4RFSB

Structure of a pantothenate energy coupling factor transporter
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
ENIISVDHLTYQYDENQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transport protein
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA2
publication title Structure of a pantothenate transporter and implications for ECF module sharing and energy coupling of group II ECF transporters.
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 72
structure length 275
sequence length 275
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rfsB00
1T8TA 1E4VA 1W4AA 3TVDA 1ZW6A 4ZI3A 4XTCS 3LO5A 1E0SA 4Z8XA 1XD8A 5FTKA 4PHHA 3UATA 3M0EA 2JEOA 4BLSA 2XXAB 4ERNA 1GL9B 1JECA 4P4SB 3CX6A 2WMOB 5FUYA 2X77A 4V0OA 1X8JA 2WAXA 1QZXA 2Q9CA 1HQYE 1DAGA 2CCGA 3TSWA 4HLCA 2HDNB 3C5CA 1CU1A 5EZ5A 1N5JA 4B73A 5FR2A 1ZNWA 4FCTA 4DHEA 3THYB 3QF7A 1XDBA 1QHGA 2SHKA 2IS1A 1IAQA 2XEXA 4UNQA 4A0FA 5KPDA 4B47A 4NYIQ 5JEDA 5LBIA 1SGWA 2R6CA 1E2LA 4NPHA 3L0SA 3DO6A 4LRWA 1CP2A 2FH5B 2QSZA 1CR0A 2JJ2A 3UG6A 2VHJA 1CTQA 3OE7A 2QZ4A 1GVNB 4GPTA 4RKEA 1ZIOA 1KO7A 3BB1A 5CM8B 1L4YA 1E2KA 1U90A 4AG6A 4CEHA 1KMHA 4MRRA 4V0MA 4PC3A 1ZP6A 3QF4B 1HT1E 1PJRA 1G64A 2ZROA 5JWHA 1J70A 1GP2A 3PVSA 3TW4A 1P2VA 3U4QB 3QPVA 4PC7A 3GFOA 4JL6A 3CKLA 1JNYA 2BVNA 2F1IA 3FDIA 3K70D 1N6NA 2J7PD 4HAWA 3F8TA 3NBYC 4XWAA 5FUWA 1E9CA 3K09C 2V3CC 2P6NA 3FYHA 4GMXA 4MRNA 4Q9KA 2IUUA 1S8FA 4URXR 4JKIA 2QORA 1XNJA 3KXLA 1FMLA 4A4DA 4L16A 1ZD1A 3Q7QA 4M1KA 2NG1A 5GJBA 3TK1A 1VMAA 1Z0KA 3NHAA 4M0LA 4HB4A 3GLHE 1QHNA 2JASA 5GJWC 1E9EA 2F7SA 1Z6TA 1E2IA 1NMXA 2ANCA 3QEOA 1YZQA 1GNRA 3M1IA 3I92A 4QKQA 2IT1A 3R20A 5JCPA 2R65A 5K8LA 5JHGB 1ZNYA 1O3YA 1PLJA 3E2IA 2GA8A 1XTKA 4BE7B 3MWJA 4ASUD 5ELXA 4ITRC 2OAQ1 2ZI9A 2DHRA 3VKHA 4B75A 1Z8FA 1XTRA 3DKVA 4BLQA 4BEBA 2V1XA 1G3IA 4FN5A 4MUBA 3CPEA 4H9GA 3NDBB 2V1UA 2CMKA 3U44A 4DT1A 2BBSA 1SKQA 2KWIA 2V55B 2VP9A 2RMKA 1KK0A 3SYLA 1PUJA 1WE2A 2QUZA 4CW7A 5J5CA 5H8WA 2IS4A 4OI0A 2CCKA 3DM5A 4CEIA 1N25A 4A8JB 3LRPA 2D06A 4AKGA 2V8OA 1T3LA 3U3RA 1XB2A 3VFDA 1LTQA 4C4PA 3TUJC 2I3BA 2RGDA 4XVUA 1E3MA 2ZUDA 4GZMA 4Q4AA 2ATXA 3IO3A 1W2HA 4PO8A 2J7PA 2WIAA 4PQYA 4RCYA 1KJZA 4LV5B 2R62A 5SZKB 3WHLA 4CDGA 3U3OA 4YC7A 1U8YA 1TF5A 1U81A 1ONBA 4DLSA 1CULC 3LVRE 3RS3A 1KSJA 3WRXC 2GZDA 4GOKA 4UXJA 2DWQA 1E1QD 1NLYA 4F4CA 5JJLA 2AX4A 4BFZA 3QG5A 3BBPA 1XMSA 2BBTA 3W3AA 4AC9A 3ECCA 1AGRA 1J90A 4RD2A 4S2EA 4NYJR 3UIEA 4CVNA 5CYOA 2CK3D 5AR1A 3PIRA 1P9NA 1US8B 2GILA 3AB3A 3FKSD 1JB1A 1GAJA 1P75A 1VCIA 2IW3A 2FGJA 1XBTA 3D7MA 4QGGA 5DSZA 3S1AA 3VR4A 3N2IA 4ASUA 2ZE5A 1G4UR 2VSOA 2WJJA 4FMDF 2D3WA 2GDJA 3A1WA 5DI3B 4IDQA 1F48A 2FN4A 2P5SA 2XJ9A 1ZBDA 4Q1DA 4C0HA 2H18A 3L43A 2J87A 1OLOA 2OSBA 1UPTA 1JBKA 1Z6XA 4IDHA 2ZI5A 2FPKA 1U0HC 4E22A 1Z63A 3GEEA 4NYMR 5C2JB 1XEXA 3KQHA 3ZQJA 4LC0A 4R2HA 4A8JC 4PAMA 1G20E 2HJGA 4US1R 1E0KA 5D3MA 2WWFA 4XVQA 5AJZA 2BHRA 4LYHA 2OXCA 5JZVA 1GM5A 1IN7A 3UKDA 4EFMA 2ANBA 2VHQA 4JJZA 3VR5A 3NH9A 1ZU5A 3SFZA 2XTMA 3X1ZA 5KDDA 2IWHA 3EG5A 2A5FA 1Q22A 4DDUA 1L2TA 3SI7A 2ODEA 2KE5A 2AKYA 3LW7A 4I4LA 2IXEA 1E1QA 2PZEA 3H0KA 3TBKA 3IPXA 3VR1A 2QTFA 1NN0A 5DYGA 3QKRA 4HAVA 3CONA 1E99A 1TX4B 1FTNA 1OE0A 1W5TA 1R7RA 1ZM3A 2XJ4A 3MAAC 2CK3A 1JXMA 4IEIA 3HWSA 2GJSA 4DKXA 3FKSA 4EPTA 3KQLA 2E87A 3R8FA 2EYQA 5A0FA 3EIEA 4RZXA 3WYGA 2QG6A 1IHUA 3RS0A 3HYTA 3IGFA 4BFVA 3NTUA 1DG3A 2OCBA 2ZSEA 3EAQA 5HZHA 3GLIE 1WBBA 3L8YA 2FA9A 2A5DA 5CDFE 1IOZA 4BFXA 1XMJA 3GJ8A 3NDPA 5EXTA 3C8UA 4AYWA 2GBLA 1KK2A 1G18A 1KZ7B 3MWKA 3VHLB 1W47A 3X2SA 5C1BA 3DMNA 1OFIA 5EJEA 4TWZA 4URZR 1U2RA 4CEHB 1KMHB 2DWPA 1G19A 1XEWY 1D2NA 4D4LA 1XTSA 5GVRA 1T6NA 1VYTA 4M9QA 4DLYA 2O8FA 1DS6A 4TSFD 5G40A 4RY2A 3ZS9A 3L0IB 4RSGA 3B1WA 1Q1QA 5KUTA 1CR2A 3W5IA 2OLKA 4JBXA 1ZC3A 4KSCA 2WJIA 1FP7A 2UZIR 1GL7A 1R8QA 4DB2A 3PG5A 1PVOA 3LQRA 1N6LA 3F0TA 1CRQA 5JI2E 1IJFA 3L2OB 2Y8EA 1P6XA 5FPYA 4DBLC 2WICA 4HB2A 2W6ID 1RRGA 1Q12A 2K5UA 3JZMA 1DTSA 1VYUA 4NDZA 2H17A 4W5HA 1JQJC 4TN1A 3QQ5A 2HXYA 1KDTA 3CM0A 1DELA 4E07A 4YMTA 3ZJYA 5SZIA 1L7VC 3C5HA 5CLLA 2YC2C 1AKEA 1OXVA 2C95A 2I1QA 2ORIA 4W5JA 1E2QA 1XEFA 3HPQA 2ZJ5A 3T1VA 3U44B 1S3SA 2ZREA 4B35A 3BOSA 1ZNZA 1D5CA 4M1MA 4Q9HA 5FUVA 4F38A 3EIHA 2HYDA 1LF5A 3RYTC 5FPHA 3WNBA 2ZRGA 4DLTA 4CEIB 1E2DA 2VL7A 2CVHA 1KGDA 5KU1A 4MYHA 4JMPA 1BKDR 1IXSB 4TSFA 2LCFA 3KDSE 1K8RA 4QRHA 3K70B 2F9MA 3P32A 4QGAA 4DCSA 1CKEA 2IUSA 5AUNB 1GITA 2HYIC 2O8CA 3SQXA 1SVLA 3DMDA 1KY2A 4HLUA 2AD1A 2Q6TA 1OIXA 5BW8A 3I72A 1NIPA 1Q20A 2OO7A 4POAA 2P6RA 3EA5A 3EC2A 3TAUA 1TQ2A 5GJCA 3X1WA 4B3DA 4OHXA 1HUQA 3A4LA 1X8LA 3GLGE 2GJ9A 3GJ6A 5IK2D 4AKIA 4M1SA 5EUMA 4LK2A 4TTPA 5KNBA 2W6IA 4PR0A 2J0SA 4OJKA 3OIUA 4GFDA 3LQQA 1BYUA 5J4HA 4EJSC 4PPNA 3BE4A 4FD2A 2IK8A 4P0TA 1OIWA 2DBYA 1JEDA 2FFHA 3S1AB 1X1RA 1W0KD 3EWAA 3KXKA 1MO6A 3ADKA 3H1TA 2DCUA 3T15A 4MKGA 3C16C 1HEIA 2NO0A 3UWOA 3FVQA 3OHMA 4WZ6A 3UPUA 5FOTA 4A2PA 2G0NA 1HE1C 2ZYTX 2XB4A 1OB5A 2GK6A 4TQ9A 1G7RA 3QE0A 5EE9A 4MH0R 4JLDA 4RD6A 1K5DA 2AFHE 4XWKA 1Z6GA 2REBA 3T34A 2XGJA 1FMJA 2AKAB 1PV4A 3I5XA 1XEXB 4F4JA 121PA 3Q3JB 4URYR 4LPKA 4TL7A 4C7OA 1E2FA 2GXSA 2OV2A 1KK1A 5E7IA 3TR5A 4BLRA 2ZI6A 1OFTA 3BS4A 5D3MB 4HUQA 4HB3A 1Q0UA 4B3BA 3QXJA 2YOGA 1R5NA 2FMXA 4LJ7A 3U7EB 3K70C 2ZJ2A 4KBFA 4W9MC 1G1MA 3AF4A 5KSPA 3W90A 2GAAA 2RCNA 2IYLD 2YNMA 3THWA 3AVWA 2VEDA 2V6IA 1NVVR 4IHQA 5HTKA 3K09A 5IK2A 1NBME 2C2HA 1XTJA 5EE1A 1OH7A 3QKRB 1MV5A 4L8GA 4C9BA 3PR1A 2WKPA 3QEJA 1A82A 5FTMA 3AGQA 4URWR 2QI9C 2WBLC 2BV3A 2IC5A 2ZS9A 4IW3B 2F55A 2ZSFA 5FUXA 4P4UA 5UKDA 1KJYA 4JYBA 1M6NA 3TE6A 1W0KA 2NZ8A 2ZJYA 1IXZA 2QTVB 3OFND 3H86A 1VCNA 5HE8A 3SYNA 2RGAA 3QKTA 3D3QA 2ZAOA 3MJHA 4BASA 3RRNA 2ZE7A 4GOXA 3B1ZA 3ZH9B 4BQSA 4MITA 1W7AA 4NP6A 3B5JA 3T1QA 3T1TA 2AL7A 1VG0B 1UM8A 3LX5A 2HV8A 4ZCMA 3W8RA 5TY0A 1CJVC 3UMSA 4JLJA 3AH8A 4PSKA 5L3VA 4ZDJA 1J8MF 1A2KC 1JR3E 3CRQA 3K0AB 4LBVA 3TRFA 1D2MA 2N1BA 2CNWD 4Q47A 1GNQA 2EVWX 3KQNA 1G7TA 3ZZUA 3K1JA 2GXQA 3IKJA 2HF8A 4B33A 3FMIA 1FL9A 2O0JA 1Y3AA 3NEJA 3R9WA 3LX8A 1Q1EA 1TU4A 3F3YA 5DGXA 2HT1A 1KI4A 1SHZA 3W5JA 4DCNA 2YZ2A 3VR6A 4D26A 3HJNA 5JS8A 3RS4A 1XWIA 4FMCB 2DFLA 4M9SA 2GXUA 2JJ1D 3KX2A 721PA 4RJLA 1UKEA 2A30A 2YOFA 3EPLA 2WJYA 4LJ9A 1YE8A 4MKHA 4QNMA 3SS8A 1XCMA 2E9SA 2WPDD 3GP8A 3OFNA 1HV8A 4AURA 2OT3B 2F1JA 3IPYA 4CRWB 3VX3A 1AZTA 2FOLA 1ZM2A 1DADA 4CEJA 3OAAD 3BH0A 1XJCA 4V0ME 4LHVA 1NKSA 3G5UA 2GCNA 4RFVA 1TADA 4MUAA 1HE8B 1YR6A 2ERYA 4FINA 5EP1A 1E2NA 2IYUA 1JJ7A 4Y0VA 1VYVA 2XNDD 4LGMA 4ZIRA 2I1VB 3FFAA 3HPRA 3KB2A 1NN5A 2IHBA 4OQFA 1Q44A 1X86B 2CNWA 1NVUQ 3MD0A 3O47A 4PO1A 1H8ED 1N6KA 2ZJAA 2RHMA 5KSZA 4MGZR 2O0KA 3SQWA 2IYWA 3QXXA 3K0CA 2CDNA 4BZXA 3BB3A 1EFRD 2O0HA 1S0UA 1EX7A 3IEUA 4NCNA 2ZI4A 3HU3A 1FOEB 5E3HA 1ZYUA 2Q9AA 2WWYA 3VNUA 4KBGA 3VNVA 4HEJA 1HYQA 4RD3A 4JLKA 1GTVA 4KYIB 3K0SA 3KJEA 2O8CB 2X1VA 2BIFA 2P2LA 4C0KA 4URUR 2Z4RA 3U3JA 1UJ2A 2EW1A 4U00A 2EFHB 4MYTA 3PUXA 5K8UA 1N6IA 3A1UA 2ZS8A 2D74A 2JJ1A 1P72A 4JLPA 5G41A 1WQ1R 2A78A 3NIBA 3PITA 4BLPA 3ADCA 3CRRA 3QIAA 3BGWA 4KSBA 3RRYA 1LNZA 1DO0A 1EGAA 2WPDA 4M8NE 3SHWA 1W0JD 4HLDA 3U5ZB 2FZLA 2VBCA 1AK2A 2XTNA 2FWRA 1T4GA 3OAAA 4J0QA 2QA5A 5L8VA 2AXNA 2GRJA 5D3QA 2WWGA 4IDNA 4Q19A 2PH1A 3VAAA 3CWZA 3ZDQA 1US8A 2OZEA 2W00A 3EPJA 4X8LA 4JVLA 3RNLA 1V43A 1AZSC 2F6RA 2WIBA 4DCVA 3KKPA 1SVKA 2XNDA 2WWHA 3IIMA 4JBWA 2C9OA 2UVQA 2CCJA 1H8EA 3W6PA 3W8NA 2Z6VA 4JSTA 4C7OB 3I3SR 5CK4A 1Z0AA 3RS2A 2JAQA 4BZPA 1EFRA 2YYZA 3BH7A 2IYYA 4O0MA 2ZJOA 4Q1AA 1VHLA 3VMFA 3TR0A 3IBYA 4H1UA 3AVQA 4MKIA 4B76A 2BMFA 1FUKA 2J9RA 1NKTA 3CB4A 3MUFA 2VQSA 3CRVA 4A82A 4DUGD 4EKDA 2VP0A 3I8SA 2PEZA 221PA 4HLUC 2NGRA 1G8YA 3THWB 2DR3A 2W83A 1H8HD 2I4IA 3AP2A 4A0GA 1FW6A 3ZYCA 4LV6A 3CRW1 1SVSA 1E4YA 5J4LA 4B3FX 3W3ZB 1MO4A 5TVKA 2KBFA 1G3QA 5DNYB 1CJUC 1E2MA 1U9IA 2LKCA 3GQBA 4Q9IA 5FPKA 1QG4A 3KJIA 2JLZA 3DEFA 3TUIC 1WB9A 2QAGB 3GLFA 4C2TA 1ANKA 2NO9A 1E9FA 5KPJA 3QVUA 3L0OA 1I4LD 1Q3HA 5FTNA 5IDVA 1W0JA 1WXQA 4TQUS 2BJWA 2XAUA 1XCPA 3BJIC 4AWXA 3ZVLA 2ZSDA 5JI3E 1CF4A 3ND8A 4MYUA 4IVQA 4AY2A 4KFRA 1DEKA 1YZLA 4Q18A 1IQPA 2QGZA 2WWXA 1O87A 1DVRA 1Z2AA 3MGCA 3OEHD 4G5GA 4GT1A 3NC1C 3TQFA 1NN3A 2VHTA 3P4YA 2C98A 5CLQA 1TF2A 3LAWA 1KDPA 1VPLA 4JLOA 1FP6A 1M7GA 3M4YA 4Q7LA 4Q1EA 4WZBE 4DXAA 1CEEA 4HZUA 4Q66C 3KFVA 2AR7A 4DEXA 1UEJA 3IIKA 3RABA 1KI3A 1NLFA 4DVGA 1E32A 4ZI2A 4UNSA 4DEYA 3CR7A 4G5OA 2HEIA 4DUGA 5J4KA 1G5TA 2GTPA 3UMRA 4H1VA 1H8HA 2GNOA 1ESNA 3KKOA 3OIYA 3RC3A 4GL2A 3A1SA 1EX6A 4LPSA 1G21E 2H7VA 5L3RA 3VTKA 3CWQA 2WSMA 1BMFD 1KI1A 2H1LA 1UKYA 4DLRA 4D2IA 2FSGA 4GOJA 1RJ9A 5FOWA 1DAKA 2QEQA 2VA8A 1FQKA 3A36A 4LJ4A 4WA7A 4LDJA 5EE3A 4OI1A 4QNRA 4X8HA 2OILA 4DCUA 1QG2A 3U6KA 4LV8B 2QAGC 2BC9A 1ZUIA 4PPGA 3SNHA 3ND9A 3QUSA 4ZO4A 1XTQA 5EP3A 5SZHB 2W6JD 4B3XA 2DFKB 2IXGA 2QENA 3IO5A 3LA6A 1N6HA 4EJSA 3O8RA 4CEJB 5K8TA 3LH5A 4HAUA 5HCNA 3TSOA 2FF7A 3N5CA 1MO3A 3WMEA 1ZJ6A 2AHOA 3SE0A 3EZ2A 3OEHA 1ZAKA 2RGNC 4RKFA 5A5GA 1T8UA 4EPWA 4ILEA 4KAXA 4ZIRB 4WXPA 3EASA 5F98A 1IN8A 2FSHA 4CT4B 3U2QA 2MSEB 1UKVY 1G4AE 2ZU6A 2ZRLA 2GEUA 4LHXA 3KKQA 2BMDA 5EE5B 2CL7X 3TH5A 4KLZA 4B74A 1KSFX 1U94A 2ZR0A 3MWLA 2ZSAA 3GEIA 3RHFA 1I4DD 1SULA 3WMGA 4D6PA 5DHFA 3FHTA 4NONA 4LBZA 1Z07A 1CS4C 3B1VA 1P9WA 1S4QA 3ONWA 1JJVA 4XH9B 4EPVA 1YHNA 5L3QB 4D4KA 1ZC4A 4PSVA 1D9ZA 2FFQA 4IRUB 4AI6A 1BMFA 1P2TA 3PCRB 2R2AA 2ZUCA 5JWOA 3K9LA 5BN3A 4TYYA 1XMIA 1Z08A 3DOFA 2RGCA 1NI3A 1OSNA 1XJ0A 3L82B 3SDZA 4QOSA 3QSYA 4BFYA 1XD9A 3ADDA 3NBXX 2Z43A 1IBRA 1W48A 1VG9B 3WXMA 1W4CA 4D82A 5B64A 4L4UA 1BYIA 1A7JA 2OEPA 4L9WA 4JKYA 4DLXA 4YMVA 1SKYB 1QHSA 2W6JA 3HR7A 3U3KA 3VQTA 4M1YA 2ASEA 5JJKA 3M6AA 2OBNA 2Q9BA 2WKRA 5KO2A 2JJ8A 5CB6A 2QMUA 4BZQA 1KMQA 3ETLA 1N3BA 1P5ZB 2OESA 4FCVA 3RSOA 2NO7A 2Q3FA 2WJGA 5JS7A 1TEVA 5J47A 1XPUA 4DLVA 2NOAA 1T0JB 4I1OA 1RYFA 5FOUA 1AS2A 1SVOA 1OH5A 3AKYA 3K0CC 1I2MA 4EUNA 1P7CA 3ZVNA 2VIIA 1NP6A 1ZIPA 3OZXA 2VHCA 1G6OA 2R6FA 3EXAA 4I99A 2Q3MA 4U02A 3WY9A 2GESA 3V00A 4B43A 4NH0A 2ZQ5A 4DDVA 4B2PA 4WAUA 3DVLA 1JQLB 4BUJA 1GL6A 4NHOA 4D4MA 1LS6A 4QBIA 1ZU4A 1T9HA 2QE7D 3TQCA 1Z3IX 4W7SA 3AKEA 1KI8A 2GETA 3V9PA 4YXWD 3TJZA 1DAFA 3D6TB 1MKYA 1P2SA 3O8DA 1FTSA 4CZ2A 1CJMA 4PXAA 3GLFB 3U7FB 5CJPA 1W2GA 2OBMA 4GSYA 2B21A 4HLQB 3U6BA 3PFIA 4OHZA 2VRWA 2WWIA 4QG7A 2XX3A 4LY6A 4XSHA 1BOFA 2IEZA 4LCBA 4M21A 4TT3D 1OXTA 1KI7A 1UADA 2B7BA 1M74A 3LD9A 2OFOA 1NNEA 1W46A 2FEMA 1X3SA 1XX6A 1R5BA 3UXMA 4NCJA 5CYPA 3T06B 3CNOA 2JLWA 2XITA 5LPNA 4IXMA 2F43B 4I1UA 5F2EA 3V4FA 3BORA 1RRCA 2KI5A 4DDTA 1IN5A 1DARA 2BJVA 4HZIA 1K5GA 4FCWA 1SXJC 2GWHA 2XSZD 4HZUB 4RD4A 5E95A 2DB3A 3CR8A 1YKSA 3IHWA 4LWZA 3SJAA 4EQ6A 1OPXA 3QNUA 1GILA 1PLLA 4A92A 4DSTA 4A15A 1XXHA 3K0AA 3QXSA 4BRWA 4AIIA 2XNSA 3U60B 4OJQA 3E5HA 2BKUA 2RGXA 3WYAA 1E2PA 1T3HA 3ZVMA 4TL9A 2RGBA 3SJZA 2ZANA 2VYFA 3A58B 4QHYA 5EXXA 1C1YA 1OW3B 1ZINA 2QE7A 4US0R 3SR0A 1YR9A 4OK5A 1QHIA 3Q9LA 4YXWA 2ZXUA 1RJ9B 1U9IC 4JT2A 2EFGA 1GSIA 3SEAA 4M1TA 2CBZA 2ZEJA 3A37A 2QT0A 4NZYA 4DRZA 4CT5A 4B6FA 2UZ3A 4CYMA 2OCAA 3VHXA 1FX0A 1J2JA 3SU8A 3KUCA 4PHTA 4TT3A 2BMJA 4EAQA 4EJSB 1HQCA 4IOKA 4AD8A 1BO6A 1UBGA 4B2LA 3PEUA 4KV9A 1M7BA 4OYHA 1UF9A 2ZRIA 4HATA 1YQTA 3NHBA 1RYHA 3RDPA 2FFAA 2C99A 4JLVA 3X1YA 1P73A 1TUEA 2W2VA 5CIWA 4Q1BA 2HUPA 2IHYA 1XRJA 1EFHA 2ZSBA 5JBQA 3WP0A 1K6MA 3GEHA 3CF6R 4QBFA 1TF7A 5BQ5A 1MOZA 2A9KA 4MGYR 2XSZA 3P1JA 3CH4B 1VKJA 1CRPA 4RD1A 1E2HA 4LHYA 1II9A 3CBQA 1GWNA 3B7GA 2FJUA 3AF2A 2J0UA 4DSUA 5B30A 2IL1A 3K9HA 2O8BB 1DAHA 2Z0MA 4FIDA 4MQBA 821PA 5KOYA 1VDZA 1KO4A 2XZPA 2QNRA 4QJ4A 3FE2A 4A9AA 5JCZA 1DAIA 5C46F 2J0QA 2YWEA 2REXB 1KOFA 4G3XA 2IYXA 1AIPA 2X2EA 4IEEA 4PTLA 5GVSA 2EQBA 4OQXA 5FH9A 1C4OA 1W44A 3VU9A 4D0LB 4LYAA 1P4SA 2ONKA 5B57C 2GF9A 2GHIA 2W2XA 1Z06A 2YINC 5F9FA 3LW8A 3EZ6A 1UDWA 2CHQA 2WSSD 2VF7A 4O2LA 4BECA 2REOA 2ZVPX 1JAHA 1WBDA 5JRZA 3CX8A 2FZ4A 2ZM5A 2W2TA 3TMKA 5AK0A 4GNKA 4Q7KA 3KJHA 1U0LA 2ZTSA 1DAMA 3B9PA 4IOLA 3VKWA 4F7WA 4OHVA 3RANA 3EPKA 4NCHA 1NG9A 4PZYA 3KJGA 4TYQA 4DZZA 2RGEA 1W36B 1GKUB 2QPAA 2HF9A 4PZLA 2A5JA 3WYFA 4QGHA 3ZIAD 2J5XA 1LV7A 1V5WA 4B34A 2GEDA 3WRYC 3SN6A 1G9XA 2KB0A 2B6HA 2J7KA 4OI4A 1XEWX 3T61A 2W58A 4JVSB 5C4GB 4MGIR 4II7A 4M9XA 4TYNA 1F2UA 2MMCA 1UAAA 3IBGA 3CF0A 2HXSA 4NYJQ 2LWIA 3T1OA 3FHOA 3OF5A 5FPTA 4TL8A 4DB4A 1GRNA 5EE0A 5BXQC 3AVTA 2OHFA 1NSTA 1VIYA 2PLRA 5EXPA 4LSGA 3MWYW 5FL7D 1ZM7A 1KIMA 5DI9A 2BM1A 4G0NA 4OHYA 2ZI7A 2IWRA 5J40A 4IVRA 5H68A 3U7HB 4O25A 1SKYE 3K0EA 2LKDA 3VKGA 1R6BX 4YMSA 2DFTA 2EFCB 4KFTA 2QU8A 4EPYA 2FDCA 2WSSA 2CLSA 1S9HA 2R6GA 4OQNA 4YDHB 2D2EA 1CJTC 3AKCA 3MLEA 1DOAA 1GOTA 2ZJZA 2ATVA 2GVDC 2MMGA 2ZU0C 3IHLA 2CHGA 4QC2A 5FPSA 1FNMA 3IDQA 3BD9A 1RRFA 4ZDKA 1GKIA 4Q7MB 2QAGA 3D8BA 5FOVA 1NJFA 1F5NA 4A2QA 1KO5A 1OF1A 2GK7A 3K0FA 1FZQA 1E69A 4V0LA 3GJ7A 3ZS8A 1ZVQA 5J4VA 3ZIAA 1IY1A 2N46A 4QHSA 1W36C 3LDAA 5JWRA 2YWFA 2G77B 4IXNA 4PQFA 4G5RA 1Z6AA 2OCYC 1CJKC 4Q00A 1KO8A 1DAEA 1ZMXA 3EZ9A 4ARZA 1MH1A 2VSFA 5HR5A 1S1MA 5KYKA 3AF1A 4Z51A 1RW4A 2RGNA 3C41J 4LZZA 1GFIA 1QHYA 4EQ6B 4GI7A 4NYIR 2AD5A 1E0JA 5HKKD 2QGNA 4D25A 1XF9A 1XXHB 2ODWA 3BAFA 1P2UA 4TMZA 1NL3A 2BWJA 2YC4C 1Z5ZA 3CPHA 1YZGA 3LBIA 4I1VA 1EFUA 2TMKA 1OFHA 1A1VA 5SZJA 3RLFA 2EU8A 5FL7A 3GLFE 3SC3A 4TZ0A 4DLZA 1S96A 2ZRBA 4C0BA 2W0SA 4A1FA 4WOPA 1XJQA 3WBJA 2QROA 3Q85A 3SBDA 4DLWA 4JSYA 4QBHA 2J59A 1E9SA 5AJVB 5KTYA 1Q57A 2Z4SA 1CR1A 4TZ6A 3EC1A 4KFSA 4R2IA 3DDCA 3I73A 5KSOA 1EG7A 4N0EA 1DO2A 2F1HA 1AGPA 1FX0B 2IF2A 1E9BA 4DSOA 1E1RD 2CL0X 3V4RA 4IOJA 2IXFA 1LW7A 1LF0A 3PENA 3C7KA 2JLSA 1ESMA 521PA 3B6EA 1TQ4A 3RS5A 3QG1A 2UKDA 1IONA 1FQJA 3KFXA 3K53A 3LY5A 4PANA 4C30A 5JLJA 2MSCB 4LJAA 5JJIA 4UNPA 1KY3A 2R44A 2HCBA 3LLUA 3ZZ0A 1GRQA 4R7ZA 1UBCA 4BLOA 1KNQA 5CB8A 2WKQA 2QN6A 5FOSA 2Q21A 3B1XA 4DDWA 2J0UB 5HKKA 1R4AA 2DPXA 3AEZA 5HZKA 3NBFA 5AUOB 4PSAA 4OI2A 4G5SA 5F3WB 4NL4H 1XZPA 1SXJD 1XCGB 2G0TA 4B32A 2HCJB 2AN9A 1VCMA 4C0LA 4L9SA 3TUZC 2IA5A 2AWOA 3HU2A 1OHHD 1AJEA 2B8TA 1T3SA 5DN6D 4GDFA 2QAJA 1VIAA 1F2TA 3LVQE 5G3YA 4WXRA 3VU9B 3GPLA 5LB4A 5BYJA 2ZRNA 4HDOB 2OBLA 3FKQA 5LB2A 2WOOA 2GCPA 3MG9A 3PUWA 4WZAE 5L3QA 3AF3A 4QHTA 1G8GA 2OLJA 2EWWA 2ZR7A 4QJ5A 4OL0A 2NMVA 2QTHA 4ZKEA 4BPBA 3X1XA 5L3SA 3E70C 3TW8B 3B85A 3DHWC 4RCZA 3LXXA 4NCKA 1E1RA 2GAOA 2ZRFA 4EFLA 4LHWA 2CXXA 1AS3A 3BC1A 2OFWA 2WHXA 1N0UA 4TLCA 1E9AA 4US2R 4BFSA 3R7WB 4A0HA 2ODNA 4D0NA 4ZKDA 4JLAA 1YRAA 2C5LA 4DC9A 1IJEA 4GMDA 2IYRA 4JJKA 3A8TA 4ZCIA 4Q4LA 1U8ZA 4KCGA 3NH6A 1M8PA 3NXSA 1X8KA 4BEJA 1D6JA 1OJLA 3FGNA 1II8A 2QP9X 2EFDB 4M4SA 5DIFA 3LFUA 2NPIA 2RHDA 1F2UB 1JPNA 4YDSA 5BWMA 4XD7D 2YWGA 2CE2X 2WMNB 3J81k 3A1TA 1ZUHA 4BLTA 2YVUA 3I5YA 2WJHA 4K81B 1SXJA 4OK3A 4MGKR 3UG7A 5FOXA 1I2DA 3QENA 2GVZC 5DYIA 2JLYA 1HH4A 3IIJA 4FMCF 4ZPXA 1OHHA 5KDLA 1IN4A 1UBEA 4D81A 2Z83A 5DN6A 4ZCLA 2IEYA 2ZRAA 1ODFA 2PL3A 2WM9B 2ZRDA 2O8DA 5E7JA 4PC6A 1E2GA 1JEEA 2XZOA 2H5EA 3QKSA 1OXSC 3WBKA 5C18A 5DH9A 4TLBA 2NPFA 1JI0A 2EFEB 3QKUA 4IDOA 2O52A 2ZS7A 3DKPA 3LLMA 5BN4A 2NTYC 4V02A 4QM7A 4P4TA 4MRVA 2J45A 4PC2A 4JL8A 3KKNA 1RVDA 4PC1A 1AA9A 4V0NA 1L4UA 2JLQA 3QJYA 1XPOA 1GG2A 3P20A 3DZDA 3SHFA 3PV0A 2G6BA 5DO9A 1D9XA 4S35A 4B2IA 1A2BA 3NG1A 3K0FB 4B48A 1TPZA 2C9CA 2YWHA 3QY0A 2VP5A 2FSIA 2HJVA 2Z5FA 4M1WA 2PT7A 4KO8A 4B6EA 1NVVQ 4TMWA 4XWOA 1J8YF 1NMZA 2A2ZA 2ORWA 4ARZB 2GZAA 4HUTA 2OXRA 3EZ7A 2CEAA 2ZYVX 5LD2B 3FMPB 4TLEA 4TLDA 4U5XA 3CIOA 3T5DA 1LVGA 4XD7A 1P60A 2P3SA 2QBYA 1W4RA 2F43A 4C0QC 1SQ5A 3PEVA 3QVVA 4QXAA 3BERA 4Q9JA 4P3YA 3L8ZA 1TNDA 1E2EA 1TQ6A 1QHXA 1Z29A 4HYYA 3Q5DA 3PJRA 1B0UA 2QRZA 1E94E 2ZITA 2V54A 1TMKA 2JCSA 2ZRHA 1OIVA 2ONJA 2G83A 4LUCA 2QP4A 1R0ZA 2C8VA 4JT4A 1RRPA 3H2YA 4C0AC 2R8RA 4Q4HA 1E96A 4WIAA 1NF3A 2NQ2C 2ZI3A 4LJ6A 1Q1BA 1F6BA 2G3YA 3PEWA 3LV8A 2RB4A 4TYWA 1VG1A 4EPXA 5H1YA 1CBUA 4G01B 4MDFA 4Q1CA 5B2ZA 2B7CA 1S1CA 3PUVA 3JVVA 1KK3A 1LY1A 1YZUA 5JFGA 1Z0JA 2PZGA 1AKYA 1NY5A 4F93B 2JGNA 3MJRA 2P6UA 4FMDB 4KYUA 1YJ5A 4JZKA 1XXHE 4ACAA 4ZDWA 1E9RA 1JALA 1CR4A 1ZCAA 5TDHA 3TAHA 4HI0E 4O2RA 2ZRMA 3B82A 4LJ8A 2V9PA 2BEKA 2IF0A 5LD2C 2GCOA 2PZFA 2BM0A 4K46A 1W36D 4FMBB 1TUIA 1KHTA 4M53A 4F92B 1TAGA 4RD0A 3N2EA 5DLQC 1UDXA 2XZLA 1YZKA 4Q03A 1UKZA 3EIQA 3K9GA 3KQKA 1GRRA 1SVMA 2JA1A 1T5LA 2FPMA 4Y0AA 1Z6YA 4KVAA 4QJ3A 4Q48A 3KL4A 3OEED 3EX7C 3AVXA 4C0SA 3ZZTA 5C4MA 2O5VA 3CH5A 1F3OA 4U7DA 3H4MA 2O8BA 3QPUA 1ZUNB 4OQLA 1F2TB 2VP2A 2ZRCA 3AVOA 4A6XA 3GLGB 3RC8A 2OCPA 3UANA 1U98A 3Q8XB 1DG1G 3B13B 1N0WA 2VSXA 3NBZC 4P33A 4PHFA 1XTIA 4EFNA 4E5UA 3U3MA 3Q7PA 2ORVA 2PX0A 1OT3A 3A6PC 2H92A 2VH5R 3THXB 4Q4JA 3FMOB 4FW9A 3RS7A 5L3SB 1R0WA 1I4TD 5FBVB 2YKGA 2GJKA 4A36A 1VECA 2ZJBA 2BBWA 2FU5C 4X8MA 2ZRJA 1IY2A 3AV0B 3GMTA 2PBRA 2RAPA 5K8IA 1JAIA 4DIEA 5EXSA 3IUYA 4M22A 1Z28A 3HP1A 3FPAA 1LFDB 3Q72A 2J3EA 5EP2A 5GJVC 3ZD6A 3VR2A 3CZPA 2Q0HA 4V0KA 3GJ0A 2CE7A 4JYCA 4HAYA 2J1LA 3N70A 4RFSA 2X8AA 1IY0A 2PCLA 5DHAA 3DZ8A 4GZLA 4IKEA 3H84A 2NO6A 4EDHA 1II8B 1ZM9A 2QT1A 2NZJA 2V4ZA 2ZETA 2QY9A 3FWYA 4JLMA 4MYCA 5JEEA 5AJWA 3REFA 4Q5IA 3HYRA 2GF0A 2KBEA 4P31A 3ICEA 5TARA 1ELOA 4ESVA 3SZRA 4EIWA 3R8CA 4BGDA 1LS1A 1SXJB 2PMKA 1GDDA 2CJWA 2CL6X 3I8XA 1NIJA 3OEEA 4CF7A 3I32A 3X1DA 2IYVA 3MFYA 3IQXA 4IJMA 4C0JA 1T5IA 2WTUA 3QI2A 1Q1ZA 2QRNA 3GJ5A 5P21A 2O8DB 3Q5EA 5TB5A 5JMTA 4AYXA 1C9KA 2IYSA 3EWSA 3QKSB 1WP9A 3D31A 3NVAA 5KHOC 4BRUA 1VHTA 3MMPA 1DPFA 1U8AA 1R0YA 3B78A 3FOZA 1XFAA 1FUUA 4Q02A 2C9YA 1Z83A 1VG8A 4NCIA 4LX0A 2G9NA 1WDTA 2BDTA 3A4MA 3PUYA 1N5IA 1OXXK 4M2LA 4PAOA 2FE4A 4R9UC 5FFMA 4JIMA 1HA3A 3T12A 3BFKA 1TTTA 4UJ3A 2ZPTX 1YR8A 1EESA 4UNNA 1X1SA 1FNNA 1WRBA 2G1KA 2ZUBA 4G1UC 1KI6A 3HU1A 1QRAA 3JVUA 2JLXA 3FTQA 4LYJA 4UKDA 5J4YA 4QBGB 1FFHA 1WA5A 4MDEA 1GUAA 1ZD8A 4XTRA 3RWMB 3P27A 3QPWA 2AXPA 2F3TA 3SFVA 1F60A 3QXCA 1EWRA 4C3ZA 1NSFA 1QDEA 2AK2A 2HT6A 4N1AA 4NU0A 4G5QA 5GADl 4BFUA 2QBYB 1MT0A 2JIZD 2GXAA 5FBWB 1WCV1 5AJYA 1N5KA 4KLNA 4LJ5A 621PA 3AF0A 4E09A 1E2JA 1KAOA 4KFUA 5DE3A 2WJVA 1UEIA 1W4BA 1YR7A 4HDQB 1KO1A 3P26A 4DWJA 1E79D 1NJGA 5G53C 2OFXA 4NTZA 5CK5A 3VR3A 3AVUA 4DLUA 1KNXA 2GJAA 1M34E 2XOKD 1Z2CA 4XOIA 3SYKA 1IN6A 1T0HB 2H8KA 3T35A 4Q4HB 4JBYA 1T91A 3A4NA 5DISB 3WMFA 2F9LA 3HDTA 1W1WA 3I61A 1N6PA 1NVXQ 1OFUX 3G0HA 1G41A 1OYWA 3K9NA 5JECA 3PXGA 4B44A 1KJWA 2VLIA 2VP6A 2KSQA 3QXHA 3BWDD 5KSYA 3UK6A 3ASYA 1P3JA 3GLHA 4QGFA 2A5YB 1RFLA 1A5TA 3W34A 4KHZA 2H57A 5TV2A 2QQEA 5E4FA 2P0EA 4R98A 3LBNA 5EP4A 1NRJB 2P5TB 3NKVA 2ZR9A 5KNDA 1VTKA 1GKYA 2QMEA 4LHZA 3TVTA 3I1FA 1UBFA 3NC0C 3MCAA 2IYQA 4CGZA 1XU4A 3C15C 2NIPA 1M2OB 1KTVA 1G5RA 2MSDB 2AWNA 3CNLA 2JLUA 5HPYB 3GJXC 1B23P 2GCOB 3EPHA 4JS0A 2JIZA 2D7DA 3EZFA 3F5FA 3ZLJA 3TGPA 3DM9B 2AK3A 3AM1A 4ZV4A 1KI9A 1G6HA 1ZRHA 4TTQA 4OHWA 4MRSA 5EZ6B 1KSGA 5M04A 1E79A 4FWIB 2QQ0A 4LYFA 3SOPA 1AQUA 2WZQA 3AGPA 2Q3HA 4TL6A 5ANRB 1RPZA 1W49A 1PUIA 4IFEA 1YU9A 2XOKA 1OH8A 3FHCB 3TKLA 5CJ2A 5IT5A 2BEJA 5HE9A 2QL6A 1KKMA 1QHHA 1PZNA 1EFTA 2EYUA 2FSFA 2FGKA 4HB0A 3ZVRA 3QOFA 1COWD 2J0VA 1G5PA 3DOEA 4DT1B 4LBWA 2WV9A 4Q4JB 3DL0A 5IHPA 1N6OA 3PEYA 1MR3F 2DWOA 3O8BA 4TTRA 2ZVQX 1TEXA 3MSXA 4RZUA 2QP3A 3BFVA 1R0XA 5CM9C 2ZYUX 3GFTA 4IFBA 1BH2A 1G7CA 2VTKA 1P61B 1MO5A 4JVNA 1X6VA 1RKBA 4F4IA 5AJXA 4KXFB 5JHHB 2WWWA 1MABA 5JSZA 2FFBA 1AM4D 1QBKC 2YV5A 4Q4AB 2GZHA 3AVPA 1HTWA 1Z0DA 4L15A 4JL5A 4RFSB 2EWVA 2D2FA 3OIVA 4HSEA 3CPJB 4AKHA 1H65A 3R7WA 4KODA 3GD7A 5BYKA 2F3RA 2FPLA 4PQRA 3KTAA 4KITB 4TQAA 4W5WA 3U61B 2ZE6A 5LDDC 4N3NA 5EUQB 2AFIE 4JVMA 1II0A 3UWKA 2R6DA 3IQWA 4D80A 2B8WA 2R9VA 4PPQA 2CJWB 4RZ2A 2PT5A 4K8OA 4PAQA 4Q9LA 2PX3A 1MRNA 2B92A 1UFQA 3LXRA 1KSHA 2ZIAA 1P62B 2IBMA 3AVYA 2FNAA 2PEYA 3ADBA 1EXMA 3TLXA 4V03A 4UJ5A 3DPUA 4BWYA 4D0GA 1EFCA 4ZDIA 2DYKA 3LBHA 2DY1A 3UMFA 2C77A 3GJ3A 4KVGA 3RWOA 2ZRKA 3WNDA 2FEOA 5FBLB 2BOVA 4ABYA 1Z0IA 3AP1A 3U7GA 1G8PA 1COWA 4XJXA 3SBEA 4F91B 2ODBA 2ERXA 1U0JA 2PLFA 3I4LA 4EPRA 1PLKA 3EA0A 1S2MA 4GBMA 1NVWQ 3GJ4A 4X8OA 2ZJ8A 3AKDA 5FR1A 2ECKA 3B8HA 3PUZA 2JLRA 4GP7A 4A2WA 4QL3A 1ETUA 4TLAA 2WAYA 1AN0A 2QMOA 1G8FA 2PMDA 4NYMQ 1AQYA 2CLCX 3KQUA 1DE0A 2X2FA 4AKEA 2BCJQ 1NY6A 1R5OA 2P67A 3ZQ6A 3MRSA 1G8HA 4DCTA 4E03A 1KI6B 5TXGA 2XB2A 1HY3A 4KI0A 1KKLA 2IYTA 3T5GA 3GLIA 2OM2A 1SXJE 2A5GA 1HT2E 2O8EA 5CDFA 4TMKA 3CLVA 1G3MA 2IUTA 1QVAA 1TQDA 4KU4A 1XD2A 4LJYA 5BN5A 3AVVA 3PQCA 5B58C 5KNCA 1Z22A 2VPPA 3AUYA 3FB4A 4OK6A 3KUDA 2ZYWX 3L0PA 5CIQA 1A4RA 3SJCA 3VX4A 1R10A 2PJZA 3ASZA 2V7QD 4DIDA 4GRAA 2YHSA 1Y63A 4YLGA 4OQMA 5A4JA 1KDOA 2VF8A 3B60A 5AWFC 3BRWD 3IILA 3W6OA 2VHUA 1CIPA 2XXAA 1G291 1XMVA 3AUXA 3REGA 4P4SA 4Q7JB 2J46A 3NWJA 2X19A 3THOA 4PX9A 4AK9A 4ACBA 4XSGA 1FPMA 4Z1MD 3WHKA 1J7KA 4UQOA 4Q1FA 3IEVA 4XVRA 1G3UA 2QM8A 3CNNA 2P65A 4TMVA 3C4JA 1RZ3A 1ZD9A 1RE0A 2H16A 2OUKA 1ZNXA 3THYA 1SHKA 4AG5A 1XP8A 1Q21A 1E9DA 1N0VC 3GLHB 3CW2A 1N2CE 1G17A 4LC1A 1SVIA 2E1RA 4B3CA 1JPJA 2C04A 2L0XA 4YQFA 8OHMA 1XPRA 2FX3A 3R9XA 4BFTA 2JDID 2O8FB 2FV8A 3W9YA 2OAP1 2HLDD 1CXZA 2BCGY 1IXRC 1NN1A 3CZQA 5IF9A 5H70A 4I81A 2PJRA 4Q21A 1W5SA 1YRBA 1YZTA 2WOJA 4XIGS 1OXUA 2ZE8A 4O3MA 1NLZA 3HR8A 1S9DA 2NO1A 1LB1B 4OBEA 5JRJA 5AUQA 3QF4A 1QF9A 1OYYA 4URVR 2FG5A 3RRMA 3CF2A 2C96A 3U4QA 4MRPA 2DFNA 4NE2A 4LI0A 1TL7C 1HURA 4PO9A 2QSYA 4HAZA 1J99A 1YZNA 2RGGA 2V7QA 3ZD7A 4YONB 1D2EA 4AYTA 2JLVA 4QM6A 1AS0A 3CRMA 1KYIA 1E6CA 1OKKD 4FXPA 3RRZA 1BS1A 2GEVA 1CLUA 3BFXA 1DBSA 5KDOA 5FI1B 1R2QA 3FFBA 2IX3A 4WBSA 1N6RA 4M9ZA 5F9HA 1YVDA 4PHGA 2YOHA 1EWQA 1QHHB 4A6PA 3SJBA 2IS2A 2BMEA 4Z1MA 3W6NA 4CIDA 1KI2A 4HAXA 4IDPA 4Z54A 2N42A 1NG1A 2OE2A 3NEYA 2G88A 4ON9A 4YMWA 2J41A 1Z47A 4JLNA 1N5LA 3CUEF 1S3GA 4NMMA 3WNCA 2A7QA 3GFPA 2GBLC 4L5BA 3G82C 3GLGA 4RZ3A 1NBMD 4Q01A 3RAPR 3TSZA 4LOAA 2D62A 3QBTA 4PZZA 4MKFA 2XTZA 3K8YA 3EW9A 4B71A 1IM2A 2OG2A 3P4XA 4YMUA 2QMHA 2D7CA 3THXA 3ICQB 3BB4A 3BXZA 1MABB 2JDIA 3E1SA 2QPTA 421PA 2HLDA 4A0RA 5JSZB 3AP3A 1ZCBA 1XZQA 1G3RA 1OH6A 1M1YE 4MA4A 3BH6A 2CVFA 3CX7A 2CLDX 4RVCA 2KJQA 4WW0A 4A8JA 6Q21A 1Z0FA 4FWTA 3WP1B 1RIFA 1VCOA 1GIAA 3LWNA 3B9QA 2VO1A 4IOMA 4HDCA 3KTAB 2PCJA 2BKEA 1TU3A 3KZ1E 3A1VA 1GZSA 5EQTA 4PPFA 1E98A 3B2EA 4I1SA 4LBYA 4NKRA 3OESA 1JR3D 2JATA 1QVRA 3BIFA 1JR6A 2C78A 1OKKA 4Z8YA 2RKOA 5IRCD 4NBSA 3KKMA 4DJTA 4UXHA 2G1JA 4IVPA 5FTLA 5TMPA 4C2UA 5G3ZA 4UXIA 3BK7A 1KAGA 4TMTA 4GP6A 3ZGXA 2D4HA 4DSNA 4ESHA 2V6JA 2BBOA 2R6AA 3B1YA 1D8TA 5E7MA 5FBQB 2YJTD 4BFWA 2IYZA 5FBRB 4UNRA 3R9IA 3O8CA 2ZRPA 3KXIA 1RC8A 1L8QA 1MRSA 5FI0B 2RH5A 3GCGA 2A3RA 3CO5A 1KDRA 1G7SA 1WF3A 4OKSA 2WVJA 4WVFA 1NBMA 4B3GA 3FMFA 1R8SA 1JXOA 4TYPA 2F1RA 4N0DA 4R71A 4P32A 5HCIA 4PFSA 4D4JA 2W0MA 5FTJA 3RVBA 3C14C 2CHVA 3TNFA 5DI3A 5FL3A 1BIFA 1G16A 1ZM4A 1SVWA 1KZGB 4HUQB 1U99A 2GJ8A 2IS6A 4KJZA 2JJ2D 4TMXA 3OE7D 4JLBA 3I62A 2QM7A 4M1OA 1Q3TA 4QFMA 3GLIB 5CITA 1SZPA 1M7HA 3LNCA 3QBVA 2O8EB 3TIFA 3RSLA 2ZAMA 1P9RA 1E0AA 3KB1A 1OV4A 3EARA 1EK0A 2VP4A 2QPOA 1NMYA 3JZAA 1XD2B 3OIWA 1OB2A 1WMSA 2C03A 3AQ4A 2GKSA 5AUPB 4FI3C 1GNPA 1JR3A
chains in the Genus database with same CATH superfamily
1X38A 1DSSG 2IUFA 1Q0QA 4R31A 1SCUB 1K86A 2NAFA 1VYHA 2ONCA 4CTNA 5C81A 1IEQA 1Z18A 4X00A 5LMNB 2VUUA 4PGFA 3RU9A 3NWPA 5C3MA 3C3CA 2PWPA 3GIWA 2JEOA 2VNSA 4I5GA 1ZH4A 1HWYA 2V9ZA 1UFRA 4RHTA 2XXAB 1GL9B 4P4SB 2AI2A 3CX6A 4OX9B 1W5FA 2H9AA 2HIGA 2UVPA 2WAXA 1PSWA 2IJGX 3DPSA 2Q9CA 1B16A 1DQNA 2WP8J 4HLCA 4YQYA 2R1TA 1GQQA 3GLVA 3LVFO 3A2LA 5HF8A 3RRBA 3ACDA 3TJRA 5EZ5A 3KQQA 4CKWA 3Q6NA 1YQXA 5FR2A 2VBFA 3VZQA 4TM8A 3THYB 1OI7A 2XEXA 2H4YA 3KAQA 1NE7A 1YB6A 2O2DA 4YMHA 1R0SA 3A4YA 3U48A 4RZHA 5JSUA 3BMOB 3GL9A 3EULA 4JJIA 4RH0A 3DTVA 3OTIA 3KYIB 2FZGA 2I9PA 4Y9RA 1Y5MA 2G17A 4PRYA 1UPBA 4XUCA 3A4TA 4UHEA 3SX0A 1DDIA 2DBVO 4NPHA 3DO6A 2R47A 2ODQA 3AEUB 1GD1O 1HLDA 1CR0A 1GSHA 1CTQA 2QZ4A 4E46A 1KO7A 1NR5A 3CMCO 1TO2E 2D59A 4H08A 5CBPA 1L4YA 1DWOA 3KVOA 4I55F 3JALA 3D8TA 3CZ9A 5EZSA 5JC1A 1SWWA 4PC3A 5T3UA 3EIOA 3BF7A 1T10A 5JPIA 1SBIA 4HMQA 3PQ4A 2O2GA 1PIWA 1Y3HA 2Q5HA 5D87A 3TM4A 3TW4A 3WAJA 2YNMC 4YDQA 3U4QB 4PC7A 4TV8F 2VYQA 3UH1A 5BRJA 3FAZA 3CUUA 3CKLA 4JL6A 4ER5A 2QS9A 5I51A 3K70D 4HXFB 2R8BA 4NXNB 1N6NA 1QKKA 4HAWA 3NBYC 4OFXA 4ZTBA 5FUWA 4H1WA 3C43A 3HP7A 5B53A 5LBTA 5ENDA 2FQQA 2V3CC 3D2CA 3OZGA 3E5NA 2P1ZA 2O2EA 1G8KA 2GD6A 3QYFA 4IDCA 4BUCA 3FBGA 1T8PA 4URXR 2IQIA 3GZNA 4W63A 5FKJA 3KKZA 3OFVA 4M7PA 1JILA 4QYIB 4I8IA 4A5SA 3ZCQA 5HWSA 3G89A 1XZEA 2NG1A 3AM5A 5BWLA 5KYUA 4MW5A 3R09A 4M0LA 3NHLA 1GFWA 3O91A 4HB4A 1RXIA 2YMQA 5AHWA 3KQSA 1E9EA 1FS5A 1Z6TA 2OHJA 5GJWC 4YRJA 4V3BA 1YZQA 1GNRA 1NXPA 3I92A 4O5AA 2IT1A 4AVYA 4GIBA 4D4HA 3NW9A 4YACA 2CFTA 3RG2A 4D6XA 1K7YA 1QU2A 3P9RA 1ZNYA 1PLJA 3NUZA 3R7DA 2BZGA 2P90A 4YX9A 1NPDA 3FF1A 1QVZA 5CEFA 2ZI9A 2R48A 4N7JA 1USVA 2ISQA 4CM8A 2JH9A 2V1XA 3WDLA 4BGVA 3MLBA 1UMCA 3AR5A 3CZ4A 3C4QA 3HFSA 1ATZA 1D2AA 3C8ZA 2F2TA 4N8EA 4QPZA 1KEKA 1XYVA 3GZTB 4K05A 3D6HA 3U44A 2BBSA 1SKQA 4X1KA 1F14A 1PJCA 1U5AA 1YDEA 2BFPA 4F2PA 1TKCA 3QJGA 1WE2A 3B6MA 3VPHA 1H85A 3PKZA 3RUFA 1D07A 2HMUA 4CEIA 2D06A 2WHPB 5A6SB 3AHGA 2A9OA 1T3LA 1YI8A 2AG6A 3U3RA 3VV2A 1O95A 3VFDA 4CIWA 2R5FA 4C4PA 1I7NA 2RGDA 3P94A 3PXCX 4GZMA 3WGIA 1NXQA 2Y1LA 3C8MA 4G8BA 2A14A 1UT5A 2E48A 4PLGA 2ATXA 4H2DA 2CXPA 2C84A 2QTMA 3T7AA 2CLMB 1I6MA 2J7PA 5ICCA 4JODA 3PVCA 2WIAA 1RWWA 3UPTA 4RCYA 3D2LA 2FP3A 1C1HA 1H4VB 1YQGA 3MILA 1TJPB 1ZJJA 3GOHA 3HJRA 3ZUPA 4JAVC 1WAMA 4O2AF 1U8YA 2HA7A 3FCXA 1B1CA 3JR7A 1CULC 1P7YA 2X22A 2GCEA 3U4DA 3GRFA 4H7EA 4BMZA 3O4GA 1H2AS 5JJLA 1EVJA 4BFZA 4YJDA 1XMSA 3LT5A 1M9NA 3Q7RA 3W3AA 4FU0A 4X0EA 4M8LA 5K51A 4ZOLA 4S2EA 1TM7E 4NYJR 4EB6B 1TU0A 2V98A 2FMUA 3DP7A 4RYLA 4DM3A 1US8B 3EXIA 4WBNB 1DIAA 3FKSD 3ST7A 1GAJA 1ADJA 4MGHA 5ES4B 3EVDA 1L4GA 1E6MA 3M3DA 5DZSA 3ZR4B 4NG4A 3AINA 1JYFA 3TVYA 1QGDA 3ZD8A 5C32A 2DTXA 2I6XA 5AJTA 1FDVA 3MWGA 2J33A 5DI3B 2N3ZA 1F48A 4RK6A 4X7BA 3ABZA 1I2AA 1LPNA 4M86A 2IZ7A 2J87A 3UAZA 1ETHA 1TLLA 1XV5A 1UPTA 1JBKA 2OSBA 1Z6XA 1H1LB 2QVGA 4IDHA 4PZPA 3WK6A 3DYIA 2P9BA 3EDRA 2UYGA 3GEEA 5C2JB 1O6CA 2QQ5A 2I55A 5DM60 1F2VA 3ZQJA 1VM6A 4MIYA 3VH3A 4A8JC 2FP4A 2BLNA 3HG7A 5IDWA 1ZZGA 1G20E 2AOXA 1SG0A 2BMWA 5T64A 2I33A 4YRGA 1RMYA 1WIWA 1NX6A 3EXG1 3GARA 4FNAA 4DFDA 3H2ZA 3EPLA 2HJ9A 5JZVA 1TM3E 3KOZA 1M1ZA 4FEYA 1EHYA 3UKDA 2Q1TA 2VHQA 4II2A 2W6NA 2PAFA 4JJZA 3WLKX 5M2QA 3WHPA 1D3AA 1ZU5A 3UW1A 1DKLA 2BPOA 2XTMA 2H11A 4TWJA 1KVTA 3TTXA 2J09A 4EF6A 2ZPUA 4DDUA 1L2TA 2DC1A 2P1DA 1I24A 2UZAA 3GU3A 2UYHA 5A2QA 4KUEA 2AKYA 4I4LA 1F51E 3PC4A 1E1QA 3K9FC 1HF3A 3TEJA 3AONB 2VNJA 2PQ6A 4UEWA 3O26A 3TBKA 3WLFA 2QTFA 4P0PB 1F20A 4YJFB 4AZSA 1YVPA 1E99A 3JQRA 4MW4A 3SS7X 3UJBA 1YCGA 4B3JA 1C50A 1NE2A 5CW2A 5IANA 2GN6A 3EXEB 5DCUA 4S04A 5TPZA 5JVDA 4KC0A 3E8MA 4ZRNA 3HWSA 3JQ8A 4Y1FA 4JCCA 4DCGA 1GTRA 3R8FA 3GHYA 2E87A 2VJBA 4LDAA 2EYQA 1XAJA 1AG9A 3GFBA 4K26A 4WDQA 4ZO9A 2JRLA 2QW8A 3DLAA 5ALWA 4RK4A 3RIEA 3HABA 3GLIE 1KFEB 3V4VB 4ETIA 3AV3A 4RS3A 2VCYA 2A5DA 2H0AA 3AEYA 5CDFE 4H4EA 2YMPA 1DPGA 4BVAA 3GT7A 1XZ8A 2HC9A 5FWYB 4ZN6A 3C8UA 4QDUA 1H3EA 3ZQKA 1KK2A 3KJNA 3OM0A 2XUHA 1PV1A 5GONB 4D5GA 4RTSA 2FWIA 3MWKA 3QUQA 2IZOA 3K9BA 4GRIA 4UCXA 1YTUA 3S99A 3FPSA 1Y1SA 5H3HA 3KCQA 1G19A 5SY6A 1TGYA 2FX5A 3GUUA 4GEKA 1XEWY 4OH7A 2NZXA 4D4LA 2I22A 1XTSA 1T6NA 1VYTA 3PXBA 3O3OB 1DS6A 5G40A 1JSXA 2W48A 3CLRD 5FAXA 4LWPA 3L0IB 4KWCA 3ZS9A 3LXUX 1V16B 3EGDA 3N9IA 5GZ3A 1JF8A 5IM5A 3JYOA 4JBXA 2WWTA 4PR3A 2C2OA 1KKUA 1Y0BA 4LJLA 1ZLXA 2BELA 3KTDA 4QDTA 2UVDA 4X6UA 1JTFA 1MFPA 1YR2A 1DIGA 4O8ZA 2PKQP 4AIRA 4DA9A 4IO1A 1XDZA 1KZ6A 4PE5B 1XQ1A 1HK7A 4DJEC 4E2YA 4NPCA 1T5OA 1ADBA 1U0SY 1BE8A 4DLBA 3PL1A 3LQRA 2V0GA 1N6LA 3F0TA 1H2BA 2OCDA 3OKCA 4LS3A 1IXYA 3L2OB 4ZPJA 3HN6A 4LI3X 2WICA 2UDPA 2VYND 1RRGA 4HB2A 5KNBD 3ZD9A 1TI7A 1VYUA 2GN4A 2R86A 4WKBA 3JTEA 4W5HA 3O3NB 4TN1A 3FCOA 4BEWA 2HXYA 1KDTA 3CM0A 4YMTA 1NOIA 4RX1A 4QFBA 4JDPA 3D8SA 3S2YA 2HIAA 5SZIA 1L7VC 3LRTA 1PG2A 1TA9A 2VPTA 1XA4A 2XBLA 4NNOA 1PG5A 3IXQA 3WYBA 4RV4A 3ZE1B 3K05A 1BQEA 1AO0A 3NHKA 3T1VA 4BU0A 4GXRA 2OXFA 4I9GA 3KQPA 3LPMA 5CGQB 3ZLUA 3ZV7A 4EG5A 4YJHB 3DMGA 3HUEA 4G65A 4XW2A 1B6RA 4MOWA 3ZOZA 4OB6A 5GQSA 3ZWAA 2DQKA 3HB5X 4MW2A 4RZQA 2W6CX 1V8ZA 4AZWA 1CVIA 1YNSA 3WLAA 4JMPA 1H94A 1BKDR 4TSFA 3C98A 1A9PA 2C97A 3ZU3A 3EUAA 2QX4A 1UPCA 3HJBA 4GPZA 4BATA 3UJ3X 5KYTA 2F9MA 4F72A 4K9LA 1WUTA 1CKEA 1GITA 3V7UA 3NBUA 1YE5A 2HRCA 5KQGA 4C43A 4Z0TA 4RTKA 3SQXA 4K9PA 1VKHA 3DMDA 4U0KA 2AD1A 4BGIA 5BW8A 1VPWA 2EJCA 4YRLA 1Q20A 2HMYB 2WINI 1LX7A 2JIDA 2YNMD 3E61A 3OHSX 1ZITA 3TAUA 5JAHA 2B5VA 2WTXA 3MWDA 4UM9D 5ALQA 1YBVA 2YHIB 3HUUA 1HUQA 4IHJB 1X8LA 3GLGE 3NYIA 2BKLA 1XLTA 2O0LA 3HWRA 1CUYA 3F7NA 4AJLA 4DIMA 1FDUA 3DL4A 2W6IA 3FJ1A 1DQYA 1JQBA 4OJKA 2C1ZA 4GFDA 1V5IA 4X3PA 4YTEA 1EDEA 2P4HX 2C3PA 1BRTA 4EJSC 5U9CA 3W5VA 4PGHA 3L1UA 3F3SA 5D3ZA 1EM8B 2IK8A 3GJRA 2ECQA 3D1JA 4H7KA 4P0TA 3T52A 3FVRA 2GFHA 1KYQA 4DRXA 2I8CA 3HCPA 3CLHA 1X1RA 4R9NA 1W0KD 3EWAA 1KFJB 1MO6A 3KXKA 3ORFA 3H1TA 3R5KA 4HXEB 4PSCA 4P5DA 1IYZA 5CW1A 3WFJA 2NTNA 3OHMA 3TXXA 1GPBA 4A2PA 6LDHA 2XB4A 3NEAA 3G2MA 3EVGA 4JLDA 3I53A 3D8RA 4OAQA 3KS9A 5ELMA 4ETNA 3KVNA 2AFHE 4PNZA 4XWKA 1WX1A 2REBA 4OIFA 3WMWA 1V5GA 3U39A 1I13A 5LXTA 1QV7A 4JXXA 1A96A 3I5XA 1YGPA 4R83A 3E7WA 4ZO8A 5E6UA 4AXXA 4LPKA 1WWKA 4C7OA 4GX5A 1E2FA 3O73A 4ZZ1A 1KK1A 5E7IA 3V1YA 2AXEA 3GZJA 4W5QA 3BS4A 5D3MB 5C8ZA 3FRHA 4HJXA 3FOCA 3QV2A 1VB3A 3MTDA 5AHOA 5DHUA 3JQEA 4GEGA 2HMVA 2PUJA 4NPAA 1O08A 1I1HA 1R5NA 1WTCA 2BH9A 2FMXA 2G25A 2Y3IA 2ZT5A 4W1RA 5DT2A 1C9NA 4ZWNA 4EJ6A 2NSLA 5DSZA 4A1OA 5HTOA 1YK0A 1FUIA 2F1KA 3OQIA 5CVTA 3UGKA 3OTGA 3W90A 2FE1A 1JEQB 1JJAA 5IT4A 3FFTA 3IBSA 5JNTA 4II3A 3ACBA 3NYRA 4ZVNA 3O83A 5GGYA 4YAKA 1UAYA 2V6IA 3H9GA 7YASA 4NV3A 2QVZX 2QZSA 1NVVR 1FXSA 2AJCA 2I2FA 4Q7EA 5HTKA 5HKOA 1AA6A 2DPYA 5KHAA 4P38A 3RYHB 1CK4A 1LH0A 1NBME 4MVJG 3VR6D 2WU3A 3QKRB 1DT3A 4IH1A 4NABA 2YUIA 3PR1A 3I3OA 3QEJA 2GR9A 5B12A 3G2PA 1A82A 5LDHA 2ARKA 2OV1A 1L7RA 2WJ3A 3I6QA 4NWIA 2IC5A 1Q19A 1M2GA 1FU8A 2OO5A 1R4NA 4FB4A 4RABA 3OC0A 4UE6A 4ANFA 1Y80A 3ELUA 2ZSFA 1RKQA 3P45A 2JH8A 2WF6A 4MEJA 2V97A 2MINB 2HWUA 4P4UA 4YAEA 1F0KA 4JI5B 3W5HA 3AX6A 1AMOA 4W1PA 3SYNA 3QKTA 1N32B 3D3QA 3MJHA 5C5IA 3QU4A 3ZH9B 4BNZA 4XVHA 4H17A 4GOLD 3I0NA 1WOMA 4ZVMA 4TVSA 1T1RA 2HB6A 3CZRA 5KYYA 2NU7B 4G0XA 1RIIA 5CA1A 3NIDB 4PZ0A 4C88A 1XMQB 2CT8A 1QZZA 5JOQA 4TTVA 1W1UA 4AW9A 5TY0A 2HSWA 3AH8A 1ZBQA 1W8DA 2BHNA 3FY4A 1K8XB 3IR6A 5CLGA 2V6GA 4M8IA 2BMAA 2J9XB 1S2DA 2QLNA 3CRQA 3K0AB 4LBVA 4V0SA 2I7DA 1WNFA 3JQAA 3V34A 1MB3A 3JQ7B 1Z62A 1GNQA 1VMDA 2J9FB 1DB3A 1SPBS 2JFWA 1ZAYA 3TSCA 2FPWA 3GFSA 3K1JA 1RWOA 4YRBA 1RWQA 1UC9A 1VGQA 3DF7A 2R8YA 4D99A 1V6SA 4FYPA 4GDMA 1U9CA 3EBLA 1UDBA 3C6ZA 1ZS9A 2O0JA 1P81A 2YJ4A 1Q5PA 1JQDA 1Y3AA 1JTEA 2ZIXA 3KC2A 4I8DA 2WU4A 4L4XA 1TU4A 3ZCRA 4CM9D 1FPQA 1SHZA 5DM70 3FNQA 2HT1A 3KZNA 3WK4A 3VJRA 2V6FA 3UMGA 3RRFA 1K3TA 4EVIA 5HYVA 4Y1RB 2PGIA 1MORA 2BISA 1PR9A 3ESDA 3MBIA 2X0NA 2EFJA 5DWQA 5IJ9A 1USUA 2I66A 5JS8A 1O6BA 1A9OA 4RJIA 3FHJA 1GKLA 5H83A 2AZMA 2H6EA 2JJ1D 3NXKA 4H6VA 5K09A 1N1DA 721PA 2NXWA 4M55A 4UBMA 3X44A 2NXJA 5H3LA 4MKHA 3WOHA 1UKBA 2E9SA 3SSMA 4B1FA 1GL3A 4AURA 5T4EA 4G97A 1ORTA 1VGVA 4C6HA 1U4SA 4CM5A 4S1VA 4CRWB 3VX3A 2KW5A 3TDNA 1L8AA 2R4UA 2O57A 3O03A 4OEHA 2WF8A 3PPXA 3N7AA 3U40A 3BH0A 5I7SA 5JY6A 1L5LA 2HQRA 1NKSA 4PIPA 2GCNA 3FUVA 3QVOA 1CETA 2JIBA 2C5EA 4HGQA 4MUAA 4B74A 1R6UA 2GF2A 2JW5A 1NATA 3EVAA 4FINA 5FB3A 5G0VA 1RDFA 4EVQA 1ZK1A 2IYUA 1CQJB 1JJ7A 5KNCH 3TQQA 3QVTA 4W7IA 3RYIB 2XNDD 4GYJA 4R1SA 4JELA 3FFAA 2ATEA 4UDOA 1NN5A 3F7MA 4PLYA 2CNWA 1X86B 3LCUA 3MD0A 3AEQB 3MZ0A 4PLTA 4U8GA 4WKNA 4ZHQB 1X70A 2RK6A 4ZZ3A 1SPXA 2O0KA 2VF2A 4BNIA 3SQWA 3ACCA 3ZU6A 5CG2A 5CBKA 5F4BA 2GPTA 1KQ3A 1DQSA 2OC4A 4TTJA 1ZWKA 1C3EA 2Q9AA 4M46A 3H11A 4ZVLA 3DE6X 1MNQA 3SMQA 3TXYA 3QTLA 5I3ZA 4HEJA 1RWNA 4DV0B 4QBTA 1A7AA 1GTVA 3G49A 3NYWA 4RD3A 2X1VA 1T0PA 3K1AB 4P4GA 4KWIA 2EJVA 2O8BB 2BIFA 2P2LA 4P9NA 4X94A 3EQZA 1UJCA 2Z4RA 5AW5A 3V7YA 3BK1A 5ICEA 3HKEB 3BXFA 2ZW9A 3UOAB 1OGJA 2QXTA 1U63A 4QUKA 4IDGA 2EKQA 3U5TA 1PAUA 2SKCA 1MX5A 1FLDA 1XZDA 1ZD4A 4KN5A 5CXQA 3SZLA 5KHLB 4TZKA 1BDHA 3WTBA 2IXBA 1A7UA 4DADA 5C9ZA 2EW2A 2HU8A 3HDYA 4BLPA 1K92A 3SF0A 3U3DA 3CRRA 1UJ5A 2IQ5A 3RS9A 1GUYA 3PYLA 3S1LA 1EGAA 2R00A 2WPDA 3HACA 3PR3A 3ITKA 3BGIA 3DOUA 4GOMD 4WLOA 1YMUA 1AK2A 1VLHA 2J0EA 1TUBB 2Q2NA 1T4GA 2OY0A 2I8AA 1UKCA 2YN4A 3AESA 5TPWB 4G8CA 5B6IA 5L8VA 2AXNA 3GEMA 4K6MA 4BFCA 4D6YA 2FI1A 1X7YB 3EODA 1H0KA 3ZDQA 5IZ4A 2OTCA 3ZJTA 4FGJA 4NDNE 2HLNA 1FEZA 4TS4A 4H27A 4JP2A 3RAEC 3MK31 5T3YA 2WIBA 2WQZA 3PQ8A 3VRHA 4WK4B 1VLQA 1QNFA 4IJUA 4GC9A 4JBWA 3V4PB 4MP3A 4GU5A 3BDAA 2M1ZA 3MQ4A 1H8EA 4UM5A 3V1MA 5KJ6A 2HSJA 2DQZA 1DBWA 4NEHB 3E58A 4KMOA 2B4TO 4X20B 3ZWCA 1EZ1A 1G5HA 2Q6VA 4LHSA 4DXDA 2YYZA 3CCFA 1ICEA 4DV3B 3UXEA 2VG8A 4OYLA 4RIHA 5BSKA 1VHLA 3VMFA 3TR0A 5LL6P 1JSRA 3AVQA 4U2EA 3D3NA 4B76A 5KWEA 2J9RA 2Y1GA 3VTZA 1VL2A 4X65B 3GJZA 1NHGA 1K1EA 1CUEA 2IKSA 1KJNA 3CRVA 3Q8WA 4FDUA 1PCXA 4LMAA 4N8SA 221PA 1QR2A 3BHNA 1ZD2P 4RV5A 3MJEA 3UAOA 3GRAA 5LYJB 4PQGA 1RCFA 5JTUA 2RG7A 4GKAA 5NULA 1T29A 4QDXA 2WQ7A 4LV6A 3CRW1 1GN8A 3RUAA 4B3FX 5J4LA 4AZ0A 1MAWA 1ACLA 4Z9FA 3UXYA 2O8VA 1RPNA 5EJ6A 3TLKA 4Y2PA 2VQ6A 5BR1A 2JLZA 3HA5A 3IL2A 1ZOPA 1SCIA 1LRKA 4CF4A 4D44A 4YCCA 2YYYA 3ZDDA 3D3WA 3PX2A 4F1KA 3GLFA 1LQ2A 2H51A 1CRZA 3IPAA 4BO3A 3KV1A 1E9FA 1OFVA 4MB0A 5AW3A 2OXEA 1I4LD 3F9RA 5FTNA 5IDVA 1WJGA 2P77A 2CNNA 1W0JA 3Q3CA 3QYAA 3BL8A 1Z0SA 4TQUS 1N8NA 2VNIA 3BJIC 4AWXA 2ZSDA 4KUGA 4I19A 3BT7A 1L5QA 4MYUA 2YY7A 4WOJA 3TYXA 2HLHA 4IVQA 4KFRA 1AH2A 4OLJA 1PGJA 4BFUA 4QAQA 1M2HA 2Y1FA 3AIOA 2WWXA 3PE3A 4I4TF 3WB0A 2VPWA 2UUCB 1M1NA 1Z2AA 2UZ1B 2X0KA 3HFJA 3VI3B 3KLMX 4UAGA 1BXKA 4L5JA 5LUBA 2Y71A 4UREA 3TQFA 4ALKA 3DCIA 2J3DA 3KQMA 5ER9A 1NN3A 1X80A 3JVEA 5CLQA 1AQIA 2BTQA 3LAWA 5DYYA 1VPLA 2FPPA 2OB2A 4EY4A 3JV7A 4OLAA 1FP6A 4QT0A 3BIWA 4QWWA 1YVEI 2NUBA 1IZZA 4HAIA 4UASA 1R6AA 3N6RA 4Y0NA 5CXSA 4DXAA 4E08A 2R0QC 4P35A 3WJ7A 4YHBA 1VIDA 2J3MA 3FPJA 4HZUA 2X5XA 4GRDA 2FW8A 4MVJI 4ZV9A 3FETA 1EVKA 1W87A 1Y3FE 2AR7A 4IUBS 1ECLA 3JAWB 1KI3A 1VPVA 1YFZA 2V3VA 2WIFA 4J7AA 4DVGA 4ZI2A 1XQVA 4UNSA 4DA0A 3PWTA 4G5OA 4P3XA 3W4IA 4BYGA 4X1IB 5JE8A 4BEVA 4L8LA 2GTPA 3UMRA 4OU4A 5BQPA 3KVYA 4E2ZA 4B7XA 3HL4A 2OV3A 3UFBA 3CVYA 1K6IA 5ELLA 1I32A 1UXIA 1YOVB 3FUWA 1PFVA 3C4VA 5COAA 2H7VA 4D8XA 5L3RA 3VTKA 1NDUA 1UWCA 1X7XA 4M7OA 1PE0A 2AG1A 3N2ZB 1A9YA 2A0FA 3AR4A 3M9WA 3HZHA 4XQ9A 4D2IA 1TZ2A 1DAKA 2QEQA 3I0ZA 4EKYA 1PHRA 4E6PA 1V7ZA 3DBHA 4DCUA 3TTYA 1VP3A 5FJJA 2VTDA 5AM2A 1JNXX 3U6KA 3WFIA 3VC2A 2C5HA 4R51A 4MX8A 1G60A 4PPGA 3OQMA 1E3QA 4K8RB 5FWNA 3SNHA 5JNLA 1XTQA 3RTGA 1N4DA 1ZJ4A 4HQNA 1U0TA 4D97A 4TSKA 1Y42X 2NU8A 2YDYA 4KQFA 2BFCB 1C3OB 1NVTA 2P5UA 1PFQA 2B9VA 2NZVG 2PS0A 2YS7A 3ESZA 4HAUA 3MMZA 3N5CA 1MO3A 1GTMA 4BNJA 4DG8A 3AF6A 1IBKB 4UARA 2LCIA 5A3RA 5HXAA 3OQJA 1L6RA 5C31A 1PGPA 1BS9A 3T3MB 3OA2A 4EPWA 3WRYA 2B0JA 3OTQA 3EASA 5F98A 3WGNA 2FSHA 4MYRA 1SA0B 1SUFA 4WOCA 4YGYA 2MSEB 5REQB 2PMBA 2ILTA 2EHJA 2IYOA 4AZ3A 3Q7IA 4EKNB 4DUYB 4JU8A 3ZY5A 2GEUA 3BWMA 3KKQA 4PU0A 1E8NA 1L4NA 2NSDA 3R77A 4XARA 2HSZA 1Y98A 4KLZA 2ZR0A 4QVGA 3JASA 1NYQA 1I4DD 2I67A 2W6PA 4D6PA 1B6SA 2AFIB 2JEZA 3H6HA 1CFZA 3A0RB 1P9WA 3D8UA 3L93A 4EPVA 2ASVA 1V48A 3K4QA 3MERA 1ZQ1A 4PYIA 3PLNA 3RW9A 4O4HB 2IVFA 4PSVA 5ALNA 4IRUB 1RCUA 4J07A 1KU6A 1TT5A 1V39A 1V1JA 2W8BA 1C3LA 1BWRA 1Q1AA 3IELA 1ENPA 1P2TA 4OHRA 3IDSA 3QKWA 3LUGA 4JGBA 2Q62A 3U4MA 2ZUCA 4RUKA 2VYVD 4TYYA 4QOIA 1A4IA 1N2OA 2PXAA 2XCLA 4X45A 1UMBA 2W2NA 3WLJA 5ICSA 2RI0A 4AUEA 1VMEA 3L82B 2GHTA 1H0HA 2W2LA 5EINA 4DDHA 3UMMA 3ADDA 4L85A 4RCVA 1OI2A 1UJ4A 4IVNA 4D82A 4S12A 1HDXA 4H7FA 1BYIA 3K5HA 4NBUA 3RUPA 4CMJA 4PS0A 5J1TB 3T7IA 4YMVA 2W6JA 2NU9B 1U5CA 3NKFA 3HYLA 2OBNA 2FCAA 3FNGA 5A3QA 3KAPA 1B76A 2WWRA 4I1PA 2HSEA 1JG6A 2VDVE 1S2GA 5CT8A 3K0KA 2C2XA 4DUZB 5BSUA 3HL0A 4IYJA 4BZQA 4R1PA 1ZD3A 1N3BA 3BTSA 3OZCA 2C4VA 2EDAA 4HVAA 1UR5A 4ETWA 2AW3A 5GP1A 1M5RA 2P27A 3ZXYA 1TEVA 4MIEA 1OWOA 2HD4A 2XGMA 3CEPB 3K96A 1VB5A 3TRKA 4AWAA 5J47A 5KKNB 3E0XA 2ZCUA 2XODA 2GAFA 5JBIA 2EV9A 4MCJA 1QP0A 3U4HA 3DNMA 4I1OA 3SG0A 10MHA 1RYFA 1N1MA 4U3JB 3IVCA 3UFXA 1ISSA 1I2MA 4TRRA 4EHAA 3M70A 1JLLB 1NP6A 1P3Y1 1Z9BA 2ADOA 2EHDA 1ITZA 2H07A 5JYBA 2B5OA 3I5UA 4I99A 4EO9A 4LDZA 3LXMA 2RH9B 4GOND 3Q8MA 1PJSA 1BZYA 5DCWA 3WL6A 4J0GA 3V00A 2ZTHA 2L19A 4B2PA 4WMLA 5CVJA 3DVLA 2XXBA 4YJ3B 1BFUA 2Y1WA 4P54A 5CVEA 4PLCA 4D4MA 3ROXA 1ZU4A 1T9HA 1VKOA 3A14A 2D3TA 1Z3IX 3O38A 4R2KA 4D0RA 1EFVB 3O4IA 3K15A 1KI8A 3IUPA 2NV6A 4ISBA 5CA0F 3NIWA 1P4HA 4WKPA 3D6TB 2OFFA 1AKNA 3TJZA 1T25A 4KIGA 1FTSA 5AKIA 3EFEA 1T9BA 1TVMA 4QDOA 4AO8A 4CZ2A 1PTKA 1ZKDA 2VDJA 3C39A 3ENZA 3FA2A 5CJPA 3JWGA 3O1LA 2V9CA 1UH5A 2B21A 4K9NA 4NOJA 4U5QA 2VT3A 3VYVA 2MHCA 3NBMA 4N9WA 4QG7A 1JHAA 1AQNA 2ESRA 2Y1OA 1K7CA 2XNJA 1WLSA 1MJ5A 2R11A 1YA4A 4ND7A 3VPGA 1NNEA 1W46A 3W04A 4CIYA 1Q0TA 2NVWA 3CLUC 1X3SA 3BXGA 3N2YA 1XX6A 3B3FA 3Q6IA 1OUMA 2IYAA 3NAMA 4NCJA 3T06B 4HVCA 3CNOA 2JLWA 2ZAGA 1AGXA 3MBOA 5LPNA 2F43B 2NXNA 1FP4B 1DHRA 5F2EA 3BORA 3EEOA 4DDTA 4HEHA 1DARA 2G7MC 3VNQA 2GAIA 4FCWA 3SCZA 1NA5A 2DB3A 4JX9A 3CR8A 3O4HA 3IQEA 1N34B 3HYNA 4MGEA 4EQ6A 1ILEA 3GDHA 1XZAA 1W34A 4DSTA 1U65A 1QBGA 3JSXA 1BKSB 3EZYA 1BE6A 3OHPA 1IC6A 1Y4SA 2AVNA 4P82A 2G1UA 2BKUA 2RGXA 1GGHA 5DSTA 5G02A 4TL9A 1ZIDA 2PZ8A 4M0UA 1DKUA 4X92A 4XLZA 2QSUA 3IB6A 4TLLB 3EIFA 1U8CB 1ZUWA 1ZSVA 3VR4H 2M6RA 2RGRA 1YR9A 1UBRS 1JZSA 1QUEA 3C3JA 4OK5A 4FE7A 1FTWA 3H4TA 1GZ4A 4HFRA 2UZ4A 3PJDA 2Q6OA 1PQPA 3S55A 4JT2A 2EFGA 5L7WA 1E0DA 4K6HA 2QT0A 4EITA 2Q4DA 5IAAA 4DILA 2ECPA 3TL2A 5HUQA 4FW8A 2XCTB 2QDKA 4B6FA 4ER7A 3QVLA 1RZRA 4CYMA 3Q7SA 4D56A 3RODA 1IWBB 1Z36A 3LGAA 2IHVA 3VHXA 2PV7A 3SU8A 4LZJA 4BHTA 3G0OA 1E20A 2BMJA 4CLRA 1HQCA 2Y76A 2PL5A 4JJ7A 2PV0A 3BZWA 3PEUA 5EIOA 3V4LA 4L2IA 1M7BA 1QB8A 1TAQA 2ZRIA 3FUXA 1EFAA 3NHBA 1HXHA 1RYHA 4DARA 2YH2A 4YMGA 2OSVA 5HQ3B 5FPQA 5IHXA 1AT1A 1HE3A 1TUEA 1E4EA 2PSDA 2W2VA 5BUQA 5CIWA 5BVHB 1XRJA 2QVCA 4RHXA 1K6MA 3DZHA 3WP0A 1IULA 3VR5H 2D5CA 3C48A 4RY9A 1EMDA 4IHKA 3EDOA 2Z57A 1LJUA 5BQ5A 5AKXA 4AMYA 3CHYA 5BURA 5K0ZA 3UMBA 4BDSA 1AO3A 4FNMA 3CH4B 3FIJA 1CRPA 5BSHA 1E2HA 7REQA 3O74A 1II9A 1L1QA 3PGVA 3O8NA 4M0MA 1L7PA 3TFWA 3CBQA 2Q45A 3B7GA 2HMSA 4W8HA 4X71A 1OWLA 3KBOA 4AXBA 3LECA 1RRMA 3RGWS 2UUAB 3LQ4A 2ZJ3A 3F5MA 821PA 1KDVA 1KJQA 4X24A 2ZXEA 1KO4A 3S3TA 1MJHA 3U56A 5AXAA 4TT8A 2YQ5A 4G07A 3F5SA 5C46F 1BXRA 3X1KA 1EFDN 1P44A 1P91A 1VCHA 4NJMA 3GUVA 4W8OA 4Y1EA 4GMHA 3R7FA 1QRDA 4PTLA 1YCHA 2A1IA 3GRUA 2FPUA 5EA2A 4UTNA 4BX9A 3GRKA 4H4DA 3IMGA 5LZ8A 3RV4A 4MHTA 2CMGA 2GF9A 4EJMA 3T9AA 4CGYA 2YINC 4DANA 2PKEA 1C2YA 4XWWA 2DWCA 1OZGA 2FSSA 1LK7A 2IHKA 3B9BA 3HLYA 4O2LA 1TM2A 3WL5A 3ZW8A 1RABA 1W0CA 4PX2A 1BCRB 4YAUA 3ZJVA 4KXQA 3G8DA 1HM5A 4RPLA 3TW8A 3RBZA 4PLZA 3GZ4A 3G85A 2BFOA 3FPEA 4WECA 3VVCA 1AD2A 3C7DB 5AK0A 2A0YA 3ZCXA 1K0FA 3VKWA 5TX7A 2X0RA 5IJ0A 1UM9A 3QX8A 4FDTA 1CY1A 4LRTB 3I9JA 2AN4A 2OENG 2QX7A 4BVFA 3O2NA 1J1IA 1JAZA 4NCHA 1BMTA 4PZYA 3W4KA 3VV3A 1GKUB 2QPAA 3T3EA 3GOQA 4HQRA 2JVKA 1PKXA 4DDKA 4HTFA 1V5WA 2B2XA 4XFDA 2GEDA 5ALXA 4DQDA 3KEMA 4KJXA 3WRYC 1HLPA 1GGNA 2KB0A 2B6HA 3WV5A 3IURA 3MOSA 1XEWX 4DY4A 2YIVX 3IR7A 2W58A 1HYGA 5C4GB 1SZJG 3JQ6A 3LKBA 4JBGA 2HREA 3IBGA 4BMNA 4OV6B 5AVJA 1HMPA 3DBRA 3T1OA 5K6TA 1M2VA 4TL8A 5EE0A 3UT6A 4BQRA 1J42A 5F4ZA 3UJCA 4GX0A 4C4AA 1VIYA 2PLRA 1JSZA 3MPUA 4JGIA 5EXPA 1D6NA 1NQXA 3IVGA 5HG0A 2RFLA 3DUFB 4KWTA 4CG1A 3AJ9A 1KIMA 1OV6A 2XIJA 3ZW7A 1J0BA 5IYZA 1ULBA 1TYCA 1JHDA 2BM1A 5I9SA 3T7DA 5HKAA 4BV2A 2X1HA 4HYTA 1JAXA 3AHIA 2R1UA 4UCFA 2H2DA 4IVRA 2Q7XA 5H68A 5L53A 1SKYE 4D4GA 3K0EA 4J29A 4KO4S 1NW5A 4N01A 3VKGA 1JP7A 2PKYX 5DTEA 3TOSA 4YMSA 1H93A 4KFTA 4EPYA 5AKYA 4HWKA 3REOA 4YDHB 4PYJA 3CZAA 3O31A 1YMQA 4EL0A 4PZAA 4AICA 2GVDC 4BAUA 5KJEA 4H7JA 5FWXA 1E1NA 4QC2A 4N5IX 1DBIA 1NRIA 4W9NC 1HEUA 2D0OB 1XA0A 3VMMA 2VHWA 4PZDA 4YI5A 3VZBA 2PG3A 2BH2A 1GKIA 2A9FA 1EE1A 2QAGA 2C20A 3OQVA 4QDKA 2AMVA 5HBGA 3ZHYA 4A2QA 1E1CB 3OZBA 1OF1A 1C5KA 2GK7A 2QNBA 3D4IA 4HX2A 1FZQA 3OJEA 1L7EA 1CUJA 5J4VA 3MRTA 4S24A 4K3UA 4AP6A 3EGWA 5JWRA 5EXEA 1LDYA 4IXNA 5FADA 1CJKC 2J85A 4HQ6A 5DLEA 1DAEA 3RVNA 1PNOA 1UQUA 3D81A 1S1MA 4K6KA 4LYDA 2VPYA 3AF1A 3FXAA 2CNKA 1RW4A 4X90A 3UJ8A 2RGNA 3C41J 4A2CA 3FVWA 1DQZA 2OR3A 5ERXA 3LQ2A 1Q7CA 1XAIA 5BV7A 4EWLA 4D9HA 1QHYA 4FC6A 1ZDMA 2I1WA 4GI7A 1YK1A 2AD5A 4DM4A 5K8CA 1CWUA 4Y98A 1MJNA 1XXHB 2G8NA 2VKQA 4ND8A 4TMZA 5AK4A 2AUMA 4XJSA 2CD9A 4BWFB 4ISCA 1EFUA 2XBMA 16PKA 1V11A 1Z2OX 2FEWB 3U0VA 5SZJA 5FL7A 3GROA 5B3KA 4Z9XA 4L3VA 3GLFE 2FQYA 4TSRA 1EK2A 1HBJA 4IUYA 1GDTA 2GPSA 2ZRBA 4FEAA 5CNKA 2W0SA 1N57A 3ROEA 3KJQA 1TC2A 4ZQHA 5LN1A 3B3AA 4DBLE 5I8PA 2WB2A 3RVQA 4QEZA 4I08A 5J4KA 3HXKA 3CC8A 1G8SA