2AI2A

Purine nucleoside phosphorylase from calf spleen
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
280
structure length
274
Chain Sequence
NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel multisubstrate inhibitors of mammalian purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 86
structure length 274
sequence length 280
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ai2A00
1SJ9A 5CYFA 3UAVA 3PHCA 1U1CA 3FNQA 3ONVA 4M3NA 1Y1SA 1Y6RA 1YRYE 1ZOSA 2QTTA 1RT9A 1WTAA 1PR5A 1Z38A 2H8GA 3OF3A 4WKPA 4G41A 5CYGA 3OOEA 4GLFA 5F78A 4TTIA 1PWYE 1B8OA 3EUFA 4NY1A 3KUKA 5FAKA 1ECPA 1JDTA 4YO8A 1T8SA 4OGKA 3MMSA 3OCCA 4MCIA 1RXUA 3FB1A 3E9RA 3P0FA 5CXSA 4TXMA 1RCTE 4DA0A 1A9PA 2OC4A 1PR2A 2AI2A 1JDSA 3F8WA 1RXSA 1ULBA 3PNPA 3IOMA 1NC3A 4QARA 4MCHA 4F2PA 1K9SA 5DK6A 1A9TA 3KVYA 1V4NA 5CXQA 1TGYA 3PNSA 4F2WA 1JP7A 1PBNA 4L5CA 1SQ6A 2PGAA 1JYSA 1I80A 3OPVA 1ODIA 4JOSA 3EEIA 3MB8A 4JWTA 3DJFA 3LA8A 1U1GA 4GKAA 4IP0A 1SD2A 4TS9A 3KHSA 2Q7OE 4QASA 3TL6A 1OVGA 3BGSA 2QDKA 1C3XA 1ODKA 1JE1A 3BL6A 4GLJA 1U1EA 3K8OE 4BMZA 5F7XA 3OOHA 1PW7A 4QEZA 1ULAA 4X24A 1PR0A 4L5AA 5IU6A 4PNPA 3K8QA 4QAQA 1ZL2A 1TCVA 3OZDA 2QPLA 4BMYA 4R2WA 5I3CA 4E1VA 3GB9A 4WKOA 3C74A 1NW4A 5F7OA 2OECA 3NM5A 1JPVA 5EPUA 5F7JA 1SD1A 2BSXA 3QPBA 4TXNA 1OUMA 1Z5PA 4LZWA 3FAZA 5ETJA 1A9OA 1A9SA 2OXFA 1JE0A 4DA7A 4TYMA 4D8YA 4PR3A 1RXCA 3NM4A 4OJTA 1OTYA 1PK7A 4P54A 5F73A 2A0XA 5B7PA 1Y1RA 4TTAA 1Z39A 4G89A 1T8RA 3OZCA 4YNBA 4QATA 4WKCA 1A69A 2AI1A 4G8JA 3FOWA 4BN0A 2HSWA 4OY3A 1Z37A 2XRFA 4DANA 1Z35A 1YBFA 3NM6B 4BMXA 3UT6A 1PK9A 3E0QA 3UAYA 3OZEA 1PKEA 1VHWA 1T8YA 1K3FA 4LDNA 3ENZA 3PHBE 1QE5A 5EUBA 1T0UA 1Z34A 1A9QA 4D8XA 1PR1A 5K1ZA 1Z33A 3OZBA 2A0WA 1Z5OA 3EMVA 4GMHA 2I4TA 1PR6A 1TD1A 1G2OA 4DABA 5CCEA 1FXUA 4F1WA 4TXJA 2HWUA 4KN5A 3BSFA 4DA8A 3D1VA 4D8VA 3BJEA 2IQ5A 1M73E 5KB3A 5IFKA 5EFOA 2AC7A 5F76A 3UAZA 5JPCA 1PF7E 4YJKA 4WKNA 4TXHA 4F3KA 4I2VA 1Q1GA 3U40A 1RR6A 4EB8A 1YR3A 1YQUA 2HRDA 4D98A 1Y1TA 1XE3A 1RXYA 3UAWA 2AI3A 4R31A 4M7WA 2A8YA 3KVVA 1U1DA 5F77A 4D9HA 1LVUA 5CCDA 1Y1QA 4FFSA 1Z5NA 4L6IA 1LV8A 3GGSA 5B7NA 1V48A 4TS3A 4OF4A 4R2XA 1RSZA 1OU4A 3IEXA 3DPSA 3DP9A 3NBQA 3KU4A 1A9RA 1Z36A 1OTXA 4EARA 1VHJA 1LX7A 4DAEA 1CG6A 1JDZA 1B8NA 3LBAA 1K27A 3E9ZA 4QFBA 2RJ3A 1V2HE 5F7ZA 4OGLA 4ECEA 2HN9A 4RJ2A 1OV6A 3DDOA 2GUWA 1T8WA 3INYA 3O4VA 1VFNA 4JP5A 3UAXA 2ON6A 1N3IA 4NS1A 4TTJA 3T94A 3FWPA 4K6OA 1U1FA 2B94A 2I8AA 4F3CA 4NSNA 4U2KA 1Y6QA 1JDVA 4L5YA 1V45E 5B7QA 4H1TA 1ODLA 4DA6A 1V41E 4UC0A 1CB0A 4DAOA 1V3QE 1VMKA 4LNAA 2OC9A 1TCUA 4TXLA 3P0EA 1PR4A 1RFGE 1YQQA 4LNHA 4MARA 4WKBA 1RYZA 3FUCA 4M1EA 4OEHA 4YMLA 2A0YA 2QSUA 5B7GA 3EUEA 2ISCA 1JDUA 3KVRA 4L0MA 5C80A 3LGSA 3ODGA 2QTGA 3SCZA 1TGVA 2P4SA 3DF9A 3O6VA 1ODJA 4LKRA 1NC1A 4DARA
chains in the Genus database with same CATH superfamily
1SJ9A 3ONEA 1WZEA 1FDSA 1LGYA 4OBXA 1CUYA 2GBLC 2ZWPA 4TTTS 1S2MA 3QBVA 1FFGA 1V7ZA 3ONVA 3IAHA 1RBMA 4IJ6A 4TMTA 3DZBA 1MT3A 2AYYA 3DW3X 1P4HA 1L7AA 4KQIA 5AI4A 2PD4A 5AI0A 4B80A 1XFDA 4DOMA 4QHYA 2ZRIA 1Y3AA 5ES4B 4G5XA 3BERA 3HA5A 3R9XB 2ATVA 5DHQA 3V2IA 2H8GA 4U5XA 5L3QB 3TQIA 2BRUA 4CM5A 2B8TA 2JGKA 4N3GA 1LX6A 4RU1A 3HYNA 3RNLA 2NTYC 3KSUA 1G3UA 4QXOA 4F86A 3DDNA 4G41A 4RVHA 2JLUA 5I9MA 4RIGA 1CNMA 3BHIA 1EESA 1CRZA 2WIJA 2JLVA 2Z3VA 1IZ9A 4DLZA 1ZGJA 3M1IA 3PUVA 2FDRA 4FGUA 4FKBA 4PYMA 5AW9A 4YLYA 3RE1A 4JJGA 2DBZA 2WTMA 3N70A 1RD4A 3KYBA 4C0XA 1N5OX 1F0YA 4MKZA 2R1VA 1IBSA 2Z04A 3EGDB 1A4RA 4ENPA 2YZMA 3DL2A 1IFXA 1XQYA 4OHWA 2YVKA 4DQLA 1JAYA 4JXXA 1UMCA 2OVBA 2KMLA 2ZI3A 3BBLA 1HSOA 3MMSA 4J3FA 4OV6B 3OCCA 4Q4HB 4O4LF 3TXXA 2JJ1D 3NDRA 1R1DA 2BI4A 2V4UA 2I6GA 4E5UA 3UCXA 4NNOA 1DFIA 1RXUA 2Q6VA 2WJ3A 1RS0A 2WM8A 4P8RA 3DFUA 3RH0A 2M1XA 3TGPA 3CRNA 1LNZA 1LC0A 3V9AA 4MLDA 4YR7A 1EE2A 4QLBA 1DIGA 1OLOA 4WKGA 4P2BA 3Q3VA 4ZYXA 4KQ6A 3P5BA 3L4BC 2AG8A 2ERYA 2A30A 3VNBA 4RTPA 3BJIC 3TGWA 3AB8A 1U2QA 3AF4A 4V1CI 2IYXA 4W7SA 2H3EA 3NIBA 5BNWA 3ICOA 4F72A 5A5FA 1TVEA 3JWIA 1WBJB 4UHBA 4KSBA 1A4XA 1NC3A 3JATB 3EG5A 2WJGA 4TN1A 4RETA 5AXAA 1T0IA 2R44A 2HXYA 5GIOE 5SYAA 3WGIA 4FM9A 3TD6A 3GVCA 5BNTA 3QX7A 1ZH8A 1NNUA 3OTIA 1DAMA 4TMYA 3WADA 3IURA 4FDLA 3PUWA 1MZVA 3TNFA 2FW1A 2IY8A 3FCUB 3OQIB 1GUYA 2CL5A 4R2JA 2WMNB 3Q1KA 5EMLA 2PJRA 1T6ZA 2JGDA 1RW4A 1T6XA 1W87A 3KJIA 5B3AA 1L4EA 2ZJ5A 2QYHA 3CLTD 4CM4B 2CNOA 3ZCRA 2IZZA 2J7KA 2ZI6A 3VR2D 1JR6A 2Q46A 4L4YA 1M8GA 3BL8A 4LE0A 3GLFA 5K8CA 1P1KA 1HE3A 2FHPA 5HFNA 1VPTA 4KJXA 1L5HA 3WHKA 1E6UA 1U1GA 4ZN6A 1N6PA 3H05A 5IN5A 3WK4A 4KIWA 3L4JA 5E9JA 2CLCX 4OFXA 5B2FA 3HABA 4EYSA 3EWIA 1ZUWA 3QA9A 4QYMA 1DCTA 1NNEA 1KAOA 1XXHE 2IEYA 4BTEA 4ZK2A 1KZ9A 4QEKA 5IYZA 3LHIA 2OAGA 2PBZA 4YUXA 3UMMA 2QRZA 4KVGA 5DI3B 2C4NA 3IUYA 5EE3A 3H9BA 1QFYA 3GJ0A 3VH1A 4KYUA 4DIMA 4PG8A 2A3RA 1MOZA 3BRWA 4UU8A 3R8XA 3MINB 1JJAA 2W22A 4RSMA 2NU7A 1WSWA 5B1DA 1E3WB 2CWWA 3MZ0A 4IDFA 1C2YA 2YDXA 4U63A 4AO7A 4D0GA 1JHZA 1NXVA 1R66A 1SB9A 4HQ6A 4PYOA 4BNIA 4EG8A 3QFTA 4KX3A 3LRPA 3FOZA 2ODWA 1ZMTA 1A5BB 3AF6A 1T6NA 5FL7A 5I5GA 3EBLA 2BFPA 5DTQA 1JNYA 2VG8A 3UANA 1W36C 5DTJA 4ZYYA 1BNCA 2EF1A 3BXHA 1J2UA 3DT9A 3DWIA 4O2AF 1P60A 1UPCA 4G5QA 4C89A 5KNBD 4DR1B 2DTEA 1T0BA 2B1IA 4D4LA 1R4NB 1F2UB 3F74A 4YXWD 2BBSA 3M8KA 5A4KA 1R3DA 1KFBB 2A5FA 2AFVA 2JFFA 2OFWA 2ZQZA 1VE7A 4ZV4A 1RYDA 2CDNA 2VN8A 4CMAA 4AY5A 5C8YA 5JEEA 2RD2A 4KACA 4W1RA 2BMEA 1MC1A 2QPLA 2FKNA 4NZPA 3SZOA 3AJ9A 5C32A 4BMYA 2J0EA 5BY2A 4TM7A 5HW0A 1JT2A 5KYKA 1XHLA 2W5UA 3ORFA 3RVRA 4KLZA 4EI7A 1F7UA 4UHCA 4HYYA 3RRYA 2CNWA 4UCQA 1FFAA 2WWRA 5EERA 1PT7A 2VYQA 4FB4A 1OYVA 4FYHA 3NM5A 4Z2AA 5A62A 3LIPA 2BGRA 3R0VA 4KQXA 1NNI1 2GVNA 5YASA 1E3MA 2VK1A 2DF8A 3QSGA 4A9AA 2PLWA 3UMBA 2F8TA 2A35A 3KZOA 2IXFA 3QKSA 1RPJA 4ZAGA 5EVCA 4O29A 4FE4A 3R7LA 3N2GB 4KPUB 2GO1A 1M6WA 4Z4IA 2C96A 2XBMA 2JBAA 3EDRA 2P30A 4AI6A 2ZB4A 1NT2A 1QHFA 4GR5A 4GNRA 3GLKA 1I36A 1X74A 4J0HA 2R3SA 3EHDA 5DIZA 3VNRA 5AW3A 3IPAA 1ZHFA 4COKA 4ETMA 4EJSB 4FIDA 3AI1A 3EH1A 4JR0A 5K2OA 3DCYA 1WUKS 4Q37A 3PS9A 2VUUA 3N58A 5LP6A 2W2LA 4G89A 4RZSA 3WB0A 2ILTA 2XJ9A 3IT3A 4YREA 4YPFA 5DBHX 4OQNA 4TQ9A 4YYZA 5FOWA 5J2TF 2H06A 1G0NA 4YAKA 2EVWX 4W8GA 1XGKA 4P4SA 5I51A 3S81A 2QM3A 1EFAA 1C1XB 4NEQA 3TMYA 1YDWA 2X9NA 5F9HA 4ZJUA 4RESA 2AJCA 2R87A 1NJFA 3QVWA 2G1PA 2J3KA 3QZUA 1SURA 4NJOA 2GAIA 3DCNA 2EIHA 3FB4A 1P74A 3RSQA 2IYRA 2OR3A 4N47A 1WS6A 2L69A 1YCDA 1OLSA 1YBFA 2GYUA 4F2GA 4PANA 3B1FA 3OIFA 3UJ3X 2ZVDA 4I36A 1I7DA 3RS3A 1W0JA 1NE2A 3DAPA 4X93A 3QE9Y 3GLIB 3QF4B 2ZSIA 3QU5A 1G9TA 4ZMBA 1F51E 2I0FA 3VAYA 5H4GA 1ZH6A 2UZAA 4RGVA 4WBSA 5AVKA 5JPIA 1ZESA 4B3IA 4D92A 4FWTA 3KSBC 3SS9X 3RBXA 3U81A 3KQWA 1GGEA 2PUVA 2OYSA 2B8NA 4CN9A 1J20A 5HRCA 5JTTA 4CFSA 2XGMA 3JWGA 2YMMA 3FVQA 1VHLA 2GN9A 4HRYA 5IF3A 1VPWA 2D6FA 5IVKA 5U1PA 1IYZA 1KERA 1NYRA 2K2QB 2WU3A 3CO0S 4M7OA 2ASVA 2HCRA 2IXTA 1OZGA 3P32A 5HA5A 1MPXA 4EUFA 3LZCA 4PHHA 4F6LA 1J9ZA 4WL0A 2WBLC 3UKJA 2AEJA 2OUIA 3OZ7A 1XV5A 1B41A 5F9MA 4L08A 5HX7A 3CHYA 3KB1A 5K8LA 3AM5A 1CY7A 4F97A 5I7OA 1EK6A 2PKQP 5K20A 2FDCA 2OGTA 1RDFA 1XZGA 1MFPA 2HV8A 2VHXA 4HGQA 3ZGVA 2WFAA 3L4SO 2NXWA 1VZ2A 2FSPA 3INNA 3L07A 4RCYA 1BWPA 3A4IA 2ZJAA 3RVDA 4JXKA 3OJWA 4IQ4A 3FRIA 3I9V6 3FF4A 3P0JA 3O92A 3QLVC 4MV5A 2P75A 1H2AS 3L8HA 3JZFA 3QH4A 3X1DA 2F3PA 4C4ZA 2DBQA 1XLUA 3KB6A 1GO2A 4R1TA 3LWZA 2ZM5A 2QBYA 1W19A 1W88A 1LLDA 3PE4A 2JJMA 4LOHA 4LV8B 1C0KA 1FFWA 2B4QA 4PSUA 5CR9A 5IAOA 3FDZB 5JPCA 2RH4A 4BX0A 5A9TA 1WXQA 4IHJB 1U8FO 1EDEA 1NOJA 4CBVA 1H4QA 3C6XA 1ZCBA 4TXHA 1UMDA 2ZUTA 4JUIA 3HKBA 4HX5A 1S3GA 2UXCB 4RFSA 2A33A 3COSA 2WWWA 2AT1A 1W1UA 3ABRB 4JYCA 4EEKA 1K4MA 4N5IX 2ZYWX 4KXXA 3FYUA 4D9FA 2PQMA 5KTRA 1V5EA 1MEEA 3FSJX 5FTJA 2AKYA 3TB4A 2E4XA 2JGLA 2X58A 3SEAA 3WO1A 2UXDB 4KLRA 4KKXB 4MP3A 2G1AA 2VA8A 4RBNA 4LJSA 4AUKA 2K6GA 2J87A 4OHBA 3DQPA 4ALLA 2Q3BA 3HCRA 2X13A 3KL2A 3OX2A 3P71T 2CW5A 4C4RA 2XPCA 3ZWXA 3OU6A 5LQMA 3ECSA 4LVCA 2SBTA 1LV8A 2REQA 1N3BA 2YASA 1ABFA 1U7XA 2ACEA 3OIUA 4ETIA 2AZ4A 3B7GA 4QBTA 4GM4A 4LRTB 2NO9A 3KOXA 4Q16A 2P2CA 2DLNA 2Q0QA 4M0LA 5ALDA 2HZ7A 3ZUPA 1ZD5A 121PA 1XTTA 4PLZA 1I32A 1XK6A 2OTCA 4OHUA 2COUA 1PEKE 5C52B 1SBCA 1USVA 2HLPA 1Z6AA 1JQJC 2CZQA 2QSZA 1OE0A 2MWMA 4LMRA 4F2DA 4F2HA 4EKNB 3I3SR 2XMRA 2YV5A 1ZH2A 1DADA 1RAFA 2H1IA 5LU9A 3TOVA 3PNMA 4ENRA 4P35A 2REOA 3Q1LA 3HO6A 1E2NA 4G1EB 3HV2A 1FQJA 2OCDA 4XFDA 1AMUA 3GWZA 4ZU3A 3QP9A 1O57A 2FOIA 1ZRNA 1B8NA 4UU0A 1YOBA 1EZ1A 2OESA 3MGCA 1AURA 1QYVA 4RCZA 2NZWA 5DO9A 3W7BA 4CEJA 4Z1OA 1SQFA 3KZ1E 5AW4A 2HNBA 2R84A 5DOZA 5BSHA 1XKLA 1A1VA 1VLZA 3P97A 1XEFA 1Z0KA 4QFBA 2FP4A 2ZIAA 1K4KA 2FN4A 1HZJA 3A4TA 3HRIA 4GIBA 4PPFA 4J03A 4M1QA 1QNFA 2A1TR 3JWHA 3LK6A 2JKZA 3UGJA 3IH5A 1LRLA 3MGAA 1ZD1A 2WABA 5JI2E 3C5WP 2P6RA 1PW5A 1I1NA 3TEMA 3EQ2A 2YXBA 4OKNA 4QIHA 4BNJA 2EJTA 4HAOA 1B0ZA 1XCMA 2ENWA 1O7JA 3BHMA 2H2IA 3ROKA 2NVOA 4GVXA 5GMOA 1DAFA 5T4FA 1M2FA 1ZRMA 4KNWA 4JUBA 5CURA 5CPFA 2OZEA 3GL9A 3TLXA 4TTJA 5AKYA 1ZFNA 3OLQA 1LV7A 1NGSA 3I23A 4O8ZA 4QUBA 1ISMA 2ZT8A 4TWZA 1FFDA 5H59A 3DTVA 3FTDA 4I8DA 4DV6B 4ZWNA 4FK8A 5B4VA 2FSVC 3PRJA 3HBLA 5HVNA 4JOCA 2FPXA 1XRJA 3IKVA 1KDZA 4DYVA 1M6VA 3DMRA 1T1RA 3IJ5A 5DBOA 2DE0X 2XGGA 3DV0A 2I7XA 4DHWA 4X1KA 4L07A 3H19A 1ILEA 1JEYA 3HCWA 3PEYA 1M2VB 2FPIB 3N76A 4NCNA 4XR9A 1IC6A 2PWBA 5JD4A 3DFZA 3DOUA 3G8YA 3IBYA 4JT9A 2LW7A 1HRKA 4Y7DA 4KBFA 3VKVA 5B58C 4PSVA 1DEAA 5H82A 1XG5A 1VMKA 3DGFC 2QU8A 3UFXB 4BV3A 3ONNA 1G8KA 2RCNA 3CEJA 1XU7A 2JK1A 1FNSA 2GHRA 2J0SA 5AFSA 3JD0A 2O8DA 1KJ9A 3O95A 4AT1A 3TYXA 1B2RA 2VPTA 3GDOA 2NSJA 4KDCA 2CDRA 3S68A 4DJAA 2WW8A 5JBNA 2IF2A 1H2ZA 1PJRA 1V11A 4AZSA 3MCVA 1Z2OX 1X3SA 2ZSKA 5IH3A 3DR3A 3OTOB 3L49A 4TKUA 3FTPA 4JA0A 3SF8A 4J43A 3VDRA 4HX2A 1L5YA 1U28C 4P7BA 2OV8A 3T41A 4FE3A 3WLPA 1Z5UA 4E2YA 4EA7A 2MYNA 1NWHA 2XQJA 4MB2A 4UREA 1N2IA 1U3UA 3ZBQA 1OPRA 3S2ZA 2V6GA 4DSAA 2HB6A 3ZVKA 2OPHA 4YAUA 4EUHA 2P27A 3I2KA 4UFPA 3H42B 1SHKA 3W1WA 2DQZA 2P8JA 1X70A 5FBLB 2VPZA 5AM5A 3QJGA 3ODGA 3ZKAA 3MTBA 1E4EA 2WTNA 1SAYA 4KXWA 2A84A 3OETA 3MYYA 4IFBA 4PLGA 4TRNA 3RUEA 4DEVA 1M33A 1NG9A 2XYRA 1TGVA 3RSZA 2WHPB 4HOYA 4IQ8A 1EIWA 1DEKA 4ESVA 4U4AA 2FPGA 1ZN2A 4BDSA 1TC1A 3RC3A 2AC2A 1N2CA 1U7UA 4PRKA 1TFUA 1TM5E 3B2NA 4XWGA 4MULA 5CG1A 6YASA 1XMJA 3PHCA 3GUUA 3UAVA 6AT1A 4GWKA 3BUSA 1TZKA 1EB9A 1HDYA 1ZXXA 4C0JA 1DC7A 1QCDA 1QIGA 1BH2A 4FMBB 5TEWA 3TCNA 4J6FA 3ZY5A 2AC4A 2I99A 2J59A 2X40A 1XDGA 4DNPA 1H69A 4EATA 1CUVA 1P3DA 1SY7A 3K1YA 5HE8A 2JFXA 5L3RA 4AW9A 4MOWA 1FUYB 2YQ4A 4RJIA 5IJ9B 1AXEA 2GN0A 1WX1A 1ZUNA 5JY1A 1GGVA 3L7CA 5JZ9A 4Y2YA 3G6KA 3A3NA 2RC6A 1Z5WA 1I9CA 1DTSA 1WCIB 1X1RA 2XMPA 3EFEA 3G5AA 4FOTA 1E3QA 4HEJA 2A0FA 4XR4A 3RAJA 3TCXB 2GVZC 3EDQA 3K0HA 5TQ0B 4HC4A 1IEWA 2GPJA 3K0SA 1IXKA 2WR8A 4IIVA 5LC1A 3VNUA 1DOAA 5L4LA 2XQFA 1SIBE 5KZMB 2I4LA 1K0UA 4FLMA 5DYWA 5C4GB 1F8GA 4P84A 3KL4A 1SIUA 4POAA 5LCXA 4M1TA 1LLFA 2CJWA 7YASA 1LPPA 3CF0A 3F6CA 3OQOA 5JSQA 1NVVR 2HFJA 3SJAA 1NXXA 5BSRA 4GPAA 3TL3A 5KVCA 4A82A 2BR5A 3ZHYA 4BBJA 1KYYA 2W2KB 4I8IA 3UC5A 2A58A 5L7WA 1E2GA 2UYQA 4PIMA 4CXMA 4GSKA 5MN6A 2FPPA 5AXCA 4EPRA 4XCXA 1WLYA 1QGED 1AK2A 1WB6A 1Z22A 2QVCA 3CIFA 1CY2A 1YH3A 4ISBA 4JBLA 4X61A 1V7PC 4D26A 3CRW1 3BK1A 3FYDA 5AVTA 1L5MA 1M2EA 1OLXA 1QHEA 1GXSA 2CVFA 2H63A 1AS0A 4Q82A 3KXKA 1G63A 3T9BA 4U2BA 5E1MA 2IZ6A 4L7VA 1M0TA 4OMUA 5C8VA 1R16A 1Y98A 2VEOA 5K8IA 3T4EA 1W1IA 3LDFA 3DW1X 3QGMA 2RKWA 3CUSA 2JPDA 2ZYDA 1AKQA 1RABA 1GEEA 2BFNA 2A88A 4MA5A 3SZLA 2P9BA 3X2EA 1YSCA 5MN5A 1CR4A 1EVEA 1TGYA 3ORQA 3AF0A 3LPDA 3JXEA 1IJKA 2C4HA 4OH1A 2VLBA 4BN4A 2XEXA 1NM5A 3PC4A 1FX1A 2ZBGA 2C0QA 3KSDO 3OEED 1HYHA 1LFAA 4GEGA 4MW9A 2IWHA 4BO5A 4MUKA 3P0IA 3IRUA 3TQOA 5LQJA 2YRXA 3ANMA 1U2RA 1DO2A 1OR8A 1I80A 4UZFA 1W75A 3HUEA 1RRCA 2PLRA 4FOSA 4P9NA 1OLUA 4DR5B 3A1NA 5TR9A 2Z58A 4LDZA 4NLLA 5FTMA 2UUCB 1U8UA 1VKNA 4D4IA 1TA0A 1ZJZA 1GZUA 1KWKA 2E4VA 2QM0A 1YS9A 2Q5CA 4YJ2A 4U7HA 2NADA 3AJEA 2JFGA 4LWPA 7AT1A 3LA8A 2EP7A 1K2VN 1XRMA 4FCWA 4IP0A 4RHXA 5AR1A 5KTOA 5F5XA 4I50A 3L7DA 1MQSA 1SZJG 4EVSA 3V1UA 4C6TB 1UODA 4HQNA 3M5PA 1SVOA 1MQ9A 2X1HA 1IM5A 2WIBA 1GN9A 1VL8A 1Q83A 2TRSB 2W8ZA 1FRZA 2Y0BA 1VG0B 3GV0A 3RVJA 3TL6A 5FF9A 4EY6A 2VHQA 4GOXA 4NR0A 1JI3A 2J5XA 3BGSA 1C3XA 3GFFA 2KLBA 2KE5A 1PL0A 4JLUA 4RH1A 1ZIYA 1UZNA 3QUTA 3TTYA 4E09A 4Q47A 3ZHBA 2JLZA 2JL1A 1GNVA 3G7SA 5DTMA 5E4FA 1EHIA 5A1TA 1U3DA 2AK3A 2C88A 2PKRA 3F7NA 1U1EA 4OVKA 4XRRA 3VHRA 4CTJA 4CIYA 4B40A 3K9BA 2PL3A 1T0PA 4D7AA 5E3JA 5CD1A 1O9GA 1XRQA 4QWMA 4RLFA 3S2IA 4V3CA 5EAIA 2PO7A 4JUDX 2H1HA 2P91A 3FFTA 2X3YA 4YJGA 4TT8A 4BMCA 1P4AA 5FNVA 3FMGA 2HDNB 3GZTB 3BIJA 3O1HB 2D4HA 4KR3A 1F6DA 1V9CA 2G9UA 3KUXA 1JZTA 2AV6A 2MR5A 3G88A 1XLTC 3DTNA 2BUCA 4G0YA 4ON9A 1VL1A 4RK1A 5ALGA 1JJVA 1JJBA 4OI2A 2Z5LA 1GT91 1YZKA 3A6EA 3LVQE 4Q1FA 2IP2A 1SUPA 1L8QA 3VMMA 1UFKA 2OFFA 3WKEA 4CMKA 3COJA 1QC5B 3CNQS 3W05A 3ZXYA 2WFZA 3NHUA 4X3PA 1NXTA 1TQ6A 3EX7C 5JD5A 4E51A 3CT4A 5CFLA 3PICA 4RMIA 3NRCA 2Q3HA 3G68A 2CBXA 4KK3A 4E1VA 1BGWA 2XUFA 4OSPA 3GA0A 3P9RA 3N0TA 1IULA 1GG5A 3JALB 4K2AA 4RGYA 4XD7D 1E0JA 3DAFA 5JMPA 2NUAB 3W1VA 1F12A 3STVA 1P8JA 5EHZA 1BCSB 1J00A 2A14A 2AX3A 3UKOA 4EJFA 1HX7A 1L4KA 5ECDA 3SX2A 3AI2A 4FFRA 3FYSA 1B0PA 3NFRA 3JZDA 1FEZA 3F7TA 4BNXA 4I9UA 1QBGA 1X7HA 4FSXA 4POOA 1U02A 1KF0A 5FFNA 1G4AE 2Z1NA 3S2SA 2I1VB 1WXWA 3ZKWB 1GGKA 2X23A 3SSMA 5CT4A 2E4ZA 2WNHA 5KYUA 3IFSA 2IOFA 3PIDA 4LJKA 3WAJA 5FOVA 3MCTA 3MJRA 3B5JA 2IH5A 5CT6A 1VMAA 4X1OA 3VX4A 1SWWA 4PN7A 4HWPA 4BAZA 1GYQA 2H6EA 3KOOA 4QU8A 5J43A 2F43B 3HLTA 4M22A 3RVQA 1BYUA 4C0AC 1V2GA 4GVPA 3TJZA 3R0QA 1U3FA 2AG1A 5AKJA 4NK5A 3FCEA 4P92A 4UMFA 1SUDA 4LV5B 5KTTA 4AMBA 1E18A 3IIJA 2VRBA 3OAAA 1UEXC 1ZPDA 2IHJA 3JQBC 2R65A 2QGFA 1MO6A 1EVYA 1ULHA 1Z6XA 3CNBA 2ZE8A 1VKHA 3RUDA 4XRGA 2W6CX 4JFRA 4OXKA 3UJNA 4M36A 2C8KA 4RY9A 4YT8A 4CV0A 4RXMA 1OC2A 4PONA 1XHEA 5D86A 1PWXA 1VOTA 3GZNA 3ZCVA 1B6GA 1ZNYA 2AG0A 1UQUA 4KQGA 1JLMA 4LXGA 4NYMR 4TLBA 3T5MA 1JEAA 2BGMA 2XLCA 5I8WA 2AG5A 2PSHA 2YVLA 3EW9A 1OGYA 1FYDA 5DTEA 5K3SA 1YJAA 1KDOA 2OHXA 4B3BA 2F9FA 4IGKA 1Z35A 1O03A 4LF9B 2BR4A 4MQEB 5E8RA 3L1UA 1Y6JA 3F6EX 1AKEA 3PQ5A 1R0WA 1K8XB 2FXIA 4P4LA 3AI3A 4GICA 3W6NA 3PQDA 1HM5A 1I3OA 1J5XA 3WKCA 4BRSA 4BV9A 4WXRA 1AN0A 2C58A 3UHOA 1QPBA 3LVBA 5K8JB 3MUFA 1GILA 2Z56A 3EXAA 1WXIA 1YJCA 3VUFA 1E79D 4XB2A 2ZR9A 1U7TA 2ZRLA 1CUFA 1XP8A 1TCBA 2J4FA 3L1JA 1JUDA 4QPNA 4BGEA 1MABB 2UVPA 1X7DA 5JCXA 2CF6A 3K5HA 1FQOA 3E7FA 2AVNA 3ZCXA 4FHFA 1TUEA 5EMKA 1L7RA 5EXDA 1E6EA 3C4QA 3V7NA 3N6RA 3W78A 1NJ5A 4RQUA 2ZRGA 5TPZD 5HIAA 4GXTA 5JNLA 4W5TA 5LLSA 3RVOA 4H60A 1EXMA 3B60A 4GOOD 4TUYA 4UEJA 2B4AA 3MELA 1PVDA 2JLYA 2WG0A 3STHA 1ETHA 4KFSA 2PUGA 1NW6A 3B1JA 2JHGA 3TLJA 4BX9A 2I62A 1T3GA 2C82A 5B1SA 4F7WA 2HWUA 3UCFA 3BSFA 1QKIA 4JGGA 1SC4A 3KVNA 3OM0A 1QMGA 2HT6A 3E27A 4F71A 3HDHA 1KAHA 1RJWA 2B4RO 3PQ8A 3Q8XB 3G2OA 5LJIA 3NNDA 3AVVA 3KE9A 3O2NA 4URWR 5E38A 3WA7A 5C7LO 3AKZA 4W5WA 3AVPA 4MGKR 3EIXA 4PLWA 3HTXA 3NUZA 3Q9UA 1XCLA 2PBLA 2ZCUA 5FOTA 3IIEA 2ZVQX 2X0IA 1OH8A 2IEIA 4R51A 3LW7A 3TTSA 1XFAA 2I2DA 1EHYA 2OK7A 3DVAA 3FIUA 4UFNA 4RHTA 5B37A 4YJKA 2VDWB 3S1AB 3TQSA 4AWBA 2PRKA 2WF8A 1N2EA 4UM8B 1JA0A 4E88A 3IQGX 2XE7A 1GPKA 1ZP6A 3G2PA 1RR6A 3QOWA 1K4YA 5DX0A 4HZIA 4EB8A 4REMA 1YR3A 2IT1A 1ZONA 2A2ZA 3OQIA 4J76A 4XQCA 1K98A 3C48A 3RHZA 1CT9A 2FAXA 4RLSA 2O2HA 3NDPA 2C8VA 1S6YA 3NEAA 4MRAA 4D98A 1ATZA 1TL7C 3P2MA 1W9HA 4JJIA 3VX3A 1FP6A 1GKUB 2XTMA 3I4CA 4Q9AA 4R69A 2Z6QA 2VYFA 2AI3A 4R8KA 4R31A 5IASA 1SXJB 4A6DA 3WC4A 2FHSA 2PM8A 2FZLA 3KVVA 5EIOA 2O3TA 3F3YA 4CL0A 1PGPA 4X45A 1S8OA 4WECA 5D1HA 3RIGA 1K8YB 1KSHA 1I5OA 1TYAE 3K0EA 5I6DA 4JI8B 3GOHA 5BO5A 3FMPB 2B69A 2FSSA 1KFEB 1TMGE 2O7SA 3NFYA 1E1KA 2NNWB 1TK2A 5ALYA 3WK8A 1QVRA 2G9VA 3D6VA 4BUJA 3T3IA 4DLKA 2ZPTX 4A8TA 1TF7A 2TMKA 2G36A 3FMVA 5JS6A 3HCDA 2GZHA 4HXFB 1AZSC 4P58A 3UEOA 1JLHA 1SXJE 1NVFA 3OG9A 3T35A 3ZLVA 4ED9A 1RE1A 3GQBB 3EEYA 1RSZA 1P0FA 3FNGA 1QUFA 1Q84A 2C54A 3JQPA 2NTVA 4MPTA 1QGDA 4XTCS 1DQSA 2RHWA 3HP4A 3QOFA 5HCIA 4EEZA 3MTJA 3V7UA 2OWEA 5E3HA 3A2NA 5JALA 4HDAA 3LCRA 1JJ7A 3H9QA 3ADOA 1USWA 1CB7A 3DOFA 1ZI8A 1D1TA 3BF8A 4N0PA 5E6UA 4CMCA 5E4TA 4INPA 1JHYA 2FMFA 3TD2A 2WI8A 1U2ZA 1NSYA 1W96A 4HUQB 4IIXA 1Y37A 4YH1A 4CCWA 4LUCA 4NJEB 3BXXA 4IIHA 3TVYA 1S8FA 3TWOA 4DWJA 1XMXA 4ES6A 1NJ8A 3WGZA 1WPGA 5G1OA 4L50A 3UBMA 4EHDA 2QVGA 3DNMA 1TRHA 5FOQA 2Q29A 4XPIB 1AKVA 2OXRA 1NPDA 3RSCA 2M32A 2DTXA 4AS2A 1AZWA 1ZCJA 3ZQJA 1JQ5A 3UXYA 2QN3A 5JO9A 4R1OA 2RGRA 4GYKA 4YT5A 4LX8A 4PBSA 1DX6A 3B6ZA 4ECEA 1RCUA 5EJ6A 2OBNA 2I6SA 3EXHC 1NQUA 2P6OA 2GT1A 4UNPA 4WZBA 5BXQC 2FZWA 2HH9A 3GR6A 2VT2A 3T9AA 2BYTA 2IXBA 3L8YA 1I6LA 4C88A 3F49S 3QBTA 3QVJA 1R6XA 3I4LA 4M9CA 2HUNA 2YJ6A 1A8QA 2H4JA 5TGDA 1OSNA 1C8VB 1DT3A 2APJA 3FPFA 1KEZA 1Y48E 1SCDA 3EULA 3E18A 4Q48A 4R0NA 4YFYA 3TI9A 2HDWA 5DHTA 3NQ41 3F97A 4D9NA 1A1SA 2VAMA 4TWBA 5CDUA 2J0UA 4UVHA 1T5BA 1Z75A 4E4YA 4UHJA 5BSTA 5BV7A 2XZPA 3N2ZB 1RQLA 4Y2XA 3T5PA 2KPOA 3QV2A 1JQEA 1Z74A 3SK0A 5LYJF 1KJIA 5KJ1A 4JP8A 4F6RB 2GPWA 3TS1A 3ZU4A 1U9IC 3FI0A 3FI9A 1LJUA 4B3FX 1X1AA 2W6JA 2CLEB 3RVSA 1NUTA 3N1UA 3SJ7A 4RA9A 1V47A 1XXLA 4EKGA 1H2RS 3GO4A 4D4JA 2LIVA 2CB0A 3X1XA 1T15A 4YCCA 4C4TA 1KVRA 3LKBA 4AMVA 1Z63A 1Z5VA 3CMCO 1UJ6A 2C99A 3N8GA 4LSWA 5EHNA 4JDUA 4J4BA 5JNVA 3UJ7A 4DYHA 2FRXA 4B7AA 1EVKA 3QG1A 4BZXA 5B6PA 3NXKA 5DRYA 4BMPB 5K3FA 4Q39A 5A04A 3C3AA 5SY9A 3PXBA 2WF7A 3L01A 1XD8A 3IIMA 5K0ZA 4BZZA 2J9GA 1ADFA 3FUCA 3LGAA 3E8XA 4PIVA 2DYKA 2FUNB 3ETGA 4GHWA 4ZZ2A 3RIHA 3STYA 5J4VA 3OKFA 4RENA 3TAXA 2QP9X 2VZLA 2VDLB 4C4OA 1B8PA 4QM7A 3QFRA 1E66A 1RYYA 3CNNA 4WSOA 5AM2A 2A78A 1DRWA 2VNIA 4LCEA 4XJTA 3IS3A 1GTZA 3KOZA 3WLFA 5I7FA 1CEXA 1W93A 4B82A 1XXHB 4V39A 3G79A 4DRXB 1ZL0A 3GWGA 1RYFA 3PCXA 3WNZA 2RGUA 9ABPA 1P4RA 2OGWA 3ZEIA 4IKPA 4AK9A 2CZCA 1I13A 1E89A 2GSWA 4FQ7A 2CV2A 4FPXA 4S24A 1B16A 2CSUA 4G9GA 5I3ZA 4YUAA 5AVWA 3HJGA 2Q6KA 2IPOA 2XZLA 2G09A 1O89A 2JGFA 1QH9A 1YZTA 1GNPA 3BGVA 5E0KB 3GD5A 2AJLI 3A1TA 3W3AA 2KI5A 3GLSA 5HOQA 1PEAA 1QB7A 3JASA 3VI3B 2CUKA 4WUVA 2EBHX 3UIEA 1PZFA 1F2VA 1YXMA 5CW2A 2QTTA 4UBIA 3WSTA 1COZA 4S1PA 1J2TA 4OXYA 3EH2A 3EWNA 2QW8A 2QRNA 2XNDA 4XPZA 2QBYB 3KQPA 3AFNA 1GRVA 1LS1A 2Z8YM 3F4KA 4WOKA 3DUFA 3PT5A 1QAMA 4JJKA 3ZHCA 1CP3A 3CYFA 1WMDA 2Z4RA 3JQ6A 3OF3A 2Y92A 4JB8A 2P0YA 1SU4A 2PKYX 5ERGB 3KM0A 3DO8A 1Q17A 2WKQA 4GLFA 3UC9A 9LDTA 4Q34A 3T5DA 1AJEA 5EQJB 1QFZA 2IUYA 1L7BA 5ES3A 5KTYA 4BNWA 3OKPA 3KQTA 1YDMA 4MQFB 3R7WB 1CUEA 1UFQA 1O8BA 2B7BA 3HNOA 3CF4A 1JHUA 2VXBA 3GP3A 4QRIA 4ZVKA 3RLFA 1DDGA 3GT4A 3QKUA 4WPGA 1LK0A 1X7ZB 2NZYA 3OIGA 3OOJA 4FT4A 4JENA 4EQZA 3PFIA 1TYBE 3NORA 4KU4A 4WVLA 3QE2A 4NOMA 4BEJA 1QYIA 5ALWA 4C7OA 1PTJC 1YZQA 3GDGA 4N0EA 3DE6X 1JDTA 2L82A 1N6OA 1XL0A 5JFGA 1UXGA 3QYJA 5B1HA 3HG7A 1VSVA 2QJFA 2VUIB 2OO3A 2CC2A 2ZRQA 1SVIA 4MWTA 4EA8A 5FBVB 4DJDC 3S2EA 2B5OA 3LP5A 4QSMA 2EDCA 5IUKC 1J8QA 3QKRA 4GC9A 4ZQHA 2VHZA 1NR5A 4P4NA 3ZVMA 3L7OA 3N6VA 2B4YA 4QBKA 5EZYA 1TDJA 1ORWA 1Z2PX 4DJFC 4E5VA 3T5GA 1DC6A 3H2JA 3H2ZA 5AVQA 4FYYA 3HV0A 3FUUA 4A2WA 2XCRB 3FNFA 5HKAA 4AF6A 3I73A 3PGMA 4XWTA 3O21A 2XB2A 4IHJF 4B31A 3H2KA 2O20A 2NSYA 4WK0B 3ZI4A 2B1RA 1O95D 1QM5A 7ADHA 3NC4A 3PJFA 3AFHA 5IC4A 2VSFA 4GWGA 1P9OA 3ABOB 5I01A 3UWDA 4L0QA 4G37A 5D6OA 2CWDA 4MA0A 2X3UA 4IGFA 4BNVA 3ZV6A 3RBVA 1WZUA 5TARA 2RHJA 4HVAA 3SMVA 4M86A 1TM4E 3DM9B 3PF8A 1G21B 5FLYA 2YNMC 3N8NA 3WHLA 3UAOA 4N8DA 3HYRA 1NL3A 4RPJA 1VMIA 4EP1A 3GRZA 4YPOA 5KJFA 3FPSA 3JTEA 2MINA 1BH6A 1RADA 2OHJA 3HKEB 3P96A 4U1RA 4XD2A 3KCNA 1I94B 4FUTA 3MB8A 2JLWA 4C01A 1OFUA 1O94D 1WA5A 3N9IA 3BGDA 4JWTA 2BFWA 2HHJA 2G4LA 2MDTA 3AYXB 2P67A 5JY6A 1AE1A 1KMIY 4R8LA 4UOQA 2FEKA 3GPIA 3QWHA 3GBPA 3GFGA 3I9JA 4EGSA 1E9RA 2B37A 3STTA 1JQLB 4Z4QA 4WGFA 1BG6A 1BU5A 3HJBA 4L3OA 4QPJC 1Z4JA 4YO7A 4ZREA 3ONFA 5KYVA 5LA6F 2BE7A 4BVKA 2PPLA 5H4HA 2WNSA 1C30A 5CT8A 2RHLA 3RHTA 5IWAB 3D7MA 4RM2A 4X5OA 4Y2SA 1Y8AA 1KO7A 2I2BA 4NZ9A 3DTVB 1KJ8A 4BTVA 1C3VA 2ZUFA 3KYDA 3I45A 2YMLA 3EVGA 4IEIA 2HK7A 3NT2A 2IOFK 1QFSA 1Q7GA 1I24A 1GPUA 2EOAA 4B76A 4CFYA 5F7XA 4JUFA 3K2IA 3OOHA 1N8NA 2YWGA 1T2VA 1W47A 3N5KA 1QVWA 4IUBS 1N6HA 4EW3A 2QRHA 4X90A 1GFSA 3UV3A 2FZ4A 1UXOA 4G5GA 4V0NA 2AFIB 3RLIA 2BEUA 1M76A 3VTZA 1ORDA 1I2MA 3DEIA 5DBFA 3UK1A 4TVKA 3GJ3A 2E5LB 2B4KA 4RA6B 3PP8A 4PNPA 4G84A 3LC2O 2GXSA 3P0HA 2JJYA 5DP2A 2ODAA 1F8UA 4QUAA 1XVLA 1TCVA 5K5EA 2C5SA 4TV9A 4B6SA 4L8GA 5L45A 4MIKA 5EZ5A 5J2UB 2I2FA 1QMPA 5LM3A 1OGIA 1L4HA 3PA6A 4QYIB 4BOYA 5IZ4A 3K6SB 1DNPA 1OMOA 5IVHA 3WDSA 4L8VA 2QTMA 4Q24A 5G02A 1YIDA 4MRPA 4QJIA 4BLVA 4DCPA 1FNNA 4LYHA 3RU9A 4ASUA 4CU2A 1YQXA 2CL0X 3RYIA 5CDHA 1WMEA 1T1SA 5JJIA 1KBQA 4LKOA 4WNIA 4B6FA 2PL9A 3U7QA 1SD1A 4K6GA 1FP2A 3AIOA 4P5DA 3T34A 4V2IA 1MN6A 3C6MA 3TRIA 4B4VA 2A59A 1SU8A 3M5CA 4OGWA 2H0QA 1EXVA 3BFPA 1A9XA 4M8IA 4X54A 3HXPA 1YWGO 2DQKA 1JDBC 1T9DA 3QXXA 1KAEA 1X39A 5B53A 1QIMA 2PVSA 3U9SA 1Q92A 2XMZA 1NIPA 3PL1A 4GC5A 2PZJA 4HTFA 4RJTA 1Q2XA 2AE2A 1KQ3A 4FJ0A 4U7TB 4UU1A 3CG4A 5AXBA 4BRUA 4ZDIA 5EPEA 3TLEA 4NMMA 4NH0A 2C2GA 3L92A 5IKOA 3VAAA 2AJDA 1YVUA 1P9LA 3P9KA 3V1NA 5KQGA 4GM0A 4J94A 4QDJA 5AUOB 5LOVF 1ANKA 2FEOA 3DF7A 5FPYA 1L8OA 1EFKA 1ZVJA 3HI6A 3WYDA 1F0NA 1QRSA 3IP1A 4QUDA 1GR1A 2GA9A 3LT1A 4N5MA 2JFUA 4PGFA 4OA5A 3WK6A 4Z4GA 2J67A 4MW5A 4N9QA 4I8XA 4EDFA 1JMVA 1OWNA 4YROA 4B84A 2XKAA 1KY3A 2QUKA 5KQSA 4HH4A 3V1MA 1KFKB 3U9TA 3C4VA 4AUMA 5IJ9A 2D5CA 3IIKA 3ZE1B 1BN6A 1YRLA 3OP1A 1MGOA 2W6PA 2X19A 4H7JA 4IVQA 4PHGA 5AKZA 3ZVLA 1MXFA 1O96B 4UTVA 3SNHA 5GPBA 3TM5A 3SKXA 5KJCA 2KB0A 2PUWA 1M34A 1QBKC 5AVXA 2FZCA 2B99A 3H13A 421PA 4EMBA 1HWYA 1Q12A 2HPHA 2P9EA 2V55B 1AUXA 1TYDE 2VSXA 3W9YA 4AMGA 3F6PA 5IJZA 4G0MA 4RD0A 3L0CA 2JATA 1MVOA 4HEA1 2Z4TA 1CU1A 4Q7EA 2V1XA 4RZQA 4JJEA 1M1UA 1QQ5A 4HB3A 5LKRA 3VISA 1YACA 1JMKC 2IVZA 4FGKA 5DDIP 2IOHA 2XBLA 4N8EA 5EPOA 4CLEA 2NSLA 1P91A 4RW0A 1PZNA 5AM1A 4Y9DA 5FOUA 2YZ7A 1PJTA 1YQDA 4QPZA 4KO8A 4I4TF 1AG9A 3LC0A 4JVLA 1NUQA 1W6UA 1G2OA 3BMNA 3EBOA 4QULA 3ITKA 2QR2A 4MWOA 3LY9A 3ZHRA 4CT0A 2V5UA 4PNZA 3UTCA 2CFCA 1WKBA 2CMFA 3WY9A 5GTDA 5AVSA 1K5HA 4S04A 3T7JA 4ZQEA 1XOIA 1XJCA 1XZNA 1N2CE 4D9CA 4CIXA 1ULTA 2NIPA 2PTGA 2R00C 3RVBA 2PGLA 1Z45A 3AJAA 4GYWA 3ZZMA 4DA8A 3AKYA 3K0CA 4M7PA 4I3HA 1NI3A 1XA4A 2PT5A 4F56A 3P8ZA 5IKMA 5L9AA 1L4YA 3MWKA 2X6TA 3KAKA 4CG3A 5M29A 2YS6A 1JEOA 2XXBA 5LB2A 4AL4A 4FLEA 4DUZB 1XDZA 4WA7A 3TLYA 5D3MB 4CR6A 2WAMA 2MIIA 1II8B 4WINA 3IUPA 1F9EA 4PLHA 4F3KA 2AF3C 5IZCA 4IUYA 4DADA 1PRYA 1R37A 4JQSA 1H3NA 4YJFB 3SQWA 1ECLA 3KR2A 4CF5A 2CLMB 4KQ2A 1S2OA 4DDKA 1R6TA 5CVVA 3K0AB 5EWMA 4KUHA 3PENA 4U6NA 4ILKA 1T2FA 4ND8A 3AKDA 4MROA 1XRNA 3LLMA 3D4BA 2JH8A 4FW8A 1QGOA 3M6IA 5TGTA 4B4KA 4RS3A 3EMBA 4YRPA 3G82C 4WHMA 5FO0A 4CTNA 4DWVA 2HUPA 1KS2A 2J3IA 2J9FB 3NTUA 4RK0A 2IIQA 2IVFA 3DEJA 5DHSA 1G7RA 3GRRA 1PFWA 3LBHA 3VQTA 4N3CA 2QXUA 2XSZA 3IPXA 1PT8A 3U3OA 3WSVA 3DULA 4J0JA 1V48A 4M55A 3FMFA 5AHXA 1KEEA 3T54A 3F98A 3HB5X 2WSMA 2PTHA 4K9SA 1C3EA 2XNCA 4UMDA 1NW7A 3TECE 1I7NA 3K6JA 4LOJA 3ZTWA 4OHMA 5LR6A 5A1JA 2JCSA 1X92A 4IJUA 4BCDA 4JBIA 1XVVA 5CUQA 2V9ZA 2IHTA 4UUQA 2G6TA 2MYPA 2ZXUA 2PFKA 3HN2A 3PXEA 1OVMA 1SIOA 3KU4A 3JAKB 4QODA 3GX1A 5IK2A 1K8RA 2XAAA 1LX7A 3ZE9A 4RTQA 2I2CA 3P5SA 4LISA 4LRXA 3I42A 1YS7A 3EFOA 1CF9A 1M8FA 4J9UE 2AN1A 5BWCA 6NULA 4PO8A 5EHIA 3THSA 4FMDB 5H83A 1T8TA 2VBFA 2ODEA 5F5NA 2QD3A 5I4KA 3PWZA 5DN9A 3WK7A 3I30X 3OPQA 3S7TA 1IHXA 1Q6ZA 3GYGA 3FZEA 4UAGA 5TT0A 5LWHA 1H4SA 4DIFA 3LUCA 4ZDKA 3M82A 1GCOA 1JDJA 4WOPA 4I4TB 3RS2A 1RP1A 5BWBA 1CQXA 2I7TA 2IOQA 1JFFB 3QV1A 1QGUA 2NVUA 3VNQA 3C43A 1MV8A 3NB0A 1Y3HA 4G0UA 5ITSA 2XE8A 3IYLW 4J0GA 4LJRA 4HNSA 2WSSD 3OF5A 1GKIA 1E2KA 1K7SN 5CB4B 2IYWA 2BM1A 5JFOA 5BT8A 4D9MA 3AF3A 3N86A 1SPXA 2PZAA 4GVLA 1TU0A 1TM2A 2BKUA 3AU8A 3KDPA 2A9VA 4RANA 2VQFB 4DV5B 3K0BA 4NS1A 4U6SA 1P2VA 2FR0A 5E6RB 3VO1A 4D46A 1YA6A 1MVNA 2R8ZA 1Z7BA 4A0RA 5EXEA 2W4QA 3Q3JB 4Q12A 2Z5GA 1H4TA 2PL5A 3ON5A 4NS4A 1CRQA 3V55A 1EFVB 4NYJR 1GRCA 5F33A 3W3ZB 1P31A 1KMHB 1W0JD 2CHVA 1DAHA 2FR1A 5T3UA 5F2EA 4J0IA 1OFGA 3RWOA 1EB8A 4N54A 2PSJA 2NO7A 3DXYA 3HFRA 2X76A 3ETCA 2VDMB 2VAXA 3V6LA 1NZFA 5AHOA 2PN1A 2JLAA 1UAGA 2V7GA 2LGJA 3D9QX 4LBVA 1AF7A 3LUFA 1C7QA 1H2BA 1MX5A 3JV7A 4J4HA 4ZOQI 2VCEA 1OXTA 1VIYA 2JHFA 1TVMA 5ULLA 4BLQA 4C06A 3TRJA 4HEA6 3ZE8A 4QU0A 4MTCA 1HORA 3T6KA 1N6RA 2J41A 4LXTA 4OH7A 3EWAA 1F2UA 4RNDB 3WLAA 1UP6A 5IMSA 1E5TA 1VM6A 5LBTA 5TIIA 2Q0SA 4YRGA 3I52A 4XSHA 1JS1X 2PG3A 3N39C 3GAZA 4L8YA 4K9NA 4B4UA 4I6GA 5KQLA 3QW4B 4B0OA 4L4XA 1K5PA 1PYGA 4HZUB 2EU8A 3G0GA 3HB0A 2DKNA 3INTA 1GA6A 4M1WA 1FJGB 1JB9A 3UM9A 1QRUA 4BC0A 3KR9A 3RNOA 1QG0A 1JR2A 4MRMB 1HOXA 5K0NA 3K6KA 2R751 5HE9A 3TFOA 1GTMA 4WA8A 5DH9A 2YHAA 5GGXA 3WLRA 3VZQA 4OUDB 3UYLA 3NHMA 4AO6A 5MGBA 1GTRA 2ADMA 1RKVA 3LCJA 3E5MA 4CGYA 2Q4DA 4YGXB 4N82A 2J5BA 3LT2A 4Q5IA 1TZMA 4UD2A 3RVLA 4BY9E 4IH1A 2N3ZA 3K32A 3LM8A 2XIJA 1XLTA 2JBAB 4B5KA 2GD2A 3V8EA 3PWTA 4H7IA 5KMGB 5KO2A 4FINA 1WY7A 4OB6A 3QY0A 3JAMA 3D7SA 4B8ZA 2QMOA 3E61A 3Q5GA 4DLTA 5EESA 1I3MA 3CFYA 1CW2B 1RQXA 4PE5B 1BXGA 2C95A 3FCYA 1SHUX 4Y0AA 3IDFA 5CNKA 3PU6A 1Y1SA 2BDUA 4IHQA 1XPRA 5HS4A 2HXSA 5FI0B 1RTTA 2DM6A 3O2QB 3ONWA 4G1UC 4IQFA 3S4YA 4IR7A 3W3AH 2Z6VA 3HZZA 3O8QA 3H11B 3DOHA 3IVGA 3GCXA 1ADGA 3QWBA 2HRZA 3BDIA 3R3ZA 1UKYA 4X7BA 3M1LA 3B1VA 4GPEA 4NU8X 3VSEA 3OX4A 5HGJA 3AP3A 3M9WA 3M33A 4LEIA 3T99A 2GXUA 2IBMA 2P9ZA 1XNQB 3JW8A 3REFA 1KSFX 5CJPA 3U4GA 1QYRA 2WSYB 3SMQA 2CFIA 2DVMA 2WJHA 3QLUA 1CDEA 3AG5A 4MSUA 3QBDA 2ZM6B 1IXYA 1G2PA 1NXWA 3MMPA 4PSCA 1B8OA 2E1RA 3DDUA 1YFKA 2WJWA 1ENPA 4RFLA 3T3GA 2O3RA 3RC8A 1ITZA 1XTKA 4D9EA 2NPFA 5HM6A 3SOPA 4OK5A 5AOAA 3U26A 4LSMA 3BRQA 1ZMRA 5JZVA 2BW0A 4BLWA 3PDIA 4O4LB 4N0MA 2HDHA 3JWJA 1B2LA 1G7SA 3JQBA 3QE3A 3C3BA 3QIAA 4DUGA 5BURA 5JWOA 1T4DA 2Y1KA 4PCVA 4PO9A 1FNCA 1QR6A 2EW8A 3IP3A 4Q00A 1B3RA 3CTMA 1EH5A 3O1JC 4QLAA 3NRJA 3DMTC 4FYXA 4E21A 4F8YA 5DNUA 4Y98A 3E9RA 1M1YA 4CV2A 1PDOA 2ZIWB 2WDPA 1Y3FE 4M46A 5CXSA 1EX1A 4DPKA 4E2ZA 1OCEA 4C3OB 4K6KA 3E1KA 5IABA 4YECA 1KVQA 4PZZA 3GUZA 2XQGA 4RAQA 2OC4A 4EHNA 2O3QA 2V6JA 5LFAA 2GZ2A 2GXQA 3HWRA 3ML1A 1B6RA 3RC9A 2ZYTX 1L1EA 1WBBA 1N57A 1Q1NA 1JA1A 1FMLA 1EFRD 1GPH1 2FY8A 1YOVB 1BVYF 3DJYA 3LLCA 3OEWA 5TF4A 4C0LA 1RVDA 4F2PA 2IEZA 1EFCA 1QHNA 1QUEA 1Z07A 1V4NA 1IWPB 2Y2UA 2YJ5A 4MYTA 4MWBA 4EJ6A 3AVYA 3I92A 3DB1A 4G2TA 3UT5B 3WLNA 3UUFA 1I0LA 3WLJA 4BX3A 4FJ1A 4LSZA 3VYRB 3C7CB 2ANBA 3H99A 1T9KA 4F93B 4P4GA 3IJRA 3CR3C 3LPLA 4N3BA 2FR8A 4UEQA 1J22A 3KXIA 4EO9A 4Z5XA 3PKJA 1GPNA 2LD4A 4A2PA 5JC1A 1SQSA 3EEIA 3TE7A 1JFTA 1YVEI 4TL8A 5CX4A 4RABA 4DRYA 1JJIA 4ZYTA 4X85A 3AR6A 2OZKA 1RHQA 2O6HA 3CXUA 4GKAA 4MUEA 2IWRA 3KT0A 1Q7CA 3IJPA 3CE6A 4MPPA 2XWSA 4WE3A 3LXUX 1QU3A 3DPIA 3CZ4A 4AQYB 1BVUA 2B8JA 1PHPA 1QCZA 2AOTB 4PQYA 3VPXA 3HM9A 2FG5A 1V43A 1C9KA 4AICA 2POQX 1HGXA 1JSCA 3AU9A 4PC7A 3TRFA 2GILA 4QPPA 1T3SA 3ELUA 3IDSA 3HU3A 3I5AA 3IBFA 4B9AA 4C4PA 1CUDA 5CVCA 1N1DA 3FPLA 3WFJA 1M10A 3D54D 4PXAA 4UM7A 4HH3C 4B7ZA 1X8LA 2IGBA 4D6XA 2HA7A 2ATEA 1AKRA 4DQDA 2ZDHA 1J2YA 1EUQA 2PYIA 2P7IA 4H7EA 1PE0A 4EL5A 2HMSA 1JIJA 2N9UA 2R8EA 1Z7YA 4OQPA 2A1UA 1VECA 1XCOA 1QE0A 4V0ME 4Q1EA 1IRXA 3WK5A 4UVEA 4F3RA 3A3OA 1CZNA 4F9EA 2JFNA 4A0SA 2A9PA 1ZOIA 3EBPA 3NGMA 3MMNA 3J7TA 4IM7A 1DUIA 2GCGA 1NXOA 1XAIA 3QPWA 4OHCA 4YC7A 3VR5A 4CCYB 1CNEA 1GJRA 5E95A 2DCUA 4TZ6A 3AT1A 4B7UA 1KDYA 4MPJA 2IE0A 4QAQA 2HWYA 1WPRA 5A0VA 3BWEA 3WRVA 4BXOB 2JZNA 2BGWA 1XNRB 4RD1A 3C3WA 4M6WB 2IH2A 4WIAA 2ZSAA 5JD3A 3PIIA 3RG8A 3W6UA 2YV4A 4YR9A 5LMZA 3E7XA 3ADPA 3VHQA 3VV2A 4LY3A 3RAGA 4N0QA 5A3QA 4P6VF 5ERXA 2PANA 3HA3A 3GRYA 1UJCA 2POCA 5HG0A 4B2YA 1Y8RA 5A4JA 2JIDA 1X14A 2W2XA 5LQDA 3MTAA 2GCIA 1AOXA 1J1IA 1GD1O 1RLIA 1KH2A 2BEJA 3ETLA 3DO6A 2YFYA 4IW3B 3AFOA 3T1OA 4CLRA 5F7JA 5I9TA 3LUDA 5HZGA 2D2VA 2REBA 3KFVA 3WOHA 1FK8A 1WB5A 2I7VA 2P9TA 2TMDA 3AMVA 3GW8A 3MGBA 4MI9A 1U8YA 2Q3MA 4OGFA 3D5TA 2QTCA 3QOYA 1WV0A 3VR4H 3C3YA 3PC8C 1JIIA 3WQBA 3MEQA 2P90A 3K3PA 3QU9A 4ER0A 1HYGA 3GC6A 2V3CC 5H1YA 5BQXA 2OXFA 5CVDA 4ENWA 1IVYA 1B0UA 3TIFA 1B73A 1JQBA 5D87A 1P9WA 2QTRA 2VIIA 3KTOA 5JROA 1TEHA 4P33A 3IE0A 4OJTA 4U7WA 5ITZB 1QQBA 3VR4A 4MICA 2ZB3A 2JVJA 3OBBA 4NP6A 2H31A 3VO9A 3OA0A 1RJEA 2AX4A 4FC6A 4D97A 3H4VA 4X8OA 4QDKA 3OZCA 3RIXA 3WGVA 5EYPB 2RGDA 1V6SA 1WG8A 4P93A 2GERA 3H0CA 4LHVA 4PG6A 1EXNA 3FOAA 5CPBA 1CEQA 3P19A 4F5EA 3QX8A 3TLMA 1N36B 5IBPA 1PQ4A 3AHHA 3CRVA 2IEDA 1AT1A 3L1VA 4F4HA 2BKAA 4MS1B 2ZJ4A 2OHHA 2JAOA 1ZITA 4ZI7B 3R7DA 2DP4E 2FU5C 1U3GA 1IM2A 1RLMA 3NM6B 1UFRA 5EXTA 4CI9A 1ZNQO 4RFVA 4MWGA 3UT6A 2P69A 2ISQA 3K70D 1VBMA 3AHEA 3E4CA 5EHXA 2RDMA 1TTHA 3O83A 5JYBA 4GOND 2XUDA 4EKIA 4MDEA 4IXMA 1LWNA 1G41A 5FBZA 1YQEA 5EMJA 4YMHA 2BEVA 3N2NA 3DKVA 4YA6A 3WI7A 1PNVA 2ZYGA 4XW2A 4JA2A 1XDDA 4OAPA 1NNLA 2WTAA 4CT5A 1ACJA 4KV9A 3PDHA 5K1ZA 4YRDA 2PEYA 3F90A 4BVAA 3KOUA 1SCQA 1XQXA 4ZJPA 3CLSD 2XZDA 3BKWA 4NYMQ 3KKOA 4ESEA 5JUWA 1VSUA 1FP4B 4UASA 2BHTA 1BOOA 4X84A 1LZKA 3UW3A 2OT3B 4K8RB 2V3VA 4BX2A 4QOIA 2V8BA 1CS0A 2ODPA 1A95A 1RTKA 4U8GA 3FYUC 3CQ9A 4GMHA 1WUIS 4O4IB 1S2IA 4Q6WA 1DIBA 4PZUA 5CM9C 2QIPA 3ZQ6A 5I5EA 2Q9CA 2QX6A 4M0EA 1S3IA 1TJPB 2GWRA 3KZKA 1I4TD 1PG2A 3KT8A 3NETA 2X0NA 2CLHB 3NC1C 4TWRA 1SQGA 5GIPE 1C7IA 1XQ1A 3FX2A 4GG1A 5HKBA 5KTKA 4B09A 5BR7A 4YRBA 3SVTA 3WB2A 4PAOA 3CRZA 2VDVE 4JYMA 1T5OA 2DULA 4CDRA 2OOSA 1QQ7A 1PS0A 1SXIA 1TW3A 1VLVA 1SBNE 4G4SP 4MS4A 4PPNA 2R7LA 4JFAA 3DE0X 4QDUA 5IF9A 1AGYA 2JAWA 2YJTD 3FYHA 4O25A 2QAGC 5CFRA 1BXRA 4HBGA 2V7BA 2O9JA 1A27A 1ESEA 2IZ1A 3B9BA 3DHVA 3VR2A 2BBTA 2VHJA 3QXSA 2J9RA 4WH0A 2O8FA 3SHWA 2HCFA 2GBCA 4FBGA 4H0FA 4YJDA 1IWBB 5FPHA 3D7NA 3IPLA 4PAMA 4BMVA 2BFEA 2VDRB 4QO7A 4ZVTA 3OFVA 5BQ5A 4EFMA 2ZLBA 4EW6A 2FRVA 1PK8A 4P83A 1X3LA 3MB5A 2XYGA 4RPIA 4L95C 5B3LA 1G20E 3OJXA 4MP8A 4QOSA 1MB2A 4BMSA 1G21A 2OORC 2CFTA 3RAFC 3PCTA 3HADA 1F2TB 1HTWA 3RV3A 1G98A 4N6GA 5C18A 4IMJB 3MJSA 3RDPA 2Q2WA 1JHOA 1LWOA 3G3EA 3LGXA 1GQRA 2MINB 4YY3B 4OQMA 3CEMA 1ZWLA 2R8RA 2YMPA 3FWZA 1LH0A 1DXHA 1COWD 2B8EA 1KQFA 3VH3A 1RRGA 1VRWA 3GRCA 3BGIA 2QMHA 3EGOA 2QR5A 3BPSA 3I6ZA 4R16A 4RX1A 4BNTA 5ICCA 4DV2B 3IQIX 4FFDA 3RI3A 2Y1DA 1MFZA 1JIUA 1WCXA 3GLUA 1YO6A 3MILA 2WAOA 3A2LA 4L6IA 2IYQA 5L4NA 2CCKA 3MINA 1J21A 3EGIA 2HDOA 3IESA 2XWJI 5EE5B 3R5FA 1SG9A 1UKEA 4QYXA 2I6XA 3ZDXB 1CUHA 1QPGA 2HFKA 1U63A 2CHGA 2B3TA 3INRA 1VB3A 3OPMA 4LYDA 5JSFA 1ZIPA 4DY6A 2X8BA 4L8WB 3UCEA 2FEMA 4BO6A 3KYDB 4EPXA 3KJEA 1QOQB 3RS8A 1SVMA 1E6KA 5FT9A 4YAJA 3TIIA 1BMFD 1XD9A 3CY6A 3O03A 2JJ2A 2IIVA 3PNKA 4X64B 5FUBA 1K86A 3L6RA 1RXWA 4FFBB 1N78A 4YCBA 1X19A 3CIOA 5D5PA 2J0QA 3C16C 1GNTA 3ANLA 3WE7A 2R47A 1NVUQ 1NOKA 1YZYA 2C61A 4HK4A 1QHGA 2L19A 3OU2A 4KQWA 4MVJP 1NE7A 4OBWA 1MJHA 4B6RA 2VUTA 3SY8A 4UZSA 2I3ZA 3H1PA 2PX8A 4GX2A 5KCMA 3H75A 2AMYA 4KXYA 4NKRA 3UWMA 2AXEA 1Y8QA 1KPGA 3OTGA 1DUSA 2XOKD 5AHWA 3TZQA 3QUBA 5M7EA 4BPRA 4XX0A 2P41A 3RUIA 4E11A 3LTNC 2PXHA 3I9NA 4IJ5A 4MR7B 1BMDA 1A2BA 1XLVA 1OLUB 4M0PA 4RCVA 3STXA 4BQOA 4JZYA 2C2KA 2QTLA 1R6BX 3GFQA 1PTJA 3AEKA 3A9VA 5JH7B 4KPYA 4BFTA 4EHFA 1D6SA 4RPKA 1G8FA 1Z7GA 2EFDB 1OV6A 1CUBA 2BFFB 3DBLA 4FE7A 4RJ2A 3ZWAA 1JXAA 3RYTC 1FYWA 1R0BA 5GWXA 1UBNA 2PNJA 4EEXA 2G83A 4A8PA 1V1JA 1VPLA 4TSFD 3JAWB 5J2TB 1VE9A 4RY2A 1VLLA 2KHZA 1A5TA 1I2CA 2EW1A 4M8LA 4L78A 4TL6A 1HFKA 3X1MA 4RELA 1ZJ6A 4H0CA 3PX7A 3RSGA 2NSHA 2FE1A 3OPYI 1U9JA 5LP6B 1I10A 3M4YA 3U56A 1MB9A 5E9WA 3QVGB 4EG5A 2HEGA 4RJKA 2BF7A 2IYTA 3FG9A 1PDVA 5I48A 1EWVA 1PQPA 2X7XA 4QNNA 4D8TA 4ROTA 4R9VA 4DQVA 3JWEA 2IHYA 1JQDA 1XMPA 2Z2ZA 4BQNA 7REQA 1I6KA 1XRPA 1Q1ZA 5C1DA 3AUUA 1QU2A 1QO0A 1GSOA 5INTA 4MUJA 2UYCA 3PR2B 4Z0TA 3GRPA 1CB0A 4Q3AA 2AHOA 4Y9RA 5AM4A 2ATXA 3LUJA 2QTWB 1VFPA 2FVXA 3EZYA 1QP7A 1XELA 4V3BA 3A6GA 1U99A 2GNPA 1MU0A 4KL8S 4LTDA 4DLAA 2VWHA 4JI0B 4NPAA 4A6EA 3WGUA 3ENQA 3BSSA 3E8MA 1UOQA 1WR8A 2Y71A 1MTZA 4HB2A 2AXNA 3HDQA 1AUPA 3PXAA 4Q4AB 2DT8A 1VYTA 1IXRC 3ZY6A 4X7PA 1FFSA 1D6JA 1T5LA 4C7BA 5K0CA 3F8SA 1M34B 1LS6A 4K40A 2ZUCA 2AWNA 4N03A 2GARA 3Q6IA 4G63A 1ZM9A 4K9DA 2A0YA 2R1TA 3V34A 3NHSA 4KDRA 3T4UA 2ISCA 3TZKA 3PGKA 4MEAA 1ZR4A 3KZMA 3PR3A 2NWQA 3IGFA 5FPPA 1EI9A 4MLPA 3A2MA 1DJNA 3RU2A 1X7GA 1J1UA 2E5WA 2G40A 3G0OA 4HDSB 4ZO8A 2VRCD 1NU8A 1P7YA 2FQ1A 4DUGD 4BFWA 1VI2A 1ONPA 4Z0NA 1GZ7A 4BE9A 4XGIA 2IYPA 4RH0A 3U4AA 1I3NA 1ZM7A 5K4GA 4FR0A 3QEOA 4GBED 3OT4A 1HNWB 3C0KA 1NC1A 5CVTA 1RZRA 3S70A 2KYRA 3I0ZA 1F38A 2Z0MA 3LVRE 3KQUA 4CV3A 2G8NA 3JU3A 3LCUA 1X1DA 2ZPAA 4TLCA 2H54A 5EIFA 4DSNA 1PI3A 4TKVB 2UVDA 2FW8A 1XTVA 3UAGA 3ROTA 3FUWA 3UJAA 1QG4A 3CUWA 3QUCA 3RRMA 4ARVA 4BDTA 3CLHA 1JFRA 3H6GA 1YL6A 4UTNA 4GDFA 3EASA 3OE1A 3VPSA 3LXXA 3OFJA 1QG2A 3KZXA 2OKCA 2CJPA 2I1WA 1PGJA 2FMUA 4KCGA 2O8BB 2HF7A 5GJCA 1BGXT 1C3OA 4TYPA 3URKA 3HKBB 1XD2B 2YYYA 3F4LA 5DN6A 1IJBA 2PAAA 4D0NA 3MMZA 4EL0A 4BWGA 3QU4A 4W5OA 4Z4CA 1OKKD 1DGQA 3OHMA 2LV8A 3T3HA 3DHNA 1D8AA 2R00A 1UEJA 3UJBA 1J25A 4C3UA 2C4UA 5EXPA 1R0LA 1S2DA 2ZI4A 2A5GA 3LFTA 5F78A 4DZZA 4YMGA 3ICEA 4MGYR 4KEAA 2VPYA 2YVAA 2HSDA 2IZ7A 2PLAA 2R6HA 3GYBA 2OCXA 3EUFA 3CH5A 2EZ9A 4UZEA 3L0PA 1IY9A 2GF0A 4FFWA 4YJHA 1T5DX 2XRMA 1NVTA 3RS0A 5AD1A 1WBDA 3GT7A 2JLBA 5G0UA 1C4XA 5GZ6A 1M66A 3BB1A 4MQBA 2HTEA 3LPNA 4OSEA 1E2LA 3D7KA 3MCAA 3CPSA 3HRKA 4Y2PA 2O59A 4RVGA 1T9GS 5BN5B 1AKUA 4LA4A 2HHCA 1CQJB 3EXEA 4Y6PA 3SVLA 1Y5RA 3PNVA 1Z5GA 5GM1A 3EISA 5A7HA 4DUPA 2C5FA 4ZTUB 5BMOA 3WGHA 2BJWA 4KQMA 3C8HA 3K9WA 3I2IA 3ZU6A 2Z3ZA 2J6IA 3ZH9B 1HDEA 1RPTA 4H18A 3B20A 5COBA 3ROQA 1JX6A 3U37A 1TCAA 2Z3WA 4NXNB 1DI0A 1Z4KA 4HXGA 5AK4A 4C78A 4B3GA 3NBXX 5C46F 1SH7A 2CEAA 5DJ5A 1TQ4A 2C42A 3E3NA 4BE4A 4X94A 3ERCA 1ZW1A 1Q57A 4FD2A 4NBTA 3FLBA 3F1KA 3IOMA 2MOKA 3LTEA 3ZTYA 1AUVA 4EB3A 4AYTA 2B6HA 1DKQA 2WC1A 3A1CA 4MB6A 4OM7A 4V38A 5CIQA 3N87A 2NZ8A 1ADBA 4XGRA 1A9TA 1SXJC 3JZAA 4BYGA 3K0FB 1EUDA 3R3VA 2OD2A 6ABPA 3U1VA 1DMSA 2WYHA 3ONDA 4V0KA 4V2UA 1U2SA 3RRXA 3OJLA 1UBCA 3PPVA 3EFOB 3ZX5A 2ZUEA 4RKYA 4C2UA 1X2BA 2O8NA 4L5CA 3MCZA 3VDNB 3E9DA 3VUEA 4YMUA 1N2GA 1TZ2A 2IHNA 2QT0A 2I34A 4KREA 2O2YA 4XJXA 4P22A 2XCSB 5LNK1 2CXTA 1I4OA 2FCRA 3ZWOA 2BM0A 3L0IB 5DGDA 2ZYSA 3N53A 4UMVA 4IDGA 2PQ0A 2PIAA 2X42A 1DKPA 5CHYA 1GPMA 2ACKA 3TUJC 1G5HA 1TJNA 2ZULA 2JJ1A 2QLNA 2WJZB 4YRTA 1IQ0A 4P7JA 1ENOA 2JF0A 5AJVB 3D6UA 5DLPA 4C08A 5JYCA 1I8TA 1XA3A 1E8NA 3HKDA 4JUCA 3JQ9A 1OPXA 4O4IF 9GPBA 1GADO 5KNDA 2ORYA 1XQ9A 1SBQA 2ECOA 4YIHA 3DAYA 5AKKA 2VJAA 3CU5A 4O2LA 3HP1A 2HT1A 2QPAA 5IFLA 3O0DA 2GK4A 4RY8A 3B89A 4DGSA 4D9GA 4DLBA 4QTTB 2OGZA 1HDOA 1ODKA 3R9WA 1WQ1R 4ZYUA 5J2UF 1C1HA 3BL6A 4GXQA 3ZG6A 3P94A 1ZNZA 4HMPA 1O9HA 3KCQA 4KAFA 4M76B 2FUKA 4RK7A 3UW1A 4LC0A 3IKJA 1CQZA 2AFHA 5IS2A 1NI5A 1IN8A 2CHUA 2ZRJA 3VM6A 2P4UA 3KD3A 4O5AA 2JZOA 1XN4A 2J09A 4JZKA 2XB9A 2XUZA 3LSTA 3LY7A 4F04A 3U44A 1IONA 2HJGA 1V0JA 3A9SA 4ID3A 5CM8B 3UUGA 3QMPA 3Q5DA 4A8JC 2C8JA 5ADUS 2MSWA 4DLNA 1L7VC 3OC0A 4IDDA 3C1OA 2XVMA 1PR0A 2XMDA 4F3YA 2ZRFA 1SCBA 3BMOA 3EAFA 3ZWDA 2O0HA 2JCBA 2W4MA 4KRGA 4UTPA 1KP9A 1P6UA 2CNDA 1Q3HA 2WMYA 3H4MA 1H9CA 1E9CA 4PZCA 3AEXA 2WZQA 2HMTA 2OCAA 4TSRA 3RQIA 3OZDA 2XCQA 4Z8XA 1MB0A 2L18A 4E0BA 3K1JA 3FBTA 4HO1X 3V5NA 1JLRA 2I7CA 3FCAA 2DFLA 3GLRA 3JATA 5I3CA 5K6TA 3GB9A 1QP4A 5TS2A 2BFCB 4EI9A 5FPKA 2WWXA 2D5AA 1NW3A 4NCAA 3HK2A 2ZB7A 4LJLA 4JI6B 3C3PA 2A9FA 3NYQA 5FO1A 2DXIA 1CIVA 1RJDA 4CW7A 3PEUA 4P3PA 1QXSA 1E6LA 3W9SA 1E94E 2ZB8A 4LXUA 3S8MA 3QPBA 2YWHA 3GJTA 1U9ZA 5C53B 5JNRA 4P3XA 3U4IA 1UKBA 4P0TA 3A8TA 3ZGYA 3KJZA 3PD7A 4H7DA 2H4HA 1RM5A 4Z4EA 2OCBA 1CYEA 4G67A 4PCAA 4K87A 2CFOA 1TKCA 2RH9B 4TTSA 2EWWA 1J4AA 3HUDA 5SV2A 4LQDA 1KETA 2ZITA 1UT5A 4PR3A 1T91A 3NUQA 3BICA 5AM3A 1LLCA 4HDRB 3OWXA 1EE9A 2PBRA 4YMWA 1PK7A 5THQA 1UAAA 1G2QA 4IJVA 4OTZA 1US8A 5K99A 2IUEA 1EUCB 5B7PA 4MYUA 4TTAA 1CHDA 4Q1AA 2ZJYA 4U0KA 3W5SA 3WA6A 3U16A 5ED4A 4D8UA 4RTRA 3GN1A 2DKOA 3LKDA 3LF2A 5A5EA 3TQFA 3AIKA 2I3AA 4UVGA 3GRKA 1X6VA 5LPNA 2QPOA 5FA6A 3NBYC 4OLBA 1PGOA 3TQTA 1TCCA 4RVSA 1W46A 3HEBA 1IIRA 1YBVA 1E5QA 2R11A 4Y6SA 6CHYA 2ZB2A 1PJ3A 4YDHB 5EGSA 1XAGA 3QA3E 3H9CA 3QNMA 3QVTA 4NL4H 3BBPA 1Y5LA 3AY0A 2GUGA 2JIRA 3AR5A 3PI6A 4D5EA 4HGYA 1JWBB 1G8HA 1LC3A 2F1HA 3H11A 4Z9XA 3AVTA 1SBTA 4DSUA 3I72A 1NQAO 3PL5A 1GL6A 3EVCA 4GMGA 2DUNA 1PK9A 1H2XA 3SR3A 3R6WA 5J1TB 3DQZA 4R7GA 5ENZA 3TM4A 1F5SA 2R25B 1O94C 2GJKA 3HSYA 1ULSA 2BGJA 5IBQA 2OBXA 4WASA 5CFQA 1MNAA 4RVFA 2JIMA 1VG9B 2QVBA 3QYPA 1J2JA 2NUBA 2WY2D 1PVVA 2OO7A 5CJJA 1TB4A 2BGNA 3PUXA 3MA0A 1TFRA 2BTEA 1T0UA 4ZPXA 1HQKA 4D99A 2HHLA 2HO4A 2BHRA 4D9IA 3HVIA 5BYKA 4R9RA 3LUGA 4YWHA 2P77A 2RHRA 3VR5D 3WRWA 1IATA 3PDJA 2XT6A 2YUIA 4Z86A 4MI1A 2B9VA 3IULA 1R8QA 3GUYA 3WMFA 3FPKA 4JH0A 4LSGA 1HNZB 3WWCA 5L3VA 2Z6AA 1EDBA 5BPHA 4TMZA 3WGKA 5K45A 4DRXA 1ORRA 2DECA 1Z5OA 1O6CA 3T9DA 2YICA 4MV1A 3F2IA 4ZV9A 2YW2A 2JCYA 3T7RA 2E6KA 5DNVA 1GQSA 1LTQA 2AFRA 4MRRA 1U8ZA 1BOFA 1D03A 2HIGA 5AH0A 4KYTA 1QH1B 5EVJA 1EXWA 4F1WA 3SS8A 4B3TB 1L7XA 1QTIA 2Y1FA 2YQ5A 3LP6A 4MVJF 4QJBA 4WXYB 5CBPA 3ZDDA 2AYXA 4WJLA 3R09A 4K28A 4JYBA 4BIIA 3WKBA 4ZYVA 1R7RA 2PZEA 2WMOB 3JRXA 3ZD7A 1O5OA 1VL6A 1Y6ZA 5D3ZA 1Z4PX 1RI2A 3GGOA 3PNBA 1F14A 1UBLS 2WJIA 4ZD6A 5H81A 3FGZA 5HKKA 1CR0A 1NWCA 1OAKA 3EVAA 4G0XA 1FZTA 2BZ0A 1WMAA 2Q1YA 1W5AA 2C0PA 2EYUA 2VAPA 4FSDA 4PVCA 4UUNA 3DFIA 1SG0A 4P0QB 4FXOA 4LGVA 3BEDA 3YASA 4DQKA 4MNTA 3HHEA 3M5WA 4EENA 3B51X 2NU6B 1Q1GA 2WJJA 3OLCX 4NE9A 3KOMA 1MIOA 4GX0A 1N9ZA 4L74A 3DBIA 3I3OA 1C1XA 3CLRC 3TPFA 3WNBA 4B1FA 4KGDA 3OU7A 4B71A 1SEVA 5AOCA 1R9MA 3FUTA 1N3LA 3COVA 3T0FA 1NY6A 1RXYA 2PAFA 3HJAA 4FFMA 4H3HB 5KDLA 1QLHA 2B0JA 4V1CB 5DT9A 4NBUA 2QRJA 5ALZA 2JLRA 3WBJA 3RF7A 1XMVA 2ZAYA 2J6BA 5FXMA 4G3XA 1W4AA 3JTMA 3TUZC 1DAKA 2AFIE 2YRFA 3HR4A 4FEAA 4D9HA 3OWOA 2HJWA 4R8VA 3K35A 1EK1A 4UE2A 4YIKA 1Y34E 5GGYA 3T5CA 2HNKA 2HZBA 3GAMA 3B78A 4EZIA 2E3JA 2WTUA 2ZQYA 1GTJ1 2HC9A 5IANA 2VPXA 1QZZA 2FGKA 3ND7A 4DWOA 3GVXA 1KQPA 4FFLA 2OM2A 3SPXA 4WBXC 3K70C 4UTOA 1YZFA 3NV7A 2AW3A 4DLXA 2C7QA 4E5DA 5KQMA 4I7EA 2YR0A 4LGCA 3SIRA 5KX5B 5KTNA 2VDKB 3DDSA 1JZSA 5FNVB 1U0SY 2FMIA 1U4OA 1YFLA 1UZLA 2DU8A 3IQZA 2Y99A 1LBIA 1UBMS 2QLBA 2XV1A 4K3VA 4RPCA 4NEGA 4DYDA 4WUTA 4E1BA 1HL7A 1Z36A 3E3LA 1EGVB 2FEXA 4GNKA 2AFHE 1NF2A 5A3JA 1NIJA 3OQ1A 3CF4G 3GJRA 2OK8A 2XUGA 1HSZA 1KAQA 2QSJA 4CCYA 2PGJA 4D25A 1D04A 2EZ4A 3HL0A 4HH0A 2P68A 4PLTA 3GJXC 3OEYA 3GDFA 4WJZA 3V8RA 2CXHA 2X4IA 4RK5A 4WZBE 3GUCA 2R9VA 3ECCA 4J29A 2XUIA 5BNFA 4Q4HA 1PL7A 4D5GA 4QQ8A 2N46A 2D1FA 4CEIB 4WLOA 2R8PA 4MGZR 4B73A 3B38A 3D6JA 1YKGA 2I6FA 3E1SA 1AKTA 2VO1A 3G59A 3H8SA 4G1FA 4HFMA 4R3UC 4WK6A 3WX0A 2DG2A 3AG6A 3TQCA 3BL5A 1JHDA 4EHBA 1Y42X 1OWPA 1M2KA 1L5NA 1ZM3A 5AKEA 1P17A 4O4JB 1AV7A 4MVJI 3ZV5A 3ESZA 1NUUA 3LDUA 4RTOA 2GS9A 4L5JA 2EF0A 3OY2A 8OHMA 1TAUA 4ER7A 2WIAA 5LMNB 4W5RA 5ALRA 2ZROA 1ZK4A 1XZAA 2BY4A 2IYOA 2D0DA 3INYA 4JB0A 4S12A 3LSYA 4TKZA 4XASA 1BE0A 3A4VA 3AL0C 1PZGA 4KXVA 4P2GA 1S7CA 1W1WA 2FZKA 4OHRA 4RZHA 3GI1A 4BQEA 2FWNA 2VYND 4G56A 2CVPA 4CIBA 4CQMA 1AZTA 3LC7O 2NP7A 1YL5A 1E8DA 3F2VA 4W5QA 1MJ5A 3DE1X 3PGXA 4MW4A 4KNYA 1F3OA 3OA2A 2VQ3A 5KIAA 3P4UA 1NDUA 2I7DA 2XYHA 3G23A 1UP4A 4ML3A 2ZTSA 1CJKC 1NLMA 4CMHA 4AP5A 4IMPA 2VP9A 4S35A 1QRRA 1T4BA 4P3OA 3BTOA 4FILA 5K51A 1BX0A 4C07A 2JD1A 3QUAA 5A3VA 2PYZA 3B2QA 4H1TA 1DAOA 1ODLA 4GMDA 4OXIA 4ZOCA 4D1YA 3AEZA 2R7MA 1V41E 2IV2X 1DBWA 2ZYRA 4UC0A 2IDMA 2WUEA 4R2HA 1YONA 5F1YA 3ZNOA 3KQHA 2HMWA 4LNAA 1T6YA 2E4WA 3SQDA 2ADOA 1LVGA 6GPBA 1KI7A 3HI4A 2HF8A 3DZIA 3N2KA 1KIAA 2QM7A 2IOYA 4X1IB 1QF7A 3DE7X 3U80A 1KTVA 4HAXA 3GNLA 4B79A 1QQAA 2ZBVA 1RYHA 2PYDA 1QYXA 3NP9A 4GSYA 4L27A 4TL9A 3VKUA 5BWNA 2VUSA 5BXYA 4AX4A 4TMXA 1NT4A 1H1TA 4CM7A 1K88A 5IYZB 2FG7C 2J7PA 1WXDA 2OBLA 4FZVA 4YEDA 2EXXA 4LNHA 1IEQA 1P7PA 4XCVA 3ICQB 2BH9A 4EFNA 1H0HA 3I53A 2IP1A 2ZBDA 4XYBA 5J2UA 2N1BA 5AP9A 3R3WA 3BFXA 4FI3C 3QBJA 2CF5A 3STWA 4N6NA 1P2GA 3LWDA 1SVKA 4CEJB 1PCXA 2W9XA 3OQVA 3GY0A 4WFJA 2OLKA 1YHNA 1ILWA 1Z0AA 5EP2A 5BOVA 3KYJB 1O97D 2HIMA 4MR9B 1XR3A 3QPDA 1E1MA 1WKVA 4EUNA 1PDWA 5AJYA 4UBKA 3TOZA 5ADVA 1UBEA 5B6IA 3GBVA 3H1FA 5ESRA 3EF3A 4U3JA 4O2AA 4EA6A 1MIHA 3IEMA 3BH6A 2AB0A 3AV0B 4M0CA 4ND6A 3WMRA 3LPAA 3PPIA 2G70A 1NMZA 2ZBUA 3EPRA 3HB7A 4IFIA 4BB6A 3DT8A 4DCUA 1GV1A 3Q6NA 4HTFB 4QDZA 1IG0A 1VGRA 3KFLA 2ZRKA 3SDBA 1H66A 3C3DA 3OT1A 5KREA 2PK3A 4F11A 3R74A 4B35A 3FTQA 2PX0A 1A8UA 5FPQA 5LZ7A 3RYFB 1QF6A 3B8HA 3GVIA 5KYYB 2IW3A 2ZUSA 4PWYA 1S96A 2FV8A 4NZOA 3T1VA 3AEUA 5M34A 1FX0B 1L5QA 3FOCA 4R9SA 2WFMA 1LJLA 3BIOA 5FR1A 1RAGA 1NBME 4OI4A 1YS1X 3GMIA 3KYCA 1R5OA 4LGMA 1OLSB 2GKSA 4EK9A 5KYNA 3NWEA 3EDCA