3OTGA

Crystal structure of calg1, calicheamicin glycostyltransferase, tdp bound form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GRHMRVLFASLGTHGHTYPLLPLATAARAAGHEVTFATGEGFAGTLRKLGFEPVATGMPVFDGFLAALRIRFDTDSPEGLTPEQLSELPQIVFGRVIPQRVFDELQPVIERLRPDLVVQEISNYGAGLAALKAGIPTICHGVGRDTPDDLTRSIEEEVRGLAQRLGLDLPPGRIDGFGNPFIDIFPPSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSSRDTARPLVYLTLGTSSGGTVEVLRAAIDGLAGLDADVLVASGPSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGTTLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPDNISPDSVSGAAKRLLAEESYRAGARAVAAEIAAMPGPDEVVRLLPGFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CalG1
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA02
1K06A 3MS2A 2IV7A 3UYKA 2R68A 4MHOA 1ABBA 2QN1A 3BD8A 1P4HA 3CUVA 2F3UA 2R66A 2GPNA 2VSNA 3T3HA 1Z6PA 4GZ5A 2SKCA 5JTTA 2JJMA 1Z6QA 3OKPA 1F6DA 1RZUA 4X7PA 3DD1A 3MQFA 3EBOA 2X0EA 4BQEA 3MS4A 3OKAA 1WW2A 4GZ6A 1FTYA 2X6RA 1P2GA 4N9WA 3G2LA 1PNVA 1UZUA 4F96A 4CTOA 3HBFA 3ZCVA 3E3NA 3HBNA 2GT1A 4N3AA 3RSCA 3C48A 6GPBA 1NOIA 2QLLA 1NZFA 2ECPA 2PYDA 2GEKA 1JEJA 2C4MA 1F0KA 4N3CA 2IEIA 4EKYA 1GGNA 2QRPA 4AMGA 2VCEA 1C3JA 4LDPA 4CTNA 1XC7A 4RELA 4HLNA 2AV6A 3WAGA 2SKDA 3DDWA 2R60A 4WADA 2GPBA 3L01A 2WTXA 2G9QA 2XCIA 3GPBA 5TVGA 3MRXA 3BCSA 3CEMA 3VDMA 3BD7A 4AY5A 1Z62A 3TSAA 5LQDA 1FA9A 3CX4A 3S0JA 2PQ6A 4MI9A 4RENA 1VGVA 3ZCTA 2ZB2A 4M60A 3MTDA 4YI5A 3MSCA 1UQUA 1IIRA 1IXYA 4GZ3A 1Y8ZA 1BX3A 1YGPA 9GPBA 3CEHA 2QN8A 3RSZA 2QN9A 3S29A 3CV3A 2QRQA 1RZVA 2VCHA 1NVKA 2ASVA 3L79A 3NPAA 2QRHA 3WC4A 5IKOA 3T5TA 2R4UA 5DLDA 2O6LA 7GPBA 3DZCA 4X6LA 5GPBA 1UQTA 2H1FA 2IYAA 1FU7A 3BCUA 4X7RA 1PSWA 4EL0A 1YA6A 2QN3A 1V4VA 3C4QA 5ENZA 3IA7A 1K08A 1FC0A 3ZCSA 3Q3HA 1P29A 1FTWA 1H5UA 2XGMA 2X0FA 4XI9A 4F9FA 4REMA 2XGSA 4GYYA 3T3DA 3S2UA 4M83A 3NAZA 3MBOA 3O3CA 3OY7A 3UYLA 2AZDA 2G9RA 3FROA 5DXFA 3AMVA 2BFWA 2FETA 4BQIA 4F97A 1QKJA 4RIEA 3C4VA 4KQ2A 2X6QA 2QN7A 3VUEA 1QM5A 4MI3A 3Q3IA 2AMVA 1GZ5A 1L6IA 1P4JA 3NC4A 3E3OA 1GPYA 1L5VA 1XL0A 3L7AA 1Y6GA 4CDRA 1PN3A 2PYIA 2KS6A 3H4IA 3D0QA 3MRTA 1P2BA 4FZRA 4N39A 2H1HA 4EL5A 1JIXA 2F3SA 2X0DA 3D1JA 4W6QA 2F3PA 8GPBA 4NEQA 4EJ2A 1SXQA 3CUWA 3S28A 1WV0A 5BNWA 3OY2A 3OT5A 1NZDA 2JLBA 1M5RA 3T3EA 2PRJA 3OKCA 3BDAA 1GFZA 2QNBA 5TMDA 1FU4A 3TOVA 2ACWA 1XKXA 2XA9A 5DU2A 3NCHA 1RRVA 2YJNA 3MTAA 4AY6A 1WUYA 3IAAA 3HBJA 4WHMA 2ATIA 1JIVA 3Q3EA 5I45A 3OTGA 1EM6A 3BEOA 1SXPA 2AW3A 4X7MA 2Q6VA 1LWNA 1L7XA 1P4GA 4NC9A 4CTMA 3QHPA 1XV5A 3E3LA 5D01A 2C1ZA 2IV3A 3SYRA 5IKPA 3VDNB 2P6PA 2QLMA 4AN4A 3NP9A 3T7DA 2G9VA 2QLNA 3ZCRA 1FS4A 3CUYA 2BISA 3S27A 2XCUA 2GEJA 4BFCA 2IYFA 1E4OA 1NLMA 1JIUA 3ZCQA 5TMBA 4YUAA 3ZCPA 4NESA 2G9UA 3RHZA 3CEJA 1PYGA 3OTHA 4RIHA 3G2KA 2JZCA 2F9FA 4FKZA 2XGOA 3PE4A 4RIGA 3G2IA 2GM9A 3HBMA 1C50A 4XIFA 1WUTA 2XA2A 3RT1A 2F3QA 4MHSA 3DDSA 2GPAA 3COPA 3QKWA 4HWGA 2QN2A 3MTBA 2QRMA 2QRGA 4LEIA 1O6CA 1C8KA 4Z5XA 1AHPA 2PRIA 4KQMA 1XL1A 4G2TA 2C1XA 3EBPA 1WV1A 4GPBA 3ZCUA 2VSYA 4GYWA 4YI3A 4BQFA 4MICA 4MRAA 1Z8DA 2C9ZA 2XA1A 4RBNA 1XOIA 2SKEA 5C1DA 1KTIA 1L5QA 3T3IA 1JG6A 1P2DA 4L22A 2IW1A 1C8LA 2VG8A 1GPAA 3SYMA 4RIFA 3CUUA 1L5WA 1B4DA 4PQGA 1J39A 4QLBA 1NOJA 3G2HA 1A8IA 1NOKA 3BD6A 1L5SA 2FF5A 2OFFA 2R4TA 3PE3A 4WACA 1EXVA 1Y6FA 3GUHA 1JG7A 2FFRA 4M7PA 4RIIA 3NB0A 4MI6A 1L5RA 3T3GA 3MS7A 3TAXA 5JTUA 3OTIA 2ACVA 3L7BA 3WADA 4N3BA 3VUFA 2IUYA 4AMBA 1FU8A 3G2JA 1HLFA 4EKEA 2XMPA 3L7DA 3MRVA 3NP7A 3MT9A 3D0RA 2GJ4A 2QZSA 2BGUA 3BCRA 2BGTA 1E1YA 1GG8A 3MT8A 1FTQA 2IEGA 1AXRA 5D00A 1WW3A 1GPBA 1LWOA 2HY7A 3L7CA 5HXAA 3CUTA 5TMEA 3H4TA 3MT7A 3G2NA 4KQ1A
chains in the Genus database with same CATH superfamily
4L4ZA 2IRWA 3MS2A 2Q5QA 3OEWA 4GMDA 4M6WB 5K0GA 1RQ7A 2XBUA 1TFUA 3QYAA 1EFLA 1G3MA 5FI3A 1ABBA 1QR6A 5KVAA 3AC0A 3FETA 2K2QB 4RZ2A 3K70D 3C6MA 4XD7D 1YR2A 2EZTA 4PLYA 3DL0A 4RTPA 1M1YE 4CBVA 3VKHA 2OBFA 3TE6A 3EHDA 1N3LA 2JL1A 5F7ZA 1K6EA 4PO3X 1G0OA 1R0YA 2FEPA 2XUAA 4OHWA 1PZGA 3A4IA 1LC3A 2YV2A 1I6KA 1R8SA 1XAIA 1RWWA 3JARA 3PUHA 1IEVA 3SFTA 4OUDB 1FVHA 3BMCB 2SKCA 2YMPA 2XE6A 2COEA 3R8XA 1I1QB 4D99A 1XNQB 5BQOA 1Z0DA 2QTCA 3EEOA 2B9VA 1V2HE 3CW2A 3DAGA 1VSUA 4P9NA 3ADCA 2G9ZA 1IBRA 4XWTA 4L16A 5SZIA 5EJ8A 1J5XA 4GWGA 4MITA 3PWSA 2AF3C 4KWTA 4ZYLA 1I4LD 3R3ZA 1UPUA 3RV4A 4B6GA 2I2FA 3E81A 3IQHX 5IEJA 4ENTA 5AKXA 2ZQ5A 3Q2IA 2E4WA 4PQRA 2RGAA 4WK4B 5JLAA 1ZM4A 5JEDA 2K7ZA 1K3UB 1FSFA 1H9AA 4Q3KA 4LJRA 3E61A 1P2GA 4MMZB 4C7OB 2BYTA 4TZ6A 4GMXA 1E0AA 5K0SA 1SC3A 2AQ8A 3O31A 2W2MA 1F4LA 1Y5MA 3KB8A 1CCWA 1RYDA 2PVSA 3F78A 3U4MA 3LPLA 2GYYA 2YHIA 1ZGJA 1J07A 2ESRA 3C74A 2A3NA 2Q7XA 3E4CA 3FVTA 1UKVY 4M7OA 1VCHA 2D4HA 1AUOA 1M8PA 3UGTA 4E0BA 2WU8A 4X71A 3VHXA 1SR8A 2XAUA 2GPTA 3L93A 4DLUA 2IQIA 3EF1A 3HDGA 3CWQA 1O97D 4BO0A 4NFYA 4TWBA 4D26A 4D3XA 4WCFB 2EFGA 4BAZA 2PLRA 2XXBA 4QGGA 2B6NA 3ONWA 3PS9A 1WMDA 3ROEA 2AN4A 3UH0A 3NWPA 1YJAA 2D00A 3MWKA 3VHQA 5CX4A 5F5XA 3IAM1 3KSMA 5IZ4A 4QICA 1VBMA 3T7CA 3FMFA 4KPFC 3KSBC 1GY8A 2YN2A 2R47A 3HA5A 3R3HA 1YVDA 4I5EA 3RH0A 3RU7A 3JW8A 1P7ZA 3KOWA 1EX9A 4R4JA 1C9EA 2Q3JA 1K88A 1OZGA 1ZPDA 2WAAA 2CFTA 3K6RA 3OZWA 1KSJA 4P53A 1UJBA 2K6GA 4JQYA 4P31A 2XCIA 3RASA 3INRA 4RQTA 1V9CA 5IAEA 5I8PA 2AN3A 4IX9A 1B73A 4KIJA 1QJ4A 1G59A 5HILA 1PBNA 2HPZA 2BBWA 3ILXA 4EEZA 3DW3X 1Z62A 3EQ2A 4RVOA 4QVIA 4WOCA 3QFFA 4IIUA 1FA9A 1NMSA 3ZVLA 1Y3DE 4WXPA 1YS1X 2AZ4A 4ZVNA 1DADA 3BIOA 1QHHA 3AR5A 4IDGA 4P1ZA 4UE6A 4ZJPA 5B55A 1MT0A 3GFQA 2NUTB 2E1RA 4KN5A 4WFJA 1A2OA 2HBRA 1GAQA 5EWLB 5TSDA 3BOSA 5EZ5A 4EG1A 1GU7A 1O3YA 4X85A 4E08A 1ISRA 1WXIA 5F2OA 1Q7GA 3DYIA 2P6MA 1G42A 1K0UA 1SU8A 1TF5A 2GA9A 3QQPA 4OFZA 4ZPJA 1KAMA 1Q0ZA 5ALTA 1UMDA 2FTKE 1KEEB 2GASA 1ZZEA 2WDPA 2WSSA 2X40A 1F8YA 5LJIA 1X7GA 2BDEA 3MSCA 2MYNA 4GZ3A 1ZWLA 3TF5A 2Z1MA 3DFMA 4XYBA 3QJYA 1AQYA 2HA2A 2IPLA 4IL5A 1L9XA 3CWCA 2CK3A 5CTJA 4YQEA 1IZ9A 4TQGA 3RSZA 1UT6A 3TNDA 3QUCA 3U4AA 1KA9H 3WB0A 4DY4A 2OZEA 3LUPA 1ZCJA 1FZQA 2H1VA 1NUPA 1MV5A 1RLUA 2Z8YM 4CDGA 1W85B 2XEXA 1YSCA 5A9RA 1E61A 1UOQA 3LT1A 4Z51A 3VNUA 4KK3A 4EO4A 3ESYA 4ME6A 3JYHA 1I01A 3E7PA 3HKCB 3AL0C 3GHHA 1Z4IA 4NQZA 3G0IA 4UM9B 1G8HA 1DUIA 2R4UA 3G9TA 4D6PA 4NHEA 3CVOA 3GLVA 5HDBB 1YVRA 4ARAA 3I34X 3IUSA 4MVJM 4LYYA 3KAKA 5A71A 2BHLA 1ZK4A 2Y0EA 4F85A 5K0ZA 4X7RA 5LC1A 1YUNA 5THXA 3UICA 2ZZMA 4J16A 1N7JA 3EULA 2QN3A 2IYWA 5HKKA 2QYOA 1K08A 2CXHA 3FCAA 3RJ9A 4A23A 1FC0A 3EAQA 1J23A 1CJKC 1JXAA 5JSKA 3FCOA 1DWOA 3R3JA 4EYOA 5CT8A 4WZBA 1JH8A 4X64B 3O95A 2WWIA 2LXNA 3I6YA 4JCCA 5FPKA 5L51A 4WNAA 1JRLA 2RHDA 4PG7A 3BRCA 3L0BA 5L9AA 3D7RA 5AVYA 3HGQA 1ZMOA 5DCYA 2H5LA 3NVAA 4QUJA 2O8BA 4OQPA 3GGOA 2G06A 1XEWX 2XGSA 1UKCA 3BERA 4FJ0A 4F4CA 1E1QA 1M0WA 2ISCA 2Q29A 4KKVA 4X6UA 1T9HA 2AGVA 4OI0A 4QZVA 3O3CA 1R66A 5HQTA 3OY7A 1Q0UA 3ZZNA 4R16A 4W9NC 2JVIA 4O2BB 1H94A 3C3WA 3QEMA 2QZPA 3AB7A 3AX6A 1GL6A 1RMTA 1E9FA 3JALA 4MOWA 3T5MA 3JXEA 4LK2A 4MR7B 5HK8A 2VJQA 2XZDA 3GLHE 3E5RA 1YQQA 5AXBA 4L08A 3ZE7A 3OZDA 4IUYA 1IN1A 4LJAA 4L8FA 1EBFA 1T4CA 2FZLA 1VKRA 1UK7A 2C8VA 1A5TA 1LZKA 2G28A 3L06A 3KKMA 3K2BA 3FOAA 4FR5A 5FOSA 4BVFA 1AKRA 3H04A 5ALGA 1T5BA 2H17A 1Z25A 1NE2A 3CRW1 2FPIB 1G5RA 4BX9A 4M8SA 3WYNA 4Q9HA 5HUHA 1NYQA 1ZJYA 3I1JA 4PXAA 4FFMA 3H4IA 4D92A 4HUQA 1ZX1A 1OVMA 3QVGA 5EGSA 1I5RA 4N41A 4RFSA 4U2FA 1P8AA 1ZMRA 3OE7A 4L8LA 1QP4A 2ZBEA 3QLEA 1QWSA 2VLBA 4L5CA 4M89A 1KIMA 3UT5A 1DAEA 1PR2A 4BZXA 3THOA 4JP2A 2NVBA 1Q7EA 1UBHS 2BRUA 4M0CA 1RZRD 3OCVA 1WNFA 1LS6A 2FUNB 2PT9A 3DMDA 3E7FA 4ZOLA 4OP3A 3GA0A 1YBVA 2F3PA 3H9UA 5D8DA 3SBDA 3BWXA 3CVJA 3C41J 1VJ0A 5FF9A 4FFRA 2H2HA 5BNWA 3J81k 1OYOA 2BI7A 1J8QA 5MGBA 4ZQCB 2GYVA 2FU5C 4QTUB 4WQMA 3VH4A 1KDZA 2AEEA 3A32A 4Y0VA 4DB4A 1YAJA 1GZUA 4E31A 2RGGA 2E5FA 2BGGA 5B3AA 4P98A 1QO0D 2NO0A 4DCNA 1JWBB 2ICAA 4P7BA 4XQGA 1MQAA 2AJBA 3LSYA 1C4KA 2B3TA 2G09A 2HQBA 1NDHA 1ECLA 2B94A 1Y8CA 1BE1A 1J21A 2OLEA 3GMIA 4RSRA 4AZ0A 2XSZA 3UWDA 1FNMA 5HGXA 4RD3A 2JFOA 2HDNB 4TTIA 3SE0A 2XB9A 1AUQA 1CY2A 3ER9A 2EFYA 4FYWA 4DA8A 2ADFA 2B98A 3PEYA 5I45A 1DXYA 3BAFA 3Q7PA 4ZCIA 3OPMA 2O14A 3IRVA 4ALMA 1G8MA 4KOAA 3GMDA 2Q3BA 2F43A 3EH2A 3KXIA 5ES4B 2EU8A 3M1IA 3MGCA 2I87A 4ZHSA 2IIVA 2IP1A 3A4MA 3KKQA 2XBLA 3N0VA 1CWUA 1YR3A 3IESA 1TYZA 4ER6A 3OJFA 2W43A 1YTLA 2PZ8A 5CCDA 2JKVA 3QHPA 2W0SA 3WHPA 4UUQA 4DC1A 5HOQA 5EHIA 4EYSA 2CZGA 2QG4A 3A1TA 5I01A 2IUUA 2IV3A 1AGXA 3U09A 3DKRA 1FSGA 3FM9A 3OUZA 4LDJA 1ZNYA 3UC9A 3IP6A 4XXHA 5JROA 5KNBA 4PYNA 1DBQA 3FJYA 4L8VA 4ZCSA 3CNEA 1DIAA 2QM8A 2REQA 5JIBA 1Q0QA 1JAYA 4F06A 3HVUA 3L8MA 4V0RA 5JRJA 1RYHA 5JSUA 1XO1A 3W34A 5J2TB 5DHAA 3HXPA 3I32A 3HU1A 2WA1A 3C0KA 3TQFA 4B44A 1MXHA 5IT9A 1HLGA 4A8TA 4M46A 1E7QA 1N2OA 2Q5LA 4E11A 5K05A 3RC9A 3PFWO 1WZNA 4W99A 1PUXA 4HFRA 3N86A 4UFOA 4I5FA 1JHRA 3FMVA 1ISHA 2TMKA 1EG7A 1NLYA 4QO8A 1PZEA 3FUXA 5ILQA 2JLVA 3BKXA 4B6RA 2WDZA 5T3UA 2XCRB 4ZQFA 2GK6A 2NU6A 3ZY4A 1TM5E 2ZDGA 1DTSA 1L8QA 2H8GA 3QKTA 4K6FA 3CTPA 1YK1A 4PO8A 1ORWA 2VDPB 3W04A 1EXDA 3HI4A 4WY2A 2Q2OA 2O8EA 5DRYA 4Z2YA 3NM5A 2PGAA 4AY4A 1Y33E 1M76A 1JW9B 1RAHA 3ESZA 4HGOA 3UMVA 4UJ3A 5IJZA 1QNFA 5JBQA 1PL0A 5CDHA 1PV4A 3ZH2A 2XWBF 3GFPA 4EPVA 1YDHA 2HLNA 3A1VA 3V4SA 3G79A 1DTWA 3UC5A 4CIVA 2NTJA 4J0DA 4NZOA 3ND8A 3PCXA 1QMPA 2BSXA 2WSBA 3QKWA 1QFZA 4UUMA 2QYSA 1OR8A 2Y1WA 3VR5H 1JSCA 1ZBQA 2QRGA 2ZFUA 3P97A 4JLPA 3ULKA 1D1TA 3VR6D 3G9ZA 3E1SA 1U0NA 1UZNA 1WMBA 2GBPA 5CD9A 4DV6B 3A36A 2GAOA 3R6TA 4IJUA 3RF7A 1U9CA 4F46A 3C7CB 2XRZA 4B2IA 3KLOA 1XT6A 4G9BA 4UZEA 4WGFA 4YMVA 4NAUA 3C3MA 2NUAA 3HB1A 3HLTA 5CIQA 3HKEB 1KVUA 3ZD9A 1S1CA 4N6OA 2QR2A 2QTFA 5E4YA 2I9KA 4UMDA 2QE7A 3T9CA 4F84A 2VZ9A 1KI3A 2WHPA 2XNDA 5JU6A 2IYZA 3K5HA 2DBYA 2B99A 3DVLA 1Y8ZA 2FPSA 3FMIA 4BC1A 4FYVA 4LTMA 1UM9B 3NBZC 2VP3A 2R00A 1JWLA 3SZ3A 4IDNA 1RE0A 2WQZA 4BFXA 4YX9A 2F67A 3BB1A 3KB2A 1L4BA 1QYRA 4CLRB 1ZDMA 2QQ5A 3RKRA 4YRMA 5ICCA 2EBHX 2GB4A 2H57A 4GT1A 5DP1A 4B3DA 4CF3A 4IIJF 3QELA 2HIAA 4TKMA 5C1DA 1EFKA 1L1EA 4LFAB 3GT0A 5K2OA 2Q6TA 2CBGA 1QH9A 5EUCA 2G70A 5IANA 2R6HA 1BOFA 3K0CA 2YL2A 3PDCA 2HKIA 4MR8A 5CM8B 4YO8A 3PHBE 4F5ZA 2HF8A 3I92A 1YJBA 4HGZA 1PJQA 1YE5A 4H60A 4LOKA 5CLQA 3TI7A 1LC0A 3VH1A 4AI6A 1SA0B 1W0KA 5KKAA 3PC8C 2H4FA 4IDCA 2OVFA 4L3WA 4LS3A 5KTYA 4JDPA 4GOOD 4LK3A 2VPPA 4KRXA 4EAAA 3TQOA 1KL7A 1T8PA 1J1UA 4P34A 3HFSA 1VE6A 3I2FA 1M2WA 1GDDA 2HU5A 3IIKA 1UOEA 4KFUA 1BJTA 1PDVA 1T5OA 2BGLA 4R5HA 4JI3B 1VMAA 5CNMA 2UU9B 3KQKA 4B7AA 1EXVA 3GUHA 4GVXA 3RODA 1Y6FA 4KV7A 4M7PA 1KTVA 3R3YA 1BC5A 2PLWA 4M4SA 3AXTA 1NRWA 4L0CA 3TTVA 4L1KA 1S8OA 3TXYA 4F86A 3DMNA 5LQSA 4QECA 1JA9A 3H7AA 3AQIA 5JPDA 1G8YA 2XRMA 2XUOA 1W76A 3DGFC 4KH1A 2JCVA 1Z6TA 1PR1A 1FX0B 3RUPA 2IPXA 4PTZA 3PIIA 2IUYA 3NI2A 4WBNF 3EB9A 1V6CA 2GTIA 5FV7A 3SDSA 4F38A 3K6SA 2L17A 2VEOA 3ZE1B 4LBYA 3W3AD 4WJLA 4OJKA 3EOBI 4XGRA 1PS9A 3LCVB 5J5AA 1HE3A 2ORWA 5CNIA 2DPHA 3DO5A 4G1VA 3IP3A 3DCIA 4G5SA 3SYTA 2ZULA 4F0JA 5EMJA 5ECWA 1YDEA 1G7TA 2I3GA 2PKCA 4GFDA 1U2GC 1OE0A 1WSAA 2C54A 2PWBA 2XUPA 3NDRA 4IRXA 4NCXA 4B3HA 5CXUA 2MHCA 1MIHA 1PEYA 1ULZA 1DMRA 4OHMA 1AKWA 2WM8A 2W58A 1BD3A 2QN6A 2W8ZA 3CO0S 5BV2P 4YY3B 2XF2A 1HQDA 3MMSA 5CJPA 4ZV4A 1DBPA 2OORC 2YXBA 2VBFA 5DTQA 4BFVA 4DMMA 4A8JA 1KEKA 2HB6A 3B6EA 4LVCA 3MT7A 5AJXA 3PNSA 2D5LA 3KQNA 2V7GA 5AVZA 3JWHA 2RC6A 4NAVA 4QOHA 4WK2B 3EW9A 1K06A 3FFWA 4BV9A 4RANA 5E2AA 5CA0A 4LPSA 4OJTA 1U6IA 2GMWA 2JA1A 3HKBB 4XCXA 1N2JA 2FQQA 2H3EA 3OBBA 2H2FA 4BLPA 1PWYE 2YZ7A 4YAJA 4Q3BA 1E8DA 1YCHA 4XDYA 1KOGA 3W6OA 1B6SA 3ZY2A 2XB8A 5B1YA 4DCOA 1UKZA 3OHSX 3OMXA 3OI7A 1CR4A 1TYEB 3CH5A 4FMDF 2M1ZA 1F4PA 3QYFA 5DCUA 2XMBA 3ROGA 5HZGA 4IIEA 1TM7E 4LUCA 4EJSB 1GQ2A 5JTTA 5FD8A 1JI3A 3OTWA 2JFZA 2PS9A 2VT3A 4QQKA 3W7VA 5JAPA 3HEAA 4FGSA 3EDYA 4GOLD 4HLCA 3KWJA 2GZAA 4JLVA 5BSUA 2OLKA 1PIWA 4MLCA 4MTLA 3MJSA 4Z3DA 4YCCA 2ZE5A 2JGAA 3DD1A 3OC6A 1LFAA 4ZCMA 4PQYA 2VSXA 2OHIA 1YQ9A 5GONB 4DW8A 1WA5A 5E6RA 4W5WA 1AKYA 3OKAA 3SXUB 3O4IA 3T5GA 1T3ZA 5JCJA 1SG9A 1RKVA 3T5PA 1FRFS 4C9BA 5A4KA 1W34A 1M2FA 4FHDA 4ECEA 1IYZA 2YFYA 2CMKA 5JC1A 4N9WA 5FP0A 2WTMA 3P9ZA 1FL9A 4AZ3B 4I50F 3NOOA 1Q0RA 3PHCA 3KZ1E 1OQAA 4ER7A 3GLUA 1L7PA 3LX4A 4I19A 4JLBA 3DLHA 1STOA 1MGPA 4I2VA 4MUFA 3S2ZA 4H1HA 4PAWA 4NOMA 5A5EA 1ISPA 1HYEA 1MZVA 2F4NA 3DOFA 1ZGGA 3AHGA 5IWCA 2BFPA 3MMXA 1HNXB 1JR6A 3FHOA 2L82A 1NOIA 2Q9AA 2FRDC 3H5TA 3WB9A 5BWMA 3BICA 3HSYA 1KPHA 4KC0A 1Y4DE 2QSYA 1VPDA 1KNXA 3EXFB 3I01M 5JDIA 1EA7A 5HF6A 1UXHA 3T94A 2AFRA 1HLDA 3O8BA 3R7BA 1BE0A 1QIJA 3IT2A 2ZAMA 1GGNA 5AT1A 5B4UA 3VNVA 3AIKA 2HJGA 2IODA 1X7YA 5KOHB 1TC1A 1AZSC 1ZIPA 3C7DB 3D8NA 1QG6A 1ZI8A 2IPMA 3K1AB 3LV8A 4G0XA 2FWAA 4OKNA 3VVLA 3DAYA 3NHJA 3H1AA 5EIOA 1G20B 2AV6A 2WHEA 1X19A 3CNHA 4MIYA 3G7NA 4OB6A 7MHTA 1E7WA 5AKKA 4J0JA 2EG5A 2IHBA 4FJ1A 3V8PA 5BNIA 4C2TA 1E6KA 3LL4A 3HA2A 3PNPA 3VX4A 2G9QA 2ZSFA 4G3XA 3SVZA 3I39X 1A5ZA 3W1VA 1XCGB 1U8XX 2ZJYA 2A3RA 2DHRA 3PL5A 1Z7WA 3G13A 1S7CA 1DO0A 1P5ZB 1C1YA 3FCYA 4MQFB 1ISFA 2P3OA 3KHUA 5D2CA 2AJTA 2O7SA 5IDVA 4DUGD 1SUEA 5MF6A 1HR0B 3GRRA 1GUBA 1XEAA 1AKQA 1HH4A 2IPOA 4Y1RA 4TLMB 1G9TA 2DECA 1U0JA 4RV4A 1X0VA 4M0EA 3OICA 3NDIA 4KYVA 3HLKA 3A11A 2YXEA 3UJ3X 1GPKA 2PHZA 2ZB2A 2B1RA 3PQEA 4FI3F 1ZOLA 1QQTA 1ZINA 1UMBA 4O0LA 4ONEA 3WNBA 3ZU4A 2JJ2A 5FO0A 3L7KA 3F7TA 3LUJA 4OU5A 1E96A 4YECA 4L9SA 3DP9A 2OCXA 1MB9A 3AOGA 4JNKA 4Z9AA 5REQA 2VHEA 2KYRA 2O05A 1BDMA 1E8NA 1YGPA 2C31A 1RWKA 3EG5A 4I3GA 2VHVA 4WFIA 4YJHB 3CEHA 4BWFB 3ZD6A 1WD7A 3UOAB 4O08A 3V97A 2DHCA 2WSMA 4DKXA 5BR8B 2JFVA 2WUDA 3OEYA 1YC5A 2OGTA 1TIPA 1ZA1A 3HDVA 1RZVA 2M9MA 2PGLA 3HYLA 3JAKB 4YJ2B 1IATA 5AVKA 3UT0A 2ASVA 3FPHA 1SXGA 4EHHA 2C96A 3DNFA 1ZLXA 4LV5B 1FDSA 3HV2A 3OZUA 4PW0A 1WSDA 2IYEA 5LNK1 2WIBA 3LO8A 1EPUA 2WZDA 2GEBA 2CKDA 2R5FA 3HWSA 4NENB 2PFKA 4OAQA 3WC4A 3GLGA 1ZVQA 2WMNB 1UBTS 4EG8A 2P9BA 4GR4A 1R8JA 1X7DA 4BFZA 2CXSA 2NZXA 2O6LA 3F7NA 3KTOA 4MEBA 4ALNA 2EQBA 4KAXA 5JC8A 4D0SA 1UEJA 5CFRA 3TQCA 1M2HA 3I4CA 3BMNA 4KE9A 3NHMA 4EPTA 2YMQA 1FU7A 1E2KA 4NX2A 5CH3A 3NT2A 1E2GA 4YRAA 2DYKA 2DR2A 5DYNA 3W5BA 1WLYA 1JU3A 2FG7C 2H0QA 4P4SA 3PB3A 3OQJA 1F8XA 3U13A 3VOSA 3UV6A 1NW9B 2PK3A 4GPTA 4HRYA 2RB4A 3SXJA 2R6DA 4DGQA 3TIVA 2TMDA 4IXNA 4W1PA 3SHTA 3RTCA 4DDUA 2F8TA 4TV9A 1CB7A 5IXYA 3QX3A 3PGLA 2BFMA 1PF7E 3P9XA 3P7MA 5JZVA 4JVOA 5TB5A 4NE7A 2C88A 1ZW1A 5DX8A 4WBNB 1H3EA 3IEIA 1ESEA 4XQ0A 1U5CA 1A7UA 3WYCA 1ZKDA 2A5LA 1QS0A 3LIIA 3EVEA 4YRJA 1WMSA 4JVSB 3I4FA 1KPGA 3T3DA 4BN4A 3G2QA 4M1WA 5JBIA 3ME5A 2XHZA 1WOMA 2QPLA 4EFDA 3NHRA 4NXNB 4Y6RA 4UTVA 4RCZA 2O2GA 1G38A 3FBGA 3ILSA 4O2AB 1F1BA 1SCUB 4OQEA 3WOHA 1KY2A 1Z13A 1DB3A 2VPQA 3CE6A 4MV7A 3ZWMA 4R2LA 4U2CA 4AIRA 3LHFA 1IN6A 3KYIB 2J0VA 1XNJA 4LDRA 5EMNA 3S6JA 5EY5B 4RIEA 2FMXA 4UNSA 3DVAB 4HL6A 3U0BA 4DJJA 3VR5A 5K8VA 1RM4A 1OX4A 1BXGB 1NQOA 2JIDA 4URFA 4YFVA 1JSLA 3W5HA 1F51E 1GZ5A 2UVDA 4G8DA 5FUXA 4ARBA 1N2CB 2OXCA 1TKRA 5I9SA 4EFNA 1IOZA 4Q9KA 3TSYA 3E3OA 4CF7A 4UREA 3SHOA 1L5VA 5GV7A 5TV2A 1X8KA 4AU1A 4HNTA 1RXUA 4H6XA 1XMVA 4L6IA 1KDYA 4Q34A 2E85A 2IGBA 4ENUA 2BW0A 3I1FA 4FKMA 4JZKA 4TV8A 1U2EA 4DQ0A 4NMMA 2FZKA 3TUZC 1WZUA 1XJ0A 3DMTA 1A2KC 4D4MA 2WMDA 2AQHA 2G1UA 4FMDB 4JT2A 3IPYA 1UPXA 3KOUA 3E22A 4NP6A 2XCTB 1I32A 1TL7C 3OZVA 1Y1KE 3LDFA 4CM6A 1GQSA 4MAAA 1KE2A 1KOJA 8ADHA 5JVDF 2WUFA 2CF6A 4JSYA 2IEYA 4TRJA 5DK4A 4PO9A 4Q02A 2BVNA 2FN9A 5M29A 5CEEA 4B47A 3LS2A 4LQ4A 2PJZA 1CLEA 1Z0JA 1Z5UA 2I0FA 2JZNA 2QD1A 2VO1A 4XB6B 4YK7A 4B3XA 4BNNA 1R9GA 3A6JA 4BLVA 3OMWA 2ZSJA 3H16A 1SM4A 5EI5A 2NSLA 4U7TB 1RAGA 1HT3A 1FDUA 1M6VA 5C34B 4BFWA 3FB4A 2FN8A 2I2AA 1BWPA 1UBSB 1UM8A 2DPLA 3ECAA 3HCWA 3H0KA 1MJNA 4HX9A 1P18A 5B1HA 3WL8A 4I6JA 1N0UA 3EFBA 1Z0KA 1GFZA 4H1TA 3GBSA 1I13A 4CHGA 4D9NA 5AI4A 4ZHQA 3W2FA 2OEPA 4J2OA 1KC3A 4J75A 4QBHA 1DC8A 1XKXA 2XA9A 4O4IF 4X24A 5AI5A 4YNBA 1NBOA 3NCHA 3D4IA 4IOLA 2HREA 4HH4A 3TW0A 4BCCA 3AM1A 5CIYA 2D1FA 3O94A 1BZYA 3MTAA 3LPMA 3VXKA 2H7VA 4NNPA 4BP9A 2P62A 2P2NA 3EZLA 4NV3A 2ORIA 2WWFA 4B2YA 1IULA 3C1OA 1KMNA 1KBZA 4J4BA 5JCZA 4ARZB 2Q4RA 2QR3A 3RRZA 2V59A 1Z2PX 3BXHA 4DDTA 1OILA 2VP4A 1SXJE 2X5KO 3FPLA 3G85A 2REOA 3IVRA 3MF4A 4Q66C 2F48A 4B40A 2IXEA 3RS8A 1P45A 3WKAA 2YJ6A 4ISCA 4Q01A 2Q6VA 4HVCA 2QORA 4CXMA 3Q5DA 2GM3A 3EOZA 3IBFA 1XV5A 1QUFA 2GCOA 5I5GA 2VZ8A 1O4WA 1O5OA 3V42A 3JD2A 1NN5A 5CFOA 1K27A 2X1VA 3KS9A 5IBRA 3OLZA 2GOYA 3FTFA 3T38A 2P6PA 1HI9A 1A9PA 5WRFA 5AO9A 2GZ3A 1T0PA 2WKQA 1HOXA 1A8QA 3FLAA 1DV2A 5I7SA 2PV0A 2FUEA 4PHGA 3VJKA 1KBOA 4AJPA 2B61A 3DUFB 2AZMA 3I76A 3N2LA 4KN8A 4E4RA 4B31A 4DBZA 1V48A 3CLSD 3LXUX 1YOBA 4H17A 2AKAB 5G4KA 4LC9A 4ZAZA 3AF1A 3DL7A 3F4LA 5LCXA 2GNAA 3O75A 4LSWA 3VA7A 1FFWA 2IU4A 4PHTA 4U5QA 4D80A 1AKNA 1XDGA 3G0DA 1SIOA 5TMBA 3LBYA 3PSHA 1SVUA 4EI2A 4UBKA 4IOMA 3G0HA 1CUXA 3NJ8A 1GUAA 3RLIA 2PRYA 4YUAA 3V5NA 4Q1FA 2I6UA 4I55A 4CDMA 1TEZA 1SBZA 2QZ4A 2JGIA 2VSFA 2UVPA 2QIPA 3CPSA 3JQ8B 2XADA 3NJRA 2VQEB 3VR3D 2JDIA 5K6RA 1G55A 4CYMA 3BHMA 1ZYUA 3JV7A 3ZJ5A 3BKWA 3WKCA 3RVSA 2A0KA 1NKTA 3TWOA 3E4DA 3RT1A 2WHYA 4HXEB 4FFOA 2GFQA 2LCQA 5L3VA 4HBZA 2ZBFA 4K9KA 5K3DA 3DBHB 2A9RA 2PMCA 4D6YA 1GA4A 1W8DA 3U1BA 3L7JA 2G0NA 2GCIA 3ORFA 3OX3A 3P94A 1XZPA 3N6RA 5DLQC 4HLQB 2VWQA 4R05A 4WLFA 4HB4A 2CEKA 3ET5A 3P9YA 2RFLA 4ZOAA 3HU5A 4US2R 4OYYA 4F3KA 4OX9B 2J85A 3UA3A 5CDFA 3JAMA 1SCNE 4WNIA 5JYEA 5FL7A 2V0GA 4X94A 2IBTA 2R5NA 3MEQA 4RD1A 1XDDA 1I33A 4M87A 4ETIA 2J9FB 2XRFA 2QM7A 3PJDA 2IFTA 5CLLA 4B3JA 3IT3A 5FWYA 2D0IA 4E5KA 4QUEA 4AKSA 1H69A 1H1LA 1FUEA 4TTRA 5HR5A 4R8SA 1ML4A 2O8CA 4MQUA 1T10A 3SS9X 4LSGA 3U26A 3ROZA 4K6MA 3ZHBA 1H05A 4OJMX 4BUCA 4W8OA 2H92A 1OFGA 5T8KC 1EZ1A 2O23A 3MCAA 3GRAA 3RC3A 3UMGA 3ZBQA 2AFHB 3IPLA 2B4TO 4QGAA 1BROA 5G1PA 4WKBA 4DC0A 4M8LA 2YVKA 2POCA 2ANBA 2W2XA 1DC7A 4C0AC 5ALHA 3I9KA 4AURA 4YV2A 4G89A 3JQBA 5DHPA 3GLGE 5HIMA 3QBJA 1RQXA 1OXBB 4QFBA 2FFHA 2DWOA 1AA6A 3N0RA 1Z7EA 2W83A 2RI0A 3PQ6A 3LLMA 1P17A 4W5HA 5ALIA 3CZ5A 4H4CA 5IARA 5JASA 4INOA 1H6CA 1KYTA 2JCYA 3EGDB 4NDZA 5DJ5A 4U00A 3V9PA 4B74A 2SBTA 2YWJA 1JQBA 1UP6A 4JP5A 4JLJA 4FHEA 3IQXA 3U7JA 4I9FA 1PWHA 1UWCA 1ZNXA 2E6UX 3Q7EA 4F9TA 3DAPA 4CIAA 3CUUA 3K5WA 3NOVA 3REOA 2V5AA 3TRDA 3FFTA 3O4FA 1XZLA 1JDZA 2P3SA 3E5MA 1DJQA 1QVVA 3GARA 1X1RA 2BEUB 3LQ4A 1WPGA 4YTEA 4A2QA 1BYIA 1CU1A 2JHCA 4WY8A 3WDLA 4MHTA 1MFZA 4Y6LA 4DLXA 4CMGA 3HUDA 3AUKA 3F47A 1RRFA 1X7ZB 3JPWA 4M9SA 1NVBA 4NBKA 5K0FA 3QOYA 2G76A 4IJWA 1LSJA 1ESNA 1WWKA 2JA2A 1R6AA 1S8AA 1GRQA 2HAEA 2W6JD 3AUXA 1R0ZA 3AEQB 4XPIA 3VAYA 4DV4B 1JU4A 4C89A 4CF5A 3N70A 2FKNA 1YDMA 4M1SA 1QF6A 1XPOA 5G0TA 5JVDB 1NHWA 2B20A 2JFGA 2ZCJA 1YR9A 1SKQA 3CYFA 4TMFA 5EE5B 4H7KA 2XMPA 3REQB 4DJ5X 4XUCA 4NU8X 3R41A 5FA6A 4E30A 4MH0R 4JEUA 2VJLA 4ZAFA 3DB1A 2GJ4A 4EG6A 2OD2A 4O2RA 3ROTA 3F9IA 1CUZA 4KXLA 4YCLA 3AESA 4JYZA 3AR8A 3VKGA 4AMVA 4RKWA 1ICIA 3FLMA 1S89A 1FE8A 2QL6A 3AEXA 3MBKA 4HGYA 1QDLB 5D00A 1O89A 3DO6A 3UENA 5BQFA 4XGKA 3MYRA 1WW3A 3W5SA 4DYDA 4KAFA 3C8MA 1YACA 4TMKA 4G1BA 4OYLA 4TKLA 3WWDA 8OHMA 2Q1UA 4UOEA 2W2OA 5BQXA 3UAOA 5GOTA 2GRAA 3QNWA 5G0SA 2ATCA 1X1AA 1TYBE 3FSJX 5TMEA 4P2GA 1Y80A 2YRWA 3B7GA 4O4IB 2RHWA 1T1SA 2ZSAA 1RWVA 3R0XA 4J07A 2OBYA 4OB7A 3O4JA 4MRMA 3T7AA 3QOXA 3FMPB 1EM8A 4MQ6A 1IXRC 2HNAA 4U6QA 3VNSA 3LSTA 4R1TA 1YI0A 1GSAA 1MC5A 3G0GA 1G9XA 3D5TA 2JGFA 4MWGA 5AESA 5CCXA 1FS6A 4TXNA 3IXQA 1XZMA 3WLKX 1BEUB 2CNBA 4ZRDA 1CY0A 2IH2A 1AKUA 1XZBA 5JAHA 1PQPA 5DYTA 3HZRA 3T7TA 2NQ2C 1S96A 3TRHA 3ZXIA 2FN4A 1G8JA 2B82A 5T4HA 3QZUA 5AXDA 1VE1A 2FW0A 2XV1A 4R01A 4LYFA 2JARA 2VVTA 4BQOA 5F73A 2FFAA 4YRZA 4EYQA 1JBEA 4F92B 1R0WA 3K9GA 3WK8A 2R65A 2X3YA 3INTA 2NU7B 2OKCA 3T7RA 3DDNA 3U4CA 5JY1A 3VYTB 5IC6A 3MELA 3QVTA 4TMTA 3WQQA 4ZMRA 3GH3A 4QUHA 1G8SA 3PF8A 1XK7A 1HGXA 3RBVA 4EM6A 1W25A 1Y81A 4PG4A 5IG2A 3SFVA 3SJBA 2OYCA 1Y9ZA 3FJ1A 3HS3A 4M98A 4UVEA 4CKCB 5AUQA 2JBAB 1Z7YA 4QHYA 3EGIA 3S8EA 3ESRA 4RE5A 2J32A 3GUVA 1BCSA 1G5PA 2FHPA 4GYJA 3KAPA 1C5KA 3CPJB 1X0XA 1FDWA 1TQHA 2QLLA 4QT0A 4JEHA 2QW1A 5AKZA 1AUPA 4GHWA 4B8YA 3OZXA 4BEVA 3NDPA 3SYLA 2RHLA 3KSUA 1G19A 4HJXA 3HL4A 5ICFA 4GPAA 1OHHD 4GMGA 1W7AA 2J3LA 2D2IA 1EKXA 1ONSA 3QE0A 3LHDA 1C3JA 2AT1A 3ETNA 3I3OA 4KTTE 4KSBA 4U63A 1IN8A 1BHQ1 1H6BA 1ONOA 1USWA 4IV8A 4QPCA 2ENUA 5KNDA 5F9HA 5FWDA 1PTJC 5C1BA 1KMMA 4EF5A 1PFUA 2IYXA 4EW2A 5JXJA 4U7GA 2XMQA 3FNHA 1TZ2A 3PD1A 3HSSA 2W2KB 5E4TA 2WOJA 4CL2A 3RIYA 2FCRA 4BNVA 4P92A 2QG6A 3WSWA 5KQGA 1H2RS 2GN9A 3ZS8A 4HN4B 4NBVA 2N46A 2BOVA 3RTDA 3TR6A 4S24A 3VDMA 3X2EA 3CA8A 3BTVA 3A6EA 3E8SA 2HNKA 3TX2A 1ORTA 1IM8A 3P2EA 5BQPA 1QP8A 4WT7A 4ON9A 4BP1A 1BYUA 3FH0A 4P22A 4D5EA 5AW6A 5ITWA 1NF2A 4DILA 5EJ2A 5LQUA 1GNPA 4YQFA 1ZGBA 2IIQA 2BV3A 2V7VA 4QOFA 4RXUA 3WYBA 1SZPA 4ESEA 2I03A 3C3BA 4M60A 4YRLA 5KQMA 3MTDA 1JAZA 5HKLA 4UARA 4DWVA 5KHOC 1EVJA 1EQAA 2ONYA 3E1KA 4JI4B 4JJ7A 1Q7RA 1M0TA 1VE5A 3LUAA 3R77A 4NEGA 3LLSA 3T3MB 3BDIA 1IIRA 4HD8A 1YR6A 4LRTB 1RYEA 1OWOA 1OBCA 4JIMA 2CFIA 3W2GA 3E5HA 2AOVA 1THZA 3FIJA 3M81A 1OTYA 4LMRA 2UZ1A 2VCYA 1B2LA 3GJ7A 3U3XA 3ICEA 2XYRA 4WBSA 1XU7A 4TYPA 2IGTA 3PGVA 4UD6A 2VH1A 1U8UA 1VIAA 3L79A 1DTEA 4PWZA 4IR7A 1EP3B 1OV4A 2JVKA 2RONA 2YOHA 5C5CA 4G5GA 4C05A 2XE4A 3KQQA 2H7YA 3GNQA 1EVZA 4ND8B 4EUNA 5CDFE 5JNUA 2BPOA 1U2SA 2W93A 1R7RA 4EMTA 2G4CA 2ID4A 1I4EB 5DFAA 4LHEA 2JIZD 4NH4A 1PJCA 4N9QA 1H23A 3TIGA 2FE1A 2E87A 2I3DA 2HQSA 3IALA 4CCAA 1GZSA 1SQ0A 1P91A 2H4YA 3EVTA 3ZKWA 1FYXA 1CZKA 4AJ1A 1CR6A 4Z4HA 5HS6A 5LQRA 2AQIA 2CLMB 4PFQA 2HJ9A 1JVBA 2HU7A 3A1DA 3FLBA 3I2KA 3V1LA 4U9HS 5CDUA 2VTBA 1M0SA 3HB7A 2EARA 1BU5A 1VXOA 1G0NA 1QQ5A 5HF8A 4MVJP 1HEIA 3B9QA 2EG9A 3PX2A 1E9CA 1N5DA 2BJVA 3O5AA 1PG0A 4WERA 3T9DA 1E63A 3KQPA 5YASA 3TZEA 2VDLB 1REQA 5EJGA 2ZB3A 3AHHA 4E33A 2DF8A 1GTZA 4H0CA 1TF2A 1G8PA 5F2EA 5KQRA 3R6DA 3LPNA 2X0FA 3WNVA 3WGTA 4ACBA 1P8JA 2GX6A 1C8VB 1VXRA 2IVZA 3FNRA 4K0KB 2QD5A 2BFAA 3EWNA 2IYQA 4MIEA 3L49A 4Y18A 5DEIA 2RH8A 4ZZ2A 3GCWA 1AS2A 1NULA 5D1HA 5KX5B 4W9NA 5ELMA 2Q5EA 1TM3E 4EATA 1LBSA 2R8XA 1WVGA 4Q9AA 3AYZB 5BWNA 2FP4B 13PKA 1JVSA 2B6HA 1X3SA 2I4LA 4HSGA 1XKTA 4ZVSA 2RKBA 3PI6A 3TNJA 1GAXA 5F9FA 4P3OA 1G16A 3BXOA 4LHWA 3TZLA 1RHRA 1XA4A 2QT1A 1PZNA 3PDIA 3PSAA 1SD2A 3K6KA 5DK6A 3FROA 1GXSB 1NVTA 4JJ8A 2Q3LA 5FX2A 3P19A 4CCWA 7REQB 4LZZA 1CDOA 4D0LB 3CJTA 2L18A 3H1EA 4L5AA 3UHJA 5F2NA 3TSOA 2HGZA 3U16A 4B75A 3PWZA 2OO5A 5LLSA 2X3FA 5LSAA 2OAQ1 1J06A 2AS0A 3IPCA 4Y6PA 4GECA 5AJVB 3U3ZA 2RAUA 5JQGA 3OFND 1M8GA 1TIBA 1LBIA 1YBMA 2JGNA 2RJOA 1MV8A 3PXEA 2PO5A 4MI3A 2DFTA 3I2HA 1FP7A 5HJ2A 5LYJA 2AC7A 4MW2A 5ALUA 1Z7GA 2QMEA 5JFOA 1GPYA 3U1TA 2AI1A 3MG9A 2PX6A 4H3HB 2P4EA 4UPVA 2F1RA 3RSGA 1XNRB 1UBLS 2ORED 3QU7A 1VL5A 3IPAA 2AG5A 3C3EA 1N1DA 4IHJA 5FBLB 4BJ6A 4BN5A 4ZYZA 1QK3A 3LUCA 4RA6B 2ORVA 4F4UA 2V4ZA 1Y7PA 2H4WA 2WJZB 2ODPA 5IN5A 1PQYA 3ADKA 3KU4A 3G6WA 3OQIB 4X63A 5ALSA 4RL4A 3PPYA 1F6WA 4FZRA 2XYPA 4LJ4A 4WBXC 4BKRA 1J2RA 2RK4A 1BQEA 3AF0A 4DSZA 3C3AA 3KJQA 4TRRA 5I51A 5GIOE 5DM1A 4RD2A 2ECFA 4LHVA 1A96A 2M6SA 4QG7A 4J3JA 1AN0A 4MPJA 1ZXLA 2JD2A 4W6QA 3AHIA 2CFSA 5HUJA 1QKKA 2CXUA 4PYKA 2P0AA 2X9LA 2PMFA 2FW8A 1UJCA 1SXQA 2BHNA 4I14A 3IKJA 1PWZA 2XOXA 2PL3A 3QPWA 2RGXA 1U9YA 4P6VF 4ZD6A 5CB4F 3V9AA 1E89A 1NZDA 4H6WA 4JITA 4CG0A 5KX5F 3OM1A 4QOEA 5AI6A 1C1XA 4R2HA 1Z37A 2EKDA 3QFHA 1VKZA 2ZI6A 2PUGA 4D42A 4AN1A 5DULA 4ZI7F 3HYRA 5FLYA 3ZVNA 1M6HA 2XYVA 3JARB 1JT9A 2X2EA 5L3SA 1NXVA 4FDAA 3ZCXA 4FMPA 3DEJA 1T2EA 1W75A 1Y6RA 4FYPA 3RJ5A 4HQ0A 4N47A 2WD8A 2H54A 1AGPA 2LDBA 3CKYA 3E6AA 2LRHA 3LCMA 4H7IA 5ELLA 2CV0A 4K2HA 5LBIA 2XKBA 1Y1LA 4HQRA 4MVJH 1WETA 2ATIA 2J9XB 1YL5A 1XAJA 3NV7A 4MCAA 4V0MA 3SIPA 1RLTA 3BSYA 1X8JA 4QD3A 1T3LA 2PS1A 3AIIA 3QNMA 1HE8B 1LH0A 3EQ7A 4AK9A 2QMYA 3I62A 4ATNA 1X3LA 2JFFA 2ZJ7A 4EO9A 5HTKA 1KIFA 4WASA 2R9VA 1N5KA 3HJHA 3K6JA 3UUEA 4M76B 1NQ5A 1UUFA 2J4DA 1UFKA 2C92A 3LF2A 3P71T 3H1TA 3WBBA 3C5CA 3W7AA 1CUJA 2P4QA 3HABA 3CNLA 6REQA 2AX4A 4EJMA 1F8UA 2HGSA 3CM0A 2YWHA 3K2IA 3JZAA 4YEDA 4NFSA 4RZ3A 1X77A 1FDOA 4F1JA 1Y34E 1QQAA 1X1EA 4H18A 1YS7A 3LMKA 3KLNA 2YHIB 1W48A 4UM7A 3EEFA 5KCMA 1VZ3A 3UHAA 3QE4A 1KFEB 3KEQA 4HSEA 5IK2A 5T41A 3VHXB 5UKDA 3WGMA 3VPXA 4Z86A 2I6FA 1N32B 4UCXA 3ZDYB 4V38A 1D7AA 1NR7A 1U7WA 2B4AA 3H9CA 3O1IC 3L1IA 3Q5EA 3R0VA 3FPEA 4HWKA 1W88A 4Q3DA 1GEGA 3IHWA 4Z8YA 5ARCA 1TLLA 5ALQA 4G0MA 3V7YA 2QQ0A 1F3OA 2HM7A 4KDCA 2VUTA 5J4HA 2HBZA 5C46F 2YJ4A 1R8QA 1YRYE 4EA7A 1H9BA 5E3JA 1NXQA 3MWLA 4XYGA 4PSDA 2IWHA 2J3KA 3ETHA 4MVJF 3OOHA 4TXHA 3L5KA 3LDHA 2Y05A 4UU7A 4RIHA 3G2KA 1RZ3A 2IHJA 2Y66A 1CUGA 2LZ0A 4RIGA 2X9GA 4DABA 3EA5A 3K96A 4QELA 4IPTA 2FYTA 2GM9A 1HL3A 1HC7A 1ZKMA 3SSMA 5I7HA 4R5MA 3WO1A 1ZN8A 2O1XA 2XA2A 1MIOA 3QRWA 5LIRA 4R1MA 1Y7HA 2I6GA 2H9YA 4DXDA 1QHHB 4LYJA 1PJRA 3UXEA 5AHRA 5H4HA 7MDHA 3UUGA 5BYAA 2OMKA 5K4AA 5SYAA 3CKKA 5ALXA 4CKBA 2WMYA 4ODIA 1QGOA 1NI4A 3CG4A 4BAGA 1T5IA 4G09A 4GLJA 4BNZA 4UHEA 1QNLA 1KR2A 4EX7A 3R75A 4F7DA 4G4SO 1UMDB 4US0R 2Z3WA 4M8IA 1NDUA 2A0XA 4XSVA 1N6LA 1PVOA 3NBXX 4HOYA 3MB5A 3ED5A 4I5IA 4V0LA 5K3SA 2IXBA 2HCBA 4DMUB 1LCIA 1U3TA 2P5UA 4RZXA 4BOYA 1GCIA 1LK5A 3D8TA 4M86A 4IDEA 2HR1A 1UPBA 2NZVG 4EI9A 2AA3A 3SAJA 2F1KA 2C00A 2QJRA 4A92A 1V3TA 2YNMC 3H5LA 4AC9A 5D6OA 1WV1A 3Q1LA 1HRDA 3ACDA 2J45A 3FSGA 3ZY5A 3ZCUA 4ZC8A 2IC5A 2H8KA 2PSHA 3GJ6A 1UC5B 1WSBA 2X0RA 1J9ZA 1H2AS 3KM0A 1AHHA 4TS1A 3A05A 4FPXA 5CGZA 3I0ZA 1CZOA 2B8NA 3IFSA 3MK31 3NC0C 1FNSA 2I9PA 3PC8A 3U44A 3K20A 4DA9A 1DOAA 4HDRA 1TCAA 2OGWA 1NPTO 2A9JA 3LA6A 3TCKA 3UJDA 5AVOA 3TLEA 2HC9A 1U1EA 1YR1A 1FFDA 4PBSA 4A91A 5EIEA 5KVVA 4LF8B 2BP7A 4O25A 4UEKA 2HA4A 4CN8A 4L3OA 4QGSA 5CBPA 2CSXA 4QPNA 2V45A 3FKJA 2HK7A 1X9GA 3JWIA 2GJ8A 1OD6A 1T9CA 4OXXA 1GILA 1C9YA 4OJYA 4WZBB 1P9NA 5E3IA 3X2SA 4ADSG 4QDXA 1D1QA 4HDCA 4OU4A 4V1CI 2GPJA 1Y8QA 3R3VA 2WAXA 4P4LA 4WNAB 3EY9A 3CVYA 2FZEA 4I9UA 3JQDA 3TR0A 5K8UA 3ENQA 4ZI7B 2NOAA 2O8BB 3C6YA 4INPA 3A27A 4EY8A 5JSFA 1GKLA 1XX6A 1B14A 1GKKA 3TXAA 2Y1XA 3KJEA 3F5FA 4B76A 2PYZA 4IVPA 2QX7A 1WPQA 4G97A 3Q11A 1IIBA 2CXXA 3OU2A 5JTUA 3VMFA 3QEMB 2GWRA 2RHTA 3FOFC 2ACVA 3TL3A 5C18A 2HCFA 5I7AA 3RSHA 1RVV1 3ITKA 3JALB 2V8OA 3AM5A 2FWPA 2Q3DA 1JEQA 4N0MA 3WGQA 1E6CA 4LZAA 2YC2C 1QYWA 4UUOA 2JFXA 4RSMA 3LBAA 4IV5A 1T4CB 1YJ5A 3HYNA 3N3BC 1W6UA 4JT9A 2QUKA 3TAUA 2AUTA 1VBFA 2BGTA 3ZLJA 1P75A 4B3MB 4OXQA 3MJHA 3JQ9A 3PXXA 4G0QA 4BKUA 4YV7A 1U4NA 1JXMA 1T29A 1YUMA 3H8WA 3OM9A 2J5BA 3NM6B 4KR0A 4N3GA 4XFJA 3RU9A 4RGYA 4D9KA 1I2MA 1NVDA 4HUQB 3QVGB 4PCVA 5LP1A 2DKFA 1Z5PA 4CMAA 4RFSB 4DV0B 1KH3A 2N9UA 2I4TA 2AG1A 1KAEA 1MH1A 3GJXC 4A8HA 4B3FX 1T9GS 3ELDA 4JC5A 2IEAA 1JLLA 4CL3A 3UT5B 4D1YA 3PR1A 2B2XA 2C3UA 3UBMA 1DT5A 3GEHA 4BGDA 3WFZA 2ERYA 4IAOA 1OFUA 4EP1A 4YAEA 3FPAA 4ZOLB 1GTRA 4IV0A 5KJCA 1NVXQ 5DZSA 1FTSA 2GN8A 2ZPAA 2FPLA 3GPCA 3E82A 4IS3A 2AOUA 2NADA 3GZJA 3K1JA 3V8BA 2ZITA 1WDWB 4H7HA 5G0WA 1MZPA 4Q6BA 3OHPA 3T3HA 5A04A 3WNCA 2VHYA 4KQGA 4Q37A 2YHUA 1DEHA 4XX0A 2NTVA 1KEVA 1QFSA 1Y5NA 2HSEA 2QRLA 4KWEA 3TZKA 1L7DA 2AFIA 4F4DA 3IKMB 4K0RA 2CDBA 2Y2VA 4WOKA 4NZZA 1R74A 2WABA 2VPIA 4OXIA 2JLAA 3VISA 2WTNA 4FTWA 1GV0A 1EGHA 3F6PA 4OLAA 1Q1AA 2AXNA 2YFKA 3OG9A 4B46A 5CG1A 2B69A 1TUBA 2WT9A 1NJ2A 1YWGO 4AZ0B 3MS4A 3OUTA 1CEEA 4JLUA 2F62A 7ADHA 1CEQA 1WW2A 4MP8A 1U7ZA 2PAFA 2WF6A 2X4GA 2QI9F 5AKGA 2BC9A 1FTYA 1C4XA 1Z8HA 5EXXA 3TL6A 1Z06A 4GQIA 1FFGA 2Q0QA 2FRDA 1YU9A 3COSA 4BVGA 3UCEA 4ZI3A 4NJMA 3CSUA 4V0ME 5TRTA 4NJEA 5A6VA 2IP4A 4KAJA 3CVUA 2F43B 3UHPA 3RVQA 4ZIRA 2ZR9A 3GWGA 4RL6A 1QGZA 4RFLA 3R0JA 3VV2A 3RSCA 5KWIA 3G17A 4FK8A 4DMLA 2OWDA 5JWHA 2GO1A 6ABPA 4ARUA 1W0CA 3R44A 4B09A 1SKBA 1J9GA 1Z83A 1ZMXA 1TDJA 3DMFA 2WG2A 1WG8A 1R9JA 1D2HA 2C4MA 4U7WA 4ZV7A 4E5SA 3PHIA 2IEIA 3HCRA 5T7BA 3RS0A 2QRPA 3GRFA 4YJ3F 2VCEA 4LI0A 4DG5A 2H5IA 2WVHA 2C4KA 1R3DA 5KHLB 2REQB 3TLMA 5CFMA 2XUHA 2A5FA 1GRRA 1N3BA 4QRHA 4EA6A 2VAXA 1O08A 3O38A 1KO7A 1LNQA 1PZXA 1W1IA 2ID7A 2JAXA 2KBEA 2PH1A 3H4VA 4P82A 3W9BA 5KAPA 3C6XA 4YV1A 2NSJA 4DG8A 4HXYA 3AZPA 5ITZA 2FW6A 5FNVF 3GCXA 2FFJA 1RABA 3B9RA 3CNOA 4JQCA 1QXSA 4RACA 1HZZC 4BQRA 3GYGA 5DTIA 1K7CA 3FPSA 4BBZA 2WU4A 4Z99A 5F76A 4O4LF 1HA3A 1L5HA 5JS2A 2ZRNA 1A2QA 1QGDA 1TQDA 3LQ2A 4AY5A 1P7WA 3B3FA 2NU6B 4LWQA 4UCWA 2PXCA 5MN6A 3E8MA 3SQOA 3ZWXA 2Z43A 3TMKA 1W4RA 3J81A 5IAJA 5BMVA 3B7PA 3C3KA 4HV4A 2SICE 2O8EB 4BJ1A 4DIUA 2Q1XA 3KVYA 1LF0A 4IQGA 3V1YA 4HADA 3EIEA 3VSDA 4F6RA 4JJKA 4R1QA 4LDZA 2XWQA 5DSTA 3U7QA 3AW8A 4X1KA 1UQUA 3VPBA 5JUWA 3GGDA 1DTWB 1I1OA 1NJ6A 3GROA 4K1LA 4MXDA 4JI2B 2CDNA 3U1VA 1T2UA 5AKHA 3FRHA 5HKBA 1OGJA 5M7EA 1M54A 5B7PA 1DIGA 2PU5A 1LFDB 4O8ZA 5HFJA 5K51A 4C4PA 4PS0A 4GBJA 5BXYA 1U65A 4EB6A 1UBEA 3ZR4B 2DCMA 3A9UA 1ECBA 2ADMA 1Q11A 3ZI0A 1RXWA 1QQ7A 3DJFA 2YJ3A 1EUCA 2PM8A 3HUUA 2NUAB 3FN4A 2Y1DA 3WK6A 3S99A 3G3EA 3KKEA 3TXXA 2RIRA 2NXNA 3IUPA 2ZATA 4EG7A 4HS9A 4RK7A 2WHPB 4RTQA 4RH1A 1A8HA 2ZJ4A 4U6NA 3OCZA 4LDNA 3AVPA 4QTXA 3ZTYA 2Q3MA 4C6HA 2Z6VA 3DL2A 4X1YA 2ZQYA 3T1QA 2BM0A 4YDSA 3B5JA 4F1WA 1WSWA 1J4AA 2GI4A 2HHLA 1GT6A 3GVCA 3IP8A 4J6EA 4PZ9A 5C5DA 2I76A 4G63A 2JGKA 1I7NA 2B4YA 4I1UA 2BFCA 4L7VA 4YJGA 4BLRA 1ZR2A 4IQ4A 1YB5A 2E4ZA 3WWCA 4I4CA 3LNTA 1UXKA 2MSNA 1V6AA 3LI2A 5J4YA 4TS9A 2PKRA 3QELB 4G41A 2FWJA 4PO1A 2XGGA 1W94A 4G0PA 3A28A 1TKAA 2R1VA 4MR8B 1YD7A 5BVGA 1XZGA 5IH3A 1N1EA 3F73A 2EATA 5AHXA 1D8AA 2NAPA 4AF7A 2LKDA 3UV7A 3GVHA 5I8ZA 3ZDAA 4KXXA 5HHTA 1OAOA 3GGSA 1SQGA 1Z38A 3IAXA 3WVNA 5L7WA 4ZOEA 2R97A 5HE8A 1KWKA 1XRPA 4RESA 3RU2A 2AZXA 5LUBA 2NU9A 3IUBA 3TB6A 2R8BA 3AZOA 4OI4A 5ULLA 1P1IA 3GDOA 1OXXK 2WK1A 2XI4A 3WGYA 1R1DA 4IINA 3UNXA 4RQBA 1E6WA 2R96A 2I1QA 5TGDA 3WIOA 2XYHA 2HPAA 3GW8A 1HTTA 2C57A 4WLOA 3E9QA 4ZGWA 2BEWA 2P2CA 1C9NA 2ZIVB 3BXPA 5EKSA 1JQLB 4EHDA 1SHKA 4L57A 2X6QA 4G24A 4NFLA 1JPJA 1XF9A 2J3HA 3KRTA 4RU1A 1DHTA 4WLVA 2XECA 1V1JA 4RGVA 2JH9A 2VPTA 1DP4A 1U7DA 4FN4A 5TEVA 4AWBA 2Y1KA 3G23A 2QF7A 3KTDA 3Q7IA 1US8A 4KIGA 5IHXA 3K6SB 1KK3A 1RFGE 5CK5A 1GFIA 2GAIA 3SLRA 1FZTA 5EZYA 3IOEA 1SRQA 5E2BA 2H7CA 4B82A 1EQ2A 1TA9A 1LTHR 4NBTA 1H2BA 1Q0HA 1MDBA 1XKLA 1H4QA 1N92A 1H6AA 4QUBA 1D2CA 1TT5A 3TTXA 1PR6A 4YP6A 3WGIA 4L0QA 4P08A 4ND3A 1H65A 3M4NA 1KZ6A 2H1RA 3THWA 3DQPA 1UF9A 3X1DA 1KJIA 4IMRA 3L8ZA 4HVTA 3AVOA 4XX1A 1ZIYA 2QXUA 1SCBA 4ZCTA 1H4TA 2PBRA 3EIQA 4E2ZA 4JHLA 4B17A 1U1DA 3ZGYA 2XUZA 1AIPA 4RFVA 2VHQA 4MUAA 4A8JB 4OMUA 5PNTA 1RPJA 4V0OA 3Q7RA 4QLOA 1MPXA 4YCAA 3DE6X 3T99A 4CDNA 4JL8A 4YRPA 1D04A 3N8KA 1M6YA 4BWVA 5CA0B 2ZT7A 5LZ5A 1K8XB 1FVFA 1WMFA 5D3ZA 4ZT6A 2WSIA 5DKFA 2NV0A 4FGWA 4ZAWA 1QHIA 1UBFA 3D8UA 2Y0BA 4QDOA 4FNOA 1NL3A 4C0KA 1POWA 5K8TA 3QE3A 4LMAA 1FS5A 4PEVA 3M70A 5DGTA 1YF3A 2UUBB 1NBME 4DQLA 3WE7A 2PVPA 1ZIXA 3WMXA 4DCUA 1NLFA 4DCTA 3FPFA 4KX3A 3HJCA 1QVWA 1RMQA 2V97A 4X8HA 3EVZA 3ZBTA 2O7NA 2D1SA 4AY6A 1FEZA 3IRUA 4Q3CA 4TYNA 2DQ4A 4IDPA 4WHMA 2J3MA 4KWCA 4B79A 4FOTA 3WHIA 2HXSA 2H2GA 1P7YA 2OTCA 2AFIE 3I0NA 4U39A 5DI3A 5J2UF 4G36A 3WB1A 5AYVA 3OTOB 3BEOA 2CLCX 1X2EA 2DR3A 3LD9A 4CQMA 3L3BA 2Q3CA 5A3JA 4BC0A 2VWHA 5E6RB 5TQJA 3HR7A 4QYIA 1EEXB 4OLJA 4LISA 3T3PB 4F3NA 1EK5A 4UBIA 4BMNA 2ZKIA 1FTGA 2I7VA 4JXXA 4Q1EA 1LPBB 3ORQA 4FB5A 2FPKA 4OYRA 2P5TB 2YWRA 3N2ZB 3IQDB 3WLLA 3H3JA 1IJKA 1P62B 4MUNA 1Z07A 2AG8A 3QY0A 4FOLA 1TJPB 2GD1O 5IP5A 4MWEA 3UWKA 4Q4JA 5C8ZA 3NIGB 4JMPA 4R3UC 1I36A 4Z7OB 2WYVA 1MO5A 1GKUB 3FJOA 4HF7A 3ABZA 1D2GA 3PD7A 4KNWA 1LA2A 5HM6A 1Y5IA 2G9VA 4IJQA 1JNYA 1WCYA 3DHYA 8LDHA 2B2NA 3MM4A 1BMQA 1V41E 2V6IA 3D7LA 1OCEA 4A5SA 2QTHA 4PZPA 2RHOA 2O57A 4URWR 5CLJA 1RXSA 4LFBB 3OZCA 3WJ2A 4ESOA 3F8WA 2ZBUA 2VYVD 1ZN7A 2G4LA 4PLVA 3GVXA 2O2YA 1ENPA 2AHRA 1O6BA 2GFHA 3IQFA 4D5GA 1RXCA 1NUUA 3I5AA 3PYMA 2XJ9A 1PD1A 1X7YB 1ORDA 3LT4A 5HMLA 1TEXA 3VKFA 3WXMA 5FUVA 4MMXB 5AKLA 3AG6A 4EY6A 4EB3A 2C2GA 2W42A 1K5GA 2OBXA 2VJAA 5AM3A 1D4OA 1T5SA 3NBFA 2QWXA 1SU7A 1ZH4A 1JECA 1TUGA 4Z3OA 4FU0A 1OH6A 3LVRE 3GP8A 3L0CA 1D2NA 2B21A 2BZ1A 2NPIA 3DXYA 5BN1A 1OJLA 4Z7QB 2FPMA 2WYWA 4Q7KA 3DE4X 1YDFA 3K0SA 2JZCA 1R8YA 2CEAA 1HY3A 1XTBA 1XTZA 3OU6A 4PNPA 4PZAA 2NYVA 3MTGA 2FWNA 4RD0A 3PTLA 4D43A 1C50A 2C5LA 1ZK0A 1J2UA 3O93A 4CLXA 1N5OX 2CUKA 2VJBA 5H81A 5DM70 3GQBA 2XOEA 2W70A 2H4HA 1Q0SA 4NS1A 5DYYA 3GPLA 4DLPA 1MQ9A 4YROA 3VNRA 4H6PA 2ZDQA 1GKYA 5AKIA 4Y1RB 2FUKA 3LDUA 4D2IA 2VF7A 3A1CA 4UCQA 5JZOA 5LKAA 3C7TA 4IMIB 2WR8A 4B85A 2AWOA 3NEYA 5A1TA 1OX5A 3HADA 5L3ZA 4PVDA 1UMBB 4XEUA 4ZVVA 3UATA 2HF2A 4K9DA 3B85A 1XTIA 3CX6A 3NWEA 4PC2A 3GY0A 3NBYC 3VPSA 4EPWA 4B3GA 2HQRA 1Y5RA 4QYWA 1RJGA 5REQB 2ZWVA 2ODWA 4FNMA 2XUQA 3HJFA 1S0UA 2WJWA 4MVJE 4PLTA 4F5YA 3L1JA 4B3SB 2DUNA 1CF9A 1UC8A 3ZPXA 2O52A 1JEAA 1VE9A 4DMHA 5BV1A 4R69A 4R7TA 4PBTA 3U48A 1IE3A 1TAQA 4MDYA 4AICA 3GEBA 5EOVA 5KOJA 2LPMA 2BMAA 3K92A 5L95A 3H9EO 4PXYA 3PG5A 2DWCA 3QTLA 3V2IA 1SIWA 1K7SN 3T54A 3FVVA 4TTVA 1TAUA 2PS3A 3PDWA 1MX5A 1L4UA 1NMZA 4YN3A 4BUJA 1SK9A 1QE3A 1K97A 3CKMA 3VO1A 3GLGB 3UMYA 4GUAA 2D1RA 1NAIA 3FGNA 4JB3A 5LWQA 3FGPA 2VJPA 1MAWA 2GF2A 3T61A 3ET4A 5GAJA 1QAQA 2PNFA 3G59A 1NW8A 1WZCA 5HPYB 4LHYA 3AUTA 1FNNA 2WRZA 4Q82A 4L5BA 2NXWA 3AF5A 3BMNB 3SQWA 3AR3A 5JO0A 2PKYX 4C01A 3A6LA 2Y4NA 1JHXA 5EQJB 1O95A 3G5MA 1SBQA 1U7HA 4P4SB 2MCFA 4BBAA 7YASA 1SOWA 3D8BA 1R18A 4LJKA 5BSWA 1NBMD 1PBTA 2ZJAA 4RY9A 3TDKA 1LGYA 4OFWA 2DLCX 2I7TA 3UXMA 2HRZA 3C3JA 5JAUA 2Q1SA 1H5QA 4TV9B 1A9TA 3ILYA 1V11A 1I10A 5ALFA 3VMMA 3JR3A 4DLLA 2R1ZA 3KZMA 1V7ZA 4IDDA 2GJSA 3DTNA 2FK7A 4J0HA 3PQDA 5DLYA 1VKHA 5ICEA 3O74A 3K70C 3C85A 1QS0B 5SICE 2OFFA 5IT4A 5FOWA 3ZQ4A 1Z8NA 1JG7A 1VHTA 1V7PC 3ZJ4A 3PWKA 5JALA 2ZUSA 2GLTA 3CUEF 3N8DA 2JHPA 3M4ZA 3NMUF 2JFNA 3DP7A 1NNSA 1ZONA 3HRIA 4ZAGA 4BIMA 5KTKA 3VZQA 1JB1A 4I4TF 1RT9A 4WZAA 2OHFA 2YZMA 2QDKA 1NG1A 1VBKA 3FWPA 1VA5A 4Q5IA 3V7WA 1ZISA 3HVJA 5DDIP 3RPEA 1S2GA 4HDAA 1MNAA 3O8CA 3KZKA 1DQNA 4PRZA 5BRJA 5K7SA 3Q87B 3TJRA 3RAEC 4GLLA 2AG6A 1MC4A 1MO4A 1IHDA 1O96A 1IJFA 1OX4B 1P5RA 1QCYA 2FMKA 3WYDA 4AG3A 1A4UA 1XU4A 5E6SA 5DBOA 1E1YA 3L7YA 2IEGA 1QYVA 1CZNA 3T9FA 3BXGA 4KODA 4FOOA 3ISTA 2KMLA 1OASA 1L7QA 3NRBA 2C2WA 2RGNC 4KJXA 4DNOA 3F2VA 4YUXA 4TV8B 5IYZA 1QIEA 3W2EA 4KYIB 2C8KA 4NZPA 4ES6A 2B1JA 1Q92A 1TVMA 3E9MA 1C3VA 2PLAA 2Z57A 1WF6A 1ZD1A 2PSEA 1XZKA 2XVZA 4D96A 2YHBA 1EA5A 1NAHA 3LKVA 4ZA2A 5HBGA 3VX3A 1I1NA 4B80A 3E22B 3QLUA 1X1CA 3D43A 1N0IA 3PDUA 3WK4A 2RE8A 1JALA 3R8CA 3I8XA 2BFDA 3AI3A 3ZW9A 1Z29A 4NMLA 1CR0A 2CNOA 3OF2A 3BK2A 1UOOA 1W93A 2C5HA 4RKYA 3LVBA 3THXA 5A5DA 1G2PA 2ZB8A 2Z83A 5M3BA 1B41A 1IBCA 5TLSA 1IHPA 3CCFA 1D03A 2JJ8A 5B3JA 1CQPA 3P9SA 4P7JA 1QRUA 3NYRA 2R8PA 3KQHA 1WXFA 4UM5A 1M6VB 4WN9A 1Z3IX 1DIBA 2CNWD 1FUIA 2JJMA 1LRLA 1SKMA 3R7DA 2BUCA 1IB0A 4FHZA 4MVJI 1Y8RA 4P84A 4MWZA 1F6DA 4MA0A 5A4MS 2PWYA 4A26A 1NGSA 1RZUA 3DPIA 3DCNA 3HB0A 2XLBA 4OB8A 4K88A 1MJ5A 4XE5A 3MJEA 4XEHA 4BV2A 4ZHQB 3SNKA 3HJGA 1E0DA 2ZJ2A 1M7BA 4IXWA 3MHPA 4MVJD 1JAIA 5B1EA 5KYKA 4D4JA 5F5LA 3K0AA 4AJJA 3MINA 4J2HA 4WX2B 4POOA 5KZMB 1HG0A 2A1UA 3FUVA 3VSCA 3GFRA 3EC2A 5M04A 1ZN9A 4RWZA 1EQUA 1S2LA 1BKSB 2YQ4A 3VNBA 1G4UR 5C4MA 2WJ3A 3DR5A 3TUIC 1FVOA 2JF0A 1C7FA 3WGJA 4B4DA 5ICMA 4KXQA 2XZLA 4NHOA 2OHOA 3ZCVA 3UAYA 1CVRA 1YT5A 3SMVA 5JXWA 1HMPA 5JS1A 4B6QA 2ZM6B 1LVGA 1NNI1 3CLTC 2DP4E 1P9OA 1J1IA 2JCSA 3D5QA 3UJHA 3N8NA 1Z0FA 2PYDA 2GCOB 4XB1A 4AQYB 5JZSA 2HD4A 1JZQA 1JEJA 2DH5A 4CM5A 2X19A 3L7MA 1J0CA 4MB0A 3U19A 1PTJA 3UXHA 4J49A 4AMGA 3DG9A 3R3XA 3DA8A 4I1VA 4K81B 4ZU1X 1P72A 3P9RA 1QCDA 1CQJA 5DWDA 1QGUA 5A3QA 2BUBA 4OKSA 1NMXA 4Z3KA 2YWCA 3M6WA 5CXSA 4FFWA 3C6ZA 5JNLA 5G4KB 1PV1A 1UOPA 4C78A 5LMZA 1N6OA 4XJSA 5IBPA 3UPTA 3GAMA 3NTOA 5KTMA 1FUYB 1ZIOA 1XZIA 1JHQA 2NV6A 3OOJA 5FBZA 1X13A 3GPBA 4LN1A 2V96A 4FLMA 3U7IA 1CG6A 3CY6A 3B6ZA 3EWAA 1LEHA 1SBTA 1UMCA 3G89A 4RHYA 2MYPA 4PLGA 1YRQA 2QRKA 5HEKA 3BXEA 3RBZA 3W6PA 4E5DA 3GLRA 4I55B 2XT9A 1EWYA 1UJ5A 4MA5A 1CQWA 1UFQA 2UVPB 2VHUA 3HPQA 4G5YA 1MTZA 4L4UA 4WK0B 2WMOB 2VDOB 3HWX1 3VU8A 2P4UA 1VJDA 2WVGA 1I80A 3AO0B 2EFJA 2A0UA 4K26A 1Q1BA 3UJPA 3D2AA 2DBVO 2Q1YA 4RJJA 3DMGA 4N03A 4BMXA 3WO0A 3NHAA 2Q46A 4HGNA 2IP2A 1NASA 1GN8A 1LXCA 4U2BA 1XRLA 3L8CA 1L1QA 2FW7A 2IHUA 1DFHA 4BO8A 5C8YA 2PBLA 4KEAA 4AWXA 3CONA 5AK5A 2ZKLA 4EHIA 2FJUA 1PEKE 1Q1NA 1N2BA 4FGKA 3GGPA 4OL0A 1NG9A 3A70A 2QW0X 3B70A 1AGRA 4A9AA 4C08A 2YWGA 1U1FA 2E89A 1H8HA 2CJYA 2BGKA 2ZS7A 2V4MA 3D7SA 1T6NA 4MJXA 4NNJA 2A4KA 4YJFA 1Z8FA 5CA1A 4TL6A 1RR6A 2QJWA 4RMGA 5IJ9B 3TFWA 5JV5A 1AXGA 5IKOA 3ZDRA 2DPYA 2GRUA 2WNIA 2ODAA 1QDUA 2PX0A 2NPOA 2J08A 4H31A 3OLWA 4I5DA 5FWYB 1H1LB 4OQZA 4V0NA 1P60A 4JQOA 3MMPA 2JI6A 2EYQA 3O1LA 2O8CB 2AXEA 4DFDA 2B25A 4KB5A 3NORA 3L77A 1VCNA 1Q1GA 2QNRA 4XQEA 5E38A 5JNWA 2GD6A 2C7PA 1A4RA 1DX6A 1AZWA 2H29A 3CRQA 4QNRA 2HL6A 1PSWA 1S4MA 4D3FA 1C7QA 1EEHA 5AHWA 1NXPA 4F8EA 1I6LA 3CH6A 5EP2A 4OPMA 5DNUA 4I0WB 1L5GB 3SBEA 3T12A 1O6ZA 1I4TD 2WHQA 4RQAA 1Y4UA 3TW6A 3VSEA 3LGAA 2Q5IA 3Q3HA 2HK8A 5JEEA 2OBMA 4CCYA 4XM2A 3HXMA 1OTHA 1PL7A 1POXA 3GNLA 3M0EA 2YINC 3LP6A 5C7IO 4TMZA 2ZM5A 4F9FA 1QO7A 1YA4A 3ACBA 1EVLA 3GHYA 2YV3A 2DETA 2Q49A 4TMVA 1G3UA 3K2EA 1CZLA 3BJEA 4S1NA 1VL2A 3E15A 3C6QA 3EXHA 4IEIA 4LX8A 1L5ZA 2G9RA 3IV6A 4LYDA 3TVTA 4DCVA 1KH1A 2OV1A 2VQDA 3DLBA 4LXQA 1QSGA 1IHOA 2PMDA 2CNLA 2R6AA 3ICPA 3Q12A 2MR6A 5COAA 4BQIA 4N0EA 4EMUA 2FJ0A 5KYNA 4C4ZA 1GPNA 4RHEA 5CVCA 4LCBA 1BFUA 2N3ZA 4D0NA 2J7PD 4MO9A 2QX4A 2N1MA 3GDWA 4N49A 1DG1G 3HWWA 2X8JA 4YFYA 4RLHA 4JBHA 3QEOA 2ONJA 3VUEA 2XMDA 3N6VA 4XPIB 1Q1EA 5SY9A 3OWOA 3O73A 1RP7A 2Y99A 1P4JA 4F56A 4ZJUA 4P54A 2P9HA 4IO1A 4OP2A 2X7XA 3LAWA 4P3YA 3A04A 2XCSB 1E6MA 5K3CA 1JH9A 1EWQA 1KU6A 1R9MA 5FUBA 1BNCA 3HYTA 1JG3A 3N3AC 4V2UA 3EK2A 3F1KA 3U5ZB 5JH7F 1N3YA 4QQFA 5F5NA 2HNBA 1XHFA 3AESB 4UM8B 4ETNA 3BRWA 2X2FA 4TWAA 4L8YA 4NU0A 2O6HA 1ODKA 1Z2OX 3DTVA 1DRUA 2C95A 2WAOA 5JQWA 4B6SA 3T5BA 4CMJA 2EP7A 4IUCS 4RCYA 3WLNA 1PSZA 1BHO1 3H13A 2G4VA 4B45A 2F1OA 2QMUA 2XKKA 4GGOA 4EJ2A 4IYRA 4Y2VA 1D6JA 2D1QA 1QTQA 3AK4A 2V03A 3M3HA 4MRMB 1EM8B 1INLA 3LY7A 3TM5A 4DR6B 1X8XA 5INTA 3GFFA 3Q88A 4H6VA 4ZPXA 3OT5A 1GWNA 5EJEA 2AMLA 1UK9A 2FZVA 3QYJA 1IZ8A 4KL8S 3P2YA 4I1RA 4KTVE 4JBWA 1I5OA 2XNCA 3H9GA 3OHMA 5H3CA 1II9A 4XRRA 3O1JC 3QA3E 4DBLE 4GOKA 2WD7A 4NJOA 1E94E 1N0WA 2R6JA 1IDN1 3HLYA 3OX1A 2Y68A 3AETA 3WAKA 3FTDA 4UMVA 2EJTA 2K2WA 3U7HB 4GOJA 2EX0A 2ZYVX 3I61A 3OZTA 2HFKA 5KI6A 3SDZA 1VLHA 3WHKA 1MA3A 2WF5A 4UDYX 1ZVJA 1MC8A 2A5DA 3FRIA 3IQEA 4OXNA 1EBBA 3LK6A 5TIIA 4KLAA 3ZU3A 2DB3A 1Z0SA 4KXYA 4MO2A 2ZS8A 3EZ6A 1COWA 1UXJA 3LYHA 2R8OA 4DR2B 2KWIA 4QBIA 3LZCA 4JI0B 1AK1A 1DT3A 2WFLA 4HQLA 5EE9A 1E64A 2OMEA 1YQUA 5CHYA 1GRVA 3Q8KA 2Q8QA 2EL7A 4LXTA 1JT2A 4CTMA 3T35A 4HWSA 5H9VA 3L4KA 3OJXA 3QUQA 1NQVA 2XF8A 3AEKA 4OHCA 4IBOA 3K4PA 4PFSA 4EEKA 1Z4NA 3KVOA 3P9QA 3UAWA 1BCSB 1IXKA 2X7HA 2VP6A 3QWAA 2ARKA 2CLOB 2MIIA 4TVSA 2ERCA 4ZVTA 4KWHA 1CX9B 3LP8A 2AUNA 1NA5A 1NTOA 2PLFA 2FRXA 4ID3A 2C4TA 4KYUA 5ECDA 4B4OA 2V58A 1WEHA 2GEJA 2F4VB 1AOXA 1Z82A 2YXPX 3AR7A 2L69A 3CSSA 1R12A 5CRIA 4YLEA 4S2EA 3VJMA 3TNFA 2HPHA 3JZDA 2F1IA 3G8AA 5IBCA 3Q9LA 2PA0A 2DG2A 3GQVA 3LUHA 1EBUA 5CG2A 1NZJA 1UINA 2YDYA 4GSYA 1G17A 1NF9A 4XGQA 3D1LA 5CNJA 3C3DA 2GTHA 4URZR 1V26A 3QKRA 4Q9DA 3E23A 1RVDA 1PYGA 3MWJA 3NH9A 2AR7A 2DLNA 3DE1X 3ZK9A 3ONVA 4MYTA 3TLCA 1B43A 3CF4G 2C4NA 3HG7A 1G2IA 2WAYA 2V7WA 4IOJA 1S2MA 3RVBA 4RVHA 4DPKA 4FWTA 4RY8A 1TYDE 2B5VA 4WIAA 5FOQA 3UK6A 2FR1A 4HB3A 4MPPA 3TG2A 2KX7A 1JFSA 2WTBA 3ONEA 2IYLD 1N1MA 1DNPA 3WDMA 1QE0A 3U3RA 3G9UA 4KJZA 2BZ0A 3A6ZA 2G80A 3VC7A 1F60A 3FOBA 1CIVA 2FPWA 1XE3A 3H9QA 2ZPUA 3UMBA 1PFWA 1XWWA 1B6TA 1T6ZA 4BO9A 5IDWA 5DM0A 1W4AA 4FE3A 1DCKA 1T25A 1Z7BA 4Y2PA 3TW8A 2IE8A 2R8YA 2VKQA 3T0FA 1OXUA 3D64A 1NBIA 3FDXA 1UDWA 2WJIA 3AF2A 4HDKA 4NPCA 2XZTA 2I6SA 2QLJA 2Y1FA 4ZZIA 1VE7A 3C98A 3ENZA 1RYFA 3BREA 2VHJA 2YNMA 3COVA 3D0KA 2RK3A 3IHTA 3ONFA 2UZ1B 3KBBA 1KZYC 2EFEB 2I29A 4IIYA 3ZWKA 4EPYA 1JR3D 3PHLA 2PIAA 3S4YA 4QYXA 1CRPA 1SHZA 3A4YA 4OKIA 3OQMA 3UH1A 4MWBA 1WDMA 2JGLA 3W77A 3LXRA 3IL2A 3W8DA 2PUFA 1DIHA 4EY7A 4RNDB 4RWEA 2G1KA 1SBNE 1Q3KA 3FR7A 4XH9B 1I3MA 2IIBA 1H66A 4CLOA 1P1HA 1MR3F 2IYSA 1QIGA 4R0NA 2WPDD 1B23P 5IC5A 1Z8DA 1U0HC 2J0QA 1HKHA 1T5HX 4CG1A 3ZKWB 5HJ5A 1PX2A 2GXQA 3DFIA 1FY2A 4MPDA 2N0SA 4F72A 3AFGA 2JI8A 1JE1A 4OFXA 2GNPA 1SPXA 3DWEX 4M7RA 3C8UA 5AJZA 4ZCLA 4UOZA 1PNTA 2VTBB 4BPBA 2AMFA 5E0KB 4F5EA 1KFJB 2NGRA 1LK0A 1LLQA 1CC1S 1EMDA 1REQB 1YNSA 1EP2B 1TJ4A 2QD3A 1J33A 2QVCA 2ZPTX 3DBRA 3H7IA 1D1SA 1KVSA 2PGOA 2VBCA 1CRQA 3HDQA 4PZCA 4RM3A 5CT4A 5EINA 4QLBA 1E77A 1BJKA 3O8LA 4UMFA 4B81A 3RO7A 3RADC 4N7JA 5LZ4A 1N2IA 5JR3A 1QZTA 1L7NA 1P3JA 4IGIA 2BF4A 3OP1A 2WFMA 5FPQA 3VH3A 4XCVA 1ABFA 1A50B 1GOTA 1IEQA 3FKSA 3JATA 1BRMA 2FFRA 2PFGA 2PKQP 1T35A 3T0IA 4BDTA 3IEXA 4CFYA 1C3LA 1ZS9A 2PZBA 3DFZA 3PHJA 4MI6A 2WIAA 3AUAA 1BQ4A 1GZDA 1YBFA 1PWEA 3A9CA 1CUVA 3EARA 3PEUA 2EBWA 1ZU4A 3AH8A 4XR9A 4AJNA 4X7BA 5GP1A 3DHEA 4HAUA 4JBGA 4DUPA 5K1ZA 3EDOA 5ENVA 2Z1DA 4G9GA 2JLCA 4YMHA 4P5DA 3T3NA 3EODA 4Q0MA 4PGGA 4KAAA 5DYGA 5H7XA 1OB2A 4JOCA 3UANA 1KJJA 3WQSB 1IG3A 2GD0A 4IQFA 2Y2UA 5JQGB 1JL3A 1JZSA 4J4TA 4LXUA