4MQFB

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist 2-hydroxysaclofen
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
415
structure length
403
Chain Sequence
SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antagonist
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 138
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqfB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqfB01
5KQLA 4F12A 4N76A 3DLHA 3QELB 2QSJA 1JFVA 4IF4A 7ABPA 4EYGA 4WZZA 4LE1A 4DADA 2IPNA 2HSGA 1QMPA 3OQMA 1PEAA 3JPWA 4N0QA 4RK7A 1NXSA 5F64A 4JP1A 3MM4A 4JASB 4RY8A 2PLNA 4MQFB 3QEKA 1C0EA 4KFCA 1OXBB 3H6HA 1APBA 3LTEA 5KQGA 5T7BA 1JH9A 2YHAA 2MYPA 1Z2EA 4F06A 2A9QA 4KK3A 4RWEA 3Q7TA 5EWMA 2JCGA 4Z4IA 3EAFA 1MB3A 3GL9A 1NXXA 1LBHA 3TB6A 2PUAA 3E3MA 3FFWA 2WJAA 3H5TA 3TD9A 3A3KA 4XASA 3H5WA 4RK4A 1D1PA 1USIA 2LIVA 2FXIA 2NT4A 2IPLA 1GUDA 2RJNA 2R48A 2KYRA 2M1ZA 3BRQA 3QX8A 1ZAYA 4EYOA 1CHNA 4IGAA 9ABPA 1TMYA 3N6VA 1P2FA 1VLZA 2FKAA 2FEWB 3DBIA 1D5WA 3L49A 1KRXA 3FFXA 1DBQA 3O2QB 3LUFA 3FGZA 4MR8A 2MSLA 4P1ZA 3OLZA 4EUKA 1ZY2A 2FTKE 2IDMA 2JBAA 4HNSA 3EULA 3RVSA 1CYEA 1FSPA 3H5OA 5KI6A 6CHYA 1KGSA 4O1HA 4OBBA 1RXIA 1H9CA 3OO1A 2WB4A 3IDOA 5BR1A 2PUGA 4ETIA 2QVCA 4Q6WA 5BRJA 1AB5A 3C3MA 1A2OA 1Y1LA 3OLYA 1E6LA 5GOTA 1DRJA 3C6QA 2GBPA 1YTUA 3B2NA 1NXTA 2Q5CA 5KWSA 2I6FA 3EGCA 3NBMA 4XARA 1UDRA 1ISRA 1QKKA 1RZRD 4KQ9A 1JYEA 3MMNA 5DLEA 3IPAA 4KMRA 4O5AA 1D1QA 1K66A 1A04A 2R4QA 1KRWA 5IUNC 1F4VA 3CNBA 5IUJC 1ZH2A 3I5AA 1ZESA 1YMUA 4NCAA 3OLWA 3I45A 4IMJB 2IPMA 5GQSA 3HZHA 1YK1A 4Z9BA 3SG0A 4W5QA 2OQRA 4G0YA 5HM6A 3ROFA 3KYIB 3KLNA 4G86A 3DGFC 1MIHA 2L18A 4KK4A 1DG9A 5C5EA 1XWWA 2IKSA 2HQOA 4LE0A 2VK2A 3LUJA 8ABPA 4S05A 1DRKA 2E4WA 4L4UA 5EWLB 3MYYA 3A10A 3HM9A 3W9SA 3F7NA 4EVSA 1JHZA 3Q7RA 1ABFA 1DC8A 4EYKA 1PNTA 3FDFA 5TQJA 1NTRA 1LJLA 2NUBA 3KJXA 3Q9SA 1IIBA 3Q7SA 1D4ZA 4B09A 2YHBA 3FFTA 2B4AA 3O2SB 3O1HB 4FE4A 5CHYA 3RQIA 1ZITA 4MLCA 1M2EA 1YMVA 4WWHA 2QZJA 3GYBA 3QLTA 1NATA 3CU5A 3FMVA 3NHZA 4RK1A 4H3KB 1MAVA 1TLFA 4G97A 2VUIB 4KV7A 4MR9A 2MSWA 3F6CA 3KG2A 2RDMA 1FFGA 4JB0A 4LDZA 2FN8A 4H60A 4OG2A 1YIOA 3OLXA 1AB6A 2CWDA 3QELA 2HPHA 2WMYA 3GV0A 1RNLA 4F3TA 3H1FA 2IYNA 3KSMA 4YGXB 4WXEA 1SXHA 4RK5A 3S99A 4IMIB 4W5NA 1JF8A 4QPJC 1M5UA 3GRCA 1P8AA 1BDHA 1R8JA 5FWXB 4N0PA 2JVIA 1VRVA 3LUKA 5DTEA 1ABEA 1I3CA 4NV3A 2VUHB 3NNDA 4MQFA 3I09A 2OENG 3QEMB 3RVMA 3SAJA 5JNSA 3IP6A 4OTZA 3QX9A 2MYUA 3VNAA 3HUTA 5BQ3A 3OMXA 3O1JC 2H3HA 3O75A 5IBQA 3RVLA 1B00A 3HCWA 2E4VA 1F51E 1ISSA 3CRNA 2WY2D 2F8SA 2PUBA 2V0NA 1D2AA 3QLVC 4JOQA 3SQNA 1E6KA 2PUCA 5CNKA 3RVRA 3HDVA 1QNLA 3CHYA 3OMWA 3RVPA 1NXVA 3TMYA 1W9HA 5B3JA 1JX6A 2MYTA 3HUUA 3N75A 3EQZA 4RZSA 1FFSA 2AYZA 2PAFA 3EDCA 3H1GA 3LUHA 3OM0A 3Q41A 5TE9A 4IRXA 1Z12A 5JNRA 1PNRA 2JRLA 2L17A 1T34A 1USGA 4TMYA 1U2QA 5CNIA 1Z16A 3NHMA 4RSMA 3VNBA 4HYEA 2PUEA 4QICA 3F73A 4N03A 1QO0A 3P9YA 2NZVG 5KC9A 4RXMA 3CS3A 1QP4A 1ZGGA 5DKFA 4RY0A 3URMA 3O21A 4Z99A 4Z4EA 3M9WA 5TQ2A 4RXUA 3CFYA 1PHRA 2O20A 3GWGA 4IILA 3SY8A 3KLOA 4YLEA 5TPZA 2JB9A 2BGGA 5ED4A 4MR7A 3KS9A 2E4YA 2PL9A 4EGSA 2LPMA 3O1IC 2WJWA 3LOPA 3GBPA 5DCLA 2WWVD 1DCMA 3Q15C 3LFTA 5TQ2B 2DRIA 3HVRA 3C97A 2E4ZA 3IP9A 4RKQA 1HEYA 1P6QA 5IC5A 4G0XA 3T8YA 1URPA 5FBKA 3T95A 4NCBA 2A9OA 1DBPA 1KMIY 1TVMA 2J48A 3DZDA 3K9CA 3M9XA 5IEJA 3QLUC 3D8UA 4MR7B 3QK7A 3H5LA 4MS1A 4XAQA 4D6YA 4ZJPA 3NNSA 4G0PA 5TPWA 3HEBA 2JK1A 3JS5A 1BDIA 5I4CA 3D02A 2H0AA 1ZGZA 5EWLA 1DBWA 1L5YA 3OQNA 2F8TA 2RJOA 3MIZA 5ABPA 3G85A 4ZPJA 4KPYA 3OO0A 4MS1B 1ZN2A 2NT3A 3A0RB 4RXTA 1Z18A 3GBVA 5TPWB 5EWJA 4EVQA 4RY9A 3JPYA 4ETNA 1U8TA 3JY6A 4KVFA 4YP9A 2ID9A 3RVNA 1PUXA 2CD7A 1YVUA 4RK6A 4EYQA 4JAVC 1QQAA 1LK0A 4MS3B 4KRFA 4XXHA 4G0QA 4MAAA 4ZMRA 1K68A 3LUGA 1SRRA 4ML3A 1EHCA 1ZVVA 5JNUA 1P6UA 3CZ5A 5EWJB 1OXKB 4ZMSA 1VPWA 4Z4CA 1DP4A 1GCGA 3N8IA 3OQOA 3UK0A 1NY5A 3DGEC 4LX8A 2GI4A 1EWTA 5BRAA 2E4UA 2L19A 3DLBA 1CEYA 3T6KA 2FMFA 1WETA 1QP0A 4CBVA 3T38A 2P4UA 3OLVA 1GUBA 1XHFA 5DGCA 4LZLA 3JTEA 5FWXA 2GWRA 2MYNA 2PUDA 1E6MA 4PYRA 5TQ0A 4Y9TA 5HSGA 1BA2A 4XLTA 1JWLA 1Z2DA 3QEMA 5PNTA 4M88A 4YCSA 3A0UA 4Q7EA 1JFTA 2JVKA 4GPAA 1BDJA 4D6XA 1DCKA 5JNTA 2FN9A 1QO0D 4W5TA 2JVJA 1U2PA 3ILHA 5JS1A 4YS6A 3IP7A 1NXOA 3N0WA 4G0MA 5TQ0B 1SXIA 4Z0NA 2ID7A 3I42A 1FQWA 2FMIA 4KZKA 5KQMA 4JA2A 6ABPA 3CTPA 2IOYA 2FEPA 4RV5A 1GCAA 3HO1A 4E7PA 4S04A 2WRZA 4QYWA 5TPZD 4RS3A 1TJYA 3RVOA 5C5CA 4KQCA 3EODA 4PE5B 4DQDA 2CHEA 4XFKA 3HK2A 1QP7A 4WXMA 1JDNA 2M98A 2R47A 2AYXA 1Z15A 1M2FA 3IPCA 2LUOA 1LJUA 1JBEA 1QPZA 2ZWMA 4JB2A 1E2BA 2GKGA 3GT7A 4NQRA 4UHKA 3BRSA 3E61A 3N0RA 5FWYA 4G0ZA 4Q6BA 4F11A 4NICA 4HNRA 1JDPA 2R25B 4YV7A 2P9HA 3H5IA 4PICA 1JLKA 1LBIA 2N9UA 3MF4A 2FMHA 4YRZA 1EWKA 1JL3A 1EFAA 1DC7A 1FFWA 5FWYB 1M5TA 2IPAB 2QW1A 4LRQA 4TN5A 3UUGA 4ZYLA 5JNVA 3C3KA 4LDAA 4KNYA 2FQXA 3LUCA 4Z9AA 4L85A 2MSKA 2PJUA 4MQEA 1JYFA 1PEYA 4MS4A 2LBPA 1DZ3A 4F8JA 2FVYA 2LP4Y 4E7OA 2PUFA 2RGYA 5EWMB 3QLVA 3HSYA 3LUDA 5D2CA 3H5VA 2PE5A 5CNJA 1Z17A 1SD5A 1MB0A 3KCNA 4MQEB 4EVRA 3M6MD 2B1JA 4MS4B 4W5RA 3O2JA 3CZCA 1TM2A 2GX6A 3KTOA 4PEVA 5IEBA 2FLKA 2HJ9A 2QU7A 2FSPA 4GNRA 3RVKA 4W5OA 1GLGA 2X7XA 4G0OA 4HNQA 4YWHA 2PKXA 4OLAA 3OM1A 1QQBA 3H75A 4MR8B 4TLLB 2QVGA 2QXYA 3CKMA 3H1EA 4Z4HA 2FEKA 4MS3A 4N47A 3L6UA 2JBAB 4Z4GA 3SNKA 3HJFA 1USKA 3LKBA 1U04A 1XHEA 4O1IA 5IULC 1Z13A 4UHJA 2TMYA 1VKRA 3EQ2A 1RXEA 3RVJA 1BVHA 4EY3A 5KQPA 2PL1A 2QV0A 2PMCA 3C3WA 1Z25A 1J56A 3LUAA 4PZ0A 4WT7A 4YR7A 5IX8A 4MPTA 3JVDA 3TO5A 4MRMA 3G1WA 2VYCA 5JS2A 4RDCA 3KHTA 2A9RA 2L2QA 1Z26A 3HS3A 2FQWA 4MYRA 3IP5A 4RKRA 1DCFA 4FB4A 4YO7A 2FLWA 4MGEA 4WUTA 3TX6A 3R0JA 4ETMA 3JVIA 2NZUG 1U0SY 1L5ZA 3KYJB 4MRMB 3RH0A 1EAYA 1ZHHA 4RU1A 1S8NA 2FW0A 3QLUA 5CNMA 3UKJA 3F6PA 2W42A 4LE2A 5FBHA 4Z4FA 3KKEA 3SM9A 1NXPA 3CG4A 3BREA 3HDGA 5HQJA 3BILA 4D74A 1RPJA 2CHFA 2A9PA 2QR3A 1RZRA 4N41A 2HQBA 3HXMA 3H6GA 1C4WA 4TLMB 2XDYA 2FQYA 3ILYA 3MA0A 5HKOA 1JFSA 5B3JC 2FMKA 3EJWA 4RK0A 3K4HA 4QYMA 5E3JA 1YS7A 5T3YA 3RVQA 1YS6A 3MQ4A 1SXGA 4DN6A 3BBLA 1MVOA 1EWVA 3CG0A 3HV2A 4H3HB 4KREA 1DJMA 1A0OA 4OATA 4P98A 3LMKA 2HQRA 5IUKC 5JNWA 1ZDMA 1ZH4A 3GA5A 1NXWA 3LKVA 3N53A 1W25A 3O74A 4MR9B 1BAPA 5KC8A 3NNNA 1YK0A 2E4XA 4FE7A 3ROTA 4OLBA 2ZAYA 3N0XA 3CLKA 4MLDA
chains in the Genus database with same CATH superfamily
3UJHA 4UU0A 2IS2A 2QAGA 4N76A 2AB0A 4UNPA 5DCUA 1R9NA 3OEWA 1CUBA 1EFCA 2IU6A 1ZNXA 4LYAA 3V1LA 2ODBA 2EJBA 4U7JA 1RLOA 3C6KA 4FGWA 4GI1A 1N7JA 1O57A 3K1AA 2FSGA 4QO7A 4U6NA 3TMAA 4JYAB 2YIDA 4L0MA 1AKTA 1ONNA 2PXAA 2C2YA 3TQRA 4OO3A 2W6OA 3EEBA 1YC5A 3PQ4A 3OE1A 4HEHA 4CV1A 5IABA 3FLMA 1H0RA 2QN7A 4BC0A 4NE2A 4DOMA 3IJPA 2B4QA 1RWOA 5AI4A 1QCDA 2ZAMA 4XJXA 2ST1A 1XQ1A 3EVEA 3LH5A 3Q7TA 3G9XA 4OHKA 2JCGA 2IV7A 1LS1A 1I8TA 3CH4B 1NXXA 4JSYA 1CR6A 2HPVA 4KI0A 4C4PA 3PHHA 4PRKA 2H5JA 1GWNA 2JFBA 4KGDA 3AW9A 4N7JA 4NFYA 2QL5A 4DJTA 1D1PA 3GLGB 2CXQA 4WCDA 1RHQA 2V9ZA 3NQ41 3ZHYA 4IIBA 5FOXA 3COVA 2HMYB 4LBZA 1ZAYA 4MPPA 3KYBA 3ZDCA 1X1QA 3CRQA 3EMDA 3HB0A 3M5CA 3CVYA 4IDAA 6GPBA 1YDHA 3N6RA 2ZSFA 4BPBA 5LDGA 3FFXA 4Q9IA 1RXYA 1D6JA 1QE3A 1QFSA 2NO4A 2O6HA 3FGZA 4P36A 3RBZA 3W8RA 1XD9A 3OEED 3TDKA 4F6LA 4RGYA 2XUQA 2AKYA 4D42A 1EK0A 1UUFA 2HB6A 3EULA 1JU9A 4LHYA 2XMSA 3TJRA 1ITZA 1E3EA 4P7FA 4LZJA 5BR1A 2HSEA 4ENWA 1N0WA 2JLXA 4ON9A 1SCBA 1E2JA 2OWDA 3NYRA 4ZO9A 5GMOA 3SK0A 4AMYA 4E2YA 1KQ3A 3C39A 2EX1A 3QE2A 2G80A 2YMQA 1H2YA 1HH4A 3PC2A 4I55A 2H5EA 4JH0A 1I7PA 2O54A 2C59A 1X1BA 3OZIA 2FZWA 2QS9A 2CEAA 4HT3B 2B6HA 2PYDA 1E8MA 4PC3A 3G2QA 2B34A 2QROA 3F7TA 1CNEA 1UBSB 2CFIA 2A59A 1N3LA 3BORA 1GUFA 3FG9A 1U6JA 4P08A 1LC3A 4B48A 3U40A 1QS0B 1Z0AA 3L7AA 2APJA 1MD9A 4BDTA 4O63O 4ZYUA 2ZUDA 4BNXA 1A7JA 5DSTA 2RH9B 1GNSA 4CFSA 1F8XA 3WLEA 1Z6TA 4PY2A 2Q0XA 1VHTA 3ECSA 4WVLA 1HE3A 4J91A 2JZCA 3OD5A 3HKBA 4MUHA 2P6OA 4R2HA 2PWPA 2YOHA 4ZQEA 2JJQA 3H3FA 1G5QA 3I6YA 5AHKA 1VJGA 4O59O 1YE5A 3NYIA 4KSBA 1UDBA 1RQ2A 1WO8A 4P7KA 3MWDA 1E1LA 5AI8A 5E8JA 2GTHA 3REGA 2N0SA 3WGQA 221PA 2Y1OA 1EA7A 3H2ZA 4PZCA 5JVDF 2CK3D 4ARIA 2I3GA 1Q0QA 5JLJA 2V6FA 5F1PA 4E2FA 3E8XA 3G0GA 3M6UA 1S4QA 2I66A 4BFCA 4M1OA 1UDCA 1DC8A 2QKYA 4WH0A 4YB8A 4KR0A 2C7OA 1BMDA 2ADMA 1NT2A 4PC6A 5LBIA 2V55B 2WF7A 5EY5B 3K7EA 1RM0A 3IQGX 2P62A 1BYIA 4CKYA 1FA9A 3T61A 1USWA 1OI2A 1V4VA 1YZYA 4RADA 1XNQB 4EFDA 5HX7A 2IYZA 3KL4A 1NA5A 5FP0A 4WIAA 3PC3A 1YFKA 3U44A 4TRNA 4I8DA 1Z45A 5H1YA 4Y18A 1FYXA 2BP7A 2XD4A 4O08A 2DYKA 3VMFA 1G17A 4G1EB 2P27A 4KV7A 3V3KA 1UKVY 1NULA 1TO1E 5HFJA 1GT91 1MXHA 2HGSA 4LRTB 5BOSA 1FFXA 2ZJFA 4I6JA 4S1TA 1WDKA 3AFOA 2AFIB 4U2KA 1QK5A 3U7JA 3N58A 1LD3A 4BX0A 1AGNA 1BEZA 3QELA 2JCVA 2R1TA 3OTOB 2YYYA 1P7WA 4WGFA 3MJDA 3S70A 4Y1FA 4M83A 4NOKA 1WXWA 5CCXA 1OBVA 2D4HA 2VPXA 2QPTA 2R8PA 2KX7A 2C2GA 4HYYA 1Y1SA 3RSSA 3TLXA 5JSZB 2TMKA 3WIEA 1E4VA 4CNBA 1R8JA 4KQ6A 2IHUA 2G0NA 2JD0A 3I9NA 4P83A 3UTCA 3N2IA 4Z1MA 3QYAA 3EF3A 4BNVA 5JEDA 2X13A 4YEDA 3VBEA 4CI0B 4I50A 4AQDA 4K2HA 1C7JA 1PR9A 3TEFA 3WADA 2ZSEA 5IHXA 1IH8A 4P0QB 1GTL1 5BQ3A 3O75A 3QH4A 4RJJA 4BQRA 5CBKA 2PBZA 5JNLA 1ZVQA 4ZANA 1BC5A 2BD0A 4M8IA 2PUBA 1DE0A 1EE2A 1F9EA 1K6MA 3TI9A 1E9RA 5JXIA 1RJ9B 2WNHA 1E6KA 2IUTA 1J6UA 2X6QA 2ZPAA 3H7AA 4EABA 2FW1A 3WL3A 4JBXA 2G9QA 4OHZA 3TLAA 5CB8A 3CHYA 3T4PA 2OLJA 3O3NB 5FA5A 4PWYA 4U3JA 3WISA 2WINI 1KZ9A 2XCUA 3MJHA 4NCHA 2BCEA 3S0JA 5LOVB 5AJZA 2C4UA 2C0PA 2VLIA 1ZCJA 5WRFA 4MZDA 1U0HC 2MSEB 1YL7A 3GUUA 4PINA 1X19A 3AOGA 4CKEA 3H4VA 3ZLUA 2RGRA 4OHFA 2ZUWA 3FWHA 3TW8A 2XUJA 3C4JA 2PUWA 3ANMA 3LXXA 4CHGA 4DDWA 4X1YB 1M6HA 5J2UB 2ANBA 1J49A 1KJYA 2AVDA 2J4DA 1G7SA 2IYRA 1E1QD 3BF7A 3D6TB 5KTTA 1DIOB 2H1HA 4TMKA 4ZVUA 3STWA 3I6MA 2R60A 5J9FA 3KPYA 5FBRB 3H9QA 4IIGA 1G64A 1T1IA 5HCIA 2TS1A 1I2DA 1WF6A 3CF0A 3R7DA 1OASA 1HX7A 4HG2A 1EK6A 2NUPB 1Z5PA 3AEXA 1CR4A 4LYFA 4GPEA 1TKRA 5F5XA 8OHMA 1Y4AE 3HXPA 4PFJA 3B36A 4KDFA 2GVZC 3HP4A 4GOKA 2ZBDA 4Z7OB 4OMFG 2CZQA 5CAEA 3WLMA 4EGSA 2ODTX 1SVIA 3K15A 3IAM6 4QOEA 4WKPA 1WVGA 2EGHA 2J0EA 3PDIA 3DE4X 4NEGA 3SU8A 3SX4A 5DGIA 3ER9A 4UUMA 5ALLA 3E2PA 1WBJB 2M9MA 5ELMA 3TECE 3QI7A 1L5LA 5F9FA 1ORTA 1JDBC 3N1UA 1I4DD 3O26A 3SYRA 4AUMA 3SVTA 5HQTA 1KGDA 2FPRA 1A9YA 5EESA 3LWZA 1EI9A 1JRLA 1U81A 4I36A 1ZD4A 4TTRA 4UEWA 4B3HA 5TX7A 1K7SN 1RJEA 5EJ8A 2NU6B 3SHOA 3I52A 1Z9BA 1HL3A 1VJ0A 3AEKB 3HRHA 3A9RA 1J2EA 4ARAA 2VOEA 5CCBA 4KPYA 3E22B 3UUFA 2EKQA 4IXNA 5IP5A 1GY8A 2XE4A 3V7NA 2IUFA 2WAXA 2H06A 3EC7A 3D1VA 3LL7A 3OFKA 1AQNA 5CG2A 4MYTA 4OCZA 4UAVA 4AZWA 5IM4A 2H9YA 2P1ZA 3FYDA 4EYQA 1WPQA 1QQAA 1PG0A 2L69A 5BUCA 5F7OA 2C5HA 4KRFA 3V4FA 3RJTA 4DCPA 4XQ9A 2X8JA 4CLEA 1Y7TA 1UEIA 5E6RA 1KQOA 3T4UA 3LZDA 4FKBA 1NW6A 4Z4CA 2HHAA 3LAWA 1E77A 3S81A 1WXDA 1L4NA 1RBYA 1FE8A 1JMVA 1Y33E 2X5JO 3A1WA 3LWDA 4JDPA 1NVVQ 5H0IA 1ZMTA 2FR1A 2RHJA 4ZDWA 3UK0A 2HDNB 4RGBA 2J5RA 3LWNA 4EHNA 1UBRS 5HIJA 4CV0A 1LRLA 1KDPA 3DTVD 3W1VA 3FOCA 4XVCA 5ENVA 4EB3A 4V1CA 3ZV4A 3IB6A 2W6QA 5DYWA 3KXPA 1MQ8B 2CJXA 4KIUA 4BAZA 3SC2A 5SZKB 3TL2A 4FEEA 3CLRD 3MRSA 3E3LA 3GQBA 4DW8A 1Z39A 5JS8A 5L8VA 2Z2KA 1JWLA 4FEYA 4IHAA 5E4JA 3R8CA 4FD3A 4B85A 1PJAA 5KYTA 4TS3A 4L5CA 2ZJ3A 1D0IA 3FXAA 3VSDA 2QM0A 3ZZUA 1ELOA 2C1EA 2WWRA 4U1RA 5FTJA 4UEQA 5DXFA 1Q19A 3LOUA 1ZOIA 3P9KA 2Z6QA 3SN6A 1XVTA 3CJQA 3R7NA 2XQKA 2FFQA 3KK0A 3QJYA 3ENZA 1IY1A 2EEZA 3ESZA 3T5DA 4HCJA 2PA3A 3QPVA 3U3KA 3VR6H 3AUSA 3N8NA 1J2TA 2EW2A 1EQ2A 2LDXA 4B43A 3HN2A 4H7IA 1MEEA 4WBSA 5EJ2A 5F5LA 4L3VA 3CTPA 2I22A 2FOLA 3QUSA 1QAMA 1U0GA 2MT9A 4MW0A 3B7PA 1RKVA 4JLWA 3FX2A 3TQOA 4W1SA 4XOIA 2Y2UA 4BV8A 4C0HA 1JAHA 3T9BA 3MERA 3DP9A 1R1DA 3QVTA 4FHZA 5SYMA 4WK2B 4QVGA 4Q66C 1JILA 1D5CA 3A58B 1P0QA 5LQCA 5K3OA 5JO9A 4PSVA 4OQPA 1ZOOA 4WFJA 3RC3A 4KQGA 2CVQA 4NHOA 3T7DA 3HB7A 3ND5A 4JJEA 2QUIA 1I4LD 4YMIA 4ENPA 2PDAA 1H9AA 1XD8A 2FJUA 2RGXA 4IJ6A 1VE3A 5DK4A 3V2IA 4F85A 1QFZA 3PNBA 5F4BA 1MW9X 4JUCA 1AGXA 2GD2A 1HMYA 2XRYA 1DC7A 4LV6A 1OHHD 1TZKA 5FWYB 4ZOLA 1N2CA 1Q15A 1VMAA 1YE8A 1SB9A 2Q29A 5CDGA 4NYMR 1H2EA 3IBFA 2PJUA 1S8OA 4MQEA 5J2TA 2XGOA 4RHTA 2GO1A 4MS4A 4CXMA 2RGAA 3NDIA 2AJDA 3B8HA 2ZRQA 3U9TA 4KQEA 1VE6A 2REOA 3C8MA 4RQBA 3FOWA 5SYAA 2CXTA 2JAOA 3FF1A 3R9XA 4X24A 2W6JA 4MVJP 3T34A 1DKQA 4A3SA 1MOPA 4N7BA 3RC2A 2ZVJA 3VM6A 2C88A 4GZ6A 1G21B 2B2XA 3DDWA 1KEEB 3T0GA 3V6MA 4I5FA 5TY0A 4CU2A 4DA4A 4EYSA 5KSPA 4PEVA 5IDYA 1XVIA 5LQSA 1ZM3A 1T8TA 3ROGA 5JXGA 3WKBA 4YQFA 1GZSA 3RODA 1F2DA 3IKLA 2ATVA 2F43B 2YN2A 4OQQA 3U09A 3DLIA 3AV0B 2J85A 4IDFA 1K7EB 4PNHA 3L7YA 1Z5GA 4ZCSA 1EFKA 3H1EA 1NW4A 2HA2A 1P7PA 5DOZA 4EJMA 3R09A 1T8WA 3ONNA 5LYYA 1CQJA 2D5IA 1USKA 4FFLA 4UNIA 1P0PA 3O8LA 2XCTB 1QQ6A 2O2YA 3Q7EA 4PAQA 5D51S 2ZQ5A 3G5TA 2UZ3A 5LKRA 1XEXB 3H83A 1WCXA 2CNOA 3KV1A 4J6FA 4WZBB 1U3FA 4TTAA 5DJ5A 3FUCA 5KWJA 2QV0A 5IS2A 2NXWA 4LC1A 1CY1A 1CJUC 1LLCA 3LT4A 4ZT5A 4URZR 3KHKA 5JS2A 3GOQA 1LY1A 4N82A 2XWPA 1JAZA 1FVFA 3DO6A 5AVSA 1JDJA 2RCYA 2Z0MA 4IP0A 4MW5A 3CONA 2Y6UA 4IIHA 3A3OA 4AG3A 4BS9A 5I7HA 2YJ5A 1K9SA 5EE0A 1GGHA 4LXUA 1T3GA 5F2OA 3OMLA 5P8WA 1QU3A 2AR9A 3Q9LA 4O4LB 5DI3A 1P5HA 2B5VA 1L5ZA 4MRMB 1H85A 1UJ5A 1YRBA 2JEYA 1FSZA 1G55A 1ZUHA 3RH0A 4X45A 3WYFA 2W42A 1PKXA 4HTAA 1OVMA 3A1SA 4G9EA 4MDFA 1CPYA 1DC6A 2PGJA 5C1BA 1XZGA 1AOXA 1ZUNA 2V8BA 4K6OA 4PCVA 1NVFA 1HYGA 2G82A 2ZWIA 2PLFA 1R37A 3NBFA 4M7RA 4MP8A 5HTKA 3JYPA 4LXXA 5C80A 3R0QA 3TFQA 1ZK4A 3IOMA 3UB3A 2P4EA 1D03A 2QZ9A 2QMUA 4O6VA 2LCQA 4XM0A 2IEYA 3SKXA 4ZVOA 2QVXX 4K8OA 4TUYF 3RANA 3UBTA 3U6KA 4M9SA 4IEFB 4LOHA 3OICA 3FMIA 5GADl 3FOEC 5KSYA 2SHKA 5EJ7A 1NKTA 1UKYA 4LV5B 3OIFA 4RABA 5T3YA 1WULS 2HTEA 3IDZA 1YCHA 3K31A 1Z5UA 1A5SB 4C22A 4KREA 2GLUA 2WICA 4AURA 2JK0A 1ODIA 2ZSHA 3U1TA 3PNVA 4EPYA 3FGPA 4BKUA 1J4AA 4XIJA 3UH0A 3PYLA 2EU8A 5H02A 3K3PA 4RW0A 4XWAA 1ZH4A 1H6AA 3FNIA 1PZHA 2JFHA 4US0R 2Q8QA 4KSCA 2CFRA 1HZZC 4BJ1A 5A7HA 4L1KA 3THYA 2PZMA 3GT3A 1MGPA 1YK0A 2FQQA 4ZT3A 4KR6A 4YAEA 4CM4A 1OZAA 1UMBB 3Q2OA 4DADA 2W22A 3LC1O 5CBPB 5KQLA 1IBKB 1FSGA 2RB5A 5JCPA 2QVLA 2JIZA 2YVUA 4NXNB 3CMCO 1EQUA 3AEUA 2NNWB 4CDNA 3RF6A 2AH5A 2YWJA 1JN0A 1E59A 3S1SA 1RAIA 4X1IB 3T4EA 1J09A 2FFJA 2AEEA 4KXNA 2NU9A 4JBYA 5DOVA 5EQFA 1WDMA 3H1PA 3PR3A 3RLFA 4CKWB 2QAGB 2BFEA 3TQTA 3N07A 3B5IA 4J1SA 3MB8A 4UUPA 1G8HA 3JZDA 2VSYA 3M6IA 4PPQA 3L0YA 3PXBA 1GPJA 2CLSA 3JZAA 3PITA 1N9GA 2WT8A 3R3JA 1J8QA 3LLSA 3NIGB 5FFFA 3OOJA 10MHA 3TLEA 2OE2A 2MCFA 1G3UA 2IHJA 3P2EA 1TYZA 2DKNA 3E2MA 4R9SA 3RHFA 3RRMA 1E4EB 4JI4B 2ENWA 1R0WA 2NU7A 1J33A 3GUZA 3RT9A 1RC0A 1U0OC 4EW3A 5CFLA 2IPLA 3VR0A 3BCRA 2GXAA 1DFIA 2HJSA 4XIYA 3EXHA 4MV4A 4ZJZA 2PT5A 1KRXA 1TA4A 1EP3B 4NNPA 3UXEA 3FTFA 1N5JA 4OB8A 3EEQA 4OI4A 3LIIA 1XVAA 3D4PA 2IDMA 1E2HA 3HUEA 5KDLA 4M0FA 1RZ3A 1NN1A 3DDHA 1IU9A 1K4YA 3NG1A 3P97A 3L84A 2V5VA 4J0DA 3T7SA 4ETIA 5CPFA 4A8HA 2FMUA 4ASUA 4LF5B 2I4NA 4P7BA 1AB5A 3AHCA 2BGKA 1AN9A 1OZFA 1YZVA 3A6ZA 4JHLA 2F1IA 3IEPA 4WZAA 1T1RA 1YF3A 4QDXA 4WJZA 1GPKA 2Y3IA 2H9AA 4D0SA 3F3MA 3VR6A 5I9BA 1QO9A 2I8AA 1D1QA 2E49A 5KB3A 3WB1A 5ICMA 2ZCUA 1CZHA 1JFFA 2V4UA 3FDXA 1T4CA 3HU2A 4Y6RA 2H2IA 5CTJA 5IUNC 3LRXA 3D9QX 2B35A 2NWQA 1OB2A 3HCRA 1I1OA 1KOLA 5JW6A 1ULBA 1GTSA 1OU4A 3ZWVA 2Q6TA 1PP4A 1ESNA 3R9WA 3U26A 1FFDA 1PI3A 4DTCA 4W5QA 4F3YA 5KJFA 1WUJS 2WJPA 4HDMA 4UUQA 3JQ7B 3AIOA 4CWAA 1A4IA 1V3UA 2OP1A 2JHCA 5G3ZA 3OFNA 1NJGA 2IY8A 2ZTHA 3R5TA 1OWLA 1QDUA 1VRCA 3MRXA 3CCFA 4IOKA 4JJAA 4R2LA 3RM3A 1FP2A 2XBMA 1G3IA 3L8DA 1KDZA 4P80A 2AG0A 2IHBA 1DRKA 5BPFA 5HW0A 2G77B 3IAUA 4KDEA 3HKBB 1T6BY 1JHZA 3B1WA 3V97A 4DYVA 3OM9A 1RM4A 5A0FA 2VJMA 2EIXA 3JU3A 3QXCA 3RJMA 4AICA 1XU9A 2QL7A 2V96A 2DWCA 2VP2A 4NK4A 3TSYA 2DFDA 4YRMA 4KW7A 4AJNA 3M0EA 5FNZA 1K6EA 3Q0EA 4CL0A 3IEMA 1TRHA 1Q16A 2QW8A 3C48A 2OLKA 2IOQA 1LTQA 2C5SA 2ERXA 1G18A 3MGCA 1WXGA 4G85A 4MWCA 4BBZA 4MK4A 4YCLA 2B1GA 3HDQA 2QVZX 2VHJA 3L4SO 1D09A 3S2EA 4D79A 4H3KB 1XDDA 2ZSUA 5ILGA 3IVGA 4ZTUB 3MCZA 3IE1A 3ORHA 4UUOA 2R6FA 3LLUA 3DQQA 2ZT8A 3PA6A 3SXUA 5A3QA 4X94A 5JRDS 3PQ5A 1DV1A 1NW5A 4UBMA 2HRRA 3M6LA 1RLUA 2I6XA 2WIFA 4XIGS 4IQ8A 3FIJA 2COEA 1YGPA 1KRHA 2GYVA 1PJTA 2J7PD 5A3VA 4YAKA 2VT6A 4PLYA 3K30A 4BOYA 1KY2A 1U8ZA 1CZUA 3I0MA 4KQ1A 2H1WA 4Q3BA 3P8ZA 4EG4A 1FU7A 1TC2A 1WOMA 5KNBH 4LFCB 3QTLA 2PGXA 5BOSB 4N0PA 5JH7A 2JAWA 4K87A 3LQKA 2VUHB 4JQOA 5BPHA 2QR5A 5K8UA 3KTFA 3AFGA 4FSHA 2R1TB 1ZN7A 4OTZA 2WSYB 3DZKA 4ZGBA 3LBFA 4MVJG 3S8YA 5KYXA 2FNAA 4HXFB 1YL5A 1RHJA 1LV7A 3B89A 1SAYA 4HAXA 3FJYA 5L51A 1MRNA 1NJ8A 4BLRA 4M21A 3AR4A 1HYHA 1YCDA 4I50B 2IXDA 5K3FA 4DILA 2PR2A 2IYWA 1VFNA 1Z56C 2W6IA 5AIAA 2H4YA 1AZWA 3G2MA 4G8DA 4D4HA 1AA9A 3KALA 5HP4A 4R6XA 1Y8CA 4GMFA 1IN4A 3EFHA 5TT0A 1W7AA 4OYRA 1H9BA 2VP3A 1ZR4A 2J8ZA 3GFRA 3N75A 1C4KA 4HRAA 1QGYA 1G0OA 1P75A 3U7FB 1E0JA 1IIRA 1YJAA 2AMVA 4KODA 4LXYA 3OM0A 2FUG1 1PR5A 3I32A 2VYND 1VP9A 3N2EA 4PTZA 5K3DA 4KU4A 1G7CA 3HI6A 4CF5A 1KIFA 2MOKA 5FR2A 1XMIA 4RD3A 3NHMA 2R7NA 3VC2A 1V8ZA 4U3JB 3O03A 2UYHA 3VU1A 1WZUA 1QO0A 4IDBA 2NVOA 4WE3A 3H2YA 1Q1GA 2H85A 2P9FA 4UEJA 2O8NA 4RE6A 2F3UA 4CKEB 4Z9YA 1XAGA 4CPDA 2FZGA 3TW8B 4UOZA 3IPLA 4CRWB 2BUCA 5FJIA 4ZRDA 2R8ZA 1W6UA 3AY0A 3ID6C 4YRNA 5HM8A 1WHTA 4N5DA 2G08A 2GAOA 4JGIA 1IZYA 1XZCA 4UPDA 1KEVA 2CXSA 2LPMA 4PYLA 1LV8A 2JLYA 4E5UA 1TQ8A 5K6AC 3BGDA 3GK3A 3GBPA 2Z2XA 3LSYA 3NKFA 4NJMA 3RRJA 4TMWA 3TRFA 4PHHA 4V0KA 3ETEA 3EZ6A 1J5EB 2W6PA 4WK4B 4BMXA 1D04A 2H1IA 1N5LA 2GYUA 2FZKA 3P9NA 4IL5A 2V7XA 4L9WA 2AF4C 1SZPA 2O3QA 1W0KD 3H5LA 5EL0A 5CH3A 4PFSA 5LLSA 4AMZA 4BV9A 5HZHA 1X0VA 4CTMA 4F2GA 1T8UA 5TF4A 4B3SB 5IM4F 1W76A 4AN0A 5FPKA 5JAPA 4MWSA 2H4FA 1UP4A 4ZVLA 2WU1A 2YMLA 1OF1A 4NU8X 5CVCA 3O94A 5FA8A 2HYDA 4ZPJA 4JJZA 3BJIC 3EYAA 3ZU4A 1Y5LA 2DQSA 4E13A 3QU9A 5K8TA 2WYOA 1MH1A 3EOBI 4J0FA 4MV7A 1P5FA 1ENOA 2AMLA 3BBPA 3WA6A 1AO0A 1NU6A 4NU0A 3GP5A 5E4YA 1GLVA 5EWJA 2Q2OA 4LA4A 1P5ZB 5AUNB 1WOYA 2ZB8A 5J1SB 4QEZA 1B4DA 5MGBA 2A2ZA 4G89A 1DDOA 1HXHA 2CXHA 1D8TA 1OI3A 1X7WB 3EIOA 4KXQA 4A5SA 4NLLA 4HATA 2X0FA 5BSGA 1MENA 1T4GA 1SRRA 1WY7A 4OI0A 5L95A 3TD6A 2WI8A 1MVLA 3DBOB 3P94A 2IF2A 2XSZD 1L7PA 4V03A 3BCHA 4JT8A 4BGUA 4EPVA 4HH1A 3O31A 2GAJA 5FDFA 1NY5A 4BFZA 3P4XA 4G56A 3RIYA 3A4LA 1X8XA 5M29A 1Z7BA 3K53A 4FCCA 1XRLA 2X8JB 3G8AA 4ZT6A 1WY5A 3OTHA 1AVTA 2FMFA 1M1YE 4FFMA 5H3CA 3ZQ6A 3ZW7A 5D7BA 4KWIA 4FJ2A 3L05A 3OZFA 4LJ9A 4BNJA 3MB5A 3L7MA 3WFIA 1T2NA 1W94A 1E6MA 1JP7A 2JI7A 5F1YA 2WG2A 3EUAA 1P1RA 4YK7A 3PVSA 1Q0ZA 1NBEA 2ECPA 3QEMA 5E7MA 3ISVA 1AQYA 1OWPA 5JSHA 3ZDDA 2JLZA 4V1CB 4AF6A 1EBBA 5CX4A 2A0XA 4HYQA 4D6XA 3LBHA 2B4RO 4DCOA 1Z37A 2AUNA 2BIFA 4L27A 4YS6A 2CKDA 2WDPA 2OGTA 2IOHA 2NXCA 2CEKA 3EF1A 3EOZA 3GQBB 1EFUA 3KZXA 3OQIA 4KZKA 3UXYA 3D54D 4YRIA 2GTPA 3HNRA 4BNIA 2QM7A 1ZNWA 3DBRA 3C1AA 2ORVA 1XTPA 1GG9A 1SIUA 1L9XA 4ZHQB 3FYUB 3L5KA 2H51A 4HD8A 4K1LA 3VTKA 4KXMA 1TJYA 3TTSA 2UZ0A 3F5QA 1IPFA 4PYMA 1Z4PX 3GJ5A 4ALNA 1P7CA 4MINA 5K0EA 4WACA 1VHQA 4FS3A 3WAGA 2J9GA 4TPKA 3NAGA 3NV9A 4QDJA 3UY4A 4A2PA 3SSNA 2JJ2D 3U7GA 3HJRA 3IMCA 3FYTA 3IUYA 3G79A 2ZJ2A 3DLTA 1UZLA 1KA9H 3QPBA 1JFLA 2NM0A 2P11A 1E7WA 3EQ7A 5EGNA 1LW6E 2I4RA 4X7PA 1ZEJA 3GAAA 3CLSD 1U3DA 3G5LA 3MRTA 3QYJA 2D7DA 2C9BA 3QEAZ 3PL1A 1LLUA 1SCNE 1Y9ZA 3OTQA 3B70A 3LI2A 3LT5A 4IGFA 4M49A 1NW3A 4GMHA 3OQBA 4BU0A 4E94A 1E2IA 2HK7A 3NCHA 3D0RA 3PJRA 2BGLA 4BQFA 5KNBD 2G4LA 3H5IA 5DXAA 2IWRA 5CVEA 1ONBA 3UOWA 4G2NA 1ONSA 1QGED 1T2EA 2FMHA 4TTQA 2FXVA 4R0MA 2OAEA 3ED5A 3IILA 1L9KA 3B1JA 1X3SA 3KFLA 4HI0E 1PEKE 1CY0A 2PM8A 4M1TA 4TN5A 4YJ2F 5JNVA 2D00A 2FR0A 4B4WA 4UTVA 1P80A 2TMDA 2PX5A 1O54A 1STOA 2A9KA 1LNZA 4A26A 1BX3A 3RAPR 3TK1A 3PPVA 4UTZA 1T13A 1NG1A 1MORA 1KJNA 1KJ8A 1T0HB 3DMTC 4MB2A 4QG7A 4ZOAA 3V4LA 4XSVA 1OBHA 1Z73A 4GUAA 1OREA 1UJCA 2X5XA 3EWNA 4KLNA 3H17A 1N2CB 2R97A 3DULA 1G60A 4ZOLB 2ZJYA 2G1JA 2OECA 4NJOA 1WB5A 5J1TB 5DGHA 2YOFA 1Q7GA 1Z17A 4AUNA 3BKWA 5IH3A 3F49S 1L4EA 1U2RA 1DXYA 2M2IA 3M6MD 1QGDA 4HO1X 4MQEB 2GZSA 3AF0A 3EGIA 4MS4B 4NJEA 5EKTA 2HJHA 3PXGA 1QZXA 2OYRA 1TM2A 1TUBA 3FM9A 4FFPA 4XDHA 3RNLA 4KPEC 4OH7A 3A4IA 2FSPA 2CUKA 2MR6A 3CN7A 2BELA 2F1RA 3QNUA 4FBLA 4PLCA 3R9XB 2V98A 4JIGA 1NBWB 3QPAA 4D26A 2VN8A 1E6WA 1ENYA 1G9TA 2PS3A 4F38A 1Q0PA 4Q37A 1VSVA 2I0FA 4GYWA 4L9AA 4CW7A 1DEHA 2JGKA 4RAOA 1T25A 1HV8A 3C8HA 2PV7A 3WGGA 1U7TA 1DAFA 2DFNA 2Z4TA 3OEYA 4J94A 4QNRA 1R8SA 4UD6A 1VKRA 3RCBA 3TNJA 1GL9B 2B1QA 2WUGA 3QVMA 3V1UA 4BEJA 2OHGA 3H9UA 3BL6A 3L77A 4JODA 1VXRA 4DIOA 1UBEA 3ET5A 3VR3D 2A33A 2RGBA 2ZTSA 2WHPB 4M9ZA 1OUMA 2R2GA 5AW7A 4MIOA 3LG2A 4QUAA 1H2ZA 5C1PA 3E15A 3DZIA 2OAQ1 3FZQA 3OJOA 4IKEA 4Q3CA 2CFOA 3HKDA 2Q5LA 4DDKA 5DLYA 4MGEA 1K98A 5LP6F 3PDUA 4KI7A 5DTMA 2IVZA 1M1NA 1TD9A 3FLAA 1F8YA 1CY2A 4ZOBA 2BFBB 2O14A 3C3XA 5I01A 2R65A 1Y42X 2HY7A 4CM9A 1I2MA 4XPZA 4EB8A 2J0UB 1NWHA 1TGVA 2C1XA 1KI2A 2Q1TA 1TEHA 1BO6A 3HXMA 1U0JA 5FWDA 1W85A 2GILA 1C3JA 1XVVA 2J32A 3FKQA 4LCEA 5C34B 3HY4A 1DIHA 3BMCA 3LA6A 1M2GA 4WNYA 4U02A 4Y98A 1H8EA 2WTBA 1UQRA 3HJTA 5LU9A 4EUFA 4AG5A 3FW1A 4YV1A 2BGMA 1RQXA 2XOEA 2IXEA 1L5RA 1CZKA 1JQKA 2YZKA 4Z8YA 1SU8A 3BE8A 3PHIA 2JJYA 3JQFC 4IIEA 2QUZA 3RS7A 2G17A 2Q1WA 1P33A 1N2SA 1JLLA 2AX3A 2JGLA 3U7QA 1U90A 1XD2A 2H8GA 3T7TA 6ADHA 3R74A 1HYBA 3VSCA 3M3DA 1NW7A 4AS1A 5KC8A 5BN3A 1KAQA 1P9RA 3C87A 1NQUA 3RSOA 3IRUA 3ROTA 2ZAYA 2R6JA 3ZZ0A 3DTTA 4KWTA 1JIQA 1VCMA 1WP9A 4HRXA 4OEHA 1V47A 3ZWCA 1XSEA 3VKGA 1U28C 5JJLA 4RJLA 1MJNA 2ZBRA 5B3AA 1U8UA 3IUNA 2GVNA 4IF4A 1JHVA 3EVCA 3EC2A 5FJJA 2GD0A 1NUPA 2Y0PA 4IRUB 4W5HA 1HLDA 1UKZA 4L16A 4KJZA 4AZTA 4WBNB 3THYB 2Y66A 1H1LA 3NOQA 4W8HA 2ZJ1A 3JPWA 4CM4B 5I7FA 4X1KA 5IYZF 1Q50A 1VPEA 1JLSA 2YN4A 2YUIA 2VK1A 2WJYA 2ZWVA 3AP1A 1XAIA 3FPSA 4G5XA 5BY2A 2BH9A 4CN9A 4IDEA 3TW6A 4IIFA 4B17A 4D56A 1Q0UA 1U80A 4J07A 4LJYA 3DAYA 4C6TA 1W9MA 2VZ8A 4EA9A 1GQYA 1PD0A 1G42A 5DU2A 4REOA 4Z4IA 1O5IA 4CLHA 1PQYA 2V7EA 2NU9B 4BWGA 2O0LA 2NVUA 3AVTA 3OQ6A 2ZT6A 3INRA 1UT6A 4CMIA 3EH2A 3I23A 3WGMA 1S6YA 3VISA 4CMGA 5JQGA 4FYWA 2FPKA 2F55A 2ZTUA 2R48A 4A5OA 3BL8A 3DAFA 1PZGA 1AKVA 3OP4A 4LX0A 3IQEA 2QW0X 1BA3A 2DFTA 3IT1A 4KWCA 3L49A 2V6JA 5EG5A 1DDIA 4LRXA 4FN4A 5EZSA 5ADVA 3O9MA 3V34A 3CVUA 1Q7EA 1J06A 4N5IX 2H18A 2NU7B 2FTKE 3KEFA 3Q3EA 1VC2A 2B0CA 1NJ5A 3BXZA 4I1IA 5K3BA 1NRJB 1W30A 3DEYX 3EWSA 3FDZA 3FPAA 3VOBA 1G5TA 3KLMX 1RXIA 3KR1A 2HMWA 4DAEA 3I9FA 1V1MA 3VSAA 1AKQA 2GLTA 3FNBA 5AM1A 4EHFA 4ENQA 3SQWA 3EXHB 1P9NA 1Y7LA 4UREA 5FTLA 2VDPB 2EVWX 3D7MA 1LLDA 4HGRA 4IM7A 1E6LA 2EWMA 4AZ0B 1IJBA 4K9QA 1UZMA 1JJAA 3SMVA 4PAMA 3WWZA 5CLLA 4KQ9A 4YAFA 2H4XA 1JSZA 3K9BA 1IPEA 1VIYA 3KU1A 4YXWA 1L6IA 3SGLA 2Y0DA 1U02A 3E3NA 2EJCA 3RSQA 3HDHA 1F4VA 1YDMA 2UUOA 3GUVA 1IOZA 1F2TA 1SVUA 2DC1A 2IP1A 4WZAB 4ENTA 3K16A 2ODNA 4YJKA 3SC6A 3ZW9A 2JNWA 1R9MA 3FNQA 4Z9BA 4POAA 3SG0A 4JLOA 3WLRA 3ZGLA 4ZTZB 1YULA 2E4AA 3RS9A 5EP4A 3VNQA 4EW2A 2EF0A 1JFFB 1NMXA 4RIIA 3VPDA 4MXDA 4CIYA 2WUWE 3BB1A 2X0JA 2HXSA 3AUFA 3FHOA 2C8JA 2V7UA 4YP1A 4QUJA 3ZU5A 4YT8A 1VPVA 3BGWA 1QH1B 1XWWA 1YE3A 2G0TA 3AERA 3ANNA 4LE0A 4OI2A 3WSTA 2DR2A 2CNWA 3N2ZB 2CXRA 1U0FA 1Z74A 4X61A 3ZWYA 1QF7A 4LYJA 4A82A 2VF4X 3UXHA 3O47A 4AROA 4E21A 4M8KA 4J0GA 3WB0A 4PYJA 5KYYA 3GYGA 1EP9A 1GEEA 5GIOE 3A1VA 2BFAA 3VVBA 1PNTA 1DTWA 3LO5A 2LKCA 4QFCA 2DEUA 2YVAA 1AZTA 1Z4MA 3AVWA 4DVJA 1B42A 4H4DA 1OROA 1XV5A 3HH8A 4ERXA 2FWBA 3FFTA 3LDAA 5BXYA 1XPJA 2EX0A 5F4ZA 1E7MA 3E81A 3EXIA 3L9XA 4QDZA 2FLVA 4J7UA 5DH9A 2EW8A 1IY9A 1XZPA 3FKSD 4DQUA 4WAUA 1XL1A 2VJMB 4N48A 4G9GA 4EHAA 2NPOA 3PXDA 4CGYA 2AOVA 4YX9A 1A2QA 3IQXA 4MR9A 2OD7A 2PGAA 5H81A 4JQZA 4E2XA 4C4XA 2ZM6B 4E4TA 5MN5A 2IY7A 2RH5A 3KG2A 3PRKE 2GDJA 4HWTA 1COWD 3B8EA 4TTPA 1JLRA 2AQ8A 2DQYA 2IYFA 3KJIA 3RV3A 4B83A 4D2IA 1IVSA 1KEWA 2XYVA 4FZ5A 3WYBA 5G0UA 3VR1A 5J43A 2G25A 2VNHA 2I3ZA 4RSHA 2UYYA 1H5QA 1ODJA 3JQ6A 4NTZA 1JF8A 1E9CA 3L8YA 1DU4A 1UK6A 2FUEA 2PWAA 3SXUB 4DABA 4EPWA 5DMXA 1TC1A 4L7VA 1R6AA 1SBQA 2I2CA 3C85A 3N8HA 1BVRA 1GFZA 4MGKR 1SK8A 1YRAA 3RK0A 2F48A 4U7GA 4A8JC 1XCMA 4LTMA 2OENG 2RHBA 1X1CA 1FP4B 3BIXA 1YUBA 5EE9A 1PRYA 2BWJA 2FSVC 1ORDA 3KZCA 2AG1A 3CH6A 3CKYA 5G4KA 4BP1A 3A9UA 3AJRA 3QMWA 3TTUA 1ILEA 5AKHA 5D5QA 5F1KA 3AB8A 2P9YA 2XUIA 2HOQA 3DZCA 4YRCA 5F76A 3RFXA 1N3BA 3DOHA 4IJVA 4ALKA 3DMDA 4K2AA 4DIMA 3IV9A 3D6UA 3SBXA 1DAEA 3CF4G 4DHWA 1N8TA 4QGHA 2ZR0A 2MMCA 5HA5A 5HVNA 2C7QA 4Z49A 2OVBA 1HT1E 2OT3B 1N32B 5AUPB 2IW1A 1OGIA 2Q8NA 4MGYR 2PAFA 2QQGA 3RC7A 1J2UA 1GQQA 2Q28A 1N1MA 1QU2A 4A6PA 2BMAA 1SCDA 1K5PA 4KXLA 4MB6A 2HA5A 1LC0A 1YZLA 1EGHA 1JPVA 2WSSD 3O93A 4FNGA 3GVCA 4FKZA 4BVAA 5HOEA 1XBTA 2DT8A 1AZLA 1NPTO 2XNJA 3ZQJA 1HZZA 1ZJ5A 3MUNA 3BB4A 4B44A 3KETA 4M7WA 4R8VA 4U7DA 3NBZC 4D43A 1WX1A 3VR5A 1QQ7A 3DS8A 3JW8A 3SWWA 5ITWA 4MW1A 1IYZA 2O7VA 3D3EA 4R3NA 5BRNA 5TQ2A 4BAGA 3DYIA 2VTKA 3QE9Y 2R2AA 3HFGA 3DDUA 3H04A 2F00A 5E2IA 4Y7DA 3T1YB 1CS0A 1NSFA 2BKXA 3R7WA 4U6QA 2GN1A 4PZEA 1NJ6A 3PI7A 3WR5A 4MIYA 4UVEA 4OHCA 2JAUA 1RWQA 3O1LA 3PSHA 1DCMA 1WCYA 2IA5A 1X39A 1KPHA 4XLZA 3X1XA 4AWAA 4H6VA 2QGNA 3OKFA 1PR1A 3MWFA 1I2CA 3W8DA 3K9CA 4KX3A 4UBOA 1V6AA 2VBCA 3AF1A 4ZVNA 2BUAA 4V3BA 5GGXA 3W9BA 4PR0A 4IV5A 2KHZA 2NADA 4DL9A 3DL2A 2N75A 4JHXA 4KACA 3WFJA 1V2GA 1Q44A 1RI2A 4N6GA 5D3ZA 4CG3A 1E94E 2ECOA 2I4TA 4WRRA 5AHWA 1R4ZA 1RM5A 2DZDA 3TEMA 2F7SA 4HXYA 2VJDA 4YGYA 4C87A 5JRZA 4DQVA 4WADA 1L7NA 5AFSA 1UFOA 3BYZA 3WC4A 4LSZA 1CDEA 1KAEA 1N57A 4C89A 1LNQA 4US2R 1GCIA 1ZGJA 4R5HA 3DMRA 3DBHB 2QM8A 2BL4A 1XF1A 4YP9A 4RK6A 1KZGB 1RT9A 4RHUA 2Z9BA 2BI8A 2W37A 1JJFA 3NM4A 1DWQA 2GS9A 1XKQA 2QGFA 2ZIGA 4K6HA 4YJDA 1K68A 1F8GA 1OPXA 3PC4A 5FV4A 2O07A 4OBXA 3DE2X 1MDBA 5EWJB 4CMHA 4BMOB 1GQSA 4EMSA 4X54A 1NVGA 2PX3A 2ZI3A 2P0AA 3OEHA 3TNLA 5K0BA 1ENZA 2R6ZA 3OPYI 3KVNA 3EA5A 1DUVG 1I4EB 4R05A 5C7LO 1BQ3A 3ZWPA 3GI1A 5LQMA 3MBOA 5FL3A 3E0QA 3KSZO 2ZJ0A 4IHQA 1TCUA 5TC4A 3RUHA 3AUTA 2EQBA 2JATA 2P4UA 2YY7A 1GUBA 1SPXA 4LECA 4OJQA 5EZ6B 3JTEA 2BHRA 4URFA 1WSAA 5EPOA 2MYNA 3AQIA 5FUXA 1R2QA 2HL6A 1QFYA 2V7VA 2W2LA 2H2AA 2P90A 1L7XA 3OKCA 3PC8C 4ZQGA 5FT9A 2AA3A 2PX8A 5LYJA 1U11A 5JEEA 1GITA 5A04A 4IX9A 1J5XA 1NMYA 5AKIA 5K3AA 1YJQA 1EEHA 3TFWA 1GQ2A 3ILHA 1ILWA 2WT4A 3NAMA 2XUHA 4MVWA 1XKXA 3G88A 3O4VA 3S2FA 2MU1A 2X15A 5AVWA 4PN7A 2QD4A 3PJDA 5D1NA 5IZ4A 1OLSB 3BH0A 3IOYA 3PQ7A 1E3QA 3K0AA 4GYYA 4JJFA 1GGMA 1Z6AA 1QHEA 1G66A 2OEPA 2WJ6A 2XDWA 3O4FA 4CQMA 1EUCB 1QIMA 1RKXA 1WL8A 5LD2B 4L9RA 3BAZA 3C4QA 1DELA 4HEA1 4UM7A 5DYTA 2F3TA 1JHQA 2GN2A 3BD9A 4KN9S 1U3UA 1G7RA 4UD2A 2WJJA 4OU5A 5C4GB 5C5CA 3K5PA 4MVJI 5AW6A 1XRPA 5KX5A 2VC2B 4S0XA 4WXMA 2VIIA 5K6RA 3DBRB 3FOFC 4R54A 1OFUA 2B4YA 2CLHB 3SEFA 9ATCA 2PT7A 4I81A 1M3SA 1ZX1A 3C7TA 3NEPX 4JI3B 1U9ZA 3AR9A 3JAWA 5EJ9A 2SKCA 2X8WA 3BDAA 2BF7A 2ATIA 2C4WA 4KSYA 4QUKA 5IAAA 4OKNA 4G0ZA 1QYIA 2I87A 4EARA 2FZ4A 3QLEA 1CG6A 2ZE7A 4EGJA 5GVRA 3RPEA 2ONKA 4AM8A 1FY2A 4JXZA 1IXSB 2YDYA 3RIMA 1EWQA 1AD2A 3I9KA 4S12A 4FJ0A 4NH4A 5EJIA 2XGMA 3ZQ4A 4AY6A 2NO1A 4ER3A 5INTA 2EFEB 4LWZA 2C7PA 1EWKA 4KFSA 4XLLA 3DO8A 2RGUA 4OFBA 4Y9DA 4JLUA 5THXA 3TOZA 3ZJ4A 2Q62A 5EHNA 1M5TA 1TU0A 2PZAA 1RMYA 2HRZA 2QRGA 3NUZA 4OP2A 3TSOA 3C98A 2VSNA 5AKYA 5FV7A 1JA1A 1U5AA 4IDHA 2GM3A 2ZJOA 3FZNA 2POQX 4JU9A 1T2AA 2ZRGA 1RI4A 4FD2A 5I9MA 4D8YA 3WV4A 2EYUA 3V4RA 1A50B 3SE7A 4QQRA 3WWYA 4H59A 1TO2E 3JYLA 3JQEA 1Q0SA 3GA0A 1MX9A 3P5SA 1FLAA 2Q1YA 4BNYA 4L2IA 3EDMA 2OQ2A 5D1HA 4C2UA 3W3AH 4IHKA 1JIIA 3HVKA 2XF2A 4FQ8A 4ZAWA 421PA 4YMHA 3GDGA 2OQVA 3T1NA 3MHTA 3EASA 2CHQA 3PC6A 3QXHA 4MWBA 1JVSA 3ZN2A 4C5AA 2Y0CA 3G8DA 3OT4A 1YVEI 3MXOA 4CR8A 1KY5A 1YVDA 5CEEA 2FMTA 1DKLA 1TJ3A 3QUBA 4WOJA 3NBYC 1THMA 3U6BA 1PVOA 1B6SA 2VWHA 3RBVA 3PYMA 4C9BA 3THRA 3T7KA 2I3DA 1OGYA 1I4TD 2P3SA 2WWTA 2J46A 3VDXA 5E9AA 1I1NA 5KWEA 5HPYB 4NJEB 1W48A 2ABWA 3NT4A 3W5SA 4FNAA 2WHRA 1Q2UA 3GPDG 3TSAA 4WCFC 2JBAB 4Z4GA 4E5MA 2Q50A 2DUUA 4J3FA 4G4SP 2JGAA 5IULC 3KQHA 3HADA 4Z0PA 4II2A 4BO7A 3EB9A 5E7IA 3NORA 3C3WA 3PL5A 4YCCA 5JHHB 1W36D 1A5TA 1SOMA 3IJEB 1UPTA 1NYQA 3LHKA 3MC1A 4GKVA 2AXPA 1YKFA 5HDBB 1LI7A 4YFYA 1M2KA 3GAZA 3L06A 3WFZA 3IPRA 4RD6A 4BAUA 3THSA 4ZYTA 3OT5A 2A1TR 3TQFA 1UMDB 2FQWA 4UUAA 1JI3A 4XR9A 3EVZA 5CLGA 5AI6A 3UA3A 2JFQA 4D82A 3F96A 2V6GA 5K6AA 4KXFB 4QYIA 4B9EA 5LQAA 5FLEX 2CBZA 4DMCA 2Y27A 2HFJA 3JATA 4PHCA 1HT3A 1WW2A 2COUA 1QFJA 4BP8A 2XUPA 3NWOA 2FW0A 4IZ6A 1SA0B 2PANA 4F86A 4A8TA 4F7WA 1VHJA 1BFKA 4W9MC 2Y2VA 2YRFA 5JCJD 1RYDA 4JXJA 2GJAA 3PHGA 1PLJA 3X2EA 2IBMA 5D00A 5CB4A 1AF4A 3GLFE 4X60A 1ZVMA 3BJEA 5E4FA 3TJMA 4DE5A 1JDBB 4MJLA 3VPCA 2V6BA 2W0MA 1M1NB 2D7CA 3RIGA 1HORA 1PJ4A 2C4KA 1P9WA 3WGNA 2H08A 3I9JA 5EIOA 4IDGA 3QPUA 4OIMA 4EM6A 1B6GA 3I9V1 4GPIB 1VG9B 2O4CA 4TYNA 3CRW1 3UQYS 5B3JC 1TM4E 2F3RA 4DSAA 4X5OA 4UTOA 3CUEF 3DJYA 2REBA 3QOXA 4D57A 5EJ6A 3RVQA 2BV3A 3OJWA 3SZRA 1FMJA 3BBLA 5J2TB 3W7AA 1PK8A 3IAEA 4DY4A 2X0DA 5AHXA 4AXBA 1OBCA 4A6XA 3BMCB 3K73O 3CNQS 1EGMB 1ZD5A 1R50A 3WDSA 1XTVA 1EK1A 1U7OA 3SBEA 2J0QA 3EY4A 2H7CA 5HF5A 2Z04A 3DEKA 5EMJA 3RIHA 1Z68A 5G4LA 5A2GA 5GVSA 2HTFA 1QV7A 5JDCC 1UOPA 1TK9A 2XMGA 3P9XA 2QTVA 1AKRA 4PAWA 2GEJA 3GRPA 4BX3A 1PG2A 3FPLA 1QB8A 4UM8B 4DRYA 3JD3A 4I1OA 4YV0A 4EKEA 2QE6A 2GM9A 1JLLB 3U7QB 1XD2B 3DOUA 4HB3A 1E7QA 4H31A 1RJWA 1TTHA 1PJ8A 5IBPA 2JAHA 121PA 3LBNA 3AJ8A 2H59A 2HK9A 2ORWA 5ALGA 3K2EA 5A4DA 5F7XA 5LWHA 3RR2A 1QIDA 3TCKA 4BO9A 4G1FA 1LBQA 4QNMA 1VKZA 2RJ3A 1OH7A 2M32A 2OBYA 1AKWA 5E2AA 4RKFA 2I2FA 2XQVA 3M82A 5F51A 4EKGA 2GJKA 3WL6A 5I47A 2X8BA 3RF7A 2JIQA 4URVR 4GGOA 4WXYB 3G2JA 3G5MA 1UKAA 2B9EA 1LBHA 4X1KB 3ZBUA 5H3HA 1Z6QA 4BCBA 2BFFA 4DLWA 4QLBA 1NC1A 2IOFK 5FO1A 1USIA 5AWFC 4GOXA 4Q21A 4N3AA 3D3KA 4U0JA 1M34E 2XDQB 2ZS8A 2I1WA 2JD2A 3A04A 3VYUB 3MJCA 1ECPA 1FTSA 4O4HA 5K3EA 3FTNA 3R7SA 1UPXA 3DZBA 2WQ6A 1ZBDA 1DBQA 4MDHA 1H3FA 2NVUB 2CUNA 4I4CA 4MR8A 3R3XA 4CMIB 2P2NA 2V9PA 4JEMA 5JQGB 2IW3A 1WXXA 2FKNA 2OXIA 2GUWA 3GCZA 4BQNA 5DBFA 3J81k 1FSPA 4LF6B 2AXQA 2EBUA 2FCRA 4YCDA 4CIDA 3QPDA 4R8MA 2WWYA 3VNUA 1EH5A 2CBGA 2ZIAA 2B61A 3B60A 3A9CA 4G24A 3C3MA 1NONA 1P0IA 2FWIA 4M9UA 4DJJA 5AJXA 5DIZA 1CIPA 1Q11A 4Q7MB 4ER6A 3EOAI 4REQB 1MFZA 1LW7A 3KOZA 1XO1A 3FDZB 5CD9A 1DJOA 5CYGA 5DLEA 3HCNA 3E7PA 1GN8A 2CXXA 3TQCA 1V1MB 4CF4A 3PUWA 2J9YB 1NNLA 3S2YA 3SR4A 3NBAA 1VDZA 1UM8A 1X8LA 5KUTA 1EUYA 1Z0JA 4UC0A 4N40A 3DZGA 5HUJA 3CNBA 2Z57A 4CKCA 1ODCA 3ZW8A 1M0SA 3ENNA 3KWFA 4CCWA 4LUCA 5ECYA 1R8QA 1ZXXA 5EHZA 2CFTA 1UM9B 4BLQA 4IPTA 3KQKA 4K05A 4HLDA 1U2ZA 4NI5A 1N2GA 3SEZA 1FNDA 1W47A 2HMTA 2LR0A 4R83A 1RRKA 1Z75A 1K8XB 2PZFA 4HFMA 1CUZA 3A1EA 4RDXA 1UBLS 1W4ZA 4RPLA 3SPXA 4MJ3A 4D45A 4XPIA 1F2TB 2D8MA 2B78A 5C5EA 1PX0A 4G1VA 4JZKA 2ZZNA 3G7UA 2B0JA 1FEZA 2HQOA 5DLQC 3LUJA 8ABPA 1XPOA 3LDFA 3U7EB 4OJYA 2F9LA 1ZCZA 3M3HA 3WO0A 1I80A 1ISFA 3KDAA 2PKRA 1D6MA 3HM9A 2ASVA 4HC4A 1A7AA 1BWQA 1AHHA 1Z2CA 2XE6A 2CC2A 3GX1A 2C5LA 1F2UB 1JEAA 2W11A 2AL7A 3HSKA 1YKGA 3VTZA 2J1LA 2A92A 2JFXA 3UJBA 4LZZA 4HQNA 1QFXA 1Z5OA 4R8LA 3UWPA 3EBLA 4GEKA 1N9KA 1ORIA 3C6YA 2WJ3A 1EFLA 5CHYA 1KPIA 3RKUA 3BGSA 4PPYA 5EINA 1HRDA 1AN0A 1N5DA 4XDYA 5KYYB 5ISMA 4X6XA 3DAOA 3OZRA 1JR3D 1DTWB 2VXCA 1O4WA 3KBBA 3ZGVA 1V9SA 2ZIEA 3VU9B 4QPPA 3H7IA 2GPBA 4QBTA 4CV2A 3T06B 2GYYA 4ZVVA 3IEVA 1E3WA 1DAMA 2EZ9A 3ZNNA 1XZDA 1M1UA 1TJ5A 1D2MA 3CX6A 1CDDA 3EXIB 4FCVA 4H60A 4JIMA 4NBRA 3W3AA 5CLFA 2EGUA 4IVPA 3V1TC 3IQDB 4QDOA 1V9CA 2DWPA 4RSRA 3P2OA 4L95C 1C1HA 1T2UA 2BKEA 2ZJ4A 3C5EA 4BMVA 4DLRA 3RADC 1YIAA 2FUCA 1BW9B 1SXHA 4FYHA 1JWAB 1Y3IA 2FZ5A 1DEXA 2HPZA 3ZWOA 1P61B 5B3LA 1FIUA 1USVA 3PE6A 1AUOA 3DE5X 5B53A 1HFJA 3NNDA 1RWXA 4EZIA 2QNIA 4IQFA 1U8EA 1FX0B 3FNEA 2DAPA 1DLIA 3LUBA 2CD9A 5CM9C 2OPHA 2Z3VA 3R3UA 1X7XB 3D3NA 3QIAA 2GNPA 4LK2A 3CGWA 1UWCA 5FLKA 5KTOA 2A4KA 3NTVA 1GGJA 2E7ZA 3LS2A 3PFIA 3FYSA 4Q3LA 3A9SA 3WBJA 2C2HA 2V0NA 1GCOA 1UIRA 3OX4A 2HBYA 1Z28A 3E70C 3FZYA 4H7PA 4AMUA 5IJZA 4B6EA 3ZH9B 1RWKA 2YQ4A 3UATA 3ZXIA 1UKBA 1NVUQ 4EMUA 5BV1A 5IDQA 2ZIVB 3FVWA 1O6GA 1YJ5A 2UUBB 5G4KB 3U37A 5B1HA 2LNDA 1QNLA 3U61B 2FR8C 3UNXA 2JCBA 3N2YA 1XZJA 1FDVA 4YNBA 1PT7A 8ATCA 1KH2A 5D85A 1UFKA 2MYTA 3D7RA 3KB2A 5EXEA 3RG8A 4HY3A 2BZSA 1Y6RA 2BMFA 2JH8A 3NHWA 2QTTA 4ZO7A 4CQMD 1FFSA 1O1YA 2DFVA 2I6GA 2YJ3A 1NSTA 3K0KA 4KPUB 3CEMA 4MJ7A 3JQFA 1NI4A 2JRLA 1WSWA 2GHTA 2ZBVA 1BJKA 3EWAA 4HGNA 3JRNA 4ZQBA 4C14A 5BQFA 4G63A 2W9XA 5C1OA 4A23A 1V11A 1FVOA 3MTQA 4DSOA 4XVUA 2ZRDA 4EJSC 2R6DA 1U1GA 1UP7A 2R1ZA 3DB1A 3JWGA 3OX3A 4MA4A 4KOEC 3A8TA 4IWNA 3TM4A 2UXDB 3Q2KA 2NZVG 3BFKA 1N8NA 1ZSVA 2R9VA 2Y0BA 1U3VA 5DKFA 2EZ8A 4JVSB 3GNLA 5C8YA 5I8WA 2C5GA 2BEVA 4C4SA 4Z4EA 1U28A 2PLWA 5JAIA 2KE5A 5GV7A 3AH8A 3TUZC 1D6NA 2I55A 4W99A 4E0BA 4ARBA 3NV7A 1BKSB 2PZ8A 1VLVA 3L1KA 5JSKA 1WKBA 2ZOSA 2EFGA 1FUUA 1OFGA 3KS9A 2OZEA 5LXTF 1I5OA 3ORRA 1FYEA 1R3UA 4RFVA 1WM1A 4GLLA 1ZKMA 5B7GA 5JZVA 4RVGA 5TQ2B 4C7XA 3W9UA 1KHHA 2E37A 3D31A 4BX8A 1GNRA 4G0XA 3DVSX 5K3CA 2CLOB 4L02A 1KMIY 2QP4A 3QLUC 4MV1A 2FJPA 3QK7A 3FYCA 5ALXA 2WWWA 5IVIA 1FZQA 2FB9A 3IP8A 4US1R 4QASA 5DTIA 3WMEA 4G2TA 1WZNA 1ISMA 1EM6A 3K35A 5BW5A 1GOTA 2RJOA 3RTGA 3LD9A 4FDUA 3O8OA 4JT9A 2OCAA 1MZVA 3CBGA 2YQZA 3K0CC 4PRLA 3FTEA 3A0RB 5KWVA 5KYWB 1ZWKA 3MLEA 3QVUA 3WYDA 1M2OA 4Z0HO 4TV8A 4NVRA 4HH0A 4CKBA 2X5NA 4K9PA 1TQ4A 4CETA 4B6FA 6NULA 3WAJA 3KSUA 4OUKX 5KKAA 1C4XA 1YA8A 3DL7A 2G5PA 4FDAA 4NCKA 2N47A 1V4NA 2W7TA 2WA2A 3VVLA 4HFJA 3UYLA 4WCVA 5EJ5A 1R0SA 4YDSA 2AHOA 2PNFA 3W2TA 1XZIA 3MJFA 3GPLA 3B1VA 1DARA 3NIWA 3SZLA 1DKRA 3R3ZA 4UATA 4DEXA 2HJWA 2MJLA 1NMQA 3KAJA 4WPGA 2BR4A 1M8JA 2VPWA 3IODA 1HWYA 1GTJ1 2UU9B 3K96A 3Q87B 1ZL0A 4C29A 2JGEA 1F9AA 4OBEA 3S40A 2EZTA 2FRXA 2L19A 1E9DA 3BERA 3LCMA 4IH1A 3B3GA 3OI7A 2REQA 3T38A 1E60A 4WBXC 2XY4A 3FETA 4RM3A 3ORSA 4LZLA 3O8NA 4C0SA 1R10A 2Q1SA 3USZA 2UYCA 4UVIA 3R5SA 4XVRA 1DBSA 1JDZA 2X3YA 1NNSA 4JX9A 3KOOA 5FTNA 4Q82A 2EHJA 3HVUA 5I4KA 5A5GA 2YWHA 3BE5A 3KB6A 1YUNA 2AD5A 2Z3WA 2VAPA 4OAPA 4C1NA 4GVXA 4AB1A 2FW9A 1KEKA 1IMJA 4P4TA 2FFRA 3AFIA 3IURA 2PUJA 1CU1A 2CZGA 2GRUA 1H2FA 3VDNB 4JNKA 3WIVA 2FX2A 4JJ4A 5CJ2A 1ESDA 1I30A 4XIFA 4DARA 4LWQA 4QELA 5FOSA 4ILKA 2XB9A 4NONA 1FQWA 1K8QA 1UDXA 4KRXA 2DG2A 4LEIA 1WUYA 1HDXA 4CYMA 1Z0DA 5LYJB 4M0KA 3SLGA 2IOYA 1IZ8A 3JXEA 4RV5A 3ZWQA 3OX2A 2PCJA 3PHBE 2XEXA 4V24A 4S04A 4DV1B 3O8QB 2BW0A 1Z5VA 1U1DA 3MWJA 2G28A 3ORFA 5BSFA 1RXWA 2WAMA 4ZAYA 3AJAA 4V0LA 1LSSA 2CHEA 2X4GA 3PQ3A 4XFKA 2IV2X 4AP9A 2VFAA 1QP7A 2FP3A 2XCLA 3K0AB 1SH7A 4F4CA 1SD1A 3U3OA 2WG1A 4GBMA 4GLFA 4LY9A 4UKDA 2HAEA 3T94A 4DKJA 3O5AA 1RPZA 1YI1A 5L4LA 3ZU3A 1XLVA 4C6HA 5LPNA 4OI1A 3C7AA 5EUCA 2NYRA 1SXJC 2XAAA 2I2BA 1WUTA 3CIOA 1TYDE 3RBXA 5B6JA 2JKVA 1JDPA 1MX3A 2YMMA 5HG0A 1L5VA 3OCYA 1PFQA 1MIOA 4MAFA 3FHTA 5EYPA 3N2KA 4RDIA 5HGJA 1DT3A 2JCYA 4URXR 4ZZIA 1NDUA 4PG7A 3OT1A 2IYLD 4BMCA 3BHMA 4C2BA 4A8JA 5BVHA 2BGTA 9LDBA 3A2NA 1E1YA 2J3QA 4MVYA 3GMDA 1SEPA 1KSJA 2FSVA 3GLUA 3OKPA 1KI6A 4WA7A 1SVLA 3I6ZA 5DGXA 1K6JA 2H92A 3Q3CA 4ZCTA 2JGMA 3NX4A 1NPYA 1YJXA 4DSZA 4YYZA 1CRQA 3OE7D 2PIAA 4MYUA 4RHFA 4BRUA 3KR0A 2NSHA 5CNJA 2A1TS 3D8HA 2CF6A 3L7JA 5KSZA 3HCOA 1DVRA 1FDIA 3I0NA 4RLHA 2GJ4A 5H3LA 3IAS1 2VR1A 4G1CA 3ZD7A 5G0TA 4M53A 4WY8A 1GGKA 4DVGA 1RRFA 2FLKA 4DUGD 1HNXB 3L1HA 4M0CA 1ESZA 1OWOA 4ZV4A 1V5EA 4L2IB 2YXPX 5KTYA 4HNQA 4OFZA 2PKXA 1PN3A 4ECAA 4OLAA 3MFQA 4RLFA 4UAUA 1A71A 3L4KA 3B3FA 2ZXEA 4IFTA 1ZP6A 3RASA 1OIXA 2XMDA 4EHBA 2BTQA 2BHNA 4WV3A 5ALTA 3TQQA 1JKJB 4KE9A 2PSEA 4Q48A 5CFNA 5KJEA 5BV7A 1G291 1D0SA 2Q4DA 1JAIA 2QSYA 4YRKA 3CLUC 3H5NA 1GVNB 3D8RA 2XBUA 3PR2B 4PQGA 1DMSA 2O2EA 3CUVA 3U9SA 5B7NA 2CUZA 1TKCA 2LZ0A 4O4JB 4BX2A 2FFHA 1VL1A 3VHXA 3JD4A 4L50A 1A9SA 2IYOA 2P91A 3PX3A 5IJ0B 3THXB 4H17A 1IBMB 4QQKA 4XWOA 1L4UA 1QONA 1XKLA 2V65A 3NXKA 3ODGA 1GZDA 4H1TA 5GONA 4JI0B 4YRLA 4RIHA 3NH6A 3WB9A 4R1TA 3DOIA 1AV6A 4IVNA 4Z53A 1GDHA 4UZEA 2WF6A 3U3ZA 2AOTA 2DGDA 3L8CA 3Q6MA 4Y30A 2A0WA 2RE8A 2HI0A 1SOAA 1R0RE 5BR8B 1BCRA 5CIWA 4BRWA 4R40A 4QX6A 1B8UA 4GR4A 4JKYA 1S7GA 3A4NA 3NKVA 3USCS 1LA2A 1Q1EA 3VV3A 2PRIA 1QG0A 2Z6VA 4JFRA 2GDZA 1A4RA 3DFFA 4ZEWA 4ND8A 3W5VA 5CA1A 3BREA 1WF3A 3EMVA 3V00A 2LWIA 3I5UA 3FNGA 4HWRA 3KU4A 1R0YA 1YR1A 2EERA 3IIMA 4LVUA 5KDOA 3KSBC 2V7QD 1E3IA 5ALKA 4FR2A 1T36A 4RVDA 1B43A 1II8A 2CB9A 2GH1A 4P7GA 3FROA 5DRYA 2HQ1A 5A3JA 4GKJB 4U39A 3DQPA 3SYLA 5ITSA 3OIGA 1IN5A 4N3GA 5ARBA 5HZMA 3V42A 3A4MA 2PKQP 5FNVA 4IX1A 3F71A 2IFTA 3H11B 3IAHA 3ZWWA 4DCMA 821PA 1PWEA 1R00A 1MAAA 5DI9A 3ZLVA 1AKEA 2RAFA 5CB4B 1OIVA 2G36A 3Q11A 4JCCA 1HNWB 3WLPA 2PH5A 1M2NA 4C7JA 1EPUA 3QBDA 3RTCA 3D81A 4A92A 3N76A 4BKPA 3A26A 4UULA 5ARDA 1A0OA 2C9YA 3GPIA 1CRZA 3VPGA 4NBVA 3WRXC 3KB1A 1AH2A 4O2AB 3PEYA 2AT1A 2WIKA 5DHAA 2FF7A 1V8FA 1V5GA 2ZSAA 3B6MA 4Q3NA 3NNNA 2XAUA 3B3QA 4RNDB 5AI9A 5J5AA 1J70A 4NMHA 1PGNA 3ZE2B 2BTEA 1Y82A 3DMNA 621PA 1R64A 3WNDA 1TT5B 3D6VA 3P27A 1G6KA 1VI6A 3N5CA 4AMVA 1P4GA 4AN1A 1P3Y1 1QRRA 2X9VA 5F73A 3OQMA 3A6JA 2CMHA 2QSZA 4HJRA 4X84A 4X62B 4AD8A 3BMQA 1YB1A 1NBIA 2DLNA 3BMOA 3LSTA 2QTVB 1DHRA 1XLTC 1DFHA 2W8BA 2HADA 3D6JA 1Z36A 3GJQA 2JD1A 3PC8A 4JP1A 3RO7A 4PYOA 4KH0A 2QG9A 1U0TA 2CNKA 5KJ6A 4KFCA 1QRUA 4OQDA 4DJEC 5T7BA 4E4YA 1XVLA 1S2LA 3H65A 1Z7YA 1YHYA 2QRLA 5DYYA 3KAQA 1V8DA 3E6AA 3W8NA 3ASVA 1BYUA 3UHFA 2HMAA 5J4LA 4I5EA 4IHJF 4OXYA 4CL2A 4IY1A 1FLDA 2J09A 4TT3D 1T4DA 3AVOA 1LDEA 2GPSA 4A0HA 3OETA 4R98A 3TGPA 4AJ2A 4ZU3A 2FXIA 3KQMA 3TR0A 3NC0C 1Y3DE 1V3QE 3BRQA 2P0YA 3L93A 4H3VA 3ACBA 9ABPA 2JIMA 3JQPA 5H83A 2COKA 5JAOA 1K86A 2I1QA 4ZYVA 3DLAA 3AHIA 3MJEA 1ZSNA 4J3NA 2VXYA 4DLVA 4OKSA 4P1ZA 1BROA 1VECA 2QRQA 3DCNA 3M8KA 1WBDA 3BA1A 4I4IA 3OTIA 4DA0A 3RU2A 4EF4A 3E2IA 3HABA 3TSCA 4KNVA 1CYEA 2ZIXA 2VDLB 2JFNA 3GLTA 4P3NA 2QVCA 4N7MA 1NFQA 1TUIA 5KYKA 4DF3A 4D0GA 4MMXB 1H6BA 5TIIA 2Q4TA 2HREA 1NIJA 1NXTA 2IE0A 4BMSA 5HFNA 1X7HA 1F8UA 1ISRA 1NMSA 3LFUA 5I7OA 1Y7IA 3DE3X 2QIOA 4TWBA 2XB8A 4Q7KA 4YJFA 4GBED 5FUYA 3M4XA 1WTAA 3CRVA 4QL3A 4GXNA 4W7IA 2I29A 2C2BA 1E3DA 3D8TA 2HPAA 2JGJA 2YNMC 3LX8A 4Q3KA 3PA8A 3Q88A 4BBPA 5TS2A 5F9MA 4MUXA 3I5AA 5KNDH 1ZHOA 4C7VA 3FCCA 4H6PA 5FPTA 1RLIA 1XQYA 1G6Q1 1HSZA 3PV0A 1V39A 3QSGA 4M87A 3H0CA 2RAPA 2IZ7A 4PO8A 3TE7A 3WWCA 1RTTA 4CDGA 4Y6LA 4QVIA 4G0YA 4NIMA 2WT9A 2Q2QA 3T3IA 2NTEA 1H2XA 4Z1OA 1MHPA 1CFZA 2BE9A 2YV5A 1EJ0A 4HWOA 4B6JA 1FLNA 1SY7A 1DZIA 3IUEA 4GP7A 2YW9A 4CKCB 1PTKA 1CV2A 4RA9A 1QVZA 3S28A 4EKIA 4DR5B 1DBRA 3PGXA 1JSCA 1QH0A 1M0EA 3EXG1 4L4UA 4ZHQF 3A3YA 4AY3A 2ZUEA 3BXXA 5FOUA 3HB1A 4BASA 3N2LA 1RABA 4K81B 4OF4A 1A9ZA 1VBNA 5AW8A 3FHJA 3P45A 3LPCA 1HA3A 4HQ6A 5G0VA 3T99A 1P72A 1KMQA 1Z4JA 2Q46A 3IBSA 1LJLA 4XPIB 4EJFA 4D9IA 2O8DB 4HBGA 1UBMS 1QRDA 1CRWG 4BNZA 1J0XO 1V48A 3KB8A 1CXZA 2PFKA 3LBYA 3V4SA 4DPLA 4EK9A 3I5YA 4WCFA 2PBRA 2QX7A 4D96A 1JU4A 1M2EA 1EDDA 2QZSA 3BEOA 4K9MA 4PXSA 3ZWAA 1BE6A 4ZK2A 1XTBA 3GP8A 1FFCA 1Q7TA 2Q4RA 3GYBA 2XT9A 2GXQA 1DWPA 3NHZA 1UAAA 2ZJ8A 2ZR9A 2PX2A 5CX1A 1ZW6A 5DM4A 3RSHA 4JJ6A 3TQIA 1PL8A 4EY7A 2B83A 3SX0A 4QPCA 5DLPA 1FBTA 1WVMA 2E5WA 1BU8A 2P6NA 4JB0A 4DMHA 3EYWA 4QHYA 1N8SA 4NZOA 1T0JB 2ALJA 2ON6A 1O95C 2R5FA 3B53X 2R4TA 1FFAA 3OJLA 4Z0TA 3I83A 3UH1A 1T43A 3QU7A 4HGPA 3DPUA 4G84A 1EFRA 1NC3A 1OXSC 1WWKA 1L7MA 4HADA 3TZLA 3ZD6A 3QEBZ 1E0SA 1UOEA 1EJBA 5J47A 1OLUA 1B6RA 1GRNA 3GUYA 4GPD1 4ZZ0A 1E3WB 5HIKA 4MA0A 5ALUA 1VIVA 5DHPA 1NR1A 3IE0A 4BN4A 4H4CA 1ZVJA 2RHLA 2JH9A 1JSRA 3BWXA 3H9GA 4LY0A 1PSZA 3V32A 3SAJA 1YI8A 1INLA 5M2QA 2UZ4A 5M3BA 1OYOA 1ZINA 2JL1A 2B8TA 5I8ZA 3CRNA 2C2KA 2FPLA 2R4UA 4OGWA 1JHYA 1SC1A 5FXMA 2XODA 4G5YA 3TTWA 2BR3A 1ZD3A 1NW8A 2FX3A 8AT1A 2QXUA 3K0HA 4KNWA 4YRSA 5CNKA 5JPDA 1WMSA 2ZUBA 3BWDD 2WD8A 2BDEA 4FYPA 4HVAA 1R6BX 2CBXA 2P3QA 3IAM1 1ZCBA 1XTUA 4PRYA 3RVRA 4O2RA 3SP1A 3ZV6A 4DLZA 2J9FA 2I9KA 5K20A 5B3JA 2AI2A 4H1VA 2NSYA 3DXXA 1L7RA 1NIPA 1Z62A 2ZJZA 1OGJA 4U9UA 1MRZA 3AZQA 4B6PA 4EA6A 2AYZA 1ADGA 3GCWA 4U7PB 4P4GA 3ZS9A 4WA8A 1QC5A 3O8BA 4R3UC 2Y4OA 1N5KA 1WCIA 2IIQA 4B47A 1JEYA 1VP3A 3O91A 1C7ZA 2X4LA 3H2SA 4K9LA 2IYEA 3BSWA 3VR4D 5IM5A 1C30B 3CLTC 1GNQA 1Y4UA 3AOEA 1D8AA 1B8OA 4UE2A 1MX5A 5CVUA 3NJ4A 4YRQA 1QP4A 3SLKA 5JDCA 1QHGA 1OI4A 5H68A 5REQA 3ZQUA 1HDIA 5IVDA 4I2NA 2J5KA 3NIDB 4LZOA 5G40A 4BMZA 4EQ6B 1PD1A 1Q20A 4W1RA 3M6WA 3OZUA 4WXRA 4AX4A 4BZQA 2YC4C 2P68A 4I3GA 3M4JA 2W83A 4L4RA 2VHEA 3PUVA 2O20A 1G8JA 2VH5R 2JJ1A 2WV7A 3DOCA 3QE4A 4IILA 5GWXA 3IT2A 4AF8A 4OKIA 5ED4A 1MAUA 3QXJA 3TOSA 2YX1A 1B93A 3FMPB 5C8YB 5M5BA 2HBZA 1YDEA 2QTHA 1QG6A 2BEVB 3C3EA 3KHSA 4HK4A 4WXPA 2I2DA 2HCRA 2WNIA 3JVUA 3R0VA 3VUFA 1VPTA 1NWCA 3L1JA 2X42A 3OKAA 3QV1A 4MRVA 1DBPA 3EUWA 4DR3B 2DFLA 4PQFA 2VPTA 4JX8A 5K4HA 4ESVA 4D6YA 1SKQA 5M34A 4TXNA 3QU2A 5LZ7A 5MGNA 1YR7A 1UC5B 1LS6A 5I4CA 5BNIA 2Q6OA 2UVQA 4KOAA 2FDRA 2V58A 4XQEA 3R7LA 4F6RA 4N0DA 1XZBA 3WNBA 3FHLA 4O1MA 2CZCA 3C6XA 3ON5A 3ROMA 5ABPA 2JJMA 3JARB