3OTGA

Crystal structure of calg1, calicheamicin glycostyltransferase, tdp bound form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GRHMRVLFASLGTHGHTYPLLPLATAARAAGHEVTFATGEGFAGTLRKLGFEPVATGMPVFDGFLAALRIRFDTDSPEGLTPEQLSELPQIVFGRVIPQRVFDELQPVIERLRPDLVVQEISNYGAGLAALKAGIPTICHGVGRDTPDDLTRSIEEEVRGLAQRLGLDLPPGRIDGFGNPFIDIFPPSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSSRDTARPLVYLTLGTSSGGTVEVLRAAIDGLAGLDADVLVASGPSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGTTLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPDNISPDSVSGAAKRLLAEESYRAGARAVAAEIAAMPGPDEVVRLLPGFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase
molecule keywords CalG1
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA02
2XCUA 1JEJA 4N3AA 2QRGA 3MT7A 3UYLA 2IV7A 3CUYA 2JZCA 3NP9A 3CX4A 2VCHA 1P2GA 2QN1A 2PRIA 3G2LA 1P2DA 5BNWA 1C8LA 3AMVA 2ASVA 2P6PA 5DLDA 3IA7A 5LQDA 3NCHA 2QN8A 4GYYA 1A8IA 1EM6A 3CUUA 4YI5A 2IV3A 2AW3A 3MRXA 4WACA 5D00A 3HBMA 4EL0A 3E3LA 1E1YA 3MTBA 3ZCQA 4X6LA 3L01A 2QRQA 2ECPA 3TSAA 3S2UA 4EKEA 4LEIA 1P4JA 3T3HA 2PRJA 3MT9A 5IKOA 4RELA 1P4GA 4RIEA 4RENA 3RSZA 3L7BA 3MQFA 3IAAA 5DXFA 3OT5A 1XKXA 2GM9A 3L7CA 3S27A 4X7RA 4W6QA 3G2JA 3WC4A 3Q3EA 4CTMA 1Y6GA 2FFRA 4EKYA 3ZCPA 4CTNA 3CEMA 3SYMA 3QHPA 2Q6VA 3ZCUA 3CUWA 1FTYA 1NZDA 4CTOA 4NEQA 2X0EA 5I45A 1K06A 2XGSA 1ABBA 4N9WA 3BCSA 1NVKA 3CUTA 4REMA 3SYRA 2WTXA 1L6IA 3EBPA 4RBNA 1RRVA 3VDMA 3C4VA 1IXYA 4LDPA 2SKEA 3O3CA 2R4TA 4NC9A 2XGOA 3L79A 4XIFA 4CDRA 1HLFA 2QLMA 3L7AA 3VDNB 3L7DA 1UZUA 3MBOA 2QRMA 1Z8DA 1L5VA 3T3EA 1PNVA 2QRPA 1NZFA 5TMBA 6GPBA 2PYDA 2QN2A 4X7MA 3G2NA 3MRTA 1NLMA 5DU2A 4EJ2A 1L5QA 2QLLA 1RZVA 1UQTA 2AMVA 1FS4A 2QN3A 2SKDA 2BGUA 3BD6A 3MS7A 1QKJA 1UQUA 4M83A 1XL1A 1Y6FA 3G2HA 1RZUA 3NC4A 1YGPA 3S28A 3T3DA 1BX3A 3COPA 3ZCRA 1Z62A 3OKAA 4GYWA 1L5SA 3G2KA 3MTAA 4F9FA 4G2TA 2GEJA 2VSNA 4HWGA 2C1ZA 1H5UA 2VG8A 2XMPA 8GPBA 4MI9A 1EXVA 1XC7A 3QKWA 1WW2A 2GEKA 3H4TA 4FKZA 4N3CA 4BQFA 2PQ6A 3CEHA 3C48A 2G9QA 3C4QA 2OFFA 3S0JA 3D1JA 1FC0A 2X6RA 2YJNA 1WV1A 2X6QA 4N39A 3WADA 3MS4A 4RIGA 4GZ6A 1L7XA 3D0RA 1GFZA 3T3GA 2F3SA 2FETA 4AY5A 4AMBA 3T3IA 2XCIA 3DZCA 1WV0A 2G9UA 1GPYA 2XA2A 3Q3IA 4WADA 3OKCA 3H4IA 1XV5A 1C8KA 2G9VA 4F96A 2QZSA 5HXAA 1P29A 2BFWA 3T5TA 4GZ3A 2AV6A 4XI9A 1F6DA 3DDWA 4KQ1A 5JTTA 1NOJA 1O6CA 3RT1A 2BISA 4BQEA 3CUVA 2R66A 4HLNA 4N3BA 2O6LA 4MICA 1Z6QA 1LWNA 3VUFA 4BQIA 3HBFA 1GG8A 2XGMA 1GPBA 1L5RA 3E3NA 1IIRA 2JLBA 4BFCA 1V4VA 3NP7A 4EL5A 1FU7A 4X7PA 3HBJA 2F3QA 2GPBA 3D0QA 5D01A 3GPBA 4AN4A 1WUTA 1FTWA 1FU8A 2FF5A 2G9RA 4RIIA 1Z6PA 4GZ5A 2VSYA 2H1FA 2C9ZA 2AZDA 3OY2A 4FZRA 2F3UA 2IEGA 5TVGA 1B4DA 1C3JA 1F0KA 2HY7A 2ZB2A 3BCRA 4RIFA 2C1XA 4AY6A 2BGTA 2X0DA 1YA6A 3UYKA 1WW3A 4GPBA 3OTGA 3T7DA 1P4HA 3VUEA 5GPBA 3RSCA 3Q3HA 2XA1A 4Z5XA 1M5RA 4M60A 3BD7A 1FA9A 2SKCA 3DD1A 3MTDA 1PN3A 3MT8A 2XA9A 2IW1A 2GPAA 2KS6A 3OTHA 3E3OA 2QN7A 3GUHA 1AXRA 1FTQA 2JJMA 2QN9A 3FROA 3OKPA 3EBOA 2C4MA 2ACWA 2R4UA 3WAGA 2IYFA 1Y8ZA 1JG6A 2R68A 2ATIA 3BCUA 3CEJA 1GGNA 1JIUA 5IKPA 3PE4A 2X0FA 1JIVA 1JIXA 2QNBA 2PYIA 3BEOA 9GPBA 1PYGA 4KQ2A 1SXPA 7GPBA 5ENZA 2GPNA 1SXQA 3NAZA 4MHSA 1E4OA 3CV3A 4QLBA 1GZ5A 3BDAA 4F97A 1XL0A 1WUYA 2IUYA 4AMGA 3OTIA 3S29A 2IEIA 4NESA 1GPAA 1JG7A 4KQMA 2VCEA 2F9FA 2F3PA 2IYAA 5C1DA 2GT1A 3MSCA 4WHMA 4M7PA 2H1HA 4MRAA 1VGVA 3HBNA 3PE3A 3ZCVA 1XOIA 5TMDA 3ZCTA 4YI3A 4MHOA 1LWOA 3G2IA 1NOKA 3NB0A 3ZCSA 1P2BA 3DDSA 1KTIA 3BD8A 2QRHA 1QM5A 3RHZA 3TAXA 4MI6A 1PSWA 5JTUA 1L5WA 2ACVA 3OY7A 1C50A 1NOIA 1AHPA 5TMEA 3NPAA 4PQGA 3MRVA 4L22A 4RIHA 4MI3A 1K08A 1FU4A 3TOVA 4YUAA 2GJ4A 3MS2A 1J39A 2QLNA 2R60A
chains in the Genus database with same CATH superfamily
2P3QA 1XTIA 1ZZGA 4NCJA 1LI5A 4H1WA 3T1VA 1JEJA 2I2DA 4BHTA 4BX2A 1WMEA 2QVYX 3OQIA 1OX5A 2I2FA 2FXVA 2A5YB 4AP6A 1KVQA 4CKCA 1HYGA 1RAEA 4I9UA 4A9AA 2Q5EA 2FCRA 1YS7A 2AOUA 3NH9A 4I8XA 1H1DA 4MQ4A 3DMTC 4JR2A 1NE7A 4M9RA 4Z1MD 3AESA 2C2BA 3DV2A 1F2TA 3ADDA 1F8XA 2GK6A 3S4YA 4DNQA 4PFSA 5ALTA 3QNWA 2ZDHA 2VJMB 2OAGA 2PUBA 3SZGA 1R6UA 2PKEA 2R7LA 4TZKA 1XZHA 1OLUA 2DU8A 1EM6A 3C70A 4RSMA 3ZE2B 2IUEA 3UK2A 5A4DA 2M6KA 1DIHA 3FVWA 3UAYA 2HA6A 2O57A 1N1DA 2FX2A 3LSTA 2HRDA 3OLXA 4RL4A 2X7XA 1ESEA 1XTZA 4QLOA 3VJMA 1VLQA 1RRMA 1HYBA 3OCVA 4XFDA 1CY0A 2XUDA 3EGXA 1QRDA 3FDZB 4DABA 3PQ8A 2F8SA 1YKSA 1P4JA 1NX6A 3N8GA 2I4MA 3GLGA 4Y2VA 2PEYA 2XPCA 3UB3A 3I37X 2AJTA 3PX2A 3TLEA 4I14A 3TK1A 4ZYWA 2VP4A 4J49A 4C7OA 3TS1A 3HC7A 4K26A 1SPBS 5LR6A 3FTQA 3R0IA 1WTCA 1E9FA 4B7XA 4L76A 5KU1A 1EHYA 2ZIUB 3K8QA 1E32A 4FMCB 6ADHA 2FNAA 2G28A 3C3PA 3NS7A 2CHEA 4C2BA 4DBLE 4OY3A 3CBQA 2A4KA 4DJAA 2FR0A 2PCJA 1EPUA 4YB8A 3PD7A 4LJRA 3I34X 2Z8YM 4J0HA 3B8EA 5KSOA 1P1RA 2PJUA 3V1MA 2V58A 1CJMA 5DNVA 1Y6GA 1MQSA 2EATA 3R6TA 3RU9A 2OCYC 3Q5DA 1DL5A 2FH5B 3QX7A 5EERA 1F1BA 2ZS7A 5IAGA 2ONYA 5EIEA 3QHPA 4FC7A 4LQCA 2HQBA 1DC7A 3EQ2A 3PTAA 2O23A 3CKKA 5FHQA 4ZTUB 4KO3S 4Q1FA 2EKBA 1USKA 2HUNA 1XQYA 4BLPA 3PZBA 2Q0QA 3KS9A 3LQ2A 2ZAMA 4D25A 1BFKA 1E5VA 2VK4A 2IDJA 3NASA 1RC1A 1OB5A 3NGXA 2C7PA 2O2SA 1LSSA 4EYGA 4R68A 1H85A 3T7JA 1XWWA 3VGPA 1J23A 5JCJD 1U28A 4JX9A 3ZU5A 5KTPA 4QG3A 1RTTA 2EIHA 3IDFA 2Y68A 3EBPA 3U81A 2ZUTA 1FZQA 3VDMA 1ZVMA 2RHDA 3AM5A 4O2RA 5CPFA 2CHUA 2Q49A 1UANA 3WBBA 3BE6A 2Y4NA 3H97A 5KNDD 4HAYA 4E15A 1A77A 3VHLB 1WCYA 2Y71A 1BKYA 1IJKA 2YV3A 1JYSA 3KSZO 4IHAA 4N8EA 2O7NA 4UM7A 3RBVA 1YRQA 3ZE0B 2CWWA 2O7QA 5BSMA 4B6PA 1YBHA 3T7SA 2Q2VA 3T3OA 2P6OA 1E0KA 2QROA 5BMVB 1TX4B 3FNQA 3W04A 2UYCA 1DG3A 3ODGA 5BN4A 3LWNA 1SCDA 1GD1O 4HXYA 4TN5A 1JQ5A 4EGAA 2BZGA 1UBCA 2VBFA 4JVSB 3GRYA 4IRUB 1SG0A 2P11A 4JJ7A 2PYDA 3D59A 2BGWA 4ME6A 1V47A 3EEBA 2DQZA 4DCTA 4Q05A 1F17A 3ZE1B 3B1FA 4Q00A 1ISJA 2H54A 4ZHSA 2EIXA 2INGX 4GPD1 1FCJA 2DOKA 4MEAA 3CISA 5C4GB 1J09A 1TK3A 3CLSC 3W5JA 4N5NA 2WUFA 4GW3A 3EVGA 2BEUA 2VDJA 4X95A 3ZVNA 3ACCA 3QWBA 5ARCA 3PX7A 1MX9A 3BILA 1TTTA 4J1NA 1Y33E 2ROQA 3DOOA 4RVCA 3VNVA 2AKEA 1NIJA 1RQLA 5AUNB 2ZRIA 5HHTA 2V9CA 2SKDA 1O94A 4KQFA 1EU1A 4HQ6A 4TSFD 2Z95A 5IRCD 1M2GA 3X1XA 1SVKA 2E5FA 2QVLA 1RQNA 1UAGA 4N0MA 5EPEA 3QSYA 3AVVA 4AF7A 2BR3A 3NC4A 4O2AA 4OQPA 3FFBA 4QHSA 4UM8B 1ZWLA 3ID6C 2HU5A 2YKGA 1COZA 3P2YA 3R1IA 1E62A 2D4HA 1D2AA 2VUTA 4ARZA 1NW7A 4WLEA 5FNZA 5FTNA 2X8AA 4EA9A 2QZPA 3BTOA 4HPXB 3KTFA 4CCYB 1E94E 4DQKA 5A9RA 3U4QB 4GYWA 5E7MA 2JEZA 1XCOA 5L8VA 3HB1A 4JI0B 1E3DA 1OR8A 2GRAA 2P9CA 2AYYA 2OP0A 2QE7D 3NZEA 2YWXA 4KIGA 4JA0A 4X60A 1E0JA 3HVHA 1NQVA 4J4HA 5AHXA 2C1ZA 3AIOA 3FYSA 2W22A 3A6FA 1GA1A 2REBA 1I7LA 3Q5EA 1S89A 4EYEA 1WPQA 3WFJA 1U7TA 3P8ZA 4IWNA 1U5CA 3GG2A 4ZOCA 3ZBPA 1XPUA 1RWBA 1RYNA 4BKRA 5JNSA 3V9PA 3BWVA 4EI2A 1KO7A 3ZIAA 4J9UE 2JCBA 3K1ZA 1IHUA 1T91A 5B4TA 1YMVA 3T34A 5F7JA 2PH5A 3HVIA 3TEJA 3LA8A 3AXTA 4FKZA 3K3PA 5TX7A 3TKAA 3VM6A 4BYMA 4ZVVA 1XMOB 4R1QA 4G67A 2AOUB 2O3UA 4HDQB 3H2JA 5KMGB 3HJCA 1OYWA 3CE9A 3TL6A 1KMHB 1DX4A 2D2EA 2KQUA 1MJGA 3ONVA 4P6VF 3FCOA 3KALA 4KWHA 4V2IA 2FRVA 3RVOA 2X6RA 4FCVA 4PNPA 1SD2A 5HGXA 4QJ5A 2FR8C 2QGFA 4DGQA 2R6ZA 3ZD9A 2GRUA 1A8IA 2MMCA 3NDIA 3M0EA 4U00A 3QF4A 2XE6A 1P7WA 1R5BA 2O2XA 4DCPA 1X1QA 2WBLC 1RVV1 1XD9A 2W93A 3OFSA 4H77A 3V33A 5DTJA 2NU7A 4J0DA 2VDLB 3MWJA 1PHPA 4EI9A 3ER8A 1KE2A 3OBIA 2F6RA 3OA0A 5DM4A 1BJKA 1YI0A 3M81A 1GPYA 1QANA 1Y1TA 4G41A 4NBNA 2IEZA 1D7OA 2WNIA 4TVOA 3BJMA 4Z86A 1VJTA 5E7IA 1TVMA 2PLAA 4JOBA 1W93A 3HZRA 3KZ1E 1HT3A 2B92A 4KWEA 2AFHB 2PKQP 2ODQA 5MGNA 3GOHA 3B13B 1V11B 3RIYA 5MFZA 4QG7A 3E7XA 3DXZA 4E70A 4BTVA 5C34B 2W43A 4X92A 3TJRA 3G89A 3WBKA 2V6MA 3M4JA 4BNMA 4Q6WA 1Q0PA 5K8UA 1MB4A 3WLPA 3ZWPA 4LOHA 5I47A 3WKAA 4TUYF 1G5QA 2ET6A 3T9BA 1HTTA 1HT2E 4OVKA 3RYHB 1EEXB 3DDWA 3V4RA 1R9MA 4C7XA 2GFHA 3IAFA 1EBBA 1M8KA 3E5MA 3WB9A 2Z2KA 3GC6A 4JQYA 4MRVA 5BRJA 4YN3A 2OQRA 3D8HA 2Z2YA 4RXTA 1PJZA 4HGRA 4MQMA 1J2RA 1Y8QA 2HSEA 4Y0NA 1ZMOA 1V45E 4BNKA 2HK6A 3FETA 3DP7A 2IKSA 3OLQA 1MG5A 3CVJA 2XYQA 4RKEA 5FBRB 1PWZA 3WGTA 1W73A 4QJBA 2QM3A 3SSNA 1O95A 3G6KA 1PHRA 2H1IA 4OSEA 1PZNA 1W0KA 4DIDA 4E22A 5ALXA 1E2HA 3OT1B 3LJKA 3CSDA 5GJWC 1PU2A 1IL0A 2Z2IA 2I4TA 3B3GA 4JL8A 5K05A 5DOZA 2P3OA 1UMBB 2VQDA 2P40A 3OC6A 4AT1A 1ZOOA 1SHKA 4GOXA 4EW6A 1W0JA 4J3JA 2ZULA 3FA2A 2JLBA 2WHPB 3OCUA 4IFEA 4JLOA 4BFZA 1SCJA 1YO6A 1KEKA 2O5EA 1Q2UA 4CF6A 2Y05A 3AG5A 1FTSA 5TVKA 1EWQA 1QZUA 4GI2A 1MC5A 4IGIA 2BSQA 4UNQA 1QU3A 2ZJAA 3ZK7A 1ZCBA 4IDNA 2VFAA 2VXBA 4WXYB 4IIUA 5DT9A 1RLMA 2DY0A 5C8ZA 4CT5A 3TUZC 3FIUA 2W6MA 1UK8A 4P36A 4BMZA 2PPLA 2EFCB 3AR2A 2HEGA 2IIBA 2OV2A 2Z08A 3DV0A 3T7TA 3CVVA 1QS0B 1E64A 1TJPB 3QHAA 2A30A 1CUGA 3H2GA 2W42A 1BFDA 1IE3A 4HRAA 2EP7A 3V4OA 2OPHA 3RADC 1AUOA 2EZTA 1EJBA 1F4LA 2B25A 2JATA 2CLSA 4R1UA 1ZR2A 3NBFA 4NNOA 3V4ZA 1QTIA 4O4HB 2ZR9A 4EG5A 4LF7B 2H4JA 3HZOA 4LMPA 2ZE7A 1AV7A 3RK0A 5CW1A 2GN8A 2IT1A 4XCVA 5EPUA 2VHZA 3HDGA 5ES3A 3S1LA 1KKMA 2Y1CA 4IWXA 3L4KA 3MGCA 4PAMA 2CZGA 3LIPA 4ZRNA 5F76A 2JIZA 4Q9IA 3M6WA 1AX9A 2ZSEA 4C06A 4LNUB 2PZFA 4I55A 1MEJA 2G71A 3P0JA 1YR6A 4AROA 1KOGA 1DBVO 1F6WA 1WHTA 4P80A 3SR0A 5C32A 1HYQA 1WMSA 4ML3A 3R9WA 1R7RA 2R85A 2NVWA 2PT5A 4IILA 4TV9F 1UJMA 3L8HA 1JSCA 1WW3A 2WIFA 3ZWNA 5B7PA 4RGVA 2HNBA 4J7UA 2GD2A 2IHJA 4NMMA 1AKWA 1YR3A 1XN1A 3GRKA 3C3AA 3LOUA 1U7ZA 1T3TA 2OCAA 3MWEA 3T0FA 1M10A 4YQYA 2Q1WA 3E05A 1VE1A 3KSDO 1ULHA 5EINA 2HYDA 2IDZA 2QMHA 2WWXA 4GVLA 5AVWA 1XEWY 3IUMA 4XQCA 3BGVA 3FUVA 5CYOA 5E3IA 1OC2A 4C9BA 1M0EA 1FBTA 2J0VA 1PNOA 2WILA 1A2KC 3R7SA 1E58A 1RW4A 3WYCA 4CKWA 4CMGA 2XQKA 3P4UA 5IS2A 3AUYA 1R88A 1L5OA 3IAS1 4L0DA 4Q3CA 4HVCA 1UPAA 4DR1B 4W5JA 2C7QA 2V7PA 4V0SA 2JDID 2ZM5A 1Q0SA 3OZWA 1O97C 1E1LA 1HOTA 1PEYA 1QLHA 3KQWA 1JVSA 4HNHA 2E1RA 4MTLA 4QDUA 1E6UA 2R4UA 4RFVA 1Y7HA 3URMA 5LLTA 5EJ5A 4JBLA 4U9HS 4B9AA 3AI2A 1HDZA 1LBIA 3KSBC 1YJAA 2BE7A 4O4LF 1Z2PX 1Z37A 3LX8A 1KRXA 4YXFA 1HQKA 3Q3VA 2QW0X 4URZR 5HM8A 1R00A 3O8RA 4I1YA 4TLAA 1KMNA 3EGIA 5AMXA 1QR2A 1XXLA 2YHIB 4NNJA 3A36A 1SCQA 4TMFA 1FFDA 3GI1A 5DK6A 3WLFA 3IP7A 4TV9A 1XDUA 5G0SA 3L7MA 1J0DA 2CEKA 4JVOA 1YBFA 1YS9A 2HO4A 4XVRA 4B3IA 1Q0TA 3JWJA 2NIPA 4MRSA 3P0EA 1SZDA 4H1UA 4JZYA 1E6MA 1V35A 3L6OO 3ZTYA 3IE1A 2CXOA 2IYUA 3CX6A 1G7SA 5F4BA 3VX3A 1Z8HA 3HVUA 4JQOA 4CYMA 1ZUNA 2AJLI 3K2EA 3PQ2A 5EIHA 3TIGA 4DXDA 4PR0A 3TLZA 3CF4A 3KJXA 2HIMA 3CT6A 5JCOC 1GQRA 3PP8A 2OBFA 1DTWA 1MB3A 2I66A 5AM2A 4QYIA 4AWBA 3H5NA 4HDMA 3F6SA 5H5JA 3VR5H 4WZ6A 4D8XA 3ZPXA 2F3PA 4G5GA 3T5CA 2IYAA 3K31A 2PX0A 2GT1A 4CR8A 2YV2A 3C8DA 1HETA 3I73A 3ND8A 2FOXA 3CKMA 4WHMA 1H94A 4D97A 2C2ZA 4FOOA 4Q3DA 1L4LA 2Q0XA 2Q6TA 2ZYHA 4KMMA 1HDGO 2WUVA 3SS7X 2EC5A 1SQ6A 5KQPA 3MCTA 2ZYUX 3CVXA 1IBRA 1KEEB 4LUCA 4JEIA 4Z0TA 4K9KA 1HNXB 4DR6B 1R6XA 2VDWA 4LJ9A 5JNTA 1M6VB 3OECA 1RLOA 1YR7A 2VF4X 4FI3F 4MDFA 5IARA 2IQIA 2EHJA 5EIOA 2VF5X 3GOQA 1XVVA 3GY0A 4YRLA 4HBZA 2C5FA 3CVWA 3PNBA 5IVDA 3UJPA 1PTKA 2Q1SA 3R7DA 1QHNA 4AXXA 1B0ZA 2IBSA 1D4FA 4OL0A 4HDCA 4BFLA 4FB5A 1YDGA 1YRBA 4K9PA 3KZXA 1DIGA 3OPXA 2GM3A 2R86A 1IXSB 3K9BA 4H6WA 2HLDA 2PKWA 1X7HA 3OFVA 1NZJA 4F7WA 2VZ8A 1MF7A 1OV6A 4YRBA 3C14C 4CM4B 2Y9MB 4H0NA 1E2BA 2QGNA 4F8JA 2PKQO 2XCOA 2RARA 4Z9YA 5TARA 3A6ZA 4I5DA 3SZUA 4L4ZA 1ZN8A 3LY5A 1N32B 4ND6A 1A8UA 2FMFA 2O50A 1M33A 2RH9B 3IQWA 4J8PA 1JIKA 4XIJA 4PZAA 1Y6QA 3SBEA 1Z4NA 5TY0A 4DJJA 2QBYA 2N47A 4A92A 5K3EA 3HSSA 2G09A 4O33A 4ZDIA 4Z1OA 4JJ6A 2CVQA 2KLBA 3LUKA 3FCUB 4KGVA 3K8YA 2IZ1A 3LCCA 4KDFA 1JFRA 2A4MA 5CG1A 1LLFA 2QNRA 1J4AA 1L7VC 1P5FA 1Z38A 4L9SA 4MUNA 4B1FA 1YQEA 4D92A 3WE7A 2PIDA 1DAMA 1E6CA 2PGLA 4UATA 1XTSA 3Q9UA 3H83A 4YCLA 2JGAA 2PUEA 2OHFA 2D1TA 5B6JA 3DE7X 4B3TB 3GYGA 5BUCA 1RNLA 2IV7A 2GBPA 1SVUA 5BV0A 4Y6QA 1U5BA 3D1LA 2PGDA 2LTAA 2QN1A 3EVEA 2RGEA 3RWBA 1GA6A 2I2AA 2WUDA 3FSRA 1XMQB 2V74B 2C8JA 3TGWA 5A2GA 1BGWA 3EBLA 4Q9LA 2QZJA 2C4NA 3FOWA 3HMKA 4AD8A 3LPMA 2VUHB 1I3KA 1E2UA 1NVFA 1JDPA 5GONF 1NHWA 4YI5A 4N9QA 4QULA 1JPNA 4HDMB 1IWPB 4ER5A 1KY3A 2GN1A 2QQ5A 4JJGA 3O9ZA 2JAHA 3ETJA 4A4DA 3TDNA 5EUMA 1FYWA 1IAVA 4YJGA 1XZNA 3PTLA 1DO0A 1KU6A 2AC2A 3BL8A 1RHRA 2R65A 2J6BA 4FHDA 1V8BA 4C21A 4A0FA 4RELA 3T12A 2VYQA 1E4VA 2JKZA 1QLJA 3D3JA 3B53X 3M6VA 3WGQA 1LZKA 1RJFA 1T6YA 3AVPA 3C16C 1I2MA 1QB7A 3KJEA 4QUAA 4ENSA 1IHOA 2BCJQ 4YP0A 1NQUA 5DCYA 3BG5A 5FT9A 1B42A 4MR9B 4P83A 2X3FA 1P5RA 3ZDZB 4ZK2A 2N1BA 5IDYA 4JI6B 3PRYA 4QARA 1EH5A 3H6HA 3JD0A 3BT7A 3DEHA 1SIWA 5FFFA 1Q83A 1DQSA 2W0SA 2Y77A 4INPA 4X7RA 3N0VA 4OBXA 2I6FA 3HUTA 1E0SA 2AX4A 1GDTA 5E1MA 4ZT7A 3JQQA 4I6JA 5PNTA 5CJPA 4F12A 1PGQA 4X24A 2Z9BA 3OOEA 1XRNA 3GVCA 4IZ6A 4KB5A 3I2FA 4MKZA 2IW3A 3AH8A 1GXSB 1IBKB 3GJ8A 3BVPA 1XZPA 3H7IA 3B7WA 5BOSB 2DJIA 5J59A 5AXDA 2OBYA 5DTRA 2WOJA 1P1CA 1J0AA 5BW4A 2FMHA 2FU5C 1NRXA 3AUJB 1D6NA 2NZJA 3MJSA 4YCBA 1L1FA 4AMVA 2ZUFA 4UFNA 1ZIDA 4Y30A 3MWEB 4MZDA 2G36A 3COYA 4YJKA 4XAQA 1KYTA 3PD1A 4UBIA 1XVUA 2X0EA 4QC2A 3SIRA 5JQWA 3G5UA 3U3XA 3H9UA 2G5TA 1KEWA 3ZI7A 4C1NA 4RORA 5LA6B 1CEXA 1SUCA 2BGKA 4IH1A 1P1HA 3T94A 2A88A 1WKBA 4LDNA 1C8VB 2W6IA 5JD3A 1CRWG 4TXJA 3I42A 1P7YA 1XZCA 5AXCA 3I09A 5K3FA 1UBFA 1Y3BE 2WJ3A 5JYEA 4B74A 2PEZA 1U02A 2VIIA 2PGAA 4BKUA 5KNCA 3HB9A 1MEOA 5CJ2A 4OX9Y 2REQB 4K6KA 2BH9A 2KM1A 1DWQA 2BUCA 3W1WA 3IUNA 1TMKA 3IIIA 3DKRA 2AOXA 2IXGA 5K2OA 1VCNA 2E6KA 2AEFA 4RD0A 4YP6A 3TEMA 4PIPA 4EAAA 2JI8A 1MJ5A 2VZLA 3R6WA 5K0EA 2X0KA 5I9MA 2IJGX 3M33A 3T3EA 1LBSA 1AXGA 1KJJA 3DZBA 2HA2A 1YZKA 3CX8A 3HJNA 1JDVA 2A9VA 3RTBA 4UUMA 2V5UA 4V1CI 1SZCA 5BSEA 1TYCA 1NSYA 1P91A 2ZGVA 4M0EA 1XLWA 4MITA 4LQLA 4WCFA 3G2NA 1DX6A 4XSVA 3U7HB 5FBHA 1TGYA 4YP1A 4B09A 5HQ3A 1IBCA 2Y0EA 3PFCA 3UJHA 5CM8B 2PUTA 2D62A 1NVWQ 1OX6A 8ADHA 4A8JC 3OM8A 3R3SA 2JLZA 1KGDA 4TWZA 3S27A 4L0MA 4LYHA 3I58A 5G2OA 3KQHA 1ZNXA 1BHSA 4GLJA 1OI7A 3FMVA 4FNOA 3SNKA 4Z4FA 5T4HA 2BGUA 2R6AA 1D09A 1QHHB 1MR3F 1ZVJA 3CF0A 3RYCB 5JMPA 2E48A 2C2WA 4FR5A 1KK1A 4HUQB 3G2HA 1P1IA 4MQLA 2HA4A 3ZY3A 3FNRA 5TGDA 2F7SA 3ZHVA 5JC1A 2WIDA 3BRWA 3G9ZA 2GZHA 1NTOA 4FIDA 4MKHA 2WB4A 4BQNA 5DN6D 5KU7A 4S04A 1F60A 3K1AB 1SC4A 2V03A 3PFIA 1B8UA 2ZR8A 5TQ0B 5FUBA 4I4TB 3JWEA 5KVSA 2JKVA 2C7RA 1Q6YA 3PQ5A 4EI7A 5JBNA 2GLUA 2QVCA 3JRNA 4IGKA 3RBAA 1KDVA 5KKCA 4JYCA 1HLDA 3GT3A 4F5WA 3VAZA 3TW6A 1BNCA 1N2JA 3I9NA 2VBGA 1M7GA 2DR0A 3P2EA 4MUHA 3EXAA 4ARZB 4AG6A 1GUZA 2H9AA 3CNLA 5EMKA 2BZSA 3OCXA 3R23A 5AM3A 3MRSA 1AA9A 1SJ9A 2Z43A 5FJJA 3TQFA 4LSGA 1AZSC 4WMLA 5YASA 2O2ZA 2YDYA 3JATB 1A5ZA 3TM5A 4MW7A 3ERCA 3AEUA 4B44A 2GARA 3DWFA 4MGZR 1EX9A 1G291 3Q1KA 5D6NA 2Q99A 4B6JA 4DBZA 4XM0A 2I9KA 4I1OA 1H69A 1KOJA 3OJXA 1E3EA 3PA6A 4BLQA 2GEKA 1NE2A 3CBGA 4H4CA 4LOLA 4U3JB 4F1JA 2O1XA 1R3DA 4D3SA 4QVIA 1DPGA 5FYQA 2JIPA 4WA7A 1WB4A 3N87A 1AQIA 3W3AA 1J8YF 3WB1A 4DOMA 5BN5A 2VDMB 4L5AA 3D1JA 3LYUA 5JS8A 3ESDA 4HS9A 3D7MA 4DV1B 3LY8A 3AHGA 3DMNA 4WOBA 1O57A 1Q7EA 1FQWA 2GLXA 4RTLA 4BGUA 1Y4ZA 3MS4A 5GGXA 2DETA 3PIRA 2VPYA 4MOWA 3VAAA 5LJLA 1NTRA 4BO2A 3B78A 3N0TA 4E14A 1EAMA 1H6BA 3M5DA 1G8AA 1UBLS 1UK7A 2IYZA 4EPYA 1KVRA 1Z5VA 1PK8A 3HV0A 3UWKA 3Q3IA 1HV8A 1ZD3A 5FLEX 5F3RA 3TB4A 4C1BA 3FYDA 1V3VA 3Q9NA 4JU8A 5G3YA 5CEEA 5L6LB 3AVTA 2XNJA 3JXEA 3WGHA 4B17A 1C4OA 4AZSA 2PUVA 1FX0A 2QM8A 2HMYB 5I7HA 1OXKB 1XMJA 1YUMA 1VL8A 1VSUA 2AWNA 3MJEA 2QPLA 1U4OA 1WOMA 4MUYA 3ROMA 4PR3A 2Q6IA 2Y92A 1B6GA 1Z0UA 3DLTA 3KPJA 3NTQA 4HH0A 1TKRA 4M86A 4P4LA 1QHEA 3A6DA 2PMEA 4DY4A 3B1ZA 3G02A 4LY0A 1YB6A 2J07A 3B1XA 4F5YA 4AY2A 4QNMA 2BGGA 4X1OA 3VV2A 1W581 3HPRA 4PZ0A 3O1LA 5H59A 4H27A 1Z8NA 3AFHA 4MV8A 4RDIA 2J3MA 5DPMA 3ZDBA 2C2MA 4MUBA 5TSDA 1IHXA 3AR3A 1W7AA 1W1IA 1N6RA 3MGBA 4Z2YA 1V16B 3W5VA 1AKTA 1WZNA 3PUXA 4NE9A 1U9IC 4DM7A 1OT3A 4KQEA 4P92A 1VJDA 3TBKA 3HXLA 4X44A 3JSXA 4WOCA 1D4OA 1NXSA 3RYCA 1ND6A 3AJEA 3HBFA 1PFWA 3U4CA 1ZLXA 3QE0A 5AK0A 4OHWA 3TSWA 2V6FA 1OGJA 4YXWD 1SOUA 4FFSA 3IXQA 3HRHA 1KH1A 1MXFA 3GHHA 1DLIA 3TYXA 1ZONA 1S02A 4YJ2B 1X8KA 1P9NA 1VIYA 2NSLA 4JUBA 4B4DA 3KPUA 4A8PA 4EITA 4TWRA 1K63A 3TRHA 4EK9A 1POWA 3BCHA 4BB5A 4YUXA 5AW2A 1WMFA 1R4MB 1P0FA 2ZSBA 4IVRA 2XTNA 4ZCQA 4MMXB 4HSEA 3DZKA 3C45A 4P7KA 1GZ6A 5HTKA 1QQ5A 4C0BA 5HTOA 3ICCA 3OQ6A 1E61A 5A7FA 3TR6A 3ZHXA 1D6MA 2VTEA 2RGUA 3PDCA 3O8QA 4HZGA 4S1PA 3SR4A 1FU8A 3GRCA 3QBVA 4UNIA 3ZDXB 1XCLA 5JD5A 1HZZC 3PIIA 1EX7A 2HGZA 1A4UA 5DN6A 2NVOA 2X5KO 4JLAA 3TKLA 3ZZNA 2B5VA 2OAEA 1KPGA 4IEEA 5DN9A 4DS3A 5E8RA 1Y5RA 3UW3A 1U0JA 5BVGA 5I7RA 1POXA 1II9A 1J42A 1W9MA 1UBGA 2C07A 1GNQA 5U4QA 2GF9A 4ZYTA 3T8YA 1M2HA 3UF0A 2R5NA 2OVBA 3FW1A 3DE2X 4OYYA 5E9AA 4AX4A 1L7RA 1MEEA 4WTOA 4JYAB 1JHUA 1Y48E 4KTVE 3VR6A 5IMSA 3AEQB 5IVPA 1YDMA 1XTPA 3EFHA 1KQOA 1CR4A 1SEPA 3MVEA 1W94A 4TXNA 3WGKA 1INLA 1AUVA 2HY7A 2XUQA 2A78A 4QJ3A 5GP1A 3W2EA 3ANNA 4ZOLF 2R6CA 4CG2A 4XYMA 4EX7A 4PYIA 2QF7A 1YA6A 4JOCA 3UYKA 3TTTA 1E6KA 2G0TA 4M36A 1BU8A 4ETMA 3WGUA 3KV3O 2ZCUA 1COWD 3ZXUB 3B1KA 2TMYA 2ZAIA 1KI8A 3C2QA 4R7ZA 1IMJA 1NFRA 4M0MA 5COAA 1XVIA 3D4IA 3S70A 1AXEA 5B37A 5BUSA 3V48A 5CA0B 1FK8A 3EDOA 4MV7A 3BD7A 2ZAOA 4HY3A 4Q9HA 4C4OA 4YJDA 2BI7A 3BWEA 3U2QA 1YGYA 4PQEA 5AUPB 2VF8A 4E6EA 4Q4HA 1V37A 4G89A 4TS4A 3SQDA 1YB7A 4N1AA 4CTKA 3Q15C 5EL0A 3WZ2A 3KD2A 2JH9A 1HFWA 3KHKA 2QN9A 3B7PA 2NO1A 3O93A 4KHZA 1GVNB 1MVNA 1ODKA 3OQOA 5EHZA 3HFJA 4Z6KA 1U7OA 1XTJA 2ATCA 2FPKA 1JG6A 4W9NA 3C3CA 4G65A 2H1CA 4M1WA 5HKKA 4FFNA 2CK3A 3EARA 1A98A 5LD2B 1MU0A 5HYVA 3R40A 2QT1A 4DDWA 4DV4B 5DLPA 1YRLA 3AM4A 1W0KD 2PD3A 4NYIR 4U7TB 4BLRA 3VDXA 4EUKA 2C59A 5JJIA 2EOAA 2Q6OA 1PYGA 1JG4A 3C3YA 1NNSA 1OFTA 4KQ2A 2ZTHA 3K4QA 4X1IB 3LCUA 4W7SA 4WXPA 1PBTA 4XX1A 4IDAA 4LBZA 1UL1X 1RRGA 5K3SA 2AUNA 2CBZA 4B76A 5G41A 3PC4A 1UT8A 1NPTO 2CMFA 3C4JA 1UFVA 1KERA 3OVMA 1FDVA 4GD3Q 1OXTA 4Q39A 5EKTA 1ZH2A 5EWJA 1WUYA 1E9EA 5B3AA 3UH1A 4BKMA 4E4YA 1F2UA 3FNGA 3T54A 1CEQA 4HLDA 5A1JA 1I7NA 4MKXA 4DMMA 1PL7A 4LQ4A 3JS5A 4U39A 1SVWA 3L1VA 4F93B 4UD6A 1G21E 3K94A 1ELOA 1MD9A 4Q01A 4C0KA 3FMGA 1PK7A 2F3RA 4WKNA 5KYUB 1X0VA 2MT9A 2HPAA 3NIBA 4CPDA 3VI3B 5HS4A 5HP4A 1YR2A 1NV9A 4IO0A 5BWMA 1XALA 2IX3A 4NBLA 4PBTA 3C87A 3T7KA 4KN9S 3D5EA 3AWIA 3IPLA 3MSCA 1JIQA 3P19A 3PDUA 3FNHA 3LO8A 4DM3A 5JQGA 1BW9A 2HK9A 4TYQA 1AUXA 2OK8A 4NAVA 5HE9A 2AS0A 2P9ZA 3FMFA 1VHTA 3T6KA 8ABPA 3QXGA 1USUA 4EA7A 1MABB 4NJEA 3ROZA 1XDDA 1OJ7A 4PLCA 3PF9A 1KAMA 1YAHA 4JUCA 2KBFA 2XWJI 7REQA 3U49A 1FOEB 2SECE 2I2CA 2R84A 3FHJA 3U48A 4KI0A 4PG5A 3KPVA 3GDHA 1RACA 2R751 3JQRA 2UUCB 1VPVA 2RG7A 4G36A 3CJTA 2HMSA 2ON6A 4PSAA 3NB0A 3PJEA 3E35A 4R8SA 4Z9BA 1O4WA 4AZ0A 2A5JA 5A0VA 3EOZA 3TXYA 4EW1A 2DBQA 1AGXA 1C4XA 4D26A 5AVZA 2X9QA 3E8MA 2XDWA 5HZHA 2AI2A 5ALUA 4DEVA 4HAIA 4GC5A 3AU8A 4MUMA 2P0YA 5BWNA 1GZDA 1QOPB 4MR9A 3ZWKA 5ADWA 2VJDA 3N0XA 1EQAA 2GBLC 4RYLA 2ZT5A 2OG2A 1GPJA 3H1EA 4YBZA 4F1WA 4X63A 4OGFA 2HUPA 3UMCA 4EQZA 3S81A 2QLBA 3HNPA 2QG4A 4FE3A 3L8MA 4ZKDA 5CB4A 2XOKD 1XDSA 2UAGA 4P86A 4OX9B 1Q12A 2QE7A 5AOCA 3BFPA 1ORWA 5L3RA 1N7JA 5IUNC 1I33A 1YB5A 5ADHA 2XRZA 2YWBA 3DNPA 1SU7A 3KLOA 2NVUA 2VH1A 4OSPA 3O83A 4ZV9A 5KNLA 3GX1A 4N3AA 5KNBH 1ESCA 1R9NA 3QEBZ 2FJPA 4P31A 5BQFA 4YMLA 1U5AA 4WBNF 2AZMA 2AN3A 4LY3A 2NQ2C 1PFYA 2VCHA 1E5QA 1NQ5A 1JU3A 3K0KA 2KHZA 3T5GA 5FP0A 3NTUA 5E6SB 2GZ3A 4FGWA 4TZTA 1ZOLA 4JI4B 3TNDA 1JDBB 2D06A 3UJ8A 4JBGA 4MW2A 5L6MB 1P7ZA 3NOVA 3IBSA 5AI9A 1XLTC 3W5DA 4HLQB 2Q7OE 2GJ8A 3CRW1 3TG2A 3TVTA 3NUGA 4JKYA 2ZUBA 1S7GA 1GFIA 3AOGA 2GK4A 4C03A 5A4KA 1OXBB 5TGTA 5FOVA 4N41A 4FCTA 5FLXA 1E3IA 3RRJA 3TLCA 2RHHA 1ST2A 3TRFA 5DNYB 5BRAA 4X6LA 2PX8A 4KFRA 4UAUA 3ADBA 1B0PA 3BFJA 3JD4A 4I4TF 1D1TA 1J0EA 2WVJA 1THZA 4M87A 4KITB 1QJCA 1XZLA 3R5XA 2EFDB 3RVSA 1KWGA 2H1OA 1N6IA 2R8ZA 4OK5A 2X2FA 2RK6A 1P4GA 2I22A 3BJRA 4IQGA 2V54A 3HWX1 3QXCA 1DRKA 2ABWA 3K6JA 2XNDD 1XRJA 3D3QA 1TMYA 2QM7A 2OBNA 2W37A 2YY5A 3F67A 4TXLA 4DQXA 1QCDA 4DC9A 3S1AA 4RJTA 1GNTA 4FJ0A 3RGWS 3VNQA 4RD6A 1KK2A 2IE0A 5JSFA 3L7JA 1C0PA 3PI7A 1GARA 3A3NA 5FORA 5KZMB 2H18A 3M34A 3GIDA 4LBWA 1NN1A 3LHIA 3WL6A 1MDBA 3L40A 1QV6A 3HQ4O 1C81A 3AB7A 3K9NA 3L06A 1TADA 3R3UA 4IIVA 4WASA 2NSDA 3W9UA 4D41A 3CR7A 3WC4A 2XGGA 1R6DA 1EFRA 2ARKA 2QY9A 1O5OA 4ND2A 2GTHA 2YJ3A 3G6WA 3KOYA 4RVFA 2O6HA 2QYSA 3I12A 4N76A 3DKIA 1QYDA 2ZSHA 3NHKA 3OSZA 4N5IX 2Q6VA 1IY9A 1P1BA 4ZD6A 4CG3A 1KBOA 1N5IA 1H1LA 4EJSB 1N7GA 2FPSA 4BO4A 1CPYA 2W6QA 3IQXA 3BWDD 1W1WA 5KPJA 2NPIA 4HYEA 3KXLA 1NA5A 2DE0X 4YRQA 2GKOA 1QYCA 1N33B 3CZPA 4LY9A 1RM3A 4LF8B 3ITNA 4H6XA 1SBCA 2Q50A 3EHDA 1M1UA 3GA7A 4WKCA 5B55A 4OBBA 4BJ1A 4XCQA 1T1SA 2D0IA 4U8HA 3SYRA 4AWXA 1BDJA 4WPGA 3EVBA 1G8FA 3EGCA 4NEHB 3VR4H 3GRRA 1PBNA 2J9RA 1GZUA 2JAXA 1F5SA 3IMFA 4FOTA 2J6CA 4KIJA 4N7JA 4Q7MB 4Z0PA 2V0NA 1EWYA 2E82A 3NI2A 3QBEA 3GFQA 1I0LA 3TVDA 3S8YA 1G66A 1T9AA 2BV3A 2Q8QA 3H0CA 4I2NA 4RHFA 1OKKD 2ZYDA 1D7AA 3DZFA 3IP9A 1IM5A 3PUVA 2R4TA 3QJ5A 2HI0A 4HN4B 4MVJM 3CNNA 4N65A 3SF0A 2A0WA 2OYCA 2QLMA 3QY9A 1W2WB 2DH6A 2FWPA 1VKNA 2LKDA 1N6LA 3C3XA 4N0EA 5C8YB 5KJEA 4B6EA 1CXZA 1QS0A 1SXJB 2FK7A 3R0VA 4TTPA 4HWKA 1ZH6A 2JK1A 2PGXA 3GXBA 2XDAA 1PVOA 2VHUA 4GF5A 3QWIA 1RAGA 4RPHA 1X80A 3DJFA 4YLGA 2V1UA 4GEGA 1QYIA 2ZUUA 4BMNA 3MF4A 2BEJA 3MRTA 4ZVSA 1H3FA 4B3BA 1DAHA 3TL2A 4U7DA 2DTDA 5KJ6A 2FMIA 1A5AB 4ZJYA 3AHCA 3D0KA 1V6SA 5BUZA 1XYGA 1GGJA 1QPGA 4KR9A 4BMXA 1E99A 2ZSFA 3N74A 1CY4A 3ELUA 3MXOA 3WHLA 5IABA 4Z9XA 2UVPB 5JSQA 5L3VA 1H3EA 2F17A 1FSFA 3A1FA 1M1ZA 2C3PA 2QTTA 1N1EA 3PHJA 3NEYA 2EQAA 1K8YB 1ZUIA 3PEUA 5CT4A 5IFKA 5THQA 1XL1A 2YJGA 1GYPA 2HHCA 1XZ8A 4RTQA 1U4SA 4GNRA 1N2CA 3P2JA 2XAUA 2A5FA 4EZEA 2GEDA 1Z2DA 1FUKA 3I3SR 4BRSA 4ZCMA 2WJJA 3K9HA 3ZE6A 3FCEA 1RXCA 1LX6A 2Y67A 3P0RA 1GFWA 1P2VA 2HF2A 3C6BA 2XJ9A 4FWIB 4NICA 1EFVA 1R4NA 1Y3DE 3EHEA 1C7ZA 1UMDB 1WXHA 3HCCA 3WK8A 4B71A 3LD9A 5B1YA 3LCRA 2X15A 2HJVA 3DEAA 1A96A 3I5XA 4QYSA 3EEYA 2GAOA 5CLLA 5DOVA 2KPOA 3EZLA 2RHCA 3ICOA 5DXJA 3BGIA 3STUA 1QPBA 4IV0A 1SXJC 4MAMA 4PHGA 4HWGA 4ND4A 1UFOA 2CLCX 3FHCB 3I6ZA 2J45A 4P84A 3QELA 2ODAA 4FBGA 2ZU6A 4EAQA 1Y9AA 5JNVA 3CNHA 4TXHA 4MI9A 3ML1A 2J4FA 3A3OA 2BBOA 2C58A 2ZKIA 1NVVR 2O3RA 4RKRA 5AOBA 4A0QA 4F6RA 1K92A 1G20E 4LN1A 4V0NA 1SQGA 5E2AA 2B2XA 3HG7A 2RH5A 4RVHA 3FYUC 3L7KA 1JB9A 2PZLA 2V7WA 1HZJA 2ZYRA 3PDJA 4IS2A 4MKIA 3SZOA 1KXZA 2O8FB 1MUUA 2VYFA 2FMXA 4HH1A 4KZKA 4NJMB 2V7TA 3LXXA 2XUFA 2PRSA 5CDTA 1PL6A 4NFSA 3HKCB 1WXFA 3OO0A 3WRWA 1SG9A 2M2IA 2QR2A 3WZLA 5CRIA 3DVAA 2DFKB 1WSBA 3ZD7A 5KNCH 1L4UA 3DW1X 1CHNA 4M1KA 5D8DA 1SAYA 3R5TA 3DV0B 1W4RA 3SFVA 4FFRA 4P38A 5LIPA 3QMWA 1T35A 4F3CA 1K98A 1OWNA 2CZQA 1AK9A 3GQBA 1WTAA 3D4NA 5TPZD 4KVFA 1ADBA 3WXMA 4YV1A 2G9UA 1SA0A 3AEKA 2BPOA 3JR3A 4WESB 2I87A 2ZJ7A 2XA2A 3WIBA 1A04A 4JI7B 5FWAA 3ZGXA 1ODTC 3HXTA 4O3FA 1GTG1 4WADA 4TZ0A 1IJFA 5J23A 4O4LA 4M49A 2P30A 3GJTA 5BV8A 3IKLA 4G26A 4J2TA 5A3JA 4RF2A 4D4KA 3E03A 1RI1A 2PG3A 2GUGA 3IIEA 3EZ9A 3HEBA 2BFWA 3OHMA 3U4AA 1WBJB 3IL2A 1O0CA 3M3PA 2J7KA 4EKIA 1NAIA 1U8EA 3QBTA 5D7BA 2PSEA 1F2VA 3MWDB 3NATA 1FP4B 2GH1A 5EP3A 5FTJA 1DO2A 4ETIA 3GK3A 1KI2A 5DGIA 2CDBA 3CGGA 5AH0A 4CEIA 2PLNA 5DGXA 3AIMA 1O6CA 2YZMA 2QW1A 3REQB 1T36B 2VNSA 4RGQA 3CO5A 3VPAA 4D0LB 5LOVA 3L0PA 1II8A 1MBZA 2QSZA 1N2CE 4KYIB 3CF6R 2UYGA 3GDGA 3PV0A 4CBVA 3S2YA 2OHJA 3R7NA 1F0NA 3ZH2A 1WF3A 1VMIA 2H2IA 3F7OA 4XDHA 3DWIA 2Y1KA 1VKHA 5BSGA 1JQBA 3AW9A 4CMKA 1OA0A 2BUAA 5AI4A 3USZA 3JAKB 5K0GA 4MGHA 7MDHA 3K1JA 2F8MA 4JJAA 2B61A 3IUSA 3PXUA 3G2OA 5T8KC 4Q3KA 4F6CA 1QE5A 2XLBA 3O8OA 4A6DA 1N6OA 5I5GA 3E3NA 1WHSA 1JZTA 5GZ6A 4ENUA 5ER9A 3C7CB 5CNIA 5ALKA 1FUYB 3ECAA 3PGMA 5H02A 3V1NA 1UBRS 1NVMB 2Z98A 1GPDG 3E9DA 3HCWA 3NHUA 2IVZA 2TSYB 4ARUA 5IC6A 1ZGCA 4YCJA 1S0UA 4X6XA 4XYLA 4ZTBA 5F1OA 1N77A 2C4UA 3GAAA 5T41A 4F84A 4HYYA 1ODLA 2OK7A 2HSDA 1AMOA 1QOQB 1ORHA 2ZJ8A 1YZHA 2VDOB 1PRYA 1JXMA 2VDKB 3GA0A 3OPYA 4M6WB 2ZI4A 4LZLA 3IEUA 1S2OA 2WHQA 2VZ9A 1QG6A 2F1RA 2V96A 1PYDA 4GP7A 1G21A 5A9SB 2JLXA 4PXSA 2DRIA 1FP7A 3AIKA 2CFTA 3CB4A 4Q7EA 2A7XA 3RG2A 4FE4A 3AUFA 3SJCA 3KFVA 1QYWA 4IV8A 2DBVO 4FOSA 1HRKA 4PGFA 1LTKA 4OQXA 5AWFC 2BHTA 3RNLA 1L5GB 3SOZA 5CURA 3W1VA 4CCWA 4RS3A 1NP6A 1DRWA 1XZKA 1YQ9A 4EQ6A 5DW0A 5AP9A 3ME5A 1BCSA 4B82A 4OQZA 4QUBA 1VJ1A 2IOFK 4X90A 2DJ5A 5D2CA 3T5MA 3MPOA 4PCUA 5HOQA 3B9QA 4JBWA 3OFJA 4KMRA 1JYFA 3R9XA 4BFVA 1JFTA 4F91B 4B3CA 1F0KA 4GSKA 3R6GA 4UHEA 2G5GX 2NACA 3GN1A 3AERB 4BWYA 3SD7A 3OPVA 1BE8A 1ADGA 2I4IA 1Z47A 2P9EA 3DMGA 3GF4A 2Q5LA 4PFJA 2JEYA 4DV6B 1RJWA 1EDDA 4DJEC 3NETA 1LPOA 3AY0A 4MR8A 4OBEA 4FXPA 3FYUA 4GWKA 3ZR4B 2PU7A 4RK6A 4ZQBA 1UKBA 2PBRA 1SUEA 2AMJA 2CMHA 2X41A 2Y1GA 3OTGA 4L0QA 2OKGA 2H2WA 4Q4AA 4BP8A 5HVNA 3Q3HA 1RRKA 2C61A 1VKRA 3UMVA 4YRKA 3VNRA 4CLRA 4EF5A 3GAFA 1KEUA 4I1SA 1HO3A 1ZMBA 2FN9A 3LRTA 3OP4A 5DTEA 3ZJ5A 4Y9SA 5JBQA 1M7BA 4D5GA 3M4YA 4MKRA 1Q22A 1EIWA 5T3UA 1AU9A 2WJYA 1OU4A 1WXGA 1IEWA 1K2WA 3IP3A 3Q3CA 5DYNA 4CMJA 4JBNA 3OQBA 5E1BA 1KR5A 4JNKA 4BE9A 4D8YA 1E2FA 121PA 2BZ0A 2UUBB 3GUHA 4TTVA 1M8GA 4JJFA 1G2IA 3KLBA 4PX3A 3ND6A 5A7GA 3DDNA 4O3MA 3DA8A 4UD2A 3SCZA 1ZOPA 5DBGA 1JAIA 2AI3A 2ZTVA 4IM7A 1HA3A 5JCJA 3IKTA 2CJYA 4M1MA 3RS3A 3DDHA 2HA3A 3DBRB 1ST3A 4QPJC 4ZZIA 4UEJA 5HIJA 3D7SA 4DCOA 1G20B 3FPBA 5I7FA 1SM4A 2H29A 5SYNA 4EGQA 2MYTA 2XIJA 5TV2A 5ALFA 1JIUA 5EIBC 3IQZA 4FINA 1BD3A 1VB3A 2I29A 2LE0A 4M2LA 1WCWA 4WW0A 5CA1B 4WLOA 5GTDA 1WXWA 2RAVA 5ALSA 2FSIA 2OQ2A 2DGDA 3BUSA 3MB5A 4KU4A 5FPTA 5BWCA 4ZQGA 2NUAB 2DH5A 4WZZA 2FP3A 3RARA 1V5WA 1VSQA 1Y4UA 2Y9PB 1R16A 4N6GA 3REQA 4P32A 4QLBA 4DR7B 3K9CA 3OC0A 4MLDA 1QJ4A 2FWMX 2OO7A 4MXDA 1W5AA 2Q3EA 4DUGA 5EWMA 2EP5A 4FEYA 5AI5A 5DCUA 1SKQA 3BZBA 5C52B 2CF5A 3RW9A 1G4AE 1I5OA 4QOIA 1XZFA 2ZRLA 5TRTA 3T9DA 4R1TA 4KSCA 6ABPA 1G9XA 3A04A 2XQVA 1N7IA 3PUHA 4F45A 1EFHA 1GPAA 4DDUA 3K20A 2QORA 3ZXXA 2ZSIA 2VQEB 1NXVA 2DTXA 1I94B 1OAKA 1OI2A 1UWKA 2VHCA 3L04A 1PR4A 2F9FA 2A58A 1GITA 2X8WA 4HFMA 4QUGA 5FV4A 5K5EA 2HWYA 1SBTA 3ZGLA 3H17A 3QPCA 3WK5A 3OOSA 2G9NA 1XRSB 1CZUA 3PPIA 3RF7A 3TR0A 2V8OA 1JHYA 3NHAA 4G9GA 4LVUA 1GL6A 1R8JA 1BWRA 4E2ZA 2A9JA 4NS1A 4AYXA 4EY4A 1H2WA 2HIAA 5E6UB 1XCGB 3CSUA 1RQXA 2JGMA 2PXHA 2Z8YA 4L5JA 5GZ1A 1MGOA 1UPCA 2FZWA 1X1DA 2WIKA 4DM4A 2YYZA 2ZCVA 5K9ZA 1BH6A 4BQSA 1NVBA 2GAIA 4P5DA 1JG3A 4D3FA 2YXEA 3HGTA 1KNQA 4NFHA 3HN2A 1XJWA 3HY6A 4IXNA 2EX4A 4QPZA 4NYMR 2VHQA 1C30B 4BIMA 3ENQA 1NXXA 3F6YA 3AF2A 4URUR 1KY4A 3WA6A 4D4LA 2H5LA 2NZ2A 5AOVA 1L5LA 3UKDA 2FW8A 1KPHA 3K96A 1DLJA 2J3JA 1KAHA 4CQLB 2DB3A 2WAYA 3GU3A 4MUXA 5DMHA 2GCOB 1BCRB 1O08A 1T2EA 2ZOSA 4AZWA 2H1RA 5A03A 4KKVA 1PSWA 5I7OA 2BMVA 4FNMA 1ID8A 4F2DA 1H1TA 3DFUA 4KQWA 1USVA 2R9VA 3KWLA 4OQQA 3TH5A 5JZMA 3JYNA 5CHYA 3SLGA 4L51A 2PA0A 3NFYA 1HE4A 3E5NA 3FKSD 4KQ6A 4N6OA 5LDDC 1QGOA 3K6RA 2XXAA 1JLMA 5LMNB 1UZMA 2WFLA 2O8VA 1PR2A 1WUHS 3B5IA 1NYTA 3BGOS 4NCIA 4RIHA 5EZ6B 4R2LA 1T6BY 1YSCA 4RFSA 4ARCA 4NR0A 3KQTA 4URHA 4CKCB 2QD2A 4WXEA 4JXJA 5C80A 1DUVG 2XE8A 3FCSB 2CXQA 4E32A 2Z30A 3MWLA 1SBQA 3R8CA 1LBQA 2O7SA 2EU8A 3EZ2A 5JE8A 4QTTB 5GM1A 1MP0A 4ODIA 4F6RB 2VPZA 1ZIYA 2Q3BA 4K7JA 4X1YB 5FRDA 2FEMA 2FEXA 2V55B 3WWPA 1PUJA 3LYHA 4UC0A 3DCYA 3OPYB 1CF2O 5EIBD 5BNWA 3TMKA 2VJAA 1EHCA 1DUSA 5K51A 1XPJA 1ZDMA 5HBRA 4LCBA 1YBVA 1V43A 3TUIC 3NCHA 5JATA 2BY4A 3V4SA 4KXNA 4TKVA 3RS8A 2XUOA 2ILTA 4JEMA 2IYRA 3UHJA 5EKUA 3HSKA 5FDFA 5AVOA 2HJ9A 1V3QE 5AJZA 1F14A 2X0IA 4D46A 4KP7A 5LIRA 4JELA 3VYWA 2VHWA 2AW3A 1ZRNA 3KOUA 4GMFA 4M46A 3SC4A 1WHSB 2XCSB 2B78A 1YMQA 2ZWOA 1SNYA 3UFBA 1HSOA 4EL0A 3MTJA 1TW3A 1PJBA 5EFOA 1VMAA 5IC5A 1E1YA 1F20A 1OH6A 4GMGA 4IR7A 2ZUSA 4KQIA 1QQ6A 5BSHA 1ZR4A 3RV4A 3HKDA 1ULTA 4RK0A 3T7EA 2FR1A 2POCA 1G3RA 4Q6BA 3W06A 1K9VF 1D2EA 4C4TA 1AKYA 3TQRA 5IKOA 2YQ5A 4DIFA 4Z0NA 1BMFD 2GZSA 3ABSB 2B36A 3CCFA 5LN1A 2OMKA 2WNSA 1ZRMA 2QP3A 4KXLA 4BJ5A 2CLIB 2JJ1A 2IZZA 2C77A 3GZNB 5HE8A 2ODEA 2PZGA 3BS4A 4UDNA 4Q15A 4UPEA 3EPHA 3OTQA 2G72A 2ZRFA 2VAXA 1H8EA 2HJHA 3H8WA 3JQ9A 1XKXA 3EQ9A 4RZ3A 4KJXA 1JTEA 4X3PA 1FXSA 1H3NA 3P0IA 2QS9A 3DL0A 1T8TA 4UZEA 1UWCA 1Z75A 4DNFA 1X80B 1U2DA 3QOWA 4ZI2A 3OH8A 4HPJB 5KVAA 2H7YA 3AZOA 4DUPA 2UZ0A 2FFRA 2X1HA 3QEMB 1GIAA 4FZJA 1BQ3A 3N2YA 4PLPA 1DCTA 1PUXA 3E4CA 5CVEA 5DHQA 3TL3A 3SOPA 1DUIA 1MJGM 2V7BA 2WAXA 5KTKA 2ZIFA 1JKMA 3V8MA 4FOLA 3DE0X 3OJEA 5BMVF 3KQYA 3KKKA 5IDWA 4DCNA 2XVAA 3W6PA 2PSSA 3C1OA 2JGJA 1EFLA 1X2BA 2ST1A 2A0YA 1DBPA 2XB6A 4OB6A 4S0XA 1CJCA 1FXWA 4DSNA 3FMOB 3MQ2A 4EG1A 4B35A 5AVSA 2ZB3A 4LJ7A 1K06A 4RQAA 4GFDA 3JQGB 1ICIA 2XGSA 1EBUA 1OASA 4U4AA 5HFJA 2DUUA 1DQRA 3OEYA 5EYPB 4A3SA 4EQ6B 5AW7A 1ECLA 2VA9A 2ZRMA 2C98A 2X22A 4UAGA 2OY0A 4REMA 1XKTA 3WYEA 1ESNA 2B4RO 4LZOA 4G97A 3OE5A 2HSJA 2J87A 3EYAA 3P45A 4FR2A 5CX4A 3T4UA 5EXXA 3F2VA 3PHLA 3Q12A 4PWZA 3DE6X 5LDGA 4WFQA 5EVCA 3HABA 2MOKA 1YL5A 4FC6A 1DAIA 1ULBA 1I01A 1O9GA 2DM6A 3O8LA 1UOOA 3IRVA 1KSGA 3UNXA 2J0SA 5AK4A 3SXJA 2Y99A 5HKLA 4UQLA 1HLFA 1A5SB 3QELB 1VIVA 4BNLA 4LNAA 3IHKA 5BSTA 1REQB 4PQYA 4Y2XA 1L5VA 3S2IA 3VVBA 3I4CA 2IZ7A 2A2ZA 2X6TA 3GLFB 1KMCA 2J0UA 3QKUA 1T6NA 1CRPA 4R3WA 1ZC4A 3AF6A 5HF8A 2YVKA 2IHUA 3T1QA 3EA4A 4UMFA 3DTVA 1RIIA 2YMPA 2CGEA 5IT4A 4QPPA 3FOBA 5JSZB 2OUKA 2VRCD 4JC4A 2Y76A 4WLFA 1PJLA 2QU8A 1IXZA 2XDYA 1Z7YA 4QA9A 2R47A 4R1PA 2RCYA 5JXGA 3JASA 3HYCA 4L2IB 5CFMA 5A4FS 1WABA 1NRWA 1ZHOA 2B37A 2DSTA 1G6Q1 1EVLA 3FWNA 3AP3A 1QKJA 2FZLA 2D7CA 3H13A 4G5QA 4IQFA 1Q0UA 2HK7A 4FEAA 2I80A 3RREA 3OAAD 2VWPA 3LC0A 3LLVA 1AA6A 4L9WA 5C5DA 1AHNA 1E8MA 2CYBA 3A3PA 4HL6A 3HKBA 4RMHA 4WGFA 2IPXA 2R96A 2WVHA 1Z6ZA 3F6CA 2YFYA 3IPYA 2E7ZA 2HDNB 4CUJA 1P2SA 4UM5A 4QM7A 5EQDA 1EWVA 1P62B 2H4WA 3ABOB 4BO3A 3KZCA 4FD2A 2XOEA 3VC3A 2GDZA 1SHTX 1Z13A 5JQGB 1UOQA 2C57A 2CYAA 3JVDA 4RY0A 5EMMA 3RD5A 1VRCA 1T8YA 3PXGA 1E2JA 1ZPDA 1X70A 2QPOA 1EBFA 3U5TA 1IK6A 1RYHA 2ALJA 3WWDA 2JLUA 1ZUHA 2FFHA 3VR5D 1YT5A 1C3OB 1M5TA 4RCVA 1FDTA 5HZKA 1BDBA 2AEJA 4GE3A 4PTYA 3UO8B 2Q62A 2FFBA 4YECA 2HKIA 2XWBF 4OIMA 4MHTA 1DKOA 1I36A 3CG0A 1CT9A 2H07A 3TCKA 1CS0A 4QQFA 2VZ0A 3NDPA 1V6AA 4HAOA 4M54A 2V98A 2D2FA 4WCDA 4OGGA 4C30A 3ZDFA 5JPCA 4OXIA 4ZVUA 3W3AH 1VMEA 4N3CA 3ZS9A 3PJRA 3CEHA 4G07A 4AJJA 3KKPA 3FUCA 3TQHA 2VTDA 3GLKA 3MMZA 1JR3E 3EXFB 5E6SA 3A6KA 2P90A 5HZMA 1NF8A 1I3MA 3DS8A 2HQSA 1VCIA 2AMLA 2LVBA 3BHJA 2C7OA 2QLJA 5M3BA 4PPGA 5IJAA 3WNBA 4DRXB 2O2EA 2CLEB 3RK1A 5T67A 2PT7A 2V6BA 1XX6A 3T61A 3W2GA 4C0AC 1OBHA 2D1FA 1GFZA 2EFHB 4FDMA 3LG2A 2X14A 1VYTA 1WO8A 4NECA 2O5VA 1RE0A 4X94A 1TE2A 3T3IA 3ICQB 4JD5A 1TJ5A 1I1OA 2UYQA 3ABRB 3K9WA 1A71A 1EX1A 2FOIA 2DQYA 1DIBA 2EJUA 3ZBTA 4ZHQB 1DP4A 4EB3A 5BYAA 8LDHA 4KJZA 2WMOB 2CHFA 1W30A 5LM3A 5H81A 2YUTA 4DLVA 2RSLA 1C8KA 2WTUA 4U0KA 5FR2A 1L5HA 1A9RA 1YNSA 1PLKA 3TBFA 2B2CA 3BHNA 3UPTA 1MMFB 4IJ5A 2IDMA 2Q9AA 5B57C 3SHQA 1A50B 5CBPB 3O1IC 3ODPA 1CERA 5LZ2A 3BRQA 5K8LA 4F21A 3QIVA 1RMYA 1PEAA 3ONFA 4EGJA 3O4GA 4BQEA 3CUVA 3L5KA 1IZ9A 2G07A 3K73O 2R66A 3DZGA 4GT1A 4KE6A 3UBMA 4BKQA 1XK7A 2O6LA 1EZ1A 3OQ1A 1QGED 2COEA 3MCVA 5FUWA 1MX5A 2H8KA 4UE3S 2LRHA 2D59A 3UJ3X 1ZG3A 4M9QA 2RMKA 2AK3A 3SX4A 5I8WA 2GO7A 3LSYA 5C8DA 3O47A 3F3YA 3IPAA 4B6QA 3EC1A 2CL5A 4US0R 1F9AA 3PKZA 1VHDA 3CRMA 2D2VA 4UTPA 1R6VA 1RC8A 2WR8A 3CW8X 3OJLA 3F6RA 5ALRA 1PV1A 1MO2A 4G1EB 3NEJA 4UE6A 4RY8A 3GLQA 4PPNA 4PV7A 1ML4A 3L5OA 4P0PB 1JR6A 4AG5A 1RPJA 4JOQA 1N2EA 3GJ3A 4DLAA 5DYYA 2B1RA 2HZ7A 2OBMA 2Q8PA 2JGNA 3O31A 1NBEA 2J9ZB 1IDOA 1ZEMA 5DH9A 2Q2WA 3LQYA 1BG6A 4NPCA 3ADKA 2R8BA 2Z09A 2NO7A 3CWZA 3LECA 4XFKA 3KTDA 1LW6E 3FBGA 1GGEA 3JQGA 3IVRA 3DYVA 4YJ3F 2IY7A 3TZHA 2YYSA 4AN4A 1VL5A 4PAWA 3AJ8A 1MENA 5D87A 1OXSC 1B1AA 2QTWB 3BPSA 3I76A 3MFYA 5EHIA 4L4XA 4KWIA 5FA5A 3HBAA 4UTRA 2RGRA 3F4LA 4PS0A 1G98A 5CXQA 1JYEA 3L0ZA 4E5PA 2CY0A 5AVJA 4W5RA 1OXVA 2VP9A 1X7WB 2RGNA 4IKEA 5CLIA 3TDKA 3VBCA 3IAUA 1YJ5A 3NM6B 2ISCA 5DIZA 4TL6A 4WQMA 2HJRA 3HDHA 3T99A 1S8OA 5IT0A 3M70A 3SYLA 3IT2A 5DM0A 1Z5OA 1JA9A 5DK4A 2ECFA 2ZE8A 3DFIA 3ADPA 3IV6A 2ZRPA 1EA7A 1YIAA 2BMFA 1WHTB 4CUKA 2AE1A 4UKDA 2VRCA 1SGWA 4QTUB 3ZE8A 3GBSA 3SJBA 2HHLA 4BNVA 5JPIA 3L02A 1S2LA 3GFTA 3HO8A 3ZNOA 4FWBA 1J8FA 1UBNA 2YZGA 3BWYA 3F1LA 3GGDA 4UASA 3N58A 2WJVA 2R8PA 1CUAA 1JMVA 1XT6A 3AHFA 3R3WA 4G0XA 1AMUA 1R0BA 1QP4A 1ZIPA 2OUIA 3H5IA 4TMWA 4C07A 5IVHA 2A0UA 2V3VA 3G7NA 1NN3A 1R27A 4OKIA 1N8SA 3WV5A 3L3BA 4I3GA 4CEHA 3FFWA 3F71A 4EHLA 1GKLA 5FOSA 1ATZA 3ZTTA 4ZOEA 5BORA 3I5AA 2J4CA 1EUCA 2WF6A 3ONNA 4OM8A 5DTQA 1WW8A 3EVNA 2Z4RA 3X44A 3J7AC 5EZYB 2J3QA 3NPMA 4DWVA 1GTSA 1Q91A 2RHGB 1QH0A 2P67A 4FE7A 3G7SA 1UJ4A 2BYTA 2H6EA 3OZ7A 3O7MA 3COWA 4KR6A 3FJ1A 3HRIA 4A2PA 3B8HA 2PFSA 1PV4A 2R62A 1D4ZA 3LUHA 2JKYA 1BQ4A 2OV4A 2XQGA 1S6YA 3PPVA 4NNPA 5KAPA 4A7PA 4D3XA 1HI9A 1XEAA 2HV9A 1C1HA 1E3SA 1NRIA 2GLTA 5IKXA 1HKHA 4L28A 3PLNA 4KE8A 2FQQA 1N2SA 4RJLA 1RD4A 4UCWA 4C0HA 2PANA 2XRYA 1OLXA 1V0JA 4LOJA 3HR8A 3A28A 5DMXA 5SV2A 3JWIA 3NX4A 1TPZA 4WCVA 5LNK6 1S3SA 4ZOLA 2VPXA 2PIAA 3F90A 4YAGA 1F9EA 2YJTD 1IN8A 2Q5QA 2IFTA 3ND5A 1ZI8A 3OU6A 3EIQA 4S1NA 4IY1A 1C9MA 1XIVA 1PFVA 1FXUA 1ZH0A 3BZUA 1NHGA 1DEKA 2UUOA 3ORSA 2GPNA 4H3SA 4L78A 3K9QO 1IZZA 3QTBA 3P9XA 3Q3GE 5AM1A 3T3PB 2IF2A 2W58A 5ERGB 3EMBA 3QX8A 1KI4A 3DDCA 5JNLA 5AHWA 1KO4A 1RLTA 4CQMD 4KVGA 4C20A 1LUAA 1WEHA 3IA2A 4QPCA 5EE1A 4F4CA 2OOSA 5ALJA 2GD1O 2PKXA 2PVPA 2PS3A 3G23A 1LK0A 1EP2B 4G8CA 3SF8A 3UFXA 1X38A 3K0BA 3CMMA 3UK6A 2C8KA 4G0ZA 1PG5A 1WIWA 1KYXA 1K3UB 4NBWA 3WLOA 2WTBA 2W9XA 3QZUA 2J9GA 3A1EA 3B3JA 1FP1D 3FHTA 2GCPA 2FPIB 2MHCA 2XECA 4KLRA 5ESRA 5FUYA 3MHPA 4X64B 1CUDA 2V7XA 4L4SA 1PQWA 1V2HE 2P9YA 5EEHA 3HVKA 3OMWA 1XCPA 5F2KA 1FRQA 1KMIY 2ZIZA 5FPPA 5L7YA 4M7PA 2W98A 1WCV1 5EE9A 1SBZA 2GXQA 4E1AA 1T1RA 3IAEA 2DKOA 3M89A 5CFZA 2RHBA 2FSFA 4A8JA 2IUTA 3QRWA 2NPOA 5LBUA 4DMRA 1XWIA 3H9JA 2BAGA 3ROPA 3NHFA 3BDVA 1W35A 1SC6A 5K45A 4C4PA 2LDXA 4JITA 2P2SA 4UREA 3ORQA 2WKQA 5AK5A 1FFBA 3UHFA 5C7OO 4E13A 4TKZA 5JAPA 4JI1B 4ZT2A 3HN6A 2PCLA 4QEDA 2QJWA 3BFVA 1JMYA 4LZPA 1ZOIA 3SQNA 3K70D 1JKFA 1DXQA 3BJZA 4FHCA 3RB8A 5HR5A 3RS0A 3DDSA 5CYGA 1PEKE 3D6AA 1NW9B 2XMSA 3BD8A 1PLLA 1F8YA 3KKOA 1QM5A 4XGRA 3HCOA 4IIYA 5B1DA 3ROTA 3UJNA 2CT8A 1QWSA 1XMPA 3FZNA 3EDRA 2KMLA 1X87A 4BVHA 3TE6A 4CMBA 3R9XB 4MWCA 1K86A 4DMCA 3FB1A 1P80A 1P39A 1VLHA 5E0KB 3WNCA 1C1XB 1C50A 1NSTA 1TQ8A 4G81A 3Q6IA 3EVZA 2YRWA 3GGJA 2Z1MA 2AQIA 3BMXA 4PICA 1BMQA 4ZO8A 5B58T 4ITUA 3CKYA 1WP4A 4YRZA 3TDMA 1XMSA 4PHHA 1OXUA 3EPPA 3HZHA 3O82A 2L19A 1W5BA 3TOVA 5JWRA 2Q7XA 3A1TA 4LJ6A 3OX4A 4Q48A 1YMUA 4D9IA 4BZWA 1G21B 3OWOA 1KZ6A 2ENWA 3P9ZA 1YQTA 4HJRA 4LV6A 3FKSA 2WZDA 4RDCA 1L5KA 3TI7A 5JRJA 5DIFA 3FYHA 3TPFA 3TTUA 5KCZA 3RTEA 3C3WA 3SQOA 3K6SA 2CLHB 2VT2A 1DOHA 4R0NA 1A2BA 1JILA 1GL7A 3C7DB 2II6A 3KL4A 3SE7A 4BLUA 2JFGA 1V6CA 3RLIA 2L82A 5CA0F 1XNHA 2OMEA 3E61A 1BX0A 2VDUE 1ENPA 3DUWA 1WDWB 2J46A 5GMOA 3ZU2A 1QF6A 2XI4A 3KLNA 4LTNA 5JROA 3UXYA 3LGXA 3EZFA 4NCAA 5KIAA 3CN7A 1Y7IA 3N70A 4D99A 4GKVA 3BL5A 4FW9A 1JR3A 4PG8A 2H2FA 3KHTA 1LZLA 3FOAA 3SF8B 5ISMA 2PE5A 5SYAA 1GKIA 3NC1C 5HEKA 3RRBA 1XNRB 5CYPA 2ZS8A 5FAKA 3S40A 4B32A 4QBKA 5J43A 5LOVF 1Z0KA 5L3ZA 2E6UX 2WP8J 3IV7A 3JWHA 4RE5A 5HK8A 4D6XA 4OHZA 2OCXA 1DEAA 1NSFA 3U1BA 5I7UA 5CVUA 2FN8A 3INGA 1M66A 4RKQA 3W2IA 3ABQB 4LVOA 4DV5B 5FX2A 5JJKA 2I34A 1WR8A 2VZEA 3NWOA 5F51A 5ILQA 4BKOA 4KL8S 3ENKA 1K0FA 5COBA 3IKJA 1TU0A 3ELDA 4EHIA 4RKWA 1R4ZA 1WCXA 4YJFB 3ZZ0A 2OEPA 2GNOA 2HF8A 2B8EA 5JYBA 4QM6A 3H9CA 3JU3A 1Z88A 2P4EA 1GTZA 3I61A 1L9KA 3Q98A 1U3GA 3RU3A 3I0ZA 2C9BA 2XJ4A 5IMBA 4D98A 4DLPA 4M8LA 1J2EA 3EJ6A 4YH1A 1EVZA 4W4TA 3QXHA 1IDN1 1U3WA 2NWQA 2XYPA 4XLLA 4AS2A 3SVLA 1D0VA 1DTSA 1CDEA 2IRWA 4IIJF 4ZDWA 3SC2B 4RTPA 2D6FA 3A9UA 2F43A 4MCJA 4JGIA 4DREA 4E94A 2WYUA 4UULA 1KZ7B 2X9GA 3PGKA 2DQSA 1E7RA 3RAGA 2DFDA 4EZBA 1E9SA 1U81A 5JW6A 2FYTA 3W6NA 3LT0A 3GLGB 5AESA 1LPPA 1PR0A 3TLAA 1RQPA 2ODTX 1QZZA 2O52A 2ZEJA 3DLAA 2Q3JA 2PQ0A 1II8B 1IATA 5T5QA 1EP3B 3RRXA 2YIVX 3TIVA 1S8AA 1OILA 3EUEA 4MUKA 3IERA 3ZU6A 2YS6A 5BN1A 1ABFA 1GO2A 3NOOA 4M4SA 3ZWQA 1DJQA 2WLTA 2O54A 1A9XB 1U7PA 1YZUA 4MUIA 2DHRA 1EUCB 3A1NA 2IK8A 1EIZA 3I9JA 4I9GA 2EKPA 1EFRD 1KZYC 1MIHA 2WV7A 3G17A 3TXXA 5FYDA 4J91A 3QIAA 1YS1X 4HGYA 1NL3A 4I7EA 4FKMA 4K6HA 4LVCA 4IPTA 2VJOA 2AKYA 2AMYA 2JRLA 3ESZA 4JL5A 4R69A 1XCMA 4KO8A 4XPIB 1MXHA 2CLLB 5HIMA 5CEFA 3TJZA 1LPMA 2IX9A 4OJQA 5JHGB 4C76A 2X3YA 1JWAB 1V3TA 2OL4A 2YXPX 5JQGF 1ZGAA 2IUSA 3PCTA 3WAJA 3ZVKA 1GZ4A 1XN4A 2IGTA 3R5JA 4Y2PA 4GX0A 1GSOA 1RXYA 1E1NA 2XNDA 3V7FA 3EA5A 3L79A 4ASUA 4K8RB 4WH0A 5AKGA 4KW7A 1MAAA 4UXHA 3X3HA 4Y6OA 3OIVA 4RHYA 4BATA 4XJVA 4GKAA 1GPH1 2MU1A 1FNSA 2Q3DA 5E1DA 1UMDA 3U17A 1PNVA 2AR0A 4FYKA 2VAVA 4FHGA 3IPCA 5JCZA 3OP1A 1SULA 5DV9A 1OY1A 1CV2A 1T15A 4RHTA 3IGFA 4EENA 2RKBA 4GZLA 1T36A 3R7BA 1MX1A 1XHEA 2V6JA 3E5RA 1GP2A 4RZHA 3KOZA 2REXB 1Y37A 1NLMA 5AQ1A 1C9NA 4FMDB 5SY6A 3KO8A 4LF6B 1DELA 2D7JA 4MLZA 4CI0B 3E2IA 3GNTA 2FKNA 4XIYA 5BQOA 3LE8A 2QVBA 1JDTA 2QLLA 2VDVE 2ZJZA 3H99A 2YX1A 3AUUA 3RYTC 4J94A 2HB6A 3V6MA 1FS4A 1QONA 3F47A 3FJOA 4YWHA 4GH5A 3D2CA 1Q5PA 3BD6A 3W5CA 2N46A 2PV7A 4M83A 4PPQA 1U6KA 3QFTA 4PTLA 2VRBA 1WULS 4JDUA 2H1SA 4TMVA 2HXGA 3ZK9A 1ONPA 1EQUA 3HXMA 4RVUA 4ZT4A 4C2UA 4WFIA 4AJKA 1E9CA 1IAQA 4QTXA 1IN6A 1FDOA 1ETHA 1K8QA 4QUDA 3AF5A 4UVGA 4ZALA 1SPXA 5I4BA 4CGZA 2BTOA 2FZGA 4IDHA 4Q47A 2PY6A 3BZWA 4RTOA 2YHUA 3NANA 1Q7TA 2Z6AA 4B2YA 1HE2A 2Q6KA 5HQ3B 4QWMA 1G18A 3A1UA 3EF1A 4CDMA 3LPNA 1O6FA 3I1JA 4GKBA 1GKYA 2JD2A 1J20A 2Q1XA 4H7FA 4MVJD 5JZBA 1AB6A 4AY3A 4EMTA 3JQ6A 3SEQA 1Q6ZA 1NLZA 1HE1C 4MA4A 3HO6A 3TPCA 2XIQA 1YAJA 3K0SA 2GFIA 3ORFA 5CITA 4HN2A 5F98A 1H2YA 1O96B 4BCBA 3EUWA 2AT1A 4ZGWA 3IS3A 3GLIB 1IBMB 2I6SA 2IIQA 3DF9A 4H3VA 2I8LA 3S2ZA 5DHAA 1IBSA 3P9PA 1AVTA 3K16A 1Y9ZA 4JVMA 4W5WA 4Z51A 2JZNA 3FMIA 4UBMA 3TQOA 3HMQA 4CKBB 5HILA 4CM9D 1UJCA 2NXJA 3H4TA 1FNNA 1Z4JA 2HA0A 2ODBA 4LRXA 3UG6A 2PQ6A 1XZEA 4HX9A 4JUAA 2LIPA 2P9JA 1N5JA 1QG0A 2QVGA 2YJ4A 2A1IA 2NV2B 2OKCA 3C4QA 2G04A 2PYZA 1TEVA 4TQ9A 4J7XA 3GNLA 1T3GA 3OKFA 1UXHA 1SUPA 2PX2A 4PZLA 4J0CA 4TGLA 1KDRA 5AM4A 1OX4A 4RZIA 1MIOA 2HU2A 2NU8A 4NIMA 3PPWA 5JRZA 1XXHE 1BVUA 1YVUA 1YR1A 1SVLA 3QF7A 4FQ8A 4MKGA 3VRHA 1GOTA 1FUIA 2XBLA 3LYAA 4EVSA 2IY9A 1ZN2A 2B2NA 4XM2A 2H31A 3H0KA 4RAOA 4JMPA 4DF3A 2WDPA 1XCBA 3PFGA 3LLCA 3GLFE 2ZTSA 1H9BA 4AFNA 3GBPA 3KR0A 1DXOA 1I7PA 5TIIA 2CJWB 1KJNA 1LQTA 4DEYA 5IF9A 3DHVA 3FI9A 2A84A 5TPZA 4MCAA 1NR7A 2AG1A 3DTVB 1JFFA 4QVGA 4WWHA 3DQPA 4RJIA 1G5HA 4HUJA 3NKVA 4QIHA 4YFVA 2X0NA 3E5HA 3P9RA 3WISA 1Y7PA 4M7WA 4UMEA 4MAFA 3FI0A 2NVUB 1TMOA 1P77A 2CDAA 3DE3X 5D86A 3HVRA 1C3LA 4PYMA 4R4JA 4D9KA 5HS6A 1DXHA 1KARA 1T0UA 1IZ8A 2IP1A 4D4HA 4GX1A 5CBKA 1M34E 3CRRA 1VLLA 1VZ3A 3QNUA 3TPZA 1F3OA 2IC5A 4DRXA 5BY2A 1KZGB 1LVUA 1E1QA 2B8TA 3IEPA 3IDSA 3L4BC 2PGNA 3EK2A 4MUJA 4N6NA 1IVYA 4M1SA 2ZJFA 1ODCA 2XUKA 1U2RA 1XYVA 2JFFA 3BGWA 2IHYA 4NVRA 1X0XA 2ZG6A 2WLSA 3LPLA 4NV3A 1LWNA 1CUXA 1U11A 2C2GA 4RZSA 5AVKA 1KEEA 4RL6A 2QBYB 2E1PA 4TROA 4HRYA 4R8RA 2WMYA 3QXXA 2QU7A 1Z7EA 2H2HA 1ZW1A 3FN4A 1GPBA 1K7CA 4CIVA 3NV7A 4H7DA 2PTHA 3Q7RA 4RADA 4ZMSA 3D4PA 1K4MA 3DSRA 4X7BA 5AR1A 1OHHA 1CQZA 2IKQA 3ZH9B 1JH9A 4UUAA 4L2IA 4MW1A 3RHSA 5I7EA 1KWKA 1Q16A 2I1QA 3AKCA 2NOAA 2Y1OA 2R4QA 2JI6A 3CLUC 1ZBDA 3E2PA 1KO5A 3J80A 1SQ0A 2HIHA 1J0XO 2WJPA 3ZV4A 3CB2A 3F9IA 5D01A 1YKGA 4Q16A 3G5LA 5EXPA 2X8LA 4ITVA 3KYCB 4RWEA 3LKVA 2VDQB 4FFOA 4ZCIA 1N92A 3LBIA 4QKQA 3WDLA 2O2CA 1OSNA 4P3XA 4EH1A 1K88A 2MINB 2XHZA 3I39X 4PBSA 3WLQA 4X85A 1VGRA 1JEQB 3GB9A 4MJ3A 4FXOA 2GI4A 2QQGA 3LS2A 3Q8WA 3UWOA 4NBVA 4QUIA 1HDCA 3V00A 4C0WA 1GNLA 1ZMTA 1P19A 1HZZA 5JXHA 3AY7A 4KAFA 3SYNA 3ZV6A 4J6EA 1D9ZA 3AJRA 2B7LA 3ICWA 4CU5A 2QMYA 1LY1A 2AFIB 1ZITA 2WD8A 5IH3A 1X77A 3TLBA 1CF4A 1BEUB 4K3VA 1JX6A 2YY7A 4UTXA 5AYVA 3W8FA 4U02A 1H2RS 1Z8FA 3IUJA 4H2DA 4BBJA 5TF0A 3VR6D 3VR2D 2KI5A 1A1SA 1K1EA 2DFTA 2OGZA 2RB4A 1BOFA 2VUUA 3B6MA 4Q03A 5IAEA 5JJBA 2YOHA 4POAA 3VTZA 2ZUWA 3M6XA 1YIDA 4X1IA 4PYNA 2JGIA 4B4WA 3I92A 4UOZA 5I48A 3QQ5A 2FPPB 2J5KA 5EE3A 4AO6A 5A71A 3AV0B 3N2IA 1FA9A 1J0CA 1XELA 1Z2NX 3DTNA 5F7OA 4P4SB 5B1IA 1PN3A 1WX1A 2OAP1 2YNMA 3OFND 4HB0A 4WGGA 4AWAA 2ACKA 1I3NA 3IT0A 2HCRA 1U63A 2F8TA 3D4LA 4UVHA 5JSKA 3WNQA 5DI3A 4UFPA 3DXXA 3AWDA 3TIFA 1RP7A 2HJGA 2XWPA 4G84A 4TMYA 1X9IA 1NUAA 3CR3C 1JFFB 3MUOA 1GDDA 2WHEA 2IYFA 3GJRA 4GX2A 4HP8A 1AS2A 3FDIA 4JLPA 2AOTB 5DCLA 1GUBA 5LYYA 2ZWVA 3E1GA 3UA3A 2PT6A 4Z3OA 4EHNA 2AN5A 1X8LA 3O8CA 1C7JA 1IOZA 4C78A 3QF4B 4D79A 5JO0A 1N1GA 2VN8A 4YXWA 6REQB 1IG0A 4GXNA 3ELBA 3AY6A 1GM5A 1H9CA 2G1KA 4OGLA 1XO1A 2XT6A 5DSXA 2XLCA 4HNRA 3VH1A 1C3XA 2H7XA 3F98A 4ZCLA 3WTBA 5JZOA 1B8NA 1G5RA 1H6DA 4JXXA 5ERYA 3ZOZA 4D0RA 3H5WA 5KNDH 1BVRA 4QXMA 1TK2A 3K9LA 2OWEA 5DWQA 4RK4A 2YY6A 4KOEC 4NU0A 5JFTA 4HVTA 1AY0A 4RF4A 2FHSA 5HJ5A 1Z63A 4YV2A 1YRYE 1Y5IA 3I8SA 3QHQA 2XKJE 3CRZA 3ESQA 1A7AA 2VOEA 4FVTA 4J1TA 2OCLA 5B2FA 2FCAA 3D7KA 3GZ4A 1XNJA 2WMNB 1AN9A 4LFCB 3UC5A 1YIOA 3UGQA 1BXZA 3HP7A 4QFBA 5DM60 1NW6A 4YRCA 4OEHA 4BNUA 4BCCA 5J1SB 2B0CA 1A7JA 3NOQA 4FHEA 1ODSA 4IMIB 4RZ2A 3PXAA 2EGUA 4O5AA 4XRRA 2E37A 4RF5A 5ENDA 1M1NB 5FF9A 2Y6UA 5T8KA 1NBWB 1N0HA 1XYYA 1JNYA 3CH7A 4HGZA 2VQFB 4I5GA 3VPGA 3DE5X 2GJSA 5REQB 1IPEA 1VP3A 4BWVA 4WKGA 2A59A 5DKFA 3V8PA 3JYOA 4WL0A 2FPWA