2ZXUA

Crystal structure of trna modification enzyme miaa in the complex with trna(phe) and dmaspp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
306
structure length
306
Chain Sequence
LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVVGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of dynamics in synthesizing N(6)-isopentenyladenosine at the tRNA anticodon
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 104
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zxuA01
1PUIA 1GUAA 3MWLA 3GLGA 4FN5A 5AJVB 3EXAA 4QOSA 1U9IC 4DT1B 3TBKA 3RSLA 1XJ0A 1UBFA 5EP2A 3THWA 3R9IA 2VPPA 1XMJA 1EWRA 1KK3A 4OHZA 2JASA 4XVUA 3PQCA 1MH1A 2BV3A 2WVJA 2FNAA 2OZEA 2B21A 1XEXA 3DM5A 2ORWA 2YKGA 3QOFA 1K5GA 3KKNA 3WP0A 5DGXA 4DSOA 2O0JA 1D2MA 4C7OB 2DWPA 2D7DA 4OHXA 5CK4A 4B6FA 1G41A 4LDJA 4UXIA 2I1QA 3QKUA 2BCJQ 2AFIE 3PCRB 3B13B 1D8TA 3Q5EA 5HCIA 3SDZA 3MWKA 1SVIA 3WRXC 3ZLJA 3AGPA 4JT2A 2GCOB 3BERA 2EYUA 1R0XA 2IYRA 4EPXA 4BPBA 1P61B 1IJEA 1WE2A 3ZZTA 2FPLA 1Z0JA 5AR1A 3OE7A 1E99A 4DCVA 4F7WA 1XNJA 5IF9A 5JRJA 3ZGXA 2OFWA 4JJZA 4FD2A 5HE9A 3H84A 3GLFE 4TLAA 1H8EA 3KXLA 3RRNA 4AC9A 2PLFA 3ZS8A 2QI9C 3VKHA 4BRWA 1CS4C 2ZVPX 1EK0A 4Q9KA 3AVUA 1TAGA 5HR5A 1RRPA 2V55B 4Q7JB 1S4QA 4HB3A 2OHFA 1QVRA 3B60A 3KXKA 2PLRA 2F43B 4OI1A 2I3BA 3GFPA 1IY1A 1OYYA 1VG9B 3AVYA 2X1VA 3GLHA 1OHHD 2DWQA 1VPLA 1UPTA 4JL5A 1QG4A 4O2RA 3BB1A 3QEJA 3MCAA 4CW7A 2ZI9A 3L0PA 4TL6A 1XTQA 1NLYA 1HQYE 2PCJA 4C0LA 1G3IA 5JRZA 3IHWA 1OFTA 1YZQA 3VX4A 1JR3D 4KAXA 4NCKA 1Q0UA 4R9UC 4PO8A 1F60A 4AD8A 2H5EA 1ZM7A 2YJTD 3RC3A 5FPTA 2D7CA 2V54A 2F6RA 2GXAA 2QTFA 3CF6R 1N5LA 1OYWA 2KJQA 4LHZA 4JLVA 1KK2A 3KKOA 3I3SR 2WWIA 4OI0A 4M22A 1G7CA 1WA5A 4GPTA 1A7JA 3IKJA 3BWDD 2J9RA 3FPAA 3RABA 1LS1A 1GVNB 2VP2A 1U98A 2G83A 4OYHA 1R8SA 1T3SA 4DVGA 4C0AC 4WZBE 1HA3A 4LYHA 1DAEA 2C03A 2AD5A 2VHCA 2XTZA 2JJ2A 1Z3IX 2J0VA 3DKVA 4UNQA 1T9HA 3OEED 1E2HA 3PFIA 1KI9A 4F92B 5CJPA 1J99A 2A5GA 4KBFA 3NBXX 2AK2A 5HTKA 1ZVQA 2HJVA 4DLSA 1UEIA 1FX0B 1MKYA 1D5CA 2ZQ5A 2H92A 2ZJYA 5DIFA 2R6AA 5SZJA 4WA7A 3AH8A 1Q3TA 3RVBA 1KSHA 1RRGA 1K5DA 1KK0A 1CRPA 3EZ9A 4MRRA 4AK9A 4KFSA 1NJFA 4JLDA 5DHAA 4HZUB 1VHTA 2ECKA 4LHXA 1FW6A 5DI9A 2ZSAA 3NBZC 2D3WA 1VCOA 3GFTA 1RVDA 3VR4A 1FTSA 1M2OB 4M0LA 3BFKA 2I4IA 5GJCA 4D0NA 1AQUA 4GP6A 5JEDA 3GJ7A 5TVKA 3K9GA 2JLUA 1E9RA 2XAUA 4L5BA 1RJ9A 2QQ0A 4KITB 4RD2A 3SFZA 2Z6VA 1XZPA 3W6NA 2YNMA 2YOFA 4MGKR 4BFXA 4PAOA 2G0TA 1CJVC 4KYIB 1XEFA 4QGHA 2XTMA 3QKSB 4LJYA 3BJIC 4FMDF 1KTVA 3K70C 4IOJA 1XWIA 3A8TA 1KO7A 2C9YA 2GF9A 1TQDA 3TAUA 2JIZA 2OSBA 1YKSA 2GEVA 5JCZA 2H7VA 2O8CB 2HXSA 3NVAA 3UWOA 4N1AA 1II8B 4NZYA 4PC1A 3A6PC 2KWIA 4A2PA 1VG0B 3UPUA 2GK6A 2B8WA 1T5IA 3QG5A 4C0BA 2GAOA 5JJKA 4K8OA 4CF7A 3HU2A 2Q3FA 1A2BA 2OG2A 4CT4B 4QG7A 1BMFA 2WJIA 3L0SA 3B1WA 4DCSA 2JLSA 4LX0A 3QNUA 2YWEA 2J87A 4LWZA 5L3VA 3CF2A 1G8YA 4EQ6B 5C18A 5CM9C 4G5RA 3MRSA 4NYJQ 1E98A 1M7HA 1OE0A 1L4YA 2B92A 1P4SA 2CK3A 3KL4A 4DZZA 4YMUA 1XPUA 4BFWA 1RRFA 4PC7A 1UAAA 5FOTA 3B8HA 3BC1A 1GSIA 3BH6A 3FFBA 4L9SA 3UK6A 3QBTA 3I8SA 2IW3A 5HKKA 1A2KC 3R8CA 2WWWA 3F5FA 2LWIA 4GT1A 5L3QB 4PTLA 1R7RA 3CPJB 3IILA 2NPFA 1NLFA 2GJ8A 4TQUS 5FBQB 2A5YB 2FV8A 4R2IA 3F3YA 2REXB 4Z51A 2AXPA 4KVAA 1TEXA 5GVSA 1E3MA 2G88A 3A58B 1OIVA 3IGFA 1GL7A 1LTQA 4CT5A 3M0EA 1E79D 4IVRA 3SJAA 3THOA 2RKOA 4A6XA 2ZETA 1MRNA 4TT3D 5AUOB 2N42A 4BLPA 1VECA 4PO1A 1WB9A 2IYZA 1FNNA 4UJ3A 2CL6X 3FVQA 4QGAA 5DO9A 3FHOA 4YC7A 2D06A 4PR0A 3IEUA 2ONKA 1YR7A 4Q4JA 3U3OA 2NZJA 3CRVA 1OFIA 4MGZR 2YVUA 3CF0A 4OJQA 3CONA 1IJFA 2ANCA 2GBLC 3A1SA 1Z2CA 5B30A 1XEWY 4H9GA 1W5SA 2QU8A 3VAAA 1R0YA 3REGA 4JVSB 4U02A 4KSCA 5H70A 5JSZA 1D2EA 3I73A 3HPQA 5BQ5A 2FFQA 3L82B 4B73A 4XTRA 2O8BA 2BJVA 1MO3A 2CVFA 2V1XA 3IQXA 2ZUCA 5FTLA 4FCWA 2HLDA 1E0KA 2XJ4A 3LLMA 5J4LA 1CF4A 4EJSB 3EC2A 3SJZA 1G9XA 3OIWA 4MDEA 2BBSA 1F2TA 1DE0A 3UIEA 4MYUA 2QPAA 1NF3A 4QHTA 1WXQA 3U3KA 1N6RA 4JBXA 5LB4A 3WYFA 4URUR 5IRCD 3M1IA 2FA9A 3HPRA 3LVQE 4QBHA 2BWJA 3QXJA 5JWRA 4O3MA 1YQTA 2P65A 4EDHA 1ZM4A 1YR8A 1ZC3A 3L0IB 5IHPA 4M1OA 4B3CA 4LC0A 4FMCB 4B2PA 4A8JB 3QXXA 1V5WA 3FFAA 1E94E 1Q12A 2RHDA 4NCIA 2ZRIA 2GILA 2PZGA 1RPZA 4Q1EA 2F7SA 5P21A 3H86A 4IXMA 4BWYA 3GLIB 2R6DA 4LBWA 4US0R 3QKTA 4M1MA 2XGJA 2QQEA 3OEHA 3EASA 3ONWA 4CIDA 1Z0KA 1DAKA 3AUYA 2ZRDA 2FJUA 1W4AA 1ZCBA 3FGNA 1XU4A 1GTVA 1J8YF 1KSFX 1NG9A 1ZRHA 5FOXA 4QJ3A 4W7SA 1JR3E 4CRWB 1JALA 2JJ1D 4FWIB 2OFXA 5HZHA 2QP9X 4NYMR 2WIAA 1OB2A 1DPFA 5G53C 4F93B 4GFDA 1GM5A 2IYWA 4GOKA 2RGAA 1HEIA 1Z0DA 4PXAA 1P2SA 4QKQA 3EZFA 3CNOA 1R0WA 2WM9B 3QKRB 4A8JC 3HR7A 5TXGA 3EC1A 3G5UA 1ZNXA 4O2LA 3VHLB 3AKEA 2BMJA 4X8MA 1YZGA 5BYKA 3VX3A 1WCV1 1OIWA 3PVSA 3ADBA 1VMAA 4BZXA 3EPLA 1W2GA 2NPIA 4W5HA 1Q1EA 5L8VA 2P6UA 1E32A 2FSGA 2CCKA 1XJQA 3ASZA 3ZYCA 1XB2A 4KLZA 1W1WA 2FE4A 1TUEA 2ZSDA 3RWOA 4XD7D 5BN3A 4ZDKA 5F9FA 4HZUA 1E9CA 3RS4A 1Z29A 2GZHA 2ZYVX 5JSZB 4OKSA 5FI1B 1ZNYA 2B6HA 4TYYA 4OI2A 3T1OA 1I4LD 1NVVR 2CLSA 4JVLA 3U7HB 4NKRA 1XBTA 1NL3A 3ICQB 2ZR9A 4TLCA 1EX6A 4RJLA 1SVSA 4C0SA 2CEAA 3NG1A 1N5KA 4F4JA 2GBLA 3UMSA 2H8KA 4IDPA 1OXVA 4MDFA 4HB2A 4OQXA 1UM8A 1JR3A 3AVTA 3QG1A 4EPVA 1EFTA 1RIFA 3P26A 1W36C 2CK3D 3JVUA 4GMDA 2ZR7A 4A92A 2QZ4A 1ZIPA 4DLUA 4Q4AB 1O3YA 3CW2A 5EP3A 2IXFA 2ZSFA 2AX4A 3EG5A 3RLFA 1XEWX 4DEXA 1XCGB 1Z6AA 3OZXA 4Q7KA 4LHWA 1JPJA 4Q00A 4D0GA 1DAGA 1II8A 2RHMA 3U7GA 4PPNA 3X1WA 3LQQA 1D9XA 2GCNA 2QAJA 4PO9A 2WSMA 3WY9A 4L4UA 1YR9A 2ZU6A 1XTJA 1JBKA 3K09C 4WBSA 3GLGE 4TZ6A 4OI4A 5J4HA 3BIFA 3BFXA 1SVWA 5KTYA 2P67A 4DLRA 2ZM5A 4ON9A 3J81k 1XFAA 5GADl 2YWGA 3EPJA 4I1UA 3SFVA 5H68A 1P72A 1LNZA 3PIRA 1Z47A 3I1FA 3CH4B 1JEDA 4YMTA 1TF2A 1Z08A 4KI0A 3Q9LA 2C77A 1JAIA 2XSZD 3CX6A 3KXIA 2ZRKA 3MWYW 4FWTA 2F43A 3GCGA 4I1SA 4IEEA 1TF7A 3D8BA 3U61B 2XXAB 3LD9A 1ZUHA 1NN3A 3SJCA 3LWNA 5AUPB 1AK2A 5EXXA 4NCJA 4LPSA 1PVOA 2WICA 3ASYA 1G20E 4IFBA 4IXNA 4JLOA 1WP9A 3THXA 3AM1A 4I81A 4P4UA 1W49A 4OL0A 5D3MB 1HYQA 4M4SA 1FZQA 3GLGB 1X8LA 5EP1A 4B35A 1X86B 3TRFA 3WBKA 1EGAA 1R6BX 2J3EA 2WAXA 2OESA 5E7JA 1KIMA 1RW4A 3W3ZB 8OHMA 5FL3A 4FMCF 1Z6XA 2ODNA 1ODFA 2KBFA 4IOMA 3GLFA 3PEWA 4EFNA 2JA1A 2H17A 4FINA 2QSZA 1TU4A 3WMFA 1H65A 2HYDA 5J47A 3QKSA 3T1TA 5L3SB 4OQLA 4AIIA 5KHOC 2PJRA 1EFCA 4JIMA 3MUFA 1COWD 1W0KD 2GTPA 1ANKA 2FU5C 4B74A 1XX6A 4Q1FA 4RD1A 3JVVA 1U0JA 2R6CA 4MGYR 1O87A 1SZPA 4LJ5A 1LF0A 4CEHB 2Z43A 5J5CA 3TH5A 4V0MA 5EUQB 3A4NA 3CPEA 1JPNA 3E1SA 4BECA 3ZD7A 2Z83A 3CIOA 4JL8A 2Q21A 2CHGA 2Q3HA 3CH5A 2ZJBA 2B7CA 4DDTA 2JJ1A 2JDID 2XNDA 3BH7A 1UKZA 4C0QC 3I5YA 1DG1G 1LF5A 3W5JA 4D0LB 4RZXA 3LW8A 2W6JD 5M04A 4CEHA 2BEKA 2ODEA 2QA5A 2QM8A 1BYUA 1UBGA 2VL7A 2IYQA 4M21A 4TYNA 1GRRA 3QSYA 5FOUA 2ZRLA 3OEEA 2ZXUA 1AKYA 1AS3A 1XMIA 1U99A 3O8DA 1MABB 2CLCX 1YZLA 2YHSA 3HJNA 4MKGA 1Z22A 4PAQA 1W0JA 2H18A 3WYAA 3AVPA 2ZTSA 2JCSA 1G5TA 3AF2A 4MUBA 3AKYA 3BH0A 2GDJA 2WJHA 3AF4A 2JLRA 1YRBA 3ZH9B 4ZI2A 4AWXA 2YV5A 2O8FA 4B3FX 1HY3A 4M8NE 3FE2A 3IO3A 4PPQA 4UNSA 3ND8A 1OF1A 4IVQA 4CVNA 5CJ2A 1CIPA 5CB6A 3O8CA 2KB0A 4QM6A 1W2HA 2N1BA 5E3HA 4MRVA 3TVDA 1FOEB 1KI6B 2ERYA 3L0OA 4JLPA 4MRPA 1YZKA 2GXSA 2QN6A 1W44A 4DKXA 5JEEA 3RNLA 4B34A 2F9LA 3TQFA 5JJIA 1N6OA 3C14C 1N0UA 5CLLA 4WOPA 4B71A 4A8JA 1W0JD 2RGNA 1HV8A 2ZUBA 2C9CA 1XMSA 1CR0A 2V8OA 1SHKA 4Z8YA 3P27A 2J0SA 1NVUQ 3WNBA 1HUQA 5CYPA 1S3SA 2NO0A 5KU1A 4LYAA 4BE7B 1Z6GA 3AQ4A 4AYTA 1ZM2A 5FR1A 3FOZA 2LCFA 1UFQA 3BB3A 4LYFA 2D2FA 1SXJB 1J90A 4EPRA 3CWZA 3SZRA 5K8LA 4ZIRA 3KKPA 2AKAB 3ZD6A 3KDSE 1OXSC 2MSDB 2OCAA 1NSTA 5CDFA 2GA8A 3A4LA 3WNDA 2VRWA 1KNXA 3SE0A 1OKKA 4X8LA 5B64A 4QHYA 2WWGA 2ZYUX 4NYJR 5KNBA 4G1UC 4FCTA 5A5GA 2CCJA 4UNPA 3TAHA 3BORA 1U2RA 4QRHA 4RY2A 1DO2A 2J7KA 1DVRA 1TUIA 4BFYA 2AHOA 4O0MA 4XSGA 2IC5A 2PH1A 4DB4A 1KO1A 3CM0A 1SXJC 3KFVA 2QGNA 5AJZA 1KDPA 4IDQA 4MRSA 1JAHA 3TKLA 3EA0A 1I4DD 3OIVA 3U7EB 5FBWB 1IM2A 4HAUA 2JGNA 4HLUA 2D2EA 4PSAA 4D4LA 3A4MA 2QMEA 2MSCB 4ACAA 2VF8A 2F1IA 2ZR0A 4LV8B 2CE7A 2J0QA 3K53A 5JCPA 1OFUX 3SN6A 1E2EA 1ESNA 3WHKA 3KQKA 3NDBB 4MGIR 2B7BA 3QF4B 2J5XA 3MMPA 1XEXB 4V02A 3WHLA 3T12A 3C16C 1A4RA 2WWHA 3IHLA 5C4GB 4MYHA 4NL4H 1NY6A 5B2ZA 2P6RA 1CLUA 3MGCA 1W47A 3IBGA 2VHQA 2N46A 5JS8A 2CL0X 1R8QA 3TMKA 3NHAA 2IHBA 2J1LA 2UZ3A 3RSOA 1FMJA 2BJWA 3GJ5A 4JLNA 4NMMA 1L2TA 2BMEA 3Q85A 1NVWQ 1CRQA 3DL0A 1KDOA 1SKYE 4OQMA 3PENA 1KJWA 2FN4A 3PUYA 3VU9A 2O0HA 4IEIA 3CRW1 4HSEA 3R7WB 1QHIA 4B44A 2KE5A 4B48A 4CEJA 4MKIA 4Y0AA 3X2SA 5AUNB 1GL9B 1U0LA 2X8AA 2IA5A 4P4SB 1DELA 1GG2A 5ANRB 4KSBA 3LBHA 4C3ZA 5JBQA 3C7KA 2VF7A 2WZQA 5J4VA 1MO6A 4UQOA 4W5JA 2WPDA 2W6IA 4LY6A 2HYIC 4LHVA 4F4IA 3QY0A 2Q0HA 4NU0A 1CP2A 1EFRA 3VR3A 3BD9A 4B2LA 2J0UA 4HLQB 4TLDA 2QTHA 3U3MA 1Y3AA 1K8RA 1MOZA 1P6XA 5FOVA 2IYUA 1JQJC 2A5DA 3T1QA 3KJGA 4HUQB 4KXFB 3VMFA 2ZROA 3DOFA 3OAAD 4RZ3A 1AS2A 1Z8FA 4WXRA 1S8FA 3PEYA 1MR3F 2R9VA 2A78A 4DLYA 1TMKA 4R7ZA 2MMCA 4WZ6A 3I62A 5DN6A 3DMDA 2ORVA 121PA 5UKDA 4R2HA 3LAWA 1UJ2A 4CZ2A 4UXJA 4D4MA 2FFBA 5TARA 2C5LA 2UZIR 2ZANA 2XOKA 3MSXA 4FI3C 4LJ6A 2HT1A 2W0MA 1FQJA 2GVDC 2ZJOA 1Z0AA 4ZO4A 3I8XA 2EW1A 2RGDA 4YLGA 5FTNA 1IQPA 1YVDA 3U44A 5D3MA 1TPZA 1KKLA 3NH9A 1IN8A 4JLMA 4DCUA 4JBWA 2QP4A 3AKDA 3U6BA 4DIEA 1E0AA 4NYMQ 1CEEA 5G3ZA 1MO4A 2KI5A 2ZU0C 4C7OA 4L15A 3CNLA 4B33A 1TQ2A 2JJ2D 2ZAMA 5EJEA 2PMDA 3AF3A 1DBSA 1ZNZA 3EWSA 5GJBA 2DB3A 2FWRA 3TW8B 1QHGA 4B6EA 1ZMXA 3R8FA 2O8BB 1SULA 4JLKA 4TMVA 1UDWA 4JJKA 4A36A 1AZTA 1W7AA 3MD0A 2VBCA 1PLLA 2O0KA 1RZ3A 4Q1BA 2BVNA 2L0XA 4GL2A 1Q1QA 4E09A 3ZVRA 2QPOA 4RCYA 2WMOB 1FUKA 3AVOA 2JLYA 2WBLC 4V03A 3GJXC 4TYQA 3F0TA 4LPKA 5KSOA 2BIFA 4IW3B 3CKLA 4CEIB 3VFDA 4QJ4A 4HAZA 5FPHA 2WOOA 2O8CA 3TJZA 4DEYA 4JSYA 4XVRA 2G9NA 1CBUA 1KJYA 2F1RA 3KKQA 3DO6A 3SHWA 2V1UA 4MYCA 5CLQA 4RD3A 4A0HA 3CR7A 3CR8A 4POAA 5A0FA 3UWKA 1N2CE 1FP6A 1KMHB 2NO6A 4KVGA 2ZI6A 2ZYTX 1T0JB 5FTJA 1BS1A 4Q4AA 5TV2A 1E1RA 4W9MC 2R65A 2PBRA 5FH9A 2PMKA 3QBVA 4DRZA 2ZEJA 2BOVA 3K9LA 1EESA 5DSZA 4LGMA 4LV5B 2AKYA 1Q21A 5BXQC 4U00A 2QAGA 4HUQA 3IIKA 2CNWD 3T5GA 1N6KA 1E1QD 2AWNA 1E9AA 3FHTA 4EPWA 1GNRA 4GOXA 4Q7MB 2GAAA 3WNCA 3VR2A 1T3HA 2P2LA 1F2UB 2QMOA 4PX9A 1XTRA 4I4LA 1T4GA 4OHWA 2ZJ8A 1P2TA 5L3QA 4TN1A 4ZDWA 3VHXA 4DSTA 1JXOA 2QAGB 5KDOA 3ZZ0A 4LJ7A 4M9SA 1P3JA 1CTQA 3GLFB 1GNPA 4HLUC 2JAQA 4HAYA 3PEUA 5FPSA 2FF7A 3KX2A 4Q1DA 2QPTA 1I2DA 3MFYA 1E1RD 4B43A 3CNNA 2WJVA 2YOHA 4YDSA 3ZQJA 3T15A 4TYPA 5KNDA 3BFVA 1GOTA 2NO7A 2WJYA 3T5DA 3K70D 3I5XA 3P1JA 2I1VB 2BMFA 1Z07A 3NBYC 1KK1A 5GJVC 5SZHB 5FL7D 3UKDA 3QUSA 2ZRCA 4FMDB 4AG6A 1NRJB 1OH8A 4LZZA 4JLBA 4XH9B 1SVMA 3LH5A 1JNYA 1AS0A 4EPTA 3W8NA 3TNFA 1XPRA 2WIBA 2C96A 1E2IA 1CR4A 1WDTA 3CX8A 3HU1A 3KJIA 1NN1A 4DUGD 2XZOA 3AF1A 5HPYB 3VNUA 3QPWA 2QP3A 3B1VA 2RMKA 3FWYA 2XX3A 4EKDA 1EFUA 4CGZA 4URXR 4UNNA 1MT0A 2FMXA 1TTTA 3K0CA 1P62B 2ODWA 3N2EA 3THYB 1UBEA 1AM4D 4LJ8A 2ORIA 2QY9A 1P2UA 1S0UA 1VYTA 3RS5A 2O8FB 3TUZC 4Q4LA 4QNRA 3IEVA 2WSSD 4TTPA 4YQFA 4P31A 2VA8A 1T6NA 1IXSB 4TZ0A 4PQFA 2P5SA 2A2ZA 1G3RA 1IY2A 1LY1A 2P5TB 2V6JA 1N6PA 4C0KA 1XF9A 1XD2A 1W36D 3QQ5A 2J59A 2GVZC 3Q7QA 3NIBA 1SGWA 1VG1A 4LJAA 4CYMA 4OJKA 2IWHA 1E2GA 3RRMA 1CR1A 1KAGA 2BKUA 2CBZA 3H0KA 4JT4A 2W2VA 1KGDA 1ONBA 2ZVQX 2QE7A 5EE0A 2CNWA 2TMKA 4DLXA 2QM7A 2GHIA 4KV9A 1TX4B 1E2MA 1P2VA 1NIJA 1R5OA 2PT5A 1KKMA 2V3CC 2OM2A 1SVKA 5C46F 2BKEA 4YXWA 2IWRA 2WWFA 2FZ4A 2C98A 2FEOA 3WMEA 3C41J 4Q4HB 4MA4A 3W5IA 1E2QA 3BS4A 1E4VA 3LDAA 3CWQA 4HDOB 3HYTA 5FOWA 4DDUA 3CBQA 3G82C 3U4QA 4GOJA 2BCGY 5G41A 1U81A 4QHSA 2AWOA 4E5UA 3U3RA 4IRUB 2WAYA 4G5SA 5GJWC 2OCBA 3GLHE 1GDDA 4B32A 5CIWA 2GWHA 1NBME 5EZ5A 3C5CA 4JL6A 4JLAA 1GKIA 2SHKA 2FSIA 1WBDA 3IIJA 4QBFA 1AQYA 4ILEA 1GRQA 3B5JA 3B7GA 2IL1A 3N5CA 2ZI4A 3HYRA 1X6VA 2LKDA 3KJHA 4UXHA 2FFAA 2GF0A 1G17A 3TQCA 5L3SA 2IXGA 3GJ3A 3LX8A 1GRNA 2DFKB 2GNOA 1BMFD 3PEVA 4FXPA 2HLDD 3X1YA 1GITA 2CE2X 4PC6A 1ZP6A 1VCMA 4URVR 4V0OA 2BMDA 1E0JA 1KDTA 1R5BA 2DR3A 3AGQA 1PJRA 2V6IA 2IF0A 2OXRA 4AY2A 3FDIA 2QBYA 4JVNA 1NBMD 1W4CA 3KTAA 4H1VA 4PPFA 3EX7C 4DC9A 2ZIAA 4KYUA 5K8UA 2QT0A 4ZCLA 3GLHB 1OPXA 3NEJA 5FFMA 4PQYA 5KSYA 3SR0A 3IIMA 3QF7A 2ZREA 4IOLA 3SBDA 4TMWA 4PPGA 2VSFA 4YDHB 4E03A 1Q3HA 5JLJA 1X8KA 2AN9A 2FGJA 3MJRA 4Q19A 1E2FA 1KHTA 2PCLA 3VU9B 1Z63A 2RGXA 5D3QA 1TL7C 4EFMA 4TSFD 5EUMA 2Q6TA 4BZQA 4CEJB 5CDFE 1FUUA 2GKSA 4HB0A 1G5RA 3X1XA 2IK8A 1ESMA 3ECCA 4HYYA 5IK2D 1YU9A 5FBVB 3O8BA 1C1YA 5IDVA 4PZZA 1E9SA 3ZS9A 1KI8A 2GZDA 3IDQA 4QGGA 4MKFA 4DXAA 3ICEA 1U8ZA 3LFUA 2ANBA 2D62A 5KPDA 1QHHA 3NBFA 2V7QA 5JI2E 3P4XA 2IBMA 2Y8EA 3EA5A 3K09A 4Q47A 5FL7A 5JI3E 2QMUA 4S2EA 2RGNC 1GL6A 4M53A 1W4BA 2ZRNA 2HCBA 3W9YA 4TTRA 3GJ4A 4BUJA 1KI1A 4D4KA 1YZUA 2GETA 2YOGA 4RFVA 4ZI3A 4Q18A 2BHRA 1NMZA 5J40A 2G77B 3AP2A 4LBYA 4TQ9A 5TMPA 1Z5ZA 4IHQA 1N5IA 2EWVA 2XNDD 2IYXA 2HXYA 2C78A 4JSTA 3OHMA 2ZE7A 4ERNA 3SJBA 1TEVA 3CRMA 1UF9A 1SKYB 3ZZUA 4TMZA 2VHUA 2C8VA 4EUNA 2NGRA 621PA 3AEZA 1TF5A 1E6CA 4DLZA 4TLEA 1U90A 3ZVNA 2HDNB 1IBRA 4HEJA 1RE0A 2D4HA 4ZKEA 2PL3A 4JZKA 1G8FA 1KY3A 1G5PA 3CRQA 4ASUA 1G3MA 1G7TA 1BH2A 1NI3A 3A1VA 3SBEA 1AN0A 1BOFA 2ZI7A 4A0FA 4QBIA 5FUYA 3OESA 3GFOA 1KAOA 1OV4A 2RH5A 3LA6A 1VKJA 4NYIQ 3TVTA 4F91B 1TU3A 2OO7A 3BB4A 4OHVA 5GVRA 1NY5A 1AIPA 1M34E 3KB2A 3QE0A 1ZC4A 5CYOA 4Q01A 4BLOA 4LRWA 5EXTA 3GEHA 1FFHA 4XOIA 2Q9AA 2E1RA 3LXRA 2RCNA 2AXNA 2H1LA 4DWJA 5JHHB 4YXWD 4DJTA 1G6HA 2VP5A 4JYCA 3OAAA 3WP1B 4R98A 1G6OA 4V0NA 2GJSA 4URWR 1PLKA 2YC4C 5LPNA 3HU3A 5HKKD 1M8PA 5LB2A 4B3BA 2OFOA 5B58C 4WVFA 3WBJA 5FPKA 4RKFA 2JLVA 3OFNA 1F6BA 1G64A 2XSZA 1VIAA 1G21E 3ZIAD 3H1TA 3ADKA 4E22A 1OSNA 2NG1A 3GEIA 4URYR 3T06B 1Q57A 2P6NA 1DADA 3REFA 1XTSA 3EW9A 4ABYA 4ITRC 1KO5A 1YZNA 1XCPA 1S9HA 2NZ8A 2GZAA 3VR1A 2IEZA 4C30A 5LD2C 1XD9A 4C2UA 1DOAA 2V9PA 4NE2A 1JXMA 4L8GA 4Z8XA 3G0HA 2A9KA 4NBSA 4Y0VA 2RB4A 3LLUA 3EPHA 2IUSA 3AV0B 4HAXA 4WIAA 2X77A 1A5TA 4M2LA 3V4FA 3ADDA 4G5OA 1E69A 1S1MA 4BRUA 4J0QA 4QJ5A 1ZUIA 2GEUA 4B3GA 1IN6A 4TT3A 4Q21A 1H8HD 2ZJ5A 1CJMA 3PUWA 1HQCA 4DLVA 3GPLA 1KI7A 3VKWA 1M1YE 1ZD1A 2KBEA 1YRAA 2PZEA 2ZRFA 3ZJYA 4C4PA 1XCMA 1YHNA 3DDCA 3AKCA 4Z1MA 3S1AB 2DWOA 2ZYWX 1UADA 4ZDIA 5EQTA 2ERXA 1GILA 1X3SA 4DCNA 2OXCA 4LC1A 1OH5A 3RHFA 4DLTA 4C2TA 1KMHA 1PUJA 1XJCA 1UDXA 3DPUA 4LYJA 2NO9A 4I99A 1QRAA 3MG9A 4JYBA 1S9DA 3CZPA 2Z4RA 4U7DA 4K81B 4A4DA 2WKRA 5BN5A 2GJKA 3MAAC 1VHLA 1AA9A 1ZINA 1DEKA 1H8HA 3CX7A 1FX0A 3UMRA 1ELOA 4EPYA 4AKIA 2EU8A 2F9MA 4BLRA 1IY0A 1GFIA 2OAQ1 3GMTA 5DN6D 1XRJA 4AURA 3WMGA 5H1YA 2AL7A 2QAGC 4RZUA 2A5JA 3IO5A 4FW9A 1R2QA 2VTKA 3QENA 2VYFA 4F38A 2G1KA 3GD7A 1GNQA 3W90A 4Z1MD 4L9WA 4TL7A 4GBMA 4M1SA 5JMTA 4MRNA 1UEJA 4ARZA 4G01B 3X1DA 3K70B 2ZI3A 5CIQA 2O8EB 4B2IA 3KZ1E 3OFND 3PUXA 1DS6A 2JDIA 3W6OA 1XXHA 4NCNA 521PA 4I1OA 5CB8A 1C4OA 2NTYC 3R20A 2JIZD 5C4MA 2WKQA 2IS4A 1SVOA 4ZCMA 2G3YA 1US8B 3W3AA 5KPJA 2J45A 4G5QA 1E0SA 1G291 1KMQA 2DHRA 3C8UA 4UJ5A 2E9SA 1MV5A 3LRPA 3I61A 1YE8A 1YR6A 5E7IA 4KCGA 3EIQA 1M6NA 2VHTA 5SZIA 2B8TA 3ADCA 1VTKA 4XSHA 4B75A 2WJGA 4X8HA 2ZAOA 3K0FA 4BFUA 3H4MA 1G19A 3A1UA 3L8YA 1S2MA 3X1ZA 1ZJ6A 4N0DA 4RD0A 1E96A 4MH0R 2FDCA 2BBTA 1Q1BA 2H16A 3LNCA 3H2YA 5IT5A 3L8ZA 5G40A 3RDPA 2CVHA 5J4KA 3B6EA 1FL9A 1KYIA 5EXSA 2NOAA 2E87A 3E5HA 3M6AA 1V43A 1R4AA 4LHYA 3RAPR 2W0SA 4BEJA 1Z28A 4GMXA 4Q1AA 3D6TB 1S1CA 2F1JA 3FB4A 5TDHA 1Z2AA 4KJZA 2X2FA 1N6IA 2CHQA 1SVLA 3D31A 4KFUA 1S96A 1VYUA 2AK3A 2H57A 2OT3B 3AVVA 4IOKA 1P75A 4M1KA 3FMIA 4Q03A 2EFEB 3EIEA 3Q72A 2JLWA 1QZXA 2CJWB 3QXSA 4BZPA 3NC0C 3U6KA 5F9HA 1EWQA 3U60B 3GQBA 3C4JA 3RS2A 3NDPA 4D25A 4V0ME 1I4TD 4TMXA 3CB4A 4IJMA 1MRSA 2JATA 4DT1A 1HTWA 2ODBA 2PX0A 3W6PA 2IF2A 1T91A 1XMVA 3SYLA 3Q8XB 4GDFA 2WTUA 1NN5A 2EFHB 4US1R 5FUXA 3RC8A 4ESHA 2ZRJA 221PA 1QHSA 1WQ1R 4G0NA 4UNRA 1T8UA 4TMTA 1EXMA 2EFCB 4TYWA 5JWOA 2PEZA 4ZPXA 2DCUA 1T0HB 5F98A 5DYGA 4ZCIA 2FGKA 1NN0A 4MYTA 3DKPA 3QVVA 3BOSA 2WWYA 1JEEA 1F48A 3ZIAA 3TSWA 3UANA 2JLZA 2XZPA 4XJXA 4NHOA 1GIAA 2OCPA 4PANA 3QIAA 1W5TA 5CITA 1OH7A 4IKEA 1OH6A 1VIYA 4LBZA 4Q9IA 1II9A 2ZUDA 1COWA 1W0KA 4TL9A 3AVXA 1G7SA 1RJ9B 1Z0FA 2DFLA 2IYSA 3AP3A 3EZ6A 5K8IA 3CPHA 1OW3B 4A2WA 1NG1A 3B2EA 4XWAA 2PEYA 2W00A 2R6FA 1KSGA 3RWMB 1FMLA 4OQNA 4U5XA 4OBEA 2C9OA 2O8DA 1NIPA 1X1SA 2QENA 2CMKA 4BFVA 4Q5IA 3WRYC 3QXCA 1J2JA 2J41A 3E70C 1CJKC 1RRCA 4LV6A 3GJ6A 3QPUA 4A0RA 2NMVA 4IDOA 1G3QA 4P4SA 2GJ9A 1SXJE 2P0EA 4PZYA 1XP8A 4XD7A 1JB1A 3O8RA 4KFRA 4DLWA 1G16A 2QMHA 3TSOA 4YMVA 4BEBA 1LVGA 5DI3B 5G3YA 1DAIA 5B57C 2O8DB 3MJHA 1D9ZA 3SYKA 1ZYUA 1G4UR 1P9WA 3B78A 421PA 3TUJC 1HURA 1ZD8A 1ZM9A 4Q1CA 2WSSA 1EX7A 2A30A 5DE3A 3KQHA 3LBIA 5LDDC 3B9QA 5FTMA 4QL3A 2W6ID 5DYIA 3AUXA 5H8WA 3C5HA 2ZS9A 2QGZA 5BYJA 3B82A 5JECA 2OV2A 2DFTA 4N0EA 1KI6A 4I1VA 4BASA 5DI3A 4LCBA 3PG5A 3F8TA 2J7PD 1ZAKA 2F55A 3RYTC 3SNHA 4V0KA 5E4FA 1Z0IA 3LY5A 4K46A 1EG7A 2DPXA 1QBKC 1DTSA 3M4YA 1KI4A 1DO0A 2C2HA 4DUGA 2RAPA 4TWZA 1GP2A 1PV4A 2W58A 1E4YA 2G6BA 2QUZA 1NNEA 1Z06A 3B1XA 4TTQA 4US2R 3U7FB 1JI0A 1P73A 2ZRAA 1FPMA 5E7MA 2IYVA 2QTVB 2QNRA 4Q9LA 4PAMA 4RFSA 721PA 4A15A 5IK2A 2V7QD 3NEYA 3FTQA 3TGPA 2WMNB 2CXXA 2PT7A 4AI6A 2HF9A 2J7PA 1X1RA 4EAQA 4BFSA 1HE8B 4Q66C 3THWB 2IS2A 1NSFA 1JQLB 2FFHA 3GLIE 1N3BA 1E79A 5FTKA 2FX3A 3UG6A 4KODA 2Q9BA 3CRRA 4D2IA 1NKTA 3I92A 1E2KA 1W36B 2ZE5A 4RFSB 4ZKDA 2PJZA 4YONB 3IQWA 1UBCA 2BM0A 1U94A 3CZQA 1QF9A 3FMPB 4LJ9A 1OXXK 2FPMA 4M1WA 4P4TA 3MWJA 2RGGA 3EIHA 5AJYA 2R8RA 4RSGA 2Z0MA 5KDLA 1ZIOA 5FR2A 1ZD9A 2Q3MA 1Q20A 3OIYA 3UATA 3VR6A 4NCHA 4BGDA 1SKQA 4JMPA 2VEDA 2VO1A 1HE1C 2IYLD 1P9NA 3BXZA 1RC8A 1FTNA 3ND9A 3SEAA 4EJSA 1LS6A 2FOLA 1CJUC 1XD2B 1A82A 2FG5A 3LVRE 4YMWA 5FUVA 1LB1B 2EFGA 2FSHA 2UKDA 4P0TA 5SZKB 1OB5A 1LW7A 1IXRC 3HDTA 1UKEA 2EQBA 4WXPA 2VSOA 2YZ2A 3DVLA 3QF4A 1W4RA 3NC1C 3DOEA 821PA 4URZR 3BE4A 1GZSA 2IXEA 1KDRA 1OJLA 2KSQA 3K0FB 1JR6A 1XD8A 1VCNA 1G8HA 3ZVLA 1NLZA 4GI7A 3THYA 4EJSC 1FP7A 4HDCA 2XEXA 4LBVA 2C95A 1AGRA 2NO1A 1U0HC 4GZLA 2IUUA 4Z54A 4OK6A 1XTIA 1DAHA 1US8A 2FH5B 2ZPTX 3K0EA 2DY1A 4G5GA 3EARA 4LK2A 3ZVMA 2WHXA 1E9EA 1BKDR 2YYZA 4AKEA 3V4RA 4PC2A 1ZNWA 2ZJZA 4C0JA 1CU1A 1P5ZB 2X19A 3U4QB 5FBRB 2A5FA 4ZV4A 1ZU4A 2FEMA 2GESA 2ZJ2A 3EAQA 4LUCA 3P20A 3A37A 1T3LA 1YZTA 2A3RA 2QRZA 2BM1A 4TL8A 2YINC 3QI2A 3DM9B 2HJGA 4PC3A 3T1VA 1J7KA 2REOA 1OKKD 4AKHA 1NMXA 1R0ZA 1TADA 3KQUA 2W6JA 1E9BA 1B0UA 4GNKA 2ZE6A 4PHGA 4QXAA 2MMGA 4N3NA 1J8MF 1QVAA 1FQKA 1AGPA 1NJGA 1UKVY 2XITA 3I72A 6Q21A 1GKYA 2EWWA 2K5UA 1Z83A 3BBPA 3Q3JB 4TMKA 2O5VA 4RCZA 2J0UB 5JS7A 3K9NA 3KQLA 3LO5A 3P32A 4XTCS 1ETUA 3T61A 2A7QA 2WOJA 3VQTA 1IOZA 2W2XA 1LFDB 1N0VC 5FUWA 2AFHE 1KSJA 4Q7LA 3L2OB 1KJZA 2XB2A 2ZSEA 1EFHA 1PZNA 1KO4A 2GCOA 2ZJAA 1J70A 4Q48A 4AG5A 2W2TA 4HAWA 5KUTA 1WBBA 1S3GA 1U8YA 4HI0E 2OBLA 2GCPA 1VG8A 3RS0A 1TQ6A 3N2IA 3BGWA 4GP7A 1TQ4A 1G8PA 2XOKD 3NWJA 4M1YA 4NH0A 2G1JA 3TE6A 4A1FA 4HUTA 3QVUA 1G3UA 4NONA 1L7VC 4D81A 4FMBB 1XZQA 2XNSA 2ZRHA 2X2EA 4ZDJA 2O8EA 1HT1E 3FKSD 4JBYA 3U44B 1OHHA 2OBNA 2YC2C 3SC3A 1N6LA 1Q22A 2G0NA 1NMYA 3UXMA 3GP8A 1N5JA 2IS6A 3SS8A 1D2NA 1OXUA 4G3XA 5K8TA 5JZVA 1CULC 2HT6A 3D7MA 2VP9A 3LBNA 2CLDX 3T34A 5AWFC 1I2MA 3KUDA 4TQAA 4QM7A 3PJRA 3OEHD 1G8GA 4AKGA 1BO6A 3TUIC 1IN7A 2VHJA 4NDZA 4C0HA 2CL7X 2Z4SA 2GK7A 3DZ8A 3GLIA 1ZCAA 1MABA 3ZDQA 2R44A 1W48A 5EXPA 4MKHA 4OK5A 4WAUA 3K9HA 2R62A 1N0WA 2QEQA 1PLJA 4R71A 1WRBA 3B9PA 1UKYA 4B76A 2EFDB 1KZGB 1GKUB 1U9IA 3CO5A 4WW0A 5KSZA 1K6MA 5KNCA 2RGEA 4HZIA 1CKEA 4Q02A 2OLKA 3TSZA 2QE7D 2VP6A 5F3WB 3P4YA 2OLJA 4PHFA 1L8QA 2GRJA 3BK7A 2QROA 1IAQA 3PUVA 2VP0A 3EWAA 1GAJA 2QL6A 1JECA 1QHXA 3SU8A 3OE7D 2XZLA 4D82A 5AJXA 4QGFA 1EFRD 1G1MA 2HF8A 3LW7A 4B47A 1LV7A 2PX3A 3EZ2A 3QKRA 2BBOA 1Y63A 3QEOA 4Q4HA 3KKMA 4DBLC 2REBA 2RGCA 1G18A 4JVMA 4S35A 1X8JA 1F3OA 1JJVA 1BYIA 3SI7A 4W5WA 2ZRGA 3AF0A 1AKEA 5C1BA 5AJWA 5DHFA 5LBIA 2Q9CA 3R7WA 2RGBA 1QHHB 3K0AB 5KYKA 4LJ4A 2QSYA 1IN4A 2BEJA 4M9XA 4JS0A 2CDNA 4XIGS 2WJJA 5F2EA 2QT1A 3N70A 4KLNA 3IBYA 4HLCA 4EIWA 3JZAA 4A82A 1KI2A 4RD6A 4BLSA 3LX5A 3VKGA 4AYXA 4HDQB 1XXHE 5FOSA 5HZKA 5FBLB 3GJ0A 4JKIA 4DDWA 1IONA 2IYTA 4P33A 5HCNA 3SOPA 5DNYB 4L16A 3THXB 1VCIA 2AR7A 5CM8B 3Q5DA 3K0AA 4HB4A 2F3RA 1CR2A 3BRWD 4JKYA 2C04A 4NPHA 1MO5A 5BWMA 1F2UA 1NP6A 2XXAA 2VH5R 1QDEA 3C15C 4HAVA 1NKSA 2WPDD 4XWKA 4HATA 3NTUA 1ZUNB 2BDTA 3D3QA 3EZ7A 1RYFA 1IXZA 4GRAA 3K0CC 1WF3A 2BBWA 2C99A 3AB3A 2HCJB 2W83A 4Q4JB 4BFTA 4M9ZA 3K1JA 4BLQA 4D6PA 2QBYB 2ATXA 3DEFA 5JWHA 3VNVA 2OCYC 2HUPA 3KTAB 4RZ2A 2IUTA 5BW8A 4DB2A 4PSVA 1E2LA 3BAFA 3GJ8A 4CDGA 1HT2E 2DYKA 4LSGA 2OUKA 3L43A 3TR5A 1AJEA 3SHFA 3QPVA 4BFZA 5EE5B 5C2JB 1AZSC 1QHYA 3KFXA 1N6HA 4OK3A 1SHZA 4ARZB 2JJ8A 1E9DA 3K8YA 1XXHB 4NTZA 2FZLA 2YWFA 4IDHA 2VLIA 2CCGA 4EFLA 3CUEF 1N6NA 1KO8A 5DH9A 3CLVA 4II7A 4ASUD 2OE2A 4QBGB 4P3YA 5JJLA 3UG7A 3AVQA 1OFHA 3FMFA 1W46A 4F4CA 2IYYA 3U5ZB 1FNMA 2IX3A 1YJ5A 3PV0A 5KSPA 1XDBA 3IPXA 1L4UA 1DARA 1CJTC 1G7RA 3SQXA 3I32A 4FCVA 1DG3A 4TLBA 3T35A 3WXMA 3B1ZA 1NVXQ 5DISB 3MLEA 4UKDA 5ELXA 3OF5A 1U8AA 1KY2A 4PSKA 3SQWA 2AD1A 2PZFA 2FPKA 3W8RA 4GSYA 5JHGB 1M7GA 1OIXA 2OEPA 4OQFA 4WZAE 3EPKA 1QHNA 2YWHA 4JLJA 1JJ7A 1Z6YA 1C9KA 2XJ9A 1DAFA 2GJAA 1RFLA 5E95A 1D6JA 4CEIA 4RD4A 2ZRMA 1B23P 2F1HA 5TB5A 2R2AA 3R9WA 3FKSA 3QXHA 4AYWA 4B3DA 4M9QA 1II0A 1Q44A 4MITA 4MQBA 4KFTA 4A2QA 4A6PA 4KO8A 3A36A 1TNDA 2ZITA 5EE1A 4OHYA 4A9AA 4O25A 2ZS8A 3B1YA 1M74A 2ONJA 3HR8A 3U3JA 1T8TA 1ZBDA 5KOYA 3A1WA 4GZMA 2ZS7A 4KU4A 4D80A 4KHZA 2JEOA 4ACBA 2OAP1 1P9RA 4QC2A 3TIFA 4QNMA 5BN4A 3FHCB 3AP1A 2BC9A 2IS1A 3KUCA 2ZSBA 1KI3A 2QG6A 3FYHA 3LXXA 3R9XA 1N25A 5J4YA 1GWNA 1E2PA 3SYNA 4YMSA 2F3TA 4HLDA 5L3RA 3PITA 1SXJA 4PFSA 2XB4A 3RS7A 5TY0A 5CK5A 4LI0A 3NXSA 3IUYA 1IN5A 3RANA 1DAMA 5DLQC 3V00A 1VYVA 3TR0A 3OIUA 3ZQ6A 2XTNA 1P60A 1XTKA 3U2QA 1R5NA 2DBYA 5EZ6B 3RRYA 4LOAA 1M7BA 1QG2A 1CXZA 3IPYA 1ZW6A 3DHWC 2WKPA 1E2DA 2VP4A 3NKVA 4FIDA 4PHTA 3VR5A 3ETLA 4IFEA 5AK0A 3KB1A 3PXGA 3NHBA 5AUQA 4BQSA 4IDNA 2OILA 1T5LA 2ATVA 4RVCA 5FPYA 3RS3A 4XWOA 1KOFA 2OBMA 4B3XA 3WYGA 2WWXA 3TK1A 2EVWX 4DIDA 2EYQA 5EE9A 1RKBA 3FMOB 2J46A 2NIPA 4NYIR 4KBGA 2D74A 1ZU5A 2MSEB 5LD2B 3O47A 5EP4A 2NQ2C 3RRZA 3TLXA 4RKEA 4PHHA 1Q1ZA 1NBMA 2HEIA 3W34A 2VSXA 1SXJD 5FI0B 4E07A 1P7CA 4MUAA 1IHUA 3HWSA 2ASEA 3KJEA 1R10A 4DSNA 3QJYA 1F2TB 5KDDA 2IT1A 4D4JA 1H8ED 4EQ6A 4D26A 3LQRA 1KZ7B 1NVVQ 4TSFA 1F5NA 3E2IA 3PUZA 2ZI5A 2QRNA 1E2JA 3V9PA 2VIIA 5HE8A 4A0GA 4ESVA 3GEEA 3A1TA 2JLQA 2QORA 2ZRPA 4NP6A 4DHEA 2R6GA 2IEYA 3KQNA 2GEDA 1ZM3A 4DCTA 2LKCA 2GXUA 4IVPA 4XVQA 2ZRBA 1BIFA 3LV8A 3S1AA 3TW4A 3DMNA 1OLOA 4ZIRB 4P32A 2P3SA 4DSUA 1Z6TA 2CHVA 5EE3A 1E2NA 1E1QA 2FSFA 1OT3A 3JZMA 2HV8A 3HP1A 4BLTA 1XPOA 1SQ5A 2WV9A 2Z5FA 3Q7PA 4Q9HA 1E9FA 2DFNA 3I4LA 4QFMA 3K0SA 3DZDA 4M1TA 4C9BA 1G4AE 4H1UA 2IHYA 3VTKA 2UVQA 3NH6A 1A1VA 2V4ZA 2VQSA 4PQRA 4V0LA 3AVWA 4X8OA 3B85A 1HH4A 5KO2A 1WMSA 3UMFA 1RYHA 2ZE8A 2CJWA 1OXTA 3PR1A 1KNQA 4DDVA 2O52A 3FKQA 5A4JA 2JLXA 5JFGA 4Q9JA 2GXQA 1VDZA 4PZLA
chains in the Genus database with same CATH superfamily
3T9AA 3WA7A 1L5QA 5CB0A 4RADA 1M2GA 3OT5A 2NUPA 4EH1A 1VL6A 2CYAA 2IQ5A 3EXAA 3ZIDA 4CGYA 4EG0A 4EHLA 4DT1B 5A7FA 1GZ4A 1K5HA 5T4BA 3W6UA 3MYYA 5ICGA 3T4XA 1LZKA 1XMJA 1TGYA 1ZSYA 2PWBA 1Z33A 4GM4A 2QQGA 4X7MA 1CY4A 1KYVA 2B21A 3DM5A 2ORWA 4G5XA 2GN6A 3JYLA 3LVFO 1SQ6A 3MNFA 4OM7A 5DXJA 5CBPB 4EENA 1PJ4A 1K5GA 1PEDA 2C5FA 3EJ6A 4MUGA 3WP0A 3H8WA 1J9GA 4QODA 2O0JA 1D2MA 4DMKA 5CA1B 3LWZA 3KPJA 3UBMA 3VR4H 3RC2A 4G0YA 3ZHXA 2CXRA 2QT9A 4LDJA 1FIUA 5IW8A 2ZOSA 2R4UA 1FJ2A 2H59A 1AKUA 3D5TA 5FFNA 3SG0A 3AGPA 1YQDA 3IVMA 2JJQA 3UKJA 5LQNA 2HSJA 1P5HA 3H4IA 3L77A 4ZU1X 4EPXA 4BPBA 3OE5A 3C5VA 1IJEA 3LY7A 3GPIA 3G7NA 2FPLA 3BF7A 4U7HA 3JVIA 2XDAA 2VH2A 1DJOA 2OFWA 4IDDA 2O1SA 3JD3A 4HXGA 2AFHB 4JJZA 4CUZA 4EVQA 5KIAA 1P91A 3EXEB 2R7MA 4RNDB 3L5OA 3CE9A 3L8EA 2IY8A 2CHFA 2WVGA 3H9EO 3GLFE 1KQOA 1M2WA 2PUFA 4RDCA 3PUHA 5H7XA 1K7YA 1N9GA 2PLFA 3ZS8A 2QI9C 4HXFB 4BRWA 3AVUA 4Q9KA 3FROA 4JKOA 1TAGA 1U6KA 1RRPA 3NRCA 4ZVKA 1E3LA 3B6ZA 4CKWB 3ZQKA 1BN6A 3DMGA 4WL0A 2X1HA 1N32B 4NBWA 1W9HA 3TOSA 2R7KA 4WNCA 3KXKA 2PLRA 2ZUEA 4OI1A 4RIIA 1T4MA 4XUDA 5I01A 2I3BA 2PDAA 1IY1A 2FETA 2WU8A 3VDQA 4TXHA 1OHHD 4GR5A 4AMZA 1CRZA 2LDXA 1VPLA 3DZGA 1UPTA 2CNLA 4JL5A 2Y93A 4F85A 3O8OA 3QEJA 1M1NA 4YAOA 5JAPA 3W1VA 3JQ8A 4CW7A 1PAUA 4ICIA 1HQYE 4TWJA 1Z4LA 1BQEA 1OY1A 4BMDA 1UK7A 1OFTA 1RQXA 3HHEA 2H2DA 1W5AA 3IHWA 3MAGA 1X80A 2FPSA 3RJMA 4YAIA 4BXOA 1G8MA 4R9UC 2B6NA 1N2BA 1F60A 4MUEA 4AD8A 4U6QA 1UJCA 2JCGA 4HS9A 5IBRA 2YJTD 1GEEA 3RC3A 3X44A 5I9MA 4GE0A 3NTQA 3LHSA 1N5LA 1OYWA 3I3SR 3DLBA 2Z8ZA 2Y0CA 1AMOA 1WA5A 4S1OA 4CM1A 4EUKA 1A7JA 3IKJA 1L3CA 5HF5A 2R1VA 3FPAA 2HN9A 1P2FA 3M6MD 3KOZA 3VNSA 2W6CX 2E89A 3TXXA 2B35A 5IAJA 1WMEA 1U3UA 3EIFA 4ZXFA 1JLLB 1CUSA 1U28C 1VZ3A 1YE5A 1CY2A 2G83A 1R8SA 2WMDA 3EEFA 3KKLA 4II2A 4UBLA 2G5CA 3DVAB 4MR8B 4C0AC 4QPDA 2PIAA 3SE7A 1EIZA 2XYQA 2VHCA 2JFFA 5A03A 1EZ1A 1Z3IX 2QAIA 2PGLA 3GMIA 1RJEA 2VEOA 3BIXA 5CH3A 1BQ3A 2PAAA 3H04A 1ZK0A 5EGSA 3M3HA 1KAEA 1M72A 2CMFA 1T1SA 5HMLA 1J99A 5BWLA 1CUIA 1V8DA 5HTKA 4ALNA 5A4MS 2Q1YA 1SOWA 1XJWA 3S4YA 2AMJA 4DQUA 4UD2A 1UEIA 2MYTA 2AHRA 5FHRA 1K4KA 1MKYA 3EDQA 2VZ8A 3OKFA 1RAEA 2DBQA 5DIFA 2R4QA 3VHXB 4WA7A 2CVOA 4FE3A 1KK0A 3EZ9A 1WDLA 5B53A 4LF7B 2NU6A 4LE0A 1VLVA 3X2EA 2ID7A 1FA9A 1T2DA 4JLDA 5DHAA 2PR7A 3N3AC 4HZUB 4NBTA 3RS9A 2ODTX 4N5NA 2AN4A 3I5UA 1X15A 4MHTA 1FW6A 2CDCA 4JBIA 3NBZC 2D3WA 1N5MA 1QRUA 2Q99A 3K9CA 3R9KA 5BRAA 1CHNA 1SCIA 1M2OB 1W36C 4OIFA 5GJCA 1ONSA 1EUZA 1V1MA 4KQGA 4CMAA 1P3Y1 1E9RA 2PVSA 3QVXA 1BEEA 4H17A 1RJ9A 2HADA 2D1RA 4OTZA 3T95A 1YOBA 1XZPA 3W6NA 1VGVA 2ECPA 2YNMA 4IIDA 3TOXA 3S81A 4PTYA 4KYIB 3ZU2A 1Y6JA 1K6XA 1HK7A 1XEFA 3UAOA 1EDEA 3QU4A 3IULA 3BD6A 4QGHA 4AJ4A 3TXYA 3F67A 4CM9A 3ZQ4A 4F97A 4FMDF 1A5AB 1XWIA 3A8TA 2GF9A 5HIMA 2WHYA 4WY2A 2FMTA 1SHLA 2F17A 5KOJA 2FUG1 2QRVB 3OQMA 1RHMA 3G2NA 3HA5A 3GT4A 1R37A 5DM2A 4DTCA 4WKNA 2IH2A 1VE5A 3NVAA 1ODLA 5C7IO 2ZRQA 4N1AA 1FDTA 2F8SA 2NUAB 1FRQA 4NZYA 2HHLA 1AQJA 4JDUA 5JSQA 4MV8A 3JWGA 5E2AA 1A77A 1YI1A 2PGJA 4AZ3A 1F2VA 3UPUA 1PR1A 3K0KA 2B8WA 3MT7A 2PPLA 4HCJA 4YDRA 5M3BA 3CW8X 1K97A 2WPNA 2ICAA 1A2BA 1B16A 1FVOA 1GUZA 1XPJA 1OA0A 4QG7A 4MQMA 2CFOA 1SCAA 1OBOA 2JLSA 4P80A 1S8AA 2RGWA 5AK5A 1YT5A 1M5TA 4ZAFA 5JQWA 2J87A 4LWZA 3PWSA 1G8YA 4WY8A 4DWVA 2EG5A 2GPTA 1FSFA 2HBQA 4G5RA 1RWPA 4OAPA 5EIBD 3LZDA 3WLEA 1YBFA 2WTBA 4IHAA 1M7HA 5A4AA 1L4YA 3F6EX 3N7UA 3OJLA 1S02A 1UZUA 1P4SA 2CK3A 2OWDA 3HVUA 4DZZA 4E4TA 4BFWA 4HVAA 4PC7A 1UAAA 3V34A 4GPIB 2V6GA 3BC1A 2JEYA 3D6MA 4MMXB 2YFKA 4DR3B 1U3CA 2AOUA 2ZSKA 2FB9A 3BD8A 2W98A 3QP9A 3BDVA 3RIEA 5KTOA 4UM8B 5LM3A 1LI7A 1QV6A 2D7JA 1NLFA 4C1NA 4TQUS 3SJ7A 5FBQB 1MZVA 2A5YB 2NSYA 1PT5A 2FV8A 3UAYA 3F3YA 2REXB 4MUKA 4HNUA 1WUTA 4YCNA 2AXPA 3L7CA 1CJBA 1FFYA 2G88A 3LHDA 2QTVA 4K28A 1VJDA 2F90A 5LXTB 1OIVA 4HDSB 1WMAA 4BAGA 1NU8A 2DT8A 1FUIA 2JFHA 2NYRA 2WUDA 3THOA 2G17A 1JHZA 1FMCA 1MRNA 3AFNA 4TT3D 1O9BA 2N42A 4BLPA 2ODAA 3MWDB 3FHJA 4PYKA 3KSZO 1OCEA 3E1GA 2VSYA 4L0CA 2WABA 4O8ZA 4CODB 4AUMA 3SYMA 3IEUA 1YR7A 4K9PA 3P9YA 2B8EA 3M1LA 5K20A 6ABPA 5IC4A 5E2BA 1E4OA 4YAWA 2YVUA 3CF0A 3M6UA 1VKZA 4L5YA 4G0QA 2FWAA 5DJ5A 1AKMA 1SCQA 3EEYA 2O19A 2ANCA 3ETHA 2XT6A 4H9GA 1E92A 2C2YA 2W11A 3BL6A 4JVSB 3PFNA 1IEQA 2QW8A 1BW9B 3STHA 2YR0A 3KM0A 1I30A 1ONNA 4HYTA 4X1YA 1NBAA 4V0RA 3VC3A 1J23A 4PZCA 1M0WA 1MO3A 5ARDA 1KEKA 1IZ0A 3F6BX 4UDOA 2V5AA 4NENA 4YUWA 1PNVA 3ZBUA 4XQGA 1L6RA 1WVGA 2PS9A 2XJ4A 4NH4A 4DDKA 4E12A 1L5RA 5K8JB 1V6AA 3KWMA 3L0YA 2UXCB 1ID1A 3DEJA 4D92A 4MO9A 5A04A 3O5AA 1K6IA 2RHOA 3UIEA 3OKCA 4MYUA 3AETB 1JRLA 1NF3A 4YV0A 1AGYA 2W4MA 4Y2UA 1OI2A 1N6RA 2RIPA 3KSMA 1PQWA 3A11A 3IELA 3MPOA 5AKXA 1Z4IA 2XMDA 3ZHUA 1HMYA 3L05A 5IRCD 3HPRA 1CUFA 4O3MA 1Z5GA 2DLDA 4BYGA 2R47A 1YQTA 2C83A 5DBIA 3H6HA 4EDHA 4YN3A 1LJUA 1PR9A 1XVVA 5JJBA 3L0IB 3CSSA 4NQZA 4FMCB 1UDAA 1HF3A 2B1IA 2J07A 3LCUA 3QXXA 5A5FA 3CBGA 3F8SA 1PT9A 1V7ZA 2FMHA 2RHDA 3VJKA 2YZKA 2PZGA 4R9NA 2PXHA 5MN4A 1RPZA 5AJHA 5EJAA 2PFSA 1SN7A 4IXMA 1CUXA 1FTGA 2JGIA 2R6DA 1SU8A 1GZVA 4IY1A 4LBWA 4UEQA 1C0EA 4QXMA 4CMEC 5EOVA 2VHXA 3QKTA 3C3YA 1W8DA 4RKRA 3DLIA 5IT4A 4D8YA 4B4WA 1DEOA 1QF7A 2BJHA 3MWFA 3OEHA 2Q5CA 3EASA 3ONWA 3KD3A 4YROA 3SLGA 4MJ3A 5L4SA 2QJRA 1DAKA 1OV6A 2VK2A 4B3MB 3MTEA 2ZRDA 2QTZA 3K4HA 2KYRA 1GTVA 2HDOA 4XCQA 2GTIA 3HCEA 1MVOA 1ZRHA 4Y2SA 4OSOA 2AJ8A 4P3XA 4CRWB 1JALA 3UJBA 4EEZA 3G2MA 4BP8A 4ZYLA 1QNFA 2OFXA 4CKXA 3USCS 1DPFA 4UQLA 3CINA 3PF9A 5G53C 4MUHA 4L2IB 1DWQA 2IYWA 3A9VA 2HPHA 2RGAA 1HEIA 2P2CA 4HBZA 1CR6A 3CNOA 3TM4A 1UJ6A 4Z86A 3LBAA 1WOMA 2EJCA 2EF1A 3F4BA 3RFXA 1OLUA 2HK9A 2C00A 3G5UA 1ZNXA 3OD5A 1FXSA 1T4CA 4CMCA 3MINB 2WWTA 4X8MA 5FV7A 1G55A 5BYKA 1WCV1 4RIHA 3ADBA 1RYYA 5JCOC 5EUBA 1W2GA 2NPIA 3KR1A 2EX1A 4GI5A 3G88A 2XUGA 1VIMA 2R86A 2REQB 2YVKA 4JEUA 1IEVA 1K86A 2VDVE 3L0BA 3RSHA 3T7JA 3U09A 1S7GA 3PNBA 1K4YA 3CUKA 3HCBA 3HFGA 5H5JA 4EGFA 1RU3A 5BOVA 5AIBA 2WIFA 1T4BA 4MIOA 3CVYA 4NXMB 2H3HA 1HE2A 1E6MA 1BJRE 1DDOA 1OT5A 1Y42X 1RJWA 5DB4A 3UQYS 4DPLA 4LF8B 2KMLA 2C5AA 3ISTA 1BW9A 4U4AA 2DSNA 1L3IA 5DNWA 1M1YB 4OKSA 4TVKA 3TGLA 4TYYA 4OI2A 1GPUA 5E1MA 5DX0A 5EYPA 1NVVR 3RARA 1WCWA 1LDYA 3VO1A 4NKRA 1TIBA 1NL3A 1PR4A 1U1CA 4TLCA 5AT1A 3USES 5HFJA 3ZC3A 3ICQB 1W19A 2O1EA 2H0QA 3FRIA 4M6WB 1XQWA 2HGZA 3M3DA 3UFXA 5DSTA 3NFRA 4LFCB 1P1CA 5D85A 1ZBQA 3F47A 1KFKB 4Z9YA 1L8XA 3QKIA 2QN8A 2HH9A 1ORTA 1OXVA 1VE6A 1PFYA 5JNUA 3ZDAA 3L8MA 4G1FA 4OQXA 3A1CA 4L8FA 3ZE8A 3G8AA 1JU9A 3A3NA 2IOFA 3ISJA 3FPFA 3QG1A 1RIFA 4HGZA 4OXIA 4R5MA 5J5VA 3JVUA 4EYKA 5HQ3A 3DD5A 1MDFA 4UCWA 2VJMA 5TRTA 4O2BF 5FNVF 4DLUA 5EP3A 2ZSFA 1G2IA 3MTDA 4NSNA 3WO1A 2BZGA 1KS2A 5AW6A 4NK5A 3FG9A 1VCHA 4N9QA 5C34B 1SWVA 1II8A 3CLRD 3QVWA 3EEQA 4MVJD 1D03A 3S2YA 3HUFA 3QMWA 1CJCA 2GCNA 2QAJA 4V0SA 3X1WA 4YR7A 9ABPA 3T7DA 2I33A 4Z4HA 4L4UA 2OHGA 2ZU6A 1JBKA 3VH3A 4WBSA 4TUYA 1Q19A 1X7ZB 4QJBA 2VQ3A 3FZQA 3TEMA 2D1FA 2UUBB 5BSFA 3C24A 1K3TA 1KU0A 3O8QA 2CXSA 2IX9A 4JGGA 3IVGA 1Q95A 1JTEA 3J81k 1CZOA 1XFAA 2VBFA 4FJ0A 4ZEMA 4Q16A 1CE8B 4L08A 4NEQA 1FDRA 1HNZB 2UYOA 5H68A 1LNZA 1X92A 2DKNA 1Z4NA 4BN0A 1RXCA 1X1QA 3DBHA 2C0PA 2BGUA 4CM4B 5JNTA 1JEDA 1BVUA 4DV3B 4AB1A 1Z08A 1NV9A 1WQ4A 1Y5IA 4KI0A 3UMVA 2C77A 2ZZNA 1PI3A 3CX6A 2XQVA 2F43A 2QI9F 5A0TA 4I1SA 2XVXA 4YP1A 1JG7A 1XP5A 2OWEA 4F7DA 4P53A 3OOSA 1NN3A 2IYOA 1RIIA 1Y4UA 1T8PA 4FGZA 1BWSA 4IZOA 5HCUA 4AMGA 5AUPB 4DM4A 4I5GA 2EHDA 1ZXLA 1GNLA 3AHFA 4NMHA 2WICA 4H4DA 3ASYA 5CXSA 3HP4A 2FOXA 3E9ZA 3WS7A 3Q1LA 1EBUA 2IUEA 4LXHA 4ZTZB 4P4UA 5F51A 4YFVA 4Q3CA 3H3FA 2Z3VA 4J4TA 3GLGB 3UUWA 4B35A 4H77A 5BWCA 4MLDA 4C7KA 4BRSA 5EIEA 3LXUX 4UM9B 2J3EA 4XCXA 1WKCA 1RACA 2D0DA 3W3ZB 5IVPA 3GMSA 3PQFA 2XYVA 5FL3A 3R7DA 1Z6XA 2A0XA 4JBNA 4JQYA 1GFSA 4BQOA 3OQ1A 4GKVA 2XCUA 1QQ6A 3DVRX 4QYMA 2FRXA 4ODIA 2JA1A 4FINA 3R5KA 3FWNA 1H65A 4RY9A 3WMFA 2BHSA 3QKSA 4DLLA 2Q28A 1WUKS 4KP7A 3DE5X 1PJ8A 1EFCA 4X20A 1COWD 3AR2A 3EPRA 1JZQA 4Q1FA 4ARAA 1IBSA 3L8GA 1IY8A 2OQ2A 2Z3ZA 3P71T 4MGYR 4MQUA 1LF0A 4MVWA 2JKVA 4N6GA 3EWIA 3TX6A 4R4JA 4E51A 2XGSA 4HVCA 4IF4A 2WUVA 5EUQB 3I3OA 3A4NA 3HCRA 4MCHA 1FU8A 5TS3A 1F06A 3O3NB 4PNEA 3CIOA 4JL8A 2HV9A 2Y66A 4QDJA 3H1EA 3IA7A 3BUSA 4JXXA 1OC4A 3SEFA 2C7VA 1DTWA 3NNDA 4DLBA 4DDTA 1I6WA 1VRVA 3AM5A 3C39A 1UC5B 2XNDA 1UKZA 1NXOA 3AEQA 1LF5A 4S05A 2P7IA 3ZV3A 1SQFA 3HBMA 4PXSA 1P0IA 2O4CA 1R16A 2QA5A 5F7JA 1BYUA 4BBAA 1ZJ4A 4QYXA 3NYIA 3GLSA 4M21A 5BT9A 1GRRA 4FGSA 2O2ZA 5NLLA 1GAEO 3H05A 5DT2A 2ZXUA 1ZVKA 4YP0A 1I2BA 4CKWA 2CLCX 1CUAA 1P7WA 2YHSA 3WK7A 1Z22A 4PAQA 2H18A 5F2OA 5JPIA 4AO6A 2DC1A 3AVPA 4ZT5A 4D9IA 4DZRA 3KQWA 4CLOB 3BA1A 3ZW7A 1WCYA 3FVTA 1VA4A 2QUBA 3BH0A 4UZFA 1U9ZA 2P2NA 2JLRA 3JQ6A 1QU2A 2YV5A 4FP9A 3QOWA 5CA0B 4M8NE 3FE2A 1NYQA 3IO3A 4UNSA 5DLDA 2FW1A 4G0XA 4YJ3B 5KC9A 5IAGA 5I9IA 4MINA 1KVSA 4J49A 2VPXA 2KB0A 3EMBA 3O8CA 1W2HA 1JDPA 2N1BA 3P9NA 3QEKA 5E3HA 2RK4A 1BGWA 3TVDA 4XIJA 4BO7A 3L18A 3N76A 3PI7A 2VH1A 2Y1FA 3MOIA 4GUAA 2GNAA 1BGVA 3INYA 3LJKA 3ZI4A 5JADA 2E3JA 1TK3A 4JX9A 4NV1A 1WD5A 2VVTA 3A9SA 4MMYB 5CLLA 3TEFA 4B71A 1AF4A 4A8JA 4OHKA 1GPDG 5TQ0B 1TYEB 3HB0A 1HV8A 1L4LA 2C9CA 3PPYA 1XMSA 3STUA 3W04A 1SHKA 2FZGA 2GD2A 3P27A 2J0SA 2WM8A 2WT8A 4YAEA 3I04M 1S3SA 2NO0A 4LHSA 4MVJI 3SIXA 4BO8A 3UC9A 1Z6GA 3MTGA 3ICCA 4KK4A 3OA0A 3V2IA 4AYTA 4H60A 2FWIA 3FCOA 1EH5A 3ZV4A 3VGJA 4F0JA 2A0FA 4I50B 4FB5A 1CZRA 4JC8A 1G5HA 4Z9FA 4K86A 2D2FA 5TIIA 3CWCA 3OC6A 1WABA 3GIDA 3SZRA 1PE0A 4ZIRA 2YXBA 3EUAA 4MVJM 2EW2A 4JP3A 5L4LA 3UMMA 3MVEA 2MSDB 5H16A 2OCAA 2DF8A 5DX1A 3A4LA 1BTOA 1BXGB 1ZI9A 2VRWA 3LQ4A 1XTUA 2V7GA 2W4QA 3LQ1A 1F51E 1V11A 3QLTA 1LU9A 5T8KA 4JI0B 4C4AA 4IO0A 2XUOA 3NYWA 1E5LA 2NVOA 4L95C 2CUZA 2HJSA 2ZYUX 3FH0A 4XM1A 4BGUA 4D97A 4FCTA 2R8EA 2AJCA 2QL7A 5HJEA 1B0AA 2FMUA 3TTXA 1M8KA 2CCJA 4A3SA 1XZEA 4UNPA 2EEPA 1IDN1 1U7ZA 1UXIA 3BORA 3QVLA 3ZY6A 2EDCA 3ITEA 2J7KA 4XSGA 3DUWA 2MSKA 1YTLA 1XZDA 1PZEA 1U04A 4ZU6X 1KYYA 3CM0A 1SXJC 3KFVA 5J43A 4JXZA 1QFZA 3KHUA 5AJZA 3WDLA 1T0UA 3EF0A 3N1UA 1DT3A 1JAHA 3EJWA 2IKQA 2XQGA 3EA0A 5DBEX 1JG6A 3TKLA 3AK4A 1J8DA 1SH7A 1HLFA 1MEEA 3HRHA 4D4LA 2UZ1B 1SEVA 3A4MA 2MSCB 3ESXA 4E2WA 4OB8A 4ACAA 1ADGA 1REQA 3S28A 2CE7A 2J0QA 3K53A 5JCPA 1L7AA 4AECA 4O59O 3ZV6A 3HEAA 5BVGB 2DQ4A 5JARA 4RA6A 3C16C 5ISMA 2FZWA 3A06A 1BROA 4FPXA 5CT9A 1DU4A 1XV5A 2VDWB 3LC2O 4CR7A 2HPAA 2AOTA 3ND7A 1DKUA 2JFWA 4NL4H 3SQNA 5CA1A 1GYQA 2HSWA 2BR4A 5LOVB 3IBGA 3OTGA 1I2ZA 1SCUB 3OZBA 5JS8A 5JYCA 2CL0X 1OWLA 2YXNA 3PZRA 1T2NA 5CA0A 1C8LA 1QZTA 2BJWA 3GJ5A 2ZKLA 1IPHA 1U1DA 1L2TA 1Q0SA 2BMEA 2V7WA 1RNLA 2QVBA 2WFAA 1KDOA 3MUOA 3NANA 4I19A 3PENA 4J2TA 1UL1X 3DBRA 4OBWA 2AZ4A 5FYQA 2FXVA 3PUYA 3N8GA 5AOAA 2O0HA 3F7MA 2PN1A 2X4DA 1QHIA 4FDTA 4DUZB 4G2NA 2FWNA 2KE5A 3AY0A 1MNAA 4MKIA 1P4JA 2QRHA 1UBKS 3MJEA 4W1PA 3VJLA 3X2SA 4AZWA 5AUNB 1KBZA 3K6SB 2X8AA 1JIUA 2H2AA 3KOWA 4HUJA 4UOEA 1ZCFA 1JEQB 1DKMA 2SECE 1N9GB 3LG2A 3QVTA 5ANRB 3E7XA 4HGPA 3LBHA 4OHUA 3C7KA 2VF7A 1V0JA 3MT8A 1JJAA 5J4VA 3LUFA 1MO6A 1TYAE 4H7KA 4Q1VA 5LYJF 4I5FA 4XFJA 3TG2A 1XO1A 2W6IA 4R9RA 4WKBA 2H2HA 4LHVA 1JJBA 3I1JA 3AFMA 4NU0A 1CP2A 1EFRA 1G9TA 1Y1RA 3BD9A 3D7KA 2J0UA 4GR4A 4HLQB 4LFAB 2D0PB 1QNLA 1Q0RA 4G36A 4ONEA 3NOOA 2WE8A 1T2EA 3BE6A 4Q6BA 5B6IA 2A5DA 2VFAA 3DW1X 2G70A 3T1QA 5K0CA 5MFZA 2Z2ZA 5CMLA 4ZO9A 3VMFA 5IM5A 2MINB 3FDFA 3B3QA 3JQAB 4WXRA 3CG4A 1S8FA 1MR3F 3BSYA 1GO2A 3R6DA 2A78A 2OFPA 3JQFC 4W5RA 1WY5A 4DLYA 1TMKA 5B3LA 3T1NA 2WF5A 2MMCA 2MYNA 3C74A 4R7ZA 2C1XA 1N78A 1C50A 3STVA 4NC9A 1EE1A 5H3HA 3WQHA 3JR3A 1I4WA 4D02A 4P54A 5E1BA 2WM2A 4B4UA 5TARA 2UZIR 1TKRA 2DTEA 5EI5A 3TNDA 2XOKA 3MSXA 4B3IA 5REQA 3JAWB 4RPGA 3ZUGA 4DR7B 1RR6A 5KYGA 7AT1A 2W0MA 3C3BA 1CWUA 1BZYA 1Q1NA 1USWA 2BP7A 2GASA 4RGVA 2C07A 3SLKA 1RBZA 2BH2A 5CURA 2VOJA 3H13A 1NRIA 4HRVA 5C3MA 3GUVA 3RVMA 3OPMA 3PQ2A 1T36A 3L7MA 4DCUA 4NX2A 3GH1A 4L9AA 2DETA 3D6AA 3JD2A 1P44A 1QV7A 5DEOA 1MO4A 2KI5A 4B33A 1TVMA 2ZCVA 3CNHA 3IXLA 1TQ2A 1XL1A 1JQ3A 2JJ2D 1TT5B 2YFYA 5E6UB 3UFXB 1B8PA 4AQDA 3A9TA 1GQQA 4QTZA 3W7BA 2JRCA 4A73A 5BR1A 2LZ0A 5AVYA 3NJ4A 2ISQA 4HFJA 4RQAA 5CT5A 2HEGA 2PKWA 5GJBA 1PNQA 4XDZA 3TW8B 4GG1A 4K40A 3ENKA 2O8BB 1SULA 5ULLA 4UHDA 1LK0A 1ZUWA 5IPFA 1YBMA 1B8UA 4Z53A 4D96A 3AHIA 1AZTA 1LVHA 3MD0A 4OJNA 2VBCA 3QM1A 3RF6A 1LXCA 1CUZA 3G2KA 5JPDA 2BVNA 4HN4B 4J43A 2E4VA 4OB7A 2OCLA 3VC7A 2UV8A 3M1AA 4Y18A 2YL2A 3S8YA 1XZHA 4Y1GA 2PVPA 4BMNA 1Z4OA 3VZCA 1PG0A 4RCYA 2IPLA 3AOEA 3C1TA 5FADA 4C4RA 1DZIA 1K6JA 2WBLC 3GJXC 4V03A 4ER0A 3UH1A 3G5AA 5DGTA 1C30B 2FW7A 1Q83A 3VFDA 3ENZA 1AQNA 4MTCA 1ZGZA 4R54A 2IP1A 1TU0A 5CX1A 3DAFA 3PNSA 5FPHA 1YTUA 3G1UA 2W2QA 4XVRA 3H83A 1YDFA 2G9NA 4EBBA 5GOTA 1HDXA 4YRGA 4ID3A 1P5RA 4BX9A 5CLQA 1YB1A 3C43A 2Q9UA 3CR7A 3E7FA 4B45A 4B4OA 4CG0A 1I9GA 2XUHA 2C4HA 1N2CE 1PL0A 2POQX 4TS4A 3I6MA 3C0KA 3LPLA 4MWZA 3WK8A 2J9FB 3AU9A 4HDAA 4F3TA 4J1TC 3LDHA 4Q4AA 5TV2A 3NJRA 2HMVA 1E1RA 3REQB 5KNBH 1FU7A 2PBRA 5CDTA 2R5WA 4QOEA 2ZEJA 1J1UA 3M4NA 1ISPA 4LGMA 1FXUA 2AKYA 1Q21A 1XLWA 3NTOA 4NAHA 4FJ1A 1XVIA 3GA5A 4U00A 2ZIGA 1C4XA 2Q3BA 1TPYA 3QEMB 4K9MA 2OOSA 3PGKA 4WLNA 1RWKA 1N6KA 4TMFA 1E6KA 4I0WB 4INZA 1BEZA 4JBHA 5JR3A 2JFXA 3FHTA 2QK4A 1GNRA 1WAMA 4GOXA 4HGRA 1NW8A 5EHZA 3HY4A 1O08A 4IIHA 1T3HA 1T26A 3VM6A 2Q41A 1F2UB 4MOWA 2WG1A 3F7OA 2N9UA 3W4KA 2YYAA 3B3AA 3ZNOA 2RH9B 1DX9A 4LOHA 1P2TA 1TD1A 1TJ3A 3LF1A 1T8YA 1LNSA 3INRA 1QFYA 4L22A 5KDOA 3INTA 1C5KA 2IHZA 3E15A 3RBXA 4QXRA 4LJ7A 3ZE7A 3ZZ0A 5J2UF 2HA7A 1UWKA 1KRHA 4BVBA 4RKWA 1E60A 1O5TA 3GLFB 2NPOA 4HLUC 3K2QA 4CF5A 4Z4FA 3PEUA 3ILHA 4PLVA 1OC2A 2G7MC 2QPTA 4Q1DA 3V4LA 2D7DA 4UDXX 4BB9A 2WJVA 4W1RA 1GQYA 3RUIA 3WLNA 4QTUB 1VLLA 4RK6A 1IHYA 1U8UA 1WMDA 1WB6A 2Q8QA 4UCQA 5C5DA 5CVTA 1GOTA 3EG9A 5FUMA 1SR8A 3R3VA 4P5EA 3T5DA 4WKPA 3K70D 1HKHA 5ECWA 1UJ5A 1W5EA 1Z38A 4J75A 5SZHB 1F2DA 3RIGA 3KETA 1Y8RB 3UKDA 4OXKA 1N34B 3PFCA 4FMDB 3HDJA 1ULHA 4O4JB 4LZZA 4G4IA 4I3GA 3OPNA 2X4LA 5FNVA 5K0GA 4C5AA 5IBPA 1XZFA 4EJ6A 2PRJA 3IBFA 3U3DA 1VGRA 1WDTA 3HU1A 4KXMA 1I7LA 4DUGD 1MMFB 1Y7IA 3P8ZA 4HD8A 4Z4QA 4A16A 3ZBTA 1T9CA 3V8RA 3VR0A 1IZ7A 2XX3A 1XRPA 1NM5C 2BYTA 4CGZA 2IYFA 2FMXA 3CUSA 1QF6A 1IJKA 1TW2A 3FSJX 1KEEA 1U7DA 1ZH2A 3N2EA 4GF5A 1UBEA 4CQLB 5A3QA 3FPSA 2DM6A 2C92A 1TJ5A 2QYSA 4FGUA 2W2LA 4ND1A 1GKLA 1PJ2A 1QGUA 1C9EA 3FOBA 4Q4LA 5GZ1A 1RBYA 1CW2B 2FX2A 3AJAA 4I9NA 2WI8A 4IDBA 2WSSD 4BCCA 4YQFA 5D3ZA 5DCLA 4OGLA 2QM0A 4XB6B 1PNRA 2O2CA 4KNVA 2QVZX 5IHXA 3NT2A 4PQFA 2A2ZA 3OEWA 3CLTD 1G3RA 3BQMB 3SP1A 1IY2A 2V6JA 1AKWA 3KLBA 4ID9A 1SBTA 3Q7QA 4XDHA 4M9RA 1HL7A 3HMQA 4L8VA 4QDZA 4TKLA 1FBNA 1PK9A 4XVHA 5CUQA 4OB6A 1DQPA 2CBZA 4ZEWA 3WRWA 2VK8A 1UDBA 4MR9A 2TMKA 2WNSA 3HXKA 2GHIA 1XUOA 2H4ZA 1IZYA 1E2MA 4D9EA 2J67A 2HIHA 3D1JA 4YIKA 3SSNA 1V9LA 4QWMA 4EHAA 3DT6A 4YXWA 1YB6A 2WWFA 4GS5A 1F8XA 1HGXA 2IWRA 1X1AA 2C98A 2QQ5A 3WMEA 4CM8B 4RJIA 3TB6A 1E2QA 1FVXA 2IYNA 1E4VA 3LDAA 4DDUA 2PPVA 1S89A 3BSFA 2IP4A 4FEEA 3U4QA 5D3KA 3NUGA 1XN4A 2P9FA 1NVMB 3ESZA 2EZ9A 2HJ9A 1DV2A 3SYRA 2AWOA 2VPYA 1JUDA 3N28A 4IJQA 1RAGA 4Q3BA 3U3RA 5KYXA 4K2AA 3CUWA 5GJWC 4JLWA 1YRWA 2OCBA 4MB2A 2PKRA 3RYIA 3L1JA 1FS4A 1ZGHA 3DQQA 4PIMA 4M0DA 4ZVLA 2VCHA 2YZNA 1WBDA 3IIJA 2HRCA 2C4NA 3QWHA 2BHNA 2WFLB 3LQFA 3RS8A 1ICEA 2XRZA 4AM8A 3HYRA 3OZDA 2LKDA 1OXBB 2FFAA 1SQ0A 4IHJA 1MV8A 2VJPA 4UE6A 1RXWA 1S6YA 1NVTA 4BO0A 3LX8A 4XLLA 1M2JA 5DLYA 2K6GA 3U0BA 4FXPA 4MP3A 1TEHA 4Z7NB 2BR3A 4WBNB 1VCMA 3G2IA 4LNAA 2AZTA 5EKDA 2WR8A 1IMJA 3DBVO 2DR3A 1G20A 1R5BA 2GYYA 5JAQA 1QK5A 1J20A 1QCCA 3AUKA 3HWRA 4K9RA 4RHYA 2P9QA 4ZCIA 2DXIA 2M1XA 4F11A 3ZDDA 1E8NA 2EIHA 2YXEA 1DEHA 1M6EX 1W4CA 4H1VA 4ND6A 5T6MA 4EEKA 2ZIAA 3IJEB 1VL8A 2HA4A 1C1XA 1H05A 2DG2A 2O1WA 2WU3A 3OUTA 4PFKA 1JA1A 1ZISA 5T57A 1UDRA 1OPXA 4RH3A 4YRCA 4KXNA 3MJTA 4FLFA 4Q3EA 1C7EA 1T6ZA 3PNVA 1JEQA 4EGCB 5KSYA 1KZ1A 2GI4A 4IOLA 4GWGA 3HBNA 2DR2A 4NR0A 1LJLA 2D54A 4ND2A 5JLJA 2P1ZA 4YRTA 2W6PA 1JHAA 3GRCA 2H4HA 3CW9A 1E2FA 2XE4A 2PCLA 3N07A 1EFVB 3O1JC 2RGXA 3QWAA 4MW1A 4XYGA 3VXKA 5IZ4A 1NDQA 4FN4A 3ZI0A 3HP7A 4MW4A 5EUMA 3OFKA 4QU0A 2DLNA 3ELWA 3TDKA 3PFKA 2IZOA 3BTUA 5D7NA 3TO5A 4N3BA 2NVUA 4HB0A 3V8BA 3DE2X 1RPJA 1TRKA 1XQVA 2IK8A 5K05A 5KTRA 3T7IA 3FCYA 2OMEA 3WI7A 4KWHA 2W70A 3NAMA 1C1YA 5FI3A 1L4NA 1KI8A 1IG3A 4KXVA 3Q88A 2AN3A 2QN2A 3OG9A 3COJA 2FR1A 4XZ3A 2AS0A 3FBGA 1KORA 3VVMA 3JQPA 5KPDA 3NBFA 1C4KA 5H9WA 1H93A 5JI2E 2FPWA 2IXAA 2YTZA 3EA5A 3I53A 2JBAB 2P3OA 2GBGA 3ND5A 4C5CA 3E9EA 4S2EA 1N7GA 1P9LA 2RGNC 1V4VA 2CBGA 2Z09A 4HOYA 4M53A 4W9RA 3NI2A 2HCBA 3A4YA 3M6VA 2O2JA 3QLVA 3VI4B 2H48A 3T99A 1QU3A 2V3WA 3GDWA 5EINA 2AQKA 4D4KA 3CCBA 1ID8A 1JXQA 1SPBS 4B0PA 4RFVA 4KQ2A 4EVSA 1H0SA 2BHRA 5AI5A 1Z75A 5J40A 2AMLA 3KOMA 2XBMA 4JI8B 4Y6SA 3GWZA 1T9BA 3AP2A 4TQ9A 4AJKA 1N5IA 1ENPA 4KWTA 3NHPA 3OM8A 2X23A 5G0TA 1C3EA 2C78A 2P9ZA 1UMCA 3C7DB 4RA9B 1JHRA 2E6KA 1W73A 3CRMA 5FO0A 1GTMA 1B0PA 1X38A 4YJFA 1W581 3H8VA 3R5FA 4MAAA 2C8VA 1OFGA 2YY7A 1GG9A 3P9PA 1C0LA 4TLEA 4XKJA 1U90A 3AEYA 4Y7DA 5LU9A 3SSAA 3TPFA 4D9KA 1ST3A 5IWAB 1RAFA 4IYJA 1VM6A 1QIFA 3JYNA 3ELBA 1G8FA 4JZKA 4RPJA 2IPNA 3SZ3A 4PLCA 1W59A 3MWEA 4EA8A 5BP7A 1G7TA 4QRDA 1NI3A 4HC4A 2G28A 4YO7A 5TQJA 3A1VA 3FNRA 1AN0A 1JEAA 3GUUA 1HOXA 3D7RA 3V8MA 4DMUB 2VKTA 5BSKA 3G0DA 3GFOA 4BO3A 1KAOA 1KFBB 2F2TA 3KU1A 3RG8A 1O03A 3ET4A 2D5LA 2XYGA 3CT6A 3ANXA 1V71A 3DR5A 4MVJP 2OO7A 5GVRA 2FPPA 1GR0A 1EAMA 2J09A 4MDHA 4ZOCA 1M34E 1B6GA 1E5XA 1IOWA 2JGEA 1Y6GA 2YHIB 4CQNA 1RRVA 3MD9A 5EXTA 3ZHRA 4PFJA 3FPHA 1ARZA 3LXRA 3U48A 4DA7A 4CG2A 1D6NA 2DWCA 4MNTA 2GBPA 5HBGA 3T5CA 5EJ9A 1SUFA 1XNGA 2P11A 1BDHA 2VP5A 2PUJA 2WZDA 2XMBA 2QTGA 3LHKA 5DK6A 3T7AA 3TTWA 5B1YA 1G6OA 1I5EA 1EP9A 3KTOA 4WOKA 3UBTA 1X7XB 2NXCA 2VDWA 4YRAA 1PLKA 3IBCA 1IH8A 3F6SA 5HKKD 1ZWLA 3KT8A 2YICA 3DCYA