2ZXUA

Crystal structure of trna modification enzyme miaa in the complex with trna(phe) and dmaspp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
306
structure length
306
Chain Sequence
b'LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 104
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zxuA01
3WHLA 2HUPA 1P60A 1K5DA 5JCZA 1HURA 1S9HA 4GOJA 3MMPA 1SXJA 3QG5A 3TGPA 1SULA 4QNRA 4Z51A 5CDFE 3RS5A 3DM9B 2Q9AA 3A4LA 3BORA 2OLJA 2RGAA 4M1OA 5FTKA 3GEEA 3LBIA 4HB4A 4Q1AA 3SNHA 5JRZA 2QBYA 5AUNB 1XMSA 3IBYA 4GRAA 4GZLA 4NYIQ 4GOXA 3K09C 2BEKA 1OHHD 4NMMA 2CL6X 4XSGA 1US8B 4R2HA 3NVAA 1OFTA 1OFUX 1Z6AA 3CWZA 4W5HA 3KQHA 2O8DA 3TR5A 4L4UA 3FE2A 3QKRB 4EPTA 1AJEA 3EXAA 1OKKD 2OCAA 1KZ7B 1UDXA 3GJ5A 4E03A 1OHHA 2TMKA 3TVTA 3Q7QA 1U0HC 3PV0A 1J99A 1XXHE 4RZ3A 3EC1A 3C16C 4GI7A 5CB8A 4FMCB 2XJ9A 1WDTA 2KB0A 2G0TA 1OH6A 2CL7X 4F7WA 1HYQA 1W2HA 3G0HA 5CYOA 1MRSA 4TMWA 621PA 4LJ5A 3O8CA 5FPYA 3SJZA 2RGXA 4IKEA 4NKRA 4B74A 1HEIA 4E09A 4D6PA 5JI3E 2N46A 2REOA 2W83A 3NKVA 4K8OA 3UANA 4C30A 3DM5A 2B8TA 2QEQA 4Z1MD 1Q21A 1ZU5A 2O8CA 1HTWA 3PR1A 1Z3IX 1KDOA 3SHWA 4A82A 3TBKA 1GL7A 1VG9B 3P1JA 4Q18A 3N2IA 1K5GA 4Q5IA 1G8FA 4NYIR 2QGNA 2CVHA 4TTPA 2PLFA 4L16A 4M1SA 2G1JA 4E5UA 5K8TA 3ADBA 3VKGA 5TY0A 3QXJA 1OLOA 2O0JA 3PXGA 3MCAA 3AP3A 2J41A 1GDDA 1R7RA 2V1XA 2HJGA 3ND8A 1P73A 1VPLA 2GZDA 4Q66C 4BRUA 5JLJA 2W6ID 2I1QA 4BFZA 2XZPA 4NP6A 1P5ZB 3CRMA 2FU5C 2O52A 3I92A 4Q00A 2HDNB 3QF7A 4MRSA 1UAAA 2MSDB 2QP9X 4NCJA 4PO9A 1KI3A 2VHJA 4FMBB 2DY1A 1ZM9A 1XJ0A 4BFTA 3A58B 1FQJA 1GRQA 1W0JD 3FGNA 5D3MB 4DLWA 2EYUA 2IF0A 2ATVA 5B64A 4MYTA 2ECKA 1UM8A 1E4YA 4LBVA 4LV6A 2YOHA 1JXOA 3ZVLA 1LVGA 1W0JA 2FE4A 4HUTA 4L9SA 1KTVA 4G1UC 3AVPA 3CZQA 3RAPR 4US2R 2EFHB 1SHKA 4TTQA 3THOA 2Q9BA 5KO2A 4TYYA 2RH5A 1GTVA 4PR0A 2QPAA 3TW8B 3O8DA 2BMEA 5E7MA 3PG5A 4JLOA 4RKEA 2RHDA 3OHMA 1HE1C 1U98A 1XZQA 2GWHA 1ZD9A 3QXHA 3VNVA 1G21E 2CVFA 5KSPA 5FBQB 1F5NA 4UNSA 1KYIA 4EAQA 2IWRA 5C1BA 1NP6A 5DSZA 2EFDB 5AUPB 1J7KA 1OT3A 3BK7A 3E70C 2CL0X 4KSCA 5KYKA 3SQXA 3ZIAD 3AVVA 3OIVA 3U3RA 1LF5A 1KI8A 4JT2A 4BUJA 3RABA 4YMWA 3T12A 1G18A 1E2JA 2EVWX 2BJVA 3I5XA 3F3YA 4GSYA 3ZQJA 5KTYA 3IO3A 2XITA 4F92B 2Q3HA 1AN0A 1Q44A 4OKSA 1Z6XA 5A0FA 3GLFA 4X8HA 4TLEA 1NNEA 3NBYC 1G5TA 2WWWA 3DZ8A 2RGDA 1CKEA 1AKYA 2YC4C 3CRVA 3BOSA 3CPEA 4I1VA 1CR2A 1ANKA 3OF5A 1N6OA 4NCNA 4OI2A 2A5YB 3W8NA 1E96A 4V0MA 4C0JA 1YR8A 3SE0A 1XD2A 2NO9A 1XNJA 2IWHA 1PLJA 1U81A 2OLKA 3J81k 3NTUA 4DEYA 2ZVPX 3KJHA 4Q48A 4DLRA 3R7WB 1T8UA 1NLFA 4GFDA 3CH5A 2KJQA 2ZRLA 5BN3A 4BZPA 1RJ9A 3KQUA 1TF2A 2CHVA 2XB4A 3C41J 3AB3A 1FMJA 4OBEA 4OHVA 1E32A 2Q9CA 1F2TA 1CTQA 3CR7A 3QUSA 1IY0A 2W2XA 3GFTA 821PA 4XD7D 1E2PA 5IK2D 4B3GA 2F6RA 1CS4C 3BGWA 5IRCD 5CK4A 3B60A 1GKUB 4ZDKA 3LX5A 3VHLB 4EPWA 2RGNA 4N0DA 4URWR 2XNDD 1T3LA 3K0AA 3QG1A 5L3QA 5IK2A 1BYUA 4XD7A 2VO1A 4PX9A 1J2JA 4RCZA 2ZRNA 5EE3A 4Q1BA 3WYFA 2XGJA 2H57A 2XNDA 3HR8A 2F9MA 1W36D 1E9RA 4XVUA 3DOFA 2ZRDA 2ZJ5A 5G3ZA 2ZVQX 4DIEA 2C96A 3BC1A 3CBQA 4BECA 1YE8A 2ZE5A 1Q12A 2YWGA 2IHYA 3AUYA 4I4LA 2A5JA 4TMXA 1IM2A 2VP9A 4LHYA 4TL9A 3U3MA 3SYKA 4ACBA 4LJ6A 3EC2A 4AG5A 1DAGA 2CLCX 1PLLA 4NU0A 3SBEA 4CRWB 1B23P 3BBPA 2G83A 4PAMA 4TLBA 3CPJB 1QDEA 4MDFA 1OH8A 4WZBE 3V9PA 4A0GA 2ZRAA 2P6RA 3PITA 1YZUA 4TLDA 5AJYA 4US1R 4AKIA 2C77A 4IJMA 5JMTA 1ZYUA 1L8QA 1G1MA 3UG6A 2ZUDA 4DLZA 1UBFA 3NDBB 2FSFA 2FJUA 1QHIA 3U44A 2ZU0C 4P4TA 1KO8A 4EDHA 4RD2A 1Z0DA 2QPOA 1ZNYA 4W5JA 4EJSA 2EYQA 2V8OA 5CLLA 2QP4A 2ZETA 2IS6A 4KYIB 2B7CA 3PUXA 4PC6A 4JSTA 1KGDA 1D9XA 3CF2A 2OCBA 1GUAA 2O8BA 3ZLJA 1KDPA 3EPJA 4ERNA 3QPUA 2C04A 3GLIB 2QROA 3WMGA 2QA5A 3AP2A 4TSFA 3IPXA 5TXGA 3FMIA 1OB2A 1I2DA 1ZCAA 1ODFA 2IXGA 4C0AC 3OESA 2I3BA 1N6NA 4D2IA 3RS0A 4A36A 4U02A 1A1VA 2WICA 4ESVA 3AVUA 3GEHA 2HLDD 2CJWA 3Q72A 1FX0A 5F2EA 3VX4A 4GNKA 3B1XA 1UF9A 2IYLD 2XOKD 4G3XA 2QTVB 2YC2C 1GKYA 3K0SA 1XF9A 5FI1B 3M6AA 2NZ8A 2P0EA 3BFKA 2HLDA 1L4YA 1DAKA 3D31A 2H16A 4QNMA 5GJVC 3CONA 2IS4A 3QXSA 6Q21A 5E95A 5K8LA 2XAUA 521PA 3VKHA 2XEXA 1E94E 1XTQA 2RGBA 3W34A 1UDWA 3MWYW 3F5FA 1KKMA 2BOVA 4GT1A 4DLYA 1TF7A 1TADA 4C0LA 1XB2A 4YXWD 1G8YA 3JZMA 4LHWA 3GLHB 2QM7A 4KFUA 1KI2A 2EQBA 2J0UB 5DYGA 4CEHA 4M21A 1R5BA 3UWOA 3GQBA 3O8RA 4Q9IA 2B7BA 3P27A 4YXWA 1KK2A 2FMXA 5KNBA 2IUUA 4A8JB 5JJKA 2GTPA 3EZFA 4PSAA 5H68A 3W8RA 4CIDA 3HYTA 4TWZA 5L3VA 3TUZC 2GAAA 2ORIA 1KY3A 1IJFA 2RGEA 1G17A 3EW9A 1RE0A 2FOLA 2ZEJA 3FDIA 3LLUA 1T5IA 2IYWA 1IN4A 4ZV4A 1T3HA 2ZI3A 3THXA 1HT2E 3CH4B 3KJGA 1XJQA 3RC8A 3EPKA 4YMSA 3L0IB 4B33A 4Q02A 2REBA 3OIUA 2PCJA 2QQEA 3AKYA 3SEAA 1GL9B 1W4BA 3IILA 1E98A 3AF4A 4EQ6A 5FOWA 2YINC 4B44A 3BB3A 4XOIA 4ITRC 2JJ1D 5AJXA 5SZIA 3WY9A 1EK0A 2D3WA 1JB1A 2FG5A 4UXJA 3C5HA 4TT3D 2D4HA 4HDQB 2ZTSA 2JLSA 3MUFA 1AK2A 1ZNZA 2QTHA 2VHCA 2ZYTX 2AL7A 4TL8A 2H92A 2JJ1A 1ZM2A 3KZ1E 3WMEA 5FFMA 5C46F 3CX7A 3LQRA 4Q9JA 2F3TA 1E2FA 4C3ZA 4JKYA 2O8EB 2BBSA 1NKSA 5JS7A 3SZRA 3RRZA 1VYVA 1QHHA 3EIEA 4TL7A 2CLDX 4RZXA 2JEOA 5J4KA 3SQWA 1DG3A 1VYUA 3AVWA 4MGZR 2ZS8A 3M4YA 4IOLA 2PZGA 1MABA 4RKFA 1E79D 2EFCB 3T1VA 4ZIRB 4LDJA 3DEFA 1KDTA 4X8LA 2WJJA 3RSLA 1T6NA 2NPIA 2YWHA 3QY0A 4BLRA 3QBTA 1QRAA 3A1SA 2XB2A 1DEKA 3MG9A 4MUAA 4Q4JA 3EA5A 1BS1A 3AVYA 3CNNA 3EPLA 5AJZA 2P65A 1LS6A 1D8TA 1R10A 2BMJA 2ZJAA 3E2IA 2XZOA 2ZSEA 4LC1A 4OHZA 4CT4B 2YKGA 1N0WA 2IF2A 4HAYA 1G4UR 3HJNA 3I3SR 4Y0AA 3TQCA 1TQ2A 5AK0A 1SVKA 3G82C 2GCPA 1MR3F 3AKDA 4MKFA 3THYA 2V3CC 3RS3A 4U00A 5CIWA 1BIFA 1LNZA 1VCOA 4WW0A 3EZ6A 1PJRA 4RVCA 1SKQA 4PPNA 4IDNA 2PBRA 3Q3JB 3AQ4A 3EZ7A 5LB2A 1WXQA 1NI3A 5UKDA 2FZ4A 1VDZA 2ZRBA 1HA3A 3X1WA 3CLVA 1AS3A 3K0EA 3H2YA 4FCTA 2DBYA 2OFXA 3HP1A 4CT5A 5L3SA 2VLIA 5FBVB 3D7MA 4PC7A 2GHIA 2KSQA 2Z0MA 1CULC 2NOAA 4RCYA 2VYFA 2CK3D 3GLGB 2P5SA 5CLQA 4CF7A 1ESMA 1NVVR 2G0NA 3K9NA 3NH6A 3QPWA 1BKDR 3TAUA 5DYIA 3MJHA 1IY1A 1TX4B 2YVUA 4GL2A 2CK3A 4HAZA 3GJ6A 1BH2A 1E9DA 1VECA 2NO0A 4IXNA 3ZZ0A 4LGMA 4JLJA 4B3CA 5GJCA 1OXSC 2F43B 2JDIA 3MRSA 4JBYA 1IBRA 2FN4A 4AKHA 3CM0A 1AA9A 4ASUD 3NG1A 4BFXA 3FMPB 2HXYA 3K09A 1KAOA 3DMNA 3BE4A 2GJKA 2R9VA 4UNNA 3S1AB 2QN6A 2GEUA 2F55A 4IFBA 2IS2A 2WKPA 2GETA 1OW3B 3MWKA 4A6XA 3SR0A 4Q21A 3PEUA 4MH0R 2QAJA 4B3DA 5LD2C 3BB4A 2IHBA 3QXXA 2ZR7A 4LYJA 1I2MA 2GJSA 4O0MA 3V4FA 3SYNA 3WXMA 2K5UA 1N3BA 2AD1A 3MWLA 3H4MA 3LAWA 4LV5B 4ARZA 4C0HA 4TYQA 1ELOA 4D26A 2XXAA 4HEJA 2EWWA 2Q0HA 5C4MA 1NVUQ 4V0NA 3VR2A 2F1HA 3RANA 3IGFA 3BH6A 2DYKA 2VF8A 4LC0A 4Q19A 3K9GA 1E9SA 3D8BA 5JSZB 2W6JD 2W0MA 1OXTA 2OEPA 4KV9A 4OI1A 4ABYA 2ZROA 3TW4A 4DRZA 1W2GA 3I5YA 1Z6YA 4S35A 4KVAA 1DOAA 1Z07A 1VYTA 2D7CA 1KNQA 5GJBA 1NIPA 1CU1A 1V5WA 2QL6A 4PHGA 2PMKA 2PMDA 3OE7A 4UNRA 3ZJYA 5GVSA 5JWRA 2CDNA 4EPRA 2V1UA 3CW2A 2ERYA 4HZIA 1AS0A 1M2OB 1R5NA 3AVXA 1XTRA 2ZREA 5G53C 2Z4SA 4D4KA 1U99A 1N6RA 3GJ0A 5KNDA 5GADl 3WNDA 1EFCA 2VIIA 4IVPA 1KMHB 2GXQA 3KTAA 4HUQA 1UFQA 2L0XA 3OAAA 1GM5A 2PEZA 1VG8A 1UKZA 3BS4A 2EW1A 4Q7MB 2P3SA 4TQUS 1WE2A 1X86B 3FFAA 4M9QA 5CM8B 4PZYA 4OK6A 3A1TA 4DKXA 2FGJA 4I99A 1JR3D 1TEVA 5EXTA 2YOFA 1NF3A 5IF9A 1IN6A 1QG2A 1Q0UA 1W0KA 3LY5A 2B92A 3AVQA 2C95A 1YZNA 3P26A 1XJCA 4XVQA 3T1QA 4IHQA 3C4JA 3UATA 2ZXUA 4M1KA 3NXSA 1LV7A 4Q1EA 2BHRA 2QMEA 3VU9B 1JR3A 2IYSA 3B78A 2J45A 1FNNA 2QT0A 2XNSA 2HT1A 1G3UA 1QZXA 5C4GB 1IXSB 2Q21A 1SVOA 2RKOA 1LTQA 2GRJA 5CM9C 1NBMA 4YLGA 1R6BX 3SC3A 4B3XA 1O3YA 2F9LA 3KB2A 2I4IA 3RHFA 5JECA 3ZH9B 4LI0A 4OI4A 2WAYA 4PC1A 1TQDA 3N70A 3TH5A 3TSWA 4DCTA 1OJLA 3T15A 3FVQA 4AY2A 1SVMA 1VHLA 4XH9B 2C5LA 3W6NA 4DSTA 3IUYA 3KUCA 3K9HA 1KOFA 5CIQA 1I4LD 3K70B 2C78A 1SXJB 2ZAOA 2ZANA 1Z06A 1W5TA 4RD6A 4OQXA 2AKYA 3AF3A 3HU2A 2QBYB 2GKSA 1D5CA 4UKDA 2LWIA 1G7CA 2VRWA 4F91B 2BV3A 3Q5EA 1WBDA 5E7IA 4M9XA 5J40A 2OO7A 2ZSAA 4IVRA 2F1IA 5EXPA 4DUGD 4W7SA 5B58C 1XPRA 2O8DB 3QPVA 5EE9A 1GG2A 5JRJA 2MMGA 2A5FA 1E2GA 4WZ6A 3TSZA 3OEED 3UG7A 1P75A 1FTNA 3QF4A 2ZJOA 3MJRA 4IOJA 1EX6A 1OPXA 3LXXA 4OK3A 2ZYWX 5KU1A 1X8JA 2C98A 1W4AA 2J9RA 2Q3MA 1Z6GA 3OEEA 4M53A 5DHFA 3ZS8A 2WIBA 1S0UA 4F4CA 4PO8A 3THWA 1KY2A 4R7ZA 3RWOA 2WMOB 3QOFA 3U6KA 1EGAA 1JQLB 2HT6A 1GVNB 4FCVA 3ZQ6A 4JL5A 1OKKA 2QENA 4RFSB 2B8WA 2KBEA 4HAUA 4N3NA 5FH9A 5L3RA 4FXPA 4PPFA 3K1JA 1YR6A 2O8CB 4HSEA 4V03A 2A9KA 3N5CA 2Z83A 1XTKA 2MSEB 3QKTA 1IN7A 4N0EA 4RFSA 5DI9A 1UPTA 3ETLA 1OFHA 2R6CA 1E9FA 3F8TA 3CNLA 4M4SA 1D2MA 4MRPA 2QMUA 3PVSA 5JZVA 1K8RA 1ZC4A 1U8YA 4Q1CA 5HCIA 3VHXA 4B6EA 3SFVA 1AIPA 4C0BA 3IDQA 5LPNA 2BBOA 3OEHD 1MO6A 3NH9A 2ODWA 5DI3A 1XPUA 3BFXA 4Z1MA 1G64A 3QIAA 1AZSC 4UXHA 4WVFA 1CBUA 3ZDQA 1Z6TA 1GSIA 3OEHA 3MFYA 4FMCF 2FEMA 2OAP1 4XTCS 2QAGC 2BKEA 4RY2A 4ZKEA 1X3SA 5H8WA 2BM0A 3KQKA 1E1QD 4QJ4A 4AURA 4H1VA 2DWPA 3AKEA 5FOVA 3LRPA 3X1DA 2H1LA 4WBSA 1N6HA 3IQWA 2O8FA 4GBMA 1KSJA 1P2TA 1AGRA 4MGKR 2KBFA 1UBCA 1E1QA 4DB4A 2W6IA 2IS1A 4TL6A 5HTKA 3LA6A 2CLSA 1KI1A 2LKDA 1XTJA 1IJEA 2A30A 2GILA 2ODBA 1GFIA 2Z4RA 3IEUA 1T91A 3W9YA 4P32A 1JALA 3MSXA 1OE0A 2BWJA 1P3JA 2QM8A 4TTRA 2YNMA 1XP8A 3BWDD 2VP6A 4HYYA 1SGWA 3IHWA 2GK6A 4EUNA 5JEEA 1W7AA 4KFSA 2GVDC 1KO4A 1DVRA 3ASZA 1YVDA 1QHYA 1ZINA 3OIWA 1TAGA 1NVXQ 2J59A 2ZU6A 3TAHA 2JGNA 2WWGA 4LJ4A 5KDOA 4QBGB 2GVZC 3LVQE 3ZGXA 2AK3A 5KNCA 4CEJA 4WZAE 5P21A 1IOZA 4AK9A 1BYIA 2YOGA 1BMFD 1M74A 5CDFA 1E2DA 3QE0A 4O2LA 4MUBA 1JXMA 1NKTA 2IYTA 3PUZA 5HE9A 1Z22A 4DC9A 3GLFB 4KO8A 3PUWA 1EXMA 2E87A 2ZRKA 4PTLA 3GMTA 2WOJA 1BMFA 4OQFA 4ZI3A 4PQYA 1IAQA 3AGQA 4B75A 1II8A 2ASEA 3ZIAA 1FUUA 3AGPA 4LJ8A 4JJZA 2ZYVX 3DPUA 2NZJA 1E2HA 1Z0IA 5LBIA 1CLUA 2OCYC 4P3YA 5FBWB 4PAQA 1XD2B 2W0SA 4LHVA 3TK1A 2XTMA 1XXHA 2WMNB 2I1VB 1EFHA 5EUQB 4M2LA 1KJWA 4B32A 1YZTA 2IEYA 1A5TA 4B48A 1G3QA 1OV4A 4NYJQ 5E7JA 3B82A 2YWFA 3K8YA 3UWKA 5G3YA 2Q6TA 3ADKA 4LYAA 1RJ9B 4BWYA 2ZYUX 5HZKA 3ICEA 1DAHA 3NDPA 2VSFA 1XEWX 2R62A 2JASA 4I1UA 3GLIE 1F2TB 2QY9A 4QRHA 4URYR 2HF9A 2KWIA 1RRFA 4IDQA 4GOKA 4LCBA 1I4TD 1E3MA 4BFYA 4URVR 2FEOA 3GD7A 4A92A 2CNWD 4LPSA 1EWQA 2ODEA 2OXRA 3K0AB 5ANRB 3TRFA 5L3QB 2C2HA 5EZ6B 1XCMA 1KI6A 1R0XA 4JVLA 3Q7PA 4MKGA 4XIGS 5KOYA 4HDCA 1E2LA 1N5KA 4UXIA 4AYTA 1G8PA 3W5JA 4MRVA 2FNAA 2GF9A 1E0KA 1II0A 4M1YA 4J0QA 3WYGA 4TQ9A 2QE7D 1Q20A 4RZUA 1B0UA 1SVLA 1Z08A 1IONA 3QEJA 4ZDJA 4DT1A 2B21A 1NJGA 1GAJA 3A4MA 3L0PA 3B7GA 4D0NA 4NCHA 1W36B 4JVSB 2BJWA 4Z54A 2QE7A 4Q03A 2ZE6A 3GLHE 4BZQA 5BN5A 4OHYA 5HCNA 5HZHA 3HR7A 4BLSA 2D2EA 1KAGA 4MKHA 4E22A 1AQYA 1F3OA 4JIMA 3I73A 4TZ6A 3ZS9A 3PEYA 1ZNWA 2DFKB 4JT4A 4E07A 3RVBA 1PUIA 3SI7A 1KHTA 3X1XA 2ZS7A 5JS8A 3A1UA 1U8AA 2F7SA 4YC7A 4BASA 3TSOA 3U44B 2OBLA 2WSMA 1KO7A 2PL3A 3UIEA 2QQ0A 3LBHA 5DLQC 3TJZA 3VR5A 3VR6A 2PEYA 4EJSB 5KHOC 1YR7A 2BDTA 4ON9A 1P9RA 1X1RA 5EJEA 3LO5A 1W4CA 3TNFA 4OK5A 1ZUHA 1NRJB 2HXSA 1VIYA 4H1UA 1P9NA 2QTFA 2O8BB 4ZI2A 1ETUA 1G4AE 4F38A 2DFLA 4NHOA 3RRYA 4B2PA 4GDFA 4NDZA 5TVKA 4JLKA 1RPZA 4QGHA 3X1ZA 2Q3FA 1ZUNB 4MA4A 4TMKA 2JLWA 1S3SA 4HAWA 5CJ2A 4LJAA 4H9GA 4PHFA 4MDEA 4CGZA 3ZZTA 2ZUBA 3PFIA 2CJWB 1YQTA 2JLQA 4IW3B 4U5XA 1VCNA 4UJ3A 3TVDA 1FX0B 5DE3A 1WQ1R 5DH9A 1RIFA 1OH7A 4OQLA 2ZRCA 2ONJA 2VP5A 1W49A 3RRNA 3T06B 1OF1A 1MH1A 1T0HB 2YYZA 2ZRFA 2QORA 2NO6A 2OAQ1 4WXPA 3IKJA 2GCOA 4Q4AA 1GIAA 3NBXX 3QENA 2WWHA 4Q7KA 2RAPA 4JBWA 2FFBA 4BGDA 2WJVA 2OXCA 4P33A 5FPTA 2P6NA 3B5JA 4EPVA 4QHTA 1SVIA 1X8LA 3KKMA 1ONBA 3U5ZB 1MT0A 2C9CA 1NG9A 1F2UA 2DR3A 1L4UA 2XOKA 4Q1FA 3R9IA 5B57C 2ZM5A 1F48A 4BLOA 1G6HA 4CEHB 3D3QA 4HB0A 1G5RA 5BQ5A 5SZKB 1P2UA 3NBFA 3TE6A 5EE5B 5KDLA 1XZPA 1OH5A 1P2VA 3WRXC 3K0FA 4A9AA 4C7OA 2WOOA 2FFAA 2QU8A 2ZI5A 2YV5A 4KXFB 5EP1A 1UKYA 3SU8A 3VR1A 2ZR0A 4ZDIA 3U7EB 1CJUC 4QM7A 1GOTA 1XMJA 3UMSA 3THXB 1Y63A 2R6DA 1JEDA 1TQ6A 2IBMA 3NC1C 4AKEA 4EFNA 1XWIA 2WPDD 1LY1A 3LLMA 2R2AA 2JLXA 2BIFA 4AIIA 2GDJA 1IHUA 3K0CC 4BFWA 4Z8YA 4HLUC 3ZD7A 4AWXA 4B76A 2IT1A 4EQ6B 1CR1A 5J4LA 2PX3A 2N1BA 2G6BA 1H65A 2WPDA 3L8YA 3SN6A 2VHUA 1Z63A 2D74A 1S8FA 2IYUA 5J4VA 1KJZA 3EWSA 3EX7C 2V7QD 3K53A 3PIRA 4Q1DA 5AUQA 2LCFA 3H86A 1KSGA 4POAA 1QBKC 2C8VA 2A78A 3QNUA 2Y8EA 4WA7A 4D4LA 1DO2A 3W3ZB 1TPZA 3ADDA 1D2EA 1RC8A 5AJWA 2FPLA 2W2VA 5BYKA 3GLGE 2V7QA 3LXRA 4ZDWA 1TQ4A 2ONKA 1DAIA 1Z29A 1XRJA 1UBGA 1AZTA 1QHGA 2IYXA 2IW3A 2BVNA 1QHHB 4GZMA 1C4OA 4C0SA 4XWOA 2OUKA 5M04A 2AN9A 4HAVA 2WSSD 2GXAA 1SKYB 4TT3A 5E3HA 1MABB 2VHQA 3GP8A 3A37A 3BH0A 4QBIA 4BQSA 4O2RA 2GXUA 1G41A 3DOEA 2YZ2A 3FMOB 5DISB 4TYPA 2WSSA 4Z8XA 3ASYA 3QKSA 3Q85A 2VP2A 3BRWD 3GJXC 1T5LA 3M1IA 4KYUA 3SYLA 4BLPA 4URXR 1N0UA 4Q4JB 3CO5A 4C0QC 1UJ2A 2ZJ8A 3AEZA 3WYAA 2NMVA 1GNQA 5EP3A 2UZIR 4N1AA 1NY6A 3CF0A 4A6PA 1Q3TA 2MMCA 1JECA 3U7FB 1IN5A 1E79A 2GZAA 1COWD 1GITA 1Q1QA 2AXNA 2IYVA 3ZYCA 1M7HA 1NL3A 2ZE7A 2ZITA 4TLCA 2OESA 4XSHA 3VAAA 3L8ZA 5JJLA 1N6IA 3WBKA 3EPHA 1VHTA 2QMOA 4OQNA 4B34A 3THYB 2GXSA 2HF8A 4A0RA 1G7TA 2PZEA 4IOMA 1COWA 1JQJC 5FUYA 1T3SA 2X2FA 3NEJA 3W5IA 121PA 2PT5A 3FWYA 3ZVMA 2CHGA 3FOZA 4NL4H 2FWRA 3NC0C 2BCGY 3REFA 2IX3A 1RKBA 2MSCB 4NCIA 2QSZA 5AJVB 1U8ZA 3FPAA 5L3SB 2VSOA 3I4LA 3CR8A 4DBLC 4ILEA 2OT3B 2ZSBA 3SJBA 1EX7A 4NH0A 2ANCA 5FTMA 1ZVQA 4D80A 3TLXA 3EAQA 2FFHA 2DFNA 5FL3A 2VSXA 2EFEB 1ZD1A 5KDDA 1CR0A 3BJIC 1DO0A 4S2EA 2VPPA 2J7KA 2YHSA 3R8FA 1TF5A 2BEJA 2WJHA 4Q4HA 3X1YA 2CCGA 1XCGB 1ZNXA 3B9QA 4IXMA 1T8TA 5G40A 4OQMA 3BIFA 1RRCA 1M34E 2P5TB 2WWXA 1N6LA 4I1SA 3R8CA 5DGXA 2ZRPA 5J4HA 4QGFA 3AUXA 4W9MC 4Q47A 5A5GA 2QP3A 3KFVA 1M8PA 2VEDA 3B1VA 4II7A 4XWKA 1GL6A 3U4QA 3NBZC 4P4SA 4V0LA 3OIYA 4YMVA 5TARA 4B73A 2R65A 4HB2A 1JBKA 2J7PD 3GPLA 1NBME 2RMKA 3LQQA 3TR0A 1RRPA 4PHTA 3L0SA 5F9HA 5TV2A 5KSOA 1N25A 2VBCA 1EFTA 2FGKA 4QBHA 4M8NE 4TN1A 2FV8A 3UXMA 4DDVA 1FOEB 4D0GA 1HY3A 4PFSA 1RYHA 5IT5A 2YJTD 4WXRA 4QKQA 3F0TA 3PEVA 3FMFA 1YZLA 5DHAA 4ASUA 4BLQA 3MLEA 3H1TA 1G8GA 3KQNA 4ARZB 4QFMA 4ZCIA 1TUEA 3VKWA 3VQTA 5AR1A 2XXAB 5FI0B 3QVUA 3EIHA 4BLTA 1E9CA 2FSHA 1NLYA 1LS1A 2JJ2D 4I1OA 4B3FX 2JA1A 3FKSD 4IRUB 2ZS9A 1DTSA 2ZSFA 2CCKA 4OYHA 1FL9A 1SXJE 4KLZA 2WTUA 1WBBA 5F3WB 1CF4A 5HKKD 3QEOA 2WJGA 1P9WA 4IFEA 4D81A 4A8JC 2E9SA 3CB4A 4EFLA 1TU3A 4UJ5A 5FBLB 721PA 4AI6A 3REGA 2XTZA 1XTSA 3VMFA 4OHWA 1IN8A 3EASA 1S3GA 4RD1A 3I61A 2XSZD 421PA 5C18A 5HKKA 2PJZA 3ZVRA 4CEIA 1CJVC 4YDSA 3HPRA 2FA9A 1T4GA 4LBYA 1SVSA 3I32A 2DWOA 1DE0A 3LWNA 3GEIA 1GP2A 2XSZA 1KI4A 1WCV1 5HE8A 2W6JA 3CRRA 3QKUA 4XVRA 1N2CE 4HUQB 3KTAB 5AWFC 4R71A 4URUR 3DKPA 4PPQA 3MWJA 1XMVA 1WF3A 2IUTA 221PA 2QAGA 1I4DD 2J87A 1SQ5A 2GBLC 3IO5A 1GNPA 1UBEA 5KUTA 3U3OA 5JEDA 1G6OA 2ZI7A 2W2TA 1Q3HA 1PUJA 1ZRHA 1XMIA 4BFVA 2WVJA 3IIKA 2ZRIA 5TB5A 4ACAA 5JCPA 2DB3A 4G5RA 1J8MF 1YRAA 1JPJA 4MYCA 1DS6A 2ZAMA 2O5VA 4OL0A 2RHMA 3LW7A 4TQAA 5AUOB 4A15A 3PJRA 1DBSA 2ORWA 4JLDA 2OBMA 3V00A 2A5DA 3KKOA 1E0JA 1FP6A 1L7VC 4DZZA 2UKDA 4JS0A 4D82A 4DCUA 2GJAA 2C9OA 1XEXA 4FCWA 1WP9A 4FW9A 2OFOA 3QI2A 5FBRB 4W5WA 4M1TA 4JVMA 1LW7A 5CK5A 1ZM7A 3FYHA 1G7RA 4KJZA 5HR5A 3CX8A 1A2BA 4C4PA 2O0KA 1N5LA 2OFWA 2X19A 1XTIA 4FD2A 1ZAKA 4ZCLA 1WA5A 3A4NA 1RRGA 4EPYA 2R8RA 1WB9A 3A36A 3PCRB 1TMKA 2WV9A 3T1OA 2OM2A 1U9IC 1XDBA 1X6VA 4KVGA 3WP0A 4HZUA 5HPYB 1Z8FA 2JIZD 3QF4B 2JLRA 3W6PA 2E1RA 4C2TA 3RYTC 2UZ3A 2Z43A 4G5GA 2P67A 4FIDA 1Z2CA 3DO6A 2G88A 1SZPA 2AK2A 5FL7D 1N6KA 2KI5A 3I62A 3I72A 2WKQA 3PENA 4FINA 3TKLA 1LF0A 1VG0B 4JLVA 1C9KA 2IYYA 3THWB 4DUGA 4KFTA 5FL7A 3KFXA 1JAIA 2EWVA 3K70D 1FQKA 1SXJD 1XD8A 1G3RA 3KDSE 1KI7A 1SVWA 1QVRA 4KI0A 4BEJA 1W5SA 1HV8A 1KNXA 2WKRA 3W6OA 4LWZA 4V0KA 1MO4A 1G20E 2ZSDA 3C7KA 3EA0A 4JMPA 4V02A 2AX4A 3B13B 1TU4A 1EWRA 1BO6A 3TUJC 4DLUA 4P31A 3QJYA 1LB1B 1P2SA 2RGCA 3BXZA 4UNQA 4DEXA 4EFMA 2GCNA 2JAQA 3M0EA 3T5GA 1C1YA 3KKQA 5FPSA 1DARA 2AFIE 3NHAA 3DHWC 4EKDA 3R9XA 2X2EA 3RS4A 1V43A 3GLFE 5EP4A 2ZUCA 4A2WA 1E2EA 5DI3B 4LYFA 2WBLC 1US8A 4L8GA 1G7SA 3K9LA 3LX8A 1KO1A 1XCPA 1O87A 1NMZA 1JI0A 4KODA 1G16A 2J3EA 3QKRA 1OXVA 1XBTA 1DPFA 1NN0A 3BFVA 2FFQA 4I81A 4V0ME 2PCLA 3R9WA 2GNOA 4QBFA 4R2IA 4R9UC 3TQFA 2GEVA 4WIAA 3H84A 2A5GA 2VTKA 3JVUA 4AYXA 3VNUA 3GCGA 2O8FB 2J5XA 3L43A 4DSOA 3KUDA 4G5QA 3IEVA 2HCBA 3DKVA 1R0ZA 1U2RA 3KB1A 1JNYA 1ZBDA 1EG7A 3RS2A 4LX0A 1G291 1R0YA 2P6UA 1FUKA 3AV0B 3AVTA 4HATA 2HCJB 1UKEA 5TMPA 1MOZA 1R8QA 1YZQA 4HLQB 1JPNA 2PH1A 4JLBA 4LJYA 3UMFA 1RFLA 2CHQA 2CMKA 2NO1A 4PC2A 5IDVA 3NEYA 1OYYA 2V55B 5FUVA 4M22A 4ESHA 5KPJA 4AD8A 1P61B 2ZJZA 1BOFA 1TL7C 1VCMA 4RZ2A 5EXXA 3SJCA 3U61B 3B8HA 2QSYA 3DMDA 3SJAA 5SZJA 1VG1A 1W47A 5J47A 1NSFA 2G3YA 3B2EA 5CJPA 3HU3A 4EIWA 1P6XA 2WM9B 2RCNA 1A7JA 5BWMA 1JAHA 1NMXA 2AWOA 3IQXA 3KJEA 3SS8A 1E2QA 5JHHB 1TTTA 3AF2A 3AKCA 3B1YA 2BC9A 2VA8A 4A2QA 1Z0JA 4JSYA 4CEJB 2JLZA 1W4RA 1OSNA 2RGGA 4IEEA 3KX2A 5FUWA 3SDZA 4OJQA 3CKLA 4JJKA 4O25A 2X8AA 4A2PA 1A4RA 5EZ5A 2OCPA 4NCKA 1KKLA 3C15C 4G5OA 5KPDA 4M9ZA 1HT1E 1U0JA 2CXXA 4O3MA 4PAOA 2IUSA 4HAXA 1RYFA 1KK0A 2HV8A 2ZI9A 3B85A 1HH4A 2FSIA 2J0QA 3LD9A 4B6FA 1II8B 1NN3A 5D3MA 4Q9KA 4ZCMA 2G77B 1M1YE 1R4AA 1NMYA 2D06A 1G9XA 3P4XA 5EXSA 1Z0AA 3MGCA 4PQRA 5IHPA 4P4UA 3PEWA 1XXHB 4JLNA 3L2OB 1Q1ZA 3AM1A 2CBZA 3UMRA 1QHSA 1YZKA 3BERA 1KSHA 4BEBA 1UKVY 4Q9HA 2QG6A 1Z0KA 3TMKA 1DELA 4ZPXA 5KSYA 2V6JA 2ZQ5A 5EP2A 2GJ9A 2IL1A 3GFOA 1FP7A 1X1SA 2WIAA 4GP7A 4QHSA 2BCJQ 3AH8A 1N5IA 2CEAA 3LFUA 4C2UA 3K70C 2QI9C 1G8HA 1SXJC 4QGGA 5GJWC 5CB6A 1XPOA 3PQCA 2PZFA 5FR1A 3L82B 3UKDA 2BBWA 3LH5A 3EIQA 3NIBA 3MAAC 3FHOA 4KITB 1KI6B 3UK6A 4DSNA 1E0AA 3FKQA 4DJTA 2IEZA 2FDCA 4M0LA 3X2SA 1IXZA 1FPMA 3BAFA 4A0HA 3K0CA 1Z2AA 4RSGA 1S2MA 5H70A 4HLUA 5DN6D 5JHGB 2JLVA 1PZNA 1A82A 4YDHB 2C99A 3NWJA 3U7GA 1D2NA 3RSOA 4B43A 1XX6A 4DT1B 2LKCA 3R20A 1KMQA 3W90A 1KZGB 4R98A 2CNWA 4TLAA 5DN6A 2H17A 1G3IA 3LVRE 4LJ7A 4EPXA 5DO9A 1GRRA 1LFDB 1FNMA 4DDTA 1D6JA 2QGZA 2D2FA 3C14C 2IYRA 4NPHA 1U94A 4LK2A 2R6GA 3CIOA 1GRNA 4Q9LA 3EARA 3R7WA 4AYWA 4KSBA 4NYJR 2J0VA 5FOXA 3HDTA 5FOSA 1YZGA 4B2LA 4JKIA 4CDGA 1DAMA 1E2NA 4PXAA 3HPQA 5LDDC 3C8UA 2VHTA 2OV2A 4OJKA 3GFPA 4QOSA 1NY5A 3PUVA 2FSGA 1XD9A 2NQ2C 2VP4A 3Q8XB 3ZVNA 4RD4A 2XTNA 4G0NA 4Q4LA 3AF1A 1ZUIA 3ECCA 2NO7A 1R8SA 5H1YA 1OYWA 4FMDB 3RRMA 4WAUA 1NJFA 3A8TA 3WBJA 4BZXA 1MRNA 5B2ZA 4KU4A 5BW8A 3ADCA 4KBFA 2HJVA 1OIXA 1XFAA 1VIAA 4JLPA 3CWQA 3Q9LA 3KXKA 1NIJA 2A3RA 4QM6A 4C0KA 1CEEA 4X8OA 2IC5A 2PLRA 2ZRJA 2EFGA 3FB4A 3HU1A 2AR7A 4KLNA 5JI2E 4TMVA 1CP2A 2O0HA 3WNCA 4DCVA 4GPTA 2WJIA 2R44A 1NN5A 3ICQB 1P72A 4KHZA 1YJ5A 1ZC3A 2G1KA 5KSZA 3P20A 2GF0A 4LBWA 1MO5A 4JZKA 5D3QA 3KL4A 2V54A 3DVLA 3LW8A 3WRYC 1FMLA 1E2IA 2GCOB 2ODNA 4Q4AB 4F4IA 1OIVA 2QPTA 3KXIA 1OIWA 1A2KC 1QG4A 3KXLA 2JJ8A 1XEFA 5DIFA 1SKYE 5JJIA 2H8KA 4XWAA 1QHXA 3U3KA 4PQFA 4CW7A 4FMDF 4DVGA 1AGPA 2GEDA 2VF7A 2KE5A 1F2UB 1AS2A 3RNLA 4TSFD 3RC3A 1NVWQ 1NSTA 4B2IA 4DCNA 2H18A 4JL6A 1G19A 2NGRA 2G9NA 3IIMA 3UPUA 2IYQA 1Q22A 3I8XA 4FN5A 1Z5ZA 2A2ZA 2NTYC 3A1VA 1P62B 3K0FB 2OBNA 4C7OB 4KFRA 2ZRGA 1G3MA 4RFVA 5GVRA 2WHXA 3RDPA 2OZEA 2OE2A 5LB4A 1S96A 3GLIA 1T9HA 3I1FA 4DIDA 3AP1A 1UADA 2X77A 3EWAA 3T34A 4MITA 1Q1BA 1W44A 4NBSA 1OXUA 3Q5DA 3KJIA 1M7BA 1Z47A 2UVQA 3T5DA 4C9BA 1FW6A 2ZJBA 2CCJA 3N2EA 4NZYA 3HYRA 4MYUA 4TZ0A 4GP6A 4DWJA 1KO5A 4TYWA 3CZPA 4QXAA 1WMSA 4Q7JB 2J46A 1GNRA 2GJ8A 1J70A 3O8BA 4G01B 5LD2B 5EE0A 3CRQA 4YQFA 1HQCA 2OHFA 2ZRHA 4QHYA 4DLVA 4A1FA 3OFND 2JLUA 4TMZA 1NG1A 1IQPA 1MO3A 2WAXA 2NIPA 1TEXA 1Z28A 3CNOA 4NYMQ 1DAEA 2JATA 1YRBA 4BFSA 3WMFA 3MD0A 3C5CA 1CJTC 3OFNA 1CJMA 4B71A 3B6EA 3FTQA 4PZLA 3EZ2A 3GLHA 3TIFA 1YU9A 4RD3A 2J0UA 1XEWY 4QG7A 2VP0A 1KSFX 1E6CA 1S4QA 2OG2A 2ZI4A 2ATXA 4A8JA 2FH5B 3ONWA 2EU8A 3QKSB 1VTKA 4LPKA 4Q7LA 4NONA 3FHCB 2BMFA 3QXCA 4XTRA 3A6PC 4JBXA 4KBGA 2VL7A 3O47A 5G41A 2IYZA 4IVQA 4OHXA 4PSKA 3U2QA 2RGNC 2VH5R 3SHFA 1CR4A 4CVNA 5J4YA 3KKNA 4OI0A 4JLAA 1MKYA 4P0TA 4F93B 1DAFA 1JEEA 3ZZUA 4B35A 2H7VA 2R6AA 4AKGA 4YONB 4QJ5A 3BH7A 1E9EA 1RVDA 1XU4A 4LY6A 1QVAA 2FX3A 4LJ9A 5CITA 1W46A 2F3RA 1N5JA 4AG6A 3U6BA 3U7HB 3CX6A 3CRW1 3EZ9A 1N0VC 4PPGA 3HWSA 2QT1A 4HLDA 3E1SA 4IEIA 4NYMR 1QF9A 4LHXA 3TUIC 4PHHA 1M7GA 2GBLA 1W36C 5FR2A 1CRQA 3BD9A 4MRNA 1EFRD 2Z5FA 4M1MA 1D9ZA 4QC2A 1E9AA 2J1LA 3VFDA 2BMDA 3QVVA 2ZIAA 4G5SA 3DZDA 1ZW6A 2HYDA 4MQBA 1FFHA 3WP1B 3D6TB 3A1WA 3GJ7A 5BN4A 1EFRA 3T35A 1GZSA 1WRBA 2JLYA 2NG1A 2FPMA 2O8EA 2C9YA 3AF0A 3P32A 1R0WA 2V4ZA 3SBDA 4L5BA 2D7DA 1HUQA 1KK1A 1NVVQ 3LNCA 4DLSA 2CE7A 3GJ8A 3PUYA 3DDCA 4ZIRA 2ZE8A 3T61A 4EJSC 1Q1EA 1GILA 4CYMA 4Q4HB 2H5EA 2HYIC 4Y0VA 4LBZA 2CE2X 2WWIA 1KJYA 3B1WA 5B30A 4FI3C 3V4RA 4FWTA 2GA8A 2XX3A 4IDHA 3H0KA 4KAXA 4LZZA 1YKSA 1AKEA 4CZ2A 4DB2A 2DWQA 2AD5A 1R2QA 2VQSA 3IHLA 3U4QB 4RJLA 1P4SA 4P4SB 1GKIA 1ZU4A 4MGYR 2W58A 1VKJA 2BBTA 2QRZA 1VMAA 3VR3A 3JZAA 4LOAA 2ERXA 4UNPA 4DXAA 1U9IA 1SHZA 3U60B 2WZQA 1E1RD 4IDOA 1E2MA 4MYHA 3RS7A 4AC9A 2QMHA 3FFBA 5EUMA 1YHNA 4X8MA 1Z83A 1RW4A 1JR3E 1UEJA 1ZP6A 4HB3A 5K8IA 3QSYA 4D0LB 2NPFA 5A4JA 1KIMA 1H8HD 4QL3A 5C2JB 1E1RA 1W1WA 1F60A 2SHKA 4M9SA 3EG5A 3E5HA 4M1WA 1T0JB 3NHBA 2C03A 2GK7A 2Z6VA 5J5CA 4D4JA 4B3BA 1JR6A 1H8HA 4RD0A 2IXEA 4GMXA 4B47A 4YMUA 4A4DA 2J7PA 5BXQC 1S1MA 1G5PA 4Q01A 5E4FA 1PLKA 2JDID 4K81B 5FOTA 4L9WA 4NTZA 2PT7A 3IPYA 2F1RA 1NN1A 3P4YA 2FPKA 1UEIA 2ZRMA 3GLGA 2BKUA 3KQLA 1II9A 2XZLA 1OFIA 1CXZA 2V6IA 2J0SA 2WJYA 4A0FA 4PO1A 3LBNA 1E99A 5BYJA 4UQOA 3VX3A 4ZO4A 1L2TA 4IOKA 1DG1G 4URZR 1J90A 2A7QA 2DPXA 5FPHA 3SFZA 3ZD6A 4TMTA 5DNYB 1R5OA 4D4MA 3QBVA 3AVOA 4LUCA 4CEIB 2DHRA 1P7CA 3GJ3A 2JJ2A 4NE2A 2F43A 1N6PA 3FKSA 2ZR9A 4LV8B 4BPBA 1PVOA 1ZJ6A 1Q57A 2V9PA 4IDPA 1VCIA 4PZZA 5FUXA 5EE1A 1PV4A 3QQ5A 1KDRA 1DADA 4MRRA 5EQTA 2ZJ2A 5FTLA 2GESA 3RLFA 4BRWA 1QHNA 5CYPA 3S1AA 5FTJA 1ZIOA 4QGAA 3VR4A 1S9DA 4PANA 2QAGB 5JWHA 1W48A 2B6HA 2QNRA 4QJ3A 4LRWA 5SZHB 5JFGA 1JJVA 4L15A 4DCSA 4JYBA 2QZ4A 3G5UA 1Z0FA 1H8ED 4JVNA 5FTNA 1CIPA 5FOUA 1Y3AA 2DCUA 2OSBA 3B1ZA 1E9BA 2ZI6A 3JVVA 4XJXA 3L0OA 3OE7D 1ESNA 4DLTA 2RB4A 2YWEA 4BE7B 1F6BA 1H8EA 3WNBA 5K8UA 2D62A 1KK3A 3W3AA 4YMTA 4LYHA 1OXXK 2AFHE 1M6NA 2FF7A 1U90A 4WOPA 1S1CA 3LV8A 2FZLA 3BB1A 1JJ7A 2X1VA 1AQUA 5JSZA 3CPHA 4HLCA 2N42A 5F98A 2WWFA 1GWNA 1ZD8A 3IIJA 3WHKA 4K46A 3FHTA 1XEXB 3KKPA 3OAAD 3CUEF 1HQYE 4DSUA 4V0OA 1IXRC 1U0LA 4JYCA 1YR9A 4DDWA 2AXPA 2F1JA 1KI9A 1CJKC 2WWYA 1OB5A 5JBQA 5ELXA 1IY2A 5F9FA 4DHEA 2BM1A 2R6FA 2JCSA 1ZM3A 2AKAB 4HI0E 3U3JA 1MV5A 3RWMB 1W0KD 3VTKA 1E0SA 4DDUA 2OILA 4JLMA 3LDAA 4FWIB 1ZIPA 1EFUA 4MGIR 3ND9A 4U7DA 2QUZA 4HZUB 1KMHA 1K6MA 1ZMXA 2ORVA 3IBGA 2QRNA 1NBMD 1NLZA 2DFTA 5L8VA 4ZKDA 1J8YF 5FPKA 4TYNA 2REXB 2ANBA 4MKIA 5JWOA 1E4VA 4LSGA 4JL8A 1EESA 2GZHA 1E2KA 1X8KA 1TUIA 3B9PA 1RZ3A 2XJ4A 4GMDA 2PX0A 4DLXA 3VU9A 4KCGA 2IK8A 3SOPA 4F4JA 2GAOA 1CRPA 1FZQA 2JIZA 3CF6R 4US0R 5TDHA 1FTSA 1AM4D 2ZJYA 3I8SA 1HE8B 2IXFA 4PSVA 8OHMA 4HDOB 2PJRA 2HEIA 4LHZA 4BFUA 1ZM4A 1ZCBA 4D25A 3T1TA 3OZXA 2AWNA 3GJ4A 2AHOA 3DL0A 1E69A 4PC3A 2P2LA 2ZPTX 1TNDA 2W00A 2IA5A
chains in the Genus database with same CATH superfamily
1XCJA 3VZSA 1RIIA 3WHLA 2DWCA 4IKOA 5DM0A 4B0OA 5JCZA 1K5DA 4RY8A 2I62A 4GOJA 3DPSA 3FCCA 3MMPA 4EFDA 3KSZO 3MPUA 1KA9H 4QNRA 1Y1KE 1YIDA 1ZJWA 1Y89A 3BORA 3WLQA 4QE3A 3NUQA 4PM4A 3GEEA 3LBIA 5F3RA 4G1CA 3OT5A 3ND6A 2P2SA 2ZT5A 4JYPA 4YB8A 1XMSA 4NYIQ 1N9KA 4BC0A 2B61A 1XJWA 2CL6X 4HRXA 1XZDA 5JYEA 1THMA 2IGTA 3DFFA 4GRIA 4F5ZA 1P5JA 4H3KB 3WQRA 1WVIA 4L4UA 2F00A 1KFBB 2Q5LA 1GYRA 4KE7A 3O91A 1OKKD 3GGCA 5BSUA 3GJ5A 2H08A 3DUFA 3I5UA 5A7HA 5JADA 4PLVA 3PV0A 1TM1E 1J99A 1XXHE 4RZ3A 2JFZA 1BEUB 2E6KA 3ER9A 1JIJA 1R00A 1T5SA 2PLWA 3CISA 3P9IA 3QX7A 1T2UA 1W35A 4MWOA 5TE9A 1V26A 2IJGX 2XJ9A 1U8UA 3PQ2A 4JYMA 2G0TA 3TEJA 4AZ0A 1Z18A 3C3PA 4FK8A 4FPXA 1RYEA 2XHZA 1HYQA 2A86A 2RGWA 3EGDA 4P5EA 5JSYA 3STHA 3WE7A 1F12A 3G0HA 2WWRA 2QR2A 1MRSA 2D3TA 3A05A 5KYTA 4WSOA 1GNSA 2B1JA 1QYRA 1NR1A 5FPYA 4IKEA 2ZZKA 2O54A 4B74A 1EPUA 2PGDA 1EWVA 2C4TA 2XODA 2E48A 1RXCA 2AE1A 3BE8A 4NZPA 5LC1A 4QU9A 2JVJA 4D6PA 5JI3E 4K8OA 3VC7A 5JJ5A 5IVIA 1EXWA 1M0EA 3LQ4A 4BZZA 1SBYA 2R7MA 3IURA 2VDKB 3L7CA 2OQVA 2HSDA 1CY8A 3J7AC 3IESA 1CZNA 1UMDA 3IUMA 5AVTA 4B9AA 1K5GA 1KEEB 4A23A 2WJPA 2JHCA 3G0GA 2QM3A 1R0KA 2E18A 2RSLA 3IAEA 5DRTA 4M1SA 2G1JA 3GNTA 4ZO8A 2OCLA 1MAHA 5BNWA 3ZDZB 4O08A 2WB4A 3S1LA 3QXJA 3OICA 3GFRA 3EEYA 1W88B 3E53A 5K2MA 4RDCA 1GDDA 2Z3VA 3ND8A 3O1IC 1P73A 4Q66C 5JLJA 3HCOA 3P19A 2XZPA 4ID3A 4NP6A 4YO8A 2O52A 4FFPA 1EINA 1TM4E 3I92A 4Q00A 1UFOA 1YB5A 3QF7A 5KCMA 2FWNA 3OX2A 2VNJA 3HEBA 3RIGA 3ZDYB 1UAAA 5D1NA 4PO9A 1KI3A 1QRDA 1T0BA 1X1QA 2B2CA 3WGTA 4W99A 3LVFO 4CLRA 3TQQA 1XJ0A 3AZQA 2H59A 2XMZA 5B1HA 5F3DA 4LSMA 2VSYA 4FGZA 2GS9A 5SYNA 1T36A 3FKJA 2IF0A 3OO0A 4YJ2B 1JAXA 2UUPA 4LRXA 4F2GA 1T2VA 5IFLA 2Y1LA 4CM8B 2RHHA 2JGMA 2AYZA 1E4YA 1XQXA 3EGWA 4NV1A 3AR3A 3ZWNA 2NUTB 1G60A 3ZVLA 4L2IA 1LVGA 4HDRB 4RGBA 4L9SA 5TQ0B 2VKQA 3BRSA 1Z8HA 3PGVA 3AVPA 4B85A 2YMLA 3KWFA 3RAPR 1I33A 3R23A 4HK4A 4YPVA 4KRGA 4P82A 2FW8A 5HVNA 5KO2A 3SF8B 1DIGA 1ZICA 4GXTA 4ZJPA 4TYYA 1WZCA 4UHDA 3TZQA 2VEOA 2G7ZA 1JHAA 2QUAA 3TW8B 4XB2A 3O8DA 1V1MA 3OE5A 5E7MA 1HG1A 1I14A 2Q0XA 5A3RA 4E08A 2I6XA 5ILQA 3QWIA 5D00A 1T8YA 2G9UA 2W8BA 1HEUA 1Q19A 5LA6B 2GWHA 3QXHA 3TTWA 2QRKA 1VLZA 5KSPA 1EFDN 1F5NA 2VAPA 3MOSA 1PR3A 4MTLA 3FYDA 3EEOA 2FUG6 2AMVA 2I3AA 2VDWB 3MCTA 1OT3A 3P2KA 4OAQA 1ZONA 1G20A 5AUPB 3HXMA 3DR5A 4DLLA 1JHRA 4XUEA 4MVXA 4RH0A 3TN7A 4L50A 5FXMA 2XQFA 4JXZA 1T6ZA 3UOWA 3U3RA 5LQDA 3KC2A 4C6TB 1LF5A 3JVEA 4JT2A 4BUJA 2XAAA 1RHRA 2RHTA 4LDNA 4ZYTA 5BPFA 1J1ZA 1LRKA 1NXSA 4WK0B 4JSRA 1R1DA 5KWSA 1RWPA 3B6MA 3F71A 1E2JA 1HZJA 3LYLA 4WKNA 5AI5A 2I99A 2Q6LA 1N36B 4ZAYA 1ISFA 1NVMB 1Q44A 1J09A 1NXWA 4OKSA 3DFIA 5LJLA 4GL4A 4KXUA 3D3EA 1OR8A 1YB4A 3HVIA 2WYIA 3OMXA 4OHFA 4BCDA 3VDXA 5MFPA 2ZBGA 4ND8B 16PKA 4QODA 2WG1A 1K2VN 1NBAA 3LPCA 4JR1A 2E6UX 3GPDG 3A6JA 5F76A 5FA6A 2RGDA 4ZVMA 2WUEA 2G06A 1DJOA 2FK8A 4B6QA 1GGHA 3OF5A 4K5QA 2BR4A 2IZ6A 4TWJA 2A5YB 3OQNA 5GONB 1E96A 2QQGA 3BHJA 1YR8A 2LIVA 2NO9A 2PJDA 2HSJA 4JJEA 2IWHA 1GNTA 2ZWVA 4GQBA 3I3OA 4RESA 4KXYA 5KVAA 2H1FA 1DJPA 3M49A 1FDRA 3KJHA 4Q48A 1ZHFA 1BXGB 4UBNA 2R8PA 1QX3A 4KVFA 1X8XA 5AXCA 3MS7A 3KVNA 3R7WB 1MHTA 4LKRA 4ER3A 1WX1A 1VE7A 2HWUA 4KQXA 1U3FA 2DE0X 1RLTA 2ZRLA 3WGZA 5BN3A 1H4TA 4RVOA 4G5YA 5DNAA 2P9JA 4BN4A 2DM6A 2R4QA 3KQWA 1DRUA 1H94A 3PKIA 3VU1A 1MB0A 3K9WA 1FMJA 1XVAA 1RKVA 2OYSA 1GYPA 2YZ7A 4UMDA 3DCNA 3GMDA 4GM1A 4QELA 2FMTA 3P2JA 4CLXA 5KJ6A 1JWBB 3K5IA 3JD4A 3PGMA 4B3GA 3RS8A 4S0ZA 1V11A 4BS9A 1O4VA 2Q29A 3B60A 3FCEA 4ZDKA 1DXYA 1WXDA 2DOKA 4BNGA 3FH0A 1FNBA 4URWR 3V7NA 1CCWA 1T3LA 3IJRA 4I46A 1P29A 3WLPA 5IK2A 3OKPA 1VBMA 1RAGA 3HMQA 3OZVA 4NBNA 4Y2TA 2CLHB 4EW1A 4ZRMA 4H6VA 5LBTA 2I22A 3JASB 4UTXA 4Y6LA 1Z56C 2XHEA 2H1RA 3IJEB 2H57A 5KYXB 2PBZA 2XNDA 2F9MA 1NZJA 5K01A 1W36D 3WAGA 1E9RA 4XVUA 4DZRA 3D0OA 1VE9A 2WB2A 3OQVA 3U1BA 2PS9A 4WZAB 5G3ZA 1RI5A 3WO0A 4C89A 5K0FA 4KH1A 1ECGA 4BECA 3PRKE 2QSUA 4L28A 4I4LA 4YCMA 4WINA 1ZXBA 3R5XA 5HIIA 3S2GA 3VR5D 1Q7GA 2MOKA 2FG7C 2YS7A 4KAAA 3U48A 4AN1A 4AG5A 4QU0A 1ZSNA 3FOAA 3SBEA 3TLGA 3T3HA 1I1NA 1HDOA 4X7PA 4PAMA 4TLBA 4CRWB 3IUBA 1QDEA 4LTDA 4C7JA 2ATCA 2QMYA 5FI5A 4V1CA 2C4WA 2P6RA 1P0QA 2GUGA 2MINB 2EG5A 1H4QA 1YZUA 4TLDA 4ZP1A 3HSSA 3SSOA 4NSNA 2C77A 4PZUA 4NPCA 1M2VB 3CG4A 4REQB 5BYBA 4DA7A 4ZOLB 2HQOA 3I30X 3R7SA 3KM0A 2ZUDA 4AS3A 2IPXA 3OP4A 2ATEA 3JQ8B 2A0YA 4P4TA 1KO8A 3P94A 3UJHA 3HC7A 2QPOA 3KYDB 3OCCA 3QVXA 1ZNYA 4PGGA 4XJTA 4W5JA 4Y2PA 3SM9A 3ZWCA 1L5VA 2Q28A 4QRIA 3C3JA 5HRAA 2V8OA 2C0PA 1JJAA 2V3WA 2G5GX 4RL6A 2IS6A 2P5UA 2H1IA 4ALLA 2Y0PA 2OR3A 2VZ8A 1D9XA 4OP3A 2YJ6A 1X7XA 2H4FA 1VA4A 1P80A 5E8RA 5F5NA 2O06A 4K9QA 3RGWS 1JKMA 1N3LA 1T43A 3QPUA 1LC3A 4XWWA 3OCXA 3VTFA 3VUFA 4GEGA 2H52A 2IHJA 3DL4A 3GAFA 5EIOA 4RYLA 1A5AB 1E7SA 1QQ5A 3KOOA 3KDAA 1MJFA 4H59A 4ANFA 2WICA 2H0RA 3KLOA 2H2IA 1ZWLA 2CJWA 3UGTA 3H97A 3H4VA 3LX4A 2IOFK 2P0YA 3VX4A 2ZPUA 4G3XA 2Z8YM 3EH1A 4WBNA 2QL9A 2DH5A 4AXBA 3K0SA 1SBNE 5KJ1A 4JYAB 1XF9A 2ETXA 5FI1B 1MPXA 2P0EA 1ZJYA 2Y1WA 1DAKA 3D31A 3D5TA 3G9ZA 1ZSVA 5CVJA 2YDXA 5DSXA 1PT8A 3RUDA 3EAGA 1FMCA 1KE2A 3SEFA 3AB7A 2QVCA 1BCRB 2B35A 3ROMA 3VKHA 3P2IA 2BAGA 2LUOA 2B1QA 2J09A 3F5FA 1N2GA 3C87A 1KAMA 4GT1A 4DLYA 4PYOA 3GR6A 3KYJB 3W5VA 4C0LA 3FOFC 2XT0A 5KNBD 4B81A 3GLHB 1RJGA 4YV7A 1E89A 3PRJA 1ZJZA 4KFUA 3KALA 2EQBA 5KOJB 4RU1A 2W2NA 1EE1A 4UUPA 3ZEIA 5K6RA 3GHYA 4M21A 1CUSA 3EVGA 1Q6YA 2B7BA 1XQ9A 3P27A 3F3MA 5KX5B 1KVTA 2VJDA 4DM4A 1Z75A 1ACMA 1X9IA 2P2YA 1IJFA 1RVV1 4P5DA 2GEKA 3RT7A 3DXXA 1CJBA 3WLMA 2XTAA 1LLCA 3EBOA 4NNOA 1N0HA 2OYCA 4ZV4A 1RYZA 1DMRA 4DPKA 4BTEA 1CIJA 3THXA 2B82A 4BMSA 4CM1A 5FI3A 2B5VA 2ZJ6A 3GRPA 4OQYA 4ZICA 1F9EA 3RC8A 4YMSA 1CE8B 4HUJA 2J07A 4KE6A 4IH9A 5AM0A 5SYMA 3W4IA 5AVKA 5JSFA 2AXQA 3M33A 7AT1A 4LHEA 4F84A 2YINC 4L08A 3G0IA 4XOIA 2IP4A 3QE9Y 1TGYA 4D1YA 5GTDA 2D3WA 1JB1A 2FG5A 3P0FA 1SEVA 4AY6A 1DC6A 1T13A 3R0XA 4TT3D 1CQIA 4X20B 1QGUB 3OLWA 4BMNA 4D7AA 2LVBA 3C24A 3MUFA 1AK2A 1KJIA 1ZNZA 3H5OA 2YV2A 2NN3C 1AKQA 4WNCA 4R7GA 5D6OA 3H9GA 2AL7A 4TL8A 3CLSC 4QEZA 4OOEA 2KMLA 3HB9A 3E7DA 5ITZB 4MIKA 5L6MB 3V8MA 3WG9A 5CH5A 3WIDA 4BGEA 1LPOA 5CVUA 4UOEA 1L6IA 4JKYA 4P53A 5GQSA 1V37A 3X1JA 4WNAB 1QHHA 2X7HA 1DIOB 1XV5A 2BFAA 1DG3A 2JEOA 3OZAA 4TTSA 5HGJA 4DQUA 4E2WA 5FAXA 4MGZR 3M4YA 4ZU6X 5HJ2A 3HJBA 3JR7A 2Q8QA 4LI3X 3TNJA 1E79D 4ZIRB 3URKA 2AHRA 5A4AA 4LDJA 5HTOA 2WJJA 2D00A 3FR7A 3G5LA 2V3VA 2YWHA 3QY0A 4HWTA 2C2MA 5ER9A 1BWRA 4AMUA 1U8CB 3QBTA 4IGFA 1QRAA 4I1PA 3A1SA 2VJOA 1JPUA 3I9LA 1MVLA 3MG9A 1UBKS 3DMPA 4UEKA 4FZ5A 2WHPA 3VC3A 2AG0A 3HBAA 4TVBA 4PRYA 2JAOA 3AVYA 1E6EA 5AJZA 2H3EA 4BRSA 2P65A 3CZ4A 4Q82A 1KZYC 2XQIA 3JZIA 1I3CA 2HRCA 4DR7B 1OLSB 1DQZA 2YKGA 1W5AA 2IF2A 4IXDA 4B40A 4HAYA 4P1ZA 4A5OA 3QLJA 4OUDB 1DP4A 1ZDMA 1FFAA 1ULHA 5EMKA 3G82C 1QGZA 3M4JA 4BYGA 3OETA 1J8VA 1Z7WA 2GCPA 1K3FA 3AKDA 2AEMA 2V3CC 2PH3A 2YN4A 4O4HF 2RGYA 4U00A 1LNZA 3NM5A 3LWDA 3EZ6A 1YBMA 1MJGA 2FAXA 3RJMA 4PPNA 1AV7A 1G0NA 2EFJA 4MV5A 3Q3JB 3WWDA 3C97A 2ERCA 2WABA 1UPXA 4C76A 1NI3A 1J8QA 1R4NA 2RKWA 2FZ4A 5UKDA 2ZRBA 3H1EA 4ZALA 1DC7A 2GN0A 4FOOA 3VSCA 2MCFA 5HS4A 2R5WA 3JQ9A 4DG9A 3PI7A 3C2QA 2EIHA 2M6SA 3LY7A 2DTEA 1J1IA 4JDUA 1XRLA 4O2BF 4R8SA 4I5DA 1IZ0A 4N5IX 5L3SA 3QOYA 4JU8A 3ZJUA 3H9EO 1JJIA 2UXCB 1RACA 1CULC 2NOAA 2ONCA 4AP6A 1N33B 1CEYA 3GRYA 3I2YX 4CF7A 4KX3A 4UBOA 5TF0A 1C4WA 4MV3A 3ZX5A 1T0IA 1NRWA 5DYIA 3EZLA 4D56A 5IULC 1TX4B 4YJFA 1YRQA 2MSNA 5IT4A 3HKEA 4CNQA 1T8PA 3TGLA 1E9DA 2QJWA 1M3SA 4IUDS 2P9QA 3ZZ0A 2JIOA 2PUTA 2TYSB 4JLJA 2ZBVA 3V48A 1UODA 2QN9A 4DM3A 1IB6A 4FC7A 5GJCA 1OXSC 2A9OA 2JDIA 1NP7A 2HMTA 2O20A 2W6PA 3CN9A 2YH2A 1IBRA 4JJIA 2AEEA 3EOBI 2IZ0A 3BQNB 4FIZA 1NQXA 2RARA 1AA9A 3CM0A 3HUEA 4IGEA 5AK5A 2WHYA 4DY4A 4E1BA 4TVSA 4YRMA 1TUBB 4RELA 3DMNA 5C34B 3KPYA 2VYVD 3BE4A 1OLXA 2GJKA 2R9VA 3ABRB 2COUA 4UNNA 4MKRA 3ZQKA 2EJWA 4CLOA 2XMQA 3GWGA 3FGOA 4AZTA 4IFBA 4UBJA 3L0BA 2WINI 4U2DA 4CTMA 2X2PA 3SR0A 3Q2IA 4MIYA 1BROA 3HRIA 4I50B 2HU7A 4KE9A 1G4HA 1MJ5A 3BB4A 2N1MA 5E4TA 1U1FA 3O3CA 5TLSA 3QFSA 2ZR7A 2BONA 3R4VA 2FUG1 1UUFA 2YMQA 1BDBA 3INRA 3WXMA 2K5UA 4WDQA 3S6JA 3VR2D 3MWLA 3H4MA 3LAWA 4JEUA 3U9SA 4AZ3A 4BO3A 3ZCXA 4C08A 3COYA 1FDOA 4DR1B 3LT4A 3KU1A 4JI3B 3EJ6A 3IQDB 4EKGA 4HNTA 3V4OA 4IJWA 4DYHA 3W8FA 1NVUQ 1VE1A 4DXHA 4MR9A 1N3IA 4M54A 4EBBA 3IGFA 4M1QA 2VF8A 1XT6A 2N3ZA 3AINA 3D8BA 5FEUA 1TKBA 4IWXA 3H9CA 2W0MA 3M3DA 3TW4A 2QN1A 1V5EA 1W2GA 1A5SB 1MC4A 2BSXA 3RK4A 1GZ7A 4BVLA 1HYHA 1Z07A 1M1ZA 2I9KA 1Y9ZA 5GJBA 1NIPA 2I4RA 1G6KA 2QL6A 2PMKA 3CUSA 1G55A 5J9FA 5INTA 5JWRA 3LI2A 3LC2O 5KNDD 1EVJA 3SBXA 1RYMA 5DB4A 3OMLA 3HWX1 4GPIB 4AUEA 2XCQA 3GYGA 4EB6A 1K6EA 1R5NA 3ZHTA 1OVMA 1XTRA 1GG9A 1M8JA 2Z4SA 4GPBA 4J2TA 5ABPA 2RBGA 3EXG2 4DJEC 2CLKB 2CJPA 5IUJC 3ZHOA 3ZY6A 1G98A 3DEYX 4X1KB 2GD0A 4CKXA 3ZWXA 1QMPA 2NQ8A 1GM5A 3D64A 3IB3A 1VG8A 2PIAA 3FZGA 4Q7MB 5FKJA 5FJJA 5K3SA 4C4XA 3ONDA 3WLOA 2GO7A 4HDNA 1CDDA 4TQUS 1H93A 1UAGA 1Q0LA 4PZYA 5REQB 5JUWA 1Z4JA 4R1MA 3EOZA 4DKXA 4GYYA 5EXTA 1QE5A 1MZVA 4OHRA 2YOFA 1AK9A 3IERA 4TV8F 5IF9A 2XDAA 1IN6A 1YRYE 1Q0UA 4XLLA 2QDXA 1RYBA 4MUMA 4OHCA 3LY5A 2BELA 4GDMA 2R00C 4D79A 1PV2A 1LV7A 4JP3A 3WGGA 2I7CA 2EZTA 3B78A 2J45A 4G0QA 5AMXA 3D3WB 1RP7A 2JBHA 4HQOA 5B4UA 2VHEA 1P9OA 2RKOA 1W5EA 2D5BA 3ENVA 1RLUA 3ESBA 3GMIA 2Q4DA 4IGAA 4RY9A 3DOHA 3TS1A 4FZ3A 2R68A 4LJLA 3T3DA 1EUYA 4L95C 2QTNA 2I4IA 1ECBA 2ENUA 5AT1A 2IPNA 3HO6A 4QQRA 3RYHA 4BIIA 1T3TA 3AU8A 1TLFA 2ZJ3A 3CKMA 3HNOA 4JCCA 4AS1A 5ICGA 4RHUA 4F3NA 3T15A 3UENA 1KYVA 1Y7TA 3H8JA 3HM2A 5FAKA 5HIJA 2H85A 4ND2A 4RIIA 3E61A 1DTEA 4YRBA 3R3VA 8GPBA 1EEHA 1U0RA 4BVFA 3JYQA 3MBIA 5LDGA 2OOKA 2AT1A 2GLXA 4RORA 1ZUWA 2P41A 3Q3VA 1D5CA 1FDWA 5JMOA 4O4LF 1PQUA 1EGHA 4AIRA 1JHMA 3O8LA 2WUWE 4HGZA 1IULA 5BQPA 4Q6BA 1NMEA 1XHEA 4RLSA 4IVRA 5EXPA 2F1IA 4B6PA 5KTPA 1AKUA 5F23A 1XPRA 1JI3A 5EJ4A 4Y9DA 1GG2A 5T57A 4OH7A 5JRJA 2JD2A 3HACA 3VZDA 1E2GA 2ZDQA 3OD5A 1GZ5A 1P75A 3QF4A 1O9BA 4JOSA 4Y1GA 4KIGA 3G1UA 3Q0EA 3V3TA 4XQGA 4NV0A 4W9NA 4BLVA 4EUHA 4PLYA 3G89A 2CJXA 2ZYWX 3B3GA 2FWJA 4N4AA 1PTJC 1S2NA 3KO8A 3DOJA 2IIPA 5D01A 5K6TA 1UDCA 4M53A 4HNHA 2CSXA 3NPAA 1L3CA 4B46A 3RC2A 5HJEA 5ALUA 4F4CA 4BB0A 5ICMA 2VNKA 1KGSA 1E61A 4LE0A 4PO8A 4YRPA 4ZGBA 3THWA 2YIDA 3LRTA 1JIIA 2P78A 3T9EA 1A5ZA 1XHFA 1N2CA 1UIRA 4Y1RA 1JQLB 1GVNB 3LPMA 5A5EA 2X0NA 3KHSA 4OH1A 1GHTA 4KXQA 1YZYA 5BORA 2EL9A 1E8DA 2XDYA 4QUKA 4XWYA 4HAUA 3PGKA 1ULSA 3HCWA 2IHTA 1M6HA 1EXVA 2BMVA 2J3DA 2VF4X 3UAGA 4D8YA 3NBUA 3AW9A 1YR6A 5G0UA 4DCPA 4UC0A 4V03A 3S2YA 3KZOA 1QH8A 2MSEB 1RI3A 3ZWWA 4C20A 4F4FA 1YA8A 1UPTA 1Z2OX 2O4CA 3L1UA 1QIMA 3CNLA 2WA1A 1DINA 2JF0A 2DHEA 3PXUA 4NLLA 3KZKA 1VZ3A 4MUGA 5IH7A 1LPMA 1VFPA 4MS3B 4Q1CA 4JI0B 3F2VA 3DT6A 3VHXA 4B6EA 4JN6B 3EGVA 5B7GA 3SFVA 2QUIA 5B7QA 5KOHA 2YVAA 1E3IA 1K86A 2Q5FA 1PDVA 2QD1A 1MO6A 5BV8A 3MJ4A 5JYCA 1ZD2P 2IITA 3AESB 2IOYA 2PSEA 3NH9A 2X13A 4KWCA 4EM6A 4NFSA 2NUAB 3JRXA 2JKYA 2XLBA 1G64A 3OZBA 1IIBA 4J4BA 4UXHA 4WVFA 2EJUA 2IYNA 3VNBA 1Q11A 1R74A 3Q9SA 4BO0A 1GXSB 3HBLA 3HXQA 1H2ZA 5IZCC 1Z6TA 5B5SA 1YK1A 2QNBA 3PDHA 1W96A 3DTNA 3PXXA 2OAP1 3ON5A 2RIPA 4O3FA 4ZVSA 4Z4HA 4M55A 4RY2A 2O1WA 2GPTA 3O73A 2PPLA 4HGOA 5J63A 3SK0A 5LDHA 4KPEC 4QJ4A 1WG8A 2FSVA 4H1VA 4HGQA 3WOHA 2FZCA 1Y33E 4YCAA 1G38A 3KL2A 5EJ9A 5JQWA 3NV9A 2G9QA 2O8FA 1BCSA 2WU4A 4FBMA 4GBMA 4MW7A 1L5NA 2HQ1A 4HPXB 1AGRA 5CGQB 1N5OX 4FTWA 1ITZA 2KBFA 2H4YA 3C1AA 4IRXA 4KR0A 5DASA 2IS1A 4NH4A 2DF8A 4TL6A 1KI1A 1WVMA 2V6GA 2YXPX 4WK2B 5F5LA 2UXBB 2A30A 3SSMA 2RI6A 1WULS 3IEUA 3RUEA 5JNWA 1XF1A 4MAAA 1PX0A 1R8JA 2R7KA 3DTVA 4P32A 1Z6PA 4UHKA 4ER7A 3FTFA 1OE0A 2BWJA 3HCAA 1FBNA 1XWWA 3IOBA 3L06A 3TM5A 5I3ZA 3G2LA 5AVYA 1DC4A 1XP8A 3BWDD 3EDCA 2VTBA 1JSZA 5EIHA 5F64A 1PNTA 2JW5A 3TMAA 3LOUA 1NUHA 4FZVA 4Z3OA 3WK5A 4PYQA 5JS2A 4PVDA 2E3JA 2ID4A 3L6BA 2PT6A 4FGWA 1RI4A 1KO4A 1DVRA 1PNRA 3FY4A 1DEAA 4KO2S 1GSOA 3ULKA 5KNCD 3HUFA 3E5RA 1N2EA 1UT8A 1I3KA 2BZSA 3AEKB 4WFQA 3GGJA 5IJWA 4ICIA 2JGNA 4G8DA 2WWGA 2NSLA 2I3DA 2I1WA 2QMQA 3ROTA 4XM0A 3A3PA 2ASVA 2AC2A 4RK0A 3ZU2A 4X44A 4HCJA 4WZAE 2OGSA 5GMOA 2XUIA 1ZVMA 3E9NA 1E3EA 2B4YA 2TMYA 4LAFA 4EATA 2YOGA 4NMXB 5CDFA 4MUBA 3PUZA 1NKTA 2IYTA 3CLKA 1RJEA 1ADCA 2HY7A 3FOBA 3HDVA 5LZ2A 4RTOA 1T8SA 2GBFA 2ZIWB 1DBPA 4OMUA 4ZEOA 3BIWA 2CD7A 3I4CA 1TO6A 5I7UA 1EXMA 2KX7A 3T5AA 1P2DA 5FUBA 2D7JA 5ALGA 4OQFA 4EGCB 3LPNA 4DIOA 4NU6A 3L8DA 2ASEA 3JY6A 3CXRA 3D8RA 3MM4A 4P22A 2NZJA 1O0BA 5AW1A 4Q3DA 1BU8A 3MWEA 3OHPA 1M2FA 3DBLB 1XD2B 1K6XA 3E9CA 4IBOA 2CJFA 3FBTA 4WDRA 1BEZA 3ROXA 2VUIB 1W2WB 2I3ZA 4M2LA 3NOVA 4I5FA 3QTBA 4H2DA 3NHZA 3EDQA 3N39C 3BD8A 1U9ZA 4PQEA 2GERA 4B48A 1G3QA 2IHUA 4OREX 1DEXA 3TL6A 4MDEA 4FLFA 2C84A 2VRNA 4ID9A 1E3DA 4MV4A 5G3YA 3WYDA 2D4AA 1AHIA 2QTTA 4LYAA 2HR1A 1WU8A 4R3WA 3ICEA 4DL9A 1RWBA 3HVKA 3KVRA 2OC9A 3K1ZA 4IP0A 1RTKA 3NGMA 2DULA 2XNKA 4PZDA 5F2KA 1JMKC 3GYBA 4XI9A 4MLCA 1U0OC 2BFMA 4MUKA 1WW2A 2JFVA 2XCOA 4TZKA 1R16A 1M10A 3K4PA 5DHPA 4DR2B 3QELB 2XVYA 2FEOA 1O6ZA 4HNAB 4LPSA 1C0LA 5BXYA 1EWKA 5CLJA 4NQRA 5ANRB 1X94A 4MVJG 2Q5OA 2C2HA 3SGLA 1EE2A 1XCMA 2C97A 2DZDA 4TTAA 4FFOA 4XIGS 3OJOA 1E2LA 1OGYA 4B7ZA 5C52B 2QL7A 1W6RA 3WJ7A 1G8PA 1I36A 3ZW9A 4DMUB 4TXHA 4XRRA 4C6HA 3PXCX 3MF4A 4MRVA 4EELA 2FNAA 4A8PA 3K73O 2GF9A 2ZWMA 3JD3A 1BVYF 1GLNA 3QEMA 1A4IA 4J0QA 5C3UA 4TQ9A 2GCGA 2QE7D 3UB3A 3SZGA 3UYLA 2JGEA 2VDRB 4WXYB 1Z08A 4BE9A 1QTQA 5BV1A 5K0EA 1XNRB 2B21A 1U2GA 1X7WA 3C8MA 5IYZA 3WFIA 4CKWB 1W36B 3H5IA 4MW5A 5HG0A 3AEYA 2ZTMA 3WLSA 1TK3A 2FPPB 5BNZA 1DB3A 2QIPA 2ZE6A 2QV0A 3GLHE 3EVBA 3NS7A 3CVVA 1K08A 5HZHA 2I2BA 5IVDA 4DMFA 3V33A 1KAGA 4AL4A 1MW8X 1AQYA 1QF7A 1AMOA 1BDIA 4GVPA 4GEKA 3F6BX 4G26A 1J0DA 1DDOA 3LT0A 3SEQA 2D6FA 4J1SA 1QF6A 3OQ6A 4YRSA 2D1QA 2HNBA 2JGKA 2FE1A 4OHKA 1OX6A 3F5QA 3L02A 4U3JB 1N5RA 3NC4A 4X54A 4ALMA 1KHTA 2WIGA 3EHDA 2YHUA 1KARA 3A1UA 3SKVA 1U8AA 2JK0A 3VV2A 1D6MA 1UWVA 2P9HA 3VH4A 2OBLA 3HKBB 2WSMA 1KO7A 3NJ8A 4GX0A 4CUJA 2GYUA 1ULAA 1DIRA 2W2LD 2AG8A 3WJ2A 1GAXA 3FIJA 3AETB 5KHOC 5LWHA 1NMQA 3UXEA 4ON9A 3MMSA 1TA4A 3BILA 4ZYLA 2H4HA 1X9HA 4F5WA 3EGEA 5JO9A 2Q5HA 3C5WP 1RSZA 3WLTA 1ZUHA 5CDUA 3Q8MA 1NRJB 1I6WA 1TUGA 1VIYA 1YB1A 2VH1A 1P9NA 3KVOA 3C41J 4ZZIA 1K7SN 1G4AE 4F38A 2DFLA 4EUKA 4QGSA 1QKIA 1C7JA 1G21A 3JALA 4GKVA 3X1ZA 1ZUNB 4MA4A 3UV3A 1O58A 2R4TA 5JIBA 1GO2A 4HAWA 4LJAA 4KUGA 4WOKA 2OG1A 3TPFA 4FFSA 5ALLA 1OTXA 1ST2A 1Z62A 1FLAA 4EO7A 3QNMA 2O57A 2XH8A 1GADO 3GT7A 4BKOA 1ULTA 4UCWA 3V1MA 5IAOA 1UMKA 4G37A 1ZWKA 5DH9A 3JS5A 2VPIA 4C4OA 1OH7A 2RFLA 4OQLA 5IMBA 3GT0A 2X1HA 2HMWA 5DYTA 1ECFA 1UWKA 2GCIA 2QORA 4S1NA 3CKYA 1ENPA 1IZYA 2G0AA 2NO6A 3DLCA 5JANA 5K7SA 3TLYA 3U4DA 1Q7TA 1B8NA 2G5PA 3UB4A 4BTLA 1LJ8A 4KWIA 4Q7KA 3SS9X 2RAPA 5KVCA 3Q2KA 2QUHA 2OXCA 2FZ5A 5PGMA 4B82A 4C7KA 2VDJA 3E8MA 4QHTA 1IYZA 1SVIA 2OWEA 4R2MA 3R8XA 1ONBA 2Q3LA 4ZA2A 2AGVA 1NG9A 2DR3A 1Y3DE 3FAKA 1LPBB 4JA2A 4Q4DA 5FADA 4Q1FA 3R9IA 2C1XA 4BKMA 3RTDA 4BLOA 1XZMA 3FLAA 5JAIA 3GQBB 3JAMA 4E2ZA 3ZVKA 4FFDA 3SNHA 3K30A 1Q6ZA 3SDSA 3PGJA 3SIRA 1EUQA 1Q92A 3TLJA 2H5LA 4QTUB 2EGGA 1KETA 3PC8C 3GC6A 1OH5A 1XZPA 2IPMA 1N2ZA 3K0FA 1A9YA 1LNQA 2YMPA 4NENB 3L0CA 1GEGA 2M1XA 4ETIA 3VR1A 2EBWA 4WBNF 2O23A 4X6XA 5F12A 4I08A 2C8KA 5E6UA 1AC5A 4QM7A 1E5TA 4UTVA 1BSVA 1XMJA 3R3ZA 1Y63A 2WJ4A 3EODA 2R6DA 1JEDA 2GH1A 2P77A 4D5GA 1KY4A 1TQ6A 4QPJC 3AFOA 4RUKA 1SUEA 2WPDD 3K3PA 3RYIB 4DRXA 2PLNA 1M2WA 4WK4B 1BJKA 1DUVG 1NE2A 2BIFA 2XIQA 2GDJA 5JSQA 3K0CC 2CN1A 4BFWA 5L7TA 1JA9A 1F0YA 3D5EA 1UK6A 1ZL0A 4B76A 1Q74A 4PSCA 1UM9B 5IC5A 2BTEA 4JV5B 4JQOA 4F12A 1H65A 1HT3A 2GYYA 1SC4A 4J16C 2YQ5A 4HO1X 3NHPA 1U7ZA 4ENVA 3GFVA 1GARA 1FP2A 4DGSA 2EW2A 4RGVA 3SVZA 1KH2A 2ILVA 2W2KB 2W7TA 1QBKC 4QICA 4UFOA 1D6SA 3S99A 3FSRA 2Y8EA 3I12A 1OWLA 2FRVA 3HUTA 3U1VA 4IPTA 1TPZA 1O4WA 2Z58A 4D9MA 1D2EA 3B3FA 3NHWA 2WFMA 2FPLA 5AJWA 4YWJA 5IX8A 1PV1A 2V7QA 2Q7OE 2SNIE 2CDRA 4ZDWA 2INGX 2FHPA 2ONKA 2IKQA 2Q07A 1UBGA 3KAKA 1FS6A 2BM9A 1JHUA 1TJ3A 2IYXA 2IZ5A 2PD4A 2VAVA 2ZB8A 1E58A 1C1XB 1MIOB 4Q15A 4R1NA 5FNVB 4HAVA 2Q6OA 2I3GA 5G1PA 2PKXA 4ND6A 4C5BA 2GXAA 3H42B 5E3HA 2VHQA 3GP8A 4IGIA 1U7TA 5KQSA 4BQSA 1QU3A 3JQPA 5ALRA 4JUIA 3AR2A 1B4DA 3N2GA 3W7VA 4EHHA 5EPEA 3ZWPA 2OORC 4TYPA 1UQUA 2A92A 2WSSA 4FGLA 4GVXA 3ASYA 4EYSA 1AUVA 3GJXC 4KYUA 1ZI6A 1B8PA 3KS9A 4RGYA 3RBZA 2PK3A 5BUQA 4Q4JB 3CO5A 1XYVA 3F7OA 4UBIA 5DIZA 1JHVA 3OWXA 2WFLA 2ZT7A 4XUDA 3BMQB 1QGYA 2FPRA 2C83A 1NY6A 2ZOSA 3CF0A 4II3A 2PUGA 3TLKA 5A7GA 3G0CA 1QGED 2X3UA 1X1TA 4K9NA 1N78A 2VDUE 2AXEA 2R8OA 1RNLA 5JV5A 1JECA 3U7FB 1ABFA 3UMBA 1IN5A 2A4MA 2V5AA 1Q1QA 1ZJJA 2AXNA 2IYVA 4KQJA 3HYNA 3HKCB 4RNCA 1J2RA 2OESA 3R9KA 3L8ZA 3ZQ4A 5JJLA 1NR5A 5JVDB 5AK4A 3DP9A 2QVZX 4AW9A 4HAOA 1G2PA 3T1HB 3TL2A 1COWA 1JQJC 2B8JA 2Q4TA 2XUZA 1U2TA 3AFIA 3FTPA 3MZ0A 2GO1A 4KVZA 4RHFA 5HIMA 3ZY2A 4A5SA 3TXXA 1FFYA 2OK7A 3I0NA 4YCNA 5CCXA 1YCHA 3FLEA 4RA6A 3ZVMA 2CXTA 4IICA 4NBVA 3RW9A 3UYKA 3X44A 3AEUA 2QJOA 4FZJA 4BUCA 2EZUA 4IM7A 1Z0UA 4NL4H 1TYBE 4QXRA 4QYSA 2BCGY 2CB0A 3UQZA 1RKBA 2D0IA 3WB2A 2V7TA 4PLPA 5LLDA 1W36C 3ICOA 3FPAA 3DCIA 4NXNB 1ZIDA 1XMXA 4IVNA 4DBLC 1DZ3A 2QX8A 3GP3A 1I4WA 1KOJA 2XRMA 4NH0A 2NZUG 4URFA 2GTIA 3EAQA 4QFCA 2DFNA 1JJFA 2VSXA 2EFEB 1ZD1A 2IY7A 3CZAA 3WNVA 1QNLA 3ANYB 5ADUS 1AKRA 3RRXA 2J7KA 4HX9A 1X14A 4AM8A 3J81A 3R8FA 1V8ZA 1SKBA 2GPJA 3FF1A 4Q4HA 2IUFA 3X1YA 2OB1A 1Z2PX 3E5MA 4GG1A 4JOCA 1XCGB 1ZNXA 4BO7A 2NTVA 3LT5A 4C4YA 1Z5WA 2WYHA 4BMPB 4OQMA 3SX0A 4ZVRA 4DZTA 3DVQX 2WWXA 1Y6ZA 1HDZA 4H6PA 1AUQA 3NIGB 1V35A 4FFRA 5J4HA 3KKEA 3R7BA 3AUXA 4Y6OA 4MMZB 1Y37A 3W4KA 5A5GA 4ARSA 3CLTD 2AG5A 2MTBA 1G42A 3F6PA 5K0GA 2ZUEA 3SBOA 4P4SA 3K9BA 4MW6A 5ADWA 5TARA 3CMCO 4B73A 3HQ4O 2BFFA 2QLBA 1MMFB 3V9AA 4OA8A 1F7UA 4HB2A 2J7PD 1V8DA 4RJJA 1N5DA 1NBME 2RMKA 5F52A