4RFSB

Structure of a pantothenate energy coupling factor transporter
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
b'ENIISVDHLTYQYDENQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA2
publication title Structure of a pantothenate transporter and implications for ECF module sharing and energy coupling of group II ECF transporters.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
total genus 72
structure length 275
sequence length 275
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rfsB00
4C0HA 1NI3A 5JCZA 1GP2A 4JLPA 4F92B 3MGCA 4PXAA 4Q19A 1DAFA 4DSOA 4M0LA 1OFTA 1BMFA 2GRJA 2ZSFA 3OFNA 3FHTA 1Q20A 2REXB 3U6BA 4LV5B 1XZPA 1NN3A 2XZLA 2FMXA 4Q1FA 3GMTA 3WMEA 2Q3FA 1M6NA 2D4HA 1TU4A 3QF4B 4AWXA 2HF8A 4HYYA 4HZUB 4PC6A 3OE7A 5FR2A 1LW7A 2ZRIA 1E2FA 2ZS7A 4Q4LA 3QXCA 3OESA 1VYTA 5KDLA 3O8RA 2CEAA 3KB1A 4RD2A 1XEWY 1KI3A 3B5JA 1G18A 4JBYA 1VYVA 4HLCA 4X8MA 1AKYA 3QXSA 1A1VA 1PUIA 2CVFA 3DVLA 3TLXA 3PEUA 1XDBA 4KYIB 4Q4JB 1GFIA 4RD0A 4UXIA 1W36B 1ODFA 1XB2A 2GZDA 2VTKA 1JALA 2C9OA 3NBFA 3SZRA 3TKLA 3NG1A 521PA 1VTKA 4PHTA 3ZS9A 1P9NA 4FMBB 1UDXA 3I8SA 4HLUC 1UJ2A 5KDDA 1GVNB 3H1TA 4Q5IA 2XGJA 1RPZA 2BC9A 3KJEA 4D0GA 5CDFA 4C0AC 3IPYA 4CF7A 1T6NA 2AWNA 3QXXA 4DDTA 1OSNA 3CX6A 4YMVA 3AVTA 1E96A 3VAAA 2ERXA 2J46A 2Z0MA 3M1IA 4W5WA 3U60B 1KKLA 1ZW6A 4C4PA 4RD3A 5JRJA 3GLGB 1OKKD 1MV5A 4PO8A 5DSZA 2RCNA 2MMCA 5JEDA 4TQAA 4ZKDA 3GEHA 2WJIA 1D9ZA 2FPMA 4Y0AA 3RHFA 2QY9A 2NMVA 1HQYE 5FBQB 4JS0A 4B3CA 2B21A 1XJCA 2XOKD 2ZJ2A 3FHOA 3R7WA 1E0AA 3BBPA 2IYXA 2ZJAA 2BM1A 2WAXA 3DDCA 2VQSA 5CM8B 1G16A 3ZZTA 1FX0B 1P60A 1N6OA 4B6FA 1YZUA 2RGNC 2Q6TA 2XITA 1ZAKA 3W5IA 1XPRA 4BUJA 4P31A 3U44B 3REGA 4BFUA 5FI0B 2GXSA 3TSWA 3VMFA 5ELXA 2EQBA 2W2XA 3RSLA 1U98A 1MO5A 2IT1A 3DKPA 3P4XA 3RLFA 2JLWA 3OIUA 4U00A 3QEOA 3HJNA 1LY1A 4NDZA 1ANKA 5KSZA 1KNQA 1XMJA 2JJ2D 2QU8A 3QENA 1U2RA 4QBIA 4RZ2A 2IS2A 2X19A 5HCNA 4TQUS 1JI0A 1XTSA 4QGGA 1QRAA 3U5ZB 3EZ7A 4BZPA 3A1UA 1ZM3A 1LV7A 2ASEA 1JR3D 1NSFA 1S9DA 3GEEA 2GESA 2QQEA 3VNVA 1W4AA 1SVWA 3BB3A 2VP4A 1WP9A 3NEJA 4P33A 4OQLA 4P4SA 3J81k 3A8TA 2QP9X 2REBA 2CK3D 2OE2A 5JJLA 3SHFA 4TSFA 4B2PA 4DSUA 1XXHB 1YKSA 1WXQA 2ZS9A 4P32A 4AYWA 1ZIPA 3EX7C 1G7SA 5CK5A 2QGZA 3X1DA 1E94E 4TLBA 5LBIA 3QVVA 3L0PA 4XWOA 2DB3A 4TLEA 3K9NA 2W6IA 5FPSA 3CPEA 2VPPA 4HLUA 421PA 4F7WA 1Z0KA 4F91B 1I4DD 3LVRE 5JJIA 4BLTA 2JA1A 1M7BA 3IPXA 4V0KA 5E4FA 2JIZD 5FR1A 1Q1ZA 4TT3A 3AP3A 4B32A 1GL7A 2AL7A 3F8TA 4OI4A 1N6LA 4TYPA 5FTJA 1RRGA 4TL6A 1QHHB 2WJHA 2L0XA 2Q0HA 1XTQA 1GL9B 3A6PC 2FU5C 1Z6GA 4DCVA 1MOZA 2Q9BA 4HZIA 5IHPA 4KU4A 4HDCA 2WIBA 2FSHA 4CIDA 1XMVA 4Q1DA 3EXAA 2QT1A 1J8MF 1GDDA 1U8YA 1YHNA 4XD7D 1U8AA 2ZYTX 2WWXA 3EIHA 1D8TA 4C0KA 1KZ7B 1QG4A 2BWJA 2BV3A 2F43A 4PSVA 3SJZA 1YZGA 2NGRA 2FX3A 2RGNA 4PZZA 5HZHA 1XEFA 2A78A 4R98A 2XTZA 5TB5A 3AKYA 5FBRB 2QM7A 3OAAD 5B2ZA 1DG3A 4B3BA 1XEXB 2F1HA 2HLDA 3Q5EA 4G5SA 2QM8A 3HR7A 2CMKA 2O0JA 4QNRA 2RGGA 3VFDA 1Z06A 5FOUA 4Q48A 4JSTA 2FOLA 5J4VA 2HF9A 1NN1A 4MGYR 2PLRA 3BOSA 1FX0A 3AKCA 1EFHA 4Q1EA 1YZNA 1E0JA 1NMXA 1HV8A 3AF1A 3B8HA 4M1OA 5DI9A 5EXTA 3U44A 1HYQA 3K70D 3EAQA 3LXRA 1H65A 1LNZA 2A5GA 3K0AB 3ONWA 4Z1MD 1R8SA 2CE7A 2HYDA 1E2QA 4EPYA 2IYVA 3U3MA 2PT5A 2XXAA 3CB4A 2G1JA 4RY2A 3L8YA 5A5GA 5G53C 1DBSA 1F6BA 2QRZA 5DNYB 1G4AE 3RDPA 3EIQA 4TTPA 2ORWA 5DHAA 4W7SA 4PQFA 1AA9A 2OBLA 5H70A 1S1CA 5FBVB 4GFDA 1RYFA 4Q47A 4IDOA 3WY9A 2ANBA 4NYJQ 2F9MA 4US2R 1Z08A 2VP6A 1N6IA 4XJXA 3U2QA 3OEEA 2YINC 3VTKA 2FEMA 1P9WA 2RHDA 1E79D 1G7RA 2W83A 1GNPA 2ZQ5A 2P65A 4ZPXA 1BYIA 4N0EA 3AVUA 5DO9A 4N0DA 2GNOA 2WWWA 3U7GA 1X8LA 2NO0A 4L8GA 2ODEA 3I92A 1E1RD 1KAOA 5A0FA 4C3ZA 1R5BA 4NL4H 2WM9B 1UBCA 2EFHB 2FSGA 4L5BA 1E2GA 5FUVA 2HV8A 1MO6A 1EFRD 1XJQA 2JDIA 2VP5A 2ZRCA 4XWAA 1Z6XA 1HEIA 5AUQA 1XD9A 3TJZA 3X1ZA 2B6HA 2BEKA 3HWSA 3T1VA 2ZI6A 1II9A 1UKEA 2IYZA 4BWYA 1N6HA 2AN9A 1VKJA 3SC3A 3EG5A 3CH5A 4FWIB 4J0QA 1I2MA 1KGDA 2JASA 2NO1A 3IIJA 2PX3A 4OK6A 4OI1A 4ACAA 2ZE7A 2V1XA 1NJGA 4EQ6B 3ICQB 2IF0A 3TRFA 4KSBA 2KJQA 3AEZA 3IHWA 4MUBA 3A1WA 2XOKA 1JJVA 1B23P 4AIIA 1UEJA 2FZLA 1ZCBA 3TW8B 4BFSA 5LD2B 3MJHA 1J7KA 3Q5DA 4BLSA 4B3DA 1UF9A 5P21A 3L0SA 3RRYA 3UG6A 3K70B 3K0SA 3GLIA 5EP1A 3TR5A 1QHSA 1U8ZA 4A0GA 5KPDA 1D5CA 1OJLA 1ZUNB 2D2EA 2ZRPA 1R5NA 1OLOA 2ZSAA 3CR8A 4URVR 2J0QA 4JBXA 3AH8A 3NBYC 2FPKA 3IBYA 4QJ3A 4YXWD 4WA7A 1NLZA 1ONBA 4FD2A 4LBWA 1VG0B 3B1WA 3FKQA 3P32A 4UXJA 1SXJC 1UDWA 2V6JA 2GCOB 3WYAA 3H4MA 4RZXA 3RYTC 4DLYA 3LX8A 1Z6AA 3KKPA 1JR3A 5DISB 3EA0A 4JVMA 5KNDA 3CONA 1OIXA 1NF3A 3NH9A 2ZXUA 1G21E 3GD7A 3KKQA 2XZOA 1DTSA 4LOAA 3O8DA 1AZTA 1GRNA 2UZIR 1NLFA 1P61B 2DHRA 1KI2A 5FBLB 4JMPA 2CK3A 2HCBA 1Z3IX 3C14C 4JLOA 4KHZA 4LUCA 2RGXA 5AUPB 3W6PA 4XVUA 2H57A 3GFOA 3AVVA 4AYXA 5CYOA 1TUIA 3CWQA 3V4RA 3QXJA 1G3QA 4QRHA 1DEKA 4LHXA 1EESA 2DFKB 2ECKA 1V5WA 4UXHA 4FCWA 5L3QA 3QKTA 3EPJA 1WBDA 1S9HA 3SDZA 1K8RA 1W0JD 1Z29A 3B9QA 4NPHA 2QBYB 4BFTA 3JVVA 5FPTA 3U4QB 1KSGA 2J45A 3T15A 5H8WA 2OCAA 3E5HA 4PHGA 4RD1A 3VR5A 2F6RA 1GWNA 3DO6A 4LV6A 5EP4A 4P3YA 3TSOA 2ZI4A 4DVGA 4XOIA 1II8B 4DLSA 3AVQA 3QPVA 4HUQB 1TL7C 1YR8A 2RMKA 3ZVLA 1N6KA 4Z8XA 1JJ7A 2V54A 4GPTA 2FZ4A 4R2IA 5FPHA 2DPXA 2P2LA 5EQTA 1K6MA 2IEYA 3CUEF 1KHTA 4L4UA 4Q1AA 4D81A 1F2TB 2EU8A 3B7GA 4Q01A 1GIAA 1KY2A 4MKIA 3GLFB 4DB2A 3EZFA 3ZD6A 3GQBA 3EPLA 1J8YF 3KQKA 1DG1G 3BB1A 1ZM7A 3MMPA 2AXNA 1Q57A 3RNLA 1U0JA 4DHEA 2XTNA 4EPWA 4NHOA 5JZVA 3MLEA 1QF9A 3FFBA 4HEJA 5JHHB 3SYKA 4EQ6A 1HT2E 4IEIA 3UKDA 3TVDA 1YZQA 2GDJA 3K09C 1DS6A 4G5OA 1N6RA 1Z22A 3I72A 4D0NA 2Q9AA 2DFLA 3TUZC 1S4QA 5TVKA 1YR7A 3QJYA 4IXNA 3DM9B 3MWKA 4NYJR 4DUGA 3THYB 5G3YA 2AFHE 1KMQA 3LLUA 2JLYA 1T5IA 3LVQE 3TIFA 5KSOA 3CIOA 3GLHE 4G01B 4RD4A 4EDHA 3K53A 1N0WA 1E9BA 3Q7QA 1E1QA 1GAJA 2EFEB 2WWIA 3KZ1E 2WTUA 1JEEA 3CO5A 3QPUA 2CDNA 3K0CC 3AGQA 3MUFA 1P72A 1GUAA 4Z1MA 1CULC 1P75A 4LHZA 1KO4A 1SZPA 4O2LA 4V0LA 2OBMA 4D4MA 2JLZA 621PA 2O8EB 4G5GA 2GCNA 3ND9A 2B8TA 4A92A 3PEYA 4DZZA 2ZPTX 4HDOB 2BMDA 3TR0A 2JAQA 3KUCA 1KI9A 1N0VC 2OO7A 1U99A 1W48A 1T0JB 2IYSA 1GNQA 4OI2A 4OK5A 4DXAA 5EXPA 2FNAA 4BEBA 2W0MA 3AF4A 4KVGA 2J0VA 3MJRA 2GEDA 4MYCA 1R8QA 4GMDA 3WNCA 1RZ3A 5HPYB 2ZRHA 4MRSA 4RD6A 4GMXA 3DOEA 3QG1A 1ZM2A 1A82A 3Q3JB 4FMDB 3QIAA 4TQ9A 1BH2A 3JZMA 3I8XA 5LPNA 1KYIA 3OZXA 1W4RA 4US1R 5AJVB 2YC4C 2ZI3A 2WICA 2C5LA 1E1RA 1M1YE 3A1VA 3KL4A 4YMSA 4YMUA 1CRQA 1QDEA 1ZC4A 4KFSA 1C9KA 4M2LA 3HU2A 1N5IA 5J4HA 5F9HA 1E9AA 1EX7A 3T1OA 1CR2A 2OAQ1 2GJSA 2BKEA 3QBTA 3ZVMA 4OHZA 2QBYA 2GJKA 1Q3HA 1Z2AA 2GA8A 3U4QA 2IHBA 1TQ4A 1UEIA 4HAVA 4WOPA 5C18A 1DAMA 4V0MA 2QE7D 2KI5A 4C9BA 5IK2D 3GJ8A 1E4YA 2RGEA 3QG5A 3NHAA 1II8A 2OSBA 1OH6A 4QJ4A 4B73A 2WWYA 5BN5A 2QPTA 4RSGA 2KWIA 2C04A 3BH0A 4XIGS 3W6NA 4B75A 3QPWA 1SXJE 2Z43A 4HAWA 4MRPA 2WJVA 3LX5A 3K09A 2Z83A 1PUJA 4DDVA 3W3AA 4UNPA 1UADA 4XWKA 3GLFA 3HYTA 1ZBDA 3C5CA 3A1TA 4HB0A 4TWZA 1HE8B 1WDTA 3BS4A 2ZRBA 3KXIA 4G0NA 4CDGA 4P4TA 1DAIA 4TSFD 3LH5A 2FFBA 3ZQ6A 5IDVA 4Q21A 2Z4RA 1PLJA 4QL3A 2ZE5A 2CL0X 2G88A 1EFUA 3KQNA 1Z6TA 3IGFA 1AGPA 3K0CA 1KMHA 3A4MA 1F3OA 2Q3HA 4QG7A 1YZLA 3THYA 4WVFA 4YXWA 4DLWA 2QP4A 1US8A 3HYRA 2UVQA 1TUEA 2CE2X 3E70C 4JLVA 1H8HA 3I1FA 4S35A 3AB3A 3QE0A 5CM9C 4TT3D 4PR0A 2A5JA 1ZD8A 4WZAE 5JEEA 3R9IA 1OH7A 1G3RA 1OXSC 3PG5A 1NVXQ 1AIPA 5TXGA 3KFVA 3LFUA 2AKYA 4A36A 4Q4AA 5E7JA 1Q1QA 5BYJA 3DKVA 3ZVRA 4GOXA 3CNNA 4LRWA 1KK2A 3PVSA 2ODNA 1BIFA 1G8GA 1IBRA 3NEYA 4NMMA 3B1VA 1OFUX 2GXUA 3IIMA 5L3RA 4B47A 1M34E 5F3WB 3WXMA 1ELOA 3R7WB 1MO4A 4MKHA 4D4JA 1P2VA 2G0TA 4PQRA 4BFVA 2ZS8A 2FWRA 2QZ4A 3C41J 3VHLB 3PCRB 2VHTA 4US0R 4IVPA 4I99A 4F4IA 2P5SA 4CEIA 1SKQA 2FH5B 1SKYE 2ZYUX 3EC2A 1FNMA 2QI9C 4FINA 4MQBA 2VLIA 5BQ5A 2PX0A 2VF8A 2ZSEA 4IOJA 1R10A 4JLDA 4DC9A 1W47A 1G3MA 1LS1A 2FFAA 1DELA 1GZSA 4ZKEA 1J99A 2VIIA 4B35A 1WRBA 1IN7A 1BO6A 1T3LA 1P2SA 2CHGA 2OUKA 4MYTA 4Q66C 4R7ZA 3SOPA 5BN4A 3KTAB 2O8BA 4BZXA 2QPAA 3F3YA 4TMKA 1N5LA 3JVUA 4FWTA 1N6PA 1XF9A 1IOZA 3P4YA 2YV5A 4YDHB 3QXHA 3B1YA 3P20A 2FEOA 3RSOA 4PZYA 4IJMA 4M1MA 3CPHA 1OE0A 1AK2A 1DAHA 4PFSA 3LQRA 4PAQA 2HXYA 2IUSA 1PLLA 2QTFA 3B13B 5EZ5A 4MKFA 1XCGB 4HB2A 4P4SB 4WZ6A 3DM5A 3T12A 3L0IB 1RE0A 4NH0A 3W9YA 1OXTA 1NMZA 2A5FA 2J59A 4JJZA 3VNUA 4AG5A 4OQNA 5AJXA 3S1AA 5FI1B 2GZHA 2IS4A 2DY1A 1T0HB 5HR5A 3TK1A 2OM2A 4Q7LA 3K9LA 1D9XA 1E2NA 3VKHA 3ND8A 2J0UA 4B43A 4D4KA 1XTRA 2D74A 3MCAA 3MRSA 2MMGA 2XJ4A 1WE2A 4DCTA 2OFWA 4Q7MB 2ZU6A 3GFPA 2JLXA 1L4YA 4YMWA 1G3UA 1ZUHA 3EZ6A 1YU9A 1WA5A 2OCYC 2Z4SA 3LLMA 3OEED 4A0FA 3NBZC 3NDPA 1SVLA 1MABA 3RS5A 4XVRA 1TF5A 3RC3A 4EJSC 2VRWA 4MRVA 3NVAA 4AKHA 1AJEA 2ZR0A 3THXB 3UG7A 5EUMA 3MG9A 5DYGA 1WQ1R 2JLUA 4B74A 5DE3A 2GVDC 4K46A 4PO1A 3EC1A 2JDID 4K81B 3LDAA 5BYKA 2GBLC 2A3RA 3ASYA 2RGAA 1XD8A 1FQJA 4OYHA 2IYLD 2K5UA 3ZVNA 2JGNA 1GKUB 2B7BA 3SBDA 4NCKA 3PR1A 1T3SA 5K8UA 2F43B 2GHIA 1DARA 4XVQA 3T34A 1TQDA 3FFAA 3FMPB 4D26A 1RKBA 2AKAB 2PMDA 121PA 1U90A 4ON9A 4B48A 5JWOA 4Q9KA 1Q44A 3K8YA 1GNRA 2X2EA 3TVTA 2C99A 4B33A 4A2QA 4Z54A 1XJ0A 1Z0AA 3A37A 4MKGA 2WSMA 2I4IA 4RCZA 3PXGA 3CZQA 1T4GA 2P0EA 3EZ9A 3AQ4A 3LWNA 4WXRA 2R2AA 2IX3A 1R5OA 3FPAA 2G3YA 3WMFA 4JKYA 5BW8A 5JCPA 2QTVB 4DSNA 4HB3A 1UBGA 3VX4A 5EP3A 5CB8A 1U94A 2AXPA 2Z6VA 4IDHA 3WMGA 4PPFA 1YRAA 4NCJA 2HT1A 4UNRA 1OPXA 1IXRC 2ZRGA 2WSSA 1RFLA 4NP6A 1W2HA 2ANCA 3C7KA 4C7OA 3CF2A 3FGNA 3NKVA 3PITA 5FFMA 1L8QA 3QUSA 5FOVA 1Q1BA 4LYFA 2XXAB 3UWKA 4D25A 2QE7A 4XSHA 3W34A 5CIQA 5IK2A 5KU1A 1Q21A 2VH5R 1RRCA 3KB2A 3KTAA 2FPLA 221PA 1B0UA 1OHHA 4JYBA 2FE4A 2HUPA 1GTVA 1GM5A 1CP2A 1G8HA 4LDJA 2JEOA 2YOFA 5EE0A 2XNDA 4TLCA 3NHBA 2VHUA 4AG6A 5JSZA 1OYYA 3EW9A 1VIYA 1F60A 1W4BA 1G7CA 4G5RA 4QGAA 3BH6A 1J70A 1DE0A 2O8CA 2LWIA 1EX6A 4L16A 4ZDIA 3AGPA 2B8WA 2KB0A 3BFVA 3Q7PA 2F1RA 3K1JA 4RKFA 2F55A 4B34A 2YWGA 4JYCA 4V0NA 2GJAA 3WNBA 4EJSA 1FP7A 1SULA 1EK0A 1N25A 2A5YB 2VP0A 3U3KA 1NBME 4TTQA 3SFZA 1IY0A 1JQJC 2RGDA 2RB4A 2YZ2A 1JXOA 1T5LA 3TSZA 2ZETA 1D2MA 721PA 3D7MA 2WMOB 2W58A 2ZR9A 2IL1A 3KUDA 3LV8A 1KSHA 4ZDWA 2H5EA 2FF7A 4D6PA 2GBLA 1N5KA 2FG5A 1NLYA 4IW3B 5C1BA 1M7HA 1EFCA 4V03A 1LF0A 4LJ4A 1W0KA 3TQFA 5AUNB 2UZ3A 3C16C 5GVRA 2D06A 3THXA 4TMXA 1NY5A 1G291 2P5TB 3V9PA 1PLKA 2ZYVX 3CRMA 2YNMA 3IBGA 3QKSA 1G6OA 3GEIA 4DSTA 2OZEA 4B71A 1M7GA 2C2HA 2ZRNA 4QGFA 5JWHA 1WMSA 4UNQA 1G8PA 4EFNA 4H1UA 4AY2A 2GJ8A 1R4AA 1Q12A 2WV9A 2OXRA 5LB4A 5SZKB 4POAA 4CRWB 4JBWA 3ASZA 2OT3B 2XX3A 2ZRDA 3KXLA 3LW7A 1IONA 2QPOA 1KI4A 5GJWC 3IO3A 2QEQA 5KYKA 3G0HA 2VSFA 1VMAA 5J4YA 1KI7A 4URYR 2EFCB 5FPYA 4YQFA 1VCOA 4IFEA 3GLIB 3VR2A 3SHWA 4AKGA 3P1JA 3IIKA 2OLJA 3LQQA 4URWR 3U3RA 1D2NA 3DZ8A 1G5RA 1M74A 4DUGD 3I62A 1OB2A 3SJBA 4L9WA 3BK7A 5AK0A 2IYWA 4WZBE 4DLTA 2CXXA 2F3RA 1S8FA 3RS2A 1SXJD 2F7SA 1E1QD 1G64A 3FMOB 4GZLA 1UAAA 5GVSA 5DIFA 2QSZA 3FWYA 1Z6YA 1ZJ6A 3GLHB 4MGKR 2CCKA 3CNOA 3L82B 3VKGA 4IOKA 3QEJA 1DAEA 2WMNB 1IAQA 4GOJA 2YJTD 1KI1A 3KX2A 1W5SA 4AURA 2H92A 2D7DA 2BIFA 4P4UA 3W5JA 1U9IC 5K8IA 1X3SA 4GSYA 1XEWX 3T61A 4C0QC 1E9FA 4LYHA 1KSFX 4U7DA 2JLRA 3TUIC 4OBEA 4QC2A 1KI6B 4A82A 2VSXA 3QKRA 2CL7X 1Q0UA 4PSKA 4BRUA 5JS8A 4GOKA 4CEJA 5L3QB 2QG6A 1IN6A 1G5PA 1K5GA 1EXMA 2ZYWX 2R62A 4TYQA 5CJ2A 5C46F 1OFIA 2PZFA 2SHKA 1XMSA 4G5QA 1NJFA 2NZJA 2ZREA 2A30A 3D3QA 2QP3A 2PL3A 3CLVA 2D62A 3KQUA 1KK3A 3EIEA 1JECA 2JATA 3LXXA 3A4NA 1VYUA 1Z28A 2J5XA 4KAXA 2BJWA 2R8RA 2ORVA 1YZKA 3QY0A 3B60A 3CH4B 4FMDF 1E2IA 2IK8A 3D8BA 5JI2E 1G17A 5JFGA 4N3NA 4OK3A 2REOA 5J5CA 2FSFA 3CX7A 2NPIA 4ZCIA 1TQ6A 2XAUA 1MR3F 3AF0A 1DVRA 2ZJYA 1GOTA 4IXMA 3OEHD 4PC3A 3I4LA 1P73A 1JPJA 3K0FA 2G9NA 5JI3E 4QNMA 3K0EA 2QAGC 4UNNA 1T91A 4C0SA 3NBXX 1QVRA 2W2VA 4KVAA 3PV0A 2O8DA 1WBBA 3GLGE 1VPLA 1MRSA 1IXZA 5GJCA 3WYFA 2NO7A 4OQFA 5D3QA 1X8JA 3GJ7A 5E7MA 1Q22A 5JECA 3VR4A 1VG9B 2VA8A 4OQMA 1XNJA 3X1XA 3PJRA 2XSZD 3NIBA 2G6BA 3TMKA 1SXJB 3VR1A 4NCNA 4Q4HB 2FGKA 4M4SA 3HP1A 4EPXA 2VP9A 1Y3AA 2IUUA 4JL6A 2ORIA 4II7A 2ZJZA 5BWMA 4M1YA 1ZC3A 1YR9A 3QQ5A 2AR7A 4NYMR 4M22A 4OHYA 3SJAA 5J47A 4LPSA 4QGHA 2ZSDA 3PUVA 1H8HD 3ZIAA 5FL3A 3Q9LA 3AVPA 1W49A 1U9IA 3M4YA 2YVUA 3DEFA 3P26A 1FZQA 3T5DA 1AM4D 2ZANA 3LBIA 1EFTA 2C78A 5EZ6B 4EKDA 3ZLJA 3RRNA 4TZ0A 1QG2A 3QSYA 1E6CA 3U7FB 2ZRMA 3HPQA 2GAAA 3GLHA 3RWOA 3IO5A 4TMTA 1TF7A 2ONKA 3FKSA 3LY5A 1X86B 4P0TA 4WW0A 2P3SA 2F1JA 1ZIOA 4ARZB 3WHKA 4ZCLA 3ADCA 3DMNA 2J3EA 2CHVA 2HJVA 4DLZA 1AN0A 3PEVA 2AK3A 3K9HA 5KTYA 1KI6A 2ZRFA 1P62B 3TQCA 4ILEA 2V6IA 2H18A 1XXHE 4C30A 1O3YA 4A8JC 3KFXA 1HURA 3UXMA 1NG9A 3FB4A 4GZMA 2VSOA 3ZGXA 1CKEA 2GJ9A 3PUYA 1GITA 1GL6A 2R65A 3AVWA 1WB9A 4HAZA 2EWVA 1F2UA 4EPRA 2G83A 1EG7A 3M0EA 1JQLB 2AFIE 4N1AA 1G20E 2JJ1A 1FPMA 2O52A 1NKSA 4KO8A 3P27A 1ZM9A 1SKYB 1QVAA 2R6CA 1RJ9B 5FPKA 3O47A 3BJIC 3TBKA 3IQXA 4KITB 4GT1A 1G6HA 2IS6A 4OQXA 1PJRA 4OJQA 3VR6A 1X8KA 1N3BA 2BVNA 2HXSA 3VQTA 2XNSA 1GRQA 1XTIA 4LYAA 1TU3A 2BEJA 1IJEA 1J2JA 3OIVA 4QKQA 1ZVQA 821PA 5L8VA 4TYYA 3LAWA 2IHYA 2YHSA 4C2TA 5TY0A 1YVDA 2V9PA 1SHKA 1C4OA 4XTRA 4CT5A 2ZVQX 4Y0VA 2YWFA 4QOSA 2J9RA 3KDSE 4QM7A 4NBSA 4Q7JB 3NWJA 1Y63A 2BMFA 3C15C 3ZQJA 3TH5A 5IT5A 2ZITA 1KK1A 2O8FB 2N42A 1KMHB 5FBWB 2OESA 2AHOA 4PSAA 2YWEA 1FTSA 3THWA 2JLSA 4E09A 4O3MA 2YC2C 2IYTA 4QHYA 1PVOA 3UANA 1US8B 2ODBA 2QORA 2AK2A 2BMEA 1MH1A 1ZD1A 1SQ5A 2R44A 5CYPA 2YKGA 4LJ7A 2WKRA 2NPFA 3WRYC 1SXJA 1N6NA 4Q4AB 4Q4HA 2Y8EA 2ZAOA 4RJLA 2G0NA 1E0KA 1XTKA 1OF1A 4D82A 1N2CE 4QHTA 2YOHA 2ZM5A 2WKPA 4B76A 5B58C 4NKRA 4EPTA 3ADDA 4G3XA 3TW4A 3A58B 4KFTA 3RRZA 2PMKA 3NC1C 4DT1A 1KDOA 4ZCMA 4MDFA 4D0LB 2WJJA 4I1VA 5F98A 1KTVA 4LJ8A 1TPZA 4NE2A 1Q3TA 3CRRA 3CBQA 2ZR7A 4JLAA 2QTHA 4ZDKA 2ZIAA 2KBFA 4O25A 4W9MC 2W6JD 1ZNZA 4B3XA 4D2IA 3E1SA 4CEIB 2VBCA 5E7IA 4OL0A 1CRPA 4Q9IA 2G77B 4A6PA 4A8JA 5EP2A 3CRQA 3OIYA 5FOSA 4PPGA 1G7TA 4RFSA 3X2SA 1P6XA 4JLKA 4JLMA 5KNCA 4ARZA 3NXSA 3U3OA 4DB4A 1FW6A 2ZRLA 3MFYA 5KOYA 4PAMA 4BQSA 1HY3A 4BGDA 2O8BB 2AX4A 4B2IA 2HDNB 2OEPA 2BHRA 3QBVA 6Q21A 2XTMA 4HATA 3PENA 2E87A 4H9GA 4NU0A 4URZR 3TGPA 3R8FA 2C98A 5JMTA 2V3CC 2VHJA 3BRWD 1C1YA 3W3ZB 1F5NA 1UBFA 2WSSD 4RFVA 5FL7A 2KBEA 5KO2A 4EFLA 4U5XA 4TYNA 2MSDB 2X77A 3TAUA 2BBOA 2X8AA 3HU1A 3OEHA 3ZYCA 5TDHA 4R71A 3S1AB 2BOVA 4BLOA 3KQLA 3N2EA 1RJ9A 4O0MA 2CJWA 4Q7KA 1G4UR 1VCIA 3PFIA 1OHHD 2J0UB 5AJWA 1QHXA 1CEEA 1DO0A 2IXEA 2XNDD 1G41A 1ZRHA 4DLXA 5FTNA 4LX0A 2GETA 4BFXA 1KJWA 3H0KA 4NZYA 2OCPA 4TN1A 3FOZA 2I1VB 2ONJA 3Q72A 2V4ZA 1XBTA 3GJ0A 1KO8A 4ACBA 1MABB 2XSZA 1P2UA 2X2FA 4BLQA 1T8TA 3VKWA 1OT3A 4LC0A 3JZAA 1A5TA 1I4TD 2FJUA 4S2EA 3FTQA 4LK2A 4GL2A 4BLPA 4OHVA 2J0SA 1W1WA 5SZIA 1LS6A 3DPUA 2BBTA 2O8FA 2J87A 3CX8A 3GJ5A 3EPHA 1GKIA 1ESNA 5TV2A 4FCVA 5DGXA 4GDFA 1NP6A 2G1KA 3WNDA 4ABYA 3BIFA 4PC1A 5DHFA 1JAHA 2LKCA 4IDQA 3AUXA 1P9RA 4M21A 1I4LD 1KO5A 3UMRA 3VU9A 4A0HA 3LRPA 2IF2A 3SFVA 5D3MA 4PPNA 4PAOA 1PV4A 1W0KD 3MWJA 1M8PA 5M04A 1T8UA 2TMKA 4BRWA 2V7QD 3RAPR 4AK9A 4IVRA 1E69A 3SEAA 2BM0A 1XU4A 1FP6A 2H8KA 1UM8A 4I1UA 4LHWA 5H68A 3SU8A 1NNEA 5BXQC 4BFYA 5ANRB 3GFTA 2N1BA 1YE8A 2C03A 1E2LA 1COWA 3N5CA 1CJUC 3QI2A 3UMSA 3WP1B 2VP2A 3B85A 1CIPA 4NYIQ 1F48A 1E2JA 1QHYA 1FTNA 1IN4A 2R9VA 2ZU0C 1VIAA 2PEYA 3BC1A 5KSPA 1R2QA 1WF3A 4C7OB 2V55B 4MRNA 4KODA 4PO9A 1JXMA 2ZE8A 1KK0A 4I1OA 5JWRA 2NTYC 4PC2A 2VF7A 1E2DA 1S2MA 1D2EA 3QNUA 2QMOA 4NCHA 4RVCA 4LJ6A 2CLSA 2YWHA 4ZIRB 5JSZB 4E07A 1VHTA 4E03A 3B6EA 3LO5A 4FMCB 2QN6A 4RCYA 2PCJA 1FNNA 4IDPA 2DBYA 1SVSA 2VYFA 2NO6A 4Z51A 3ADBA 4EAQA 2P6RA 1TF2A 3BB4A 1S3SA 1OYWA 3BXZA 3NTUA 2O8CB 3IEUA 2GAOA 4M8NE 4BLRA 4NTZA 3N2IA 3EWSA 3A4LA 1CR0A 1KJZA 4TTRA 3GJ3A 5FUXA 3HU3A 2C9YA 3LBNA 4EJSB 2C96A 1OV4A 2BBSA 2E9SA 4ERNA 2ZUDA 2GVZC 2OG2A 2OXCA 4MH0R 1KO7A 4GI7A 4L15A 4B2LA 2OAP1 1G5TA 2GZAA 3KJGA 4DDUA 5SZHB 4LHVA 4DKXA 2XB2A 4LJ9A 4KV9A 1R6BX 3CKLA 1HUQA 1KIMA 4OHWA 2HT6A 5FH9A 2F9LA 4LGMA 3FMIA 2WOJA 2GF9A 1SVIA 2WBLC 4D80A 3Q8XB 2PEZA 1NMYA 3AP1A 3D6TB 1ZINA 4LC1A 1XCPA 1KSJA 1W5TA 2C77A 3SI7A 1E9CA 4ZDJA 4Q18A 1K5DA 2QT0A 3V4FA 5L3SA 1VCNA 1JB1A 5G3ZA 4JLBA 4MA4A 1BYUA 1HTWA 1X6VA 1XD2A 3QKSB 1R0XA 3FHCB 4TL8A 3RS3A 4D4LA 5DH9A 3K9GA 2PJZA 1ZM4A 2WZQA 4YONB 1HA3A 1OXUA 1DPFA 2IYRA 1NBMA 1S1MA 1YQTA 4QHSA 1G9XA 2VEDA 3NC0C 4IEEA 2QGNA 5HTKA 4JL5A 4KYUA 2EFGA 5EXSA 2WKQA 3CNLA 3EA5A 4AKEA 5KNBA 2W6JA 5A4JA 3AVXA 2ZUBA 4LV8B 2ZRKA 1G8FA 4DLRA 1QHNA 3L0OA 1CU1A 2QENA 4DCNA 2JLVA 4C0LA 5IRCD 3KXKA 5AR1A 4PQYA 2CVHA 3FE2A 4CEHA 1JPNA 4U02A 5CB6A 3DOFA 1W36C 1MT0A 2OILA 3RWMB 2GILA 5CITA 1LTQA 2PJRA 3AF2A 5DN6D 1E9DA 2OV2A 1RIFA 1S3GA 2ZEJA 4BECA 5H1YA 4IRUB 3DL0A 1XFAA 4IVQA 2ZI5A 1AQUA 2BDTA 1R7RA 1ZUIA 4LBVA 5FOWA 2JLQA 4DLVA 3H2YA 1FUKA 4IDNA 3CPJB 1ZCAA 1U81A 2J7KA 3MSXA 2R6GA 4GBMA 1OIVA 3ZIAD 2GEUA 2PH1A 2WWGA 1ZU5A 2DFTA 1W7AA 2QL6A 3QKRB 4ZIRA 3IUYA 4OJKA 4CEJB 4V0OA 3T1QA 4BZQA 4GNKA 1QZXA 3IQWA 3LBHA 5DLQC 2MSEB 3UPUA 2EWWA 1KDRA 2DFNA 2OFOA 4F4CA 4ASUD 3FKSD 4A2WA 3SE0A 5J4KA 4M1SA 4LYJA 1W4CA 3R20A 5UKDA 4HUTA 1IY2A 1ZNXA 2ATVA 1CJMA 2X1VA 5FTMA 2IEZA 2W2TA 4PHFA 2WVJA 3WYGA 4DDWA 1Z0FA 1G1MA 3VX3A 3BH7A 2FDCA 2A5DA 4NYIR 1HE1C 1Z0IA 2IS1A 3CM0A 4EIWA 4NYMQ 1Z63A 5AUOB 4F93B 3PUZA 4DWJA 4TMWA 2D2FA 2ZUCA 4TLDA 1Z47A 3T06B 2ZJBA 4JLJA 1XRJA 2RGBA 3QF4A 1ZD9A 5CDFE 2JJ1D 1NG1A 3A36A 4HZUA 4PTLA 2BKUA 2Q21A 1VCMA 3K0FB 1KDPA 1NIJA 2V7QA 4A9AA 3B82A 1BOFA 1LF5A 1JAIA 1SVOA 1NVVR 2O8DB 5KHOC 2NOAA 2EVWX 5JBQA 1GSIA 4JSYA 1L4UA 1OB5A 4TZ6A 2EFDB 4JLNA 5G41A 3KQHA 1QBKC 1XWIA 4QBFA 4E22A 3HR8A 1P4SA 3GJXC 4Q4JA 1JR6A 4M9QA 4MGIR 1QHIA 2VHCA 1U0LA 1VECA 3GP8A 3H86A 2H16A 3HDTA 2R6AA 4MYHA 5K8LA 4M9XA 3PEWA 1AS0A 2OFXA 3SS8A 3B1ZA 1FQKA 3QOFA 3CF6R 2AD5A 4JKIA 1G8YA 4GP6A 4I1SA 1OH5A 2IXFA 1DAKA 2ZVPX 4ZO4A 3U61B 3ZH9B 3V00A 2WJGA 4YDSA 4HAXA 1GRRA 2ZE6A 3I32A 2NZ8A 4HSEA 1E3MA 4X8HA 2PZEA 1CR1A 3MWLA 1EGAA 2J1LA 3L8ZA 3AF3A 3UATA 1R0YA 2CNWA 5F9FA 3GLGA 2PCLA 1TTTA 1AQYA 3DHWC 2NG1A 1IY1A 1CBUA 1E99A 4FCTA 4MITA 3BE4A 2WPDD 2CBZA 4C0BA 1IM2A 1O87A 3L43A 1H8EA 2A7QA 4KI0A 3F5FA 4BE7B 2ZJ5A 4ESHA 3KKMA 4A1FA 4LWZA 4EUNA 2QA5A 2Q9CA 5GADl 2QRNA 2H17A 3W90A 2P6NA 2GXQA 3BERA 1NVUQ 2IW3A 2PZGA 3BGWA 4LJAA 2MSCB 5EE9A 3VR3A 3I61A 2UKDA 4JJKA 1BKDR 2Z5FA 2RGCA 1SVKA 2XEXA 4LBZA 2FA9A 3ZZUA 1W44A 2A2ZA 1NKTA 1KDTA 4QBGB 1KI8A 3I5YA 5HKKD 1F2UB 3TAHA 5GJVC 4QM6A 3BAFA 4URUR 4FI3C 1A2KC 2B7CA 4Q9JA 2ZROA 1AZSC 2DWPA 1UKZA 1E2KA 4A4DA 2ODWA 2QAGB 3WBJA 1IHUA 4B3GA 1TEXA 2KE5A 3IHLA 3SYNA 1CR4A 5DYIA 1ZNWA 1JNYA 4KFUA 2R6DA 4QFMA 2WJYA 2F1IA 4LHYA 5FL7D 2IC5A 3LW8A 4DCSA 2WHXA 1E0SA 1Z83A 3WHLA 2O0HA 3B78A 3MD0A 4LJ5A 3UIEA 3ZZ0A 2HYIC 1XXHA 1ETUA 1P5ZB 3A1SA 4WAUA 3RS0A 1FUUA 3SJCA 2E1RA 4KBFA 3WRXC 3O8CA 3BWDD 1IN8A 1XMIA 4Q03A 3R8CA 3THWB 4BPBA 2B92A 3AM1A 4HAYA 2QQ0A 1S0UA 2Q3MA 2KSQA 2QROA 4F38A 2ZJOA 5EE3A 1NN5A 1QHHA 4OHXA 3ADKA 5DN6A 1E2EA 2BJVA 1OKKA 1FL9A 1DOAA 5FOXA 2ERYA 5FTLA 4C0JA 2GF0A 3E2IA 3R9XA 1TQ2A 1KO1A 4KLZA 3FDIA 4KFRA 4DIDA 5EE1A 2O5VA 2HEIA 2C95A 4HLQB 4DT1B 1RVDA 4DIEA 4MYUA 3B2EA 1L2TA 1KZGB 5BN3A 1UPTA 4Q02A 1A7JA 5LDDC 1UBEA 2DWOA 4LY6A 2BCGY 1CLUA 1E4VA 2I3BA 2QMEA 4BFZA 1E9RA 4CW7A 4JVSB 1CTQA 3C8UA 1P2TA 1S96A 1WCV1 1XEXA 1RW4A 4A8JB 4KJZA 4M1TA 3KJIA 3WP0A 1A4RA 3THOA 1YJ5A 2DWQA 4ASUA 5B57C 4JVLA 1IJFA 1D6JA 4RFSB 4A2PA 5E3HA 3IEVA 1L7VC 1ZYUA 2JJ2A 4HDQB 4QJ5A 5LD2C 5CIWA 4B3FX 2DCUA 2ZJ8A 1TX4B 4YLGA 5DI3B 4ESVA 5HCIA 2RKOA 3IDQA 1COWD 3UK6A 2AD1A 2V1UA 3K70C 3QF7A 3ZDQA 5G40A 4PX9A 4UJ3A 4IFBA 3Q85A 4A15A 2IYQA 1AS2A 1SGWA 2LCFA 4G1UC 3T35A 4YMTA 3K0AA 4DEXA 1LB1B 3OF5A 1NY6A 5SZJA 1XPUA 1Z0JA 1UKVY 5LB2A 2IXGA 1NRJB 5AJYA 5FUWA 2QNRA 3AKEA 5JS7A 2ZTSA 3VHXA 1P3JA 3AVYA 4MDEA 1XX6A 2IWRA 1XTJA 2CJWB 4FN5A 4Q00A 3U7EB 3H84A 4M9SA 3C5HA 1II0A 1I2DA 2FN4A 4PC7A 2R6FA 4MGZR 5L3VA 3B1XA 3GPLA 2QAGA 2RH5A 3F0TA 2DYKA 3KJHA 3NH6A 4TL9A 1TADA 1XZQA 4NCIA 1P7CA 2J41A 3N70A 2A9KA 3B9PA 5FOTA 2GCPA 3CWZA 2JIZA 2XB4A 1NL3A 1TMKA 2C8VA 2C9CA 2WWFA 1XPOA 4H1VA 1OXVA 1TNDA 4K8OA 4Z8YA 2P67A 5FUYA 2GEVA 8OHMA 3AUYA 2PBRA 2W0SA 4M1KA 4CGZA 2HJGA 3R9WA 1TEVA 1DO2A 3UWOA 4CT4B 4AKIA 3PUWA 1Z2CA 2RAPA 4FMCF 4HAUA 2J7PD 1RRFA 2RHMA 2WIAA 5C4MA 3FMFA 3G82C 4Q9HA 4TLAA 4JT4A 4KBGA 4M53A 1EWRA 1OW3B 2CLDX 2IUTA 4RZ3A 4E5UA 5JHGB 5JRZA 1UKYA 4PANA 4XD7A 2GK6A 1KAGA 4FW9A 1BMFD 3CZPA 4KLNA 3MAAC 3OFND 4LJYA 1JBKA 5C4GB 4ZI2A 1YZTA 2QMHA 3O8BA 3WBKA 3GLIE 4TYWA 2BMJA 4M9ZA 1W2GA 3VU9B 2O0KA 2OBNA 1HQCA 3G5UA 4IHQA 3W6OA 5D3MB 2WAYA 5TMPA 3ICEA 3OE7D 5E95A 4I81A 4KXFB 4W5JA 2WPDA 4JT2A 3OAAA 1YR6A 5CLQA 2F3TA 4OI0A 4UNSA 1JEDA 3ZD7A 4O2RA 1ZMXA 4PPQA 2CCJA 2ZI9A 4LCBA 3REFA 1JR3E 3SBEA 3C4JA 4UKDA 2IYYA 4MRRA 1KJYA 3CR7A 4HLDA 2BCJQ 4JVNA 3LA6A 3MWYW 4RKEA 3I5XA 2GTPA 3AVOA 1OXXK 1NBMD 1U0HC 1AKEA 2GK7A 2NIPA 3RS7A 3AKDA 4NONA 3X1WA 4DEYA 4ITRC 1DADA 3U6KA 4R2HA 3SR0A 1T3HA 1MKYA 3I3SR 4QXAA 1LFDB 4RZUA 1Z5ZA 4DCUA 4F4JA 2GKSA 2HCJB 1X1RA 5EXXA 4ZV4A 1Z8FA 1R0ZA 4HI0E 5J40A 4C2UA 4L9SA 4AD8A 2FV8A 5C2JB 4WIAA 5HKKA 1KOFA 3M6AA 5B64A 3AP2A 4FIDA 2FGJA 4GRAA 2IWHA 4URXR 3D31A 5JLJA 2CL6X 4XH9B 2FFHA 1KNXA 3I73A 3SYLA 1FMJA 3U3JA 1AS3A 2N46A 3LD9A 5DI3A 2EW1A 4CYMA 5IF9A 2GCOA 4DBLC 1G19A 1G3IA 4GP7A 4JIMA 5F2EA 3IKJA 4AYTA 5CK4A 4A0RA 4B44A 4TMZA 3W8NA 2PT7A 1VG8A 2BBWA 2GWHA 4TL7A 5EUQB 4CVNA 2WWHA 1T9HA 1AGRA 1LVGA 2XZPA 1XCMA 3IILA 4LBYA 4DRZA 3SQXA 1N5JA 2VL7A 1MO3A 3HPRA 2VO1A 1E79A 1HT1E 2P6UA 1W46A 2QUZA 3BFKA 3W8RA 4XSGA 1NVWQ 1CJVC 5KSYA 4WBSA 2JJ8A 1GG2A 2XJ9A 1E2PA 1XP8A 4Q1BA 4Q9LA 4FXPA 4PHHA 4W5HA 3U7HB 1ZP6A 5TARA 5KUTA 3EZ2A 1DAGA 5EJEA 3FYHA 4Q1CA 1EFRA 4UJ5A 1PZNA 4QBHA 3TNFA 1E9EA 3GCGA 2W00A 1ZNYA 3PIRA 4KSCA 3RRMA 1FMLA 2QSYA 1A2BA 2CLCX 3EASA 1TAGA 3ZJYA 4PZLA 2ZSBA 1E2MA 3T5GA 2ZRAA 3EPKA 2OLKA 2QAJA 3CW2A 5HE9A 4LSGA 1M2OB 1RRPA 4DLUA 3CF0A 1FOEB 3PUXA 4B6EA 2CCGA 2ZRJA 5CLLA 4HUQA 5L3SB 2AWOA 2IYUA 4WXPA 1SVMA 1KKMA 1GILA 3PQCA 3SQWA 1XD2B 2EYQA 3ETLA 3RABA 4R9UC 1YRBA 5AWFC 3ZS8A 5HE8A 1V43A 2FSIA 4HB4A 5GJBA 1F2TA 4X8LA 3DMDA 3BD9A 3EWAA 5FTKA 1E98A 4BFWA 2ZAMA 1ZU4A 1CJKC 5K8TA 1ESMA 1CXZA 4DJTA 4V02A 3RS4A 3AV0B 3SNHA 3SN6A 1IXSB 4TMVA 1CF4A 4JL8A 2DR3A 2OHFA 2H7VA 2QMUA 2V8OA 4CZ2A 3X1YA 1CS4C 1J90A 2NQ2C 1BS1A 4EFMA 2YOGA 1E2HA 4JZKA 2CHQA 2YYZA 2W6ID 1OFHA 1X1SA 2ATXA 3BORA 4IOMA 3RC8A 3RANA 4ZI3A 2EYUA 2D7CA 3LNCA 1CJTC 4CEHB 3DZDA 5JJKA 3CRW1 4I4LA 3RVBA 3TUJC 1E32A 4LZZA 3KKOA 1HH4A 2IA5A 4EPVA 4IOLA 5AJZA 2I1QA 4LPKA 4X8OA 1W36D 3UMFA 3TE6A 3L2OB 5HZKA 1EWQA 1IN5A 1GKYA 4AI6A 1Z07A 4MUAA 2PLFA 1QHGA 1NSTA 1RC8A 2JCSA 1RYHA 4AC9A 1NN0A 1N0UA 1R0WA 2GXAA 2IBMA 1VHLA 2WOOA 2O8EA 1Z0DA 3QKUA 1OH8A 3NDBB 3QVUA 1OIWA 4BASA 2H1LA 2LKDA 2NO9A 4KCGA 1SHZA 1VG1A 1NIPA 4M1WA 5KPJA 1VDZA 2ZI7A 2CNWD 4YC7A 5B30A 1NVVQ 5J4LA 4V0ME 4A6XA 1W0JA 1UFQA 2D3WA 1H8ED 2VHQA 4UQOA 2HLDD 1IQPA 3T1TA 1FFHA 4IKEA 3ECCA 4LI0A 1E9SA 3CRVA 1MRNA 3GJ6A 3KKNA 3BFXA 2FFQA 3EARA 4XTCS 4BEJA 3OHMA 5EE5B 4OKSA 1Q1EA 3FVQA 3OIWA 1KY3A 5KDOA 3GLFE 2J7PA 2OCBA 3GJ4A 5CJPA
chains in the Genus database with same CATH superfamily
4C0HA 3HGMA 3ETDA 5IC5A 2HMWA 1D3AA 1FFDA 1V9CA 4Y98A 4JLPA 4AROA 3RVLA 4Q19A 4BGVA 1FPQA 1UC5B 3AR8A 3HJAA 4Z9YA 1T4MA 2DUMA 2LGJA 3JWHA 3HJRA 4HGNA 3OFNA 2XYHA 1V4BA 2XKAA 1WY5A 3U6BA 3H5IA 5EC8A 3B2QA 3LPCA 1NN3A 1YRLA 3BMCB 1KYXA 1P9LA 3GMTA 2AOTB 3AI7A 3HCOA 1OTHA 3QF4B 2Q3EA 4RK0A 4BO2A 1QOZA 2HF8A 3GA0A 4HYYA 4O4HF 1SXPA 5FR2A 4AJEA 1LW7A 1L5HB 3C1AA 5DBEX 2B4TO 4I55B 4C3OB 4G4SP 3KSMA 3LQYA 5REQB 2R8OA 4DE5A 2BR3A 3QXCA 2JCGA 1BKSB 1VYTA 3P7MA 4ZVSA 3RV3A 2CEAA 3PHLA 1RKVA 3R0IA 1Z2NX 4GS5A 1QPBA 4FYXA 4YRDA 5LZ4A 1ETHA 3KT6A 4TVBA 1RQGA 4OY3A 1Z3CA 4TWJA 2X0NA 2Z09A 1G18A 2VDMB 1VYVA 2EOAA 4HLCA 2DX7A 4M0MA 5CNJA 2IV3A 4IJ6A 4F96A 1BHSA 4FX2A 4UE3S 1P1BA 5DCWA 3W7BA 3ZE7A 3PEUA 3BRQA 3BJEA 1RQLA 4XSVA 1XNHA 2AEFA 3ACDA 2I8AA 3GK3A 3OPYA 2PQ0A 5JZBA 1P44A 3E5MA 1Q0RA 4IXDA 1U8EA 4X41A 5DHPA 3M33A 4J75A 1T36B 2W6NA 4PHTA 4DGSA 2QYTA 4IH9A 1VFPA 1F20A 3I8SA 2XDYA 5K8UA 2Z58A 2LV8A 1VDMA 4GGPA 1T0PA 3HMKA 1FU7A 3F2IA 4NU8X 1TE2A 4Q5IA 2BC9A 5DBHX 2YXPX 3GFBA 3ABOB 4RY9A 5CURA 2H8GA 1XRSB 5DBGA 2ECOA 3SQNA 1A04A 4B8ZA 5DHUA 3DE0X 4R1OA 3SLKA 2E82A 3MS2A 1TMGE 4ENSA 4XJTA 2J46A 4XGQA 3M1IA 5EHGA 2CLFB 2X0FA 1NNI1 1QLWA 1ZA1A 2XTJA 4RD3A 3I64A 4V0SA 3UJDA 2H9AA 4C4PA 2GWRA 5B6JA 3Q3EA 4KMRA 2FAXA 4BVEA 4GMKA 4RLQA 5EIBD 1H6DA 1QV6A 1WXDA 4ZQBA 4FT4A 3FW1A 4FWBA 3N74A 1YRWA 4HLNA 2O8VA 5H4GA 2MMCA 5HZMA 3ZJUA 2ARKA 2Y9MB 3VSCA 2B8NA 2WJIA 2QLBA 4H77A 3B6MA 4XFDA 4Y0AA 3W2EA 4AZ0A 1I13A 1LBEA 2K6GA 3CJTA 4B3CA 1K7CA 3H5NA 3R7WA 4ARAA 2BMAA 1FRVA 4TTJA 5EG5A 3SXUB 3R5XA 3IC5A 4Y6SA 3DCNA 2VQSA 1AU9A 1G16A 3ZZTA 2F2TA 2P6PA 3GLRA 2Q6TA 2XMDA 4BN5A 1FUIA 1HSZA 4AQ7A 5IBCA 1QQ7A 1UBLS 2H51A 1F8XA 2BGIA 2GXSA 2HJSA 1DKRA 3UMJA 3VMFA 4DAOA 3E84A 1V0JA 2W2XA 1MO5A 5LUAA 4UPDA 5BSFA 2F64A 4DA0A 4GW3A 1PSDA 3D2AA 1F38A 1G55A 3QEOA 5EPOA 1T2NA 3PNSA 3HJNA 1LY1A 4DMHA 4NDZA 1ZL0A 2QU8A 2JJ2D 3QENA 1ZI9A 2X8LA 3C6XA 3SJUA 4DUZB 1JB9A 3P2KA 4UDOA 4BNZA 1EQUA 3Q0IA 4QGGA 3TLGA 2XHEA 4CMEA 1ZM3A 4JJ6A 2ASEA 1OZ0A 1L4HA 2Q5EA 4X7MA 3B8EA 1Q2XA 1CPYA 1NQTA 2QQEA 2IDJA 2VKTA 3IP5A 3L8MA 2ECFA 3A11A 1RYDA 1ZESA 3KSRA 2H5LA 4NRDA 3MBOA 3HYSA 5KYXA 3PPXA 3PWKA 4P33A 3V2UA 5ERYA 1NVFA 5DGDA 1A97A 1DQYA 3F46A 3ZNPA 4ADSG 4FQ8A 1PG5A 1QG0A 1DCMA 2HK9A 2PBFA 3KXDA 1ZN9A 4GUAA 1ISHA 1D4AA 4P2BA 3UOWA 1YVUA 1YKSA 2ZS9A 3P0RA 4P32A 4WA8A 4DTCA 3EX7C 5CK5A 4NY1A 1T5OA 4RS4A 5LBIA 5KOJB 1IHXA 3L0PA 2NU9B 4TLEA 5G0VA 1M2EA 3GJSA 4W9NC 3VU3A 2WFLB 2VPPA 2PFGA 3BWEA 1MAVA 3H1BA 4L3WA 3SF0A 5J2TF 1I4DD 2PXXA 3O3MB 1E2UA 3NYQA 3ESYA 1MDFA 3VC3A 4V0KA 4FHFA 4MVJP 1YVEI 1KEEA 4OM8A 1N6LA 1RRGA 4HQKA 1QHHB 2WJHA 1FFAA 2L0XA 3VR5D 4F4UA 4IIFA 3WK5A 1P77A 1XTQA 2GRUA 3X3HA 2GEJA 4I4IA 1UZNA 3PR2B 5CGZA 5IHPA 3CLTD 1Y9EA 4KG7A 1DBQA 4R69A 1LK0A 4X93A 4HDCA 2XUOA 3BRSA 2CJXA 1AUXA 2FZVA 2IHJA 4Q1DA 1GSAA 5JTUA 1ONPA 1U4OA 5EPEA 2HK7A 4N7RA 3EXAA 4FEYA 3QHPA 1Y34E 1P1RA 4XD7D 1BWRA 2G9ZA 5JLAA 4YRZA 3GPCA 2QLTA 5ISMA 3L0CA 5BN3B 1T5DX 2AFVA 2WF5A 4C0KA 1JF8A 4LE1A 2BWJA 1S89A 5KJCA 4RAQA 4KDRA 2ABWA 3VZSA 1EFLA 4ZVLA 2FX3A 4AZ3B 5LP6F 4IP0A 2RAUA 1H5NA 2XTZA 3ODPA 2QM7A 4B09A 3OAAD 5B2ZA 3BWVA 2JW5A 1QHEA 4QASA 4AMGA 4IJQA 4QFDA 3VPSA 2CMKA 2O0JA 2JGDB 2RK6A 2PWAA 4QNRA 1O0CA 3JYPA 3AJDA 4LOIA 5FOUA 3KNZA 3A25A 2P2SA 4REOA 3WQRA 2HF9A 3V4SA 1I4OA 1PJ2A 2I6XA 4MGYR 3WNVA 3D1LA 2XBMA 3QYPA 2IPNA 1U8UA 3BOSA 1V6CA 2G9UA 2QTVA 3H2HA 3MTEA 4RPKA 2WNHA 4WXMA 4XDGA 3N2YA 1FX0A 4GKJB 1KFBB 5DMXA 2WEKA 1EFHA 2NACA 1YZNA 1W87A 2BEVA 3Q7SA 3ZE2B 5DI9A 2NYAA 1KMMA 2Q5IA 3DZBA 3N6XA 5THXA 2FWAA 5LC1A 4AVYA 3K70D 3LXRA 4H16A 1L5VA 2ADOA 4KX5A 1XTPA 1WMFA 2CE7A 4X7PA 3CG4A 4GI5A 3VPDA 1HNXB 3I0NA 5HFNA 1DTWA 1E4OA 3JALA 3U3MA 4ZYXA 5BQXA 2XXAA 1V4VA 1U0EA 4K88A 4D9IA 4EITA 3L8YA 3PJGA 3VOBA 1KYQA 4Q7EA 1YASA 3HCFA 1G1AA 1RI2A 1Q1AA 2R8XA 3EIQA 4EI7A 2I3AA 4W7SA 3UJBA 2FP4B 2Q5QA 3LBFA 2FLWA 4CUKA 1FFCA 1ITZA 2QVLA 3HRKA 3DDHA 3PUIA 5L45A 4IDOA 3F6SA 4TXMA 4DV3B 3V9AA 2ERCA 1XK6A 2SCUA 2QV0A 3K5HA 1Z08A 5EIXA 1N6IA 2H1FA 1P9WA 2XT6A 2V6MA 2AH5A 4CHGA 1QKIA 2GUGA 3BM5A 4LYDA 1DMSA 3EPRA 2JFGA 4ZPXA 5EJ5A 2DPMA 1POWA 2EQAA 1V47A 3VH2A 1Z75A 2Q46A 4N0DA 1UAGA 3WYEA 3KYJB 3U7GA 2NO0A 5I45A 1ESZA 2X2PA 3R0JA 2BHSA 3AY7A 3ZYZA 2AMFA 2QVGA 3IQDB 4C3ZA 1Z39A 3ABQB 1B2LA 4WSOA 1SOMA 2EFHB 1OTYA 1EQAA 1EZ1A 4Y18A 2VP5A 1MO6A 3GLQA 2JDIA 4XWAA 2W71A 3P71T 1Z6XA 2IDZA 3KQOA 3TTUA 3X1ZA 2C4HA 2BEKA 3BGOS 2FR8C 3HB4X 1IRXA 1CC1S 1M1NB 1JEOA 1PX2A 2X3YA 2ZI6A 1II9A 4P4GA 4JI4B 4BO5A 2IYZA 3OHSX 1A1SA 2NWQA 2Y1CA 4BWYA 2Q4DA 4BN4A 5K2OA 4WXYB 3FPJA 3TL3A 3D6MA 5I9BA 2WU8A 2XE7A 1EWYA 2XUQA 1QC5B 2AZXA 1E3WB 2QRMA 1BA2A 2W9XA 3N8DA 4GYWA 4EG1A 2IF0A 3G9ZA 1U80A 2Q3CA 5C7OO 4TKLA 3F3SA 2FPRA 1M8GA 2KJQA 2FB9A 2DFDA 5ECYA 2PRSA 2CLHB 2E4XA 3NETA 4J43A 4YJFB 4W5TA 1Y4DE 4LGYA 4MUBA 3IUNA 5B3JC 3NOVA 1QVWA 2FRXA 4QRIA 1BDIA 1S2IA 3K2BA 4AIIA 3CN9A 1ZCBA 4K2AA 3CPSA 4X44A 4LNAA 5T8KA 3TW8B 1XWFA 2O6LA 2F4VB 4MUJA 3B20A 3Q5DA 1CZOA 3S2YA 1C7IA 3GJYA 5K0BA 4B3DA 5KNBH 1UF9A 4ZC1A 3L0SA 1U7ZA 3K70B 1C9NA 1M6EX 2B83A 4QUKA 5AM5A 4LQ4A 5ELLA 1ISSA 3N0WA 3NPAA 4RYLA 3K0SA 3CJQA 3IJEB 1VJTA 3GZ4A 2CUKA 1CHNA 3QQPA 3TR5A 1U8ZA 4GC5A 3WMXA 1NI4A 1R5NA 3ZW9A 1GQQA 4WLFA 1DU4A 1JFFB 1NQWA 2EJUA 4HEA6 4WA7A 4LBWA 1VG0B 2Y2UA 3B1WA 4BBZA 4MVJI 2WG1A 3H11B 3RI3A 1JHDA 1V41E 3KD2A 1HZJA 1L6RA 2VJMB 3QX9A 3TLJA 4RZXA 3FPBA 4IJUA 2PRIA 5DISB 1NUUA 3T9EA 4FILA 3CONA 3TE7A 1OIXA 2ZXUA 1YV9A 1G21E 1PZFA 1REQB 4FLFA 2HK6A 3KKQA 1ISJA 4I4TA 4OQ4A 4XCVA 2DTDA 2XZOA 2AXEA 4ZRMA 1R5JA 1I33A 1QS0A 1P61B 5FBLB 3N8NA 4L3VA 3D6NB 3C3JA 3C14C 5C32A 3FYDA 4HF7A 1EUQA 3RTAA 5JMPA 4NMLA 1JA9A 2C7GA 2HZBA 5FWYB 3CWQA 3K8QA 2WQZA 5AVOA 5BNTA 1ULUA 4GBGA 5DTJA 3VC7A 4LFBB 2VJAA 1RYYA 1YIAA 3QLTA 4QRHA 4UAVA 4YFVA 4P35A 2ECKA 2RC6A 3GCZA 2WK1A 3MNFA 4QLOA 4UXHA 3ICWA 3CC8A 2FG7C 4UULA 3EVTA 1S9HA 1KJNA 3B9QA 3S28A 3FBTA 1DJQA 1FEZA 3OCXA 4XB6B 2QJOA 4YP9A 3V3KA 3ZUPA 4B79A 2ZPAA 1KSGA 4QEDA 5BSMA 3T15A 1O9GA 4DG8A 4PHGA 4RD1A 1M8KA 10MHA 3UCFA 3PC8C 1WV0A 2F6RA 2KQUA 2VJKA 4BU1A 5EP4A 1A4IA 1OREA 2WT8A 1E8NA 3KKZA 1BAPA 4PLPA 4KVZA 1NTOA 4UMVA 4HUQB 2C5HA 2JGRA 1BU5A 3BHMA 1OJ7A 5GMOA 3IEIA 1T9GR 1H9CA 3AEUA 3K1YA 5CD9A 3S6JA 1JJ7A 2P5UA 2HAEA 1W2WB 3IODA 3Q6MA 4GPTA 4M9UA 2O1EA 5T4BA 4XYLA 2PYDA 1PEYA 4RANA 4S1OA 1K6MA 5F2KA 1KHTA 1X8XA 3MF4A 4L4UA 3UPDA 4OUKX 1VZ3A 4P93A 4TM8A 2E3JA 3LU1A 4MKIA 5DW0A 3X1JA 4OAQA 3R0VA 4HJXA 2I5PO 4JUCA 1K63A 2O5CA 1DQRA 3MMPA 4OGGA 1Y6JA 2GGSA 4WJZA 1KY5A 3CLUC 1FP4B 2XTNA 3PFNA 4M8KA 5L6LB 4MW4A 3JY6A 1UBSB 4NHOA 4QVGA 1AT1A 3S2EA 1JDPA 3PPIA 4GH5A 4BAGA 4AUNA 3DXXA 2I6GA 2UYHA 3SYKA 1HT2E 5K09A 3M89A 4IEIA 4RJJA 2XCTB 3F6YA 3TVDA 2NNWB 4UBKA 4W7IA 2GDJA 3DOUA 4BYGA 5IDXA 4ES6A 3RK1A 4WZZA 3MMNA 2Q9AA 2EATA 1V3UA 1T34A 2UZ1A 1TI7A 3GZNA 2JAPA 3MWKA 3QJYA 4IXNA 2VUSA 3PC7A 2EEZA 1KMQA 3SEQA 4O2BB 3H97A 5KSOA 1OA1A 2AR0A 2FMIA 3W2TA 4KO1S 4K6MA 4RD4A 4EDHA 4QODA 1DV1A 3KR2A 3DEAA 4ENTA 3F73A 4F97A 1JG2A 1GAJA 1OVGA 2WWIA 2WTUA 1LDBA 3CO0S 4ZTUB 3CO5A 3QPUA 4ZQCB 4B4WA 4W7HA 1O6FA 1VGRA 3ONNA 2FPWA 1P72A 4MV0A 1O95A 1JU3A 2VVTA 4YAGA 3FLAA 3JQBA 1IBMB 4V0LA 4FS3A 2Z04A 3CXUA 4G1FA 2AG0A 5AKLA 4BNVA 5JNSA 4D4MA 3LSTA 1GU0A 4F86A 2X5NA 2QNIA 4RBNA 2DUUA 4ZEWA 4A7PA 4Y2VA 1SVNA 4UVHA 5CLGA 1CUSA 2PKQO 2BMDA 3HG7A 4HDOB 5HVNA 1LK7A 3EIFA 5AIAA 1N0VC 2OO7A 4WUVA 2O3JA 4KP7A 4NX2A 1TFRA 3ND6A 4Q0MA 4LY0A 1I3MA 2W2QA 3TRIA 4DXAA 1ND6A 4HPJB 2FNAA 7REQB 2UV8A 4RIHA 1LNSA 3KAPA 5I5EA 3MJRA 1EVJA 4PX5A 3VKUA 3EK2A 3DB2A 5BMVB 2AXQA 3WNCA 5HPYB 3Q8KA 4UBLA 1PZEA 2F4NA 2D5CA 3DMFA 4XGNA 2QX7A 3N2GB 1MIOB 4UHJA 1T1SA 3HCEA 2EZ4A 3RF7A 3Q3JB 4FMDB 3WLTA 3ROMA 5ALMA 1BH2A 3JZMA 1N1EA 1TC1A 4L8VA 4X5OA 3OZXA 1W4RA 1XA4A 2BUBA 2YC4C 2ZI3A 1Z4JA 2WDPA 1E1RA 4MROA 3H1FA 5IYZB 1CRQA 2AI3A 4A1OA 1UP7A 1ZC4A 4KFSA 1M0TA 2UU9B 1BHJA 3RVOA 3J7AC 3T1OA 3IE0A 3PC2A 1W52X 5IXYA 1MZPA 3FETA 1LPOA 2EP5A 3S2ZA 3ZVMA 3EH2A 3OF2A 4WOCA 1NUQA 1UM9A 3A3OA 4RDHA 2IHBA 5CYGA 1JG4A 1RC1A 4RKWA 3W6UA 1TQ4A 2GO1A 4EW6A 4HAVA 4BNHA 2F3QA 4V0MA 2IOFK 2QE7D 4MWEA 2KI5A 4CCYA 3QG5A 5T3YA 3WQQA 4MGEA 1Y8CA 1OH6A 4B7XA 5LZ8A 2GRAA 3DLPX 3N0XA 4QUIA 2GASA 1NFRA 3L6BA 5SYMA 5K0NA 4AW9A 3RIXA 3L7NA 3PFKA 3TIVA 1HMYA 2ZBRA 4B75A 2VATA 1A9QA 1QSGA 2I6UA 3K09A 3L7CA 5AVJA 2X7XA 2GPBA 2Q3LA 2CNKA 2VT3A 3DE6X 3H2IA 1L4EA 2WIKA 4H4CA 3M2TA 3RAGA 1RZRA 2ATIA 3K9QO 3C5CA 3FGOA 4O4IA 4DLAA 4M8SA 3X43A 4FNAA 1HE8B 2V4UA 2PZMA 4WOJA 3JQ7A 4M38A 5IVHA 3T7EA 4M0DA 4P83A 1FJHA 4RGBA 3M6MD 3PQ6A 1BVRA 2R7LA 3KVRA 4WDRA 2CZCA 3G2PA 1QO9A 3TCKA 1JLRA 2IVFA 4O6VA 2YL2A 4G9GA 4S0XA 3TTVA 5D85A 3D2LA 2ZZKA 2BEUA 4NOJA 1W29A 1U2DC 4JB2A 1DO8A 3A6ZA 2JIQA 1A9SA 2WF9A 4WVFA 4YXWA 4DLWA 3QKWA 5KYWA 2OCDA 1PG2A 2J3KA 2J9YB 2UVQA 4Z3KA 5IU6A 2DERA 3GDOA 1ABFA 1SAYA 3AB3A 5GTDA 2A5JA 3D8UA 4ZC8A 3R9IA 1A8SA 1G3RA 3RK0A 5TXGA 1AIPA 4F5WA 2BGKA 3IOYA 2ATEA 1W581 2YWJA 4J0EA 1VI5A 4Q4AA 1Y6GA 3BTOA 4DMRA 2ZYIA 3WBFA 2EW2A 2DWUA 1I6MA 3CNNA 4HR7A 1HE2A 2ODNA 1BIFA 1ZGGA 2YTZA 1IBRA 5JU6A 3NEYA 3B1VA 4EYQA 5F3WB 2C5AA 1M34E 1Y0BA 1USVA 3WXMA 2WF8A 3H05A 1THTA 4PLHA 1NBWB 3R7WB 1MO4A 4MKHA 2XUKA 5AQEA 4MIYA 5KYUA 3SXPA 4D4JA 1AGYA 2QRQA 4PQRA 5TJ9A 3IKVA 2P1RA 2RI0A 5IVIA 1DX9A 4JU9A 3VHLB 2HWYA 4IVPA 2WFAA 2IKSA 4R16A 1GUYA 3EC2A 3NWPA 5DPMA 4A5OA 1QNFA 5HILA 1R10A 2VRBA 2E2WA 4G85A 4HGZA 3DC7A 3LQFA 1CF2O 4I6JA 5D6NA 3TX6A 4CF5A 1C1DA 2VA9A 1GZSA 4J2OA 3TTTA 5AKJA 3QEAZ 4LX8A 3USCS 4P4NA 2OUKA 2I8LA 4Q3EA 2E0IA 3C3WA 4R7ZA 3DMRA 4R5MA 4RF3A 3TRJA 3GCXA 2FUCA 4CJXA 4QPNA 3JVUA 5DFAA 2DG2A 4FWTA 4UD6A 1N6PA 5C81A 1IOZA 3QXHA 3TLGB 4PN7A 3P20A 2FEOA 2OZKA 4PZYA 3IAM6 1SQSA 4YRPA 2RIRA 1MJGA 3CPHA 3N2KA 1ZAYA 3R7BA 3T9BA 4PFSA 2ZB7A 1CDDA 1GZHB 1R37A 4G0OA 2QTFA 3KALA 1ECJA 3B13B 3ETNA 4AP9A 5KYXB 4KW7A 4UTOA 1XCGB 1F14A 3RBZA 3SCZA 3T54A 3B5EA 1X1BA 3T12A 1OI4A 2XXJA 3L0IB 1E1KA 2AN4A 1FUYB 3FYUA 4IYJA 1TM5E 2DWCA 3LY7A 4QGSA 5ICMA 1ST2A 3FFWA 3H9UA 3ORYA 2A5FA 2J59A 4C2BA 3PJEA 2X5OA 4CM9D 3VNUA 4X1YB 1J00A 3NCTA 1DKLA 2O4UX 1BX3A 5KVQA 2FEXA 2Z2ZA 2AW5A 3TK1A 1SVUA 2F3UA 1L7PA 4X7RA 1AV7A 4P5DA 4I4TF 2J0UA 1CNEA 3GNQA 3R77A 1UH5A 2NU6A 3GEDA 3MCAA 4JFAA 4PONA 3IMCA 1XXLA 3F9CA 1AMUA 2OFWA 1P2GA 4Q7MB 2C2ZA 3DDNA 1L4YA 3TXAA 2JLXA 4JLUA 5THQA 1JHAA 4P9NA 1YU9A 3F3MA 2BSQA 4EHBA 2G5PA 3QPDA 2OZLA 4NPCA 1E1NA 5EAIA 3DMYA 3W4KA 3PXEA 2ACKA 3NDPA 3WISA 1MABA 4K6FA 4XVRA 4C07A 4ZI5A 4F5YA 1JSRA 1KQ3A 1VLQA 3W5UA 2XZTA 3ROZA 2B3DA 4YJ2A 4X90A 1KZ6A 1RXYA 2WU3A 2X13A 5HIKA 3QOXA 4RMJA 4PCLA 4RL6A 4B74A 5DE3A 2JZOA 2YN4A 4CUZA 4K46A 2JDID 3LDAA 4IYRA 3GPDG 2AUNA 1VBMA 2NV0A 4FOOA 3W9SA 3SHOA 1FQJA 7GPBA 3HO6A 1FLNA 1IB6A 2PTGA 3PR1A 3JVDA 1T3SA 3M5PA 3E3LA 1F0KA 1O5IA 4OG2A 1EDOA 3EVAA 4D26A 3T5PA 2D1TA 2ZKIA 2BRUA 4B48A 5JSHA 1LDYA 2EDCA 3K8YA 1PT8A 4LRYA 4C7BA 1JBEA 1RRCA 2H1HA 2B36A 2P78A 1Z0AA 2I7CA 2WSMA 4FU0A 4DYDA 1ZD5A 1QMGA 1RCUA 3EF3A 3KHTA 2CYAA 1UPBA 1T4GA 1VB3A 2P0EA 5KTKA 3VAYA 3HWWA 4JI0B 3EVZA 3FPAA 2O2JA 2G3YA 3WMFA 1USGA 1L4KA 2W5UA 2QTVB 3MMZA 5F7XA 1UPUA 3PICA 2H9YA 4HB3A 1YU6A 3DDZX 3VX4A 5D5QA 1FS4A 3OEWA 4JK3A 2BEVB 1DNPA 5AKGA 4IDHA 5KTMA 1NF9A 1J8FA 3BRWA 1YRAA 3P8ZA 3PXAA 2GT1A 3F9RA 4UNRA 2HLPA 2WU4A 2XWJI 2WSSA 1L5SA 1RFLA 2ANCA 3ZKAA 2PX5A 3GA5A 4TVOA 3UA3A 2ZG6A 5ALKA 3L4SO 3WMEA 1PT6A 3JALB 1SU8A 3OUTA 3LZ6A 2XXAB 3UA4A 1Y37A 4D25A 4FVTA 2PO7A 1M5TA 3Q15C 2ZB8A 5IK2A 2XA9A 5EVCA 4BB0A 1NASA 1I1QB 4QYXA 1KJ8A 1GM5A 1BGVA 3M6XA 2XT9A 1G8HA 2V0CA 2YOFA 3A1DA 4GX0A 4YAFA 4XGKA 2VTBB 2PRYA 2VHUA 2B8JA 4E5SA 1OYYA 3EW9A 2X1LA 4YASA 1F60A 4PQEA 5ARCA 4E2YA 4GR9A 5LJIA 2PMFA 2SCUB 4OSOA 3V4ZA 1TJ5A 3FPGA 2P3OA 1J70A 3N9IA 5CR9A 2Z9CA 2VSQA 1L3IA 4BO4A 2QX9A 4JBNA 3IPCA 2LXNA 3GR6A 5JSYA 3RD5A 4L2IA 2AI2A 1GPMA 2A0WA 2OWDA 2B8WA 1Q1GA 3BFVA 3ZHXA 1NUAA 4RETA 4B34A 2YWGA 1C5KA 3DCIA 3KSUA 4F3NA 2WW8A 3JVEA 1FS6A 4CODB 1GPUA 2ZCVA 1SULA 3ZBPA 4TQGA 2A5YB 1T1JA 1NBME 2RHHA 4P98A 1IY0A 3SFZA 4KR6A 5EMKA 1V6AA 3GEPA 3HL0A 1K68A 3UY4A 4BDTA 2RGDA 5LQRA 1YZFA 3L1IA 2QTCA 2RB4A 2HADA 2OL4A 4MIEA 3JRNA 2G1PA 3AK4A 1ZK0A 3M1LA 4U39A 5J43A 3GUVA 4YJDA 1J23A 3I4FA 2IL1A 2B30A 2Q27A 4IUCS 3S4YA 3HYNA 4YRCA 1KSHA 1SNYA 1I3NA 3OCUA 2ZBUA 3LT5A 2OWEA 1N5KA 4FEAA 1NLYA 5ALYA 1M7HA 1QGDA 4OJMX 1EFCA 2I2WA 1E3JA 2F62A 3KD3A 4V03A 4GLFA 3MWFA 5K6TA 5MF6A 4B4KA 2OR3A 1PK9A 1GAQA 1K08A 1M66A 2UZ3A 3EIOA 4JB8A 4DM7A 2WLTA 1PGOA 3THXA 5H4HA 4Q9AA 3EMKA 2QD5A 1V48A 4E2XA 1IBLB 1AQIA 3V9PA 4UFNA 3TXYA 4NFYA 2YNMA 3WJ2A 3ZE9A 3QKSA 2M98A 1G6OA 2O2SA 1YOVB 4B17A 5JWHA 3P4UA 2SBTA 5EA2A 3QFFA 4NCAA 1T6BY 5JVDA 4H1UA 2GJ8A 2AQIA 3WIOA 2XE8A 4CRWB 4NBRA 4BWFB 3C6QA 5A4DA 2X0RA 2IUFA 2NQ8A 3KXLA 3FSEA 3HXKA 3LW7A 4JWTA 1IONA 3PC4A 1QJCA 1TT5B 2P9BA 4BNMA 2QEQA 2VKQA 1DXOA 3ZXUB 1A71A 5J4YA 2XKBA 2Q1TA 2XWQA 3LT2A 3QEMA 5TQ0A 4YRAA 1WCIA 3KB8A 1VCOA 1H42A 1P1HA 5MGBA 3SHWA 1Y3HA 2ZT8A 3RROA 4AKGA 1NI4B 3OQNA 4O4IF 2W2PA 4PVDA 5KQGA 5JNRA 2EBFX 4RLFA 2FHSA 4URWR 3U3RA 1NZFA 4BNXA 4C20A 4MA5A 1G5RA 5A7GA 2Y1DA 1V7ZA 4NZPA 1OB2A 1OAAA 4IO0A 1GRCA 1ZH2A 3JASA 3OFKA 2IYWA 4WZBE 4EY6A 1EHCA 2WVHA 2DHDA 2W37A 3MT0A 4BQPA 3CU5A 1PFKA 2CXXA 3IAXA 3OJFA 2XDQA 1QTIA 3LCVB 1NV8A 5EHXA 5IMBA 1SXJD 3M6UA 3MM4A 5E4TA 1Z15A 2ZJ4A 3NT4A 4JELA 5A7HA 3GN1A 2DOKA 5JPCA 5FWAA 1N3LA 1YGPA 3CNOA 3L82B 4AWBA 4UVGA 1PNQA 4IOKA 1O95D 3ZHVA 3JARA 1DFIA 1JS1X 2HREA 1DI0A 1LBTA 1NOJA 4P22A 1ZH4A 2YJTD 5F5XA 1W5SA 2RJ3A 3QNWA 2Z3WA 1ZVKA 4JY7A 3SEFA 3W9BA 4JYPA 1RYEA 3W5JA 4CMKA 2FKNA 4RLHA 4GSYA 2HHCA 3MUNA 3T61A 1BJTA 2O3SA 3ZU4A 1E9FA 2HA7A 2RHLA 2PDAA 4DUPA 3L7KA 1KSFX 4U7DA 3A3PA 5DYNA 4MTLA 1HLPA 5CIYA 4UBMA 3RSQA 1MD9A 3DKRA 2CL7X 4CCSA 4QUDA 1POXA 4I50F 5DNWA 1ZJWA 3M34A 4GOKA 4K9KA 1IU9A 5DNDA 5A9SA 4HN4B 2RBKA 2R62A 4NIMA 2POCA 4WCFC 1OFIA 1JLMA 3AL3A 2SHKA 1J7JA 2HRRA 1JIUA 5AHRA 1AA6A 1V8DA 2JFPA 1H1TA 4S12A 5T7BA 5TIIA 4ZO7A 1NBIA 1PJBA 1P7ZA 2PL3A 1WD7A 3CLVA 3I2FA 1BE0A 2Q6IA 2H11A 3O26A 4AB1A 5IT4A 3IEKA 2AIRA 3A2KA 2J5XA 2VN8A 5IT0A 1TO1E 4D8UA 4ZTZB 3AEUB 1BDJA 2JEYA 3DO8A 3K73O 2P2GA 2R8RA 3GJZA 3OQVA 4LNHA 3ZR4B 3RS9A 1KZHA 1D0SA 2IY7A 3CH4B 2ZUSA 3O0DA 4Z4QA 5G02A 2IK8A 1G17A 1Y4UA 3PQEA 1U1IA 2REOA 4X45A 3G89A 4HYTA 2HIAA 4M76B 4KR3A 3AF0A 4IXMA 2QD1A 1E5VA 4W1RA 3ENZA 1Y3IA 1IH8A 3I4LA 3OEHD 4G37A 1UC4B 1N5OX 1LK5A 1JWBB 2GHRA 3V7FA 3IP3A 5JI3E 5TQ2B 4RHTA 3TSCA 1AY0A 1LTHR 2JD1A 4Q12A 4QNMA 2QXUA 4YAUA 1OTXA 3NV7A 2W2VA 4KVAA 1EUDA 1L4BA 1NM5C 4L6IA 2O8DA 5HJ5A 1WBBA 1YONA 4IMPA 1I1HA 1IXZA 1MRSA 1H9AA 2BISA 1RI1A 4WH0A 2NO7A 3IHKA 1IK4A 2QX4A 3ESBA 3GZNB 5CG2A 3K5IA 4OQFA 1I0LA 2OP0A 3GJ7A 4X1IA 3Q7IA 3KQTA 4TLLB 1NUTA 2FN8A 4AQYB 3I83A 4KRXA 1RZRD 4TV8A 4OQMA 3OLQA 5DSTA 1YJXA 5AI4A 5A5VA 4RHEA 1IXYA 1EUCA 2HTEA 1SXJB 1B6SA 3RIGA 2ZT6A 2R97A 4CTMA 2Q99A 4M4SA 5EKDA 3BEOA 1Y5MA 4D5GA 3LHKA 1V71A 3HXTA 4O1HA 4PWZA 4MUIA 4JENA 3ZHRA 2B4AA 2C42A 3MT9A 4TT8A 3CA8A 5J5AA 3T3DA 3U3XA 2XZDA 4F2WA 3E1GA 5IEJA 3IKLA 1XJWA 1ZC3A 3KUXA 1ACLA 2IPOA 4NJMA 2OECA 3ISTA 4NYMR 3RSZA 4ARUA 4H1TA 1X7DA 3PQ8A 1HZZA 2ZSDA 3C97A 1OCEA 4HS9A 4LPSA 4KSYA 3ZBQA 3ZEIA 2I4NA 1DXYA 1W49A 2GPTA 2Q4RA 3AVPA 3M4YA 3P26A 3WSWA 3P94A 4BNUA 2VK4A 2ZANA 3LBIA 1KVTA 4IIYA 4P34A 1EFTA 4UBOA 5EZ6B 3ZLJA 3LWZA 4MGHA 4TZ0A 4BXOA 4D43A 5JG7A 1LEHA 1F5SA 2WJ4A 4CMGA 4PTZA 5KB3A 2VXCA 3ILYA 3ZE8A 4KMOA 3KPYA 1TEZA 3LY5A 1X86B 3OJ0A 4P0TA 3N0TA 4UHHA 1ILEA 3ZDAA 2P3SA 2P9FA 2QT9A 1BW9A 3B5IA 4ARZB 4D8WA 1I5EA 3KLBA 3WHKA 4ZVRA 4G0MA 1YFZA 4HXEB 4HVAA 4ZCLA 3SY8A 2GB4A 3ADCA 4DLZA 1MOSA 4PNPA 4U7WA 5A02A 3ZCQA 4NNPA 4COOA 4RV5A 2AOUA 4TM7A 5K20A 1U0TA 3GLSA 2R5NA 2Y1OA 3WFZA 1HG1A 1NG9A 1Y3DE 5BQPA 4BKPA 2VSOA 4CETA 3NDJA 5IULC 2HWKA 2IEBA 1UM9B 1WW8A 4HAZA 3K71B 1IIBA 3AVWA 2IE8A 5HQTA 3M0EA 1MZVA 4I9UA 3LUAA 4N1AA 4U1RA 1K92A 1Y9ZA 4F9TA 1FPMA 1JFTA 3P27A 4CCYB 1QVAA 1X9GA 3V4LA 4M6WA 1K06A 1CB7A 2L19A 1Q0LA 3BJIC 3T7KA 4NHEA 3TBKA 4XARA 5A2GA 3NDBB 4LZAA 4JUIA 2R79A 4OQXA 1FP1D 4OJQA 1G63A 2HXSA 3HA2A 4UHKA 3U80A 2Q4OA 3FJOA 5BSEA 5BPHA 1U7WA 4EF5A 1I0ZA 1IJEA 1ADBA 1J2JA 1U0GA 4TYYA 2PUVA 1RWXA 2HQRA 3AR5A 2YHSA 3OIGA 1ZGZA 1SUIA 1M1YA 4DANA 2XDAA 2YXLA 4RXMA 1AUQA 1J8DA 1RMTA 1O6CA 4H7EA 3H9CA 4N5LA 3B6IA 3IA2A 3JQ7B 5HMLA 2XQKA 5LSAA 1SA0A 3RU2A 5J3JA 4QM7A 1RFGE 3NWJA 4AZ0B 4J7UA 1G2PA 5C3UA 5C8YB 3KWJA 5I7OA 2GK3A 3KIPA 3TH5A 4E4RA 2QWXA 3QYAA 4R2XA 3AONB 4YAJA 2XF2A 5F76A 4AJNA 7MDHA 2O8FB 4FEEA 1L8AA 1EK2A 4NULA 5FBWB 3BBLA 1UBHS 1H2HA 1I7NA 1FTSA 2Q1YA 5A7FA 1PL8A 2CHEA 2OK8A 5BWLA 1L7OA 5DYTA 3E7FA 3RJ9A 5ENZA 1C0LA 4RULA 1Y5NA 2Z5VA 2AK2A 5ITSA 4Z7JA 4RACA 3O31A 1MH1A 3SMVA 1NUSA 5CYPA 4AKHA 1OZFA 4PV7A 1KC3A 4Q4AB 5EVJA 4Q4HA 4RJLA 1Q7EA 4DGQA 1R88A 3GRRA 1SCKA 4IM7A 4HEHA 4X7BA 1E0KA 3Q3CA 4RK7A 1QHFA 1XTKA 4BNYA 2DF8A 1M2JA 3F74A 3I9LA 3AWDA 3OC0A 4BCCA 3R3YA 2WKPA 1QIMA 2K2WA 3WGKA 3BJRA 2UYCA 4OLBA 3ADDA 1JJAA 3A58B 4QUEA 3S7ZA 2B4RO 4MS1A 3VKFA 1KDOA 5LOVA 5LJLA 4D0LB 2WJJA 4Z9BA 3BYZA 1Z2PX 4LJ8A 1YK0A 2V98A 4A73A 1UC9A 4NFHA 1TIPA 3DOIA 3FF1A 3ITEA 2X6TA 5AKHA 4W9MC 2W6JD 3IQHX 5TJHA 5JD3A 3I04M 5JFOA 3PL5A 5E7IA 1X94A 1AUVA 1RZUA 2NXJA 1WO8A 2OCKA 2G77B 1Y80A 5A05A 4YT8A 5IC4A 4A6PA 4UHFA 4C89A 2O1XA 3OIYA 4HC4A 4N48A 2PKYX 4WZAA 1C1DB 1QWSA 1G7TA 3X2SA 5KNCA 3V8QA 2TRSB 3BVPA 3KE9A 3U3OA 4EHDA 5EHZA 1E5LA 1MJNA 3OX2A 4FYMA 5AQ1A 5KOYA 1FMFA 1CSEE 4RS3A 2AX4A 5C7LO 2VAWA 3ZTTA 3RYCA 3C3DA 3BSWA 4RTLA 4N5NA 2E87A 4MRMB 3HGTA 4FFSA 4NU0A 4CL8A 1I94B 3UUEA 3H2ZA 2C98A 1FYWA 3N2KB 4PHCA 3BRWD 3MMXA 3ICPA 3W5HA 3ECAA 5ILGA 2Q7DA 5LBTA 3FPLA 4YT4A 2GN2A 2WSSD 3KVOA 4F3RA 4N7MA 4RAOA 2Y68A 2KBEA 4PE5B 3E3AA 2ESRA 2Z6QA 4IY1A 1N8TA 1U5AA 2G0AA 3CEAA 3JTEA 4U5XA 4DWWA 1EM8A 2N47A 4DDHA 4OHUA 1QXSA 5EJ7A 5KVCA 3UMGA 4R71A 5C7YA 4NBWA