA 5F77A 3RBZA 5JD5A 1DAFA 2X40A 1P2UA 1OGJA 3RJZA 4MUEA 4A4DA 1XTKA 3WP1B 5LMZA 2YZMA 2YXPX 1EFPA 4JS0A 1JUDA 1VLVA 3E7PA 1E89A 4MIOA 2G06A 1XEAA 3IQFA 3CIOA 3CUSA 4YYEA 4Y6PA 4YRJA 3L8CA 4TX1A 1T9GS 4I7EA 5EXXA 3EGIA 5EJ9A 5JCJA 3BXPA 4M8KA 1F0KA 1FJ2A 1ML4A 1Y6RA 1FZTA 3EOZA 3SZRA 2FP3A 1O6FA 2G70A 4IIHA 3B2EA 1JDBB 4QUGA 1JQKA 3ODPA 4MW2A 1C7FA 4X6YA 1GZUA 2FRDA 4H1UA 4DHEA 2P62A 3CLHA 3CSUA 4MVYA 4YCBA 1LD3A 2J3JA 3QWIA 4RUKA 5BSTA 3DBHB 4C06A 4FZVA 2OECA 1E2EA 3BGWA 3A4MA 1EK2A 1NVVQ 3IIEA 1LBQA 5HOEA 3RI3A 2ZJ0A 1X9HA 3J81A 3R8FA 2C58A 1SBHA 5LQDA 2XGGA 2VO1A 1UFKA 2FWJA 1AZLA 5DHTA 2B25A 3DEIA 4R98A 5CDHA 1ES9A 1QYXA 2XVXA 2OAP1 4IDEA 3RV3A 4ZK6A 5FO1A 1RKQA 3FUWA 4PLFA 4Z8XA 4X7RA 1SQGA 4HPWA 4JP5A 3R9XB 2IHZA 4J94A 4YXWA 1R00A 2WSLA 2CCKA 5K0NA 1N5MA 4PCAA 3Q10A 1SC4A 3MRVA 1XK6A 3UYKA 1CE8B 1G8GA 3AF4A 4BO9A 1V8PA 4RSGA 3NKVA 3RUFA 4Y7CA 2DF8A 1NUSA 3NAGA 1LJUA 1CUAA 1E6UA 4JC8A 3D7MA 3JRWA 3KZCA 1EWTA 2O52A 1F2VA 4IIFA 3RU9A 3W2HA 4DARA 4F2PA 1HNXB 1C0IA 3BWEA 3GXOA 2GLTA 4HAYA 4JY7A 4R3NA 4EY3A 4TZTA 2NU9A 2PTHA 1N2IA 1UBKS 1YK0A 3NJRA 3UAZA 1W9MA 4L78A 1L5VA 4YMHA 1K4YA 1JB9A 1RHKA 5E6UA 4F60A 1N4AA 4DBLE 2EARA 3IDSA 3AEKA 4X3CA 4FD3A 2O8DA 4K03A 3ETDA 4TV8B 3BIFA 5IXYA 2X8AA 2IDKA 2VXYA 4K6GA 1P44A 3R7WA 2IGBA 5B3KA 5GIOE 1AKMA 1PSDA 3CLUC 4DCSA 3DPIA 5K9ZA 3M83A 3ECAA 1NC3A 3BCHA 1BJRE 2X58A 1DRUA 3DWFA 3OKCA 1TCCA 5AI4A 4EOGA 1N8TA 3E22B 1V2GA 3H0EA 2RGNA 4MRAA 4OTZA 3E8SA 1SELA 1O97D 3BE4A 4P5PA 4PAQA 3UXYA 4QTYA 4DV2B 1ZU5A 1OMOA 1NV8A 3TCKA 5KKNB 5TVKA 4CM9A 2HH9A 4W5OA 4A8HA 1TM2A 2GI4A 4QFDA 4FQ8A 4ZVPA 4K0RA 3JSXA 3ISJA 1KEEB 1JHVA 4XQCA 3TI9A 5BMVF 3OZ7A 1N36B 1JHRA 5GONB 4UUPA 3V97A 4ZDWA 1DADA 1Y6ZA 2CFTA 2G9VA 3CZAA 2D7JA 4RVSA 1WDMA 2VHQA 2Q6LA 1ZESA 1OFIA 2BAGA 2GNOA 4JEIA 4QXPA 2QW1A 2JCXA 1U9JA 3RFFA 5JQWA 4TTRA 3N6RA 4LY3A 2OL4A 1NUPA 2QIOA 1E1YA 3R7DA 2FX5A 1AE1A 3JU3A 4NZNA 2X9VA 1X39A 2QVGA 4RC9A 1FFXB 3W77A 2ECFA 1TW3A 3RFXA 4IJMA 2CFOA 5PNTA 2XJ4A 2Q8PA 1A7UA 3K6RA 3BSSA 3OZWA 1JALA 2BKEA 4L02A 2QQFA 1MVLA 2H1RA 3HBNA 3IR6A 4XPIB 4HQLA 4P34A 1N6RA 1BS2A 2P68A 1E66A 1Q0UA 1P8AA 1V37A 1HEIA 3OPYB 4ZVVA 1VKJA 1CR2A 2DU8A 1WY7A 3CZPA 5B2FA 5C3MA 2DWOA 3UG6A 1JHMA 2E3JA 2Q50A 3IJRA 4N40A 2QTFA 4HFJA 2GB4A 4ZU3A 4E31A 3TNJA 4F2DA 5BYKA 2HBQA 2FWBA 1GG2A 1GVNB 3TQHA 3H75A 2MSCB 2Z09A 1U1FA 3Q7EA 4X8LA 1HO3A 2Y9PB 7YASA 2Z6VA 1SOWA 3EUFA 2WZBA 3LC0A 5EQDA 5KTMA 2X5OA 4FJ2A 4WZAA 3AR3A 1PJSA 4MDFA 4FR5A 2UUBB 3UCFA 4XVUA 3IX7A 4PPQA 2WC1A 1SY7A 1RAHA 1RWMA 3ESQA 2AC4A 1CUGA 3EQ7A 3WZMA 3PQ2A 5CHEA 1I2ZA 4CJXA 1ZUIA 3THXA 3KOZA 4B2LA 3WYGA 5ITZB 1YDFA 3M4XA 1C14A 2W37A 3G5MA 4GQAA 2FXVA 2WLTA 3WX0A 3U3OA 4NJMA 5IWAB 3SXUA 3CR3C 3GPIA 3WGLA 2D62A 5IM4A 1MR3F 4JI3B 2PVCA 1IVSA 3ER8A 5ENVA 1XL1A 3HN2A 3E5RA 3KJQA 4JB8A 4MUFA 3VDNB 1QFSA 1C9NA 4PS0A 3BQ9A 1GEGA 2FPOA 2H59A 5DSTA 2H0QA 3ZK8A 1TJ5A 1II0A 1ZA2A 2WIDA 3DHVA 4DCPA 2NTVA 1VLMA 3B38A 1W4ZA 1RXYA 4G85A 1UKYA 3Q2KA 3NM6B 2OXTA 4E46A 5F9HA 3NU1A 3O75A 3DE0X 4AY3A 1XDSA 2JAPA 1GILA 2YN0A 3JQFC 1PT8A 1I7DA 1EVJA 3VR3A 3K30A 1RYMA 2J9XB 5H83A 1MB3A 2J45A 3H9GA 4YP5A 4BNKA 3L4SO 1KI3A 4JVSB 4UVEA 4KYUA 4E4YA 2BCGY 3C7AA <