3OTGA

Crystal structure of calg1, calicheamicin glycostyltransferase, tdp bound form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
GRHMRVLFASLGTHGHTYPLLPLATAARAAGHEVTFATGEGFAGTLRKLGFEPVATGMPVFDGFLAALRIRFDTDSPEGLTPEQLSELPQIVFGRVIPQRVFDELQPVIERLRPDLVVQEISNYGAGLAALKAGIPTICHGVGRDTPDDLTRSIEEEVRGLAQRLGLDLPPGRIDGFGNPFIDIFPPSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSSRDTARPLVYLTLGTSSGGTVEVLRAAIDGLAGLDADVLVASGPSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGTTLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPDNISPDSVSGAAKRLLAEESYRAGARAVAAEIAAMPGPDEVVRLLPGFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalG1
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA02
1GPYA 1EXVA 2BGUA 3TSAA 1WV1A 3G2NA 1FU4A 4KQ1A 4GZ5A 5DLDA 2VCEA 5HXAA 4M83A 1WW2A 3Q3EA 2R4TA 1XC7A 3ZCTA 5ENZA 3MRVA 1J39A 5DU2A 3OKPA 3T3IA 4RBNA 1PYGA 1P2GA 3HBFA 4M60A 1FTWA 2G9RA 3WADA 4Z5XA 2IYAA 1Y6FA 3E3LA 2X6RA 5TMEA 1C8LA 4HLNA 4AN4A 3ZCSA 2PYDA 1Y8ZA 1FS4A 1GZ5A 2QLLA 3L01A 1ABBA 2F3QA 2IEIA 3S27A 1XOIA 4LEIA 1C3JA 5DXFA 2QRMA 3CEHA 3EBPA 4XI9A 2BGTA 2JLBA 2GEJA 1UQUA 3S28A 1GG8A 3MS2A 3ZCRA 2ACVA 1WW3A 2IUYA 5JTTA 5I45A 3L79A 2C4MA 2F3PA 3OY7A 2VSNA 3T7DA 1L7XA 2QRPA 4YI3A 1EM6A 3H4TA 2IYFA 5GPBA 2YJNA 1RZVA 3MSCA 4F96A 1Z6PA 3CX4A 3HBNA 2R66A 3OKAA 1A8IA 9GPBA 3VUEA 1KTIA 1JG7A 1LWOA 1L5SA 1Z62A 3CUWA 3Q3HA 4BFCA 4N3AA 1XKXA 2ATIA 2AMVA 2XGSA 2GPNA 3DZCA 2AZDA 3H4IA 3D1JA 4KQMA 1RZUA 3OTIA 1NZDA 2X6QA 3CEMA 2QN9A 4GYWA 1GPAA 4GYYA 4YUAA 3UYLA 2KS6A 3GPBA 4RENA 2PRIA 3QHPA 3L7AA 2GEKA 1GGNA 1NLMA 5TMBA 3QKWA 4WADA 2AV6A 3L7DA 3OTGA 2X0DA 3NPAA 3SYMA 1FTYA 3AMVA 2BFWA 3CEJA 2QN8A 3E3OA 4MICA 3MS4A 2R60A 4RIEA 4MI3A 2QN7A 3HBMA 1NOKA 4RIHA 3BEOA 4WHMA 3ZCVA 2ZB2A 3S29A 2C1ZA 7GPBA 3BDAA 4CDRA 4RIGA 2XA9A 1K06A 1L5VA 3RSCA 4GPBA 3BD8A 2IW1A 4W6QA 3T3EA 3MT9A 8GPBA 3C48A 1H5UA 4AMBA 4NESA 4GZ6A 1K08A 1JIXA 1JG6A 1QM5A 4L22A 2GJ4A 4X6LA 3MS7A 2PRJA 4KQ2A 4GZ3A 3CUYA 3OKCA 4QLBA 4MI6A 6GPBA 3MTDA 1Y6GA 4MHOA 4RIIA 1GPBA 4AY6A 3CUVA 2G9QA 1VGVA 1JIVA 3S2UA 4EKYA 1JEJA 5LQDA 3CUUA 1IIRA 4REMA 4G2TA 3EBOA 1P4JA 1F6DA 1FU8A 1WUTA 3NCHA 1NVKA 3COPA 3MTBA 3C4VA 3IA7A 1AXRA 2P6PA 3E3NA 4X7MA 3MRXA 1P29A 2G9UA 2F3UA 4LDPA 4HWGA 1C50A 3CUTA 3NP7A 3BCSA 1M5RA 2XCIA 5JTUA 1P2BA 3G2IA 3PE4A 2JJMA 3ZCPA 3RT1A 2F3SA 1AHPA 2JZCA 4FKZA 2QLMA 3GUHA 3NB0A 1RRVA 1O6CA 1UZUA 1LWNA 1NOIA 2R68A 4MI9A 4WACA 3UYKA 2HY7A 2QRQA 3VDNB 3FROA 3C4QA 3WC4A 2C1XA 4FZRA 5D00A 1FTQA 2IEGA 1XL0A 3MQFA 3BD6A 1B4DA 4F9FA 3D0RA 3PE3A 1XL1A 3DDWA 2X0FA 4XIFA 4MRAA 3G2KA 1P4GA 2QRHA 3ZCQA 3T5TA 3VDMA 2ECPA 4X7RA 3G2HA 3NP9A 1L5RA 5D01A 3D0QA 3OY2A 4BQIA 4NEQA 1L6IA 4AY5A 3MT7A 4CTNA 3VUFA 3BD7A 4EJ2A 2OFFA 4EL0A 1YA6A 4N3BA 2SKCA 4PQGA 3TOVA 4F97A 1JIUA 3DD1A 3OTHA 3L7BA 1P4HA 4N3CA 3TAXA 4RELA 2GPBA 2QZSA 4BQFA 1P2DA 3G2LA 1SXQA 1SXPA 4N39A 2G9VA 2F9FA 4AMGA 5TMDA 3S0JA 1YGPA 1NOJA 2GT1A 2X0EA 4CTOA 2PQ6A 3T3GA 1Z6QA 3NAZA 3RHZA 4EL5A 1E1YA 3HBJA 1BX3A 2AW3A 2XA2A 1PN3A 1FU7A 3DDSA 2VG8A 2BISA 2XGOA 4BQEA 3OT5A 2QN2A 3CV3A 3Q3IA 4X7PA 2C9ZA 3SYRA 3T3HA 5C1DA 2FFRA 2ASVA 4YI5A 3WAGA 5BNWA 2XCUA 2IV3A 3MRTA 3MBOA 3NC4A 2VCHA 5IKPA 1UQTA 2QN3A 2GM9A 1E4OA 5IKOA 2XMPA 2PYIA 2VSYA 3RSZA 4RIFA 3T3DA 1WV0A 1IXYA 1L5WA 2H1FA 3BCRA 1Z8DA 1HLFA 5TVGA 1NZFA 3IAAA 2WTXA 3G2JA 4NC9A 1GFZA 2XGMA 4N9WA 2QLNA 1L5QA 2O6LA 1PNVA 2SKEA 2FETA 4MHSA 3L7CA 2FF5A 1FC0A 2IV7A 2QNBA 2Q6VA 2SKDA 4EKEA 2QN1A 3O3CA 1C8KA 1QKJA 3MTAA 1WUYA 1PSWA 2XA1A 2R4UA 3MT8A 1XV5A 4CTMA 2H1HA 1FA9A 4M7PA 3BCUA 2QRGA 3ZCUA 1V4VA 1F0KA 2ACWA 2GPAA
chains in the Genus database with same CATH superfamily
1EXVA 4Q4HB 2ZR7A 4JENA 4D81A 5IZCA 1YRHA 3TSAA 4CQMB 5B55A 1E0AA 4ESOA 1UFOA 4UZFA 3NWEA 3LBFA 4O2BF 3NHJA 4F84A 3U3RA 4WOBA 1L4KA 1UZLA 1KMMA 5LA6F 2OFWA 4U7FA 5EP1A 3R0QA 2VAWA 1ZJ5A 4I4TF 1TZJA 2PS9A 4HI0E 2XVYA 5AOVA 2XI4A 3TUIC 1CRQA 3NGXA 3PDIB 2WD9A 3K9BA 3RPEA 4CFSA 4XCVA 4L28A 4G3XA 2Q3EA 2VK8A 3L4BA 3LT0A 4LXQA 3MF4A 3LW7A 1J39A 2X5XA 4ZU6X 5KX5F 1U7PA 2EXXA 1V8FA 2X8JB 4ERXA 2X42A 5IM4F 3GOQA 1E5DA 1LCIA 1IDOA 1GOTA 3GLSA 3R0JA 4RY0A 3HA2A 1DRJA 2P1ZA 3R76A 4RPLA 2JAHA 2ZWMA 2PXAA 4JL6A 4M60A 2EYUA 1RM4A 2E9SA 3D8TA 2CEKA 2QL5A 2QYOA 2CNOA 2QRJA 2W11A 2FR0A 2Y67A 3AVQA 3EA5A 4LHWA 4M87A 4OL9A 5E1BA 3WHLA 5KYXA 1RKXA 5HS4A 3ZU5A 1Z2NX 2IVZA 3FF1A 3THWB 5AXCA 4HLNA 3K0AB 3OAAD 3JQPA 1AK1A 4PG4A 3HABA 2A0WA 2IEDA 4R83A 2W70A 3ZGVA 4YRIA 4HQKA 2Y1OA 4H9GA 1BA3A 1L1EA 1W88B 2OK7A 2WR8A 4D9NA 3OETA 2IRWA 4K9SA 2TRSB 2F17A 4MKIA 5DHTA 3OQMA 2LWIA 5EY5B 5SY4A 4BEWA 5JCJD 2P2NA 1QZTA 3OP4A 1MH9A 4TLMB 4HH3C 1J8QA 1FFGA 2V97A 4KNWA 1NUQA 4RNCA 2C0QA 3HKBB 3V33A 3Q15C 3UC5A 5ADWA 4X8LA 4BU1A 2RB4A 3NDJA 1AIPA 1AKTA 2BRUA 3QV2A 4WXRA 2X14A 3I92A 5DX8A 3FMPB 3ELBA 4ZVOA 1EWRA 2V3VA 3F6CA 3N53A 4REQA 3WQBA 2PEYA 1MF7A 2J9YB 3R0XA 2GBPA 1JTVA 5FAKA 1SUFA 1QMGA 2W2KA 4RK0A 3A05A 5LOVF 5J43A 3RSHA 1MORA 4FYIA 1M8KA 3EXG1 3OY7A 3SQXA 2BEWA 2A2ZA 5BQOA 3H11B 1I01A 4X60A 4C01A 1XRJA 2EFHB 4QOFA 3BWBA 4NBTA 2I87A 2IYFA 2WPNA 4RDCA 1RYBA 4C4XA 3V8NA 3C5WP 1X94A 2WA2A 2WSYB 4BFYA 1DARA 2QYSA 4Q7MB 3TMYA 3B3AA 3DTYA 4FGLA 1C1XA 4GP7A 4KKXB 4JOCA 4PIMA 3VQTA 4DC9A 2KYRA 2E5LB 5CTAA 1E6LA 1RMYA 3NHZA 4KLRA 4BECA 1WDTA 3T1HB 2XNDA 3SHFA 2XB6A 4OQLA 5ESXA 2HOQA 3OKAA 2MTBA 3GQBA 3GB9A 3R7BA 3PPYA 4OREX 4TTIA 5KYVA 3ADKA 3EFOA 4RGVA 4HTFB 2FZKA 3KTDA 3NUZA 3LOQA 3AF4A 1JMYA 3FB1A 3TR6A 2J67A 4N3AA 2HJRA 3GRKA 4Y2JA 1DJOA 2P11A 3RR2A 2FQQA 2GPNA 5HUJA 1VLMA 2X2OA 2AYYA 2VHYA 4E11A 2GVZC 2ATEA 5INTA 3K1AB 4HH1A 1TUIA 3IMCA 3PR3A 4RMNA 5HQ3B 4IAOA 3TZCA 1I32A 1NKVA 1NZDA 3UUWA 5C8ZA 5HIKA 4IFTA 4DHEA 1QIGA 2ZYDA 3NR2A 1GLVA 1QYXA 3GXOA 3TPCA 1ORTA 3RKRA 5H3HA 2FMTA 1CQJA 5H82A 2F43A 4Q9AA 3X2SA 2NVUB 3GZNB 1EDZA 1FQKA 1E1KA 4UMVA 3USES 5GV7A 3IPYA 4DIMA 2O5CA 3IQWA 3RVQA 4WK6A 5F7ZA 1QLWA 2I7DA 3TLXA 4LY0A 4D4HA 1RYFA 2PLAA 4QFCA 3VC3A 4NV1A 4RE6A 3ZE2B 3I1FA 4DUYB 2WVAA 1T0UA 3EEQA 5KKAA 1HSOA 1T4CA 3CRNA 3NHFA 4YMHA 3S5UA 2VYQA 1SVUA 4EECA 1GTVA 3PC8A 1HZZA 3AMVA 4JGGA 4YRDA 3NBXX 4IUDS 3V3KA 5CNJA 1C1HA 1KC3A 4OJKA 4YJ3B 5CVJA 1BROA 4W9NA 2C98A 4M1QA 3VTZA 4HX2A 3C3PA 3WLLA 1OWNA 4B76A 1IBRA 1TW3A 2ZRIA 1E3MA 1OXSC 5TGDA 2R60A 2A9VA 2FFJA 4YCCA 2NSYA 3W8RA 3TSOA 2PFSA 3V80A 2IH5A 3TDKA 3B8HA 4F3NA 4TS4A 4KIFA 2AX3A 3DAFA 4DHWA 1NNI1 1BZYA 2DH6A 3JATA 1IUPA 1JXOA 4JQSA 4OQQA 3ZDYB 4C6HA 5BNIA 2D0DA 4RIGA 3SQOA 1OJ7A 4PEVA 1RYNA 1A9ZA 2B25A 2GN4A 2Q5IA 2H48A 3F8TA 1LSSA 4BNIA 3HHEA 4YV2A 5ILGA 2AMLA 4ND1A 4ZEVA 1VYUA 1AKWA 4I9HA 4ZYVA 4Y2PA 1C1DB 3O2JA 5AWFC 3DW3X 4CG1A 2FPGA 3GF4A 1KBZA 3FFWA 3T7SA 2ZJ1A 1E2NA 5HQTA 1BJRE 4O5AA 4OXRA 1E9CA 3OHMA 4NPAA 1EE1A 4RXTA 5G40A 3W9BA 1TK3A 2WT9A 4JI7B 4JB0A 2QTLA 1THZA 2GNPA 4K9PA 1ZNQO 2M6LA 4L22A 5THXA 2I6FA 3PGMA 3DS8A 4LF8B 1KQPA 2BP7B 3KHTA 1OIWA 1RWVA 1AGYA 1NRXA 1VYTA 2XRYA 4IM7A 3R6LA 2EJWA 1PCXA 4Z9XA 2GO1A 2XTNA 4YJGB 3R3ZA 5CK5A 3RIXA 2R25B 2IV2X 5T64A 1EXNA 1ZC4A 1ZW6A 3N8NA 1CNMA 5JXJA 3LG2A 1P72A 2R4QA 4WCFA 2H2WA 2PQMA 2V7GA 3RNOA 1EINA 1PBTA 4TUYB 5CVUA 1EVJA 2PDAA 2YWJA 1ZGBA 2EZ9A 1FFEA 2GPSA 1B6GA 4KDFA 3RAJA 1PSZA 4RIIA 3VKWA 5CURA 3E05A 2IBSA 1YMQA 3FYDA 5D3MA 3PWSA 5MGNA 1UBUS 4DMKA 4OLHA 5JC1A 1DT3A 2VWPA 4XVHA 1VL2A 1NP3A 1XZGA 3OJCA 1NUUA 4GM4A 3QQ5A 3ORSA 4AICA 2MYTA 1NATA 2R6AA 1BS1A 3L0SA 5EJFA 3RC9A 4ZGGA 1MZVA 1Z6GA 1BHSA 1Y1KE 1ZA2A 1JNXX 3HCOA 3J7TA 3KKLA 4TXJA 1NP7A 3WXBA 3V4RA 3LXRA 1F9AA 1RKQA 4DJDC 4UM9B 5C5CA 4TV8B 1L5ZA 2FN8A 3LCRA 3ZE7A 2P6UA 1XB2A 3HYSA 1OH6A 5AK0A 5CDTA 3WSTA 3Q8KA 3AUSA 3KKKA 1KQFA 4MWOA 3M8KA 2NU6B 2XZDA 4UUNA 2K7FA 1IN1A 5CNMA 3EBOA 4GEKA 4UE3S 4V38A 3WYDA 2ZR9A 2JJYA 5CVTA 3HCPA 3BMCB 2XOKD 1HF3A 3COPA 1OLUA 1Q83A 4YAGA 4O02B 5ICMA 2C20A 3PBKA 4B4VA 2JW5A 4FFNA 5EZQA 2BUAA 4IJ5A 4DEXA 4MKGA 1U0TA 3AIOA 2X4IA 4R8MA 1GN8A 4B3FX 2H18A 4TV9F 3C7CB 3ND8A 4IICA 3RAPR 4LVNA 3MA0A 3TVYA 1UANA 4KKVA 3LCUA 4PYNA 1Z47A 2JLZA 3Q7PA 4OATA 2Q1SA 1REQA 3EHEA 2JGJA 3OZTA 4FU0A 4H60A 4MV1A 4TWZA 4Q6BA 1L7RA 1WUJS 4Y9UA 5D5HA 1EG7A 3FYUC 4M8SA 5DM2A 4ZT3A 5A3QA 4FGWA 4C0LA 3GRAA 3MWYW 3RRFA 1JR3D 2RGRA 4OGKA 2MR5A 4LTDA 1M5RA 4URZR 4BLPA 4HDKB 5JTUA 4M4SA 2XB2A 5BN4A 3PE4A 4AKTA 2GBFA 4I55B 2GN9A 3ZWPA 1PW7A 3CE6A 1UMDA 4MH0R 1BOOA 2FWNA 2ZSBA 4DV7B 1KYZA 3LLVA 4HEA6 4LYYA 3ORHA 4KO4S 4TYQA 1ZFNA 3QBDA 4ABYA 5JO0A 3I0NA 3GEBA 3ZCXA 1DAEA 4UVDA 2W2TA 2Z8XA 3PWKA 4A2PA 2O3UA 5TARA 1U7ZA 2R1TA 4UTRA 1R9MA 3F46A 3O8CA 3AJDA 4NXMB 2HY7A 4L85A 1R15A 1F3LA 1JQKA 1W0KD 3DKIA 4WEQA 4ENTA 2YJZA 4HQRA 4CI9A 3WC4A 2JFZA 3HGTA 4E5YA 4J0JA 4Q21A 2WINI 3ANNA 3L49A 1WSBA 1WP4A 2XNKA 2EFJA 1J6UA 3DM5A 5B1SA 4ZCTA 1CJVC 3WYNA 3OCCA 2JBWA 1P5RA 3MMNA 2XRZA 3O8NA 2O8FB 2EFDB 5A3SA 1G5PA 4OGGA 2WF6A 4R0MA 4XM2A 5KYTA 4WGFA 1I5RA 1UM9A 2G9ZA 4G0ZA 4QSMA 3O1JC 1I6KA 1H0SA 1I5EA 2P9CA 2XRFA 5DK4A 4Q9LA 3V4ZA 4FR0A 4G8DA 2ANCA 4LC1A 2EKLA 4PO1A 1XL1A 1EEXB 1G60A 1GZDA 4NOMA 3LP6A 3UTCA 4CCAA 1BDIA 2HQOA 1YZUA 5FJIA 1CE8B 3DH0A 4RD2A 4NZZA 4B32A 2OD9A 2WK1A 1WB6A 1MMFB 4G4GA 5I7AA 2AF4C 3PIDA 1U8CB 4TKZA 1T3LA 4DAEA 3NV9A 1F8UA 2JG3A 4OKIA 1KFCB 1N3IA 4BNZA 1L5RA 3CEAA 1LPPA 3CVOA 4AZWA 4OMCA 5H68A 3D4OA 3HO8A 4YACA 1K2VN 2ORED 3B8EA 3NDIA 4KXVA 4QQKA 1JT9A 2QNIA 2FVYA 5DTIA 3IMEA 2EF1A 5LDGA 4P80A 4CFYA 5JSQA 3A4TA 3KSDO 2ZRCA 3HC7A 2VTBB 4MQ6A 4EHLA 3E5NA 3U81A 5FPHA 5EERA 5AW1A 3OQHA 3GR6A 3K2BA 1VKHA 1KO8A 1WU7A 3PVSA 3R4VA 4CTNA 3H05A 1QC5B 4MRNA 3VPXA 4FQ7A 2OP1A 3PWTA 5J2UF 3B52X 3FB4A 2OFFA 3ITDA 2PD3A 4UQLA 1R1DA 2HJSA 5DP2A 1AQUA 2ADMA 4GX2A 1ZJJA 2IY7A 3G13A 2QOEA 2CCGA 4B3BA 3IQIX 2E6KA 3QA9A 2ZTSA 1OXVA 1QYVA 5IM5A 4RTJA 3E1GA 2QNRA 4NAHA 1F20A 1TRHA 4BFLA 2EARA 2HEIA 1TUGA 1RAIA 5HIIA 1NPYA 3SYNA 2JCBA 3P9NA 4O1HA 5CXSA 4C0KA 4PLFA 3T3OA 2FK8A 3RYFB 4UTZA 4O4IF 1DP4A 3T5PA 1P4AA 2QTVA 3G82C 4I5FA 2QUKA 3NNNA 2RMKA 3IV9A 4CKXA 1Q14A 3UW3A 5AKJA 2IIBA 1RM0A 2D1YA 1FTGA 2X0EA 1Y8QB 4Q6WA 2AXPA 4JHLA 1LRJA 1OLOA 2HSJA 2JCXA 4QPJC 1K5DA 1E1NA 3I9KA 3QA3E 1WMEA 2XUAA 5LB4A 1UBGA 4LRUA 2LXNA 1QHNA 1N0UA 2VYCA 3IVAA 1AK9A 2E7ZA 3ZKAA 4EYOA 5KYUB 2UYHA 4YMIA 4GDFA 3K9CA 1V7QA 3FCEA 5B7PA 1NBEA 3R8XA 3NEAA 4IXMA 1SG0A 2POQX 3W5SA 4YRMA 3IUNA 3LUJA 4N5MA 2PV7A 1QQAA 1ETUA 1J8YF 4C4YA 1KJQA 3V7UA 3JQAB 4D74A 5B1YA 4IOKA 3R5TA 3EMBA 2O4CA 3H16A 4QUEA 3OBIA 1T4BA 4LFCB 4D9MA 4YRGA 5KYKA 4A0GA 3P4UA 4M53A 1NVEA 1Q16A 2TMDA 1PFGA 2HLHA 3DLPX 4FMBB 4M0CA 3RRJA 5ADVA 1A97A 4HBGA 4LOKA 2PKRA 5JD4A 3A4YA 3MRTA 4BBAA 5E7MA 3ZLUA 4U5XA 3JY6A 1XWFA 3UWOA 1JAXA 2X76A 1X8KA 3SSOA 2EZUA 4GI3A 5ED0A 2GN2A 3JWPA 1V3UA 4E15A 1DC7A 2WILA 4LYDA 4ZMBA 2I76A 3F71A 3DOEA 1VHWA 3ES9A 1AKVA 2FE1A 4HBZA 1NI3A 5EQFA 5JNLA 3PXUA 1TRKA 1ZJYA 5DXAA 3E4DA 2XWJI 3TFWA 4F21A 1XMXA 2H1FA 2FN4A 2H7YA 1MJGA 2HNAA 2O5VA 2V4UA 2R6HA 1XDBA 2WSLA 3CVJA 2FR8A 2OY0A 3DMGA 3NC0C 3NTQA 1U1IA 1WHTA 5TVGA 2OPHA 4JI3B 2QTTA 3VTAA 2G08A 3V1KA 5DTEA 4KE6A 3FMVA 4NC9A 3WLHA 2WNHA 2OBYA 4UDOA 1CRZA 1MT0A 5KVQA 2OWEA 3WP1B 3AF0A 1DX9A 2J3EA 2W0SA 2R8OA 3PPWA 1ZLXA 1GTMA 3I9JA 4IJUA 4KX5A 1N1MA 2OB1A 4MUBA 5B1DA 1XU4A 4YQYA 2WT4A 2AMYA 5IT5A 5JZOA 4S05A 3OZUA 2R44A 4R1UA 4DLVA 2QNBA 5L3ZA 3NVDA 1L7DA 3DYIA 3TSCA 3BHJA 1RP1A 4KE8A 4ZHQA 1D1TA 2FA9A 3AR9A 1SXIA 4E5UA 4QX6A 3UMBA 4B6JA 1NY6A 3T0IA 1JB9A 3RSGA 1TO1E 1PSWA 3FPGA 3GN2A 1NSYA 4NZYA 4K8RB 1MRSA 4NULA 1KEPA 1N8KA 1EP1B 3R9WA 1J2EA 3BGOS 4P0PB 4AMVA 4LN1A 4EUHA 4HTAA 3SYLA 2OA0A 2YQ5A 3TTWA 4CJXA 5IH7A 4HDAA 4BRUA 1NBWB 4F2WA 1DG9A 1ADFA 2BJHA 1ULAA 3OM0A 2BEUA 1MAHA 5CLQA 3RKUA 4JJEA 1Z33A 4UAGA 1E9SA 2ACWA 4MARA 3ZD8A 2YCBA 4P93A 3HGMA 5B2FA 4INOA 2BGUA 2DAPA 1TX4B 5JBNA 2ZXEA 3I45A 1BW9A 2MSWA 1ZMBA 4NSNA 5HXAA 1UF9A 1K98A 3EGOA 2XTAA 3MJ4A 1G5QA 4G23A 3VOBA 5AXDA 3R77A 9LDBA 3ZWBA 4QA9A 4O3MA 2P9FA 2DBYA 1XC7A 8LDHA 3UG7A 3MVEA 4MVJD 4YP6A 2FLWA 3OEHD 1X1TA 1H1LA 2FPRA 4H3SA 3E1SA 4I7EA 4Y6LA 3PQ2A 1PDWA 2IYRA 5KTTA 4QICA 1B6TA 2VPZA 3ND9A 2PHZA 3T3IA 4EA6A 4DSAA 2B4QA 2C7BA 3D1VA 2YQZA 2VHXA 3BG5A 4OHFA 2JFYA 3L3BA 3WMXA 5CFLA 4CDGA 3MOIA 3DMHA 4PV7A 3UJ6A 3RRYA 4CLEA 1X1AA 2IYAA 4ZV7A 3KFXA 1RYZA 2ZAMA 3FCAA 3QLUA 3H7AA 2NIPA 4BQRA 2DERA 2ZKIA 4W5QA 1OBHA 2PBZA 1MUUA 4JU9A 1ZVJA 1OC2A 2G6BA 3TI7A 5AKYA 2ZCUA 2WVHA 1KOJA 3NHUA 1GZ5A 1BHO1 2Z4SA 3WGYA 1L6RA 1LW6E 2H4FA 2NYAA 3AP2A 3L43A 4R8KA 1PZEA 5HKBA 1IPFA 5DN6D 2WM8A 4E7PA 4ZKDA 1PKXA 1T1GA 3EZFA 1R00A 1ZITA 4MAFA 4TMTA 4EKIA 4ENPA 5I7HA 2WSMA 4ZVTA 1XCPA 1TCCA 4LJYA 2WIKA 3QTTA 2JLBA 4LSMA 3GLGE 4FEEA 4ZI2A 1MT3A 4NNJA 1BO6A 3R23A 1ZM7A 2P5YA 3OA0A 4WVFA 2GEFA 1DVRA 5HK8A 3I01M 3RABA 5E6UA 1GGKA 4DV5B 3DT8A 2R1VB 4ZI5A 2QDKA 2NT4A 5EJ7A 2A5JA 3C98A 4IEIA 4LHXA 3DBOB 2CBXA 2NPFA 1U9IC 2ODBA 1LV7A 2VJQA 3JVEA 2WFMA 2VJPA 4IL5A 4NBSA 2BMFA 3K70C 1D2EA 3IEMA 1Q44A 1CRLA 3FZQA 1QG0A 3R5KA 3TPZA 2YJNA 2BKAA 2Y1EA 3M2PA 3EEYA 4L0DA 1P44A 1NSFA 2RGGA 3W2EA 3WNZA 2P3QA 2OR3A 1SB8A 4A8JA 2BI8A 4WNCA 2Q5CA 4RY8A 4OH1A 4O4HA 3GV0A 3VDXA 3MWDA 3ZHYA 2P35A 3PF8A 3T5DA 5IKMA 2PS0A 1KEWA 3GJZA 2IH2A 4FSDA 3SIWA 1UDXA 5BXQC 2ODEA 1QORA 1L5SA 4NBVA 2NNWB 4F60A 5KPDA 2IZ5A 5IBRA 2YOFA 3WLAA 4YMGA 1HLPA 4Z7QB 3G9ZA 4R54A 3JARB 1RW4A 1L7QA 1IG0A 1MTZA 3LBIA 4URUR 1Y1RA 1EVEA 3CVUA 2Q8QA 4PZEA 5KNLA 2DJIA 5FOTA 3A9WA 2XXAB 3RFTA 1FFSA 4Q05A 3KJIA 2BGIA 3VR4A 1XPUA 1DHRA 1I4DD 3PCRB 4RMIA 2QG6A 3SIRA 4ARIA 1XKLA 1ZVMA 2CJYA 1E92A 2DHQA 4N5DA 3RSLA 1OBVA 4DEYA 4ZDWA 4GSKA 2RKWA 1J8DA 5IEBA 1LFAA 1BSVA 2FPIB 2W6ZA 3JAKA 1NNEA 2X15A 1M5TA 4N6GA 2C4WA 2FNAA 1UWLA 4DV4B 2IHBA 5LBTA 3NVKI 2V6IA 2XKJE 4I4NA 3H13A 2HDWA 1U3VA 1R4MB 3P9RA 4JV5B 4YDQA 1N2BA 1NFRA 4OAQA 2ZUWA 5CR9A 3MCTA 3NM6B 2WSBA 1CIPA 4RPCA 1N2SA 4DFDA 2QLJA 1MG5A 1V8ZA 2CKDA 2Z5VA 4IOLA 4TM7A 5HBGA 3ZNQA 5C37A 1P2TA 6AT1A 4Z3OA 1G6Q1 4R1QA 1ODFA 5IFLA 1E3TA 4HAOA 4MVJP 1A76A 3JAWA 1U0BB 2AZTA 3RIGA 4IR7A 4KGZA 1M72A 4LHSA 2J0EA 5JQGA 2JFOA 4HKTA 3UT5A 3IAUA 2BEVA 5D5QA 5EIXA 1K9VF 2H31A 4J7XA 1SIWA 5BOVA 2O0KA 3U31A 4CL8A 4QZVA 1IRXA 1Z0SA 2A5YB 1YUNA 1CUWA 1II9A 4RGYA 13PKA 2JA1A 3KFVA 4XCQA 4GPBA 4DA8A 3BD8A 4JWKA 3Q5GA 2YMPA 3DVLA 5BQFA 5JNSA 1M8PA 4QFBA 4EI9A 2BGGA 4WVLA 2O4UX 1VJDA 4OFXA 1PKEA 2QXYA 3W9UA 4LRTB 4AJNA 4G5GA 8GPBA 4O25A 2GN1A 4HK4A 1IOVA 4AKSA 1Z5VA 4JEMA 1WDWB 2WFAA 4AECA 2PL9A 3DAYA 4MRMB 2AA3A 2ZBRA 4IHKA 3ZGYA 3QWHA 3P9XA 1D7OA 3PHCA 2FY8A 3TCNA 3JR3A 1ENYA 2I4RA 2C2HA 4ZZ0A 3UGJA 1RNLA 4XVRA 3N2KA 3SF8A 5CIYA 2BC9A 2JLVA 3S1AA 3HYNA 4EB6B 5BYJA 2Z9BA 3GLUA 3MCWA 4LMAA 4AF7A 3VJKA 2J9FB 2O8CB 1M1XB 4GYKA 4NBWA 4M76B 4V0RA 4P81A 2M32A 3P9QA 1Y6JA 1QFYA 1IBCA 2BM9A 4PX9A 3KQQA 1X1RA 3FHOA 2XTMA 3PJFA 3DHEA 3HXTA 1USGA 4LNUB 2W5UA 1JL3A 1S2IA 3G79A 3KSMA 4XJSA 3GUUA 4XSGA 4B4OA 2MR6A 4MUIA 4RK1A 4NKRA 3G9QA 3CEPB 1DPFA 1JR3E 2Y8EA 3KAQA 4ARVA 5FA5A 5C4MA 1KO1A 3SEFA 2GN8A 1SQ6A 2A1UA 1ACJA 3AWDA 4JODA 5EZ5A 4QBFA 3KTOA 1ZESA 4GW3A 2A9RA 2BTOA 2CLOB 2H6EA 4JJ6A 3B1FA 3OC0A 3UQZA 4QBHA 4BN0A 4WK4B 4YT2A 3E70C 3BMXA 4UBJA 5I9LA 5ALDA 2HMVA 3ZX5A 1X13A 1YCHA 3DBHA 4X8HA 1XNQB 2J3KA 2WICA 2GJSA 4LDNA 4OBBA 3WI7A 4OHCA 1XPOA 3KLPX 3A6KA 4MEJA 3V34A 4YRKA 3RKSA 4X41A 1GNLA 1M34E 2CLLB 5HF5A 4GWGA 2Y99A 4D82A 2WJGA 3PUWA 1W94A 3BGIA 5JS2A 2BWJA 2J30A 1IY1A 1XF1A 3V3TA 1I7DA 1LV8A 1QUEA 5DCYA 2NVOA 4JLOA 10MHA 1JE0A 2Q8PA 1NL3A 4J76A 3A9SA 1ZBDA 2BFDB 3AV3A 4BKPA 2CHEA 2R6R1 3IBSA 4DIFA 1XALA 3EXHB 4NI5A 3SN6A 4ZCIA 4G0QA 1AXRA 3I62A 3ECSA 1E79A 4WQMA 1YC5A 3K0CC 2Y1XA 1AS2A 4WLUA 5ALGA 2Z5FA 1UAYA 2A0YA 3ECCA 1BDJA 5L51A 1COZA 4J7UA 1X7YB 1KJYA 5AVJA 4NU8X 2JIMA 1X80A 1ZW1A 5DYGA 3A3YA 4Q18A 2AEEA 2OORA 4RLFA 2G9NA 3T12A 1TTHA 3GGOA 1T6BY 2O8CA 2Y0CA 4CQMA 5AFSA 3JQ8A 4M0KA 4WK2B 1IWPB 2BH9A 5IKEA 3FZEA 1TEVA 4K3VA 3DBLA 1Z2OX 4ZEOA 4EI2A 1ZGGA 1LI4A 3D4BA 3D6FA 2GAOA 2D00A 2E1RA 3WG9A 3O4FA 5F1KA 3H9QA 5T3YA 1VE6A 1U2RA 4DR5B 1SBTA 2RGXA 4KOEC 4CE6A 4ZMRA 4HEA1 5C5DA 4B4DA 1B1AA 3FDZA 1IBMB 3MXOA 5JXWA 1UDRA 3U61B 1HG1A 2ZIWB 1AKEA 2P40A 4R31A 4L5JA 1MRNA 4BXOA 1T8YA 2XCOA 2B8WA 2Z58A 1H6BA 3AYZB 3I52A 3UYKA 4UHHA 4AS1A 2C7RA 4NFSA 1SXJC 3BYZA 4CLOB 4BO4A 5ELLA 2I4MA 2HSWA 2XCLA 3AF2A 1UC4B 3QVGB 3ZXIA 4OHVA 2VF4X 3HBAA 1YGYA 3MWEA 4KWCA 2AVDA 2AQHA 1KDVA 3TFQA 2NO4A 3SM3A 1PHPA 3M5WA 4MA0A 4X5OA 1SKMA 2QLFA 4MHTA 5IXYA 1BJTA 4MQEB 3MQFA 4HF7A 4NG4A 4F0JA 3MD0A 4PZPA 2CVOA 3C3XA 4Y98A 3FUWA 3P97A 3BT7A 4RKQA 3D4LA 2XUQA 4IIFA 5CRIA 3WDKA 1E64A 1UK9A 2ARKA 2QZJA 5JLAA 3EGDB 5CM2Z 1MQAA 3KKEA 2HH9A 5E3HA 1Z39A 5TRTA 2AUMA 3HWX1 4K26A 2PX2A 2W0MA 3JZIA 1ZK3A 2NP7A 4U0JA 1NFQA 4LOAA 1GT91 3H17A 3U37A 4DQKA 2HA5A 6ADHA 4HB0A 3Q3VA 2JIPA 3IBTA 2WM3A 2BBTA 1XTUA 1SFRA 4HJXA 4JC8A 1BDBA 2RK6A 4RTNA 3NV7A 2W93A 3BZBA 5HM6A 1KYTA 3HCRA 4QUKA 1MO6A 3HM9A 1HDEA 2REBA 5J5VA 2PFKA 2PSDA 3TIXB 1JFVA 3SZMA 3AQ4A 2XNJA 3AY7A 2CLFB 4ND7A 2X9QA 4ZIRB 5IULC 4W6ZA 1YNOA 3E9QA 1OFIA 5FTNA 2I4LA 4IUBS 1Y3BE 1Z07A 2GAIA 1K2WA 4MR8A 5F5XA 2QRZA 2DWCA 1DCTA 3TVDA 3BD7A 3VUFA 3X1JA 2O5RA 4J6FA 7REQB 1V6AA 2XLBA 3H1FA 5IJ9A 1TZ2A 2IX3A 1K75A 2ZM6B 1BKDR 1KO7A 2Y27A 4NQRA 5FFMA 1Z18A 1C0EA 3RQSA 3KVOA 5JBQA 3HPRA 3SICE 4H0FA 3TLJA 4ZDJA 1C14A 1LDGA 1NVUQ 2MCFA 3MSXA 3UM9A 4QULA 2J07A 3SJAA 1MABB 5BQPA 4FOOA 3E82A 1V5IA 4RVUA 1TZKA 3U9TA 3W9SA 1PGPA 3D31A 3O83A 2P67A 3ZLTA 3KT3A 2C54A 3L8MA 1QONA 1YI0A 2I3GA 4LI0A 1CZHA 1U65A 3LF1A 3N2GA 4RVFA 3WK9A 5FLEX 2JGRA 5IRCD 3MHPA 1ZAYA 3D2BA 4UAVA 4CQLB 3M7IA 1ITZA 2B36A 2W98A 3U3KA 1IOWA 5BUQA 1R12A 5K8UA 2DGDA 4PBSA 3OKFA 4OHUA 1Y1TA 5KQRA 4S1TA 2HV8A 2NZ8A 5AOAA 1FFYA 4PRKA 2Q45A 1Z7YA 3QY9A 4DLKA 3RM3A 4PYLA 3T34A 3LJKA 1RVV1 2NVUA 2XOEA 1Q1GA 3M49A 2FSFA 5IAEA 5ECGC 5SY6A 4UEOA 3P9KA 5FBKA 2CV2A 1PT9A 1U5BB 1XP5A 3JRXA 4IMIB 2HSEA 1U80A 3PEYA 1ZX1A 2L82A 4YDSA 3I28A 4D4GA 3KWMA 3MJHA 2DUUA 1FYFA 2ZU6A 4HRYA 4KV9A 4TZKA 2WTAA 4UM9D 4JIMA 2LBPA 4QFMA 2HKIA 1NUTA 2R5WA 1QTRA 2I4TA 3O90A 4LXHA 4A0QA 4K9DA 4ENWA 2Z6QA 2H3HA 2NTYC 3H75A 4DUGA 1D2CA 1JDPA 3FVVA 4JKIA 1WIWA 2QT1A 1G7CA 5EIFA 1J7JA 4EB8A 1CUEA 4LYHA 2ASVA 4ZALA 5BNWA 4DYDA 4TLLB 5IYZB 3QVJA 4JP3A 2ZI4A 5FYQA 1KFJB 4C4RA 1RHQA 3N87A 3Q1LA 5I3CA 2DY1A 2YZGA 5SYAA 3STXA 2GM9A 4JAVC 2QD1A 2QVLA 3WBKA 2NU9A 3FSEA 4AC9A 3CH5A 4IDNA 1WA5A 4ZJYA 3VR2A 2QSYA 1GVNB 1PDOA 2UYYA 1X1DA 3FNEA 5KNDH 2QX6A 3O92A 1Z8DA 3O9MA 4PSUA 4F86A 5D3KA 1IM2A 1R0ZA 4UKDA 3R74A 4JBWA 4I1RA 1H5QA 5FRDA 4YJ2B 1W4ZA 1O57A 2X5JO 3EZLA 1MJHA 3HLKA 3HRIA 2NU7A 4RZIA 2H29A 4DCSA 1YHZA 2CXHA 2REOA 1EK0A 3REQA 2ZRBA 2JFQA 2SKEA 2OAEA 3OZAA 5KWJA 1EDDA 3ONNA 1QVAA 1XAIA 4UQPA 3C1TA 3K0KA 4BUJA 4QODA 4YJFB 1L5LA 4BKQA 4S1OA 2OHJA 3DGEC 5TMPA 4L51A 4GH5A 2FF5A 2OWDA 3DZBA 1Q21A 2F1JA 4J6EA 4CT0A 1KVRA 2I7VA 3PCXA 2QN1A 3HJHA 2BMWA 4EHBA 2QV0A 2XGJA 1IVYA 1CX9B 4MR7B 4BUZA 1KXJA 2N1BA 1KSHA 2BMEA 1ADGA 4GS5A 3RC7A 1W1UA 4HRVA 3RRNA 1CS4C 4MXDA 4BGUA 3V97A 1G21A 4L4UA 3ENQA 4DY4A 3WJ2A 4RS4A 1PR6A 1WMBA 3QLTA 1QKKA 4U7DA 2EJVA 2PZKA 5JRZA 1P6UA 1QANA 2PZBA 1PJ8A 4FFBB 3DWIA 4LX8A 4V2IA 2B78A 1ISJA 4GHWA 5K8CA 1Z63A 1GGHA 3RC3A 2Z1NA 3M6AA 3QVWA 1TKBA 3K09C 3WK7A 4MLDA 2Q1YA 4PZAA 1ZL0A 2TMYA 1WQ1R 3ZHUA 5G4KA 4BIMA 1VJ0A 3JASB 1UPFA 4M9RA 4ARZB 2BFBB 5CPFA 1CHDA 1LVHA 1NKTA 1YAJA 2O05A 5F5LA 1Z28A 3V6LA 3EWAA 4KPYA 4NATA 4JELA 1WCWA 1V26A 4KGDA 4YRZA 5C3MA 2PH1A 3MGAA 3DCYA 4IF4A 1W36B 1HEIA 2NZ2A 4IUYA 3AESA 2XTZA 2ECQA 4Z0TA 4WZBA 5K0BA 4XM0A 1GPWB 2HHJA 3GRRA 1HDCA 1O9HA 4KEAA 1VPEA 3UATA 3FR7A 1O6FA 3LWDA 5SYMA 3MERA 2V5UA 3ZDZB 1YA4A 1K63A 2PYZA 1L1RA 1UBRS 2VRNA 4LHEA 4BMOB 1Q74A 4YXWA 1V9CA 4E4RA 4R16A 2OCYC 2IXGA 5AI4A 1B16A 1QIJA 3JVUA 3PA8A 5EWJB 2YXPX 4I1SA 3ZOZA 4BO5A 4Q4JA 2Q27A 4KWTA 4ZV9A 3JQEA 4R40A 1NLFA 5E6RB 3UAZA 4PZ0A 4A73A 1KZ9A 3IDZA 5FDFA 3H8VA 5ARCA 2BM1A 4XASA 5A3RA 1HDZA 4AN4A 1EQAA 1XMIA 1YSCA 2O3RA 1EPUA 3FVRA 3R40A 3U09A 1DAFA 2VATA 5TDHA 1EKXA 2AUTA 3SJZA 1VI5A 3SD7A 1R0CA 4EF5A 5DSZA 2GM4A 2MYPA 4MVYA 5TY0A 3FPHA 4Q1DA 1NXOA 1EUQA 2Q4EA 2FPUA 1TMOA 2SCUB 3ADOA 2WLTA 4FFSA 1SWWA 3TTXA 1UWCA 3CGGA 3V9AA 3PFKA 2YN0A 4YLGA 5F64A 3F3YA 3F6PA 1W44A 4O4HF 2X5KO 1BX0A 3EG9B 3NIFB 4OB6A 4QASA 1XZQA 1IWBB 2V58A 5A9SB 1WW3A 3QVXA 4AMZA 4RYLA 1XMPA 2HO4A 3EH2A 2Z2YA 5DNAA 4A0FA 2Q2QA 5K3EA 1JFRA 1XRMA 1DX4A 5DN9A 2JGDA 3K9LA 3QNWA 1HORA 1U1FA 4H3KB 4B3CA 2QZZA 3QI7A 4B75A 5KKCA 2C2ZA 2RAPA 4A4DA 2PS3A 4HFRA 1GXSA 1TF5A 1C7JA 2II6A 2WZQA 1N6OA 3JYOA 3O3MB 1KETA 1ZKMA 2FKAA 1GSOA 2HD4A 3IESA 1Z0FA 3PQ7A 3QJYA 4C7OB 2HWWA 3DSRA 4JBLA 3LVQE 1G66A 3BMNB 3ZJ4A 5IANA 1SIOA 1CQIA 1X6VA 3SSNA 4IOJA 5FI0B 4KGVA 4PNZA 4LXIA 2TYSB 2C2OA 3CW9A 5TV2A 1ONPA 4B3JA 3RI3A 5KNBH 3TGPA 3RANA 3CUWA 3EA0A 4HZGA 4KMOA 4WESA 1DAKA 1TQ6A 2L2QA 4S1PA 3ANMA 3M6FA 1E3JA 1ORVA 1ZYUA 1M2HA 2B6HA 2JJ1A 2NZUG 2VDNB 3PXDA 4OA5A 5JZ9A 4JUBA 2ENWA 1G5FA 1I7SB 1SPXA 1DPGA 4S3MA 1E1RD 3GMIA 3LZ6A 2J8ZA 1TCBA 4JCOA 1GNTA 5EJAA 4BHTA 2ERCA 3GLTA 1WXQA 4JYCA 2FEPA 2GXUA 3CEMA 521PA 4RH3A 1T5BA 2FG7C 2BFCA 1G2PA 3GFRA 4KW7A 4MUJA 3SQLA 3ONDA 1AJEA 3KUKA 3E18A 4ILEA 2X77A 3IJRA 5TT0A 5HPYB 1ODJA 2CNWA 1H05A 3BM5A 2EFEB 5JQGF 2AHOA 3U13A 4C5AA 4J0HA 2QAIA 1QGUB 2K2QB 2ZUDA 3FOBA 1QTNA 4C05A 4CYMA 2R5NA 1U8TA 3ABZA 4ND5A 4O2LA 2HXYA 5LP1A 1RAGA 3QTBA 1VZ3A 4DIBA 2IS6A 1VIDA 3DONA 3DXXA 1CKEA 3PXAA 4FDLA 3L5KA 5JS1A 3CRVA 2FQYA 3LCCA 1DOZA 1KDOA 1KORA 2IVFA 3VI4B 4PYJA 3HU3A 3VH1A 4FYHA 2A78A 3OM8A 4N7RA 3W5JA 1IIBA 1G16A 2ZRJA 4PU0A 2H07A 1JR4A 3KBOA 3I83A 4IZ6A 1P7WA 1B3RA 1RCUA 4RIEA 2AL7A 5EZYB 3RYFA 4UUQA 4HAZA 2PSJA 4TT3A 3KYDA 2X9NA 3EZNA 1C3VA 4I3FA 3ZD9A 1I4LD 3LX6A 1R0WA 3DVAA 4PICA 1OTYA 4TX1A 5CDGA 4EKNB 4CLRA 4WZ6A 1CHNA 2A59A 3HY4A 1EWTA 4QTTB 3VC7A 1HYGA 1A9RA 2LCFA 3AUXA 5H9VA 1K06A 1P1KA 2YHSA 4Y3UA 3B3FA 4RCVA 3T3EA 2GRJA 3MMZA 4GPD1 1XT6A 3GFSA 4GXRA 3G2PA 5KYUA 4LNAA 3TG2A 3RC8A 3LW8A 1XX6A 2IZ1A 4HFMA 4KHPB 2JEOA 2R62A 4FHCA 2WF9A 3GW8A 4BNLA 5M5BA 3UJCA 5K0FA 4GC9A 1VLJA 1XAGA 3SU8A 3GMDA 3ZI4A 3C45A 2H2HA 3I76A 4LI3X 5E9QA 1VHTA 5CFRA 3DDCA 2PD4A 2WTUA 4UVGA 5A4AA 1O5TA 1U0RA 1WXEA 1L5FA 1QNLA 1BMQA 1NYLA 2YYAA 4HGOA 1PNQA 1J7KA 2FMIA 3KU4A 2GCOA 2QRKA 1IN5A 3L7MA 1QCDA 4A2CA 2NSLA 3O94A 2QTWB 1H4VB 4Z6KA 1G6OA 1KP2A 1RXIA 2J3LA 2GAFA 3E03A 4MI6A 3DO8A 5ED4A 4XJXA 3T61A 4H4CA 3K4PA 3CLHA 3W0LB 4ZDKA 1NN5A 3P5BA 4A92A 1ZD1A 1O58A 4OJTA 4LAFA 1S1MA 1U28A 5FO1A 1T91A 4GNKA 4HRXA 5DLPA 3JQ7A 1YQQA 4I6GA 1TJNA 3JQ6A 5F7XA 4OI0A 1MC5A 1P6XA 1XG5A 3HWRA 4H27A 4IS2A 1G3UA 1N8TA 4CCSA 3PTZA 3UK0A 3F74A 3TGWA 4QNRA 2G9QA 1AKYA 2R00C 3O21A 2SNIE 3PUZA 3P8ZA 4YLEA 5AW0A 4WLOA 1G4HA 4KO1S 2WF8A 1KP3A 2ZJBA 2E37A 4PPFA 4R41A 4RVDA 4B2LA 1I24A 4I19A 4TM8A 5IN5A 2KPOA 5EJ5A 2FJPA 3L6DA 2PSHA 3AM3A 4A10A 4KR7A 1G2OA 3D7MA 3L92A 2IHNA 2NO1A 3EGXA 1MXHA 2JEYA 4FR5A 1QAMA 2FDCA 3L6RA 1HE1C 1JH9A 4RTLA 2RBKA 4B7XA 2A5GA 5CB4B 1L7MA 2OGZA 2J4CA 1IK4A 4R9NA 1GT6A 2ZSEA 2HQSA 4KFUA 1JFSA 1R5BA 3C8DA 4BTEA 4CEHB 2PKQP 3EZ9A 4UHCA 5KYYB 1JJ7A 4Q5IA 5TPWA 4KQIA 4L2IA 4X24A 3RJZA 4Z4HA 1QDLB 1VBNA 5HJ7A 2C9MA 2XDYA 3C7DB 1Z4LA 4ZANA 1JQLB 3HR4A 4MAMA 1Q2UA 4RACA 3D3WA 3HFSA 4HDMB 2F3UA 4RQTA 4WGGA 1EM8B 1AN0A 1W73A 2XVMA 1XYVA 2MWMA 3EA4A 5IVDA 5FX2A 4ZOLA 4N8EA 3HJGA 1IEXA 1Q1ZA 5HRUA 1PT5A 3EISA 4M9XA 1HYEA 4GBJA 2W90A 1Y3FE 1ZDMA 4H16A 3TCKA 1FUYB 2WU4A 1ZICA 3AOEC 3Q85A 1JA1A 1KK0A 3IB6A 4XDYA 3H9UA 3FCYA 4BX2A 3HMKA 1VQ1A 4PNPA 1D2GA 2C7OA 3BSSA 2ZIEA 1G2IA 1T3SA 2C31A 2JLXA 3D5TA 1XU9A 2VPPA 2FPSA 2GJAA 2VJOA 1F06A 2GFQA 5KJEA 1NUSA 2CNDA 4R5MA 4BVBA 1OB5A 2YHBA 1C7IA 3G8AA 2VUUA 4JS0A 3PQCA 2HUPA 4KLAA 4QYIA 1DJNA 3DCJA 3I4FA 3WXMA 4UEWA 1NOIA 2X5OA 1X0VA 2G1JA 1ODTC 2G40A 3FOAA 4RSRA 5HILA 5TIIA 4RK4A 3ORRA 1E6KA 4KUHA 1Q17A 2YWXA 4L50A 4O08A 3VDNB 4GGOA 4MUKA 3AU8A 2GTIA 2A67A 2HK7A 3O03A 1HO3A 4C2TA 2HF7A 2FXVA 2XZPA 5L6MB 3ZHVA 4EVQA 2AJLI 1B15A 3BZUA 4F3KA 1HYBA 4M55A 3VJMA 1T8WA 1PLJA 1XEWX 2GK6A 3COZA 2DT8A 1JU3A 4YBRA 1R4NB 5AVRA 5F3WB 1B4DA 3FCSB 2PT7A 3CTMA 1KOLA 1U7XA 4A0HA 3DXFA 1USVA 3O3OB 4U1RA 3MMXA 4IKOA 4QAQA 2G6TA 4ENSA 3VOAA 5IPFA 4ZARA 2OV3A 1NW6A 4LXGA 4R98A 4MRAA 1E32A 3TSWA 3ZGOA 3I5XA 1V11B 1HDGO 1UKCA 4P54A 1VCHA 1VIAA 4ALIA 2QRHA 4BAZA 1RJFA 3NGLA 1PQ4A 3KEMA 2H7VA 1JHYA 5FXMA 1O54A 1ZD4A 2PZMA 2OD2A 4YV7A 2H5LA 2J5XA 1QLJA 3EPRA 1YF3A 2VS1A 4Y2QA 1MIOA 4Z99A 7MDHA 4IV8A 4FDVA 5FPQA 3ISVA 2QTFA 5HE8A 2KLHA 3CZ9A 4BQIA 3PQEA 1QRAA 3CZCA 5K51A 3ZWYA 2P4QA 1M8FA 2GCGA 1IBKB 2CLHB 3LLSA 1P75A 1IUNA 3AU9A 3GMTA 5HIAA 5AMXA 1GEGA 3RFXA 2YIMA 1XCBA 3HHPA 3OCJA 3LBNA 3LNTA 1DO0A 3UJ3X 1VRVA 1C3LA 3CR3C 1VJRA 4YP5A 1RI2A 2OMEA 4X1KB 2AXEA 3OO0A 1E2KA 3VU3A 2JCGA 5EHNA 5C7LO 5L3SB 4YY3B 2RH8A 1OXTA 3QXXA 3RUPA 5TQ0B 3W5HA 4CLHA 4RXUA 1WVMA 1A27A 4DJJA 1NXPA 2AOTB 4KTTE 1K88A 2A6PA 2AOXA 3V8EA 1LD3A 3WL7A 2RAUA 4HDSB 1RC1A 4OG2A 2ZROA 4Y1RB 3VKVA 3L1UA 1C3OB 2I6TA 2JGKA 3UQYS 4MS3B 4D42A 5AHOA 1I4OA 3LT4A 4HL6A 2V96A 1S2GA 4TMWA 2B1RA 4P5EA 3BWEA 3BFVA 1LBEA 2W6QA 3GAMA 2MOKA 1QVWA 3OURA 3FLEA 1KGDA 3CX3A 5ALLA 3F8WA 5KWVA 1BKSB 4URXR 1CJUC 1HTTA 3IKJA 3J7AC 2D74A 4H08A 4W5TA 3GRZA 4YX9A 5AO9A 3KHKA 3RK4A 3TFOA 4KAJA 5FR1A 1E58A 2A7XA 3I09A 2C7VA 2P69A 4EUEA 2DXIA 3PGXA 3VDRA 4KQGA 5L3QB 4A8TA 3FYCA 3ISJA 3NAZA 1TJYA 1SHKA 4JKYA 2GTPA 4XKJA 3K20A 2I9PA 5FUWA 1EZZA 2F8MA 5TQVA 4B40A 5LQKA 1FFAA 4PS0A 1VG0B 3V55A 3M6VA 2VZLA 1IJEA 3NDRA 3NXKA 1JYSA 1YJ8A 3HEAA 4GEGA 2WUGA 4IDEA 1Y1LA 3D64A 1T36A 2I1QA 3UAYA 5CM9C 2XGOA 1XMVA 4ZVLA 2SBTA 1SUIA 5EN4A 2P6RA 2ZJ7A 5K03A 3AKDA 1AT1A 2COKA 3Q41A 1A1SA 4F1JA 3WAGA 2H4WA 3EB9A 4Y1EA 1X7XB 3GJ5A 4D9KA 1MAUA 2G04A 5I8ZA 2IV3A 5CH3A 3MBOA 1O0BA 4YRFA 1Z7EA 2V1UA 3L8DA 2OB2A 4L3VA 4UAUA 1T5LA 2X0KA 4MCAA 1GHTA 1TKCA 4EB3A 1P1RA 1YE8A 1P7ZA 1CY8A 5BSVA 2CZGA 3DTTA 1N9GA 3OC6A 1QP4A 4PG5A 4PHGA 1KH1A 1NLZA 4R0VA 4GZLA 2JAPA 3S2ZA 3W1VA 3U44A 1SC1A 4LZLA 1NVAA 1AN9A 3M1LA 2R6ZA 1YT5A 4DLNA 5HX7A 1YHNA 2AI1A 1VL0A 4BNVA 5IZCC 1U2GA 4ETMA 4HYTA 3DLBA 1JT2A 2P0AA 5KTMA 1LQUA 2QZ9A 4MRMA 2OCKA 1N2CA 2V9PA 4UJ3A 4RTRA 4M86A 1VMIA 3QKSA 3A27A 4M36A 4AQDA 1Z3CA 1IOLA 1PK7A 3HI4A 3OHSX 3N6XA 4K9QA 5HMMA 1U0EA 5EP4A 3GLHB 1DMRA 4HXEB 2VBFA 1CDZA 1V96A 3AKEA 5GZ6A 2LKCA 3L4BC 3LTNC 3EX7C 3V5NA 3ASZA 1FC0A 4W5NA 3CKMA 3ELYA 1ISFA 2VXBA 5TF4A 2XB9A 5K0NA 4K9NA 4EW6A 3UK1A 2O52A 3ZYCA 1GUFA 3USCS 2ZATA 1RM3A 3O93A 4MQFA 3N2ZB 4TV8F 1JDVA 4KXLA 5I5EA 3EDQA 4MDEA 3FOCA 3L06A 4YH1A 3NKVA 3K0HA 1ZVQA 1GPH1 1J00A 2PR2A 2CDBA 4JX9A 3WTCA 4Q7KA 2FX3A 4KACA 5DCUA 2V45A 2ECKA 2CNKA 1WPQA 2HRQA 1IM8A 2O2IA 4MIOA 4CQNA 4KWEA 4R2MA 1KRHA 1WEKA 2V1XA 2BGLA 4KI0A 4TMZA 5A6VA 2I9KA 1IQUA 1SBQA 4BRSA 4RVHA 5JS6A 5GONB 5FTJA 1YS1X 2IPOA 2QUIA 1B8UA 2C2WA 2C5HA 3CB2A 3RSCA 2H2GA 4P3XA 5HZHA 5FBWB 3E9NA 1J8VA 2VDVE 2W6JA 4P98A 4DBLC 2AZ4A 1S01A 2CLCX 2L42A 3HJCA 3R20A 1C2TA 2Z2IA 1L5GB 4B7AA 4C88A 2BRUC 3HQ4O 2DWPA 1CFJA 1IY0A 5LZ2A 2B4RO 3DZDA 3RASA 4Y6QA 3LM8A 1TECE 2HJWA 4OF4A 2YWGA 4YRJA 3VYUB 1H2FA 5EUQB 2Z1MA 5B3LA 3OFKA 3U7EB 5T3UA 2FOLA 3ZW9A 5FNVA 3WGTA 3ZVRA 1KWGA 2KW5A 3SOZA 5EKUA 3DYBA 3KL2A 2CNBA 3MFYA 3DMDA 3PX7A 1GWNA 4UD6A 2W8BB 2QS9A 4I55F 2CHUA 2DLNA 2BFDA 4I2NA 1YJBA 4LBWA 5ALRA 2Z8YM 3O0DA 1PYGA 5G2OA 2FW6A 1P2GA 2GJKA 1Z5UA 5PNTA 4ZVNA 1BTOA 3JZAA 1TF7A 3W06A 5IK2A 4XDZA 3MOGA 1TA0A 1QO0D 5C32A 5IT0A 1A2QA 1AA9A 1CF9A 1UK8A 3E3LA 3OFND 1G18A 1TLFA 5HCNA 1QS0A 1FXUA 1PV2A 2X6RA 3IHLA 4IO1A 2BGNA 4J3JA 1X7YA 3HH8A 3NBZC 4MVJG 3GFBA 4KGXA 4MQLA 4O5OA 3I0ZA 4PLTA 3T0GA 1G59A 2OP0A 5JYEA 3ZCSA 2C9BA 4FNAA 3MUNA 4JXZA 1FS4A 3OOHA 3OQJA 3ZE8A 1NVDA 2V4ZA 4ZODA 5H4GA 4BB5A 2QROA 1ISHA 3IOYA 4LHZA 2VUTA 4P35A 5CX4A 1N0WA 5DFAA 4NE2A 4NJOA 4CV2A 4PYOA 3LWBA 4HEQA 3RVJA 1V9SA 4WPGA 1DFIA 4ZKEA 4YAKA 2ZU0C 3KEQA 2Q5LA 3LDGA 3NZEA 3OOJA 2PGDA 1E1CA 1G9XA 3G59A 4OJYA 4G4IA 5CVCA 3ZIUA 1SELA 1YJXA 4J16A 1RWWA 2QXUA 3EXG2 4DPMA 5DNWA 1IB0A 4E2ZA 3Q88A 3QYJA 5F23A 2C04A 2GF9A 2ZQYA 5AIAA 2OHGA 3ZWVA 1JIIA 2PMBA 1YRAA 1AQIA 2ID7A 3KJGA 4OFZA 1EWVA 1V5WA 2IOYA 2P8JA 1G4AE 3KJZA 2PT9A 3OU2A 5DZSA 4I2VA 1RZVA 3KM0A 1Z0UA 1CVRA 2I78A 1UJNA 2B1GA 2PGLA 2WFLA 3BGSA 3D7LA 1XP8A 3OZXA 4NICA 3UMGA 4UUOA 1M33A 1CZKA 1BH6A 1Z6PA 3LT5A 3FPEA 4V3CA 3PC8C 4YVFA 1BMFD 1GQYA 1HZZC 4IFIA 3KHUA 3ZHBA 1N5KA 4W9NC 1SU4A 4L15A 5CLJA 2RHHA 3DE4X 1KMHB 4WZZA 3TQIA 2JARA 4NDAA 2BN4A 1FX0B 2XD4A 3BFXA 3O95A 1HTWA 1LWOA 3WL8A 3WL4A 1D6NA 2OLJA 4TQAA 1D2HA 3AIKA 4MQBA 2UAGA 1YL5A 2LUOA 1TZBA 2J0UA 4R1LA 4URYR 4D79A 2JHAA 2OE2A 2D06A 2EG9A 1JLLA 1ZIYA 1ZEJA 2AZDA 3PYXA 3K72B 4WKBA 2M6KA 2HCRA 1J23A 2CLSA 5D1HA 5CNKA 2P9BA 3ZK8A 5C9ZA 5WRFA 3WQRA 4EY3A 2J7PD 2JANA 4MWZA 4DLUA 1Q12A 5DI3A 2R7AA 1O0SA 1E4YA 2PO5A 1WSDA 3ILHA 1GG2A 3D8UA 3NH6A 4U2CA 1DBQA 1L1FA 4J43A 2WJVA 3SIPA 5LZ9A 2DC1A 4YCAA 5EE3A 3GEDA 4CVNA 5CCEA 1RXWA 4D2IA 2P2SA 3ILVA 4L72A 2AJBA 1DBSA 3L07A 4RPGA 1GKYA 4AUMA 4E30A 2WHQA 2V6MA 4RLHA 2PRIA 2HU5A 4P5DA 4XQ0A 2UU9B 3IP6A 3U5TA 1VHJA 3A11A 2UV8A 4FYYA 3WHIA 4OLBA 3KCQA 3CLSD 1UBFA 4OO3A 2H16A 3CT4A 1JRLA 1P80A 3SNKA 1ZD9A 1K27A 2FZVA 2VP9A 3IPLA 4EJSB 1WO8A 2F67A 4BZXA 3SYMA 4XSVA 2QGZA 2VYFA 2C9OA 5L53A 4NR0A 3CEJA 4ER7A 1DCFA 3ESAA 1OPRA 2IP4A 4IDAA 1G1AA 4IZHA 2GTHA 1C7EA 1E89A 1NC1A 1YZLA 4TZTA 4WCFC 2NUTA 3RJ9A 1E3DA 1RKUA 3DJFA 1W1WA 5JSZB 3AUKA 4WFQA 2NU8B 3TM5A 5HUHA 1XSEA 2K6GA 3OD1A 4OM8A 4PBRA 2N75A 1CDOA 1DFGA 1O94A 5EXSA 5G0SA 1K7XB 2IEBA 4EBFA 2RHWA 5DGIA 5K3FB 1UAAA 2EGUA 1IXZA 4ZOEA 3T5AA 5DH9A 2CV1A 2AFHB 2D8MA 2O0LA 4AQ7A 2D1QA 2ZIXA 4Z4EA 1ZPDA 4FFWA 4LF7B 3OZFA 1XZ8A 2O5EA 1W4LA 2NLOA 3LBAA 1XGKA 2R86A 4NJMA 4D1YA 1T35A 4YTEA 1RS0A 3IP9A 5IW8A 4G1VA 1H5UA 3KOXA 3RUEA 3MUOA 3WHPA 1U5BA 1J0DA 2B30A 2WU8A 2G8LA 2GCIA 3SBEA 3PEEA 1N6IA 4KLNA 3L1IA 2WJJA 2V7QD 1CFZA 3WL5A 5HF6A 3BMOB 4DE5A 1C9KA 1DRWA 2IP2A 1XQ6A 4TTPA 4C7VA 4MO9A 1VKJA 4TKVA 1IWOA 3M9XA 3OQ1A 3QYAA 3HDTA 3MFQA 4DCOA 1A5ZA 3EY4A 4DLTA 1W36D 2QTRA 3MINA 3UAOA 2NPIA 3OIYA 1HT2E 1QZZA 2JC3A 4YYZA 1JDSA 3BERA 2CVHA 4OK3A 3UH1A 1JVNA 3RTCA 3QKUA 3AK4A 5K5EA 1KZ6A 3A2NA 1ZVKA 2Q1WA 4FEGA 5JASA 4Y9DA 2EGHA 1NVVQ 1OYYA 2AF3C 3FRIA 4FI3F 1FVFA 1HQKA 4MVJM 3HCNA 1ZUHA 5AW2A 2NMVA 3OTQA 1KI2A 2RHRA 4L07A 2IEYA 1UJ5A 4J0FA 3V8QA 2H1LA 3AR6A 3HKEB 2H3EA 1OHHD 1XN4A 4MKHA 3HZZA 2XR1A 2HK6A 1FRVA 3QWFA 3WMGA 1A2KC 2NAFA 1QIDA 4PPNA 3R7WB 4RTQA 1J0XO 1UBSB 3I12A 4JMLA 3KJHA 3V1MA 4NPHA 3CVWA 4LF6B 3U2QA 3DL4A 2BYTA 3EC2A 3T3MB 7YASA 4OSEA 4EITA 2GZDA 3K5HA 4LG1A 5FHQA 3RE1A 3BAFA 4RZHA 4DMCA 1GZSA 4XR9A 4ZOLF 3NYWA 4REMA 4L0MA 2AR7A 4C2BA 5EJIA 4RCZA 3RV4A 1EVLA 2DMRA 3VPCA 3A9CA 3CPEA 3SXPA 2Y4NA 3NNSA 3RUIA 4C89A 5KNBA 5KNCH 3L6BA 1GRVA 1H2RS 1LBSA 3WKDA 2HR1A 3RF6A 4C7XA 1MIHA 1A04A 3GCWA 3BTVA 3A06A 1AKRA 1CXZA 1QGYA 3DE0X 3KLOA 3M6UA 3N05A 3NC1C 4HB3A 1X86B 3W5CA 3F5QA 4M9CA 4H7HA 1DUSA 1DFHA 1WD5A 1W7AA 3TB4A 3BWVA 3EGIA 2XXBA 2PUBA 3D8BA 1Y7TA 5KKNB 1P2VA 2XNHA 5AM2A 1DCKA 3BRWD 4NU6A 1TVKB 5TC4A 1A9OA 2C7PA 1I1NA 1WKBA 2QVYX 2WJIA 4PIVA 4B2IA 2I7CA 1BDMA 3KSZO 3LPDA 3IP1A 1QR2A 1S02A 3HACA 2NUPB 3KQVA 1GAWA 2XJ4A 3QW4B 3R2JA 5F1OA 1HG0A 5IT4A 3EPLA 5FD8A 3LUHA 1DADA 4KQWA 3BE6A 3CY6A 4OHYA 1N7GA 3EDYA 4JFRA 4M1WA 5AM4A 3S2IA 3PFCA 3FWYA 1YJ5A 3W3AD 4DLZA 3JV7A 4LSGA 4PHHA 2WJ4A 4E07A 4YROA 3UMRA 1CV2A 3AG6A 1IBLB 4TKUB 4JROA 4E31A 1R6XA 1WE2A 3GPDG 3BREA 5BYKA 1B0ZA 3BIWA 1FP2A 5I4BA 2AC7A 2BHSA 2VP6A 1R74A 1V8DA 2OVFA 1RFGE 2FW7A 2IDMA 4PHFA 5FQOA 2TS1A 1H22A 4D4LA 4EEXA 2R68A 5AOCA 4DV3B 1CT9A 2GJ8A 2Q0QA 2RH4A 1A4IA 2N0SA 1G8FA 5C46F 4L9WA 3IAHA 4L5IA 1AQLA 4ASUD 5KU1A 1U02A 5F9HA 3KNZA 3NYRA 2AJTA 1YA8A 1XROA 1YQUA 1UL1X 5IJ0A 1D09A 1EFRD 3HN6A 4I8XA 3QPBA 2VR1A 1EFTA 3DEIA 3PFNA 4RJKA 5TVKA 4B09A 2F1HA 2E85A 2JBHA 3C43A 4ALKA 4QYTA 1P7CA 2QRUA 1DKQA 1T26A 4RSGA 5K45A 2H63A 3GLKA 1OKKD 1DQNA 1QHYA 2D5BA 1GU1A 1YQEA 2JKVA 5JY6A 3ZDDA 2QG4A 1TMYA 3QVLA 1ODCA 4OQNA 4L4YA 3CSSA 5A7HA 2QAGB 4Q1EA 3HY6A 5C8YA 4FOLA 3G5LA 4TS9A 1PRYA 1MX9A 1T34A 2YZKA 3HCBA 5FL3A 2YV5A 4HFNA 3MCZA 2Q7XA 4QELA 4IVNA 1T0HB 4FLFA 4MWGA 2ZREA 2ODQA 1TI7A 4ZVPA 4HEJA 1TYZA 2IEAA 1ES9A 3E4CA 2WWWA 3PQ5A 2XV1A 3QVVA 3P0JA 5IT9A 2I67A 2RONA 4IQ4A 1F8YA 3R9XA 4K0RA 3GRFA 4W8GA 2NAPA 4CHTA 4EYQA 2GKOA 3R8FA 4GP9A 2ZT8A 4QDZA 3AETA 3BMNA 4B6SA 4ZJZA 2C3OA 2HK9A 4TWAA 4MKFA 4CKEB 3IOCA 1VBMA 2JLCA 3DD1A 4EJFA 1M1NA 2ET6A 4NOJA 3EVAA 1XEXB 4RCYA 3RT7A 3GA7A 3TD9A 3M83A 4PFKA 3ZUGA 4XCXA 3ZU4A 1THMA 2R8ZA 3KJEA 3KRTA 1HLDA 2C7QA 2FG5A 1O5IA 4XZ3A 2GZ2A 4FZJA 4Y7CA 1D6MA 5COAA 4JVSB 1J25A 5LFAA 4MWCA 3KT8A 2YMQA 5TEWA 1RD4A 4N39A 3Q3GE 4Z2AA 1G6HA 3SFVA 2QV7A 2ZBGA 3FIJA 1FMFA 2SECE 3E22A 4KN6A 1ZM3A 1NASA 3PZBA 4D9BA 4CEJB 1R9NA 4C0XA 3MLAA 5H83A 1TNDA 5DNCA 4EHFA 1K68A 3GELA 2IZZA 4AW9A 2DR2A 4B3SB 4FZ5A 1TT5B 3VHXB 1PJ2A 2FR8C 4J2HA 1YI8A 4H1HA 3TE7A 5EE1A 3TN7A 1CULC 1SQSA 4OMDA 4X44A 4GE3A 5CD1A 2W4IA 4Z4CA 2DTDA 2CWDA 1JAYA 2PL3A 3CRZA 4UU1A 1Z68A 4N0PA 1KEUA 3SOPA 2XZTA 6LDHA 3NJ8A 1FFWA 5JZMA 4J9VA 4O3FA 4EY5A 4ZI7B 3MAGA 1Y3IA 3S70A 3KTAA 5BRAA 3ESCA 3WWOA 2GVDC 3ZDAA 3N8KA 4Q3BA 3NW9A 2F55A 2AH5A 4MJLA 2QN2A 4J90A 3TTSA 2JGIA 1W36C 5AVSA 2JJQA 1XZLA 3SR0A 2ZOSA 3ZS9A 1JPNA 3MJDA 5AW7A 5K4HA 3IUQA 1NBMA 3MPUA 3K9WA 1TYAE 1RMTA 3S5JA 1ECBA 1VKNA 2IY8A 2B83A 4HHEA 3W4IA 1C2YA 2EQ5A 1GUZA 3ZTYA 2FPPB 2FX5A 1VE9A 5BVGB 4Q39A 1J20A 4KR0A 1P8AA 1GU7A 1Y3DE 1X2EA 4PINA 2YTZA 2MU1A 4WJKB 2UVPB 3EASA 3VSCA 1SOAA 4BKMA 2XPCA 4UOQA 5LQSA 1SGWA 2P0EA 2FFBA 2W6IA 3OEED 4LRXA 4OU4A 5CLGA 1IPHA 3W1EA 1PFYA 1OILA 4LA4A 2QPOA 3L0DA 4NBRA 4RWEA 1KQ3A 2YXNA 1ECFA 2WTXA 2YV3A 4KAAA 4DJ5X 1D6SA 4NBNA 5I7SA 3M81A 4LBYA 2PS1A 2XGMA 1VPLA 3L6OO 2DPLA 4ZK2A 1LVUA 1GSIA 1U6KA 4Z3DA 4HS4A 1PNVA 1XFDA 1N25A 1VBFA 4FTWA 1TQ8A 3P7MA 1YBHA 2D5AA 4MV9A 1O4WA 1WABA 4R3NA 2X23A 2PCLA 2EQAA 2IV7A 1G20B 3UKOA 1J56A 1TQDA 4KUGA 4XJTA 4FPXA 4C7KA 4EKEA 3JAMA 1DIOB 2VBGA 3EWNA 4IG4A 2IA5A 4N40A 1B42A 1J2TA 4PC7A 5E95A 4BATA 5AVVA 5MN6A 2D0PB 3B1XA 3O8BA 2OZLB 2VUHB 3N8HA 1T8RA 3CZRA 1AZLA 5TPZD 3QLUC 2R6JA 2HF9A 4OHWA 1DEHA 1UPXA 2BUBA 1J9EA 1M2VB 2B9EA 4MLPA 5FNVF 1ZY2A 3UUFA 3ZTWA 4ZOQI 5KMGA 3U6BA 2NPOA 1E2PA 5K6AA 3N86A 4QLAA 1CUDA 1SG9A 4I99A 4GXQA 3DDUA 4ITRC 4RL4A 3N3BC 3QOFA 4M22A 1P1FA 2FW1A 2GNOA 2OOSA 2RC6A 2Y68A 3ZCUA 3VV3A 1XNGA 4BCBA 1UCFA 3ABQB 4QEZA 1VI2A 1FYDA 1SBCA 1V16A 2OSBA 2XXJA 4K9MA 4KQFA 4MVCA 2X1HA 3RK1A 5HOQA 2J9RA 5HKOA 3FHTA 2O8EB 1NVWQ 1CNEA 2RI1A 4YAUA 1P0PA 1SVSA 4UCFA 4CM1A 2VCEA 2AWNA 2ZI9A 3M1IA 1RE1A 2AJCA 1TEZA 1LBQA 3Q3EA 1O0CA 1E6UA 4FR2A 4E13A 5K3OA 4LJLA 1GITA 1OI4A 1KI9A 2CL6X 4DM7A 4LGCA 1SWVA 1WF3A 4D98A 3L0ZA 2QDXA 4UNNA 5EZSA 1NI4A 1R18A 2V8BA 4M1ZA 3A1NA 1B2LA 4Y7DA 3BFPA 4C4ZA 4IH9A 4F5EA 1KWKA 4PTZA 5EG5A 5LB2A 5JWOA 1NXSA 1VPVA 3BICA 3LZCA 3GT3A 1FTWA 2NV2B 4FUTA 5L4LA 1W6RA 3HXMA 4RDHA 5CFZA 3UCEA 4A8JC 5BWMA 1BEZA 5JNTA 1P3Y1 1DSSG 3ZKWA 5A4KA 1U6IA 3T4EA 4US1R 3AJ8A 3H6HA 5IC6A 1X9GA 5I47A 2PU5A 2QQGA 2Y1WA 4WECA 2IUFA 5JZBA 2PFGA 3RBVA 1I2MA 2GZRA 4JLDA 3OPYA 1IMOA 2B1QA 2P9GA 3EG5A 3KE8A 5F2KA 4OMFG 3TR5A 4AP5A 1ILEA 1ABBA 1IHOA 3GC6A 4XB2A 4R6WA 1XVAA 3ODPA 1JQBA 3F9RA 1MEJA 1OXMA 2A5FA 4P7GA 4Q03A 1URPA 3H5VA 4IIGA 1YB1A 3QI2A 2P2DA 1Y5LA 4HVTA 3HXOA 2MMGA 1FRZA 1SOVA 2G06A 3K31A 3MS2A 1XQYA 3T8YA 3DLCA 2NYVA 1GGFA 3IUSA 1Q22A 3CO5A 1QH8A 2V74B 4OGWA 5C7OO 1Y9AA 4DMUB 2ICAA 4Q9KA 5FOXA 5I45A 2BKEA 4EELA 2FK7A 1VMDA 1E3SA 1KYYA 2HA4A 3WO0A 1U4SA 2O06A 5D84A 3STHA 3T7DA 1UK7A 3NBUA 5K0EA 5IVKA 1E69A 3Q8MA 1BMDA 3I34X 3VSEA 1JEQA 2WJWA 2ZS7A 3D54D 4KLCA 1NAHA 1IJKA 3U5ZB 1UDWA 3VKFA 5TLSA 4AG5A 3JWEA 5J4LA 1Z4JA 5JS7A 2HI0A 3CX4A 3EDOA 4ZGWA 2QW8A 3X2FA 2GFHA 2HPAA 4X3OA 2C77A 3A6GA 4Y2VA 4CMKA 1PK9A 2P3LA 4H1WA 4G25A 2P9YA 3NKFA 4NBLA 5CNIA 3VM6A 4LXTA 3A32A 2D7JA 3A1CA 8MHTA 4N3NA 1KL7A 4ENQA 3NYQA 3IPCA 3T1VA 3X2EA 3G0DA 2VJNA 3QGMA 4L76A 4E5VA 1ONNA 1Q0ZA 1TL7C 5LYYA 1N5MA 1M1YA 1Q1EA 2XX3A 3CF4G 3UG6A 1NHWA 3WB2A 1FPQA 2CXSA 5ALWA 1JG3A 1QVVA 4LRWA 1FMJA 2DQ4A 1Z5PA 3NAMA 4I5DA 3DZCA 4QTUB 1OYOA 3H4IA 4R2XA 2PUGA 1I2DA 2ZBVA 3HJBA 3PFWO 3V4LA 3U7HB 1YOVA 2PE5A 1WZNA 3OE1A 2Q4DA 1KYQA 5CH8A 5HGJA 4DCUA 2JLWA 2X0RA 1TVMA 4JSYA 5BV1A 2R87A 4M99A 1Y4AE 3HUUA 3PFIA 1RZRA 1ZEMA 4GYWA 4DRXA 3OZWA 1T9DA 2ON6A 5DISB 4H4EA 2OG1A 4Z4IA 3ZY2A 4MIYA 1UFQA 3EZ7A 3M9WA 4QC2A 4WCVA 3BL8A 3UYLA 4Q7QA 1L8XA 3GP3A 1NF9A 5I51A 1KERA 1MEEA 3BRQA 4O1IA 4TZ0A 3L7AA 1RWXA 2IPLA 3L7LA 4LXYA 3CWQA 5LVAA 3BMQB 5IJWA 2ZIAA 3NNDA 3OQIB 4TYYA 2Z30A 1YB7A 4L57A 5TMBA 4WUVA 2W2PA 1N2JA 5BSHA 5LUAA 2XWQA 2DVMA 2PX5A 2H0QA 3NWJA 3R6TA 4LXUA 4RV4A 1DJQA 3Q7TA 4QREA 3JPYA 5FBHA 1F8FA 2I33A 2YIVX 5JMOA 1ZO8A 5HVNA 3AI1A 2VJMA 4UUPA 1BCSB 4XX1A 2I1VB 4PLYA 3OECA 5A4FS 2NZVG 1MAVA 1EFCA 2F4VB 2QN7A 2P4HX 2EJCA 3IRUA 3RVKA 3VR3D 4W1SA 4QVIA 3QEOA 1QQ6A 5EJ2A 4DM3A 1ZD8A 2IELA 1EEHA 4E32A 2O1EA 5KO2A 1NG1A 1VE3A 4PXAA 3UKDA 2QP3A 3H5RA 1NJ5A 2NXNA 2JAQA 2ZK7A 4YJHB 3U9LA 1K6JA 4HWPA 3NHRA 4S2EA 1G8GA 3LRXA 1CCWA 5I48A 1HFWA 1EFAA 1DIBA 5YASA 1XZJA 2AG8A 2H51A 4JYPA 4AJIA 1P5FA 1A3CA 2X9LA 4HEHA 1GL7A 5AVUA 4W6QA 2A7QA 4EG5A 3CRRA 2UXCB 4QQRA 5BSFA 1ZH6A 1CP2A 1XUOA 3TYXA 4BO7A 3PLNA 1JHUA 1UBMS 1Y4SA 2Z3ZA 1E2LA 2G1UA 4FEAA 3K1YA 2V9ZA 1N3YA 2Z2KA 3B1WA 3OX1A 3Q2KA 1FSZA 3AW8A 4FYMA 3MAAC 2YHIA 1K08A 3FF4A 2L19A 3KQMA 4CV3A 1FFXB 4P3NA 1MU0A 3GJTA 4HQLA 4PR0A 3IOMA 3WV5A 4ZAYA 1SC9A 3RTGA 3K8ZA 1GSAA 1KEEA 1RRCA 1U3WA 1R0XA 5A5EA 5B4UA 3ZY5A 2FSVC 3ZDXB 2IPXA 3V32A 3GLIB 2MSDB 5BNTA 4OBEA 2XIJA 4CM5A 4KN9S 4GZ3A 5JCOA 2NO5A 3BK2A 1TU4A 3L6CA 2GLTA 3Q3JB 4RESA 4YAOA 5CLLA 3TQTA 1H1DA 3BC1A 2ZB3A 4ALNA 3IKTA 3C7KA 2X4GA 3M3HA 5GJCA 3WIDA 2YXDA 5GGXA 3KXIA 3TZQA 4C7JA 4M9QA 3H5OA 1GR1A 2ZSDA 4RV5A 4Z86A 4WASA 5J63A 4AJEA 3A1TA 2CNNA 3NEPX 4WA7A 3VO1A 3IMFA 1IJBA 2H2FA 3GJRA 3DFMA 4RD4A 3F9CA 4NMHA 3HM2A 1RI1A 3I2IA 2KMLA 3BHNA 1I4EB 3EXFB 2WWRA 2VNIA 1B43A 1V1RB 1T6NA 1DTEA 3CUVA 4OGFA 1ZRSA 3IVCA 2PIDA 2PXXA 3G2OA 3DLAA 3M33A 3N0XA 1MFZA 4FK8A 5HE9A 1DAIA 3DFIA 3VZSA 4A5OA 1E2IA 1N3BA 2WU0A 3SP1A 3WAJA 4KX3A 4EX6A 2ZJ3A 5K01A 1KAMA 4PBTA 4PZZA 4OHZA 2I8AA 2B69A 4PFQA 1FFCA 5PGMA 3MGKA 4LZPA 4RY9A 1NMZA 4UBNA 1PZNA 3ZE0B 4Y9RA 2PSSA 1LU9A 4E21A 4EMTA 1ZH8A 3ORQA 3BJZA 1M8GA 4JGIA 2RH9B 3P5SA 2G17A 4PHTA 3RGWS 4CL2A 3ZVKA 3EQ8A 4O4LA 5K3AA 2EIHA 1UC9A 5CT8A 4O2AB 3WKEA 3GDWA 3MTBA 2HBRA 4ZEMA 1XNHA 2PQ0A 1QYWA 4HAWA 4CV1A 2DETA 4PQFA 1PG5A 3PTAA 4F6CA 1G98A 1KMCA 1Y5IA 2WHPB 2OHXA 1NURA 2FW8A 2VDKB 4UXIA 2D2IA 1A98A 2YXLA 3MAJA 4INPA 4J4BA 4YRTA 4IIJB 4WSOA 3ZLVA 3H2YA 4DMFA 5BYAA 4LY3A 2ONZA 5IFKA 3IVGA 2G88A 4HZIA 2X22A 5BV2P 5JU6A 4BX3A 3C1AA 3T5CA 1BXGA 1QWOA 2AYZA 2YWDA 4YGYA 4EK9A 1UMCB 2QRVB 1WOYA 2C2GA 5JVDB 5JAZA 3UPTA 4DDKA 4B0PA 2DQKA 1XDDA 3IHWA 4CZ2A 3IE1A 2ZVPX 2VDPB 3DD5A 3C6YA 4HLCA 1LSJA 3G2IA 2BJWA 1RWQA 1CUYA 4P1ZA 3WYGA 5BQ3A 4MTCA 3RVBA 1VLHA 1AO3A 1LK5A 2VZ0A 4E6EA 1SVOA 4U2GA 5H59A 5CD9A 4NV0A 1PK8A 1SBHA 4FFRA 3RT1A 1GSHA 3NS7A 3QMWA 2JZCA 3EDCA 2EOAA 2YL2A 4JWTA 3NB0A 4RKYA 621PA 1WXGA 1T3HA 2PVPA 1IZ7A 3AXTA 3KWJA 1RRVA 4P84A 1L5MA 2QGNA 4G0WA 4G1BA 1G8MA 3HKCA 2LNDA 4EA7A 4EGAA 1E8MA 3GJQA 1MPXA 3Q6NA 5HZKA 1AD2A 4G5HA 5EKDA 5ETJA 1YR9A 3M4XA 2W2OA 3R44A 3J81A 4CUJA 4AZ0A 4R84A 2DT5A 2IHYA 4R1NA 2CJWB 4ZWNA 2I2WA 4A6EA 1PEDA 1Y1PA 4U39A 1GGJA 4URWR 2LCIA 5DVZA 1F8GA 1UP7A 2IEGA 2KBEA 2V98A 1U0GA 3NOVA 4IIVA 1J2RA 4H3HB 4BEVA 3SMVA 1R10A 3DFFA 5AKIA 2WI8A 4Q82A 1M76A 2DFVA 1EP9A 3ITEA 4YPFA 5F2OA 2G4VA 1WEHA 2E18A 3D0RA 4UNSA 4XUCA 1HXHA 4KYVA 3OT1A 3I42A 2ID4A 2NTVA 2A9FA 3GZTB 4MMXB 2R751 4IFEA 3KEGA 1ZK4A 3EN0A 4HAYA 3HL4A 1V1MA 5EZ6B 1LRLA 3E9EA 3QF4A 4D57A 1H23A 1ISPA 2X3UA 3KOYA 1ZCAA 2EG5A 2Q9UA 2XVXA 3Q6MA 5G02A 3VTKA 5C7YA 1QRUA 3CE9A 3MOSA 1WBBA 1KVSA 2WKRA 3QXSA 3IIIA 2CLKB 3PT9A 4IVRA 1P8JA 1VL8A 4Z51A 3JX9A 4CXMA 4AWXA 1EBBA 3L93A 4RVOA 2ZYWX 3JQQA 5SZJA 1UPBA 4UXHA 3PWZA 1RDFA 4WKGA 4AT1A 5KTOA 3C74A 2ZJ2A 4W5HA 5CB8A 1L2TA 4BV9A 3DEKA 5DBIA 4O4JB 2VTVA 3I6BA 3LU1A 3QE2A 2C3YA 5E3JA 4EI8A 4P7KA 5ALQA 1DT5A 1N2OA 1UBHS 1U0HC 2ZYUX 3KZKA 4BLWA 4IHJB 2BTQA 4R1OA 2RHJA 4CMIA 1AA6A 4X1OA 1ELOA 3FRHA 2C4NA 5FEMA 1XXLA 4F97A 4MQ4A 3KQWA 4TL8A 1MX5A 3TI9A 3V7WA 1WBJB 3M1AA 4UHEA 3OF2A 3L04A 3AFGA 4IS3A 2LIPA 2DWUA 2FYTA 4KH1A 1JU9A 4AS3A 4EENA 1KMHA 2FSSA 2PR7A 3DDZX 3Q3CA 4IDOA 4ZAGA 5EWMA 4YUXA 4XWOA 1WW8A 4R7ZA 1Z37A 5CXQA 1KJ9A 4AP6A 5JLJA 1I5OA 4N1AA 2XMGA 2HLDD 2ZRGA 2CHFA 2ZULA 2JD2A 3TL2A 2ILVA 1EFVA 4GSLA 3DUFA 1FBNA 1HR0B 1XFAA 5KNCA 4HAUA 1Z22A 2PEZA 1FDOA 2GM5A 1M2OA 1EFDN 2AN9A 1TFRA 1J70A 1NOJA 1EFPB 1P2FA 1T1SA 3OE7D 4C76A 3LUDA 1G8YA 1V3VA 2VKTA 5EZYF 1WVIA 3T7RA 3TR0A 1UFRA 2J3HA 5DNYB 4IX9A 5LQUA 3P9PA 1N5DA 4HDQB 5ALIA 1VPWA 2ENUA 4BE9A 1OZAA 3FPKA 3JSXA 5JD6A 2WFZA 3I8SA 3KYCB 4JJIA 5AW4A 2HWYA 2AMJA 5AKXA 2AEMA 1ATIA 1LPOA 3G88A 3U6KA 4JC0A 1XVIA 3GLFA 3GRPA 3BN3A 4WIAA 4NQZA 2FMKA 2XA2A 4AN1A 3TIIA 3VU8A 1JG2A 4F1KA 2Z83A 2RG7A 2PTGA 3EMDA 3OJXA 4JKOA 1KQOA 4Q7EA 4BQEA 1F6WA 1SIUA 1BC5A 1MAWA 2X13A 4XE5A 4MV7A 3UJDA 4QOIA 1W4AA 1ZNXA 2BE9A 1CZNA 1CC1S