2ZXUA

Crystal structure of trna modification enzyme miaa in the complex with trna(phe) and dmaspp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zxuA01
1XWIA 1KK1A 3OEED 4ZV4A 4TYYA 2GJ8A 2J0SA 1OSNA 3QKUA 3CF6R 2IYRA 2NIPA 2ZRJA 2XITA 5E7IA 4DC9A 3I8XA 4B2LA 3R7WB 1DELA 4YMSA 1MABA 2ZJAA 5CJ2A 5TY0A 1SHZA 2VP0A 1R0ZA 1UPTA 3DO6A 4RD6A 2ZE5A 5CM9C 1JBKA 4HUQB 2OXRA 1R6BX 2QEQA 3N70A 4FINA 4CF7A 4KI0A 1U0LA 2ZRCA 1NRJB 3MAAC 5CIWA 3U3RA 421PA 1G8YA 3UG6A 3K70D 3VNVA 3OESA 521PA 5HPYB 2YYZA 2BC9A 3B1VA 1KAOA 4GDFA 3E1SA 2V4ZA 2BOVA 4DLYA 4EPWA 3FKSA 1OB2A 3Q7PA 1MO5A 4JLMA 3UIEA 1YU9A 1E79D 3RHFA 3DZ8A 2QGZA 2X19A 3CRRA 3GJ8A 2HEIA 3EC1A 1PV4A 4LBZA 2WWGA 1NP6A 1OKKD 4C2UA 1NMYA 1YZNA 1JPNA 2DR3A 4KITB 1T8TA 2XNDD 1KY2A 1RPZA 3QKTA 3A1VA 1BYIA 2G0NA 2PZGA 3L8YA 4GBMA 3AF2A 4S35A 1QHGA 1S9HA 4YDHB 2OBLA 4NL4H 1EG7A 1PLJA 2Y8EA 3RANA 2JLYA 1A2KC 3ZVNA 1VIYA 5TMPA 1EXMA 1E69A 2GCPA 2WWWA 2A5FA 2OLJA 2V8OA 1NMXA 2B7BA 2KBEA 4F4CA 3H1TA 4RY2A 2Z6VA 1TPZA 4WXRA 3I8SA 4B2IA 4EUNA 4UNSA 2ZJOA 3NTUA 4GRAA 3WNBA 2UKDA 2P6RA 3ECCA 2VP5A 5CB6A 2UZIR 1R0XA 2RGEA 5LB2A 2A30A 2J7PD 5C18A 1XEWY 4DCNA 1H8EA 1KGDA 1IY0A 1WQ1R 2O8BB 2CHQA 4DZZA 5SZJA 3NEJA 5HE9A 3O47A 3PXGA 2BKEA 5JSZB 5JJLA 1XPRA 2H18A 3CPHA 2H92A 4KYIB 2W83A 2XX3A 4HDOB 1MKYA 4KVAA 3FDIA 2ZRFA 3J81k 2WM9B 2XXAB 1DE0A 2QQEA 1QZXA 2CHVA 1AS2A 2QSZA 4IOMA 1R5NA 1D9ZA 3BJIC 1TADA 4DLSA 1O87A 4TT3A 1JEDA 3ZH9B 3B7GA 1A7JA 3I5YA 1DVRA 2XZPA 3QPVA 1KI4A 2N42A 4HSEA 2FH5B 4CEJA 1XJCA 4ABYA 3BS4A 2DFKB 1SQ5A 4TL6A 1OV4A 2W2TA 1FMLA 2GXQA 2PX0A 4JYCA 4MRPA 4D4MA 1MABB 1W2GA 1E99A 4CW7A 1L4YA 1R5OA 1J99A 1DPFA 2R44A 2WWYA 2D06A 2JIZA 1N0UA 1UADA 5E7JA 1GL6A 2VHQA 2G1JA 2XNSA 1JXMA 2XJ9A 1QBKC 2BMJA 3G0HA 1W48A 3JVVA 1XXHE 2GTPA 1XZPA 5B58C 4JL5A 5KSYA 2GJAA 4DEXA 3A1TA 4IEEA 3ZVRA 1IN7A 2CEAA 5FTNA 3X1XA 1ZJ6A 2R2AA 1ZUIA 4C0LA 4DEYA 2WIBA 3CZQA 4LJ8A 1E3MA 2GZAA 5LD2B 4N0EA 1OE0A 1XTQA 1J8MF 4LI0A 4MDFA 5FR2A 2YNMA 4IVQA 3CPEA 1U9IC 1G8HA 1KJWA 5B2ZA 1Z0AA 2O52A 3KKQA 3TRFA 2R6GA 3VKGA 4LBWA 2PT5A 3AEZA 3IGFA 1VPLA 4DIDA 1E1RD 4FMCF 3R9WA 3AF4A 5GJBA 2ZQ5A 2FA9A 2ZSEA 5EE3A 1GRQA 1ZYUA 3MWKA 2Z83A 2QTFA 3K09C 2ZVQX 2YWHA 1LS1A 3BK7A 2QTVB 2ZAOA 1HT1E 4B3CA 1CULC 4DSOA 1YE8A 1T91A 4WZ6A 5EE9A 1XMSA 5EP1A 5EXSA 2OCAA 1SVOA 1W5SA 1SKYB 3AKDA 4LV5B 4WA7A 5AK0A 5DYGA 3SBDA 3DKVA 1XEFA 1CS4C 4FD2A 1II8B 2GJSA 4AIIA 1KI3A 4LCBA 5DN6D 1OFHA 2OBMA 4FMDB 4UJ5A 2OFWA 4AKHA 3C4JA 1Z28A 3KXIA 1FQJA 5D3QA 4HLUC 1SVSA 2RMKA 4PFSA 1L2TA 2PH1A 4OJKA 5B57C 3K53A 1NL3A 4BLPA 1IN4A 3O8BA 2VHJA 2CCJA 3Q5EA 3R20A 1FX0B 3T1VA 2N46A 3AP2A 2HUPA 2BKUA 4B71A 1NY5A 1G3UA 2ZREA 2FZLA 2OCBA 4M9XA 3V4FA 1CJMA 5CIQA 3NIBA 5IK2D 2ZUCA 3RDPA 3THYA 1M1YE 1RJ9B 2YJTD 3QG1A 3QXJA 2Q9BA 1PLKA 1EFUA 1S2MA 3ADBA 2QT0A 4PC1A 4E03A 2ZRDA 4GMDA 3AVPA 1MOZA 3GLFA 5LBIA 3GLIA 4BECA 4CEJB 4HAXA 2ZRKA 4OBEA 4ASUD 4WZBE 2VLIA 1KDRA 4OQNA 4AK9A 4XH9B 1LW7A 1M8PA 1E32A 3MD0A 4K8OA 5FPKA 2IEZA 4PAQA 3TLXA 4BRUA 2LCFA 4CEIA 3CF2A 2WV9A 3TSWA 2E87A 5CYPA 2PJZA 3FWYA 1WP9A 3PFIA 4HZIA 5JWHA 2AFIE 1U9IA 5FL7D 1Z6YA 3TQCA 3ONWA 3WRXC 1Z3IX 3DZDA 4NCIA 4YONB 3M6AA 1UKYA 1QHNA 2R65A 4JVNA 2J0QA 2G88A 4CEHA 4W5HA 3P4YA 3IQXA 4R2IA 3W34A 1QHSA 3NBZC 3K09A 4QC2A 5FOWA 1KZGB 3UMFA 2VP9A 1CF4A 1IQPA 4QOSA 4KVGA 3B1YA 4XWKA 1E2MA 4Q02A 4KFRA 3KKPA 4FWIB 1N6OA 3VR1A 4D0LB 4QHYA 5F2EA 1YZLA 1Q3HA 4CZ2A 2EFGA 1RRGA 1SULA 3ZZUA 3FFAA 4O0MA 1L8QA 3U7HB 2QMUA 1Z8FA 2IYTA 4V03A 3KQKA 5DE3A 4WBSA 2F3RA 1E98A 3K0AA 1WB9A 2XEXA 4XTCS 2ZS7A 3AP3A 4B3GA 4HLUA 1UEJA 4ZCMA 4FMDF 3PIRA 3EPLA 1KO1A 2BJVA 4URYR 1TQ4A 4OK5A 1TF7A 2ZYTX 3VKWA 3EWAA 4L9SA 4BLTA 5DLQC 4PAOA 3CNNA 4NDZA 1KI8A 4O2LA 4KSCA 5AUNB 3U6BA 3I4LA 3BFVA 3OIWA 1S3GA 3B1WA 1YVDA 3CR8A 5EP2A 3PV0A 5D3MA 2GAAA 1TMKA 1W36C 3SQXA 2IWHA 1VYTA 4AKGA 3F3YA 4KU4A 1HE8B 4A0RA 4A92A 5KNDA 5CDFE 3NBFA 3TGPA 3SFZA 4LJ6A 1KHTA 2FMXA 2W6JA 1VHTA 1W0KA 1XNJA 1QHHA 1I4TD 3PEVA 2IS1A 1MT0A 5J4YA 2YWGA 3THYB 1Z22A 1AGPA 4W5JA 5JHHB 4YC7A 4NYJQ 4KJZA 4OHXA 1UBGA 1XJ0A 4YMVA 1YR9A 2YOGA 4I99A 2ZXUA 3GLFB 1G7CA 3GLIB 5AUQA 3EASA 2QM7A 4Q9KA 1I2DA 1XFAA 2OG2A 3ZS9A 4YXWA 1JB1A 4IHQA 4IOJA 5AUPB 3RRYA 4LHYA 3TKLA 1G5PA 2B7CA 3BE4A 3LQQA 1AQYA 2GA8A 1RKBA 4HB0A 1FQKA 2QPTA 1EFRD 5DSZA 5UKDA 4C0QC 1RRPA 2KBFA 4D82A 1P3JA 4JLDA 4PX9A 1W0JD 3SYLA 4Z1MA 5J4KA 4NYIQ 3GFPA 3W8RA 2V55B 3TUZC 1KDOA 4B75A 2QAJA 3K1JA 4RKFA 1G7TA 2AKYA 3BAFA 4EFMA 4LWZA 2W2VA 2HDNB 4NCJA 2ZJZA 1P72A 2IYWA 4PC7A 4F93B 2BBWA 4CEHB 3MWLA 1KI1A 4IDHA 4LV8B 4B73A 4NYIR 2O0KA 4JLPA 3K9NA 1WCV1 4IXNA 2OCPA 4LK2A 4P33A 3X1WA 3REGA 1N6NA 4JKYA 4DCSA 1MR3F 4XVUA 2EW1A 1KTVA 3EIEA 2XB4A 2BBSA 3RAPR 1Z6TA 5FBWB 1N5IA 4Q9IA 1IHUA 2CK3A 1A2BA 4EJSC 1SVKA 1JJ7A 3EZFA 4D2IA 3HU3A 3TH5A 1BMFD 3KXKA 3F5FA 1XP8A 2VF8A 3M4YA 4V02A 5C1BA 2HF9A 1XD8A 2CL0X 2J87A 4JBXA 2CJWA 1VYUA 4BFXA 2YHSA 4MGZR 1X1SA 4DCUA 3K0AB 1Z83A 1Z6XA 4M1YA 4RSGA 4GP6A 5AJYA 3U7EB 1BKDR 1WF3A 1NBMA 5EJEA 3B9PA 1KMHB 1GNPA 3A4NA 1E2QA 2IWRA 4GOXA 1W36D 3EXAA 4IDOA 1ANKA 1Z2CA 1SXJD 1CU1A 2IHBA 4Q48A 4BLSA 1AJEA 5D3MB 3DMNA 3QY0A 2OLKA 1NSFA 3RC8A 3SHFA 2A2ZA 3G82C 2DFTA 4MGKR 4ZCIA 1Z6AA 2O0JA 4M53A 2FSHA 1G8PA 4MDEA 2IK8A 3HR8A 1K5GA 1T0HB 1QHHB 1YZUA 4B44A 2QZ4A 3A4MA 2GESA 3OE7A 2GNOA 3AVXA 5FOSA 2H1LA 5JCPA 1G5TA 2G3YA 1XPOA 1Z5ZA 1GUAA 3ZVMA 4QJ5A 4V0KA 3SNHA 4GNKA 4LBYA 2ZSFA 1NLFA 2GVZC 4LGMA 1Y63A 2HT6A 2RGXA 2R9VA 3GQBA 3L0OA 3X2SA 4XJXA 4M22A 1KI2A 1W1WA 4BFUA 3GLGA 1XRJA 1WBDA 1T4GA 4EIWA 2D2FA 2X1VA 3RNLA 5L3SB 2QAGA 2NQ2C 3SZRA 1KO4A 4Q7LA 1N6LA 2Z4SA 5KUTA 2ZS8A 1G17A 1E2GA 1KY3A 4F4JA 2PT7A 2AD1A 2O8EA 5JJKA 4ILEA 2NOAA 2MMCA 5TDHA 3JZMA 4AG6A 3CB4A 4NCKA 3Q85A 3Q9LA 1BH2A 1Q1ZA 1DO0A 4GT1A 1OH7A 4LX0A 3I32A 3RRMA 3LBHA 3QPWA 5H1YA 3VR2A 4EJSA 5TV2A 5K8LA 4QNMA 3T5DA 1AM4D 1VCOA 5JRJA 4IDNA 1ODFA 2OBNA 2VHUA 5DI9A 3WNCA 4V0MA 1T0JB 5EUQB 4RD1A 1W5TA 1EK0A 4WOPA 3I62A 3HR7A 2V7QD 1KZ7B 1Q1EA 3IDQA 1AA9A 3U60B 2FF7A 1KIMA 4R2HA 1SVWA 4PZZA 3K0SA 3AF0A 3QEJA 2KJQA 4EFLA 1XMIA 2KSQA 2OHFA 2VA8A 2ZRBA 3I92A 3Q72A 1P5ZB 1Q0UA 3QXHA 1U2RA 2F6RA 4G5RA 3U4QA 4L5BA 4TLAA 4Q1BA 1COWA 4BQSA 4LHWA 4HAZA 2IF2A 4IW3B 1W49A 1WDTA 2KB0A 1YZQA 2QN6A 1HT2E 1MRNA 3K8YA 4DVGA 4DUGD 1W7AA 2BIFA 1OF1A 1SGWA 1G6OA 1JQJC 1KSJA 4ZO4A 2ZJ8A 2REBA 4M8NE 4OK3A 3QPUA 1AIPA 1E2IA 4G0NA 5AJVB 4B6FA 2FFQA 2O8DB 4LZZA 2EWVA 2FOLA 5TXGA 3GJ5A 3KUCA 4BWYA 5FOTA 2X8AA 3SI7A 3BRWD 3HPQA 2OFXA 4HDCA 1DAGA 4AY2A 4L4UA 1PJRA 3UXMA 1ESMA 1RRCA 5B30A 2ZI5A 3OIVA 4DXAA 3TAHA 2HLDA 1U8ZA 2W0SA 4D81A 3OFNA 4P4UA 3RS4A 3T06B 1M6NA 4E09A 2GK7A 2IEYA 3GEIA 3TR0A 1WA5A 3L0PA 4RKEA 1OJLA 4DSUA 1GDDA 2A5DA 4QGFA 2I1QA 2YC2C 3PR1A 1N5JA 1QDEA 1EGAA 2C99A 3CX6A 4E5UA 4PAMA 2BMFA 4DWJA 4MKIA 1OLOA 2G6BA 5KDDA 1KO7A 3S1AA 2BCJQ 4C30A 2V6IA 2OEPA 3MSXA 3OZXA 3ZLJA 4MYHA 3BH6A 4V0LA 2TMKA 1XEXA 4KFSA 2DB3A 4KFUA 1VG9B 3WYGA 3K70C 4LJAA 2QSYA 1IY1A 4PZLA 4AYTA 2RGGA 1JQLB 2JLWA 1E94E 1FUKA 3ICQB 3WMEA 4DSTA 1Q20A 2QAGB 1L7VC 1Q1QA 2JJ2A 4W9MC 2WSMA 2B6HA 4P4SA 3E5HA 3I72A 5DI3A 3I1FA 1XTSA 4H1VA 2O8EB 4LUCA 1YR6A 3SU8A 4JSTA 4MRSA 2AWNA 1CJUC 4KXFB 4QBHA 1TL7C 2RGCA 1AN0A 2WHXA 2ZTSA 3M0EA 2JJ1A 3KTAB 3LD9A 1OHHD 2E1RA 1W46A 4ARZB 3IO3A 5KHOC 3ZYCA 1XB2A 4A0GA 1GNRA 2C96A 2VIIA 1F60A 3IBYA 2ZJBA 4AYWA 3RSOA 2WOJA 4TLEA 4II7A 3OAAD 4B32A 1KNQA 2MSCB 2ZS9A 3TNFA 4NE2A 3I61A 3QKRB 4UNPA 1WMSA 1GKUB 1KK0A 1ZD9A 2GETA 1N0VC 2IUSA 2NG1A 1F5NA 3CR7A 4ZKEA 4YMTA 2EQBA 5AUOB 1E1QD 5J5CA 5FBVB 1OW3B 1WE2A 3GD7A 3ZZTA 2AK2A 5JHGB 2OFOA 2C5LA 4DB4A 1E0SA 4PHTA 5J40A 4Q00A 3NHBA 3RLFA 5KYKA 1NLYA 1VCNA 3BWDD 1P9NA 2HJVA 1XX6A 1A4RA 1F48A 4JKIA 2QA5A 3NC0C 4TLDA 2VP6A 4E22A 2IS2A 4MRNA 1F3OA 1Z07A 2RB4A 2RCNA 3OEEA 3ND9A 1OFUX 2NPFA 1VCMA 4HZUA 3SOPA 2ZRNA 4B76A 1TAGA 4QL3A 1W2HA 1HEIA 1QG4A 4R9UC 1CJKC 1OFIA 2QM8A 3ETLA 1E9AA 3HYTA 1KKLA 3QF4A 4Q7JB 4FN5A 5HE8A 4QJ3A 3W3ZB 2R6AA 4GOJA 2AFHE 1LTQA 2OV2A 4BFWA 4DLRA 4GMXA 3U44B 3O8RA 1YZTA 3MMPA 2YV5A 2R6DA 2RGBA 4URXR 3LXXA 1XU4A 2QP3A 1VDZA 1ZBDA 3RRZA 4NCHA 3NBXX 1Q1BA 3TJZA 2ODBA 1E2PA 1T6NA 4BFYA 2IHYA 2J0UA 2VP2A 1WXQA 5FTKA 2CNWD 2V9PA 2GJ9A 1QRAA 4JBWA 3SN6A 2JLRA 1E79A 2G0TA 4KLNA 4FMCB 2PEZA 3B1XA 4Q66C 5AR1A 3V00A 3BERA 2J45A 2WMNB 4LJ4A 3OEHD 4XVRA 4A9AA 2NMVA 1J90A 4JL8A 2VPPA 2VO1A 2BBTA 2BDTA 3GLHB 2XNDA 3LVRE 5DHFA 3K9GA 1ZNYA 2BBOA 4BZXA 1JI0A 4JLVA 3NKVA 3MFYA 1N6PA 3IPXA 4LOAA 2VEDA 1UBCA 1OXUA 1TEVA 1XBTA 5AJXA 1D2NA 4B3BA 3A37A 4Q4AB 3B82A 1UJ2A 2JATA 4P4SB 2C98A 2C77A 1G5RA 5DI3B 3IIJA 4HB4A 4RCZA 4A15A 4C2TA 4AG5A 1YKSA 2XGJA 4URUR 5HTKA 2HCBA 2KI5A 2GF9A 2O8CA 4K81B 4ZI2A 1T8UA 2NTYC 1FUUA 1XDBA 3B2EA 3K9LA 4QJ4A 1J70A 3WNDA 1DAFA 2QBYA 4OQLA 1UKVY 2EYUA 4HAWA 2J7PA 2ORIA 3SQWA 1AK2A 1K6MA 2JIZD 1TUIA 2G1KA 2X77A 4CT4B 1F2UA 1C4OA 1VCIA 1Q22A 2ZI7A 3RS7A 1HH4A 3HJNA 1RYHA 1HA3A 1QHIA 4L15A 1ETUA 5J4HA 2CVFA 3HU2A 4ESVA 1M7BA 4TYNA 2H16A 1NLZA 1JR3E 3FHCB 1DAKA 2W00A 5FUVA 2ANBA 4PPGA 4UNQA 1N6HA 2IW3A 2CLSA 2IYQA 3WYFA 4PQFA 4QBGB 4QHTA 4YMUA 3RWOA 4POAA 2VHCA 4LY6A 4DB2A 5EUMA 1IXRC 4ITRC 5KTYA 4KCGA 4RVCA 4AYXA 1NG9A 2EFDB 4GZLA 4HZUB 1SVMA 3L8ZA 4QRHA 2FWRA 5F9FA 1OXSC 5FI0B 1J2JA 4OI2A 3T15A 1GKYA 1NJFA 2H8KA 3H86A 4LSGA 3A6PC 3KQUA 1NVVQ 4HEJA 1MV5A 4C0AC 3BOSA 3QF4B 2XOKD 4WW0A 3EARA 3A8TA 3U7FB 1PZNA 3D31A 3CWQA 1G19A 2FSIA 4LC0A 4QGGA 3W5IA 3AH8A 4F38A 2GVDC 3PEWA 3K70B 3LY5A 4BEJA 3ZZ0A 3BBPA 4RFSA 1OYYA 2DCUA 1U0JA 2G77B 2PLRA 1P4SA 3WMGA 1GG2A 1K5DA 2ZAMA 5L3RA 2J0UB 1NVVR 3C7KA 4UXHA 3T1OA 4ERNA 4HUTA 3IPYA 5JLJA 1R5BA 5F3WB 1ZD8A 2Q0HA 3LV8A 1P2SA 2JJ8A 1U94A 4PQYA 1E9DA 3H0KA 3VX3A 4QGAA 4E07A 2ZEJA 1QVAA 4X8OA 2WJIA 3UATA 1DS6A 4NZYA 1XTKA 4CVNA 5JJIA 3GFTA 1UKZA 3GP8A 1RW4A 5DYIA 3GJ4A 1E1RA 4AWXA 1H65A 4J0QA 4Q19A 1YRAA 3RS0A 3VKHA 5HCIA 1NN0A 5FBRB 1IN8A 1JAHA 3CH4B 1VYVA 3C41J 1RVDA 1B0UA 4BLQA 2O8CB 1OT3A 3W6NA 4HLDA 3LA6A 2DYKA 3Q3JB 1KKMA 4I1OA 1ZNXA 5BYKA 4MGIR 1P2UA 5SZIA 2QBYB 2IYVA 1ZM9A 4IJMA 1VHLA 4V0OA 4EQ6A 1ZM2A 3LDAA 2H5EA 2HXSA 2A7QA 1KO8A 4UXIA 5JFGA 3SYKA 4MYTA 5K8IA 1DADA 5DN6A 5LDDC 2FE4A 2C9OA 5J4LA 1G18A 5A4JA 5L8VA 3AF3A 4QM7A 3KUDA 3D6TB 1P9WA 1ZP6A 2CLDX 3H84A 3IUYA 4QHSA 3TE6A 2HYIC 4PO9A 1MRSA 3WRYC 1WRBA 1TNDA 5E7MA 1GZSA 2QORA 1JPJA 5J47A 3TUJC 4OQMA 1JJVA 2F43A 2GEUA 4TYPA 3U5ZB 1G291 2QP9X 4FCVA 1XF9A 3X1DA 1BYUA 2OAQ1 3EA0A 3UMSA 5IK2A 1VKJA 1FFHA 1HQCA 1NN1A 3EC2A 1PLLA 3FMPB 4RD3A 2ZYWX 3FFBA 3RS5A 3H2YA 4M21A 3NH9A 4BE7B 5FTMA 4DJTA 5F98A 4Q1CA 5AWFC 2PZFA 4Q9HA 3AF1A 1SXJE 1YR8A 5JEEA 1CRQA 1T3HA 3DDCA 2ZVPX 3BB1A 4ASUA 3QBTA 4OQXA 1BS1A 1E0KA 3CRMA 1R2QA 3AM1A 3FMOB 2DFLA 1W47A 2DY1A 4LJYA 2WWIA 3B78A 1W4RA 1Z63A 2BVNA 1I4LD 3ND8A 4EPTA 4GZMA 1EX7A 3MRSA 1UBFA 2ORWA 2ZI9A 4LYAA 4OL0A 5FL7A 1JR3D 2QROA 2FX3A 4RFSB 2J5XA 3GCGA 2IS4A 4Q1DA 3EWSA 2HCJB 4HLCA 2OCYC 2QG6A 4TTQA 3MLEA 4LPKA 4M1KA 4M9QA 2ZRHA 3C15C 3U2QA 2ATXA 1KI6A 5L3QA 2GWHA 2ZR9A 4X8MA 3TW8B 1Z47A 2DWQA 4RCYA 4IVRA 1QF9A 2AWOA 2YVUA 4B35A 3Q5DA 5H68A 4B47A 2A78A 2VL7A 5B64A 1MO3A 4B34A 2D74A 1W4CA 3IQWA 3L2OB 4L8GA 5DHAA 4B6EA 3C14C 4XWOA 2NPIA 2P5TB 3AUYA 4G5OA 3LRPA 2V1UA 1S4QA 1E9RA 3PUVA 4NU0A 1IJFA 3LX5A 5ANRB 1FNNA 2AXPA 3B60A 3CH5A 4H1UA 1YRBA 4A2QA 4KAXA 2FDCA 2MSDB 1XD2A 2VTKA 4Q4JA 2QE7D 2G9NA 1XXHA 4IDQA 2GAOA 4O2RA 3PG5A 3O8CA 2CHGA 3DMDA 3QSYA 5ELXA 2C95A 2V54A 4NONA 1VG1A 3SJCA 2PJRA 1N0WA 4XSHA 1CBUA 2E9SA 1N6KA 4Y0AA 1A82A 2ZSDA 3EIHA 1HE1C 4LPSA 5EE5B 1OB5A 1KJYA 3NG1A 1M7GA 3PQCA 4Z1MD 4F4IA 1SVIA 2J1LA 4PO8A 3HDTA 2W2XA 1OXXK 4OHWA 1LB1B 4PANA 4PTLA 4EFNA 1X86B 4C7OA 3B6EA 4CEIB 1P61B 4AKIA 2IL1A 1W4AA 3MGCA 1HY3A 2XSZD 2GK6A 5C46F 5H70A 1RE0A 2F43B 3U3MA 4U02A 2F9LA 2B92A 3QQ5A 2XZLA 1TUEA 1R8SA 2F7SA 4LYHA 4B43A 1HUQA 2OUKA 4DLUA 2F55A 3JVUA 1KDPA 5IRCD 4OYHA 2EFHB 3TUIC 1NMZA 4TMTA 3SJBA 4RD0A 2RGDA 4PR0A 1ZU4A 1SXJC 2AKAB 1MH1A 2CL6X 3AGQA 4BLRA 1IN5A 5JECA 1UEIA 1E0AA 4TTRA 1FNMA 2C78A 5KDOA 2Q9AA 2WSSD 1ZM4A 2F9MA 4IVPA 1GP2A 4TLBA 4Q47A 1RRFA 3ZD7A 2JLXA 3E2IA 2XTNA 1LF0A 1ZINA 2VSOA 3B13B 2F3TA 5HKKD 4A8JC 2QENA 1GSIA 1ZMXA 2QL6A 3KJHA 4TQUS 3BIFA 5JEDA 1KK3A 2N1BA 5GADl 3CIOA 1HQYE 3QF7A 1E96A 4LJ7A 1EFRA 3FE2A 4I81A 4DLVA 3CZPA 5EP3A 4D4JA 2MMGA 1OH8A 3ADCA 2R8RA 5CLLA 4PPFA 3ZS8A 1XCPA 1D2EA 3CX8A 1S1CA 1W0JA 2IYZA 3N2EA 5KO2A 2DWOA 4C9BA 1GFIA 5CK4A 2WKQA 2FFAA 1RIFA 1P9RA 4JS0A 3UK6A 2NZJA 3MCAA 4NMMA 2ZYUX 5TB5A 1LNZA 2WJVA 2JLQA 2ZR0A 5EZ5A 4IXMA 5G53C 1R10A 4P31A 3VR3A 5JS7A 2WVJA 5CLQA 3BC1A 3WP1B 4GL2A 1E2JA 2GXUA 3QEOA 2JDID 3U3OA 1T3LA 3VHLB 4TZ0A 1KI6B 4DCVA 2AD5A 5L3QB 3KB2A 2AK3A 3BFXA 1M34E 4A0HA 2OO7A 4LV6A 5KU1A 1KK2A 1XZQA 3KFXA 1X8LA 1P2VA 4A4DA 4TL8A 1VECA 2GEDA 3EZ9A 4NYMR 2ZRMA 1BMFA 3DL0A 1TQ2A 3WMFA 4EPXA 4Q21A 4A1FA 3FPAA 8OHMA 1SKQA 4C0HA 1TU3A 3SHWA 1E2FA 4GI7A 4M1MA 2KE5A 3SR0A 2VHTA 2FG5A 1KOFA 2ZETA 2J3EA 1XD2B 1UAAA 4FCTA 2GJKA 3FMIA 4UNRA 1FPMA 4Q1FA 5K8UA 1XXHB 1X1RA 3QVVA 1G7SA 2FGKA 2FJUA 1EFHA 1E2DA 3VTKA 3SBEA 2NO6A 4DT1A 5JS8A 2VBCA 3NXSA 3GJ3A 2J9RA 2FFBA 5E3HA 2ZJ2A 1GRNA 4FI3C 4HI0E 5FPTA 3A4LA 2P3SA 1SXJA 2EFEB 3QKSA 4FIDA 3WBJA 4ZIRA 2ODEA 1GL9B 2NZ8A 5EP4A 4C7OB 3NHAA 1ZC4A 4MRRA 5FUWA 5KSPA 1DAEA 3BB3A 1E2HA 2ZI6A 2QY9A 4RZ2A 2ZIAA 2D62A 3KX2A 2FEOA 3QOFA 2BEJA 4I1UA 1HV8A 1S96A 4ACAA 2B8WA 4JJZA 2I3BA 1R4AA 3IBGA 2XAUA 4A2WA 5KNCA 2IC5A 2FNAA 2ZU0C 3NH6A 4XTRA 4DLWA 4GPTA 3DHWC 3N5CA 3A1WA 1KMQA 1NG1A 2WJJA 4LYJA 2JCSA 1CR4A 1E9EA 1ZU5A 2QMEA 3GPLA 1RZ3A 2QT1A 4O3MA 2WJHA 4PC6A 2EFCB 1ZIOA 3IHWA 4LJ9A 4Q5IA 2W6ID 3BD9A 1X6VA 2Q21A 1K8RA 5BYJA 4Q7MB 5KOYA 1SKYE 1AKEA 1X8JA 3GJ0A 3LH5A 4JBYA 4U7DA 4GP7A 2EVWX 2CLCX 4PZYA 1I2MA 4EPRA 1R0YA 3U61B 1LF5A 1XPUA 1FMJA 4GOKA 1OPXA 3CW2A 1IJEA 2CXXA 3U3KA 2HT1A 1VTKA 4LHVA 1YR7A 2Q3MA 2CJWB 5CDFA 4OHVA 4JL6A 3K0CC 4HB2A 3KXLA 2F1RA 1LV7A 3AKYA 2YINC 1LY1A 5KDLA 4TYWA 1DAIA 5LPNA 2C2HA 1TQ6A 2IXFA 4G01B 2GBLC 4A2PA 5FOVA 3I73A 1E2KA 2PZEA 4IFEA 2KWIA 4TN1A 5EE0A 1EESA 2J41A 3V4RA 1NY6A 3EZ2A 4HUQA 4PHHA 3SYNA 1QG2A 1G9XA 3X1ZA 3QENA 3QI2A 1YZKA 2V7QA 2WPDD 4MYUA 4HAUA 1J8YF 4IRUB 4BFZA 4AC9A 1N5LA 4XD7D 1NVXQ 2FPKA 2WJYA 2NO7A 5C2JB 3VX4A 4KODA 1UDWA 3FGNA 4BEBA 3RWMB 3RABA 1II9A 3A1SA 3E70C 1H8HD 4GSYA 5KPDA 5BN4A 5P21A 3ZIAD 2Q3HA 1I4DD 4TMVA 4DUGA 2IYYA 4TYQA 2ZE7A 4M9ZA 1ZW6A 2BJWA 2C8VA 2XTZA 2ZRAA 2JLUA 4JVMA 4QFMA 3DM9B 3SDZA 1T9HA 1VMAA 1FOEB 4TSFD 1OH5A 3LVQE 2BMDA 3VU9A 4PPNA 2Z4RA 2GHIA 1VIAA 1YQTA 3QUSA 3ZGXA 2ZITA 4DLXA 5GVSA 2WTUA 1CXZA 2ZUDA 721PA 5JRZA 1W36B 3GLGB 2GCOA 2HYDA 3NDPA 1TTTA 1Q57A 1T5IA 3QKSB 3MWYW 4ZIRB 2XTMA 5H8WA 2BM0A 2ZROA 1E2NA 1FW6A 1HTWA 3CLVA 2RHDA 4G1UC 5SZHB 3AVWA 1JNYA 3PCRB 121PA 1G3IA 5AJZA 4DRZA 4F7WA 3W5JA 4DIEA 1DTSA 2ZJ5A 2QPOA 3L0IB 4NBSA 1ZIPA 2VP4A 1NSTA 1GIAA 4V0NA 4IFBA 3BXZA 3LW7A 4TMKA 2XJ4A 4M1OA 5FI1B 1CEEA 2IXEA 2REOA 4IOLA 5KPJA 3LNCA 3K0FA 3NBYC 1AZTA 2VQSA 3IIKA 4EJSB 3CNLA 1E9CA 1JR6A 1G64A 4XSGA 2REXB 2IUTA 4S2EA 2P5SA 2J7KA 5FR1A 4C0JA 4FWTA 3VFDA 4EKDA 3UANA 3M1IA 2EWWA 2ZYVX 1DG3A 2RGAA 2Q3FA 4RD4A 2GBLA 2XXAA 2IS6A 4CRWB 3T1TA 4A0FA 3GJ6A 5LB4A 1GAJA 1KI7A 5A0FA 3FKSD 821PA 3GJ7A 4TQAA 3U4QB 3IIMA 4Q9LA 1E4YA 4MKGA 5TARA 3P20A 1KO5A 3BH7A 2G83A 5JMTA 1S1MA 3LX8A 1KI9A 4G5GA 1NN5A 1OHHA 4KBFA 4DLTA 2WAXA 3LW8A 1Q21A 2AHOA 4P0TA 4TMWA 2J59A 3V9PA 1TEXA 1BIFA 2P6UA 2RGNC 1QHYA 4Z8YA 1GTVA 4LBVA 4C3ZA 5IT5A 3QBVA 4Q9JA 4DDVA 3EG5A 3OAAA 4OJQA 1YHNA 4D0GA 2NO0A 3SJZA 4QXAA 4BASA 1V5WA 1TU4A 4KHZA 1Z2AA 5EXTA 3PVSA 3TR5A 1Z0IA 3DM5A 4XOIA 3GJXC 5BWMA 2ZRIA 1ZCAA 3PJRA 1E1QA 3GFOA 1G6HA 2W58A 1KDTA 2ZE6A 1JXOA 3UKDA 2QGNA 3GLFE 3GLIE 3NDBB 3IEVA 2BV3A 2QI9C 2V6JA 3CF0A 2L0XA 3ZDQA 1ZAKA 1H8ED 3PEYA 1Z0JA 1E9SA 5K8TA 5CYOA 2IBMA 4D6PA 3S1AB 5G3YA 3TVDA 3CWZA 3FVQA 5FPHA 5FUYA 3LQRA 1CR2A 3G5UA 4NH0A 1OKKA 1M7HA 2WWHA 3SC3A 1XEXB 3VU9B 3DKPA 3UWOA 3W6OA 3IHLA 1S8FA 3ZQJA 1FP6A 3HPRA 1XD9A 2WOOA 1KYIA 3B8HA 1CP2A 3W3AA 2GCOB 2AXNA 2D7DA 3F0TA 1ZRHA 1LVGA 1NVUQ 1GM5A 4ESHA 4DKXA 2SHKA 2BCGY 1M2OB 2FU5C 3AP1A 3EPHA 2HXYA 1NNEA 3SE0A 4TT3D 3NWJA 1E6CA 3AUXA 621PA 3RSLA 4GFDA 1HURA 1UKEA 4CDGA 1II8A 3AQ4A 3LBNA 4QNRA 1AGRA 1ELOA 4HAYA 4MITA 4DBLC 4A36A 2CNWA 3OHMA 3SJAA 3BB4A 4C0KA 1NIJA 1IXSB 3K0FB 3I5XA 1DG1G 2R62A 2OE2A 2OESA 2BWJA 4TWZA 1P60A 221PA 3OEHA 3ICEA 2GKSA 2ZI3A 5CK5A 2IX3A 5FBLB 2YOFA 1WBBA 4R71A 4US1R 1FX0A 1YJ5A 3EA5A 4MYCA 4OI4A 5G40A 5FOXA 4QM6A 5JCZA 1SHKA 2RGNA 2FEMA 4JIMA 4BFTA 2QU8A 3BGWA 2PEYA 1EFCA 1RJ9A 4AURA 5J4VA 1AZSC 4P3YA 3C16C 2P67A 3UWKA 2ONKA 4PQRA 2CBZA 1JALA 4PSVA 2RAPA 2DBYA 3FHOA 3KQHA 4QG7A 3AVYA 5BN3A 2ASEA 4PSAA 3HU1A 3QIAA 1PUJA 4M4SA 4MUAA 4NCNA 4LRWA 3RRNA 1TQDA 1U0HC 1OH6A 1NF3A 5HR5A 1CIPA 1TF5A 2QMHA 1AS3A 5M04A 1YZGA 5DGXA 1DARA 5E95A 4BFVA 4JLJA 3UG7A 4F91B 1RFLA 2ZPTX 1T5LA 4ZDWA 1UDXA 4RJLA 3DOEA 4TZ6A 1JEEA 2LKCA 4UQOA 3WY9A 2JASA 2VH5R 2A5JA 1XTIA 3PUXA 4ZI3A 4EDHA 3RVBA 4ZCLA 3VR4A 3B85A 3P27A 4Q7KA 5C4GB 1E2LA 4YQFA 4CT5A 2ECKA 2YWEA 2K5UA 1U90A 3GMTA 4QBFA 3MJHA 4BPBA 4TMZA 2ODNA 1FL9A 3VR5A 2HF8A 4HYYA 5JWOA 1F6BA 5EE1A 1II0A 2JAQA 3D3QA 1ZCBA 3PUZA 3PUYA 2BMEA 1ONBA 2IT1A 1FP7A 3EZ6A 3QJYA 3QG5A 1T3SA 1ZUHA 2FPLA 4P4TA 2F1IA 3ADKA 2R6FA 4X8LA 1XCGB 1G4AE 2H7VA 5G3ZA 1G8GA 3OIUA 1LS6A 5FUXA 4YLGA 1G21E 4CIDA 1P6XA 1CLUA 3VHXA 1SZPA 4P32A 3QVUA 3AVQA 2ODWA 3KQLA 2XOKA 3B1ZA 2ZR7A 1CTQA 1NN3A 2Q6TA 2RKOA 5GJCA 4LHXA 1QHXA 3A58B 4JVLA 1IY2A 3NEYA 3TQFA 1A5TA 1GWNA 1S3SA 3OIYA 1GOTA 4B2PA 3C5CA 4XWAA 2FSFA 3QXXA 5JWRA 3A1UA 3THOA 4X8HA 2QRNA 3FHTA 4JLAA 3VAAA 3TW4A 1FTSA 1GVNB 3AVTA 2OSBA 3KDSE 3D7MA 3TMKA 2GDJA 2XB2A 1IN6A 1G3QA 2P6NA 2PCLA 3DOFA 2QRZA 4OHYA 3B9QA 1Q12A 4HLQB 3EAQA 1F2UB 3Q7QA 1B23P 3CONA 3K9HA 4MKFA 1R0WA 1V43A 2OZEA 1FTNA 4JT4A 2JEOA 1FZQA 2GZDA 5FL3A 2UVQA 3FOZA 2X2EA 2C04A 1QVRA 3T61A 3TIFA 4ACBA 4KFTA 2CL7X 1Z0DA 1NBME 2QP4A 1IONA 2JLZA 2EU8A 2VSXA 1X3SA 3L0SA 1DEKA 3WP0A 5FH9A 2WICA 4RZXA 3R9IA 5SZKB 1OXVA 2WIAA 2B8TA 1DOAA 1IXZA 5F9HA 4D4KA 4A6XA 4EAQA 4HDQB 4ZPXA 5CJPA 2V1XA 1O3YA 4HAVA 3P32A 5BXQC 2JGNA 4UNNA 2B21A 3FYHA 5BQ5A 4N0DA 3CM0A 3AKCA 4QKQA 3UMRA 1CR1A 2CCKA 3CKLA 2ZRGA 4Y0VA 4WAUA 3W6PA 1GITA 4PHFA 1ZD1A 3TAUA 4TTPA 1VG0B 1KNXA 4MRVA 4AKEA 4N3NA 4R7ZA 5C4MA 1NKSA 3LFUA 3AVUA 3CX7A 4OHZA 5JI3E 4MH0R 1CKEA 2DPXA 2WWXA 5FBQB 4ZKDA 3TSOA 4JVSB 4BLOA 1U81A 3AV0B 1NVWQ 4JJKA 1G7RA 4OKSA 4YDSA 2IXGA 4KSBA 5BW8A 4B3DA 1US8A 3GLGE 4ZDKA 2Z43A 1NKTA 3BORA 2ZSBA 1G4UR 1N25A 3P26A 3QXSA 4Q1AA 4UXJA 3T35A 3W9YA 3TK1A 3N2IA 1CRPA 4HB3A 2ZANA 5IDVA 1G41A 4Z54A 4BGDA 1XEWX 4BRWA 3KJGA 2CCGA 1ZVQA 2RHMA 2GXSA 2NO9A 4Z51A 1E0JA 1F2TA 1OXTA 2ERXA 2A3RA 2WMOB 4OK6A 4TQ9A 3X1YA 4AD8A 1IAQA 4JSYA 3KZ1E 2CDNA 2R6CA 2WKRA 1E4VA 3WHKA 3I3SR 4DDUA 6Q21A 4KLZA 4MQBA 2FGJA 2P65A 3EPKA 4TMXA 2W6JD 4TLCA 3SFVA 1W0KD 3TSZA 3THWA 3THXA 2GXAA 3DPUA 3RS2A 4V0ME 2PL3A 4M0LA 2X2FA 4JLKA 4L9WA 1NIPA 2P0EA 4FCWA 2FPMA 1JR3A 5IHPA 1S9DA 1ESNA 2QNRA 4MGYR 3LWNA 3LLMA 1KMHA 2WWFA 3CRQA 5JI2E 2H17A 2ORVA 4CGZA 1CJVC 2FV8A 5EXPA 4MUBA 4DLZA 1GILA 4YXWD 3AVVA 1UFQA 4D80A 3EPJA 1ZUNB 1AKYA 1R7RA 4EQ6B 1ZC3A 4LJ5A 5JBQA 2DFNA 4PC3A 3CO5A 3QNUA 2VRWA 3ADDA 5TVKA 2JLVA 5HZKA 1RC8A 3R8CA 4Q4HA 5L3VA 4OQFA 1D2MA 4RZ3A 1DBSA 4EPVA 4DHEA 1TX4B 2EYQA 2ZU6A 2AL7A 4Q01A 2HJGA 1DAHA 1BOFA 3KB1A 5CITA 2ATVA 5DNYB 3WBKA 1N6IA 3VQTA 1Q3TA 3MUFA 4B3XA 1BO6A 3IILA 4JMPA 4ON9A 4O25A 2Q9CA 1X8KA 1G16A 1JAIA 3KJIA 3LAWA 1U98A 1XMVA 1EX6A 2YC4C 4FMBB 4L16A 5DH9A 4BFSA 3KKNA 3ZVLA 2ZSAA 1PUIA 2ZJYA 2NO1A 4PHGA 2QE7A 2IA5A 1E9BA 2OILA 2GILA 1D8TA 2BHRA 2D3WA 1Q44A 4MA4A 5L3SA 3T1QA 3O8DA 1UM8A 3ASZA 3EIQA 4NYJR 2QUZA 2CK3D 2FN4A 2GZHA 5DISB 4CYMA 1RYFA 1ZNZA 3EX7C 1D5CA 3F8TA 1JECA 4RFVA 4DCTA 1Z6GA 4G5SA 4OI1A 3C8UA 1IBRA 2Z5FA 4W7SA 2WKPA 3KKOA 4BUJA 4JLBA 3P1JA 4M1WA 4ZDIA 2QAGC 3DVLA 1G1MA 2XSZA 3GLHE 2WAYA 3HYRA 5JZVA 3RYTC 2IYUA 3ASYA 5CM8B 4B3FX 1UF9A 4Q4LA 4D4LA 3LXRA 1NBMD 1US8B 1HYQA 3D8BA 1G3MA 4DDTA 2YWFA 4WIAA 2ZI4A 4YMWA 3FMFA 2W0MA 2VSFA 2LWIA 1Z0FA 3WHLA 1KAGA 2WBLC 4US2R 2WSSA 1F2TB 4NYMQ 5DO9A 1OIXA 1TF2A 4Q1EA 2PCJA 3QXCA 4PXAA 4TL9A 5HKKA 1Z06A 1CR0A 1GL7A 4U00A 1G3RA 2QQ0A 2VYFA 4MKHA 3THWB 3THXB 4US0R 1P73A 4UJ3A 4IDPA 2OT3B 2OXCA 2CE2X 2ONJA 2IYXA 3T34A 5GVRA 5FFMA 1ZNWA 2D2EA 4I1VA 3U6KA 3OE7D 4KO8A 4A82A 4B74A 3CRW1 1XJQA 3QE0A 3PITA 2IUUA 2O8DA 4JLNA 4KYUA 2QPAA 3T5GA 5FPSA 2YKGA 1G20E 2OM2A 3K0EA 4WZAE 3EZ7A 4XIGS 4LYFA 3KQNA 2CE7A 3KKMA 4Q4JB 1MO4A 3SS8A 1DAMA 1EFTA 3MWJA 2JDIA 4H9GA 4NTZA 4QBIA 4BZPA 3AGPA 3ZQ6A 2XZOA 2RH5A 4M9SA 1U8AA 1ZM3A 5G41A 4OI0A 2WJGA 4Q4HB 5FPYA 2D7CA 3P4XA 1MO6A 2GCNA 3R9XA 1U99A 4DSNA 1U8YA 3W90A 2H57A 3CUEF 1P62B 4Q18A 1P75A 3CBQA 1KJZA 1KSFX 1EWQA 2I4IA 1C1YA 1VG8A 4PPQA 4JLOA 1Z0KA 4LC1A 1AS0A 5BN5A 3AKEA 4HATA 5FOUA 1P2TA 1AQUA 1UBEA 3VMFA 4A8JA 2AN9A 3AVOA 4JYBA 2PBRA 5EQTA 2PLFA 3FB4A 4ZDJA 5FTLA 1D6JA 1W44A 3FTQA 4IOKA 5GJWC 1IOZA 2GF0A 4NHOA 4D25A 2O8FA 2CVHA 3WYAA 5A5GA 2PMKA 3PEUA 1XTRA 4URVR 1OFTA 5HZHA 1NI3A 2J46A 5AJWA 4A6PA 1COWD 3EW9A 4B33A 5KSOA 3T12A 3R8FA 1Y3AA 2C9CA 3KFVA 1SVLA 3KTAA 3ZJYA 4K46A 4LHZA 4C0SA 3HP1A 3KJEA 5IF9A 4ARZA 1OYWA 2VF7A 2V3CC 2CMKA 4Q03A 4WVFA 5KNBA 2JA1A 5EXXA 2YOHA 3TVTA 3CPJB 1N5KA 1N3BA 4AI6A 4IEIA 2AR7A 1NJGA 2FSGA 3IEUA 3QKRA 2A9KA 3R7WA 1IM2A 3MG9A 5CB8A 2J0VA 3RC3A 2C03A 4B48A 2YZ2A 3VR6A 3WXMA 2ZM5A 2HLDD 3A36A 1Z29A 3OFND 4PO1A 2GEVA 2O5VA 3U7GA 1XTJA 1GKIA 1PVOA 1A1VA 4KV9A 4I1SA 4QGHA 1XMJA 2ZE8A 3PENA 4FW9A 4TL7A 2W6IA 1ZM7A 4M1TA 3RS3A 3C5HA 4N1AA 4RD2A 3FKQA 3W8NA 4W5WA 4JT2A 4NP6A 3UPUA 4I4LA 4D0NA 3BFKA 2UZ3A 2GRJA 4XVQA 3REFA 3DEFA 2WZQA 4D26A 4M1SA 3LLUA 1N2CE 3L43A 4PSKA 3Q8XB 4R98A 3U3JA 2DWPA 2A5YB 2Z0MA 1KSHA 3JZAA 1C9KA 2IYSA 2JLSA 3LBIA 3NVAA 5GJVC 4C0BA 3KL4A 2F1JA 1Z08A 4NPHA 1EWRA 1G8FA 2ZRLA 4KBGA 4C4PA 4RZUA 1R8QA 4DT1B 2PMDA 4EPYA 2JJ2D 2WPDA 3U44A 2D4HA 2O0HA 1L4UA 1OIWA 3H4MA 4JZKA 3LO5A 2IYLD 3GEHA 4XD7A 3BH0A 5LD2C 2BEKA 3PUWA 2QTHA 4IKEA 1N6RA 1J7KA 1SXJB 2F1HA 4WXPA 2A5GA 2DHRA 3L82B 2JJ1D 1DO2A 2I1VB 2MSEB 3IKJA 1H8HA 3TBKA 4DDWA 2IF0A 1LFDB 4NKRA 3ZIAA 3VNUA 5E4FA 1GRRA 3B5JA 3AB3A 5DIFA 1S0UA 3ZD6A 3IO5A 1OIVA 4A8JB 2FFHA 3GLHA 4URZR 5FTJA 3CRVA 1D9XA 4F92B 2LKDA 1KSGA 1CJTC 2O8BA 1P7CA 4U5XA 2OAP1 2ERYA 2ANCA 4TSFA 1W4BA 4M2LA 2BM1A 3SEAA 1E9FA 3MJRA 4LDJA 2O8FB 5JSZA 4BZQA 4Q4AA 2FZ4A 2AX4A 4URWR 3K0CA 3GEEA 1E2EA 4G5QA 3HWSA 5KSZA 1GNQA 4G3XA 2P2LA 2QMOA 4Z8XA 4UKDA 3CNOA 3NC1C 2NGRA 3OF5A 4PC2A 2HV8A 4FXPA 2C9YA 2ZRPA 5EZ6B 5HCNA 1M74A 2PX3A 2ZUBA 1XCMA
chains in the Genus database with same CATH superfamily
2VN8A 3RAEC 3BHJA 3LCRA 2W2OA 1XWIA 1LLDA 1PJBA 4ZV4A 2FMFA 3IR6A 4YJFB 2QV0A 1SEVA 3RIGA 4UTXA 1SVNA 5JAHA 2J0SA 1E4OA 3CF6R 5B37A 4U2EA 3ZE9A 5IBRA 3T52A 5HP4A 1YB1A 4PLHA 4ZO8A 2XITA 1JLSA 3T4EA 4L3WA 4E4RA 3OX1A 4X85A 1RSZA 1K0UA 1O6CA 3AY7A 1X7WB 4K9OA 4WASA 1SHZA 3DE6X 3PPXA 2VP0A 4G5YA 5E3IA 3VKUA 4CWAA 4FINA 4CF7A 4KI0A 1VI6A 2ZRCA 1NRJB 5CIWA 3IE1A 3U3RA 1L7RA 2ONCA 3UG6A 4PIPA 3VNVA 4DMMA 4ARBA 4KLCA 2HF2A 2V5UA 3FCUB 3B1VA 4GI1A 3S44A 5C8VA 4GDFA 1P7PA 2C58A 2DBVO 2V4ZA 4WX2B 5EIOA 3RM3A 1KU0A 4FU0A 4PZDA 1SG6A 1J24A 5IZ4A 4OKNA 2QGZA 3CRRA 4B80A 3PIIA 2HEIA 4BTLA 3ANNA 3AM5A 1PV4A 1GTL1 2MYUA 3HCBA 4LBZA 1JNXX 1RYBA 3HABA 3HCFA 3R3XA 1NMYA 2H4XA 4FOLA 5AI0A 1T1JA 2QU7A 2DR3A 1CFZA 3FPHA 4DWVA 4F06A 1ARZA 2VPIA 1FUYB 2WHYA 5HQTA 4GBMA 4D99A 3AF2A 1QHGA 1YNOA 4EF5A 3PBKA 1OAOC 2OBLA 2V03A 3L01A 1O57A 4NZNA 1DBIA 1P4AA 4B8ZA 4XRGA 4HH0A 1UK6A 1G8MA 4AULA 2JLYA 2PKYX 4EL5A 4GQAA 1DEAA 4O5AA 3EUFA 2BDUA 3OH8A 2P2GA 2PAFA 5LQNA 4UVIA 1MA0A 2HSEA 4KUGA 3BGIA 1I5OA 2FUCA 4N0MA 5TQVA 1XPJA 1G9SA 1HT3A 2JS7A 2Z9CA 4KUEA 4V3BA 4WXRA 4B2IA 4CLRB 2QTVA 2ZJOA 3NTUA 4GRAA 4R4JA 3WNBA 1GQQA 2PZAA 4Y0NA 1ESDA 4XAQA 2JANA 3EXFA 2AJDA 3VSAA 5I4CA 2VP5A 2VT6A 5CB6A 5EMNA 1FRQA 4HDNB 2BGLA 2F8MA 1I1OA 1IEWA 5D6NA 2Q0QA 1Y34E 3NUGA 2Z58A 2TECE 2A30A 1CQIB 3IRVA 3E9YA 1Y7PA 1YL5A 2ZUSA 4ZOLA 5EHGA 1BVHA 2XB9A 3KD3A 1XEWY 4DLLA 1SQ0A 1WQ1R 3FTCA 2C54A 2O59A 2FKNA 4RK6A 4O8CA 3K73O 4HTAA 4F56A 3OLXA 4QE3A 4ZC8A 1PS9A 1O4WA 1U2SA 2I65A 2Z3WA 3WJ7A 1YVPA 4EA8A 3PXGA 1QWSA 2BKEA 2QZJA 4FKZA 4S1WA 1ISIA 3LQFA 2AC4A 3IC5A 2D3TA 4EAAA 4RLHA 2W83A 5L51A 2Q27A 3CX3A 4PCLA 3X3HA 1F8UA 1IPEA 4HDOB 3BWXA 4FYXA 4PTYA 3SPXA 1ZGCA 4X91A 3RT9A 2ZRFA 2JC3A 2VK1A 4I7EA 4D02A 3HLYA 1TZKA 4ENVA 3K5IA 1DE0A 2QQEA 3F1LA 4JI6B 3U0VA 4BMPB 2CHVA 1AS2A 3WJAA 3S7TA 3MLAA 4KNYA 3MELA 2O14A 1FFDA 4K86A 5KYVA 5F2KA 3TJRA 1TADA 4X1KB 1ZICA 1O87A 4TT3A 1GU1A 4LYYA 4X62B 3ZH9B 3QPVA 2GFIA 3QVMA 3QX8A 2N42A 1H2WA 4CEJA 1G1AA 2CMDA 4WNYA 5I9MA 4E33A 2NU6A 5KYTA 1OU0A 4NSNA 1H5NA 4HWRA 1EM8B 4R0VA 3RF6A 2GXQA 4WERA 3PZBA 3EVBA 5HGXA 3ELDA 3HXQA 4M9RA 1RWPA 4MRMA 2HN9A 4O4HA 1J99A 5IXSA 2R44A 5EYPA 1TTPB 4I1RA 1ZGJA 2DTEA 3ROEA 3SC6A 2OO5C 2Q3DA 2ZBVA 1GL6A 2VHQA 1LW6E 3N6RA 4QGSA 3KQOA 4W5QA 2WRZA 2BMJA 3IUSA 2CBXA 1W48A 2IV2X 1N9KA 5A9SB 4P1ZA 2R87A 2IP1A 1FLAA 1GCGA 2VDRB 1XZPA 3AW8A 4JL5A 4NATA 4Q7MB 3MB5A 2ECOA 2QVGA 4ZAZA 1OAOA 4IIGA 4DEXA 3W8EA 2WQZA 4ND7A 1IN7A 4DANA 1D1QA 2BT4A 3N7TA 1ZJ6A 3NHKA 1K4MA 5AW5A 3SX0A 5CDSA 3EQZA 2R2AA 3DF9A 3FDZA 2WIBA 3CZQA 4XPIB 3ZWPA 2NVBA 2GZAA 1OJ7A 5K45A 1UDCA 3I1IA 4FUTA 5HIIA 1WP4A 3G68A 5LD2B 3FWKA 4HNGA 2C7QA 3KEQA 4N0EA 1J8MF 3G3EA 4G9EA 1XJ5A 4B9AA 3QVXA 2I22A 3KYDA 5B2ZA 2M1ZA 1CWUA 2YJZA 3KKQA 1IZYA 4B4OA 4FZJA 2R1ZA 4JNKA 1N2GA 3N28A 3MQFA 4ZZ3A 2PT5A 3TPFA 3TLEA 3IGFA 1E1RD 1A5AB 2BKLA 1Y5LA 3RVDA 3VPFA 3EGXB 3R9WA 4G65A 1ABEA 4IMIB 4HADA 1L4KA 5EE3A 1GRQA 3K09C 2NX2A 5DGTA 3EGOA 2NACA 1C2YA 4B3CA 1XWFA 2GNAA 3VM6A 2V59A 4KMMA 1G98A 1E3SA 3H83A 3L4JA 4UFPA 4EHDA 1XMSA 3E5RA 3AUUA 3HJHA 2ZFUA 5FNVF 1VIVA 4BE4A 1NFQA 4WA7A 1SKYB 4BO9A 5DYGA 3AK4A 4P3XA 3JZFA 5I45A 3KUUA 1U2DC 1RXWA 4NBTA 1G5FA 1X9GA 2CMHA 2XUIA 5I9NA 3K6SB 4X95A 1R16A 4II3A 4EY5A 5BWBA 4ZARA 3Q8LA 1P39A 3QFHA 4DA7A 1Z28A 5TVGA 5BORA 1IUPA 1FQJA 1T0IA 2FN9A 2IZ1A 3L8MA 4NOKA 1IH8A 3QPBA 2C5EA 3VU1A 2PH1A 3AV3A 2O2JA 2C2WA 4HGQA 4N7JA 4OJKA 3K53A 1TDJA 1NL3A 4BLPA 5EJ2A 2VHJA 4ZT6A 3ESYA 3JYQA 4H08A 4NAHA 3AP2A 1G3UA 5CT4A 2OCBA 4M9XA 2BH9A 3F71A 3PQEA 4MUFA 2YHIA 4RA6B 3NIBA 1QV7A 1X1CA 2JFHA 2XYRA 2YRWA 3AIMA 3FHLA 4OGKA 5EXEA 3WR5A 4M8SA 3QXJA 3M3PA 1DX4A 3OM9A 1EFUA 4LKRA 2OO5A 4UQPA 1Z2DA 2RI1A 3ORHA 3UMBA 1OR8A 1XSEA 1MOZA 3CW8X 3WLQA 2WE8A 4Y67A 4NFYA 5F5NA 2IBTA 5DHUA 4F4HA 1Q74A 4OBEA 5LM3A 2DHCA 4RZHA 1WCWA 4ASUD 4N41A 2J3KA 2VLIA 5TMDA 1KDRA 1R4NA 2KMLA 2W48A 1L6RA 1LW7A 1M8PA 4XH9B 3RGWS 1LQUA 2CJXA 4HKTA 5FPKA 4D92A 3MVEA 4P58A 3TLXA 1U1CA 5I8ZA 3CVXA 3TSWA 2WV9A 4TRMA 3B3FA 4GBGA 3FOEC 2V7WA 4Z49A 5IKOA 2QF7A 3JQAA 2QMZA 1Q5PA 2FKAA 3V7UA 3U4HA 4IF6A 2QIPA 3RVKA 3ABZA 3ER6A 3B9RA 2W2KB 1DXOA 3MMZA 4IGEA 4NCIA 4EF6A 4TX1A 1PL7A 1WHTB 4PM4A 1BH6A 2C2ZA 1RAFA 4IH9A 4PS0A 3V42A 4JVNA 2J0QA 3QSGA 4WK0B 3OQVA 2HJSA 3RV4A 2XUFA 4W5HA 1RXVA 3M4JA 2RE8A 4R7GA 2JGEA 5KYXA 1XKQA 3JR7A 3H8JA 3NBZC 4QYTA 3K09A 3V46A 4X65B 4ROSA 4UUPA 1G42A 4NCXA 4M8LA 4MW4A 5KWIA 1IUKA 2XRMA 3R9XB 1IQPA 1GPUA 1NF9A 3E2PA 3HO8A 4YP1A 4C2AA 5KMGB 4OQPA 3RUCA 3RW9A 3B1YA 3FVTA 3VTAA 4XWKA 4Z4GA 4CG1A 2EFJA 1W25A 4I4TA 3R09A 4RC9A 1TCBA 2XDWA 3U1VA 1C0LA 4A8TA 1N6OA 4DYDA 4D0LB 3MHTA 4ER3A 1I0IA 1U2DA 4EO9A 3GDGA 3WG9A 4CZ2A 4DA6A 1QQAA 1RRGA 4KR0A 1SULA 2J6HA 3ZZUA 3L1VA 4BV2A 3QTTA 1E2BA 3DGFC 1XDSA 3TVYA 1CUGA 4AZVA 1R66A 3VJLA 4FR5A 4V03A 5BV8A 1HG1A 5DE3A 1PL0A 3K5HA 4H0CA 4JOBA 4ZGWA 1WB9A 4BNFA 2Q5LA 3AP3A 3AEUB 3L8GA 4R81A 4MV3A 3PQ7A 4Z99A 5HJ2A 3EIFA 3EPLA 3RWBA 2CFRA 1HF3A 1TQ4A 4URYR 3U17A 2Q46A 4COKA 4EGCB 1O97C 1O77A 4PE5B 3BWMA 4GC9A 1Z56C 4YO8A 3I4LA 4N6GA 2ETVA 2FJPA 3B1WA 3DUFA 3BZBA 1M75A 3DZCA 3G0IA 4HNAB 2OB1A 3MF4A 2FG7C 4H7JA 5H16A 3R0IA 2IWHA 4AKGA 3NHUA 1PSDA 1KVRA 4JLSA 4YUXA 1EKXA 4JJ4A 4PO3X 1A88A 2NU7A 4BWVA 2W98A 3E3OA 5JXGA 1KHTA 3SZGA 3NJ4A 1PJTA 1L7BA 1QRDA 4FZ5A 5CA1F 1ISPA 16PKA 5JD6A 4XVHA 1GPAA 4JI8B 1VLJA 3F5QA 4F0JA 1I4TD 4DM4A 2WHPB 4CNBA 2XCRB 2ZWAA 2WYOA 3KT8A 1Y6FA 3OZAA 5J4YA 3U7RA 4L76A 1C0KA 2CUZA 4L4XA 1ECJA 2CEKA 4I9NA 2IYAA 4NYJQ 2Q5EA 5M29A 1RQPA 3ORRA 3FGZA 3K4QA 2RK6A 4GLOA 1OAAA 1Z15A 2RH8A 4YMVA 1M2WA 2QI9F 2C5HA 4I99A 4MR9B 4RQTA 3AHHA 3MK31 2ZXUA 3H42B 1TKRA 3EASA 2A4MA 2QM7A 3NJRA 4MQ6A 5TGZA 4AW9A 1TJ4A 2YVQA 3NTXA 2ZB3A 1TIBA 3L7IA 1AB6A 1RWOA 3OQPA 4ENPA 2AG5A 2FW0A 4RMGA 2VJNA 3C3MA 4LGVA 1FQKA 1EFRD 1KQFA 1THMA 4RUKA 3TXYA 4PSUA 2FPXA 4U7PB 2ZIVB 2BHTA 3MXTA 4W1QA 2G04A 5FFNA 5LNK6 1TVKA 1ODSA 4Z1MA 4PNZA 5B7QA 3EXIA 3UXEA 2HTEA 4NARA 5A7HA 4H18A 1G21A 1KDOA 2QAJA 2WK1A 5E38A 1W1IA 3THSA 2XVAA 5K09A 1DCMA 2Q41A 2ZB7A 4CDNA 2HA5A 3MGBA 3PB3A 3JAMA 4CQMA 1SEPA 2NN3C 2W2VA 2VK4A 3EY4A 3VR3D 5CLFA 1PCXA 2XMZA 5DCLA 5EIAA 3MB8A 3DWEX 3I1YA 4BO0A 2TMYA 3MWLA 1KI1A 1KOJA 1BKSB 1T9KA 4A10A 4CEHB 4LV8B 5DHRA 3REQA 4D3SA 1PE0A 3QVSA 5LYJA 3K9NA 4CM4A 3C3WA 3LQYA 3X1WA 3A4VA 1N6NA 4JKYA 3U3DA 5EJ4A 3R3JA 4B7CA 1O95C 1Z5NA 4C03A 1FYFA 1YZYA 1UMCA 2W4QA 2XB4A 2BBSA 4IHKA 2IXDA 3RAPR 4OUDB 3R9KA 3X2EA 3PL5A 5DWDA 1A2BA 1HTTA 1A0OA 1SVKA 2RCYA 1FXWF 1MJHA 4NG5A 1SHTX 2JFZA 1D3AA 3EZFA 4NF2A 4OGFA 4D2IA 3EH1A 2D0PB 2IKSA 1GPNA 4ZRNA 1XP8A 2VF8A 5JQGF 1XD8A 3O5AA 3LSTA 3SF0A 3L9XA 4BX3A 1M67A 3JYHA 2NM0A 2P4QA 2YHSA 4G1VA 2B8EA 3LIIA 3UGJA 5I7VA 4YCLA 2E4ZA 3OU2A 4DCUA 4KXXA 2BR5A 2FEAA 1MX1A 3OE1A 3K94A 1IVSA 1QIJA 1QH1A 4NFHA 1FSZA 4DJDC 1ST2A 5AJYA 4KR3A 1LPAB 4MWOA 4BPRA 4F21A 1NBMA 2H07A 2WG0A 2ZYAA 3B9PA 3MMNA 4OB7A 5IFKA 1KMHB 4GYYA 3S0JA 2R7NA 3D4LA 3N5KA 3DYBA 1EJ2A 4HN2A 4I36A 4JB2A 4KR6A 1TTHA 2FB9A 5KWVA 1U7XA 1UJMA 1Z2CA 2XNCA 3IUQA 2GM3A 4YB8A 5L6LB 2DLCX 1SXJD 5REQB 4MGHA 4BLSA 1AJEA 1G8SA 1WWKA 5D3MB 3DMNA 1LPSA 1WMDA 5D84A 4CKCB 2A2ZA 2YWXA 4KJXA 1JEYA 3QPDA 3WWDA 4D43A 4LSWA 3GLUA 2DQ4A 4ZCIA 1HE4A 1Z4QA 2FDRA 2HC9A 1PT6A 2O0JA 1I3KA 3AUFA 3FPSA 3K9BA 5BNFA 3VDXA 1CNMA 2WU4A 4NRDA 5CVUA 1ABBA 2PUEA 10MHA 4DYVA 1K8ZB 2ZBQA 4GX1A 3A4MA 5AK6A 3JQEA 3QOWA 5CA0A 3OE7A 1P81A 1JF8A 2JVIA 5FOSA 1DI0A 4CMIA 4H6PA 1OFUA 5ES4B 2HXGA 2XE8A 3B3GA 2PUVA 4HDMA 5FIUA 5AM2A 2ZSFA 5JVDB 3WLFA 3AY3A 1NLFA 3QNWA 4DV2B 4YT2A 4CCAA 3L0OA 2X6RA 3GEDA 4RV9A 3X2SA 4Q6WA 3H11B 3BM5A 4BFUA 1P17A 3RUIA 1ILEA 3OLYA 1T4GA 2F62A 3K2EA 1PWZA 2D2FA 4MWTA 4DMRA 2X1VA 4LOHA 1C80A 5F1KA 4ZCPA 1DNPA 4IICA 3SZRA 4EJFA 5EHXA 3RARA 1QVVA 1GT6A 5KUTA 2VDNB 4J16C 2G08A 4YQEA 1I30A 3WSVA 4L8FA 2XZTA 2VXOA 4ILEA 3UWDA 1D4AA 2MMCA 5MF6A 2PS1A 4NR0A 3CB4A 5B2FA 2FWMX 1ZIYA 2V5AA 2Y0EA 3LHIA 4HFNA 3VO9A 1DO0A 1O95A 4M7PA 5JMOA 4LF7B 4MPTA 2A9PA 4L8LA 3I32A 4CUKA 4D4IA 5LNK1 3LBHA 3T6KA 5H1YA 1ZISA 3ZXYA 5TIIA 3TFOA 3GD5A 3AR6A 5TV2A 4F85A 5K8LA 4QNMA 2Z3VA 4UEKA 2AB0A 1AM4D 4IDNA 1C9JA 5DI9A 2NLOA 3IEIA 2HWUA 2JNWA 3NC4A 3LT0A 4V0MA 3WNCA 1GAXA 4WFKA 1PQYA 1T9CA 2QVLA 3WAKA 1O2DA 3I62A 3AZPA 1ULUA 4WOJA 3JZDA 3K1AA 1ZMBA 2ID8A 4OVKA 2FF7A 1KIMA 3I9LA 3RK1A 3ZU2A 2CKMA 8GPBA 3AUKA 1XCBA 2HBZA 3QEJA 1TIKA 3BWCA 2YR0A 4RSHA 4WK2B 5FBKA 4C78A 3BDIA 3PQ5A 4ZOEA 1XMIA 3V3TA 3X1MA 2KSQA 2OHFA 2DUMA 2VA8A 1XRSB 3Q72A 2Z2IA 1YRQA 4BNTA 1X15A 4L5BA 2EERA 1ISJA 1COWA 4JBIA 2XKAA 4PGGA 4HAZA 4BO1A 1FFYA 1CJCA 2VYNA 1ZWLA 4B5LA 3VAZA 2EP5A 4QDTA 1T4MA 1W49A 4ZOBA 2KB0A 3UMJA 3NVKI 5GWXA 4YREA 4DVGA 1C41A 2BIFA 3DPSA 3GAZA 4FQ5A 1RQ2A 1Y4SA 2WU0A 1G6OA 4AY6A 4W9RA 1C3OA 4HEQA 1WU8A 4R3NA 2Z8YM 1AIPA 1E2IA 2EQ5A 5JD5A 3D0RA 2JAXA 3MM4A 1WXDA 1XTZA 3KB6A 3PF9A 4ZQHA 4YPOA 1CUJA 3UT5B 5TXGA 1JIJA 2HA3A 2XVXA 4BWYA 5FOTA 4G81A 1KE1A 4I19A 3COJA 3SI7A 3HPQA 1CEYA 4HDCA 1NBWB 5KWSA 1V3TA 1FU8A 2HPHA 4OXQA 4Q4DA 1RWXA 3BJEA 4TKVA 3DCNA 4PINA 1GZ6A 4IL5A 3FKJA 4QPNA 3RS4A 4QAQA 3T06B 5HJ5A 5JCJA 3WLNA 1JDZA 4FX2A 2IEYA 2WFZA 3L0PA 3L77A 1YRLA 3OQBA 2A5DA 1SUFA 1YHZA 2P90A 2YC2C 3ENVA 3OM1A 1QDEA 2IQ5A 3R0VA 4UTZA 3H2JA 5AM4A 2J6CA 3CX6A 2XCOA 5FYDA 3RYCA 1PQWA 5JADA 5LZ9A 1P45A 4ARIA 2YVKA 1HDRA 2RBGA 1OLOA 2RKWA 3MJTA 2O7QA 5HIMA 3WGIA 1DFHA 3S1AA 5JZ9A 2GYWA 3THRA 2V6IA 3OZXA 1L1EA 3E9MA 5EESA 5BN5B 1NVGA 2BP7B 2C7BA 3RBZA 5FA6A 1S7CA 2YBEA 3IMCA 3KXPA 3K70C 2E5LB 4W6ZA 1IY1A 1KIFA 1JFVA 4DLNA 4AYTA 5JISA 1SPXA 3P2IA 3SHQA 4D9KA 3R3UA 2EIXA 1FUKA 4QFCA 3ICQB 3WMEA 1WPXA 4IKPA 1NAIA 1BMTA 4OQEA 2BFDB 5DKFA 2I76A 3WWPA 1RTTA 1J1IA 2JJ2A 5COQA 4W9MC 2QUHA 2ZUVA 3E5HA 2NYAA 3I72A 5DI3A 1SO8A 2X5NA 3AG5A 3I1FA 4Z1OA 5MN6A 1OVMA 1XTSA 2I4NA 4H1VA 2FEPA 5KYYB 5DYTA 2O8EB 5K51A 2AWNA 5SY9A 4XIJA 3DXFA 1RZRA 4HQOA 2RGCA 2WHXA 1NMSA 1GQYA 1KZ1A 2ZTSA 3HKCB 4ZHQB 3BL5A 3LD9A 4TN5A 3AU8A 4PCUA 3IVAA 2R4UA 4PZUA 2QTBA 1SQFA 1ZCJA 4WESB 1XB2A 5ECWA 4A0GA 2C96A 1F60A 3AI1A 2AMLA 3I9OA 3CHYA 3P0FA 1N2EA 1DPGA 1TPYA 2Z98A 3CUUA 1TKCA 4WLEA 4TLEA 4YAUA 3OAAD 1KNQA 5LQRA 4RETA 2FSSA 1K27A 3LOUA 2QUJA 2ZS9A 4G41A 3TNFA 5EMLA 3LKVA 1P5RA 1Q50A 1WMSA 2XWPA 4NX2A 4A8HA 2GETA 1H6BA 1N0VC 2YZGA 2R7MA 1F17A 5AVXA 1K8YB 4KQWA 4WZAA 2PVCA 4IXWA 2C8JA 3GVHA 4YMTA 2H4JA 1SCBA 1CFJA 5FBVB 3ZE0B 3NVDA 2AK2A 2LDBA 2OFOA 3TYXA 4OXRA 5AK5A 2C5LA 1E0SA 3EDQA 4IFIA 3LBYA 3HVKA 4KXYA 5J40A 1WX1A 2RB5A 3DOJA 1N4AA 5KYKA 3BWDD 3G2KA 2HU8A 1RYNA 2NXJA 2WR8A 1A4RA 1A9PA 1F48A 2JFGA 4RMNA 4JKIA 2JFUA 2QA5A 3NC0C 4L7VA 2VP6A 4FFNA 4E22A 1RBQA 4MRNA 1MC1A 3ZW8A 1USWA 4D6XA 4YJ2A 2AHRA 3ND9A 1ONNA 5CURA 4EG8A 5ITSA 3E35A 1WEKA 2YYSA 3AI7A 4PAGA 5FCDA 2I3DA 2MIIA 1K06A 3OWXA 3SOPA 1GZUA 3F5SA 1W2HA 1WXWA 2IPNA 1TIPA 1ZOPA 3FFWA 4UTOA 4N4AA 2P9ZA 3SZ3A 3B5EA 1CJKC 4B8WA 1J2EA 1WABA 2XUGA 4F11A 1H9AA 4Z9FA 3W3AD 3UOWA 4Q7JB 3DOOA 3QBEA 2H1FA 1VJCA 3U9LA 2AFHE 3H5TA 2OV2A 1Q19A 5IASA 4GMXA 4IMPA 2F00A 3DDUA 3U44B 1HEUA 5FPQA 2E89A 1FFWA 4Z7NB 1QTRA 2QP3A 3TCXB 2O3TA 3IKVA 2OQVA 2OLEA 4MQUA 1ZBDA 2N47A 2P1ZA 2ZIXB 3OWHA 4GL4A 1KBOA 3TJZA 4DHWA 2I91A 3PDCA 1M2NA 1OGJA 1WXQA 5FTKA 3N9IA 3QJGA 5PGMA 2GJ9A 1M1NB 1MFPA 3E58A 3SN6A 5B36A 4Z3OA 4KG7A 4EFKA 2IDZA 1E79A 4DNQA 4G4SP 3NNDA 4YHBA 3B1XA 4OL9A 5CUQA 5AR1A 1UMBA 3ELUA 1S5PA 3V00A 2NMVA 2GYYA 3KNZA 1GUFA 4XVRA 1S8AA 1P1IA 3RGGA 3WWYA 4L5IA 2VSNA 3GLHB 3K9GA 3M81A 1Q7TA 2BBOA 5FWXA 1HDIA 3N6XA 4V1CI 5CXSA 3L1KA 1OWNA 5BMVF 1N3YA 1XN1A 3GUUA 1NQTA 4KL8S 5LZ8A 5DDIP 2XR1A 2N9UA 1BCRB 1OXUA 1ZN7A 2EIHA 1H2FA 2I6TA 3L02A 4D46A 4ZHQF 1D2NA 1IC6A 1WXXA 3SC2B 3LRTA 4Q4AB 2JATA 4P4SB 2C77A 2YWRA 3GZTB 1HYGA 3ILXA 3PTLA 3IIJA 3WZ2A 4S1NA 4XX0B 4NJMA 3H6HA 3GLKA 4AMBA 1DLIA 4KZKA 1YKSA 1H2YA 1K4KA 1XVVA 4URUR 4BV3A 2HCBA 2X13A 4A03A 2IX9A 2JVJA 2ZYHA 4Q24A 3WE7A 4ZI2A 1KQGA 1T8UA 4BATA 4TTVA 3B2EA 4OXYA 2QRPA 2PA3A 1ULSA 3GUCA 2DUWA 2EYUA 4HAWA 3FSRA 2O0LA 1ZSYA 4GX0A 5BV2P 3EZNA 1QGZA 3OFKA 4J7XA 4X54A 4KK4A 3IULA 3KIPA 2G1KA 2HQRA 2X77A 4UOEA 4E7OA 3ILHA 1LNSA 1Q22A 2OV1A 3FPJA 3W6ZA 1HH4A 2AMYA 1MPTA 2HJHA 4ZREA 5I9BA 4YRMA 1XROA 1Z45A 2VFAA 3HYNA 3NKLA 4HBZA 3R7SA 1QHIA 3VUFA 1ETUA 4ESVA 3V2HA 1NX9A 1N7IA 4P5EA 4RK5A 1JR3E 2N0SA 2C83A 1A72A 2VK8A 3D02A 4HRXA 1DAKA 1ZL2A 1FW8A 1QIGA 2W00A 4UMVA 4CLHA 4LFAB 4MVJM 3DDOA 5CG1A 5ADVA 4INAA 2IYQA 4J0IA 4WKPA 3BSFA 3WYFA 6AT1A 2G82A 5DN9A 2GO7A 1NQXA 3VR5D 3R24A 2Q07A 3BDAA 3EYWA 2RARA 3HYCA 4YMUA 1P0FA 3KHKA 5AVQA 4HWGA 3SGLA 5HS4A 2DQKA 2M1XA 4LY6A 2QAIA 2PV0A 3UJHA 1EK2A 3LUBA 3LUPA 4OM7A 3SS9X 4ITRC 2B94A 3PFCA 4W1SA 3BJMA 4QYIB 1ZHHA 4K6FA 1ZJWA 1C50A 2QDKA 4H31A 1XEAA 5JYBA 5G1NA 4HZUB 1A4UA 4O1MA 4QRHA 2XCTB 3NB0A 3TZHA 4RTNA 4IIJF 5FO1A 4FB4A 2QE6A 4FE7A 1XHFA 3TS1A 3ETCA 3I9KA 3CLSC 3DAHA 1DJMA 1TKAA 5D87A 3PQ6A 5BXYA 3RCBA 3CINA 4FK8A 1N2ZA 4HEJA 3OETA 1MO2A 3T3GA 1X80B 4DRXA 2XOKD 4RADA 2V6BA 2P2YA 3PNYA 2ZAGA 3TZBA 5C7LO 1A71A 4KH1A 3UOAB 2PGOA 3L4BC 1UKCA 3MJSA 3S2GA 4R2MA 4CHTA 3PEWA 4BEJA 4PBRA 3GVPA 3BRQA 3WMGA 1U0JA 3JXEA 1P4SA 4FFOA 3EPRA 4W9NC 4QUIA 2FPIB 3C7KA 2W37A 2AS0A 2H59A 2VJBA 3TAXA 1FFAA 5EJ8A 3RR2A 4JT9A 2V97A 2XUQA 4FNOA 4M1QA 3IPYA 5JLJA 1MJGM 1ZD8A 5FHQA 1FB5A 2OK7A 2N1MA 1DFIA 2G6TA 4GDMA 4MEJA 1GR0A 4D3YA 4DMHA 1W5FA 1D7AA 5KHLB 1C9NA 1NV9A 3H0KA 1RI3A 1QFYA 3TLGB 1ZVKA 4UQLA 4QGAA 4N9QA 2AV6A 1D09A 1QVAA 2HTFA 4ZYXA 5CB0A 1R9NA 3EQ8A 4JFAA 1KTIA 2WU1A 1UP7A 4NZYA 4CVNA 1QO7A 2QPLA 4Y3UA 4B3RB 1G2IA 2PMWB 3GP8A 1RW4A 2P6PA 1SOVA 3GJ4A 4ED9A 1YRAA 3TD9A 1TYZA 4QUBA 4WJZA 4HPWA 3OT1B 4JR0A 1Q92A 5EWMA 3DR5A 1O6FA 3EXEB 3QRWA 4FDMA 1JAHA 2X7XA 4E32A 1QTQA 1MAWA 1C81A 2H4FA 2WKWA 3NPMA 3LA6A 1RJFA 3GPIA 1O8CA 2CUKA 3KVOA 2EZ4A 2Z3ZA 1KKMA 1UMKA 4CCSA 3RKRA 5CAEA 2C97A 5SZIA 1H05A 2IYVA 1ZM9A 2HWWA 4IJMA 4CR6A 5L4SA 2ASVA 3FOCA 4EQ6A 3WRWA 3VBEA 3GGOA 3LDAA 2ZUUA 3V32A 4CFZA 1OI3A 5DTEA 2LPMA 3K2IA 4CM6A 1DADA 2JH9A 2C7RA 3QVGA 2FE4A 2C9OA 4HN9A 4N3CA 1G18A 4PGMA 4EHKA 3AF3A 5J4LA 3D6TB 3H84A 1ONSA 2JIMA 3AESB 1N2CB 5KVVA 1ZN9A 2FMTA 1MRSA 2DOKA 1TNDA 3C1UA 1RCTE 2P79A 5BRNA 4F71A 2QT9A 2QORA 1JPJA 2WV7A 4QULA 4A0SA 3TD6A 5TS3A 2G8LA 1N34B 3TTYA 4J75A 5IVPA 4ND8B 1QZTA 3CKKA 4OUKX 1XYYA 2VNSA 2XNHA 3AW9A 1JJVA 3HCPA 4QU9A 1R27A 5ITWA 2AFHA 1X19A 4JEIA 3GVXA 4XWWA 2OAQ1 2FZKA 5FUQA 4UUQA 2PWPA 4IBOA 5BQFA 4CIVA 4D9BA 1QZZA 1NN1A 3E6AA 1SUPA 3FZYA 4TXMA 2DSTA 3EC2A 3FMPB 3ROXA 3LPMA 3EXG1 3RS5A 4DJ5X 3DXZA 2IPMA 5JXHA 5K6RA 1K75A 4ZT3A 4D97A 1I94B 4CL3A 2NVOA 4C4TA 3KYCB 3GRPA 1F3LA 3GWGA 5JSFA 5KBYA 1QS0B 1SK9A 1GRCA 2ALJA 5DOVA 3RVOA 1WUIS 2ZXEA 1T3HA 1T9ZA 1V37A 3VO2A 5LUBA 3BB1A 4BNXA 4W9NA 5T41A 3ZK8A 2QZSA 1BS1A 1E0KA 5BR4A 4H7EA 5FQNA 3HADA 3FMOB 3M1YA 5IJ9B 2DY1A 3H18A 4IV8A 4LJYA 4EX7A 3HDYA 4F5YA 2P5YA 1TM5E 2WM3A 1SAYA 4ZI7B 3JQRA 3FOFC 3N6VA 2MYPA 3FVRA 4H3VA 4CFSA 3AHIA 4JODA 3UM9A 4GZMA 4JNCA 1UBFA 2D5BA 3D2BA 3PNQA 3QLVC 1JR3D 3ITDA 4RFSB 5FL7A 1YS2X 1ZHOA 4CIWA 1YGPA 2P0YA 2Q5FA 1E7RA 2FMUA 1T4BA 3LP5A 1A9QA 2C42A 2OCYC 3KQVA 4HLCA 4LPKA 5KYNA 3OCWA 4IHJB 4M9QA 4Y2UA 1XLTC 3FYCA 5BOVA 3SQNA 3TFQA 3URMA 4ZMSA 1EP9A 3ZKWA 2X0IA 1ZK2A 1RWWA 1HDEA 1TAQA 2ZR9A 4PHCA 5BSEA 3TW8B 4B83A 2DWQA 5ALGA 5LQKA 3ILVA 4RCYA 4B7ZA 1QF9A 4E6EA 2IQIA 1HXHA 2YVUA 1SBYA 3CB2A 4ADSG 4CTMA 2XVMA 3UK7A 4JEMA 2WUWE 4EG4A 1ZEJA 4B4WA 5H68A 4WUTA 4B47A 4RV4A 2QV7A 5HF5A 3S81A 2ACKA 5CFZA 3NATA 1OWLA 3NHZA 1W4CA 3IQWA 4FGZA 1SQSA 1NYQA 1U3WA 1VC2A 3BMCB 3L49A 4L8GA 5DHAA 1AQIA 2NPIA 4B6EA 1BW9A 2NUPA 4G5OA 5COAA 1E7QA 5ALLA 4AUNA 1QV9A 3GIWA 4KE8A 4CR7A 1IJFA 2VPYA 1S3FA 4HGYA 1FNNA 3TMYA 4H1UA 1AN9A 2QDXA 4YAWA 4UDXX 1Z36A 5BSWA 3X44A 1UK9A 4K9DA 3SSAA 2HR1A 2XKJE 2Z2KA 1XD2A 2Q4RA 2X3YA 2P78A 2HADA 2P11A 2WABA 4HYEA 1NTOA 4R1NA 3O8CA 1NXTA 1VDMA 2CHGA 3RI3A 4YMGA 3GNSA 4LZAA 3ST7A 3VPGA 3SJCA 1VBMA 3O7WA 3PNLA 1D2GA 1RQNA 4XLZA 3DUWA 2E9SA 5B2EA 3RIHA 1RP1A 3DO8A 1HE1C 3DE4X 5JNUA 2PWYA 1RACA 3NG1A 1M7GA 2W6NA 3S55A 3SYRA 1SVIA 4XB6B 4YV1A 1B6RA 5ILGA 3HN7A 1OXXK 4XKJA 5NULA 4FOOA 2WP8J 4PYMA 4N3AA 3OZRA 4UD2A 1J1UA 2GD6A 3KFLA 2AEMA 2IL1A 2UYQA 4X1KA 1P0MA 3HMQA 4RTMA 2J5KA 2GK6A 4FE3A 2IHTA 4WXEA 1RE0A 3B6ZA 1RBYA 4R2LA 5HMLA 5I7AA 4RDIA 4NMXB 1CZRA 2B92A 3DGEC 3ZNNA 1R8SA 4O4LA 2XZLA 2F7SA 2RC6A 3OQIB 4A6DA 4DLUA 2F3SA 4ZGGA 1W36C 2EFHB 5A4KA 4P3KA 3STVA 4RD0A 3T7IA 4PR0A 3H17A 1CETA 3EG9A 4Z0HO 3JYNA 5BT8A 2ET6A 5EPEA 2XV1A 1V47A 3T7DA 2ZSJA 1GPWB 2OC4A 1UEIA 4RIFA 4TTRA 3VPXA 1WBJB 1KE2A 5KDOA 5HJ7A 2XRFA 3R1IA 4NPAA 3PK0A 2F9MA 3O31A 3RNOA 1U8TA 1RRFA 1OLSA 3ONFA 3QLVA 3TM5A 4FSHA 5JTTA 1E77A 1QF6A 3ERCA 4D9IA 1NT4A 3V97A 2FQ1A 2GCIA 1GSIA 1T2VA 3KJHA 1CT9A 1G63A 3BIFA 1N0HA 1KK3A 2N1BA 2I2DA 3BMOB 3ND5A 3FCXA 3QF7A 4JJAA 2KW5A 4KIWA 1XLTA 5GADl 5JROA 2X22A 4HHEA 3FE2A 3MJFA 4I81A 4PLZA 2OHHA 4PRZA 4DLVA 8AT1A 5EP3A 4P53A 2W8ZA 1D2HA 4XYMA 1Q83A 3MWFA 2IHKA 4R3WA 3TOXA 3ZS8A 2P9FA 1W0JA 2IYZA 2PS0A 1LPOA 4EYKA 5H0IA 3NBAA 1UBMS 5AKYA 5AKXA 2WKQA 5JO9A 4ZYTA 2FFAA 4JS0A 4AS3A 1X7YB 4P82A 1NQWA 2C5BA 4DIUA 4EEXA 3MCAA 1L5QA 1RXEA 1LNZA 1Q0HA 3U81A 2PSJA 3K4PA 1SA0B 4IFTA 4IZHA 2WVJA 4BIMA 3PX2A 3IODA 4MZXA 1E2JA 3WP1B 3U3OA 3VC7A 4B6GA 4IAOA 1XL0A 4LS3A 3D5QA 4LFCB 2AD5A 3L7MA 1LJLA 5DOZA 5LFAA 3KB2A 3FTNA 3G5MA 3T5BA 3I39X 3P5SA 5CTAA 2OO7A 3NOVA 2X42A 1KK2A 3FBGA 4XEHA 2C0CA 5CP8A 4FJ1A 5IM5A 1JDNA 2R5WA 1P2VA 1XKLA 4NMWA 1IPHA 4EGAA 5TRTA 5A6SB 3GG9A 1KQPA 2GEDA 3JATB 1QLJA 3C8ZA 2IUFA 4M88A 3EZ9A 4EHHA 1G38A 3B6JA 1Z4MA 3DL0A 3KSZO 3R0QA 4DUYB 4M46A 3CZCA 3UXHA 3FPAA 1AF4A 1BQ3A 2I99A 2W9XA 4LECA 4BN4A 5CFRA 1G60A 5LP1A 4WLNA 4IIXA 2F4VB 1TU3A 3OCXA 4YIKA 3R74A 4EP1A 3U7JA 4Y8VA 2DETA 4KQXA 1RHQA 4OMCA 2CDBA 3R7AA 2D0OB 1XVUA 2ZETA 1SBHA 3C3EA 1UAAA 1AKVA 1X7ZB 1EVLA 4FCTA 4UNRA 4DVJA 1M54A