3KQOA

Crystal structure of hpnmt in complex adohcy and 6-chloropurine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqoA00
3P9CA 3CBGA 4BP1A 5LSAA 1YB2A 5K0NA 2QY6A 1XVAA 5LR6A 5HIKA 3FTFA 3KPVA 1IY9A 2AN3A 4GC5A 4PYNA 5E8RA 5LQJA 1KIAA 2ORED 2GPYA 1EJ6A 3I64A 4F86A 5CVEA 5DX0A 1YFLA 2ZIGA 1NW6A 1JG2A 4PIPA 5GWXA 2B3TA 3DMFA 1BHJA 5M5BA 2VDVE 3CJRA 2K4MA 5T64A 3P8ZA 4YV0A 4X61A 3NDIA 2AZTA 3UJ9A 5E8JA 1XCJA 5BW4A 3DXZA 2PBFA 1I9GA 2PXCA 1BKYA 1X1AA 2UYQA 3MQ2A 4RTOA 3EVGA 2IH4A 1FPQA 1NE2A 2ERCA 2F8LA 2GAFA 2LD4A 2P40A 3DULA 3OU2A 3Q7EA 3Q87B 5FADA 1L3CA 4DZRA 3MAGA 3G2OA 5CVUA 5EZSA 4M36A 4P7KA 2C7OA 2JH8A 2Q41A 3R3HA 3HA5A 2I7CA 3PS9A 1O9HA 4P58A 1G55A 4AZTA 4CKBA 4CWAA 1ORIA 1MJFA 2IDKA 3BXOA 4A6EA 4DCMA 3PT9A 3SMQA 3QV2A 3ME5A 4KIGA 2EJTA 2IDJA 1KR5A 5K0CA 1Y8CA 1WG8A 2P3OA 4HTFB 4EVIA 3ELUA 2FRXA 5DTQA 4FP9A 2O06A 4E30A 4E2XA 4HGYA 3P9KA 4E2YA 5K0GA 1RJEA 4PGGA 5BXYA 4KW7A 5EIWA 3KQPA 2PJDA 1I4WA 3EVZA 4RTJA 1V39A 1F3LA 2BH2A 1Z3CA 3KQVA 3FPHA 4LG1A 3EGVA 4FZVA 4EKGA 3LCUA 2R6ZA 3KHKA 4PIMA 5KYGA 2YTZA 4RTRA 3FRHA 3LDUA 1XDZA 4OA8A 1AF7A 4BP3A 3P2IA 1ZQ9A 2QYOA 1WS6A 5U4XA 2IFTA 2UYHA 4AZSA 2GB4A 2O05A 4R8RA 3LDFA 3I53A 2BZGA 1EJ0A 3AJDA 3HA7A 3T7TA 2IP2A 1JQ3A 1N2XA 3TLJA 4RTMA 1JSXA 3GRUA 3PFGA 4PYOA 5DRTA 1KPIA 2JHAA 1ORHA 3E05A 2ZZKA 1NW5A 5GIOE 5LQNA 1TW3A 3M4XA 2EJUA 3GU3A 3E23A 2EFJA 2I6GA 5E9JA 3ERCA 3HCFA 5EEHA 2HMYB 1Q0SA 2AN5A 9MHTA 4RWZA 3A27A 3KR9A 3C0KA 1XDSA 4GOLD 4QQNA 4X41A 4YV1A 5GIPE 3GDHA 4BY9E 1WXWA 2OPBA 1I1NA 1VE3A 3BWYA 3DR5A 3FTEA 1QANA 1FP1D 1JSZA 1KYZA 5K01A 4CKEA 4DA4A 1L3BA 5C9ZA 3GXOA 2JH9A 3BWMA 5BW5A 1MHTA 4R05A 4X60A 4RTPA 5HIJA 4Z2YA 3A4TA 5KQRA 3R0QA 1RI5A 2XYRA 3F4KA 3HP7A 5FUBA 3ER9A 2OO3A 3B7PA 3I9FA 1EG2A 3M6UA 5KS2A 3HVJA 4RX1A 5EKUA 5GP1A 5K0LA 2PSSA 2O07A 5FQNA 5C0OE 2OB1A 1SG9A 1P39A 1G8AA 1NBIA 3GNLA 2YUIA 2CL5A 3R6TA 3AXTA 3LSTA 3TR6A 2NYUA 4BLVA 4UOEA 3NVKI 5CCXA 4OQEA 5E2BA 2I62A 3AWIA 2P3LA 1KHHA 5DM2A 5LQUA 2AS0A 1VL5A 4ER6A 2PXAA 3G2PA 1BOOA 3KPYA 4A6DA 3SSOA 3O4FA 4LECA 5IH3A 2ZZNA 3RW9A 3EPPA 3P2EA 3PX3A 2C7QA 2ESRA 1R8XA 3GIWA 2AN4A 1X1CA 5P8WA 5MHTA 4YMGA 2CKDA 2P41A 3SM3A 3UA4A 4GC9A 2HNKA 3MHTA 4C05A 4YUZA 3M70A 1VLMA 4ISCA 1SUIA 2OYRA 2UYCA 3I5UA 3KQQA 4QDKA 4GOMD 1INLA 3R9XB 1SQGA 4X1OA 1NT2A 4QPPA 1RJFA 2DPMA 2HTEA 3DUWA 4C04A 1QAMA 4PYJA 4KDCA 4U7TB 3VC1A 4OA5A 1JG3A 3BKXA 3G2MA 3I58A 1IXKA 3LPMA 3EGIA 4PINA 3KQTA 1T43A 4IKPA 1NW7A 3RODA 2FHPA 3LHDA 3X0DA 3KQSA 1SKMA 3FUTA 3KPJA 2YXEA 5EVJA 4AZWA 2XBMA 3UA3A 4EKIA 3EVBA 1OR8A 1UIRA 4R6XA 3O31A 3GRZA 3HCDA 3MB5A 3GO4A 5EG5A 3UJAA 5DM1A 3VYWA 4HRAA 2ZW9A 1XTPA 1P91A 3LL7A 5D1HA 4GUAA 3V97A 5ICCA 3OFKA 4M7RA 4FGZA 4HH4A 2O0LA 4BLWA 3EVEA 4YUWA 5B1SA 1XDUA 3C6KA 4KVZA 4WXHA 5EGSA 1N7IA 4CKCA 3CJQA 4AX8A 5KVAA 3NWBA 2B78A 3SSNA 2JHPA 3IEIA 4RTSA 2Z6AA 5E9WA 1R18A 3LKZA 1D2CA 1VPTA 5EZQA 1L9KA 2ZFUA 3KQWA 4RTQA 2P1DA 4MHTA 5FWDA 1PJZA 3P9IA 4XCXA 4HGZA 5K0FA 3LKDA 2GLUA 1YZHA 5DM4A 4DKJA 4GF5A 2ZZMA 2CMGA 2E5WA 4KWCA 5EKXA 4M37A 3MCZA 4E2ZA 2G8NA 3LCVB 2ZBQA 2P35A 4P7JA 3HCCA 1ZGAA 4YV2A 4YUYA 3IYLW 3L8DA 2PY6A 5EMKA 4F84A 2WA2A 3FZGA 3KR0A 1H1DA 2XYQA 3UZUA 1M6YA 1R74A 5EMLA 5HILA 5T6BA 3VC2A 4E70A 4FSXA 5CM2Z 4EMSA 2NXJA 3OFJA 4HSGA 2CWWA 4QTUB 5EOVA 3FYDA 2ADMA 1AQIA 2FK7A 2YXLA 3C6MA 4F85A 1RI3A 5DT2A 3HVKA 3TM4A 5K05A 3EVDA 5DX1A 3TRKA 1QAQA 3ID6C 4CTKA 2OKCA 3LDGA 4PYKA 5K0EA 4GQBA 3WSTA 1Q0TA 4AZVA 3HTXA 1JG1A 1WXXA 4GOOD 4DQ0A 5E9QA 4H0NA 3BWCA 3MCTA 2VZ9A 1U2ZA 2UYOA 5FULA 1JTFA 5HFJA 2PWPA 4G56A 1YF3A 4ZTBA 3TQSA 3PTAA 3NW9A 2H00A 1VIDA 3K0BA 4CTJA 1VQ1A 1JQDA 3G8AA 3TKYA 2WA1A 4XUDA 5DTRA 3T7RA 2YQZA 3SXJA 2VS1A 2AOXA 2ZWAA 3GCZA 1NBHA 3NWEA 2XVAA 3A7EA 2PLWA 4PYLA 4U7PB 3V8VA 5JR3A 4Y2HA 2PX4A 3EVAA 3G2QA 1P1CA 2OZVA 2PKWA 5C1IA 4AUKA 4LWOA 4PCLA 1NV8A 3LGAA 3BWBA 2G71A 3G8BA 3OZSA 2ZVJA 2AOVA 3CJTA 3HCAA 1F38A 4M38A 5DPMA 4ER7A 1KP9A 1M0EA 2Z6UA 2C7RA 5F2NA 5CVJA 2UZ4A 3TM5A 1G6Q1 4KDRA 5K8VA 2OB2A 2PX2A 2XVMA 4RVFA 3DXYA 3NTVA 2VP3A 5E1DA 3JWHA 2P3QA 3FTDA 2YR0A 4DM3A 4E31A 2OY0A 3FRIA 4ER0A 2FPOA 1NW3A 4MWZA 3G7UA 5D1NA 3CKKA 4FS8A 2EX4A 2HV9A 3G5LA 5CIYA 3G88A 3FUUA 5DLYA 4JXJA 3EMBA 3M6XA 2YVLA 4BLUA 2GH1A 2WK1A 5FA5A 2ONZA 2ZIEA 2AOTA 3B3JA 3ELYA 3LX6A 3M33A 4RTLA 7MHTA 3A26A 3JWJA 4YMHA 4RTNA 3B5IA 3HVHA 3QOXA 3B89A 3BT7A 1IM8A 3DXXA 2QRVA 4NECA 2FYTA 1VP3A 3DOUA 3FUWA 3VSEA 3UJ7A 4QVGA 2YX1A 5DXAA 3JWGA 3ELDA 1DUSA 2Y1XA 3EGEA 4MQ4A 3KU1A 3RIEA 2YXDA 1WZNA 3HCBA 1D2GA 4E2WA 3GGDA 1PRYA 2AVDA 3UWPA 3BUSA 3HEMA 2Z6QA 3M6WA 3B3GA 3ANXA 4C06A 5FHRA 4DCGA 3MERA 2O57A 3AXSA 3NMUF 3KPWA 4V0QA 2PVCA 4IV8A 2ZBRA 5CVDA 2JJQA 3OZRA 3ORHA 3B3FA 3REOA 3PFHA 4RTKA 3FPGA 3G5TA 1KPGA 2EG5A 4QDJA 1D2HA 1XXLA 3PLAE 5F2OA 3MGGA 4PONA 5HOQA 2B9EA 1X19A 3OU6A 5ICFA 2G72A 1DL5A 2ONYA 3HA3A 3ELWA 3R24A 2IIPA 3GRVA 4WVLA 5E2AA 2PWYA 3NDJA 4C4AA 1FJXA 1BC5A 3A25A 1SUSA 4L7VA 1RJGA 5HIIA 1G8SA 3CC8A 4E33A 2PT9A 2Y1WA 1R8YA 3LBYA 5ICGA 2AOTB 3KQOA 3O7WA 4PYIA 2GS9A 1JR4A 1ZHFA 3KPUA 3DLCA 1M6EX 4QTTB 3DP7A 4OBXA 4PNEA 3DMGA 1KYWA 4EQZA 3HM2A 2QRVB 3KR2A 4XUEA 5FHQA 5K03A 5EIFA 5FQOA 2AR0A 1VBFA 1NV9A 5JUWA 4KIFA 3UJ8A 3DMHA 3SGLA 5LQCA 3GWZA 1UFKA 2PXXA 5LQKA 4K6MA 4R6WA 3FUXA 1R00A 3HCEA 3PB3A 2OXTA 3TKAA 5GINE 3FYCA 3LCCA 3TMAA 4C03A 3CCFA 3FPJA 3UJ6A 4FR0A 10MHA 2HWKA 2AVNA 3DH0A 3P71T 5IKMA 1JTEA 5HZMA 2ZLBA 3OPNA 2IBTA 2ZIFA 4MIKA 4RVDA 1KPHA 3PX2A 5EMMA 5DSTA 4P7FA 2NP7A 8MHTA 3BGIA 1EIZA 1RI1A 4IWNA 3AY0A 1G38A 2G70A 3PVCA 5H02A 4RSRA 2P7HA 1TW2A 5DX8A 3THRA 1FBNA 4P7GA 4PYMA 5EC8A 3TOSA 2BR4A 3BKWA 3ER8A 3K6RA 1NW8A 3KQMA 1XJ5A 3OCJA 4PGHA 3TPZA 3C3YA 1YFJA 1G60A 4QVKA 4EK9A 3C3PA 5EHIA 5GM1A 3KQYA 4RVGA 1HNNA 1JG4A 4MTLA 3P2KA 3UJCA 3OZTA 1O54A 3GJYA 2ZBPA 3GRRA 2ZCJA 3IV6A 3CGGA 1DCTA 5KQSA 2P8JA 3KKZA 4DMGA 2AOWA 2QM3A 2FCAA 3LBFA 4HG2A 3E7PA 4Y30A 5DM0A 5GOZA 3EEOA 1L1EA 1AV6A 3UJDA 5FA8A 2I9KA 5DRYA 5ERGB 2AOUA 3EMDA 1X1DA 4POOA 4CXMA 3SX0A 3NVMB 4FT2A 3THSA 5G02A 4ER5A 4XUCA 3BGVA 3DTNA 3FPFA 4V0RA 1WY7A 1ZKDA 1UWVA 2V7EA 4PYQA 1YUBA 3S68A 2C7PA 3EVFA 4O29A 2R3SA 1SQFA 5EEGA 2XYVA 3P97A 1L3IA 2BM8A 2HR1A 2A14A 2ZWVA 2BR5A 5LQAA 2N47A 2NP6A 1SVUA 1KXZA 2PGXA 4PWYA 2P7IA 3U81A 2PV0A 2JHCA 3CVOA 5LQRA 2VDWA 3FTCA 2ZULA 2PX8A 4GBED 4IV0A 2ZTHA 3T0IA 1AQJA 3BGDA 1JQEA 1XCLA 4E32A 3KR1A 3LECA 4RVHA 1TPYA 5FCDA 2H11A 3UBTA 3EEYA 2IBSA 3A7DA 3IHTA 1EQAA 2GA9A 2PX5A 5HEKA 3D2LA 4OX9Y 3NJRA 4YUVA 5DXJA 5CD1A 4QQKA 3H2BA 5DTMA 3G89A 2QE6A 5DSXA 4QPNA 2B25A 4OBWA 3MTIA 2PT6A 4RV9A 3HVIA 5K0BA 3FUVA 2ZSUA 4YUXA 4LWPA 4B17A 4R8SA 4X63A 5FTWA 2DULA 4HC4A 2BR3A 1EAMA 1YZ3A 3HNRA 3JWIA 5FWAA 5T67A 3OE4A 5EPEA 1RI4A 5E1BA 3E8SA 3OU7A 1N7JA 2AOUB 2CMHA 4FT4A 1ZG3A 4GEKA 2JG3A 5DWQA 3GRYA 5F2KA 2H1RA 3SR4A 1RI2A 5K09A 2IGTA 1QAOA 3EVCA 3SSMA 4ATNA 2G1PA 3P9NA 1B42A 1QZZA 2FK8A 5ICEA 1QYRA 4RYLA 3M6VA 1VP9A 2NXNA 1FP2A 1O9GA 4PCAA 3TFWA 5CUQA 5E1OA 2BM9A 4C07A 2NNWB 1R6AA 4GOND 5E1MA 2OBFA 2IPXA 1RJDA 5EMJA 3UJBA 5CCBA 2IH5A 3OE5A 3QOWA 3UFBA 2KW5A 3BZBA 3MTEA 5HIMA 5CVVA 1X1BA 2NXEA 4DF3A 4HTFA 5GM2A 4C08A 1NKVA 1P1BA 4ER3A 5BP7A 5K0JA 3T7SA 1ZGJA 2NXCA 5EHGA 2VDUE 1HMYA 3DLIA 2V74B 4FSDA 4OQDA 2IH2A 3FPEA 4KRGA 2B2CA 3SVZA 5EQJB
chains in the Genus database with same CATH superfamily
1RRFA 2ASVA 4HPWA 1YB2A 1CETA 1K3TA 1L4FA 2HMAA 4G0NA 4GWGA 821PA 2AN3A 4GG1A 2QJRA 1MFZA 4KO8A 1H05A 1UM9A 2HF7A 3BS4A 3ZLTA 3PGXA 3FZNA 3O8CA 4Q7QA 2GBLA 3EZYA 5AJZA 5AW7A 5SYNA 2KLHA 2BKUA 4UQOA 4HD8A 2B3TA 4XB1A 3NHRA 5HGXA 3E27A 2WYOA 1TK2A 2JJ2D 2JAOA 1KFEB 2PUWA 5DTIA 3NDIA 3BZWA 5IDQA 1UPXA 1IHUA 1SVWA 1HE8B 4QX6A 3PPVA 3TW6A 2PXCA 4TSFD 1DUVG 2ZSEA 3QVOA 1TCUA 2XMQA 3OE1A 5AUNB 5IBRA 3CLVA 2Q9AA 1KQOA 1UWCA 2Z08A 1D6MA 1B6RA 1EIWA 1AHNA 4MLZA 4CKZA 4JYBA 1ZISA 3A9CA 1Y4UA 3I01A 1P2SA 4IDFA 3KSDO 1LY1A 1ZOLA 5DV9A 4IWYA 2WOJA 3NS7A 5EHQA 3D59A 3CISA 2A33A 1QBKC 1V8ZA 1F6DA 1WU8A 3CIFA 4LI0A 3TQFA 5JWOA 1DIBA 4IHJA 3KJQA 1TTHA 3MW8A 4PRZA 5REQB 3RV4A 3EGXB 1QJ4A 3B2QA 4XA8A 1Y8CA 3JSAA 3LKVA 1EGAA 2WG0A 3EFBA 5ERXA 3BIFA 4CDRA 5AM5A 4EVIA 1RP7A 3P0EA 5DTQA 4AWAA 1A8SA 3HZRA 1BAPA 5JMPA 3P2MA 2Q5EA 4GP9A 4N5NA 1N32B 3IUYA 5K0GA 1UT5A 2Z8YA 2XUPA 2HMVA 3DTTA 3UUWA 1P6QA 1T2AA 2V97A 4L8WB 3WZMA 1MN6A 1JH9A 1WUTA 4TSKA 2HCBA 1C8BA 3PEVA 1P6UA 2OGSA 1Z3CA 2PV7A 4S05A 3PNMA 4KHPB 3EGVA 5JCOA 3HR7A 1OIVA 1USVA 4CUZA 1WBDA 5SZKB 3L6UA 1XLTC 2GPAA 2KBEA 3W5SA 2H92A 1IJBA 2CF6A 4CJXA 3GGPA 3UO8B 5KYGA 4X3PA 2BZSA 3BULA 1IQRA 2AQ8A 2BGTA 9ATCA 5L3RA 1ODLA 3MWYW 3HE3A 1K63A 1PAUA 5JYBA 2ZRPA 1XRLA 5G4KA 1MIOB 1J0BA 4KQ2A 3DLPX 1EMDA 1N6IA 4GMXA 5FTNA 3FX2A 3RUFA 2B8EA 2HMWA 3CX3A 1NWHA 3F1LA 3M82A 4G1BA 3SQDA 1JSXA 3VUEA 4D4LA 3L2OB 2JCYA 4HAXA 1UXOA 3RYIB 1KPIA 4RMJA 1GTSA 1V7QA 3DZFA 1IPHA 1WNTA 3DTVB 3QI2A 5BPHA 1AZTA 1EX9A 4RKWA 2XEDA 3ANSA 1U8CB 5DF1A 1RWBA 4YJ3A 2HMYB 2AN5A 121PA 3RYCA 2X0EA 1RVV1 2Z30A 1JQLB 3H16A 4PZAA 3V4LA 3CLTC 3F8WA 3EIHA 1IK4A 4QQNA 4DGQA 3GI1A 4E6PA 5JANA 4HUQB 4P4UA 3FGOA 3BWYA 1VGQA 3U3JA 2XVYA 4EI2A 3NO4A 4EJ6A 2G5GX 3NBXX 5CYPA 5C9ZA 4FYHA 3L05A 3HYCA 1Z6ZA 5FYDA 1KP3A 2VNKA 2B0CA 4PHTA 1IRXA 1QIHA 3W4JA 1PQ4A 4EG6A 1N2SA 5B12A 1Z4PX 3R1IA 3WB9A 5GVRA 5EJ9A 1C29B 1OMOA 4BVAA 5AJWA 1PKXA 1PVVA 1TZBA 2BEWA 2GCNA 3HCNA 4L76A 4MKRA 1ES9A 2R8YA 2WLTA 1SNYA 2OFPA 3GCWA 4QWWA 4FOLA 1PNQA 1VCOA 2I80A 1L7MA 2NU7B 1CB7A 2ZIXA 4XPZA 3RKSA 1NBIA 1KI9A 2DQYA 4XX0A 5CVTA 2YUIA 3EPRA 3R6TA 1ZAYA 2ABWA 5AI5A 2Q29A 1IN7A 1U1DA 3AWIA 4G5YA 1KOFA 2HJRA 1A9XA 1XVVA 4MR8A 5DM2A 2HZBA 3ISVA 4XCVA 1Z28A 4LGVA 4RNDB 3UHPA 4LQLA 1S2OA 3OIVA 2FEMA 1K8QA 1XTIA 4RDCA 1GYRA 3W8DA 1UDWA 1C9JA 3FVWA 1GUYA 2W4MA 4AJLA 1C1XB 4ZODA 1WCYA 3QFCA 5THXA 4ARUA 3LW8A 2GSDA 3TDNA 5J2TA 1GUAA 1UFVA 5C52B 2HI0A 2YRXA 3KU4A 3VZQA 5MHTA 4LOIA 4PPNA 3AP1A 5LQSA 4WESA 1G59A 1SVSA 2VZ0A 1JEYA 2X7HA 1FX1A 1R12A 3OAAD 4NMXB 4P34A 4PSVA 4E5SA 5HZKA 3BF7A 4BRWA 1VJDA 2BI7A 4Q24A 2QYSA 1B1CA 2YC2C 1KXJA 3D3NA 4BBJA 1NT2A 1ZYUA 4Y2UA 2DPMA 2HRQA 3GT4A 1DMSA 3PV0A 5DOZA 1L5OA 4KDCA 2FQYA 3A28A 4U7TB 5DI3A 5C34B 2WM9B 1J0CA 3TIXB 3V4PB 4DA4A 1Z68A 2GSWA 4K5QA 3SWWA 1JR6A 4LNUB 4L9AA 2GPTA 3T0FA 3X0DA 1AF4A 3PWSA 4U3JB 4AKHA 4TYMA 1B16A 3Q40A 4NDNE 3IEVA 2EFHB 3QPAA 1OR8A 4I50B 3JAKB 4N82A 4RV5A 2F3PA 1UPUA 2VRBA 4EAAA 3VYWA 1C1DA 2QGZA 1XMOB 4MUYA 1ODCA 1PYGA 3ABSB 4FR2A 1P91A 2G80A 4Z1MA 2L0XA 1ISSA 3P94A 4QUGA 4ZAGA 2VFAA 2E6KA 2JH3A 1II9A 3QGMA 2A7XA 2BT4A 2N75A 4KDEA 521PA 3ZQJA 1JECA 2Q3EA 3UFXB 2QM7A 4H17A 1GUZA 5BR8B 1DAFA 4CCYA 3U3MA 1DOZA 2VTBA 2IW3A 2B78A 4Q6BA 3RS3A 4Z49A 1FRFS 1TADA 1DX4A 4ECAA 2WUEA 4DLZA 5JNTA 3N87A 1NVDA 3CE6A 4OOFA 5NULA 3IIKA 3LKDA 4Q9AA 3A1FA 2DPHA 4ZVUA 5EKXA 3O75A 2YY6A 3LPAA 5LPNA 3QEMB 2Q21A 3HCCA 1QC5A 2WAOA 1DLIA 3VR5A 1J6UA 1RKUA 2D2VA 2GD1O 3HABA 4M8NE 4CIYA 3THXA 2XYQA 1WD5A 1LNSA 1PI3A 1UXHA 3R2JA 4RLFA 1SHKA 5CM2Z 1JHYA 4HL6A 1I5EA 3ROKA 2XCSB 1HT3A 2VHQA 4TMTA 2NG1A 4B85A 4W5NA 3CLRD 4D9HA 1I7LA 2R6R1 4PZDA 4GKBA 5DT2A 1T9BA 3QE9Y 3TRKA 4DCUA 1GT91 1GFSA 3E5NA 2QX4A 4Q7KA 4REOA 1JDTA 1LDGA 1U1CA 4IEEA 3ROFA 3AUKA 3D3WA 5AW9A 4ALKA 2XCRB 1M1ZA 2P6MA 4BLPA 3PRKE 3OZEA 5ALOA 2OXIA 4CNQA 1CT9A 1M1YB 1QF7A 3QVLA 4QVIA 3UCFA 3T35A 3E9RA 2IY9A 4LSGA 2C5FA 2WMNB 2JGAA 3NEAA 4XR9A 3R74A 2OEPA 1YJBA 3L0ZA 3ODGA 4ALMA 3OEHD 1BN7A 1PEYA 4CKCB 3E4DA 4QDTA 2GKOA 1L5GB 1M2HA 4PZUA 1PHRA 2H2FA 1RWMA 5HVNA 1VJTA 1L7OA 2JGKA 3BE5A 3JRNA 3CX4A 3NHYA 4HGRA 4B3JA 4G1FA 5B7GA 4YECA 4JOCA 1ZM3A 3QMPA 4OK3A 3RUAA 2QORA 3AT1A 4WK4B 2UZ0A 1PD0A 4JVLA 2F9FA 3O94A 2TMYA 2VBIA 2IYZA 1I2DA 2QMUA 4HT3B 5BWLA 1YQDA 1A7UA 4KIWA 4I08A 5AIBA 1Z35A 3K2IA 1QVVA 1MAWA 3EQ6A 3TL6A 1NLUA 7REQB 5TMPA 1LV7A 3P0FA 4C43A 2GCGA 4AS2A 4CMEA 3CJTA 3L0BA 2WZDA 4HVTA 4QBFA 1EXWA 5FBRB 5C4MA 4Y0VA 2E4WA 4E94A 1AHHA 1T5BA 4HZUB 1OF1A 3VU9B 2UZ4A 2JFFA 3G02A 4WQMA 2XVMA 4N8SA 3GUHA 4OCZA 3JWHA 1H5QA 5JPDA 2YHIB 1RWWA 3UOAB 5IBPA 4JUCA 4KDFA 2CEKA 3G68A 4YWJA 1E2MA 1K6MA 4IIEA 4IZHA 4DCNA 2ZYSA 1F48A 2AJCA 2HF9A 4LJ8A 3LPCA 3R5JA 1I9CA 3GLHB 2GTPA 3JWJA 4TQGA 4LC1A 3GJ0A 9ABPA 5E4YA 1CUGA 2P1ZA 4L8VA 1D1SA 2AQKA 3H86A 3VRHA 1FRVA 2Q0SA 4F9EA 1PJQA 1CUWA 1MJHA 2YCBA 4ZQGA 4QVGA 5FPQA 3RU3A 2C97A 5DHSA 3VKVA 3WGHA 1X6VA 1FMLA 4ND6A 1JQKA 1O7JA 2LKCA 2ZPTX 1YTLA 3VKFA 2A57A 1II8A 2FMHA 1OHHA 3EF1A 3QE2A 4PM4A 4QFBA 1EFAA 1YMVA 5AYVA 4P7BA 4S35A 3VAYA 3DBRA 3BUSA 1O1YA 1V1RB 2PZMA 4D8VA 2HY7A 3II6X 3G2NA 3N8KA 4WI1A 5IT5A 3ZWYA 4N0PA 3ZNQA 1A2BA 1EGMB 2I4LA 2AE1A 2BI8A 2WLSA 4DDKA 5H8WA 2G1UA 2WPDA 4RKRA 3NM5A 1DJQA 1TT5A 3MTGA 3O8LA 1YI0A 3ZD9A 1XKXA 3CZ9A 4CF4A 1D2HA 3QVMA 2RGBA 4BGVA 5HOQA 4M0DA 4PONA 4UUQA 1X19A 5EWJB 1BWQA 4C0JA 1LSUA 1OBVA 2IXAA 3A9RA 4JHLA 2IDZA 4OHWA 1NRXA 5ARDA 5EVCA 4MW6A 4CTNA 1CQPA 4H7DA 2HXSA 3BH0A 5E2AA 2F67A 3O91A 5C7OO 1PWZA 3PWTA 2AEMA 1XNRB 3VH4A 3DR3A 4JI8B 2X77A 4DUYB 4YP0A 1PW5A 4U9HS 2CL0X 4TM8A 3HL4A 3COVA 3S2GA 3WOHA 2R6FA 3SXUA 4RSGA 1K92A 1Z75A 4C2BA 3GGOA 4DV3B 4TTTS 2AX3A 2W37A 1UC5B 3LAWA 4LOLA 5HX7A 2X3UA 3HM2A 1KOLA 1P2FA 1I10A 5T3UA 5FQOA 3ILHA 5KINB 4EEZA 4RSMA 4UBLA 3ZUGA 2G28A 4KIFA 3CF2A 1V7ZA 1EJ2A 3T4PA 1DNPA 2XA2A 1P7VA 1QYDA 2P5YA 3DHEA 3FWNA 3HJCA 4X1YA 3T4EA 1AXRA 3FCSB 4M86A 4CM9D 5AD1A 4YMVA 4CG0A 3NBKA 2OBNA 3FMGA 2OUKA 4KNVA 1RVDA 1X8KA 1ZNZA 4HDRA 3PCTA 4HUJA 4Q4HB 4WNIA 3ZU4A 1MJ5A 2W0MA 2BGIA 2NVUA 5I5EA 5JVDF 3FOAA 5HZMA 3TPFA 1IZ9A 4RA6B 5DSTA 1EXMA 3EZ7A 3NRBA 4W1PA 2HC9A 4FCCA 3PR3A 5DYNA 1CR1A 2CE7A 6AT1A 3G1UA 2HBYA 3O1IC 1ARZA 4LV5B 5DBOA 2P2LA 3RRJA 4MWEA 1K97A 2F43A 3K6RA 4ZK2A 1N2CE 4TKVB 4EUKA 3W4KA 3KSBC 2BTQA 3HZOA 1SG6A 2CLDX 2MR6A 3DAFA 3KYCB 3MWLA 1TQHA 1XAHA 2RJNA 3DLTA 5D3ZA 1S89A 2GEFA 4OFZA 4AKIA 4H9GA 3RYTC 2A86A 1M5UA 3IVMA 3KKZA 3QOYA 5H16A 2GO7A 4EHAA 3TLYA 1ZUWA 4KQJA 1H2AS 1JA1A 1UBNA 1UXKA 4WJLA 5FA8A 3ZDEA 1HYEA 1AV6A 4LZAA 1A50B 3WLIA 2E9SA 4BUJA 2XMGA 1RD4A 1HGXA 2HNAA 1YUNA 4P3XA 4PYQA 3S81A 3DHNA 1PLJA 3PD0A 3DEKA 4JY7A 4H0CA 4YO8A 4EI7A 5G1PA 5CT4A 4EYGA 2J0SA 4FBLA 2PGOA 5PNTA 2WC1A 3R9WA 2HU5A 1T3HA 2P7IA 2JLVA 5E0OA 2D4HA 3B38A 2D54A 3IJ5A 1NYLA 4IHAA 1NXVA 4DLLA 3TAUA 4O1HA 4MUNA 4PTYA 4D3YA 3T3NA 2WJZB 3JZFA 1EFTA 2ID8A 2AD5A 2Z0MA 3C16C 4FJ0A 4BEWA 4I1UA 4M1TA 3AU8A 2FPMA 3OKCA 5CXSA 5FKJA 2AFRA 4KN8A 5DXJA 4EY5A 2QE6A 1BJKA 2JGDB 4B6SA 2QAJA 3IUMA 2V9CA 3LOPA 2A9JA 3SD7A 2PKYX 1KAMA 1UWLA 2FUCA 1YBVA 3FUCA 3P9QA 3KJIA 3IESA 4KJZA 2BBSA 1YHZA 3AM5A 1XVTA 2YWDA 3A0RB 2C4KA 2RONA 2FW6A 3VPXA 1WULS 3RLIA 2PZJA 3R0VA 2GXAA 4Z1MD 3RSZA 2YZ7A 1MB2A 1TD9A 1H66A 3CLRC 1JDPA 2FQXA 2WIAA 3NWJA 3TTWA 3ZI7A 4BV3A 5I48A 1V41E 1W8IA 2ANBA 2FF7A 2XECA 3CFYA 3MFQA 1EP9A 2BY4A 4RYLA 5ARBA 1W6RA 3F8TA 3SX4A 2JARA 3HM9A 3VA7A 1Y6GA 2FV8A 1Z5OA 2IZ6A 4YRLA 4U0KA 3IRUA 4URYR 4R1OA 4EYSA 4NCHA 4PC6A 3WMEA 4XGQA 4EHLA 1VKOA 4KMMA 2IUEA 1C14A 3QKRB 2P9BA 1H0HA 2BI4A 4BMPB 5JJ5A 4CCSA 4CKWB 1EVKA 3M4NA 4LZLA 4LYHA 2NXEA 3PXXA 2X3YA 1NULA 4PR0A 5CW2A 5FPSA 2X41A 1B41A 3RYFB 5B36A 5IPFA 1QLJA 1TJPB 1ENZA 2IKSA 3VR5D 3N86A 4Y3UA 4IH4A 3DLIA 3F9RA 1GITA 2GZDA 3H17A 4WRRA 5KOHA 1N1EA 4Y2SA 1DRWA 1ABBA 4W7IA 1YE5A 4WXEA 5LR6A 5J5VA 3CNLA 4NJOA 3UJ3X 4YAGA 1NG9A 2ZI3A 1JDNA 3E15A 3I5XA 2VUIB 2V0NA 4MITA 4MB2A 3CLKA 1E0JA 5JZBA 4PLZA 1CUIA 3KX2A 3RTGA 3O90A 3OOEA 2ZPUA 1EFLA 4X61A 1ZD3A 2AZTA 5ELLA 1XRNA 1FNNA 2RC6A 4DIUA 3ZVNA 1W581 1J56A 1WB6A 5K3AA 1I13A 1Y80A 4OXRA 4YWHA 3P4XA 2GBLC 1YA4A 1QVZA 4U7WA 3DC7A 2G77B 5IJ0A 2C4VA 3R7WB 2PZAA 3MQ4A 1BNCA 4KPEC 3CKYA 3R3HA 5DKFA 1Z08A 1Q0PA 4ZT7A 3G2IA 5JSQA 3UPTA 2M6KA 3E3LA 1RRCA 5B4UA 1O9HA 1NN1A 2FZGA 3I3SR 3QXSA 2I65A 4FDVA 4LJ4A 4NABA 4R16A 3ZY2A 4E6EA 4KH1A 3H1PA 1N2JA 1TLFA 2FPGA 3R3JA 4K6CA 1GPH1 3RQIA 2P6NA 2VEDA 2VAXA 4BFXA 1WETA 4H27A 4I7EA 3O1JC 3VR4H 1QP7A 2OHXA 1ONPA 2UZ1B 2AC7A 4D9KA 4MCIA 1DBVO 1RACA 2OYSA 4QELA 2J9FB 1ZIPA 3AIMA 3BRWA 1KVQA 1VPDA 3JQGA 3WO1A 3CF4G 4K9PA 4L6IA 4E2YA 2HDWA 2QN6A 1H8HA 2H5EA 3TR5A 3K0FA 1X9HA 5FBHA 1F9EA 2F6RA 2P1RA 3MIIA 5KSZA 1MVLA 4JYPA 3KT0A 1QZ3A 2VZLA 1ID1A 3C1UA 4DW8A 4MRVA 1W1IA 1ISHA 1Z2DA 2C4TA 3D6TB 3ESRA 3AONB 3KZCA 4GAEA 1SY7A 3U7QB 4J1NA 4UVGA 3FRHA 3SHWA 1V26A 2VT6A 5KAMA 3O47A 4KR0A 2CK3A 1AN9A 1CUSA 1DE0A 1TIPA 1XAGA 1YJXA 2BHSA 3OD1A 3FYUA 4TN1A 5CT9A 1L5YA 1ZW6A 5H59A 3V3TA 2JJMA 4MICA 2IFTA 1L5RA 3N3BC 1JHOA 5JCOC 3I53A 4K88A 2APJA 5CHEA 2KM1A 2ZYHA 1A2KC 1GG5A 3FOFC 2CLLB 4P84A 1P5FA 4BGUA 1E2PA 2GJ9A 1QLWA 1S2GA 1NW5A 2ZVPX 3I83A 4YJFB 2W11A 4NH0A 1AV7A 1GR1A 1TW3A 1V5GA 1H3NA 5BVGA 2VRNA 2IEYA 3ZC3A 1F0YA 4M7PA 1OHHD 4LF6B 4FI3F 1GZSA 5I45A 1Q0SA 2GT1A 3FOZA 1VE5A 3KR9A 4WSOA 3L02A 1XDSA 1EHCA 4PC1A 3K15A 5I3CA 5KTYA 2JGMA 3D3QA 4PANA 2Q2OA 2J4FA 4D3XA 1Y4SA 1JPNA 2LDXA 1DS6A 3VZRA 1DOAA 2WPDD 3E5MA 1FP1D 1Q84A 1C0EA 3D6UA 1NBAA 1NXPA 3WK6A 1IM2A 1ZBQA 2JH9A 2DWCA 3B1XA 3MJEA 3TN7A 2R96A 2JATA 3CVVA 3O1LA 2UZAA 2W2NA 2XKBA 3HP7A 2CCKA 3IPCA 4IKOA 2RB5A 3NBAA 4RGBA 4FFNA 3RTEA 1MEEA 3FA2A 3IB6A 3IIMA 2A4MA 4YAJA 2HJ9A 3V2IA 4YQFA 4J16C 1D1TA 3E9EA 4KJXA 4EJFA 5HNKA 4GM1A 1CERA 2GCEA 1EE1A 1GO2A 4BUCA 2I1LA 5I7EA 3PPIA 4BVEA 2XNKA 2Z4TA 3HJTA 5LZ7A 4ETIA 2PKQP 2W2KB 4HAVA 4YJKA 1OBOA 1EI9A 2NPOA 3FLEA 1KU6A 4P5EA 4C5AA 4TXMA 3DWEX 5H83A 3VTZA 3VVLA 2A1TS 1BE8A 2F3UA 1VL5A 1PL6A 3L8FA 3QFSA 4H6PA 4CQNA 4DXDA 1BOOA 3TGLA 3R44A 2Y4OA 1TEXA 5KSOA 4W63A 3IR5A 4ND2A 3DE2X 3JRWA 4JAVC 1P7YA 1MO5A 5HRAA 1FY2A 1NQXA 1GU1A 3PXBA 4RSHA 5TQ0A 3HLTA 4IXTA 4O4LA 2GUWA 4BKUA 4R41A 4BYMA 3U44A 3KTDA 2HNKA 4RQTA 1G5RA 4DLXA 3RROA 3H8SA 4B3DA 2OV3A 4L07A 3FPCA 1INLA 2QD4A 5LDHA 1XTVA 2AG8A 2ZYDA 1MV8A 2XUGA 3CG4A 3KCQA 2W8ZA 2QQFA 4OB8A 3SIPA 5AQ1A 2OFOA 4I9UA 4LXQA 4E22A 1IHOA 3S44A 3NBZC 1UOEA 3PRJA 3DSRA 4N03A 1Y4ZA 2IZOA 3FFBA 3KLNA 1V48A 1Z2CA 3QUAA 3RGGA 4AZWA 4JMLA 3ND9A 2NZ8A 1NJ2A 3IXLA 3ZWPA 4GR5A 4WLVA 2WWIA 4ITRC 1ODKA 1S4MA 3LT2A 3ZKAA 2EZTA 4HDSB 3GK3A 2VJMB 5FP0A 4G0XA 1WEHA 3BFPA 4A0RA 4DFDA 3BHMA 4HFJA 3T7JA 4X7RA 3N2EA 2IYOA 2NW6A 4F11A 3C6KA 4Q9DA 5TF4A 4D81A 2H4FA 1CDOA 5K4GA 1ODIA 1Z7WA 4HAUA 5LZ9A 2I4IA 3NWBA 3JR7A 3MGAA 2EF0A 3I2FA 4IX1A 3COPA 3W7AA 1AURA 3OKAA 3S8EA 4QZVA 2P1DA 1F3OA 3AG5A 3IEKA 2Q6LA 5F3WB 5K0FA 5BNZA 1BX1A 4A15A 1XZJA 1BDBA 1X9IA 2CW5A 2VO1A 1Z6GA 2I1QA 3ICVA 4KXLA 4X0EA 3TJMA 3KKLA 4CLEA 3F71A 1BCSA 2CLIB 1FA9A 3FCCA 1U3DA 1YFZA 3GLQA 3HI6A 4M6WB 5HUQA 3C5VA 2P68A 2X7JA 3VTFA 4DREA 4OO3A 5FPYA 3TFOA 4EMSA 3K6SB 1NXTA 3EZGA 4QOIA 3CB4A 3EXHB 1JIUA 1CRLA 4D26A 1GPBA 4N7MA 1R88A 2R5FA 2R9VA 3TTXA 5K05A 4BNYA 1QAQA 2VLBA 5IT4A 4IDCA 3PQ2A 2ZWIA 1QKIA 3ZX5A 3GJ5A 3FCYA 1ISJA 3C3CA 3V2GA 2JD0A 5E9QA 1XALA 1KEKA 4A6XA 1KQGA 4L5CA 5JT1A 3KJZA 2PWPA 3O4VA 4KI0A 2DHQA 3DV0A 4BL5A 1T3TA 3E18A 1O9BA 1OYOA 2C8VA 3JQAB 3ROTA 4F4FA 5JAIA 1YZQA 1IYZA 2FNAA 1SK9A 3L6OO 4RHCA 1ZGZA 2HHCA 2H4ZA 1QCYA 2GWHA 4ZOEA 3KVVA 1NJFA 3TKYA 1N7HA 1G21A 2DR0A 4B71A 3AVTA 2JLAA 2X0DA 1VIMA 3BWXA 4ZI5A 2AOXA 1UP4A 1G5TA 1N2EA 2PLWA 1LBTA 1N25A 4I3FA 1EFPB 3ZN2A 1TYAE 4JLMA 3HU1A 1X86B 2IEDA 1CXZA 4J43A 2YWJA 5EP4A 4EGCB 3BWBA 3R4VA 1R4NA 4BO2A 4DIBA 2GZ3A 5F51A 2AJ8A 3ETJA 4ZQEA 3D7LA 5EWMA 1E66A 1PSWA 4RCVA 4PSCA 2C7GA 1GFWA 3FDJA 1FYDA 1TM2A 3DG9A 2PS9A 4IR7A 1OIWA 2O5VA 3PE3A 4N8DA 4WKCA 5KVSA 1R4MB 2HIHA 1V2HE 1I2ZA 2V4MA 2V58A 2YR0A 2Y3IA 1DKMA 2Z2IA 3C8ZA 4X00A 4LBWA 4CMEC 3DLBA 1NW3A 3G7UA 5EE0A 2C5BA 1DBRA 1W35A 1VHWA 2PSFA 1WTAA 3EMBA 5CDTA 3QH4A 2NO6A 1LRJA 5BYJA 2D1TA 1UBUS 4I1YA 3QKTA 3ZBTA 2OFWA 3CCCA 2ZJ7A 1O6FA 5IJAA 1HC7A 4DRZA 1Z2EA 3I6YA 3GMDA 5F21A 1DG3A 3FUWA 3I9LA 2C00A 2ZAGA 3PL1A 3HB5X 3ZCQA 5JC1A 2BN4A 3BIWA 4DNXA 1IOVA 2GHRA 4TKUA 4XYMA 4QGGA 1JIQA 1F2VA 2OV8A 1QIJA 3ECAA 3G0BA 3GGDA 4AUNA 3HEMA 1GY8A 2IXBA 2RH8A 1P0QA 1Y9DA 1NVVR 2Y8EA 3B3GA 2HSZA 3EEBA 4B9AA 3AXSA 1I2AA 5E7QA 3BCSA 3C6XA 5CVDA 3EXEA 3N28A 5FUXA 2YHUA 5REQA 4EP1A 4J0EA 3RRFA 3UXEA 1RQXA 3QITA 1U5BB 1EM8B 1ZH0A 1H8HD 3SMVA 2CXUA 2D0OB 4TTIA 3EXG2 4H77A 1WLYA 3KXKA 3LVFO 3GZNA 1NE7A 3PGJA 5FNVA 2WSYB 3TOVA 3DMNA 3OIFA 4TMXA 1QBGA 1QPBA 3WNCA 5K6TA 1GM5A 2OWDA 3E7FA 1QTQA 4EB6B 4UOZA 2CK3D 1BC5A 2VQDA 1ZHOA 1M1XB 5HIIA 1RJGA 2X0IA 4BLTA 1M6NA 2VHWA 4NBKA 4DM7A 4MZDA 1ESMA 1PR2A 2WVJA 13PKA 4ZCIA 1TUBB 3IJEB 2R2GA 3ASVA 3E9CA 3EJ6A 4U6NA 1QG6A 1ZRMA 1VHJA 1B00A 4FE3A 5KSWB 3OZXA 2W4QA 3E22A 1AG9A 3DXFA 3KB6A 4E14A 2YYAA 3N8DA 3EC7A 1ZMOA 3NNNA 2W98A 3GJRA 1VBFA 4IVRA 3EW9A 5LP6C 4ZPXA 4LGCA 3WIOA 1TYZA 3DMHA 3WRYC 1ORTA 1X39A 3GVPA 4UU0A 4F4DA 2PMKA 4L50A 4B2PA 5A3JA 1JKMA 1P18A 1THZA 3BSWA 3QX7A 4R2KA 3M3DA 3TKAA 5TPWA 5KOJB 4BS9A 4LXIA 3FYCA 3SS9X 4TS3A 3MWKA 3GGJA 2FQQA 3UHAA 9GPBA 3PGA1 3ADCA 2LIVA 1IDN1 3GEHA 4KXNA 1PSDA 4I50F 1FF9A 3ZDBA 4XIFA 1SCAA 2Q46A 4GDFA 3MJRA 4HWTA 2XBUA 4N5HX 3WNBA 3OZCA 4FDUA 2ILTA 4G65A 4BQOA 2I76A 2NO5A 1H22A 3KELA 2Q4DA 2QXYA 4PYMA 1X3LA 4QRIA 3RIXA 4QGAA 2FMFA 1L7PA 4GZLA 4B8ZA 3V1TC 1TB4A 3S2SA 2PUAA 5J4LA 4OIFA 2O2EA 1ZJ5A 4QHTA 2NUPB 1C7RA 1SMKA 3UJCA 3UM9A 3BL8A 3INGA 1VL8A 1NUUA 2IXTA 1KO1A 3QLTA 2ZSAA 4EA6A 4RTNA 1NVAA 3I5AA 5JH7F 1R5BA 4E88A 4NR0A 2PT5A 4MV6A 4A9AA 4RCYA 2BCEA 4POOA 1VI5A 1ESZA 1Z0KA 1ZRSA 4V38A 1E79A 2A1IA 4TN5A 3I37X 2G67A 2VDRB 3DTNA 4RPCA 2YRWA 3DMYA 2RD2A 3DL7A 5LP1A 1AE1A 1QFZA 1P4HA 4M54A 4NV3A 1SKQA 2VXYA 4UHFA 4AO6A 3REQA 5IT0A 2HB6A 3QVGB 3DV2A 2BM8A 1X80B 1F5SA 3IDZA 2WYIA 1SVUA 2UAGA 5LB2A 2A78A 1GRCA 2HWYA 3AIIA 1WMEA 3UN1A 2YBDA 1RZRA 2XCUA 2VHUA 3WSVA 4BE4A 1IBRA 3WAGA 1L7NA 1NVTA 4L3WA 2PL9A 3KZ1E 2IBSA 5U4QA 4JJFA 3OJWA 1EQAA 1TZJA 3CSDA 2A1UB 4UD6A 5LDGA 5BN3A 1NNEA 1CRPA 2EG9A 1WQ1R 5KYUA 2CXRA 3PHCA 5ANRB 1HR0B 4AS1A 1LDBA 5LJLA 2D8AA 2IYAA 3UGKA 1VLJA 4LWPA 5DYIA 2MYNA 4D79A 5LXTB 4HC4A 1SUEA 2NUAA 2DWPA 3H9BA 2C3OA 4B7XA 5K2OA 1NY5A 3ZVMA 1J2UA 4HAIA 3KFVA 1FXUA 1LS6A 5C1BA 2J0EA 4LXUA 4R54A 3GLIB 4BTEA 5DWQA 3UIEA 4TYNA 2JFVA 3CW9A 1CE8B 2P2SA 3FB4A 3VR2A 2IY7A 3P9XA 5B5SA 4BUZA 8OHMA 1NT4A 3T1HB 1E3DA 1PG5A 3E0XA 3IERA 2QZSA 3EASA 4MWCA 5J9FA 4LA4A 4FXOA 5JG7A 5AVTA 4K2HA 1QYIA 3HI4A 4GKAA 3EXFA 5JAPA 4LSZA 1DO0A 4HQRA 4MVCA 4Q3KA 4HN4B 2JZOA 4FYVA 2BJWA 4FHDA 4J76A 4BNZA 1JL3A 4JBWA 3H6KA 3UMBA 4CMHA 4N7BA 1PP4A 1NOKA 4KXYA 1NBWB 5EIBD 5DCUA 1P2BA 2AMLA 1UQUA 3CZ4A 3EMKA 4IUBS 3R7AA 5C35A 2LIPA 1SKYB 1CRWG 2J87A 1KDPA 2Q3CA 1Y3DE 4BP1A 5KNBA 2NX2A 4CCYB 1WDMA 1QCCA 3KPVA 3PNKA 2IOQA 3SN6A 1ADGA 4B3FX 5LQJA 1JVNA 1H2HA 3LIIA 3AGQA 1F14A 4AX4A 4F86A 4Z7QB 1ZR4A 3FPSA 4G9GA 2R47A 4TV9A 1U04A 3W6UA 1TAHA 1T5TA 2QG6A 2QR2A 2VZEA 3IJRA 1L5WA 1T1RA 4GPTA 3TLMA 5A3RA 5M5BA 1GCOA 5BW4A 4M0LA 4X8HA 4G8JA 2YUTA 5HE9A 2BEKA 3IELA 1I9GA 4KYIB 3H6HA 1DRKA 4WECA 4X3OA 2ACVA 4JQCA 2E82A 1FPQA 1YMQA 2P40A 2JDIA 3U7RA 1W34A 3AO0B 1WKBA 4B3TB 1PJ2A 3KOOA 1CJTC 1P8AA 4OUKX 1V1MB 4MA5A 4UBNA 5B3JC 4J1TA 2PJRA 3CCBA 3PSAA 1M1YA 2FUEA 4Q3CA 2BCJQ 2JIDA 2YFYA 3UWDA 2HA3A 3HA5A 1C41A 1KOJA 4FXPA 2XDAA 3CLUD 3QOFA 3VGJA 3IV9A 1N6KA 5H9WA 1HXHA 2QLJA 3NP7A 5DASA 3UMGA 1PQUA 4AG6A 4FDAA 1J1IA 3H5NA 2C98A 3D5TA 1J7JA 4JFRA 2V6FA 1EM6A 3M4JA 3R5TA 2VRCA 3UB2A 4ZKEA 3HPQA 1AO0A 1CQWA 2XUOA 3EWSA 2EWVA 3JX9A 5LA6B 5L53A 4UE2A 3LF2A 4QU9A 1LGYA 1MOZA 2QTCA 2PX6A 1S2IA 3AJ8A 3MWDB 4KC0A 1U7UA 4KW7A 3K05A 3O6VA 2PUEA 2CBZA 1JQJC 3EFOA 3G23A 4QL3A 2XB2A 1V45E 2Q1WA 3IAUA 1KKLA 3MINA 3PGKA 4M8IA 4NDZA 3RFCA 3KQVA 3AR9A 3V6LA 1Y1QA 7REQA 4F9GA 1GCAA 2X5JO 4KP7A 1ODFA 5AXBA 2R6ZA 3MWJA 5SICE 5U9CA 1XOIA 5DK6A 2M1XA 1Q7TA 3M1AA 4CN8A 2O2SA 2RH4A 4CV2A 2DPXA 1CKEA 5A9SA 2VT3A 1EVLA 2Q6KA 3O8OB 5CLQA 4BQNA 1Y6RA 3GLFE 1Q14A 4LDAA 4YJHB 1IHDA 3CPEA 4PPFA 4DMCA 2VUTA 2W2PA 2O05A 2SHKA 3LVRE 2X86A 3FF1A 4IGKA 4CW7A 3KOMA 4RTMA 2W2VA 1N2XA 4EYEA 3CZCA 5DRTA 3C15C 2R1TA 4RL6A 4WDRA 2R25B 1GVHA 1RLMA 1ZOOA 3DKKA 4EFMA 1SQ0A 1K08A 5B57C 4BVLA 3JCZA 3E23A 5EINA 3WLOA 4K03A 5KJCA 3ZIUA 1KDOA 5EEHA 2YIMA 3GVIA 3L92A 2EKLA 1QDLB 4TQ9A 3TVTA 2OC4A 3WRWA 1JFFA 2F00A 1PT8A 4AJ2A 2PUDA 2HU2A 2WUWE 3LW7A 3OJLA 4IZOA 1BS9A 1HQDA 1QYCA 1SIOA 3GA0A 1ZWLA 5ELMA 1B8VA 3DEIA 1RPAA 1Y89A 4MWGA 1XFDA 1PWXA 3EDRA 4JA2A 2FEAA 3IRVA 5EE9A 4EABA 1K7YA 3WXBA 1JG7A 3EQ2A 4LN1A 3A4TA 3R0QA 1I36A 5E6UA 3T4UA 2R86A 2P6PA 2ZSDA 3M6UA 1QGYA 4WNCA 5JJLA 4BFZA 3B7GA 2IHZA 2M98A 3GP3A 3RVOA 2GZSA 4N01A 3O3NB 4W99A 5K7SA 1L5QA 3AY6A 5KPDA 3RHZA 5TLSA 4RS4A 3NVKI 1Y5RA 2WUFA 3KTAB 4HDMB 4BV8A 3U48A 3TG2A 1FJ2A 2CC2A 3E2PA 5JRDS 2W7TA 2IZZA 2QD5A 3WVNA 1NRIA 3MN1A 4CIDA 2GETA 5SZJA 1P0PA 4ZZIA 1N1GA 2FW8A 2JFWA 1DXHA 3U19A 1NUSA 4QGBA 1CK4A 2FB9A 3PQDA 1GCUA 4P33A 1DAMA 3F6BX 4GWLA 4BMVA 4C0LA 1NBEA 5I4CA 1EFUA 5CK4A 4EW3A 4CG1A 1T3SA 3ANNA 3JQFC 3A2KA 2JVKA 4IIJF 4YCSA 1JB9A 2BCGY 2HRBA 3DTVD 4ZANA 4L4UA 5SZIA 4B48A 4R7TA 1GNLA 3FVRA 4M1MA 4BDSA 4CIBA 5CDGA 4F4CA 1AC5A 2KHZA 2AZXA 2C61A 2ZRLA 3I5UA 4HB4A 5L51A 5BT9A 3QJYA 1SQGA 3QFFA 4ND7A 3NYQA 3PXAA 5FLKA 3V7FA 3SOPA 3SM9A 1UPCA 2EKDA 3OZGA 3B5JA 2QBYA 1FNMA 2FEXA 2QL6A 3PGLA 4QGHA 5K0TA 1DI0A 3VC1A 1ZITA 1HSOA 3QEOA 1HEUA 2OECA 2L19A 2VG8A 2X22A 1EDOA 4O1MA 4RA6A 1S01A 2JVIA 5E7JA 1UADA 2GFIA 3C6YA 4BGEA 3LUCA 3Q1KA 5BRJA 1O3YA 1QM5A 3ORRA 2R8XA 1WSBA 1CB0A 1UIRA 4QBTA 3KQUA 3FBWA 1TO2E 3BQ9A 2WF8A 3MB5A 3ONEA 5COAA 3KYCA 3O4GA 4UQLA 1EP3B 3ZHRA 1LW6E 3VYSB 2ZWOA 3LA6A 3U3DA 5HE8A 2ZUSA 1ZI9A 4GUAA 5IXYA 1V6CA 2FPRA 2CLSA 1E79D 3OURA 1SUAA 4TMKA 4MGIR 3VI4B 3ASUA 4AWBA 1XJCA 2EYUA 1VI6A 4OGKA 4Q9IA 4C7OB 1T1IA 1E1MA 4M9RA 4PWZA 5DMHA 4B34A 4INPA 2K6GA 2DBYA 3CR3C 3F6CA 3IEIA 4XYEA 3S29A 4A10A 1FSPA 3DFUA 2Q4RA 3GWGA 1I3CA 1I4DD 3OHSX 3BXPA 2E2WA 3GFVA 5D01A 3WI7A 4MHTA 2OV2A 5CRIA 5HQJA 2OAEA 5LOVB 2ZM6B 4CGZA 1ZESA 3PKIA 4XPIA 1QONA 4EARA 4MW7A 1DIOB 1EGHA 2YZ2A 1RZRD 3FWKA 3I6MA 2Y1FA 2PMWB 4M88A 2J4DA 4L6AA 1E3WA 1YQGA 2O3RA 3RJTA 1P5HA 5C8DA 3N6RA 1R8QA 3CNEA 1RBQA 4I4TA 3QWFA 3WKCA 1CIPA 2KLBA 5FUWA 3Q3VA 2Y27A 1O97D 3VHXB 4AMGA 3IUEA 5BSWA 2FR1A 4JP1A 1SUDA 4UEKA 4XVQA 1V8OA 2QMHA 2YXLA 2OM6A 4PR3A 4P0PB 1A77A 4XFDA 3YASA 5FI5A 2FG5A 1E62A 4KWIA 3MTBA 3UYKA 1N2OA 3ID6C 4QXOA 4AMBA 5H70A 1OXKB 3R7LA 1S2LA 1IBCA 2OAQ1 1KFKB 1Z15A 2FEWB 3GLTA 2VZ8A 2UYOA 3QX8A 5FULA 3RK4A 5D3MA 3VMMA 3TPCA 3O2JA 4XE5A 5J63A 4JUIA 3GT0A 4RKYA 2QGFA 2W42A 3VR2D 2XUIA 5HW0A 1RIIA 2ZXEA 1XQVA 4XCQA 2ETXA 4LSMA 1AA6A 1U2QA 1XEWX 1FDSA 5HCUA 4IVNA 1WV1A 2G9RA 3BMNB 4TVOA 3VR3A 2HUPA 5LLSA 1UK8A 1A8QA 2F3TA 2QL7A 2XVAA 3KKQA 1S1MA 2W2TA 3VNRA 2IPLA 3RC3A 3AVQA 3AKDA 5DGDA 3Q9NA 4AP6A 3VDMA 1HUQA 2ERXA 4UCFA 4B35A 1NC3A 2JGIA 3OHPA 1JJAA 2CJXA 5I9TA 1JIKA 2C31A 2C7BA 3KVNA 3N76A 2YZNA 2PD4A 4PCLA 5AW2A 1YRAA 3CUVA 3GMIA 3MJHA 4R1PA 3QKRA 1E2IA 4JVOA 4YP9A 3L7KA 3DMTA 1OLSB 5FLEX 4JROA 5LKAA 5KNBD 5DIFA 3MBIA 1RYZA 5CHYA 3ZKWA 1M0EA 1MNAA 1BX0A 3Q7TA 5LCXA 5SY6A 3EEQA 4KQGA 3ZEIA 1JFSA 1UKZA 3GOQA 5K8VA 1PS9A 3DVSX 5M29A 2XOKA 4X44A 1N0IA 1NNSA 2VP3A 3RSFA 2EC5A 3EW7A 1FRQA 2J9RA 5TT0A 2HJGA 5EJ6A 2VJLA 3JQ8A 4LRXA 4IDQA 2JK0A 3FI9A 3T3MB 3G5LA 1M66A 5GZ6A 2FPLA 2C2BA 1MH1A 2XE6A 4JXJA 3ZDDA 2ZAYA 4EG5A 2HQOA 1TU0A 1DWPA 1O5IA 1LBSA 2P79A 3BMCA 1Q1GA 1N34B 2ZPAA 3TJRA 4GMHA 1EINA 2P9GA 4N5DA 4PSDA 1AUOA 3DUFB 5EJEA 3ELDA 5AJYA 1QIEA 3ANLA 4IIVA 5I7SA 2EDAA 1GV1A 1XELA 2JGJA 4MI6A 2ZCUA 4YRIA 3BA6A 3HCBA 1NJ8A 5JBNA 5AVRA 4ZU3A 5TMEA 3ILVA 1X77A 2AVDA 4MO2A 2ZQZA 4UFOA 2WIFA 3NFRA 2A5FA 1OYVA 2QUZA 1KO5A 5B4VA 1IHXA 5C7LO 1WA5A 4KQFA 3NMUF 4XWGA 2Q3MA 2PVCA 2ZBRA 4WADA 4D4JA 3ESAA 4RY8A 1N2GA 1UF9A 2BFAA 3GPBA 1P19A 3OUTA 5J59A 3QMWA 4E21A 3G5TA 3D7MA 2QQ5A 4LRQA 2MTBA 4G5GA 1E4EA 2TMDA 4BNDB 4UU8A 1FL9A 1V2GA 4ZDWA 5IJ9B 4MARA 4CCWA 3NB0A 4EY6A 2FJPA 3D5QA 3RVLA 5M04A 5HTOA 5B58T 4N5LA 1QQ5A 2QG9A 1XK7A 3IT1A 2VTDA 4ZI7F 2CHVA 1XP5A 3LS2A 5AKYA 4DMMA 2H1WA 2M1ZA 3ANYB 3ECSA 4WLEA 4ZAFA 1GARA 4FYKA 3GNTA 3KNZA 4WFQA 5EERA 1WMFA 3VFDA 4C3OB 5FOQA 2I34A 4RY0A 5HUHA 3KTOA 3TH5A 1C30B 2V96A 4MKZA 1OGYA 2UVDA 1B7GO 4XB2A 2FZ4A 4JJ4A 2AMFA 3ZIAA 2AR0A 1XAIA 1RMQA 4D9IA 2YKGA 4AMUA 1YVUA 2QWXA 3FWYA 3SGLA 4WT7A 1QYVA 5DCWA 1UODA 1R2QA 1P9NA 3FMFA 1V5WA 2WHQA 1XRJA 2A6PA 3H9EO 3KCNA 3PB3A 3O38A 1L5NA 3TW0A 3WFZA 3RVKA 4YJFA 1PFGA 3FPJA 5EMHA 1OWMA 3UJ6A 2NZVG 1P7CA 1YNSA 4F5EA 3BILA 1SCQA 4E5DA 3CRRA 3D7KA 4DIEA 3AR4A 3ZDAA 2HT1A 1KSHA 2C1ZA 4BNKA 4PX9A 1X1QA 3TIIA 4BAUA 1XTJA 2AEJA 1HL7A 4KQEA 1ZXXA 1I5OA 3M0EA 5AI9A 1JZTA 1IN1A 3ICQB 1NTOA 3NU1A 1F7VA 4GOXA 4N5MA 1UP7A 1JLSA 1M10A 4TUYB 5IKEA 4RQBA 2B2NA 1NN3A 3GPDG 3RVBA 1H0RA 1V3QE 1AGRA 3AI3A 1KK2A 5JU6A 2Z1DA 1JU9A 1TM3E 2IHYA 5LWQA 1DKOA 1UZNA 1ZU5A 1Y3AA 3OQ1A 2JJYA 4RESA 1JBEA 1GEEA 3X2EA 3PEFA 3ZQ6A 5BMOA 3SOZA 5KTKA 2QYHA 2WFLB 2ZK7A 1ZCJA 3WFIA 1T6NA 5JAHA 2ZRNA 5GPBA 3GFSA 4P86A 3V3KA 1P2VA 2MSEB 5HQ3B 3OOHA 5TC4A 1GGJA 2COKA 2VXOA 3EZFA 4XJXA 3UYLA 1IVYA 3X1JA 2FVXA 2OZLB 2FZLA 2WWGA 3A3PA 4XSGA 2JI9A 5G02A 2IDMA 1KK0A 2VYVD 3PDIB 1MQSA 2AEFA 2YS6A 3S68A 3IL2A 1HDYA 4AG3A 3BRCA 4JI1B 4ZTZB 3JZMA 1GIAA 2PO7A 3U1VA 3JD0A 3N7TA 3I8SA 3FB1A 3KQNA 3PYXA 3RS5A 1SIBE 5F1KA 3I2KA 2PLNA 1KXZA 1P5ZB 3MRXA 4NL4H 2H17A 3LYLA 3UHOA 4Q1FA 2EGUA 3FTCA 3M2PA 5FWYA 1WCIA 3N2LA 3BX1A 4GHWA 3QBJA 1R0RE 2YOHA 1NYTA 2V03A 1H23A 3Q3JB 4V0ME 1U3VA 1BFUA 2Q5LA 3EEYA 5IF9A 2CHQA 1N6HA 2NZYA 1NY6A 3LXUX 1G8MA 4MKXA 1BN6A 4GUDA 3LLUA 4TRRA 5HEKA 3VMFA 1J1UA 4YUVA 1C3JA 4AQYB 3F6YA 3WDKA 5AW0A 2GM4A 1FPMA 3HB9A 4LRYA 3E7XA 1HNWB 5C4GB 3C48A 5AK3A 3TL2A 2CGEA 4J0FA 5G3ZA 3CS3A 4ZI3A 3AR6A 1RZUA 1MO6A 2YN0A 2RGCA 1E32A 4JJAA 2C2XA 1RE0A 3AF0A 4AJNA 1H3EA 2BZ0A 3OOYA 3AVPA 1ZIDA 4QU8A 5JO9A 2VPZA 3L8MA 5DW3A 4CMCA 3DAOA 1GKIA 2L42A 1HYHA 1TVMA 2NPIA 2Q4TA 5BPFA 4MHOA 1MENA 4WCFB 1QFYA 1R6TA 1JDVA 1MC1A 3NBMA 2ZT8A 4D57A 3E9ZA 2QNRA 3W2FA 2GGSA 1JE1A 1P4RA 1WIWA 3PUXA 4LY0A 4HO1X 3Q3IA 5DGIA 3WE7A 1EX6A 4RD6A 4EPYA 5I9LA 3MT8A 1U8YA 4GS5A 5BQFA 5BSHA 4C07A 3BTOA 4NAUA 4Q3NA 4H60A 1NMQA 4KQXA 4F4HA 1GQYA 1G18A 1SRRA 3ENVA 3H18A 4LC0A 1DEHA 4OBBA 1VE9A 5C80A 1P1FA 3JATB 2H7YA 1JAZA 4GI1A 4MW0A 1ORRA 1IJEA 3AFOA 4HTFA 2XUQA 1V3UA 4X92A 4ZWNA 4JLUA 1DKPA 2JEZA 3H0KA 3ZH2A 5J58A 3FETA 4O2AB 4V02A 5H68A 2OP0A 4RD0A 2PYIA 4XD7D 2A0YA 2FPIB 4A8JB 1T15A 5LIPA 4DR6B 1NFRA 3GFBA 5HS6A 3GGGA 4R3NA 5CYOA 4I9FA 4ZVSA 5KMGB 3HWX1 4QUHA 1HO3A 3A6GA 2QQGA 1YFLA 1PX2A 4GXQA 3NWOA 2P4SA 2RFLA 4W5JA 4WLFA 3MCVA 1X38A 3B48A 1SOMA 3S70A 3OTQA 3PFNA 4G37A 4EA7A 4ACBA 1PJ4A 3ETHA 3UJ9A 4DLBA 1M1UA 3GAFA 4P35A 2CL6X 2GBFA 1DP4A 4KUEA 1O89A 3DLAA 3ZBPA 4ZYLA 1IONA 3HP1A 2PZKA 2OCPA 4PG8A 2ZTUA 3DMRA 3G2OA 4YRMA 1E6EA 4KLRA 4IQ8A 5L6MB 3PJGA 3PDWA 1KEEA 4CKXA 4OKSA 1KY2A 3VSDA 1XZMA 3U4HA 4QFMA 3OBBA 2JLYA 1IZ0A 5CA1B 2JA1A 2PD6A 1N3LA 4BJ3A 1GPWB 3VR3D 3UAGA 4AJJA 2G1JA 3H19A 1MR3F 3CNHA 4QKQA 2O54A 3PT9A 2I6TA 3UMVA 3L7LA 2EARA 3OUZA 1WXEA 2WD8A 3ME5A 2ZBGA 1G291 2Q3HA 1TPZA 4J1TC 4JKYA 4Z9BA 3E53A 3GDFA 3I6QA 3C6BA 5K0CA 4M89A 1RLUA 3C3MA 4WZZA 3IVRA 3UAXA 4BE7B 4ME6A 4PQGA 4Q47A 4RK4A 5ALWA 1EFPA 1CF2O 1WE2A 2A88A 4MXDA 3D8RA 5CJJA 3S40A 5BXYA 3SJZA 3H3XA 5B1HA 3LZDA 2OZKA 1CUZA 4HVCA 5IVHA 4CBVA 1AD2A 1RC1A 1HFEL 2RH5A 4RMHA 3TX6A 3QVJA 1HYQA 3CZRA 4W8GA 2MYUA 1HEYA 1SXJA 1G6KA 1AMUA 2ZB7A 1JWBB 1ZK1A 4X66B 4BP3A 1CP3A 3SXPA 3PSHA 6YASA 4OLFA 4KKVA 1KDVA 3PRHA 3WBBA 1XZNA 1WZEA 5U4XA 1PQYA 4DQUA 1UMBB 1UANA 5EKSA 1QRDA 1WZUA 3DBOB 1EJ0A 1FTQA 2INGX 5J2UB 2L2QA 1SXJE 4ARCA 2SKEA 4MS4B 3PFGA 2YFKA 3N75A 5H3HA 1UCFA 2PMFA 1TFRA 3L3BA 5IF3A 2VQFB 3DFKA 3DM5A 3OEEA 1Q15A 1WW8A 4JR1A 2BP7A 3KUDA 2G5CA 1DFHA 1JQAA 3M9WA 4PXSA 4AJ1A 2I6GA 1ODJA 5E9JA 3ERCA 3IBTA 1OFTA 1YOVA 2QI9C 3AEUB 2YFQA 4G36A 4RWZA 4Q4DA 2OQRA 3C0KA 3UXHA 4EGFA 4TQUS 3E1GA 5TMBA 1LLQA 5EJGA 2OPBA 3VDNB 1C3LA 2AMYA 3ZE9A 3T7CA 2Z58A 3FTEA 3F8SA 4CQJA 5U1PA 2JEOA 1TRKA 4HWOA 3PC8C 2ET6A 3TVDA 2RHJA 1WEKA 4FJ2A 1U0BB 3WIEA 1GSOA 1E1NA 4DWVA 4GRIA 3CZQA 4Z2YA 5DM70 1UPBA 5JS1A 4IH1A 2R4UA 3GY0A 2C9ZA 3WTBA 5L40A 3KL2A 1KI4A 1QJCA 3LP5A 3JD3A 5HR5A 4QM7A 3QJGA 1U5BA 5J3JA 4EITA 4LTNA 1GTVA 4RENA 4TLBA 4HEA1 2Y9PB 5C1OA 2M9MA 3UH1A 1P77A 5CW1A 2CSXA 4RPIA 2HA2A 2R1ZA 1JW9B 4B81A 5IFLA 3WL5A 2WP0A 4BLVA 2FR0A 3T0GA 4R1UA 2A5GA 3ICOA 3NG1A 4EPRA 1T6XA 1EFVB 3KYBA 3QLUA 2XE4A 4O4IA 1B2RA 4J07A 2JHFA 4J49A 5CB4B 2H9AA 2EWMA 2DFPA 3U4GA 3ZIAD 4BMDA 2VOEA 2WBLC 2DETA 2FPKA 5CIWA 1TUBA 2JFGA 2JIQA 4ZVLA 5HFNA 2JLSA 4X95A 2PK3A 1NUAA 2ZREA 3E1SA 2ESRA 4FVTA 2NNLD 4RFVA 1KWKA 3EF0A 1N57A 2WJJA 3UICA 1ESNA 1FXWF 3ZY3A 4YDHB 1CY2A 4RK6A 3DL4A 3WADA 4CLHA 5H81A 3D1JA 2G5TA 1Y63A 3A4LA 3GLRA 5EZ5A 4I5EA 4ISCA 3ZGYA 5LXTF 3G0DA 3OT5A 4QO8A 2YZMA 3FMPB 4I9HA 4O4HB 2QUHA 5GJWC 5EWLB 3ZE6A 3GLVA 4YRSA 2F1IA 1SIUA 5JMWA 2EVWX 1GV0A 2WTBA 3GZJA 1NMZA 5AVZA 3AHDA 3DEAA 1LZLA 1RJFA 3QU9A 2DLNA 2RAVA 3HUEA 1T1SA 4S1NA 5DFAA 3IOEA 3G2MA 1JEAA 2OO5A 2VIIA 4MUAA 4S3MA 3USCS 4IKPA 2G63A 3RODA 1SU8A 4O5OA 1PUIA 1F4VA 4EDFA 3MD0A 3RFUA 2YXEA 4L8LA 3KEMA 3UH0A 1JKJB 4EKIA 1ZVJA 1D2EA 5IM4F 2ZTMA 5EYPB 4BC1A 1CF9A 3C7KA 3NHFA 3OO1A 1NF9A 2W2QA 3WYGA 4JQYA 5ALQA 2H1FA 1U3UA 2NZUG 5EE5B 2ZI5A 1NBMA 4RGYA 1VJRA 2O6LA 2LCQA 5BWMA 5ICCA 2AFIB 1KDZA 3DBHB 4GVXA 2X5NA 4Z8YA 1E0DA 3NI2A 4YP1A 2WVAA 3Q0IA 3MTJA 4WXHA 4EI8A 2PUTA 2VSNA 5M34A 3DO6A 3K0KA 1Q95A 3GJSA 4PAGA 4Q1DA 3MMPA 5KPJA 5CH3A 4N40A 2K7FA 3LRPA 5CU7A 5JFTA 1R5NA 2ZFUA 3TL3A 3KAQA 1P4GA 4HMQA 3P9IA 3FSEA 1OX4B 1HURA 2QZ9A 3C14C 1J5EB 3I45A 2FDCA 2IYLD 5B7QA 2DXIA 2CUZA 1DEKA 2XYPA 3WGOA 1DO2A 4BQRA 3DT6A 4FD2A 3FHCB 3LCVB 3PFWO 1N6LA 4J7CA 1X80A 2BOVA 4IIUA 4INZA 4S1VA 1KP2A 3IVXA 3OKFA 4NU5A 1I6LA 4YALA 5JW6A 5LD2C 1KETA 3ZJVA 2CHGA 2ZVDA 4BZPA 4TYYA 5JS8A 5HILA 1R74A 2PEZA 4QA9A 2WE8A 5LU9A 2BONA 2YBEA 4LCEA 2P78A 4N7JA 2HNBA 4RVUA 5L7TA 2F55A 5CG1A 2NVBA 1NA5A 1QV6A 1ATIA 4K6FA 3ZOZA 4B7AA 4JBIA 3EVDA 4UTZA 4HPJB 2C07A 3ZDZB 4XOUA 2O3SA 2OCBA 3WSTA 2A1UA 3TNDA 2XZDA 3NPAA 1JHVA 1LTKA 4FFPA 3Q8WA 3RFXA 5ALDA 3DCYA 4UPVA 3T9CA 4MV5A 2WRZA 4QTYA 1TQDA 2C96A 2FKNA 2ODPA 2EDCA 5ESRA 4QGSA 1YF3A 1W5SA 3OPXA 5D6OA 4LGYA 3WWEA 4L85A 1EWQA 1HZJA 1T4MA 1U9CA 1U6JA 1UBHS 3GG2A 4X20B 4NMWA 5LA6F 3RRZA 2BUBA 3S7ZA 3V8MA 3ZCRA 4YNBA 3NOOA 2DYKA 4QARA 4K05A 1L4KA 3PUJA 4W9NA 2AG1A 1NOIA 2XE8A 3CEMA 5KI6A 1SM4A 3UTDA 5CNMA 2JZCA 4WIAA 3SP1A 3GAAA 5THQA 4P9NA 4M87A 3UATA 4LFBB 3LU1A 4Z4GA 4F6RB 3HBNA 3Q9LA 1LX7A 3RVQA 1X7HA 1QTNA 1VMEA 3H0CA 3GW8A 3JWEA 4S04A 1SBTA 1ULTA 4QU0A 3TLXA 2X9LA 1I4OA 5KYYA 4PTZA 2V7PA 3O5AA 3WDLA 1O57A 4DARA 4B6OA 3ZDYB 4LXXA 4M38A 2X4GA 1J7KA 1N5IA 1HA3A 4WZAA 4ZOLF 3AJ9A 4DLSA 5ALMA 1E60A 1ZEJA 1L5MA 2EOAA 2VJBA 3IMGA 1I2MA 1WTCA 1MFPA 1G6Q1 3JR3A 1WY5A 2VTEA 3PDHA 3D0RA 4E03A 2B3DA 2P3QA 1XQ1A 4NC9A 2DUUA 5ETJA 3SC2A 1JAYA 4RXUA 2VK1A 2YWRA 4NG4A 5K51A 2X1LA 1CS0B 1JLLA 2VTKA 2ZM5A 1SG0A 1XRPA 2RGXA 3H8VA 4WZAE 1MQ9A 1PZNA 5D1NA 5JZ9A 4KGZA 2MWMA 3FUUA 1M8KA 4BWYA 2WIBA 4CGYA 4XJTA 3NCHA 3RS2A 5T4HA 4N6OA 3PXUA 4CM3A 5KU1A 4W5TA 4M9QA 3NGMA 3PLNA 1XGKA 2C5HA 1N9GB 5TJHA 1V4VA 2B4AA 4F3YA 2QRNA 4MV4A 1IMOA 4DR3B 1VSQA 3BT7A 4L5IA 4WZBB 2JW5A 4GBGA 4PC3A 2WHPB 5DNWA 5AW5A 1JLMA 1OKKA 3UJ7A 3EEIA 1R37A 2GNAA 1ESEA 1QMPA 1SKAA 1RQ7A 2Y1XA 3I05A 1AKVA 1ZOPA 1OILA 4YT5A 4F3NA 1JWAB 2ZUDA 1Y34E 3BJIC 5A5VA 3T1VA 1PRYA 1UDCA 4J3FA 3ZGVA 2TSYB 5LZ2A 2J08A 2NO9A 3K9CA 1C7ZA 4WBXC 4EHJA 5FHRA 3PF9A 3DWFA 4X3CA 1FQKA 4N0MA 1R0KA 2HIGA 5CB0A 5JSZA 1WD7A 1P2TA 3JQ7B 4FYPA 5BQOA 3WBFA 1P8JA 5JHGB 1YXMA 4OHPA 4QT0A 3W5VA 4KAFA 4S24A 2VPYA 4NBNA 2FSIA 3UKDA 1P9OA 2JIMA 3LQKA 3OQIA 2J6IA 2PUVA 1QO0A 2JBAA 3LY9A 3EJWA 4CEJB 1Z4IA 5ICFA 4XWTA 2EHJA 1ZQ1A 1C9DB 3AUXA 3BGOS 2GVNA 3JQ9C 1BD3A 4LJ9A 5PGMA 4YRRA 3W7BA 4UFPA 2VJOA 3GARA 3H5RA 2V9PA 3ZCXA 1WDLA 2CCGA 2RGNA 4XR4A 4KAAA 2V98A 4LVOA 4EHNA 1XTUA 4L7VA 3V2HA 5ILQA 4CIXA 4IMJB 4B40A 3DDZX 4IOKA 1I01A 4B74A 4Y1RB 1IRIA 4Q7LA 4BBZA 3TD2A 4TYQA 4CEIA 4D42A 1IY1A 1DWOA 4P0QB 5TV2A 1T2VA 3RKUA 4J29A 1PR3A 1P60A 2OD9A 3FCEA 1SOVA 1HPLA 1X2BA 4XVRA 1CU1A 3OEED 4ENVA 5LMCA 1DBWA 3QUCA 5T8KC 5LQCA 2VNSA 4DT1A 1M8JA 5KTTA 1WRBA 3MJSA 3QM1A 1M2NA 4R6WA 1YRYE 4EQ6B 1LLDA 1R00A 1XRRA 1NNLA 3LCCA 1H6AA 1O94A 3MPUA 1ZP6A 4PQRA 4FR0A 2XDQA 1QFXA 3EIQA 2WFZA 3AUTA 4JBXA 3UWSA 3DH0A 4CM5A 4TT8A 1IZ7A 4RNCA 1NR7A 3F6SA 3TSAA 1U0LA 5FX2A 4AFNA 3OPNA 2ZAOA 4UMVA 4OP1A 4UDNA 5EIOA 4GMDA 1N5DA 2DKOA 1YL7A 1ZCZA 3KT3A 3GJ3A 5JDIA 2UUPA 1MW8X 3PXEA 4F8YA 1JLRA 1GG8A 1EAYA 1P17A 4MRMA 3DWGA 1Z4NA 4MS1A 4U7DA 1JDUA 1E69A 2E55A 3I4LA 5AKJA 4HQOA 3V4FA 5HWSA 5C51B 1UJ6A 1HETA 5KNDA 3FVVA 1JLHA 4GSYA 1ILEA 3IV6A 2X2EA 3OLQA 4WGFA 6NULA 3OFSA 4IVPA 1BA2A 4WN9A 3E82A 3AVXA 1NI4B 3O92A 4TWAA 4XJSA 5LOVF 2IHNA 3AF5A 5BUSA 5HZGA 1C8VB 2XQJA 3EMDA 4DJDC 4KPYA 1B14A 3FAZA 3ZGOA 1O0BA 5AUQA 1XA4A 3CUEF 3Q6MA 1RLJA 1JHDA 1Z07A 4H7EA 4IBOA 4R68A 3U4AA 5BOSB 5TQ2B 5ADVA 4J7AA 3RARA 2HPVA 4C4RA 1AXGA 3HDHA 4LJKA 3P97A 3QF7A 4BEVA 4AMZA 1CY0A 1G4AE 4NXNB 2F8SA 3IILA 1OJLA 1GL3A 1DAOA 1SPXA 5AK6A 2HH9A 3EGDB 1TVEA 2CLEB 3BIOA 4LYFA 4MPDA 4J9VA 4PWYA 3SYLA 3KOZA 3LMKA 4FFLA 3NDRA 2O5CA 3C5EA 2HEGA 1GRQA 5EZYB 2DHEA 1O03A 3QWAA 4QPDA 4Z0TA 2ZU6A 4DYVA 4HRYA 2QUAA 4OXXA 4DLPA 1T0BA 3CX7A 3I8OA 1MOQA 4M1SA 5FCDA 5A7GA 2BKEA 1RHUA 2PX5A 2CT8A 4TTAA 4XZ3A 2WVHA 2PGNA 4E46A 1DXYA 3IOCA 3IUQA 5TF0A 3R4CA 4MO9A 3I9NA 3QEKA 2FDXA 4L5JA 1VECA 5COBA 2PT6A 2J30A 3HVIA 4BN0A 2XXJA 1T35A 2ZSUA 3CU5A 4D3FA 1K6JA 1BE1A 1PGNA 1XHLA 2I33A 5KVCA 2XH8A 5ELXA 4U2CA 5IZCA 2B4TO 2WKSA 4LYYA 5AJVB 1Z26A 5E1BA 4C88A 2OC9A 2H65A 1LFAA 2OHHA 3DYVA 5JRZA 3L07A 1NBMD 2I4OA 2IPOA 3OSZA 1FTNA 2OCGA 5ITWA 3QENA 1XCPA 4LKRA 2IIVA 3BJRA 1AZSC 1U7DA 3B36A 1T3LA 3I1YA 3TBKA 3TFWA 3W6OA 1KYXA 2FW9A 4UU1A 4TMYA 1OLUA 2PKEA 4YPFA 1ZSNA 1NP3A 4BIMA 3LGSA 4QOFA 8LDHA 2IKQA 1JPJA 2XUDA 3KKMA 1Q1AA 1VG9B 1Y9JA 3FLAA 3HKBA 3KLBA 3KV3O 4KZKA 2AUTA 4LE2A 2JAWA 1US8B 3QIVA 2IP1A 4NWIA 2YXNA 3C1AA 2VDWB 2X9VA 3DVAA 2KW5A 3E1KA 3THYB 4M76B 3DDWA 2WJWA 1JNYA 1BCRB 1M8GA 1SCIA 1SC9A 2X8JB 3LYHA 3BCRA 4WEQA 3F9IA 3AZPA 3C7AA 3IEMA 2WABA 4I4IA 4ZRDA 3I0NA 3OQPA 3IUBA 2XRMA 4RH3A 5JTUA 3V5NA 5F4ZA 2GBCA 2CEAA 1KJZA 4NEQA 4F8EA 2F62A 3B3QA 2C78A 5DIZA 4KR9A 2OOSA 3AHIA 1NNUA 2HZ7A 2GN2A 2JANA 2QAGA 3IBFA 4U2GA 5B3AA 3V1KA 5BW5A 3V4RA 4NCBA 1YO6A 1I7SB 1JJFA 2ORED 2EKZA 3F90A 1GAJA 1ZA2A 5KNCA 1NVXQ 4R2LA 4R1SA 4PIPA 2PZ8A 4WUVA 1T4GA 3A9SA 2VH5R 4BKOA 3T3OA 5J4VA 3U3OA 2ZR0A 1Y8QA 3DO8A 1TO6A 2F7SA 4FFBA 3PNQA 1WB5A 4ID9A 2HGSA 2Q5CA 3OECA 2AH5A 4L15A 4PHHA 3TI7A 2BV3A 1OQAA 2PBFA 1BKYA 3H1EA 2HK7A 4RMGA 3DQPA 1QH8B 1NNI1 2WZCA 4DHWA 4B3MB 5I4IA 2IYXA 1POWA 4HJRA 1V6AA 4NCKA 1KE2A 3R23A 4KFCA 4ZYWA 1LBEA 2OVFA 4PFKA 2Q41A 5EIHA 4WXPA 1ETHA 1TVKB 2PFKA 4CMIB 2ZWPA 3GHHA 4CM4A 2VAMA 4P58A 4MVJA 4D9MA 1T8YA 2FLVA 3I52A 1TJYA 3ZK8A 3JQQA 4R3WA 2IYTA 4PZ9A 1YKSA 4PVCA 3W2GA 3RLFA 4DDVA 1NHWA 4MI9A 1TEHA 2XNDA 3EG9B 3D7NA 1NXXA 3TTUA 3GDOA 5DO9A 3ADKA 3U0BA 1FSFA 3GEMA 4QUKA 5A02A 3W7VA 5ES4B 1Q12A 4MVJE 2ZYAA 1EE2A 1O6CA 2FETA 3FFTA 1E7MA 1GZ3A 2DT8A 3HR8A 3Q6IA 3I4CA 3PCXA 3IDAA 4KKXB 4D0SA 2FR8C 5JD5A 1S9DA 1VRVA 2XEXA 3BWDD 3CB2A 2HF8A 1V3VA 4PZEA 3PZBA 2QPOA 4ZZ1A 1VMIA 2H85A 1XTTA 1E3TA 1BYUA 1TGYA 1XEXB 2P0AA 4LMBA 1BEEA 1K27A 1D07A 1QOPB 2HCJB 1UXGA 3BSSA 1T25A 3I09A 3I4FA 2X7XA 1BZYA 4UATA 5I7AA 3T1OA 4A91A 4F12A 5AJUA 4E2FA 2QX7A 5FL7A 3EA4A 1CVLA 2PO5A 5TXGA 4B3BA 3U09A 5FOVA 4OUDA 3FOWA 1BEUB 4QJIA 4CLOB 3DYBA 2FPWA 3OLXA 3WLMA 5T4BA 1P73A 3TKLA 1PG0A 3HU5A 4ZYXA 2AG6A 3T5CA 2VK4A 3ZWDA 5IAAA 1DJLA 4K26A 2C9DA 4M1QA 2HXGA 4CG2A 1C2TA 1SXJC 3T9EA 1PR0A 2ATVA 1CULC 1E2UA 1T13A 1Z2PX 2OBMA 1BVUA 3SZUA 5B1EA 5IAJA 1OKKD 1ETUA 1TQ4A 1DTEA 1LVGA 1NN5A 4TVBA 1NVFA 1E18A 3BB3A 4TUYF 2H4WA 2HL6A 2RSLA 4HMOA 2P2NA 2WWVD 1ADFA 3QZUA 3CMCO 7ABPA 1KAEA 5KJEA 3C45A 5KWIA 2X42A 4D6PA 4GKVA 3UMSA 1YS9A 3SQLA 3PENA 3A06A 3D8BA 2I3GA 1W5FA 2ZRCA 1KYZA 3CHYA 4G1UC 5HG0A 3TLKA 4CKEA 5LFAA 1W2GA 2OCKA 3ETGA 1WWKA 3K0EA 4J0QA 5ITZA 4G5HA 4UNSA 5FBZA 2CDBA 2IQ5A 1QO0D 3MWEB 1NBOA 1TVCA 2XI4A 4PO1A 2HUNA 3F4KA 1M6VA 5KDOA 3S1LA 1H85A 2IF2A 1BXGB 1WV0A 5KX5A 2E4XA 5ADWA 2QDKA 1PK7A 5KS2A 2JIOA 3HVJA 4NK5A 5IDXA 5EKUA 2HSJA 5K0LA 4JJIA 5BSTA 1JR2A 5FQNA 1HBJA 4C0BA 2BPOA 1QHIA 4BNDA 5B2FA 2MINA 4K9NA 3W90A 5H82A 3LFHA 3ZVKA 2AQHA 4FFDA 1E8NA 4OQEA 1A4XA 1G20B 4UVEA 1BW9B 1AQ6A 3BHIA 4GI2A 4P82A 1OYYA 3QRWA 2DWUA 2XMSA 1DPFA 3N7AA 3PC2A 3F47A 3G2PA 4N12A 4K9QA 1PT5A 3FN4A 3DOIA 5IRCD 2PKQO 2VN8A 1G3QA 3VOAA 1UJ5A 2RH9B 2QZ4A 5AHOA 4QJ5A 4G24A 2AN4A 3DNPA 3K70D 4XYBA 1O94D 4IS2A 8GPBA 2CB9A 1TAQA 1A9TA