3KQOA

Crystal structure of hpnmt in complex adohcy and 6-chloropurine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 96
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqoA00
4KIFA 4OA5A 3E23A 3UJ9A 1QAMA 3KQSA 1VE3A 1HNNA 2BZGA 3A25A 4E2ZA 1D2CA 4CTKA 1V39A 4OBXA 3DMGA 5BXYA 1UFKA 3EGEA 1I4WA 3ELUA 3GCZA 3EVZA 1RI3A 3I9FA 4LECA 4PYNA 5P8WA 5DX0A 3JWJA 4GC5A 3ERCA 2WA1A 3AXSA 4P7GA 1R18A 2EFJA 4OA8A 4QDJA 3FUWA 3VC1A 2V74B 3FPEA 5GIPE 1TW2A 5KQSA 4RVFA 2LD4A 5BW5A 3FTEA 1JG4A 2AVNA 1H1DA 4FGZA 3KQYA 3T7RA 4L7VA 3A4TA 1ZG3A 3M6UA 2AOXA 3DTNA 4RTSA 1KIAA 1XCLA 1JG2A 2HTEA 3C6KA 3HA3A 1BHJA 3QOWA 5FHRA 5CVUA 4LWOA 4ER3A 1XCJA 3M6VA 3LGAA 2FK8A 2ZSUA 4C08A 2PXAA 4YMHA 4QDKA 3FRHA 2R3SA 1TPYA 3G2MA 3K6RA 4P7FA 3R6TA 5LQNA 5K0FA 5DTRA 1G60A 3KKZA 3KQQA 2OBFA 2ZIGA 5EMKA 2OKCA 2AN4A 3NWBA 2HNKA 2GS9A 4AZSA 4PIPA 5K0EA 5FWAA 2P1DA 3DXXA 3FTDA 3OCJA 5K0BA 2PX4A 2G71A 1R74A 4PNEA 3ME5A 3PX2A 3LECA 5CM2Z 5DTMA 2P3OA 4PINA 4POOA 2P35A 4RTPA 1VL5A 3I58A 1ORHA 4IKPA 4M37A 5EMLA 5EZSA 1AQJA 2ZIEA 3OU2A 3R0QA 3QOXA 4DKJA 1XJ5A 2ZIFA 3BWCA 3GRRA 4X63A 3PVCA 1NBIA 3C6MA 5LSAA 2UYCA 3LDFA 5FTWA 1G55A 4M36A 4U7TB 5DWQA 3SX0A 4ER5A 2QY6A 1JR4A 5E9QA 4ER0A 4ISCA 3KQOA 3P97A 3MAGA 5EGSA 4IV8A 2AOTB 2O57A 3P9CA 4ATNA 1NW3A 3FTCA 5K05A 2ERCA 4GBED 3G2OA 4F84A 2IDKA 4HGYA 2CL5A 3OE4A 5EMMA 1O54A 2B25A 5JUWA 3RODA 5K01A 1DL5A 1KPIA 3ELWA 4HC4A 5EQJB 1R6AA 5T6BA 3OZTA 4MHTA 3HCDA 3HCEA 2PWYA 5FADA 3ER8A 5E1OA 2G70A 3LDGA 1G6Q1 3FRIA 2NYUA 3PFHA 4R8RA 4RTJA 1HMYA 1QZZA 3OZRA 3NVKI 3UJ6A 1SVUA 2N47A 2ZWAA 2PLWA 2XYVA 5E9WA 1JTFA 5K8VA 1L3CA 2AS0A 5EVJA 1P1CA 1WY7A 3GO4A 3FUVA 4DCMA 3CJQA 3FPHA 4XUCA 4EVIA 2UYHA 1JQ3A 1KYZA 4FZVA 1FP1D 4RSRA 5IH3A 2VDWA 3IEIA 5C0OE 3ER9A 1XTPA 5C1IA 2JHAA 5D1NA 2H00A 2AOWA 2P3QA 5C9ZA 1N2XA 3MQ2A 4LWPA 3FPJA 3CVOA 4GOOD 3KPYA 2PV0A 5LQAA 3V8VA 4C07A 4A6DA 3UJ8A 4PYKA 2FYTA 1KP9A 1RI2A 2NXNA 3DR5A 3NJRA 1NW7A 3OE5A 4P7JA 3DH0A 1KYWA 1Q0TA 1WZNA 3TKYA 5KS2A 3U81A 4C06A 2VZ9A 1YF3A 3KQPA 1O9GA 1PJZA 3LCUA 3KPJA 3EVAA 2OYRA 2H1RA 5DTQA 3GRZA 3DP7A 2IGTA 3TQSA 4CKBA 4FT2A 4DM3A 3HTXA 1P91A 1FPQA 3G7UA 1I9GA 1RI1A 1SQGA 2B2CA 2ZULA 4KWCA 4RWZA 2PX2A 2GLUA 5FUBA 5GOZA 3UA4A 3KR2A 3UFBA 3EPPA 3FYCA 4G56A 3LBFA 1X1AA 3ELDA 3Q7EA 5CVEA 2HR1A 2CWWA 2PJDA 3SVZA 4BP3A 2I9KA 1M6YA 5M5BA 3B89A 3GDHA 5JR3A 3G8BA 3BWMA 4PYQA 2Z6AA 1QAQA 3QV2A 5DM2A 4GOLD 2IFTA 3M6XA 3X0DA 4MTLA 5G02A 3B5IA 1JQDA 3ORHA 5T64A 2OZVA 3A26A 3OFJA 3LKZA 4R6WA 4E70A 3EEYA 3F4KA 3LX6A 4FS8A 4BY9E 2XYQA 4E2WA 1XDUA 4KVZA 5HZMA 2B3TA 5ICEA 5HEKA 3UWPA 4FSDA 1WG8A 4RTRA 3T0IA 1VLMA 2QRVB 3LCVB 5T67A 4X1OA 2VDVE 5HIKA 3DLCA 2AOUB 4X61A 2ZZNA 4C03A 3MB5A 3BKXA 1NV8A 5K0JA 2IH2A 4RVDA 1JTEA 1X1CA 4O29A 1NBHA 1ZQ9A 3BKWA 4WVLA 2Y1WA 10MHA 5FQNA 2PSSA 2JH8A 3R3HA 3CKKA 4QQKA 5KQRA 2B78A 1R8YA 3UJAA 1NW5A 4E33A 3HA7A 4GOMD 3TFWA 1JSZA 3NW9A 2XBMA 3SSNA 4AUKA 3KR9A 2OO3A 5LQKA 4IV0A 1IXKA 3A7DA 4PYOA 5EEHA 4E31A 5E8RA 3THRA 3M33A 2B9EA 4AZVA 5HIJA 3UZUA 8MHTA 2I62A 4PYMA 1ZHFA 3OPNA 2P40A 5IKMA 3KQMA 5DM1A 4YV2A 2UZ4A 4UOEA 2DULA 1OR8A 4JXJA 4KRGA 3UJCA 4DA4A 4KDRA 4AZWA 4C4AA 2ZW9A 5CVDA 4C04A 2BR3A 3C0KA 5LR6A 1YUBA 3HCBA 5FCDA 3H2BA 2G72A 3KR0A 5CUQA 3UJBA 3GRYA 3VSEA 2XYRA 3FPGA 4YUZA 1EQAA 2ZLBA 3TPZA 3TR6A 2IH5A 4HTFB 5DSTA 5E9JA 4GOND 2VS1A 1RJDA 1L3IA 1G38A 1DUSA 2AN3A 2ZBQA 3BGIA 3EGIA 3EMDA 3Q87B 3P8ZA 2OB1A 1YZ3A 5D1HA 3UJDA 1VP9A 1DCTA 4F85A 3OFKA 1QANA 2IPXA 3EVDA 5EHIA 3B3FA 3TMAA 2I6GA 3M4XA 2ZTHA 3JWGA 4R6XA 4DCGA 4RV9A 4LG1A 4RTMA 3NWEA 1B42A 3PB3A 4GC9A 4DMGA 2FCAA 1SUIA 5K09A 3BUSA 1FJXA 2HMYB 2AR0A 4R8SA 5E2BA 3G8AA 2QM3A 3LHDA 4R05A 4YUVA 3KQWA 2JHCA 3HCAA 5HIMA 2JJQA 1SQFA 1BKYA 3IYLW 3KPUA 4PIMA 3SR4A 4PCLA 3EVEA 1AF7A 4RYLA 4WXHA 4BLVA 5EMJA 3GIWA 5DRYA 3TOSA 4RTQA 3DXZA 3O31A 1Y8CA 1FP2A 3IHTA 2EX4A 5K0GA 2A14A 5EZQA 1X1DA 3EGVA 2IBTA 4FR0A 4ER7A 2F8LA 3DXYA 5F2OA 1KXZA 4H0NA 2YXEA 4YUXA 3G2PA 4QTTB 2ONYA 3G2QA 3AXTA 5DSXA 4CKCA 3MCZA 4EK9A 2AOVA 2O0LA 2ZCJA 4E2XA 2AOUA 3PS9A 3CC8A 3PFGA 1UIRA 3HCFA 4QTUB 3SSOA 1VPTA 2GB4A 2PX5A 3CBGA 3G88A 5EEGA 1ORIA 3G5LA 2C7OA 1MHTA 5DLYA 3NMUF 5DXJA 1G8AA 3O4FA 4ZTBA 2EJUA 3A7EA 3A27A 3B7PA 3EVGA 1F38A 2ZZMA 2ONZA 1JG1A 5LQJA 5MHTA 4FP9A 2IBSA 4A6EA 2BH2A 2IIPA 5GM1A 1RI4A 3KPVA 2AZTA 3HCCA 3I53A 4AZTA 2EG5A 2PY6A 1VP3A 3HA5A 1ZGJA 3TLJA 1P1BA 4IWNA 1L9KA 5CVVA 5EOVA 3UJ7A 2FHPA 1NKVA 3PLAE 3EVCA 3ID6C 1L3BA 1ZKDA 2G8NA 1SG9A 3VC2A 3LDUA 2HWKA 1QYRA 3EVFA 5F2NA 3JWHA 2NP7A 1O9HA 2YXLA 2HV9A 3BGDA 4QVKA 3KU1A 4V0RA 5EHGA 4CWAA 4EKGA 5LQRA 1G8SA 3IV6A 4PGHA 1YFJA 4U7PB 2OY0A 1NV9A 3D2LA 1XDSA 3C3YA 1PRYA 3EVBA 5F2KA 3SSMA 4X41A 1BC5A 3T7SA 3K0BA 5BP7A 4RVHA 5DX8A 3NDJA 5E1DA 1INLA 2BM9A 3MTEA 2IP2A 1JSXA 2WK1A 5E2AA 5U4XA 4E2YA 4Z2YA 3HVIA 3ANXA 3GWZA 4EKIA 4HG2A 3R24A 3BXOA 4XCXA 1IM8A 3OU7A 5GM2A 4DF3A 1YFLA 2BM8A 5EIWA 5EKXA 2ESRA 3O7WA 4MWZA 3THSA 4F86A 2PWPA 3E05A 4YMGA 2C7PA 2V7EA 1WXXA 5EC8A 3KPWA 5CVJA 3SGLA 3GRVA 5BW4A 2PXXA 3I5UA 5E1BA 3P71T 1YZHA 3CGGA 3HP7A 1L1EA 3GXOA 2FRXA 5B1SA 5FA8A 2E5WA 2O07A 3PX3A 4HRAA 3CJTA 5EPEA 3AJDA 2IDJA 4MIKA 2ZVJA 3M6WA 2CMGA 1M0EA 5CCBA 1RI5A 4GEKA 3G5TA 1VBFA 2G1PA 1RJEA 4QQNA 4BLWA 5FWDA 1SKMA 2VP3A 5EG5A 3BGVA 2NXJA 1EJ6A 5ICCA 5DM0A 4B17A 4PONA 2YR0A 3GNLA 1FBNA 2FK7A 5CD1A 4QPPA 5FQOA 1XXLA 3FUUA 4FT4A 4OQDA 1X1BA 4CTJA 4EMSA 4M38A 1JQEA 2NXEA 2PGXA 4OQEA 1RJFA 2QRVA 3JWIA 3HM2A 2Z6UA 4FSXA 5CCXA 2NP6A 4YV0A 1R00A 1SUSA 2P3LA 3M70A 1YB2A 2XVAA 4YV1A 3FZGA 3MGGA 2UYOA 1VIDA 2GA9A 1XDZA 4HSGA 4MQ4A 5K0LA 4CXMA 5GINE 3BWYA 5K0NA 3P2IA 1XVAA 3HEMA 3DUWA 1EJ0A 1MJFA 2Q41A 3B3GA 4RTNA 2YX1A 2Z6QA 5DPMA 2PVCA 3P2KA 5FULA 3TM4A 5DXAA 3HVJA 5EIFA 3RW9A 3FUXA 1T43A 3SXJA 4RTLA 1BOOA 3EMBA 4XUEA 2CKDA 3CJRA 3WSTA 4AX8A 2FPOA 3HVHA 5DT2A 1KR5A 3C3PA 5ICFA 2K4MA 2PX8A 1AQIA 5E8JA 1I1NA 3P2EA 2OB2A 4KIGA 4EQZA 3P9KA 1NE2A 3ELYA 4HH4A 2OXTA 3P9IA 4E30A 3DMHA 7MHTA 5K03A 1KHHA 2ZZKA 1X19A 4YUWA 5LQUA 3NDIA 1EIZA 4RTKA 2P7HA 3VYWA 2YTZA 3BT7A 9MHTA 3SM3A 3TRKA 4YUYA 1QAOA 2PT9A 3G89A 3LKDA 3PT9A 5FHQA 2ORED 1NT2A 3B3JA 3DOUA 2GPYA 2PKWA 2Y1XA 3LSTA 1P39A 2O06A 1ZGAA 2PT6A 5E1MA 4CKEA 1U2ZA 5KYGA 4KW7A 5HOQA 3MCTA 3AY0A 1M6EX 3LPMA 2QE6A 3KHKA 2WA2A 2CMHA 2JH9A 3GJYA 1TW3A 2P7IA 5DRTA 5EKUA 2PXCA 4V0QA 3SMQA 4M7RA 3BWBA 3T7TA 3UA3A 3L8DA 3PTAA 5DM4A 3FUTA 1IY9A 1KPGA 3MHTA 3E7PA 3V97A 3KQVA 2IH4A 3LL7A 5HIIA 4PYJA 1N7IA 1WXWA 1AV6A 1D2HA 3KQTA 3GGDA 4Y30A 2I7CA 4NECA 3MERA 3R9XB 1WS6A 2JHPA 2BR5A 2YVLA 3KR1A 4K6MA 2XVMA 2ZBPA 3CCFA 3LCCA 2ZBRA 3TM5A 2AVDA 3E8SA 4PWYA 2C7QA 3NTVA 3REOA 2H11A 2O05A 4HGZA 2YXDA 3AWIA 2VDUE 5GP1A 5HILA 3EEOA 2NNWB 4GF5A 4RVGA 4QPNA 5ERGB 5H02A 5KVAA 4DZRA 4QVGA 2KW5A 3DULA 3GU3A 3OZSA 2GH1A 2PBFA 1R8XA 4XUDA 3BZBA 4Y2HA 3TKAA 2ZFUA 5CIYA 2EJTA 1EAMA 2YUIA 3RIEA 2AOTA 4P7KA 2JG3A 1KPHA 1NW6A 2AN5A 4BP1A 3FTFA 2ZWVA 4HTFA 3S68A 3GRUA 2QYOA 2YQZA 5LQCA 4OX9Y 4PGGA 2P41A 4BLUA 2OPBA 2ADMA 1JG3A 3HNRA 2GAFA 1N7JA 3NVMB 2P8JA 4P58A 1Z3CA 5GIOE 3LBYA 3FYDA 2R6ZA 1RJGA 4RX1A 3HVKA 4RTOA 4GUAA 4PCAA 3P9NA 5DX1A 5GWXA 3DLIA 4KDCA 5K0CA 4E32A 2C7RA 1Q0SA 3DMFA 4GQBA 4PYIA 5HFJA 1NW8A 2DPMA 3I64A 4PYLA 4C05A 4ER6A 5ICGA 1D2GA 3OU6A 3MTIA 4DQ0A 3UBTA 2BR4A 1VQ1A 1UWVA 1EG2A 1F3LA 2NXCA 4OBWA 2UYQA 4X60A 5FA5A 3FPFA
chains in the Genus database with same CATH superfamily
3BICA 3ZD9A 1QCZA 2HBRA 3GHYA 4DVJA 4H18A 2TSYB 3AHHA 2J9GA 1UOQA 1WD5A 4Q3KA 3F5FA 4LZPA 1R4MA 2G7MC 2QZ9A 4PQRA 4GQAA 3NASA 4QOJA 4D81A 1YS1X 3BM5A 5DNAA 2NX2A 4XDGA 1OFUA 1ACMA 2XUDA 4LECA 4QUBA 3UFXA 5B3JA 1ZAYA 5A5VA 2V55B 5P8WA 2J41A 4XFKA 2AMYA 3N8GA 3ZOKA 2XUPA 5C4GB 3ZYCA 4PAGA 3WO0A 3SU8A 4A8JA 4B3RB 4P7GA 3PG5A 1TO2E 2L17A 2EFJA 1DSSG 2NO9A 2CHEA 1QMGA 2Y0EA 2PGLA 3AU8A 3DHEA 1U2DC 4O0LA 1GD1O 4OA8A 4EW3A 3J81k 4OU5A 1GU7A 3QXSA 3EXHB 1VL8A 4P86A 3KSMA 1EFUA 1H1DA 2W8BB 4OH7A 2JFGA 4O08A 1NHGA 4WA8A 2OBMA 1XC7A 3OQIA 3EPHA 4L74A 1TCVA 1RKVA 2BIFA 3A4VA 3SR0A 3SYKA 2QG9A 4YAWA 1MO6A 2QV0A 3LGAA 3OJ0A 1IHXA 5KB3A 1N0HA 4UVHA 5C7YA 2VH5R 3AVYA 4IDHA 3NAQA 1OXUA 4RIEA 3UGTA 4ACBA 5I47A 3WJ1A 1E6UA 5C81A 4JXXA 1AU9A 1R15A 1Y98A 4DQKA 1GL3A 3FWKA 4POAA 2AL7A 4U63A 1CF2O 3ECSA 5EP1A 1D1PA 2F59A 4QELA 4YJKA 1HK7A 1SCAA 2GD2A 2GS9A 2HNKA 2Y66A 4FCWA 4MWTA 4OQZA 3VU9A 3KBBA 4REQB 3D2CA 1CR0A 4KAXA 5EP4A 1Z5OA 2B4TO 1IPEA 1MX3A 4OOEA 4O2AB 3JQAD 5EZSA 1RS0A 5IZCC 4I9FA 3ZXYA 5I5EA 3HJAA 1GA4A 4L4ZA 1MG0A 3GRRA 4DMRA 5KMGB 2OC4A 1GN9A 1EP1B 1VL1A 3ZS8A 4U7TB 1ZZEA 5AWFC 1S1MA 3RYHA 5JROA 5EJ4A 5B1HA 1R6UA 2FW6A 5B55A 1YJ8A 1DX6A 3GZJA 2OILA 3JD4A 3GDOA 3HJCA 1AF4A 5EGSA 4GNKA 1ZMOA 3W3ZB 1Y5IA 3EIQA 1V9CA 4CHGA 4DSNA 2C2KA 2I6TA 2W2VA 1SHJA 3C5HA 4JQSA 3WYAA 5L7WA 3GFFA 2CL5A 3GH3A 3KWFA 4AXXA 1V8BA 2VDLB 4GECA 4V2UA 4L5JA 1OWPA 4JV5B 4CL8A 2FXIA 5EQJB 1JNYA 4F4HA 2XCSB 4MHTA 2QDXA 4DSOA 1DEHA 2XY4A 4MVJI 4CDMA 1QCCA 1OLXB 1D4AA 3MLBA 1RVDA 4QUJA 1C3VA 5A6SB 1SQSA 4M9CA 4E3WA 4NONA 2EZUA 3CPEA 4F56A 3LUCA 1US8A 3KKMA 4MEAA 1QQBA 3CSDA 3SIXA 4BX2A 3H1FA 3VX4A 2XV1A 4FZ3A 3DEJA 4UJ5A 2XWQA 4TLCA 2AOWA 1P7ZA 5ADVA 4DMKA 1XYGA 1N6LA 3TSOA 3U7GA 4YJ3B 4BNHA 1OFIA 5F78A 3F47A 1V16A 2V3VA 3E22B 3MOIA 1P1JA 2B2NA 3T7KA 4CPDA 2PAFA 3HO8A 1OBFO 4ZVVA 2H0AA 2HWYA 3JVUA 3NJRA 5CT6A 4OMUA 3K05A 1CJSA 4YRDA 4GI2A 2H52A 2AYXA 5IT4A 1NJGA 2JVIA 3AFIA 4MVXA 4TSFA 1PTJC 2WIDA 5LP6B 4RM3A 3LPNA 1EDEA 2AC4A 3IVCA 4DM3A 3KJZA 3G7UA 3QVKA 1SQGA 1OV6A 3FKSD 2FZ5A 3NEAA 4PTYA 3TRFA 1Q7TA 2GPTA 1N2JA 1TCUA 2FN8A 4MS1B 1IL0A 3TIIA 4CM1A 2QGNA 5CAEA 5K8TA 1S2MA 3LBFA 4PZDA 2H4YA 5FOTA 3F90A 2XMSA 1HT3A 5DNDA 2J3EA 4Y2YA 1RHQA 3TSCA 1M6YA 2BCJQ 3C2QA 2H7XA 4DMFA 3DE3X 2WQ7A 1CDDA 3HABA 4HBZA 1D3AA 4KZPA 1U2TA 4PYQA 4GZ5A 4KO8A 4ZGBA 1PEYA 3UMYA 1E3QA 1T9KA 1QHHA 4TKVB 1G291 3M6XA 1BX1A 2I3AA 4KXWA 4FE7A 4AYTA 3N2GB 3E9EA 2H9IA 1IHYA 1N6PA 4QFMA 4YT4A 1ARZA 2OXFA 5I8PA 2FWMX 2XQJA 3OFJA 3PXCX 1PSZA 1QO9A 2FLKA 2OMKA 2ZG6A 4AULA 4HPXB 2OP0A 3NHBA 4IFBA 2DE0X 2X15A 1IATA 2F9FA 2QPTA 4IOKA 3W8RA 2G5PA 3M9XA 3A4NA 3W05A 2E85A 3GGPA 2JANA 2VH1A 5HIKA 3DAGA 1DOHA 3NHRA 1M74A 4MGEA 4U2GA 4C03A 1W5AA 2R6JA 3TG2A 5KOJB 3LQ4A 1V5EA 2F1JA 2SICE 4ETMA 4MS3B 3OSUA 1F4PA 1X1CA 3D02A 3QBVA 1XBTA 2VL7A 2IDMA 4Q1BA 5H82A 4JT8A 2MSLA 5J2TF 1S3IA 1M1UA 4PFJA 5AVRA 4MKFA 1YCHA 1YZTA 3BHIA 3CA8A 4UZFA 2AW5A 4FKZA 1SVSA 2ZXFA 1MN6A 4XB1A 4RJTA 1IXKA 4N5IX 4HFJA 2GN6A 2G83A 4E4YA 1ULBA 1XG5A 4JENA 2VCHA 4URYR 3TYXA 2P2SA 5DLDA 1BXZA 2GVZC 3PHJA 4BHTA 3UCEA 2Z2ZA 2O1WA 1ZIDA 2JGKA 3OPNA 2PGOA 3QI2A 4KO3S 6REQB 4D5GA 5A0VA 7REQB 4BO5A 1XEXB 1DEXA 1QIJA 3QELA 5IBQA 2EJVA 3LK7A 3HFSA 3RLFA 4ARSA 4Z54A 3JQEA 4MICA 4KDRA 2ISQA 4RL4A 3IO3A 3BD9A 5A4AA 4F5ZA 1LDGA 3KOZA 1UDWA 2I2FA 4KE8A 1U8ZA 2HCTA 4E5YA 3HCBA 2PSJA 4TXHA 3CX3A 1ZH0A 4P4LA 4E11A 3VGPA 4QQFA 4BO0A 3C8MA 4YFYA 4Y6RA 1R10A 1GTSA 3NBXX 1BE0A 1EQAA 2O0JA 2VKQA 2ZLBA 3D2BA 1YQDA 3H3FA 3L9WA 4UQOA 4M8KA 3W4IA 1T2FA 3ZHVA 4ZU3A 4B4OA 4CTMA 4NCJA 3RV4A 3KXKA 3NFYA 3EMDA 4D9HA 3W5AA 1VGVA 3BC1A 3VC3A 3SHVA 3SWWA 3ROKA 3NHAA 4WZAA 3IUYA 1Y3AA 1GNQA 2VJPA 3P0IA 4I08A 4OSPA 2BFFA 3PXBA 3B9PA 4JSTA 2YIJA 3A3PA 3BUSA 3T1YB 2ZJ5A 4LYFA 2AR0A 2XB8A 4R8SA 3VHLB 4B6QA 5H3CA 4RQUA 2VJDA 4DG9A 5JCZA 4ILKA 5HJEA 1D6JA 5KHOC 1UBRS 4M7PA 3V5NA 2X2OA 2JEZA 5TNXA 5FLXA 3OLVA 4IZOA 2M1XA 4Q4JA 4RTQA 1NATA 4HQKA 4I5EA 3N7AA 4FI3F 3OM8A 3CYFA 3ZDXB 2IYWA 2BFCB 5LZ4A 1XT6A 1AT1A 2A14A 4UQPA 4NRDA 3WVNA 3CMMA 1GTG1 2JIZD 1RKUA 2C2GA 1FZQA 1P7WA 3M3DA 2R5FA 4C6RA 4Z51A 3SYMA 4JDPA 4AKSA 2BRUA 2IVFA 4IMJB 4FK8A 4CR6A 3GP3A 3G82C 1CZUA 3JPYA 4BQQA 1CHNA 2O0LA 3K0AA 1VCOA 2HYDA 1JF8A 4I1RA 4UXJA 5BN5B 5EEGA 4G9EA 3BE8A 4D8UA 4YYZA 4NPHA 1PYDA 3QH4A 1P7PA 1Z83A 1YNOA 1Y3IA 2FG7C 3A7EA 3KHSA 3WGZA 1T1SA 5I9MA 2GZDA 2Z30A 1U2PA 5CDFA 3PLNA 2Q3MA 4NAVA 3G0HA 1P4SA 5BV8A 2XMCA 1VE6A 1USIA 1GFWA 2X8JB 2O8VA 3BG5A 4DDUA 4K6FA 5KYUB 3BGSA 4D26A 1XRNA 4P81A 2IIPA 5EJ5A 4XRGA 5BNZA 4RK4A 1Y6ZA 4ZO7A 2O2JA 4RH0A 4JUFA 2PY6A 1ZR2A 4YP0A 3EG5A 4EY8A 3LOUA 3EZ2A 2C5SA 2WM2A 2R7AA 4E5NA 1PJSA 1ZN2A 3ZGVA 1KTIA 2J3HA 1URPA 1M6VA 5P21A 1D04A 3ICVA 3OZIA 1LRLA 3LA6A 2IWHA 3T9AA 1LA2A 2GF2A 3L07A 1ISSA 5AXBA 3SC4A 3BGDA 4QVKA 3ZUGA 3LPCA 4MX8A 4KR6A 1WVGA 3MVEA 4PGHA 2ZUSA 4U7PB 3FMOB 4FOLA 1ADBA 2X22A 3QBEA 4QFCA 4YRFA 2OGUA 4K8OA 4PHHA 4KPGA 4LZAA 1S8FA 4AD8A 3WGUA 3Q41A 5LIRA 4CKCB 3IMGA 3GLGB 4KUHA 2A84A 1CRQA 1K6JA 2A3RA 4QM6A 3DFUA 3T5TA 3TW4A 3VTKA 4F9EA 1OCEA 3TZEA 3WYCA 2VHUA 2DHCA 4CBVA 3IP8A 3BXOA 3CRW1 1NQVA 3BQNB 1JI3A 1N2ZA 2NO5A 1AURA 3LD9A 3OU7A 4LNUA 4EYQA 1V6AA 4UREA 1OFVA 1OFGA 3PZBA 5F3WB 3LJKA 1CF4A 3IEPA 4YP6A 2C7PA 4L6IA 2I78A 5JSZB 1UOEA 2JFQA 4H1UA 4H3SA 3S5UA 1M7GA 2P9CA 3I5UA 4TUYF 3ZXUB 4WT7A 1PJ2A 1YZHA 2QX9A 4BX8A 5C32A 2FRXA 3HV0A 4I1SA 3ZBQA 4RMHA 5B1SA 3AONB 3H9GA 4LE0A 3JRWA 1H3NA 3BMNA 3B6IA 4M0FA 4URZR 4YPFA 4ZI7F 1CK4A 2X6RA 2RGEA 3G1WA 2GCOA 5DVZA 1XCBA 2GKOA 1SC9A 3D3EA 2PKXA 1VLLA 4N54A 2WICA 4P2BA 4TS4A 3NTLA 8AT1A 4LE1A 1RJEA 2OMEA 4U5QA 4IIJF 5ED4A 2Z6VA 2OLEA 2DT5A 5HCIA 4Z1OA 4JN6B 3UPTA 1ZNQO 4YAJA 1B8UA 2XOKD 3OY7A 4HNVA 4C0KA 4YXWA 3N7TA 2I6UA 5AVSA 3EOZA 5ILGA 2V96A 1UP4A 5KQGA 1XO1A 2AUMA 1G1AA 1ZD5A 1FRQA 3H0EA 3KSDO 4GP7A 3VR5A 4K87A 5F98A 2XD4A 1JMVA 2OOSA 1IG3A 2DU8A 1STOA 2VAWA 4LOKA 3ZZNA 1U3FA 1XK7A 4RFSB 2VSQA 3KUDA 2BMFA 3JQPA 4Q15A 4C88A 1MG5A 1V8ZA 1Z2NX 4J0JA 4ZI7A 3TLXA 1A7KA 1IRIA 2HLNA 2QL9A 4G8BA 3CONA 4IXNA 4HAOA 1T8TA 2AZDA 4QHTA 1ETHA 4TTIA 3SKYA 1M2HA 4JLWA 4DYVA 5BSVA 1MQAA 4FU0A 2CF5A 1K6XA 3ETDA 4L27A 2N1BA 1OWMA 1RWXA 4EI2A 1LJLA 5E8JA 3ZY3A 5G53C 2F3UA 4PG5A 3S1AA 3PJRA 1E5LA 3FVRA 3NDPA 4LYEA 3QX8A 1AY0A 2QG6A 4Q4DA 3K70D 1N5OX 1NUSA 1QPGA 5ALEA 1DS6A 3REQA 2RHCA 3V9AA 4ARAA 2XYGA 1NTOA 4F9TA 2FSIA 4X84A 3VDNB 3LKBA 3SQWA 5GJBA 1KH3A 3PWKA 3O8LA 4U8GA 2BAGA 2GHQA 4KFSA 2EHJA 4OSOA 1J49A 1WSDA 4B44A 5CNIA 1J8DA 1QFYA 1VPDA 1J1UA 1H9CA 1QVAA 2Y1XA 1EESA 1LFAA 3RHFA 1WMFA 3TJZA 1U2ZA 2DERA 4TWZA 3H17A 3N74A 1N5IA 2GPNA 2CMHA 2QAGA 3RUHA 4L85A 5JAZA 3FDIA 2A9QA 1H0HA 2J46A 3GUVA 4ENPA 3K35A 4Q4JB 1Z6XA 2DUJA 3U80A 3LL7A 2JI6A 3ANSA 2BFEB 3I73A 4X1YB 3GGDA 1V26A 4KQJA 1HNXB 3QPDA 3W06A 3RGWS 3T5BA 4AQ7A 1RXSA 2ZIXA 4WADA 4MW7A 4B2YA 1SCQA 4YRLA 5ALMA 5ILOA 2PBRA 2Z8XA 3JQQA 2AVDA 4HH3C 4ZJZA 5C80A 1A96A 2CNOA 5BNIA 4MRSA 1CRLA 3OMXA 4HGZA 2EATA 3GK3A 3B8EA 4PGFA 2A57A 2JI4A 4ARVA 1YTUA 3LIIA 5TQ2A 2I8LA 1LLDA 1LK5A 2I2AA 4MK4A 5A3JA 1HDYA 5JADA 2NVUB 3ESDA 2QZJA 3U39A 4B80A 3GU3A 4LXHA 2BI7A 4P53A 1JHOA 3MRVA 1MX9A 3DE4X 2GCPA 4QNRA 3ZVNA 3UH0A 1YBHA 1G7RA 1A71A 4TUYB 3FTFA 3SC2B 2I29A 2FG5A 3QHAA 3GL9A 5D3ZA 1YS2X 2ZM5A 2Z95A 3SQOA 2QUZA 1OW3B 4MUJA 3JQ7B 5AK4A 4ZQIA 4CKXA 4DUPA 5KSYA 5AM4A 4Q4HA 5FO1A 4QRDA 1H2YA 4K9DA 5DX1A 5GWXA 3ABIA 4PPQA 4RJLA 2C4WA 3WGTA 1QVZA 2DPMA 4ER6A 2GYVA 2ZWMA 3L0SA 3QE0A 1M9NA 4TKMA 1F2UA 4LQDA 5K4HA 2ZBVA 4OGLA 2JAQA 8ADHA 2NACA 4B6FA 2RH4A 5HQTA 1W36D 1M1NA 2YCLA 1Z6TA 4FFSA 3NT2A 4G5XA 5AW3A 5CFZA 1AO3A 1BVYF 1V41E 1LPAB 3CNBA 4RHEA 4ZVPA 3RSFA 1NVMB 3UT5B 2ZI4A 4FNGA 4F92B 3FCAA 4ALJA 3D6VA 4ESOA 3T3PB 1R9JA 5BXYA 1X14A 4TYNA 4HH0A 3I01M 4TRNA 1DBSA 2B4KA 1UT5A 1U1CA 2A0FA 1WU7A 3PEUA 5DHUA 2HJ9A 2PS1A 2R7KA 2BKEA 4WCVA 4G1BA 4H6PA 1M8FA 4NBVA 3U1VA 3ERCA 2WA1A 5HZGA 5DNYB 1NC1A 1IIRA 1FMTA 1OXKB 3PC8C 4QDJA 2EP7A 2QLLA 1KZHA 5B5SA 2PQ0A 3EXEB 1YQUA 3TGWA 2P4SA 3PL5A 3EGXA 1QLHA 5KOJA 3JYLA 1RAIA 5KVQA 5K2MA 1KVUA 4CN9A 4B43A 5U4QA 4LOLA 4BE4A 1VJ0A 2HHAA 1BHJA 3CUKA 1DBWA 3I4CA 4PO9A 1X39A 2AQ8A 3OOJA 4WINA 4GG1A 4D9CA 1KF0A 1WUKS 5JZSA 2JFZA 4FD2A 3CUUA 2YRXA 3DQPA 4GM4A 3WL4A 5JANA 3COSA 5JBIA 3WYBA 2ZRHA 2ZYRA 5CFMA 4ZWNA 3U7QA 1TPYA 3PRKE 3QXCA 1GA1A 3PT5A 1PQ4A 2FMHA 3KZMA 4FGWA 1M2JA 3FOAA 2CBZA 4OOFA 2CZQA 1X1RA 1GEGA 1CV2A 2VTVA 4DV4B 5JSQA 1FOEB 4OXIA 1P9LA 1XTJA 4N6GA 4XIYA 3E5NA 4BMZA 3E0QA 1ZRNA 2HEGA 4Y2TA 1AKMA 3LECA 5DTMA 3NIBA 1IHDA 4JB3A 2B5OA 4KPEC 4IKPA 4E2YA 2XE8A 3JQAA 3EXFA 5EMLA 1AQJA 1FS6A 1RRGA 3MEQA 3DCJA 1WNTA 4U8HA 5EL0A 1Z8NA 4I66A 4PHGA 3KB2A 3JQ7A 1U3TA 3MOGA 2DM6A 1SHZA 3RYFA 4CR8A 1ZOLA 5F33A 3SC2A 2JLCA 1OGJA 1QTNA 4X20A 1MOSA 4PO3X 2R8ZA 1GAQA 3NPAA 4H7JA 3IDOA 1KDPA 1NSTA 2DF8A 1H05A 1KYQA 4Q39A 2B8NA 2MSKA 5GOTA 3WRVA 4GKBA 4Q9LA 3G2OA 3GLTA 3PC8A 2XKBA 2BEKA 2TMKA 4C0XA 3IR7A 2Q29A 3E22A 3HB7A 4ZICA 3EIXA 4YRBA 2JI9A 2Y1EA 2PWYA 1EX6A 4FTWA 3CHYA 3NVKI 2CT8A 2YIMA 3H9QA 3ICCA 3FMGA 4EFLA 2W6NA 3W6OA 1ST3A 1PFYA 1ZIXA 5DM70 1J2RA 2ZIXB 3KSAC 2VYND 3TRIA 3O4GA 2XVXA 2MINA 3BAZA 1AQUA 1W73A 3DZBA 4FFOA 1I6MA 3W6NA 4DCMA 5ERYA 2UYHA 3R7DA 1UBUS 1A98A 2W90A 3A0UA 2MR6A 4RFLA 5C0OE 3RANA 1QOPB 3ER9A 1GEEA 3LWNA 1NF9A 1AQLA 1Y3FE 2QN8A 2WJGA 4II7A 3K7EA 4WH0A 2AXEA 1JEYB 4A0GA 2Z09A 1ESNA 3TRDA 1RDFA 4QGSA 2GFHA 2ZM6B 1BQEA 4LTDA 5IW8A 2GVDC 3QLUA 1I30A 5DF1A 5HSGA 3PEEA 1GSAA 3T3NA 4QOIA 1Z6QA 2BHSA 2NZWA 2X5NA 4FJ1A 1PZFA 1DZIA 4J7UA 1L5HB 1K06A 3MJVA 4JEHA 1H94A 4FD3A 4RD3A 3EB9A 4CKBA 4BEWA 1O0BA 1GTJ1 1TZKA 4EEKA 3BD8A 1EUQA 1DFIA 3I9KA 5GV7A 5FYDA 4B75A 4V1CA 1BMTA 1I6LA 2FMXA 3UUEA 3K4PA 3R6WA 1PD0A 2I6QA 1K7YA 2A9VA 1F2TA 4E07A 4X66B 1ZPDA 1DIGA 5M5BA 1YR2A 1QGOA 3BIWA 1R1DA 2MSWA 2VDOB 3HUUA 3OKCA 4HGRA 4ND6A 1VSQA 2CMDA 2IEGA 4AXBA 4D9EA 3KLOA 2HKIA 3ZZUA 2NV0A 4YLYA 2ZRNA 4ZI7B 1E3MA 3X0DA 3TWOA 1JFVA 2CLFB 2NUAA 4DLTA 2CHVA 2OQ2A 5AKIA 3OM1A 4JB8A 4MUAA 2DFNA 1NKTA 2JCSA 2OCGA 3OH8A 3M89A 3RC9A 4A73A 2GD1O 4KVZA 4INAA 2W7TA 1O77A 4OM8A 5TJHA 1E7YA 3AJEA 4YP1A 3O4HA 2CVHA 4N65A 4ZAFA 3ZNQA 2FWAA 1E20A 3OE7D 1M1ZA 3U4HA 2J5XA 4C29A 3SG0A 2YFHA 3EXIB 2YV3A 2AOUB 4BN0A 2JFWA 1DDGA 4KX3A 3ASUA 4RA9A 3VBCA 3X1MA 3ZIUA 4ETIA 2QENA 1P0PA 2JC3A 3IUBA 2IH2A 2I3BA 4QG7A 1JTEA 4F2HA 3EC2A 1T5HX 1TO1E 3L79A 4Y2JA 4UCQA 3UANA 3CB4A 2JH8A 3ZLTA 2B4QA 3OETA 4BTLA 1I1OA 1LPPA 2ZSIA 3D4LA 1RWWA 3EXIA 3K9NA 3SXUB 3MBOA 2OAEA 1E5TA 1I3MA 1XWFA 3KR9A 4MINA 2OO3A 4YX9A 5BN3B 2IHVA 2PQ2A 4YJ2F 4Y2XA 2N3ZA 3C7AA 2Q5FA 1IE3A 3OPYA 4MKZA 2BFPA 4CRWB 3Q6NA 1FXUA 3HCWA 4JBYA 3S1LA 3VBEA 4LGCA 2A3NA 2XDWA 3DP9A 3ZY4A 5ITSA 3EW7A 3IDFA 3M2PA 3ZHRA 5JSZA 1KEEA 4GW3A 2PZFA 1I24A 3KQMA 2Q5HA 4M7WA 1S7GA 4MR7B 5DM1A 1D7AA 2C8KA 1OIXA 2CJXA 3NKLA 4ZYXA 3LBAA 3P32A 4URWR 2IX3A 2I3DA 2RK4A 3P0JA 5CVDA 4C04A 3M3PA 4C5AA 1CY2A 5AXDA 2BUAA 1T5DX 1ZN9A 2Q9UA 3GRYA 1SIBE 3LM8A 2WY2D 1JKFA 1H8ED 2IK8A 3K0KA 2XQVA 3TIGA 1JHMA 5KJEA 3GNTA 1HYGA 2CLSA 4DIEA 5CFQA 1EFAA 1JR2A 1AB6A 3M6LA 1IQRA 4I8IA 4UHKA 3MMPA 5K1ZA 1HR0B 3DJYA 4E13A 4Z1MD 3AKDA 3K1YA 3O73A 4FUQA 1YZFA 3O03A 4IDQA 1L3IA 4R5HA 4RBNA 4JODA 5DBHX 3BGIA 2EQAA 3NCTA 2QTMA 1L5HA 2PMWB 4LJ7A 2XKKA 2OZKA 5IUKC 5JZOA 3EULA 2N1MA 2IPXA 3O5AA 2ERXA 4BFUA 3DF9A 1Q0UA 4N9WA 1M0SA 3D7SA 2VNIA 3CLUD 1QK3A 1GGEA 1UM9B 4PLWA 1SO8A 4UEQA 2NIPA 1NUPA 2AD1A 3E7DA 3IQDB 2HQOA 2P27A 1ZEJA 2EOAA 1Q7RA 5EPOA 4LQ4A 1KJIA 2XUQA 3EMKA 3FG9A 4V0OA 4EPWA 3GLFA 2R0QC 3RKSA 3RCBA 2RMKA 2JJQA 4QUKA 2A5DA 4CLOB 2FSVC 5JDCA 2BI4A 5CK5A 3UHOA 3SR4A 1K8YB 1YOBA 3H6KA 2I4LA 3O9MA 1UDBA 5DRYA 1XJ0A 3TOSA 1R8QA 3IPRA 4FMDF 2IPNA 2Z1MA 3RREA 4US0R 1L5ZA 3G2IA 3MUEA 5EZQA 4L02A 1MPTA 1H5NA 2IBTA 4PG7A 2FG6C 1FTQA 1KXZA 1JX6A 1NYLA 2QMUA 4IMPA 2PX6A 2Y71A 3ADKA 3MT0A 4DYDA 4DG8A 1UANA 5ECGC 3I5MA 4KGDA 3U37A 4K0RA 3D8SA 1COZA 2UZ1B 4LXYA 3CLSC 2RGWA 3NVAA 1NGSA 4R84A 2AA3A 4KBFA 2E1PA 2NUBA 4BLSA 4RK6A 3KEQA 1Z4JA 2VP6A 1QVRA 3CT4A 4KLNA 2GTIA 2LP4Y 5HRAA 1D1TA 4YBZA 1IXSB 5ALNA 5JEDA 2AG1A 3MWKA 1UKVY 5JQWA 3W9SA 3FMVA 4EWLA 4JLVA 4D7AA 1ECJA 3T3EA 1B8NA 5TC4A 1FU7A 3IJEB 3QBTA 4ND3A 4BJHB 3DL7A 5IG2A 5KNDD 3K09C 5A5DA 5D84A 1TYCA 4P0PB 1TQ6A 5ESDA 2Q3CA 4ALKA 4WESB 4DLXA 5KHLB 1X1QA 2VAPA 2R1UA 1I0ZA 2X58A 2QP4A 5CVVA 5AVQA 1BCSA 4QO8A 4ZEVA 1WHSB 1O95A 5EUMA 4W7SA 3LZCA 3GJ7A 1NQUA 2PHZA 3HY6A 3SEFA 1T2NA 3FCYA 4NNOA 1BWRA 3I83A 1TVKA 3CZRA 3FMPB 4WLUA 3U7QB 1Z15A 4B9EA 3I52A 1N3IA 4V0RA 5LQRA 1JECA 3PNQA 4IP0A 4NKRA 3RVJA 1YB4A 1L4YA 3ZV6A 3UK0A 1U81A 5J2TB 4OHFA 2A1UB 2E4UA 3DT6A 4X41A 1KR2A 2PRIA 4KWTA 1G7CA 1QB8A 4ZZ0A 4LGYA 4JDUA 5KTRA 1TTHA 3LT0A 1SZDA 1EWYA 1JAXA 2UYGA 3HHPA 3ZK8A 4AMGA 1EVLA 1HE5A 1N6NA 2B8WA 2ZTUA 3MJHA 2BMEA 4IVQA 4U2DA 4BLQA 1N6RA 2BM0A 1ABBA 1LCIA 2PX3A 1K5DA 3O7WA 5BQOA 2QNIA 2V7EA 2EKBA 1ZUHA 4N7RA 5HW0A 1FRVA 4H59A 3H5IA 3N76A 1UZMA 1L1EA 2EX1A 1NONA 2IVZA 4YCDA 3MXOA 2ASEA 2D59A 2R6HA 1SU4A 2Z2YA 4KPUA 5ALKA 3UB4A 4B87A 1KNXA 4H3VA 5E4JA 4EUHA 1OH5A 5SZJA 1D9ZA 2EG9A 2ZYDA 4HQNA 1OY1A 4YMTA 1Q1AA 3DEKA 1KFEB 1VLHA 1TFRA 2I2CA 2IU3A 2C57A 3QBJA 4JC5A 4KUEA 4O8CA 4ZAYA 4RVNA 4EJFA 2OHOA 2H08A 4UVIA 5IBCA 5KNBD 1BH6A 1Y9AA 2IE0A 4R0VA 1ZHOA 1L5WA 2NM0A 3CLHA 3KJIA 4GBGA 3CR8A 4FFLA 2RHGB 4CKEB 3DSRA 3AGPA 5FXMA 5JAHA 2IIVA 2YR0A 1WUJS 3L0ZA 4PE5B 1IEVA 2Z57A 3S2YA 3NCHA 1WETA 1OWOA 1JHDA 2DBYA 2HQRA 3D3WA 4NHOA 5DW0A 2WHEA 4Q4HB 4BWVA 2DR2A 1RJFA 3VHQA 1SPBS 1OZHA 1JAYA 2OESA 4YV0A 2RHTA 3KVRA 4JBIA 2GEDA 1TKBA 4WTOA 4DLKA 5K0LA 1BFKA 2Q6KA 4D02A 3SE7A 5K0NA 1HG1A 1HLPA 4C0WA 2PYIA 4HT3B 1EJ0A 2ONJA 4BNDB 1E3WB 1HNWB 3ZU2A 4JT9A 2X8BA 1C0EA 1IY8A 1VOTA 1RYDA 1M34A 3RJ9A 5LUAA 4GX0A 1JDVA 2ZJZA 3RSLA 1AUVA 4BRZA 1IBMB 5F7XA 4N4AA 1DG9A 4LE2A 4IIJA 2QXTA 4MIOA 3LU1A 4D46A 4D74A 3GGSA 4FEYA 1XL1A 5KQPA 4ONEA 1IPHA 1IXRC 3GN2A 3NTRA 4KO1S 4N82A 4Z8YA 2AFIB 4EFNA 3CF4A 5IRCD 1HLDA 1COWD 1SRRA 3LC0A 3R5TA 5AVUA 5C8DA 4WXYB 4QICA 1GM5A 3D6UA 4BUZA 1JA1A 2BRUC 3ZIDA 2JAOA 4CNQA 4RTKA 2ZBGA 4I5FA 2Q27A 5EQDA 1KVRA 1ISJA 3L7YA 3IAFA 4JIGA 4NMMA 3LP8A 4MQEB 4QZVA 2WIFA 1B1CA 2XECA 2YYAA 4WKOA 4XGRA 4DJDC 3OZUA 4ZO9A 1A8UA 4HO1X 5E1MA 1IHPA 5ALVA 1OH8A 1J2JA 2P91A 4UUAA 2C0QA 1HYBA 3LPMA 5A1TA 1FYFA 3W9BA 3GJYA 2ZOSA 4WXMA 2Y76A 4HNTA 1DKLA 3H8SA 3PI7A 3WB1A 2Y1FA 3VH3A 3OQ1A 5IKXA 4J4TA 3IIKA 3T3HA 5EP3A 4I6GA 2H4WA 5FPQA 1HNZB 1IUPA 3ZDRA 3VNSA 3FI9A 2ZT8A 1U7OA 2X4LA 3W7BA 2DY0A 4UVDA 4LJKA 3TEJA 2QU8A 1N3YA 1U7WA 4AWAA 2OCDA 2O05A 3TCKA 4ZCQA 1XZDA 2WABA 4S2EA 3HG7A 5GP1A 1Q91A 1Y3BE 2EDAA 3DT9A 3A28A 2A5YB 5ERGB 4AMYA 2V5VA 4DZRA 2IYAA 3OO1A 4JQYA 5BYJA 3OUZA 3V1TC 5C7OO 1B0AA 1WCXA 2VYQA 3RG8A 3TBFA 3EK2A 2ZFUA 4IM7A 2GXAA 2AOTA 4RPLA 3I0NA 1XKTA 4HTFA 3DO5A 3PDUA 3RYHB 4BKPA 1A9OA 1CDZA 1NBAA 3WLAA 5I9NA 2OPBA 2O8DA 4BQEA 1DJMA 5COBA 3NAGA 3PPYA 4EX6A 3VI3B 5GIOE 2QAGC 4C2UA 3JQBC 1NLZA 1M6HA 5K2OA 1W5TA 2VPWA 4ETNA 3ISTA 4QPCA 5BWCA 3J7AC 4KP7A 2OTCA 3IUEA 2EBWA 4DVGA 2FFHA 5TSDA 5DBGA 4BMDA 4ECAA 2R8XA 3HYSA 1BKDR 3G9QA 4Z9BA 4QM7A 2JAXA 5GQSA 4X85A 3GPBA 5FUVA 2AG5A 5G0WA 1NI4A 5E3JA 2FQYA 1GKIA 3FCUB 4RENA 1BGWA 3NBYC 3R0ZA 5IEBA 2D0PB 5TIIA 4KIFA 4TMFA 4UXIA 5LB2A 1ULZA 1WIWA 4ZKDA 5CFRA 1YKSA 1OBHA 5HDQA 3S44A 3TDMA 3S81A 2G04A 3A36A 3A6KA 1CWUA 4F9GA 1TI7A 2D2IA 3HBLA 3ORSA 3ZWMA 2GCNA 4ZYTA 2J7PA 3BMCA 2FR8A 4I55F 2A0KA 2VK4A 1BS9A 3I9FA 2HCRA 2R48A 4HBGA 3RRBA 5ICMA 5K99A 2V6JA 2VYVD 3AUKA 5JAIA 4F4CA 4CIVA 5E6UB 4HDMA 4YMIA 1M3SA 2KYRA 3ED5A 3LPAA 3ONEA 1SXQA 1Z7BA 4ZDJA 5KC9A 3G0IA 2SKDA 2DQYA 1DAPA 2NO4A 1JJIA 1GCIA 2YL2A 3R7WA 1KZ9A 1LDEA 4IDOA 4RVFA 1U7TA 1AGRA 3PQFA 1XLUA 4K9SA 2OHXA 3FR8A 4RUKA 1R0BA 2FPGB 4L7VA 1K98A 4CKZA 3O2QB 1VXOA 1Y6JA 2CNBA 2V8BA 3E9YA 3H9BA 3LUGA 4EB6A 2WJVA 3KU4A 1L7MA 2WU3A 1OYWA 2CLHB 2Q62A 2X9GA 1PUJA 2QJRA 5DW3A 2WYVA 2XIJA 4IINA 5HGJA 5AQEA 4YMHA 3DZDA 3MN1A 3INNA 3G9UA 5FBQB 1H9AA 2HEIA 3EGDB 3LY8A 5EUCA 2FSFA 1NY6A 3R6TA 2JA1A 4I55A 4PIVA 5K0FA 1I33A 1VFPA 3KKZA 4S1NA 3A9WA 5KCZA 3K70C 1KDRA 5B2ZA 1YIDA 5ARBA 1CUVA 4Y2GA 3P5BA 3DMYA 3KXIA 4EGQA 1NVFA 1CY6A 3MWEA 5IM5A 3E9CA 4MROA 2PSDA 2AGVA 3R3UA 1M83A 2FSPA 3QOXA 5KYUA 3WYDA 2SKEA 2WZQA 2ZIFA 4KQ6A 4DLWA 3DQZA 1UT6A 1ZM4A 3ETGA 5DHSA 3RBVA 3O75A 3U56A 4N3NA 1PQUA 5EKTA 4ER5A 1CEYA 1NQTA 2OHGA 1E1LA 1MVOA 3S7TA 4F6LA 1N4DA 1BVUA 4ISCA 3KQOA 4B46A 4M0DA 4FX2A 3W8NA 1PR3A 2R68A 2VBCA 4RLQA 4CL3A 4PQYA 1TLTA 5CDYA 5FWYA 2CSUA 2OUKA 3FNQA 4HNRA 1L5MA 2AB0A 2C9DA 4BOYA 5REQB 2GZRA 2WAOA 3LQ2A 4BBAA 1G8KA 2B25A 3PQEA 1EXNA 4QD3A 1HC7A 5EWLB 2C54A 2REQA 1KRWA 4OHOA 3GLUA 1E2PA 3IDZA 2Z4TA 5FADA 4CYMA 3ER8A 1PLKA 1OFTA 2G70A 2V54A 2HN9A 3M49A 4Q1DA 3E9DA 3EUEA 2ZIVB 4TV8F 1Z29A 4WFJA 4ZYVA 1KI6A 2W48A 1SAYA 1RMTA 3FVQA 1Z0JA 1NLYA 2RBKA 2QP3A 4WLEA 3W1EA 1Z0ZA 5EVJA 5CA0F 4DBLE 2ZTVA 3IEMA 4UHBA 1EVJA 3I37X 2F1HA 2OD2A 3P4UA 3FPHA 3HY4A 3R40A 4K9MA 1XRRA 2Y1CA 4GKVA 5B1DA 4D4MA 3ZQ4A 1ICIA 3QVGB 1PIWA 4GXRA 1KO1A 1LDMA 1QGDA 2W2MA 4G4GA 2A2ZA 3TW8B 3TXYA 1NVKA 2FB9A 3IE1A 4R81A 3FPJA 3KPYA 1JLLB 2JIRA 2PO5A 4ZT2A 4LF7B 5BN4B 2ZUDA 3ONNA 4E7OA 2ZCVA 3L1IA 4A6DA 3VJRA 3VDMA 4X00A 1E4EB 4EITA 4QGBA 1JJ7A 1NP3A 1E1QD 1UK9A 2YWRA 3I2GA 3OBBA 4JP8A 1MVLA 1PR5A 3WP1B 5T4EA 4UE6A 1Z28A 1II0A 1O9GA 2Q3JA 3O21A 4KWHA 4Q9DA 4W8GA 4ZT4A 2LCFA 2FAXA 1AK1A 3DP7A 2IGTA 3HYNA 1DZ3A 1TM7E 3MGCA 3TSZA 4W5TA 3DW3X 2B2CA 2K87A 1P9OA 4B3DA 3HU1A 3UFBA 2XCTB 3LQFA 5EZYB 3LZDA 1GZ3A 4KFRA 1JS1X 3UF0A 3ER6A 5ESXA 1NOJA 2H1IA 4FEEA 4FZRA 1T0BA 4BVBA 1E58A 1OC2A 3NRCA 3WB0A 3IOEA 1WXHA 1IBRA 3MWEB 3ORYA 4B3XA 1E3DA 1FDTA 2QIPA 3M3HA 4R0MA 5C5IA 5JR3A 1IOVA 1XRMA 1U2RA 1BYIA 2YCBA 9ATCA 2J48A 4X6YA 2FSHA 4BUJA 5H0IA 2Q3EA 4AN1A 5BVGB 1BXGB 3AF3A 4ZDWA 2PWAA 2BMDA 2DEUA 5G02A 3TTXA 3DKKA 4Y6LA 1LTHR 4XSVA 1OKKA 2H0RA 4UE2A 4L95C 2ILVA 1A88A 2YHBA 3E9MA 3G0GA 3M4JA 1XIVA 4AJ4A 1JB9A 2CYBA 4INZA 4EA9A 5BY2A 2F43A 2WYOA 4HRVA 3IQZA 5FBHA 4PC2A 4ED9A 1LLQA 2RSLA 4YQFA 3RASA 3PICA 4G41A 2Z08A 4QEKA 2VLIA 3DS8A 5A4IS 1JU9A 3LVQE 3IAEA 4HAVA 3WY9A 1Q0ZA 1FP6A 3AFMA 4JFAA 5AJTA 4H17A 1YU9A 1QB7A 5EAIA 1GQFA 2EZTA 1NV8A 4JJ6A 4CMCA 1U8CB 4B2LA 4L7QA 2ID4A 4B84A 2E21A 2FLWA 1UEXC 4BFYA 2WT8A 3KX2A 4KQWA 5TX7A 4EHDA 4CF4A 3HPRA 2IIBA 3WLKX 4E33A 2IZ6A 3VJMA 5IJ0B 1NAHA 2GO1A 5LYYA 5JH7B 1NI5A 3BCSA 1GN8A 3BL6A 1M1YE 3QOFA 3GHHA 1OVMA 3RROA 1NBWB 1VMDA 4RY8A 3OCCA 3M33A 4M22A 1W6RA 1U6IA 5DHQA 4NCBA 2G9VA 1QX4A 5LLDA 2H31A 5D7BA 2C5AA 1CQJA 1RXEA 4U7JA 3QPCA 1RE1A 2CXSA 3K4QA 4PZCA 1GCUA 2PSHA 1MTOA 3BJIC 3K6SB 2VRCA 4L76A 4RW0A 1LI7A 1NN5A 1J25A 2FW9A 4RU1A 4IJ6A 1QKKA 1B2LA 4KAJA 3CNHA 1I0IA 3RFUA 3U3MA 3BHMA 5HM8A 1WV0A 2DQZA 4FGLA 3DEAA 4U6SA 1N4AA 5IMSA 2IA5A 3P9YA 3WZMA 1PU2A 3A3OA 3BXFA 3D0RA 1YUBA 5JC8A 3WFIA 4DB4A 1WZEA 3ICPA 3IQHX 2B98A 2OCXA 4CG2A 1KJYA 2PH1A 4ND1A 4YCBA 2D8AA 3TKLA 1U4SA 2TECE 3FPGA 3SBDA 5DGXA 1Z73A 4NULA 2LDBA 3HWRA 4GMFA 5CAEB 3QU5A 1AV7A 1XAHA 4LBVA 3ZVRA 1W8DA 5E9JA 4DB2A 4XJSA 4JBHA 4DA6A 1SY7A 2UUBB 1I9CA 1T25A 3EGIA 2ZBQA 2PMFA 3UXMA 3COJA 5D1HA 2OAP1 1N2CA 3K5WA 3DDUA 1XAIA 1KZ1A 2AUTA 1CUWA 3LH5A 5EHIA 3LT1A 2D3WA 2GFIA 2ZTHA 1HI9A 1KI9A 1XTVA 3CURA 5EQFA 3V1UA 4URVR 4B6OA 3DEHA 4LMBA 1RFLA 1XROA 2H2AA 2ACEA 3FM9A 3SJBA 7MDHA 1ONSA 5EHXA 4PZAA 3R44A 3NJ8A 4PSAA 3PGLA 4FGJA 4C7XA 3DZJA 3A3KA 2WU1A 1ZEMA 3WADA 1RD4A 4H60A 1HBJA 1JDJA 5AVYA 1TZ2A 2X13A 3JR3A 1JH8A 2XUAA 5E7IA 1GPMA 1SKYE 1SOVA 4MLPA 2FMTA 4GICA 4KPYA 1RHKA 1GADO 3ZGLA 2WIKA 1UWKA 5TMDA 1IN6A 4YDHB 3RGGA 1DCFA 1ESDA 4P3XA 3HE3A 3SS7X 2QS9A 5JYEA 1Z6AA 2XUGA 3DDWA 4V2IA 4LRUA 4FM9A 3KOYA 4IG4A 4F4DA 4LDAA 4GSKA 3EYWA 4HB0A 2PGDA 4LC9A 4ER7A 2RE8A 3MC1A 2X2FA 1YGPA 2JKYA 1YQEA 2FSGA 3E53A 1UQUA 2XTJA 3I12A 4KIUA 3H84A 5I5GA 3WGLA 4XCQA 1U3CA 3ASZA 2KM1A 4DCSA 3D3QA 2ZB4A 2ZYSA 3AX6A 3TLGA 1OAOC 3OJOA 1Y80A 2B9VA 3HWX1 3PS9A 4B3HA 3QJYA 1H2HA 2XT6A 1VPTA 1ZGBA 2O8NA 4XTRA 2QRUA 3RSZA 2ZS9A 4GVLA 4KLCA 3NMUF 4RSGA 2PL5A 3O4FA 4EKYA 1GL7A 3H9JA 1KEPA 2AFIA 3MGAA 4MV5A 4IHKA 1O89A 5CG2A 1NBMA 3TD2A 1T4MA 4DA9A 4PYRA 1UJCA 4PXYA 2XXAB 2BJWA 4XGNA 2CN1A 3Q10A 4DCTA 5DXFA 3STVA 4BLRA 3OIDA 4CEIA 3NHZA 2FUG1 2RGDA 3HSSA 4TL8A 1XHLA 2AMFA 4L9SA 3KM0A 4MULA 5DI9A 2BSXA 2LGJA 1M34B 3I53A 3VPSA 4TM8A 1QCDA 4LC1A 4RADA 2QVGA 3L0IB 1VFNA 2C0PA 2HU8A 4QU0A 3H2KA 2AWOA 3R09A 3LDUA 1DADA 1YVEI 3EVFA 2PZAA 1JXMA 2C5HA 3GLVA 2WF6A 3GB9A 1O5OA 1Z6GA 3JWHA 3JYNA 3M9WA 2YXLA 1NR7A 1OYVA 2HL6A 3P1JA 4HPJB 1E5VA 1CP2A 4KACA 4TWJA 2H0QA 3X44A 1SA0B 1SC3A 4HQ6A 2Y1OA 4TMYA 2VI5A 2GWRA 1QRAA 3K0BA 4D56A 5HS4A 5I7OA 2HA4A 3T5PA 3EEFA 1B8PA 2RJOA 2W4MA 1UQTA 1V37A 2ZRCA 2JA2A 1V3QE 2ZRPA 3FNIA 3QYAA 4IQ8A 5ARCA 2PRJA 1E18A 4WZBA 3SPXA 1S89A 3I9LA 1TU0A 2GNOA 2IS2A 2RK3A 4KR9A 2CUKA 3HI6A 4LZNA 5LJIA 4Y1RA 3MJSA 5TJ9A 5A2QA 3GLGE 2ROQA 5EIWA 1XB2A 3UKDA 4XJVA 4Z49A 1ETUA 3DCNA 2DFLA 3BXZA 4R1SA 1ENOA 4TZ0A 3DZGA 1X1SA 5L4NA 4B6EA 5LL6P 1PVDA 1ZCAA 2O07A 3PX3A 5AHWA 3AJDA 3AF1A 2PA0A 1YDMA 2ZWPA 4D98A 4PFQA 3RJTA 3UWKA 4BCDA 4EUEA 1XNQB 1RYYA 2X6QA 1GKUB 1Y5NA 3MAAC 4P32A 5HGXA 1SB9A 1KY5A 1USUA 4GI7A 1JYFA 1BN6A 3SHFA 1DAOA 4I2NA 4COKA 4B1FA 1PT9A 4GUDA 4Q3OA 4TMXA 2HAEA 5K3AA 4P08A 5DNUA 2OECA 4NZ9A 3EXHC 1VIAA 4PHFA 1J5XA 1KSGA 4F12A 3MILA 2H65A 1C0PA 1KK3A 2FFJA 2PZJA 5I9TA 1JBEA 4UPEA 1O5TA 2QUHA 2DP4E 3LFUA 1PTJA 5AIAA 1RHUA 1ML3A 2B4YA 1NVBA 2PIAA 2VDMB 1SOUA 4ZVOA 4F21A 1G6HA 1Y4DE 5KX5A 5TGTA 4Y0AA 3UXYA 1ZM2A 3PC6A 3R3WA 4C43A 4AECA 1KFKB 1EP9A 4MWBA 1W1UA 3UTDA 2G88A 2WSSD 3C1AA 3FZEA 4I6JA 3WLEA 2PKYX 4RL6A 3NFRA 4CODB 3NP7A 2ZJ6A 4C3OB 1GPH1 1R0CA 4GWLA 4DCUA 5CBKA 4KFTA 1R0WA 1SOMA 5FI1B 3MQFA 2Z6QA 2RHRA 1LQUA 1QHEA 2AFVA 2BP7B 2NU7A 4C89A 1JLLA 3SXJA 2V65A 3MWJA 4EYSA 1YULA 1Y4ZA 3F8TA 2VJAA 4LBWA 3G9ZA 5IT9A 4KX5A 2HIGA 3QVGA 3LX8A 1C4XA 4FYWA 5DN6D 4WNAB 3UAZA 4EQZA 4IDAA 1QGUB 4KODA 1AXGA 1NRXA 3ABZA 4TKUA 3RB8A 2WF8A 1I94B 2H2GA 3PUYA 4TWIA 2V6FA 1AHHA 2YTZA 1EXDA 3PIDA 3GDWA 1GWNA 2WKWA 4FOTA 4X1IA 1CS0B 3MT7A 2C4HA 4IRMA 5JCXA 3PT9A 2XWJI 3DOUA 1A1SA 1NT2A 2I66A 3THYB 2GPYA 2REQB 3U3RA 3WGOA 1U5AA 2WD7A 2O0HA 1GUBA 3GGOA 2ZYAA 3EFOA 3UXHA 3TNFA 1ZISA 2P69A 2R8YA 5EP2A 1MBZA 2GXQA 1E2JA 1L7RA 5C1OA 4NXMB 1L6RA 1B7GO 3EWNA 3AEZA 1OBCA 3PVSA 3KQVA 3Q0IA 1ODTC 5DNVA 5JWHA 3WQSB 3OLWA 2XDYA 1A5SB 4CM4B 4NECA 3QSGA 4JI1B 1BE8A 1U0NA 1Y1KE 1R88A 5BSMA 4ACAA 1HQYE 1TZCA 3ORRA 2P90A 3W1VA 3V55A 3ZG6A 1V7CA 2QRJA 1Y9DA 1E0DA 3KQHA 5HYVA 3ZJVA 1RQXA 2O5RA 3RS5A 1DINA 5HILA 1N32B 3JVIA 3EEOA 3ND9A 3DMTC 4BNTA 1GNSA 4Q37A 1S3GA 5T4BA 1REQA 1VL6A 5NULA 3EF3A 3VR2A 4ZHSA 1V2GA 4MCJA 1XLWA 4PSVA 2KW5A 2ZUEA 4IUCS 1G8GA 1DWUA 4UARA 3X1JA 3ZHXA 1UAGA 1U04A 3F6SA 1E1NA 2GGSA 4XPZA 5D5QA 5SY9A 4BVFA 4ID9A 2DTXA 1DUIA 4IDFA 1VDZA 1X7HA 4OX9Y 2F48A 3KC2A 1ZHHA 3IT1A 3I32A 1MENA 2NZUG 1ZJ5A 1J97A 1YI0A 5FPTA 4AU1A 1SU7A 3CUTA 1FY2A 1MO2A 1YL7A 4PC7A 4CGYA 2VHQA 1SXJE 1NTRA 4B48A 2HYIC 1XTUA 3BJEA 3UG7A 1V3VA 3QMMA 4PAQA 3OM9A 3D6JA 4BO2A 3I64A 5TT0A 5BVGA 1X9GA 2CKMA 2XUHA 4GD3Q 4Q5IA 4C5BA 2HD4A 4RHTA 1UZUA 3D31A 3PFGA 4DQXA 2V7QD 1U80A 4JI0B 1NUQA 4MR7A 1JB1A 4ZGWA 4PBSA 4OHYA 3WMWA 3K8QA 1N36B 3TNLA 3AH8A 1P9NA 2V7XA 2Q1SA 4OYLA 1VPEA 1GFIA 1TGYA 2A9OA 1QLWA 1HDEA 4IYRA 3T41A 5HKBA 5BQ5A 4JIMA 2WKRA 1L7VC 1Z4IA 5AVVA 2YWCA 1RI3A 1K5PA 3IP3A 5BV2P 1VKRA 3GZTB 3ZGZA 3ZU5A 4FFNA 3ACCA 3AXSA 2AG8A 1PFKA 3M5DA 4HEA1 4M46A 1PJQA 3FWYA 4BO8A 5KSZA 1TM5E 4MB0A 2J3DA 4G09A 4NMHA 1NI4B 4L5AA 2QY9A 4MKIA 5DN6A 5GIPE 5CLLA 4ML3A 3ESCA 1NLFA 2EW2A 4J1NA 1G41A 4UHEA 4DYHA 3ILXA 3T7RA 4PN7A 2NV2B 2Y99A 4CDRA 3KKLA 2CXPA 1KIAA 3ND7A 3AK4A 5AVTA 5HZHA 5FHRA 4E5VA 4ZZ1A 4ER3A 3N3AC 4MGZR 4YCLA 4HQRA 2WWHA 3DLHA 2VSFA 2X9NA 4L5YA 2PRZA 5MDHA 1BCRA 1PBTA 2KX7A 3H7AA 2QXYA 1A7JA 2VJMA 3BL8A 5A5GA 1TPZA 4P7FA 4COOA 4EI7A 1HO3A 1PGNA 1SCUA 5E6RB 1XPOA 1G5QA 1KP3A 4DIUA 1CP3A 3F4BA 3AC0A 3VR6D 7ADHA 4NYMR 5AKYA 1UMDB 4LW8A 2NWQA 3BSSA 1EX1A 2C9OA 2G71A 4D9BA 1TEZA 3QQ5A 4QPDA 1V7PC 3I58A 1UKYA 2B7LA 3I72A 3N70A 1TU4A 4TKZA 4ND7A 3KYIB 1W6UA 1MC4A 4Q01A 4Y8VA 4E3ZA 1FQWA 3BZWA 2RHDA 3PVCA 4ABTA 4LOJA 1TJ3A 1Q21A 3JD1A 3TQQA 1SVOA 4M36A 3LQKA 1WCIA 2YJGA 4CEHA 3RAEC 2FQWA 4PSCA 1UQRA 4G65A 2Z2XA 1D9XA 1FNBA 4P8RA 3EIEA 1Z18A 2YHAA 4JJZA 4G81A 5IARA 3TH5A 1MJGA 1ECGA 3TQCA 2X2PA 3ZCXA 5KCMA 3UATA 1E1DA 4F6CA 1A5AB 3AR3A 4HGYA 4OXKA 2Y2UA 5C35A 4A8HA 1GZUA 2GHTA 1DL5A 1SCKA 3O83A 3NHJA 1CKEA 2J4DA 4XDZA 1OD6A 3FLAA 5CP8A 3KQLA 2OV2A 3FKSA 3TB6A 2II6A 4BKRA 1DRKA 1JTFA 1FJGB 3AW9A 2QTGA 4R9UC 3D2AA 4R4JA 2AS0A 2VSXA 3GO4A 2QW0X 3CNNA 4YT5A 4EPYA 5IFLA 1RBYA 5IH3A 5AKXA 2V0GA 4W82A 2A94A 5C1IA 3TMYA 4A15A 2EHDA 3RAPR 2BD0A 5IT0A 3VYSB 1W5BA 2ZJ2A 5JMTA 1S3SA 4RPKA 1ISRA 3OQJA 3OTWA 3V8VA 3AL3A 5IAAA 4IWXA 1JFTA 1CQXA 2QTZA 4PYKA 1T5BA 3EX7C 1HA3A 4FHGA 2WYIA 1WZNA 1T0UA 4JX9A 1FFYA 3P4YA 4XGQA 2XA9A 4HMOA 4G26A 3VYTB 3ABRB 2EJBA 3PA8A 5BWMA 1KS2A 1MNAA 1JBQA 2WHYA 4PLCA 5HE9A 3ANMA 1QQ5A 2JGDB 5LQDA 1FPQA 1QFJA 4RVCA 2OLKA 1V8PA 1EVEA 3WGYA 1L4UA 2JLBA 2EEPA 2JAWA 3SR3A 1UBJS 2E4XA 5B3JC 1MW8X 3NOVA 5D85A 3JQ6A 3PC4A 3MRSA 4MI1A 3D8RA 3CG4A 4OI0A 1LBEA 3B89A 1NW4A 4FHCA 2BHNA 4CEJA 3QHPA 4FQ5A 2HSJA 2Y1KA 1BTOA 1ZC4A 2WLSA 3EFEA 3HC7A 1FMJA 3PD7A 3PLRA 4LKRA 4M8IA 2FUCA 1GR1A 4RPGA 4YQYA 1IEQA 1HH4A 2JDIA 2OCYC 2R6R1 2Z2IA 4UZSA 4PSUA 2PT7A 3B5IA 3UPDA 1YAJA 1I6KA 2YOHA 3SJ7A 3IV9A 1IUKA 2FMKA 1TUIA 5AHKA 5KDLA 4YRNA 3THWB 4QUEA 3A11A 4I4CA 3ZWKA 5CDFE 2XUJA 3DFFA 5HEKA 5ICEA 1PDOA 2VHVA 4ZYYA 4H7DA 1CVLA 3OF2A 4F4IA 1E6MA 1Y7IA 3A6GA 3GJZA 4ZT6A 4X1OA 5FEUA 3ZZMA 5I7FA 3TVYA 1O6GA 3H65A 2VBFA 4PRKA 3WYEA 4B8YA 1DBVO 3EEQA 3KVOA 3OY2A 3T1NA 2PR7A 2ZJBA 4HEQA 4IZHA 4O3MA 2NVWA 2O3TA 3E3AA 3EGXB 3ITKA 4TTTS 4K86A 3QLEA 4A8JC 5D6NA 2ZJFA 1W5SA 2YASA 4H6VA 3EQ8A 2RDMA 1H9BA 2W37A 4LFBB 2W6ID 3DOCA 5LD2C 2PUAA 3E58A 1KE1A 5A0TA 1U5BA 1HM5A 1R16A 4ZCSA 1LC0A 5C34B 3VR2D 1E7MA 1X86B 3K2EA 3KD2A 4UBIA 4A92A 4XR4A 3H2JA 4DV5B 4IV0A 1VTKA 3R5SA 4QU8A 5FR2A 3HJBA 2BGRA 1PFWA 4RE5A 5IAJA 1FFHA 1SKAA 1EK5A 4QBTA 1YJBA 2UZAA 3A58B 1ZOOA 2BGTA 2J5BA 2P40A 3BJZA 4H15A 3DBOB 1J33A 4UOEA 1WMEA 1E9BA 1QHXA 4ND8B 1FC0A 2Y1DA 5AK6A 3ZWWA 1WDTA 4C5CA 1D8AA 2FDRA 2YZNA 4AZWA 3EG9B 3ZX4A 3MD9A 2WUDA 1NBME 4L5CA 1AS3A 3QVXA 3RT7A 5CITA 4QTZA 1SZJG 2QYHA 1AG9A 2JBHA 1N2SA 3T7EA 2YZMA 5I3CA 1P72A 4MYSA 3U1TA 2R1VA 2AMLA 1JWAB 1DBQA 2WSYB 3AOEA 1P18A 3B8HA 3D8NA 4G8JA 2FOIA 2R1TB 4MV0A 4B7CA 2MHCA 1EPUA 2OZPA 4J1SA 5LC1A 1HZZA 5JRDS 3D6NB 3LQYA 2B0CA 2ZSAA 3CH6A 1RAEA 5KPJA 3A06A 3EC1A 2JARA 3BTOA 1PT7A 3QYJA 5B6PA 2OHIA 1OB5A 4QC2A 3S2EA 2G7ZA 1KKLA 1G38A 1GPWB 1N75A 2Q1WA 3K3PA 3P8ZA 5ENDA 4ENWA 5JBQA 5AVWA 1DCTA 1T5LA 1W36C 1NXXA 1XTKA 3TOCA 3TMAA 4KXYA 1SC4A 1Z06A 2I6GA 3M4XA 4WKCA 2ZRIA 3HKEA 2WE8A 1NMQA 4O4HB 3CS3A 2QE7D 3A2LA 3TIXB 4Z86A 2YJ4A 4NFHA 1GPLA 2ICAA 1JDZA 3MGKA 5DGIA 3U4AA 2BEUA 1GZVA 3HUDA 3R75A 1SBCA 2K2QB 2VPTA 3AUFA 2EFYA 1TJ4A 3RVKA 3TW8A 3LYUA 5EIHA 2NMVA 2AD5A 2XZTA 1T6YA 2BFDB 3KB8A 1SQFA 3O92A 4KYIB 2RFLA 4JSRA 2BFEA 1RLUA 2ZWIA 5KYXA 2QVLA 3AEKA 3QLVA 4JOSA 3GT7A 3Q15C 4GP6A 3Q12A 1X9IA 5I7HA 2ODNA 3ZVKA 1SUAA 3LVBA 3QWIA 4KCGA 1XLVA 2YQ5A 2DETA 1CNMA 5TV2A 1LK0A 3ZCPA 2ATEA 1P6XA 2JVKA 4K03A 2DTEA 1VI2A 3OJEA 5A9SA 1UM9A 1R6XA 3PPIA 2YXEA 5ALLA 3QG5A 2VK2A 3GT3A 3LAWA 4PFSA 2ECFA 2Q4EA 4TV9A 5HE8A 4NCAA 1L8OA 2J3LA 2ONYA 3LWDA 1DRVA 3TZLA 1L4LA 3CLVA 5A62A 1CR4A 5FWYB 1IWOA 4EK9A 1OA0A 1TUBA 3A1WA 1DJLA 2A33A 3JU3A 1LB1B 4ETWA 1KH1A 3G5LA 3IVXA 4FYMA 5DLYA 4H3HB 4DILA 1RT9A 2RHLA 4D0RA 3NDBB 4P5PA 3CX6A 3OE1A 4A0QA 4CM9A 1Z5VA 2P6NA 3GFGA 4ESVA 4F5DA 3SFVA 1AN0A 4X0EA 3ZGNA 1B16A 1JNXX 3LHFA 1WDWB 3RD5A 5LMCA 2WPNA 1WEKA 4JP2A 4D4KA 1U7XA 3CKLA 3TUJC 3URKA 1VI6A 1EUYA 1V7ZA 4M1OA 3PC2A 1OT3A 3RVSA 1NKVA 1PQWA 4AS3A 3OX2A 4F3NA 1AO0A 1O95D 3H1EA 3U16A 1MGOA 1VCHA 3F2VA 4MLDA 1HT2E 2V6GA 4TV9F 4O4IA 1Y8QB 2QAIA 1B0ZA 3QY9A 3KU1A 4DW8A 4MAAA 4MQFA 4BLOA 3TL2A 4KI7A 2QW1A 2VRWA 2Z04A 1XDSA 1B3RA 4KWEA 4NARA 3UCXA 2DPGA 3SSMA 3WDSA 1L4NA 1GL9B 5BSHA 2BUBA 5A4DA 3GROA 3KJGA 2IP2A 3FOZA 4HMPA 1NM5A 1VRWA 3O4JA 2H1HA 3E5HA 1G5IA 4ALIA 2MTBA 5JPCA 3L4BC 2WT9A 5DT9A 1RBMA 1YZLA 4URHA 5GM2A 3F0TA 2HA6A 4TWAA 3THSA 5LZ8A 2AXPA 3Q8MA 2VDWB 2PXXA 3T9FA 2YZ7A 4CU5A 4NMLA 3TSWA 3JASB 3HP7A 2M6KA 4FGUA 1LLUA 1OFHA 4PEVA 2WMNB 2C84A 2XNHA 1Q3TA 4O4IF 4DGQA 2RHOA 1E64A 2AKAB 2GYYA 3NONA 4Q3BA 4ERNA 4KNYA 3N0TA 4JNKA 4XD2A 5F9HA 2V0NA 1K3UB 3M6WA 2O7RA 3NIGB 5H3LA 1ZR4A 2RHHA 4R31A 4JYCA 4U9HS 1ULTA 4Z4CA 4M98A 5ICSA 4L8YA 4W5QA 4ZFNA 1ZJWA 2NXJA 4ZDKA 1XZGA 5JNLA 3T4EA 1P0IA 4BO1A 5LLTA 1GQYA 3PWSA 3Q9UA 4ZOBA 1T91A 4DA8A 3G0DA 1E6LA 4FT4A 5IJ0A 3E3LA 4B81A 1Q84A 2HQSA 1FDOA 3WAKA 1XZIA 2MSCB 3CNLA 1X2BA 3AKCA 3GJ0A 3JWIA 3TLBA 2AMVA 3NNNA 4F97A 1GILA 2HGSA 4G5FA 4WXRA 2WJ6A 3MUNA 3H75A 3GT4A 3IUPA 1QG6A 1FUEA 2P9HA 3C8ZA 5DEIA 4RVOA 5C3UA 1PWZA 5KNBH 5IANA 2AK3A 3I2YX 3MA0A 2A9KA 3BIJA 3G23A 3KTDA 2BFOA 1MIOA 4PR3A 3B3GA 4EYEA 1F12A 4BWFB 1RM5A 1S1CA 4OFZA 4RH1A 3BD6A 2A6PA 3IPXA 4ZVRA 1YRQA 2WKSA 1E7WA 1M7HA 13PKA 2FN9A 1Z38A 2P5SA 3GNSA 4RTLA 1BHO1 2X8JA 3GMIA 3KE8A 3R7FA 3V6MA 4JYAB 4D99A 1KWGA 1RXYA 4CV1A 5A5EA 3CUVA 1F7VA 1OI2A 2ANBA 4JLBA 3C5VA 2JKVA 1KAEA 1XNJA 4KIGA 4MHSA 3ELYA 3VV3A 3ZDYB 3PSHA 3DMHA 1KHHA 3QIAA 5LNK6 4A82A 1JHXA 3NDIA 3NTUA 2V0CA 4KXXA 5CNMA 1BROA 1EJBA 3DD5A 3A4IA 4TLDA 2H5IA 4U7GA 3AJ9A 1W1WA 1BQ3A 1GLGA 2CLLB 2F9MA 1MKYA 2G9QA 1Y9EA 2R9VA 1GZDA 3KOUA 4NZZA 4RE6A 4YAFA 5KYGA 1N6OA 5LN1A 2WLTA 4HLQB 4XQCA 1Q2XA 5EKUA 2W6OA 1LF0A 1J06A 1DB3A 1Y6QA 2B6HA 2PWBA 5KJFA 1ZMRA 1EE9A 4Y1EA 1KPGA 1PT6A 3AEQA 3N87A 3E7PA 4IGKA 4BQOA 1NZFA 1XQYA 3AIIA 3B5JA 5HIIA 1Z36A 3WKAA 1AV6A 2JBWA 2VXYA 5B3KA 1YSCA 2NQ8A 3F6EX 3KR1A 4G9GA 4D1YA 3K70B 1Q7BA 2ZBPA 3IB3A 3W2TA 4M87A 4AX4A 1GG9A 4U1RA 1WW2A 3SS9X 1MB3A 3REOA 5JPDA 2FEKA 3RSHA 1T36A 3AWIA 5HCUA 4MJLA 4YPOA 3GBPA 3L0BA 1F5NA 2Y77A 1N9KA 2UVPA 4AMBA 3OZXA 3TSAA 3ZE0B 4G36A 3S27A 4D57A 3OQMA 1Y3HA 3BRQA 4LJRA 1QYXA 2PCJA 1SKQA 4PQFA 2E48A 1DQRA 1R8XA 2JGNA 4Q9AA 3TKAA 1ISIA 5JFGA 1VKOA 5KYNA 4QJ4A 1DUVG 2A9RA 4OQNA 3V46A 2AI1A 2ZBFA 4AAYA 3VFDA 1JXOA 4LXTA 3SZ3A 3TOVA 5I6DA 1L8XA 3KFLA 3TR5A 4BJ5A 1KGSA 3D7NA 3TDNA 3M0EA 2G9ZA 1BFDA 1JPNA 1N6HA 1SUWA 1XMPA 1NVTA 1YE8A 2UUPA 2YMLA 3MF4A 1G6KA 3IVRA 5BQFA 1VJCA 1WOMA 5CEJA 1N9GA 1JQAA 3A6JA 1CRWG 1PNTA 1RJGA 2WD8A 3STYA 5LXTA 4LHXA 1PSWA 2AFIE 3AM1A 1JHZA 2BISA 2C04A 3W1WA 5A2GA 1XDBA 1T9AA 3VGJA 3U4DA 4QU5A 1U8UA 3ROFA 3ZCTA 1KU0A 2H6EA 1DC7A 2KI5A 3FNHA 5LYJF 2FPPA 1R9MA 7REQA 2IUYA 5M04A 2G40A 1A69A 2DPHA 2HBYA 4XUGB 5SYNA 3WMXA 5I9IA 5IXJA 3KNZA 4A1OA 1SUEA 3KQSA 5HKOA 4QHSA 2YN0A 1T2VA 2ID8A 1HL3A 3GYBA 1TA4A 2H5LA 1IZ9A 1VA4A 5E3HA 2B0JA 5MN6A 4FUTA 1X7XA 3CTMA 1TO6A 2ZUUA 4KPUB 3IILA 4XDHA 2F55A 3GLSA 1XTQA 3LQRA 3DKIA 1W9HA 2G9NA 1PGJA 4L28A 2G6BA 4RGQA 1X8XA 2FPKA 3I9V1 3EJ6A 3B1YA 3MELA 1W9MA 3RI3A 3WB2A 4ZQFA 4ENQA 3CPSA 4TLAA 5DO9A 1EWKA 1Z0DA 1JFLA 1UEIA 1IRXA 2AVNA 3HBJA 4JS0A 2VF4X 4TMZA 2HA3A 4XIIA 1H5UA 4GOJA 4EB6B 221PA 3LTNC 4I50F 1N9GB 3LA8A 2FZLA 1CVIA 4NEGA 2CDRA 1ZNXA 1G19A 4WK2B 2NUTB 5LD2B 2VCYA 1P5JA 3B7GA 1DPGA 4G3XA 4L73A 4XI9A 1VL0A 5JU6A 1HETA 4AO8A 1HFJA 3ZHUA 1H85A 3DHYA 4NFSA 3WL8A 1LV7A 3LSYA 3K6RA 1V9SA 1PX0A 4DNQA 5HBGA 5CFOA 5KQLA 5PGMA 2JCBA 2F8TA 1TJ5A 2BEUB 2CHQA 3RWOA 1XCPA 4OG2A 1T24A 3N8DA 4F11A 3S0JA 2P2NA 1KDTA 5K0BA 3DXXA 3E0XA 3LE8A 1NFRA 3S2UA 1G0OA 1NVEA 3K5PA 2O54A 4E2FA 1R74A 2DFTA 4WWHA 4EAQA 4Q1AA 1L2TA 3BS4A 1ZUNB 4JY7A 4PINA 1XMVA 4FMDB 2ZJ7A 3FW1A 3ONWA 2DWQA 1NP7A 4KE6A 3WP0A 2QZPA 4YXFA 4GXQA 1XU9A 2WP8J 3N59A 3O90A 2BGLA 4UEKA 2BMWA 5TARA 3RFCA 3VZBA 4C87A 1KJQA 2UZ0A 4ZC8A 3N2YA 1HSOA 4YALA 3LIPA 3PFBA 1FNSA 1YZUA 3KZOA 3FWPA 2CDAA 1J6UA 1SUBA 1ILWA 3EF0A 1NVDA 1JZQA 4GDMA 4I50A 2QY6A 2R1TA 5DOZA 1MFZA 2B3DA 1DKUA 1Q19A 2Y0PA 3IMKA 3P97A 3MAGA 1ISHA 5JNUA 1Z4NA 2DWCA 2FQXA 1IC6A 1KZYC 3Q5GA 3OHSX 2D5CA 3D4BA 1IWBB 2UZ1A 4GBJA 4Y6GB 4ZAZA 3B70A 2QAGB 1RQ2A 2IDKA 3RKRA 4CM7A 3OE7A 1FVXA 2Z1DA 3DONA 5DTIA 1O54A 3G2JA 3IPYA 3JAWA 3VU8A 4EG7A 1WQ1R 4ND8A 3L46A 5DP1A 2NZ2A 1Z2CA 3PE4A 2JJMA 5HIAA 3SIWA 3HCDA 3ZN2A 4BGEA 5E1OA 5FP0A 2IY9A 3WL6A 1XZCA 1QIGA 4RESA 4R8RA 1N5RA 1EHCA 3JZAA 5J23A 2YVQA 3UJ6A 5MF6A 2ZWAA 3CIFA 3RR2A 2H3HA 1I2CA 3D7MA 4FYHA 4EH1A 1T15A 4S2UA 5CU7A 4YXWD 3VKUA 4HAUA 2XITA 3BFXA 4CLOA 2Z2JA 1IG0A 3QLJA 1LPBB 2QWXA 2LW7A 4DPMA 1AUOA 2BF7A 2WTAA 3GJ5A 1LZLA 1QOQB 3OCXA 4J8PA 1GSOA 1NF3A 2IYEA 3QKSA 5CX1B 1HE4A 4UAVA 2Y92A 1GOTA 2JL1A 3GEEA 5L45A 1HDCA 3WDLA 1C9YA 5A71A 2OORC 3FIUA 2GZ1A 1PYGA 5KPDA 2FYTA 1DWQA 1VI5A 3GBSA 3TQIA 1WCV1 2A9FA 2FX2A 1EGAA 3TGLA 1HE1C 1OC4A 1R12A 1Z47A 4J7XA 3U81A 3N28A 4AC9A 2FWJA 2VZ9A 1AMOA 2PLNA 3HKDA 3QJGA 1HZZC 1UXJA 1SKBA 1NPTO 1A77A 1NRIA 3BX1A 4XR9A 1U9YA 3CH4B 4P34A 1NU8A 3JATB 3QEJA 2O50A 1KK2A 2VR1A 3IBCA 4F2GA 3F1KA 4JKIA 4DLBA 3O8CA 4DSAA 3CW8X 5K3FA 1GU1A 1PNRA 2GBCA 3B52X 5A7FA 1C29B 2I4NA 1M1NB 1SUCA 1GV1A 4O2AA 1YK1A 4CEJB 2IHKA 1QG0A 1X70A 4Z8XA 1TB4A 3PQDA 4XLLA