3OTGA

Crystal structure of calg1, calicheamicin glycostyltransferase, tdp bound form
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
391
structure length
391
Chain Sequence
b'GRHMRVLFASLGTHGHTYPLLPLATAARAAGHEVTFATGEGFAGTLRKLGFEPVATGMPVFDGFLAALRIRFDTDSPEGLTPEQLSELPQIVFGRVIPQRVFDELQPVIERLRPDLVVQEISNYGAGLAALKAGIPTICHGVGRDTPDDLTRSIEEEVRGLAQRLGLDLPPGRIDGFGNPFIDIFPPSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSSRDTARPLVYLTLGTSSGGTVEVLRAAIDGLAGLDADVLVASGPSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGTTLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPDNISPDSVSGAAKRLLAEESYRAGARAVAAEIAAMPGPDEVVRLLPGFAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalG1
publication title Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 124
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3otgA02
1AXRA 4F96A 1FTQA 2QRPA 1L5VA 1QKJA 2IW1A 4GPBA 1HLFA 2QNBA 1SXPA 4N3BA 3EBPA 3UYLA 2XGOA 1Z6QA 3NC4A 4F97A 5LQDA 5D01A 3CV3A 4RELA 3CUTA 2O6LA 3MSCA 1FU8A 3T7DA 2AZDA 1H5UA 4KQMA 4M7PA 1Y8ZA 3G2NA 4EL0A 1EXVA 2ECPA 3T3GA 8GPBA 1LWNA 4GZ5A 3ZCPA 1GZ5A 3HBNA 3QHPA 4YUAA 4N3AA 4MHOA 3L7CA 3MRVA 3DD1A 5BNWA 1P29A 2IYFA 3H4IA 1GPYA 4MI9A 2AMVA 3H4TA 2XMPA 1P2BA 1C8LA 1NVKA 3EBOA 4RIFA 3OT5A 1FU7A 3RHZA 2SKCA 5IKPA 3NP9A 2R66A 1E4OA 2QLNA 3RSCA 1Z6PA 4MI6A 4X6LA 1ABBA 3G2KA 2H1FA 1EM6A 3DDSA 1Z8DA 2JLBA 3D0RA 4CTNA 2BISA 2JJMA 3OKCA 4KQ1A 5TVGA 4AY5A 4N3CA 3MTBA 1F0KA 2QLLA 2AW3A 3L7DA 4AMBA 1O6CA 2FFRA 2IYAA 1P2GA 2WTXA 3MTAA 1UQUA 4FKZA 3D0QA 2F3QA 4X7MA 2G9VA 2R60A 3ZCUA 1PNVA 3MQFA 3OY7A 4XIFA 2GPNA 1FU4A 2F9FA 5DLDA 1GFZA 1RRVA 1JG6A 2X6RA 3NPAA 1NOKA 4WADA 3OKAA 3OTHA 2GT1A 4MRAA 2XA1A 1C50A 3CEJA 1XV5A 3CUVA 5DXFA 4N39A 2IEIA 1NLMA 2IV3A 1FC0A 2GEJA 3FROA 5TMEA 3C4VA 3E3LA 4HWGA 2F3PA 5C1DA 4GYWA 3OKPA 1K06A 3SYMA 2FETA 1FS4A 5ENZA 3BD7A 3MS7A 2QN1A 1WV1A 1RZVA 4FZRA 3S28A 3S29A 4BQFA 3VDNB 3S2UA 2QN3A 1JIUA 2ACVA 1M5RA 2BGTA 2SKEA 3BEOA 3IAAA 4CTMA 4Z5XA 1SXQA 1AHPA 3MTDA 2BFWA 2QRMA 3MT7A 4CTOA 2GPBA 2BGUA 3S27A 4EKYA 4F9FA 5JTUA 3G2HA 2G9QA 2GM9A 1L5QA 4BFCA 3TAXA 1B4DA 1IXYA 4N9WA 3CUUA 1XL1A 3BCUA 3E3OA 1V4VA 3NAZA 3RSZA 3GUHA 2QZSA 2FF5A 4EJ2A 3MS2A 3PE4A 3SYRA 2QRQA 2QN7A 3O3CA 3ZCQA 1L5RA 3RT1A 2KS6A 5IKOA 6GPBA 3AMVA 2QN8A 1RZUA 4YI3A 4NESA 2XGMA 3Q3IA 4QLBA 1C3JA 2G9RA 3BD8A 3D1JA 3IA7A 3T3DA 3BCRA 3ZCRA 4WHMA 1Y6FA 9GPBA 2HY7A 1QM5A 3PE3A 1UQTA 3DDWA 3T3EA 2PRIA 1IIRA 1GG8A 1XKXA 4LEIA 2JZCA 7GPBA 2QRGA 1LWOA 4RENA 4RIGA 4X7RA 2YJNA 5TMBA 4MICA 1P4HA 1GGNA 2XA9A 1WV0A 2QRHA 2ASVA 3L79A 3ZCVA 3MS4A 1L6IA 3HBMA 1YA6A 1C8KA 2C1ZA 3L7BA 3T3HA 2VSYA 3ZCSA 4RIIA 1L7XA 4BQEA 3CUYA 2GJ4A 4YI5A 1P2DA 4X7PA 2R68A 2XCUA 5TMDA 4XI9A 1JEJA 2IV7A 4RIEA 3WADA 3VUEA 1UZUA 4EKEA 1PYGA 2PYDA 3CEHA 2XA2A 3S0JA 3HBJA 3G2IA 4MHSA 4G2TA 1XC7A 4EL5A 1XOIA 2ATIA 1J39A 4REMA 3ZCTA 2OFFA 1YGPA 2VSNA 5I45A 4RIHA 1WW3A 3OTIA 4LDPA 3G2LA 3QKWA 2XGSA 4MI3A 3DZCA 3VUFA 2PYIA 2PRJA 3T5TA 3BD6A 2GPAA 1L5SA 2H1HA 4NEQA 2GEKA 1NOJA 1XL0A 1PSWA 1GPBA 2R4TA 3C4QA 4GZ6A 4AMGA 2X0EA 2C4MA 3CUWA 4W6QA 1JIVA 4L22A 2IUYA 1FTWA 3UYKA 3HBFA 2X0FA 2R4UA 2P6PA 1VGVA 3VDMA 1KTIA 1L5WA 1NOIA 4WACA 4HLNA 5DU2A 3MRTA 1Y6GA 3CX4A 3L7AA 3TOVA 3C48A 3BCSA 1E1YA 3CEMA 4BQIA 4NC9A 3COPA 1P4JA 1WUYA 2ACWA 2QN9A 2ZB2A 2IEGA 2VCEA 4GYYA 1BX3A 3G2JA 1Z62A 2QLMA 3NCHA 2C9ZA 4M60A 4PQGA 1NZDA 3MRXA 1WW2A 3L01A 1NZFA 3Q3HA 1FTYA 3MT8A 1PN3A 1P4GA 2SKDA 1GPAA 2Q6VA 3WC4A 3GPBA 2PQ6A 5GPBA 1JG7A 4M83A 1K08A 4CDRA 3NP7A 3OTGA 3WAGA 3OY2A 2XCIA 5JTTA 2VCHA 2F3SA 3T3IA 3MBOA 2QN2A 2VG8A 4GZ3A 1WUTA 1A8IA 3Q3EA 5D00A 1F6DA 3E3NA 3MT9A 1FA9A 3NB0A 2X0DA 3BDAA 1JIXA 4RBNA 2AV6A 2X6QA 2G9UA 5HXAA 2F3UA 4AY6A 2C1XA 4AN4A 4KQ2A 3TSAA
chains in the Genus database with same CATH superfamily
3MWJA 3M6WA 4FE3A 4ER7A 4M0LA 1QAOA 3QLTA 2D0OB 1FTQA 3PXDA 3K1ZA 3E48A 5FBLB 2WKQA 2XLBA 5BSFA 3RK1A 4A26A 4OL9A 4PTYA 1NNUA 4JODA 1P4RA 1V71A 2YNMD 3RAJA 3HCCA 2XGOA 3SYLA 3D7NA 1LDGA 1P0MA 3O73A 4L95C 4BTEA 5HKAA 4Y9TA 1SHKA 1ZMXA 2JIZA 3DAGA 2IUTA 3VHXB 2GO1A 4BX8A 3GLFA 4G9BA 2OZLA 3FMGA 4JQCA 3RRMA 1XK7A 3C74A 1IOLA 4J43A 1Q2UA 4RTRA 4UNIA 2PLWA 3OU6A 1AGXA 2QLFA 2RD2A 1QB7A 1ZMRA 5CNMA 1XAIA 3EH2A 1AQIA 3H17A 4CV3A 2C5FA 3LFUA 4HSEA 3NEJA 1G64A 4JYZA 4HGOA 1HA3A 1QYCA 1WXIA 5FXMA 1U2GC 5B4VA 1JR6A 3MA0A 1D2AA 1SVIA 1TM2A 2DECA 3AYXB 4U00A 1DO8A 3PB3A 3VNQA 3I5AA 5EJAA 4TL8A 4U5XA 4LN1A 4B6PA 2AHOA 5EHGA 2D06A 2VDVE 4LY9A 2PDAA 3R74A 1K68A 2O8DB 4ZHQA 3IVGA 3LZDA 1XR3A 1IFXA 1AM4D 1KP3A 2JLCA 2PXXA 4ZVPA 1EFUA 1W5BA 2F17A 3O83A 5HJ2A 2HT6A 2N1MA 1BVYF 3C6ZA 4ZVOA 1CNMA 3N3AC 1N5JA 1M1YA 4G1VA 4ER5A 3AVVA 1QF6A 3K5HA 2NSYA 4ESOA 4LYDA 2VN8A 1N5LA 1FNDA 3C7KA 1GCGA 4RIFA 2K87A 3TFQA 1ZN2A 2WLSA 3MYRA 3FNBA 2G5PA 3R7WA 1KQPA 2OB1A 4OLBA 4DZTA 1HQYE 2OCYC 4NJMA 5E7QA 5C32A 4OK6A 4UM9B 2CLCX 4H7FA 5G40A 1X74A 1TA0A 3AF3A 4H35A 4HZGA 1KMQA 4LWOA 5K3CA 2DRIA 1CULC 1QKKA 4MQ6A 4F86A 1BOOA 4J75A 3VVBA 3HJRA 4H7JA 5TEVA 4LGCA 1OGJA 2XVAA 1W88B 3AKZA 1WPXA 2VT6A 4PC7A 1A8QA 1BQ3A 1NR5A 3DAYA 2J30A 3IT3A 4LI0A 4RYDA 2HD4A 2OD7A 2IYSA 5D86A 1O0SA 1V48A 4CGZA 3TBFA 4RMGA 5KJEA 2WD9A 2Q6OA 5H4GA 2X7JA 2KHZA 3JALA 3NFYA 1RZRD 5JS2A 4K05A 3PNYA 3JWPA 4D4LA 5BORA 2JFYA 2G4CA 5EMKA 3DV0A 4YBZA 1MOPA 1N3YA 2OE2A 3ZWOA 3W3AD 1VKRA 3P0JA 3I62A 2ZJ4A 4HDMB 1SCUA 1FX0B 3BL6A 2AR0A 3L3BA 3KX2A 1TJYA 2ZBQA 1L7EA 3BZBA 3RK4A 1EFTA 4AN0A 5A5GA 5L95A 4JJGA 4YMIA 4Z8YA 2ZWIA 2IV2X 3T38A 4BYMA 4CJXA 1SBYA 4KAJA 5KO2A 3QSGA 2DBZA 4CF3A 5C4IA 3KDAA 3KVVA 1J7KA 4JUBA 3UKOA 1WXEA 221PA 5ALHA 5DLDA 3RB8A 3ZNPA 3DC2A 4MHTA 4B3SB 2OBBA 1H93A 3I2JA 4OHVA 2ZVQX 5LFAA 2GF0A 4HZUA 2FPGA 1QVWA 2IPXA 5ALNA 1Z83A 5KMGA 2Q5FA 3TSYA 1QQ6A 2ZAGA 3LSYA 3NV9A 4QG3A 3STHA 1HT2E 1QK4A 5C8YB 4IGKA 3E61A 4JK3A 1Y1RA 4CYMA 4MKRA 5I7AA 3V8BA 2GILA 2IEIA 1U2RA 2QP3A 3M6XA 4IKPA 5AK6A 5TPWB 1IMJA 2IA5A 3DZ8A 1BHSA 4CMKA 3NYIA 3TR6A 3CX8A 7ADHA 4HWGA 2O4CA 4IX9A 4O3FA 4MR7B 1V6CA 3BDIA 4NFLA 2YHUA 4HNVA 1EM8A 2BBOA 1OR8A 2Y0EA 2V59A 3M6IA 1PJCA 3IP7A 5BUCA 2P68A 3DMFA 3R41A 3EVDA 2YOHA 1X94A 4GXQA 3AUSA 5HF8A 5HKLA 2QN1A 4AZWA 2BGGA 1IHYA 4EUHA 3ONVA 3OLYA 3B6MA 1H0HA 2XVZA 4L1KA 3Q7PA 1NQ5A 3CNEA 1GZDA 4X41A 4Q9JA 3EQZA 2WINI 1M73E 4FZRA 5TF4A 1ZUNB 2D8AA 2IHJA 3HYRA 4NX2A 2V7BA 2Z9CA 5REQA 1ZVKA 5JV5A 3QMWA 4AM8A 4ZYVA 1N34B 4XQCA 3OP4A 4AY4A 4GZLA 4GR4A 4JQSA 4WN9A 1AQNA 1SZCA 1PJ4A 4Q3KA 3AG6A 4DC9A 1JAYA 1TGYA 2JI8A 1H9CA 4NCAA 2I76A 3FRJA 2O07A 2XNDA 3OCWA 1ILEA 4U02A 4MAAA 1CUYA 2JEOA 2FK7A 1R1DA 1QPBA 5EN4A 5EEGA 2DTXA 2W00A 4ND7A 1PAUA 2OXIA 4BZQA 4BLQA 1SXHA 2O5VA 1XELA 3EVFA 3F6EX 3HB7A 5AKLA 1G7TA 1VLMA 1YI1A 3T9AA 1E6LA 3WKDA 4DCJA 4EUFA 1N0IA 5ES4B 5CH5A 1QLWA 2GM5A 1QE3A 3O82A 3QITA 4JWTA 4PO1A 1KOGA 2KQUA 4Q3EA 4GICA 2JFZA 4ZQHA 2AEEA 1JPJA 2GCEA 1OASA 4V0MA 5MDHA 4L2IA 1QRSA 4WCFB 1Z2NX 5CVEA 4D3YA 3EGVA 3PXXA 3LIIA 2WQ7A 1DO0A 1HLPA 2PFKA 3RUIA 1ZIYA 3HNOA 4CKBA 3JR3A 2BTQA 1U6KA 2CFTA 2P40A 3I4LA 2J45A 3PJDA 3QXXA 5D2CA 4BFTA 1SQ6A 5FPKA 4DT1A 3F3SA 1DQNA 2XUQA 2ATVA 4N9WA 3TOZA 1CETA 4HQLA 1UXGA 2EVWX 3CH5A 3HJHA 2ORED 5E7MA 4RGYA 1R16A 1CUSA 4YRBA 2VJMA 4F1JA 1U0HC 3PXBA 4L9AA 4G8CA 4WMLA 3ZGVA 4D9CA 2ECOA 4QHTA 1O4WA 3IQFA 3QVMA 1WDWB 5K6AC 4YRZA 2YRWA 4M54A 5EMMA 2BF7A 7MDHA 3KOYA 1RHKA 2C9MA 5HM6A 3I83A 4UEOA 1HRKA 4HH0A 4IH9A 1W9HA 5HJ5A 1XNQB 3FYUB 1NQXA 3LE8A 3KSMA 4ETMA 5JH7A 3RUHA 2HSWA 1RDFA 2W8BA 3TG8A 1LPSA 3QE0A 1RI2A 2MOKA 4RJJA 5IF3A 5JYEA 1C7QA 2D5IA 2FOLA 3IQWA 5CFOA 2IYYA 2JFPA 2IH4A 4K0KB 2GBLA 1EXMA 4K88A 3LIPA 5CTAA 4Q4JB 5K1ZA 1KZ7B 4GNKA 5BUSA 1TU3A 4UFNA 1NQVA 3R6LA 4DZRA 4Q4AA 1GKIA 1IM8A 2AL7A 4MITA 4DE5A 3KO8A 4FIDA 4D8TA 5A9SA 2R8YA 1XDSA 1F60A 3E3AA 4ISCA 4D0LB 2Y9PB 5CFNA 3K94A 4PM4A 4U1RA 1N5KA 3ILHA 4LYGA 3F6YA 3C3YA 4LMPA 4R1NA 5KTSA 2BBSA 2FQ1A 2RK4A 5F5LA 3ZD7A 3R0XA 4D5GA 3I5UA 4I1OA 4PPQA 5HRAA 2BCGY 2FW7A 2LZ0A 1FQWA 1XU9A 3QFTA 3TPFA 5JMWA 5K0BA 1LX7A 4A0GA 4MQUA 1ISHA 1N6PA 1T5BA 3RG2A 4NPHA 1I3NA 3H99A 4HEHA 1EDEA 2GASA 1V5IA 2J6IA 2VK1A 3OHMA 3TE6A 2EKZA 2HWXA 1M83A 1A4IA 3FUXA 4ZDWA 1YZTA 4Y2TA 3ES9A 2ASVA 3MNFA 4AXXA 5AOAA 3BG5A 1BU5A 5EMNA 1J5XA 5JJIA 3PGLA 1RJFA 4FFVA 1AHIA 2V6MA 3HZOA 2J9YB 1SU7A 1P5RA 2QZ4A 1PVOA 3BH7A 1FFXA 1KGSA 5DSZA 1DAOA 2C1ZA 4UUAA 1ISFA 3Q8KA 3P9PA 5J47A 4KTTE 2YJTD 4Q1DA 3RF6A 2GHQA 5ICCA 3D2AA 2KX7A 5DYWA 5J5CA 2FJ0A 4F3CA 5JFTA 2EF0A 5ERYA 1LK0A 1XCLA 3WGUA 2HQOA 1DX4A 3F9IA 5EWLB 4CEJB 2ZZMA 4ZRDA 1UP4A 1VLQA 1SKUA 2Q4DA 2AJBA 1G1MA 4EF4A 1B15A 3AKYA 3L1IA 4ITVA 5K8VA 5LA6A 5KBYA 5LR6A 2BHTA 2GDZA 4QQFA 4YONB 1PFQA 4RIEA 2XOKA 2J3MA 5L3VA 2JW5A 5E6SA 4RZ2A 4WUVA 2ZTSA 4DKJA 1NUPA 1A9YA 2GBFA 3MJFA 3V3KA 2IH5A 3VC3A 2QMEA 2R9VA 4KEAA 2QK4A 3AM3A 4QBTA 2FK8A 2VDMB 3EA0A 4G2TA 5JWRA 4ZQFA 1T8PA 5DDIP 3WWCA 2XT6A 1XBTA 3RLIA 1KVQA 2X0NA 3OG9A 3QFRA 1VJTA 4PTZA 4WKNA 1NBHA 4DW8A 5LM3A 4QULA 3N2LA 1J39A 2ORVA 2GOYA 3U3JA 3CSUA 1E6EA 1N7HA 5DTMA 4JEMA 1I5EA 5M5BA 4EG0A 3WVNA 3DDCA 5LVAA 1LV8A 4EY6A 3IQZA 4NNPA 4ZXPA 2VNSA 1ISRA 3FLBA 1KK1A 4NS1A 3REQB 3EC7A 4UTVA 1XLVA 3PGKA 5AVXA 5JO0A 4BV3A 2C7BA 2Q50A 2YZMA 3KT3A 1A4RA 4OI1A 3C1UA 2PV7A 1N2JA 3H4VA 4N8SA 4TMFA 1JE1A 1WKBA 4PZAA 4PWZA 5KOJB 1PJAA 3KUKA 3V8PA 3USES 1N2EA 3DL4A 1VIVA 1XQ1A 1HQCA 2D5AA 4GPEA 1Z17A 1BEUB 2QY6A 2UKDA 3UK6A 3ZE2B 2QTNA 2CD7A 1R4ZA 5EWJB 4OMDA 4XJXA 1DOZA 1NJ1A 3N7TA 3WJ7A 4M3NA 3WGOA 5JNUA 2HF2A 3R3VA 5CM2Z 2WU8A 3FCUB 2BFNA 3RVSA 4EH1A 4XGNA 1RWWA 1KRHA 2PZ8A 3EC1A 1H2ZA 3H5WA 4RXTA 1EE1A 3G7NA 1YFLA 4F4FA 2A78A 1YQEA 2TSYB 3H2YA 1WOMA 2VQSA 5U4QA 4HGRA 3WYCA 3AI3A 4EHHA 1KMCA 1X87A 1V5FA 5FBVB 3EIWA 5KNDD 4E46A 2GFQA 1BJTA 4DV0B 3LZ6A 3WL5A 1KFEB 4I36A 3W8RA 1TD9A 1FMFA 4YXWD 2HRQA 3R7FA 4DSTA 1VXRA 3LM8A 3SHTA 1GR0A 1H8HD 3IJRA 3H1PA 1NOIA 4DV4B 3P0HA 2JHGA 4B09A 1V6AA 2E7ZA 4X44A 4HEA6 5GJCA 5BSWA 1T9HA 1LKZA 2O20A 3AVQA 4PG6A 3RJMA 4BX2A 1EK1A 4L5IA 1CDEA 3DBHB 3KALA 3NPMA 3CJRA 3PNLA 4S1VA 5HTKA 2PSFA 1OLUB 3O8DA 2Y66A 1ID8A 4G63A 2IT1A 5B1SA 2EJWA 2WKPA 5AW3A 1AKRA 2J41A 4Q7EA 1CVLA 1G9XA 1UBOS 2O23A 3G9TA 1PU2A 3GRFA 3O8QB 4OHKA 1PJ3A 5F51A 3VPDA 2C5HA 2A5FA 3DBRA 4YDRA 3U7QA 4NAHA 2V1UA 2EWWA 2IUEA 1V4NA 3D2LA 3E2PA 1DKUA 1HL7A 3Q1LA 4HR7A 3OCUA 4B3IA 4RA6B 5T4BA 1ADFA 1GPDG 2PJRA 2OYCA 2WSIA 3W4KA 3BGVA 1Y5IA 3COJA 3ADKA 4F84A 1UEIA 1WW2A 5DN6D 3U4AA 5EFOA 3JD1A 3L01A 5AT1A 4LDQA 3U37A 4ROTA 2BEVA 3Q5GA 5GIPE 4RTNA 3KEOA 1E8MA 4HB0A 4OF4A 3IFSA 4IIJF 4OLHA 5BQXA 3VO8A 1XD8A 2SKDA 4G9GA 1LW7A 1XMIA 2WMYA 2BLLA 1H2XA 3CNOA 3UAGA 5E6RA 5E1BA 5J43A 3GPBA 3QXHA 2Q99A 3U7HB 1UOPA 1XA4A 5FPHA 3ZZUA 4RH0A 4WZZA 4HQRA 4TXLA 3BHMA 4LJ5A 3FDXA 4R2WA 5EIOA 3U80A 5ECWA 1H4SA 1MENA 1Z75A 1GILA 2CDNA 2VCHA 3H2GA 3SICE 5CA1A 3N70A 3RR2A 4QPZA 1D8TA 3T3IA 4QRDA 3UHJA 4EZBA 5BN3A 2OCAA 2WSYB 2NIPA 5C1BA 5DHAA 1CW2B 2CWDA 2JIZD 3TZKA 1RR6A 3VNAA 1OQAA 3A6ZA 4CLRB 3L7LA 2UZ1A 4MEAA 4ID3A 3RUEA 4TXHA 3CUSA 1U80A 3JXEA 1QGZA 3QV1A 4JCCA 4J0CA 4KGDA 4ZT7A 3UPDA 4KR6A 2AIRA 1E0AA 2YOGA 3EMBA 4MWEA 1MD9A 2V7VA 1GNLA 1MB3A 1P9OA 1XZ8A 3PDWA 5DIFA 4PAGA 3N6RA 1JFVA 1O1YA 3NYWA 4I50A 4H27A 3A14A 3AERB 1I4OA 5B58C 3GC6A 1P77A 3B6EA 5EE3A 5CB0A 1KRXA 5CB4A 4TRRA 3LBIA 1T2UA 1Q7GA 1PZMA 2ZTHA 3UT5A 3ISJA 4LZZA 5DP2A 4ZQGA 5ALUA 1KARA 2PD6A 4B4UA 4B6FA 2M32A 3TBHA 2ZEJA 4ENRA 2P9BA 4UEWA 3FGPA 4RPIA 4GMDA 1E62A 1HZZC 1VSTA 1D9ZA 1BFDA 4DANA 2X9LA 4M0FA 1T3LA 2P6MA 4QYTA 2FY8A 2R65A 2TMKA 4KREA 4TYNA 1CRLA 2QXTA 1KEKA 4F5YA 2AZ4A 4ZEWA 3PUXA 4N3BA 3JSAA 4JI1B 4PU0A 4DRZA 4RJTA 2WFAA 2DWOA 3KFXA 3L04A 2AR9A 2AYZA 2YRXA 1N1DA 3JAMA 3HYTA 1A98A 3CVJA 5A6SB 2QMOA 2OGUA 4HNQA 5F7OA 1YL6A 1TM1E 1C9YA 1Y3DE 3D7KA 3CNLA 4L27A 1C1XB 3AW9A 4RLFA 2BKUA 1JTFA 1L5KA 2Q3LA 4CG2A 1YRQA 2O2XA 4EHLA 1ZM7A 1EQUA 3LYUA 3DHNA 3CYFA 1RXSA 4GR5A 4N47A 5HP4A 2HAEA 3FCCA 3AZPA 4W7IA 2NUTA 1WW8A 4YMLA 4DCMA 2BUBA 2H31A 4P2GA 4YB8A 1HM5A 8GPBA 5LIPA 1GZ5A 3ZV4A 1K89A 3PRYA 3OECA 3E70C 1EVEA 1SURA 3KC2A 4DMGA 1TVKA 4DF3A 3C0KA 4GP6A 1NXWA 4QQRA 1JFLA 2UYHA 5L4SA 3EK2A 3SOPA 4BLPA 5F2NA 1PTJC 3ZV3A 5EJ7A 1KEWA 2JHAA 3K20A 3CEAA 3ESDA 3OO0A 3X1YA 3I76A 3PGJA 2GPWA 3DA8A 1P29A 1DFGA 1QZ3A 1ZWKA 1EDBA 2AMVA 1JIIA 3H4TA 1AK9A 3QMMA 2OO5C 3P2IA 4Y8VA 4KLRA 1W5SA 4PFKA 4MPDA 3UJBA 1T8SA 4WY2A 4CN8A 1T8RA 5FJJA 3VQTA 1U9ZA 4XGQA 3ZQ6A 1JPNA 1NT4A 4P22A 4DRXA 4YJ2A 3H3FA 4GX0A 10MHA 2AOTA 5BYAA 1M2GA 2ST1A 2HV9A 2I65A 3RAEC 1Y3CE 1FYVA 3B48A 6NULA 4TN5A 3RAFC 3R77A 1Z6PA 3VZSA 4U0KA 4KLNA 1E59A 2VSFA 1QWOA 4LGVA 2XNSA 1K2VN 4LJYA 4QO8A 5JAZA 3FUVA 1QTQA 2HPHA 5DT9A 1Q1GA 1Z8DA 3JQ6A 1UKZA 3OZIA 2FLWA 4QJ3A 1M2HA 5LYJF 4M46A 1GDDA 2VDUE 3RRNA 4DAEA 3DKVA 1YR8A 4L76A 1N5OX 5TVGA 4AMZA 3OJFA 1TM4E 1F1JA 1TJ5A 1UPUA 2HH9A 3UV7A 2YUIA 4BGVA 3THWA 1RE1A 3BGSA 3MTIA 3FNIA 2SCUB 2IKSA 2PRZA 3NTQA 3VTZA 4FSHA 4M9RA 4CT4B 1P2GA 3ER6A 4H6VA 3MTAA 4OQNA 5LWHA 5CIQA 2C61A 2OHFA 5TX7A 4A10A 3KR9A 2H4XA 3NDBB 2CEKA 5KS2A 1KU6A 1W9MA 4K3VA 3GLGA 5H16A 2HYDA 3WO0A 2HTFA 3Q7QA 3OIDA 2HM7A 2HLNA 1GUDA 4RH3A 5FKJA 2PD3A 3ROZA 4P3NA 3PLRA 3T4UA 1ZM2A 3TNYA 1GRCA 1GG2A 2BKEA 2RBKA 4I19A 3CWQA 4MS1A 3GD7A 1C3EA 1JIJA 3P32A 2Q21A 4P92A 1PNQA 3BB4A 3LECA 1QRUA 2QPOA 3LA8A 1Z0KA 4MMZB 5K3AA 4ZOQI 4KXWA 2XNDD 2B98A 2WFMA 2CBGA 4MRAA 3ZY3A 1HSOA 5HA5A 1BHO1 4XQGA 4FHZA 1XB2A 3CTPA 1Z0FA 2FZWA 4W8GA 2GSWA 2H11A 2QRNA 3DZHA 1E7SA 1O87A 5DM4A 1DJNA 4UHCA 5H1YA 4F8JA 1O5OA 2PAAA 1L7OA 4XLZA 5COQA 3CF4A 5BT9A 3UJ7A 1ZK1A 4H4DA 3I2IA 1SZDA 5K4AA 4ZOLB 4I6JA 3USZA 2G83A 1CVIA 1R6UA 1G21B 1EP1B 2OHGA 3BMNA 1WDLA 4KYVA 4X1IB 4CN9A 2VQEB 3OOHA 1K06A 4LK3A 4Z3DA 2PE5A 1ES9A 1H6AA 5AKKA 5DWDA 3UQZA 4IHJB 2DKNA 4F4IA 4MRVA 2M6LA 3DJFA 1KMHB 3DKIA 4HDNA 4AKTA 2V3CC 2O8CB 2ZBUA 1A7JA 4B17A 2VC2B 1Z6XA 1LJUA 4RPLA 5KEIA 2W2NA 4AKIA 2IPLA 1TFUA 5D51S 3PQEA 4D02A 1PW5A 1M1UA 2W11A 3C6KA 2I6XA 3NWOA 2B4KA 2O3SA 2Z09A 3FBTA 4QPPA 1C7JA 3GOHA 3BDVA 3SXUA 2CF5A 1U1DA 1ZGGA 2V65A 3NOVA 2BGMA 5DH9A 4RKEA 3K9LA 3A26A 3KQSA 1SQ5A 4ZO8A 4A6DA 1KAOA 1KO5A 3FPSA 2NZ2A 3NTUA 1SHTX 3AESB 3T4EA 1DTEA 3WLQA 2VAVA 3KKOA 5EQJB 3WLFA 4JYMA 1RHMA 4YRJA 1DO2A 2OAQ1 2Z57A 3H0CA 3ID6C 2IU3A 2FR8C 2GPBA 2B5VA 1Z4LA 1R0WA 4I3GA 3CS3A 4TTRA 3H2JA 1U1IA 3A4VA 3B3FA 4MYSA 3S27A 2YYSA 3CJTA 1RTKA 1TA4A 4INJA 4HC4A 3NM6B 4B2PA 5LKRA 2WU4A 2IBSA 3VNUA 4GEGA 2BMJA 1EAYA 3DEZA 3MG9A 4RZXA 1H2HA 4LY6A 2VQFB 2OCIA 4V3BA 4B73A 2HHAA 4OYRA 4D7AA 2ATCA 2E2WA 3FG9A 3NQ41 4L07A 1EWTA 2ZJ7A 2VS1A 4FS3A 8OHMA 3IB6A 5LMNB 3OMXA 3TJRA 1M76A 4OP1A 5LB4A 3IHKA 5DXJA 4WN3A 3IRVA 4HS4A 5T6MA 2VO1A 3KUDA 3Q9LA 3QPAA 1V43A 4B31A 3WWDA 4RTPA 1DRUA 3M6LA 5ESDA 4D56A 3OF2A 5LJIA 2Q2QA 4EF5A 3UCFA 2OFWA 4B6OA 2DPXA 4MR8B 3WNVA 4WVFA 4NMLA 2IYEA 2EFCB 1ZJJA 3AF5A 5FHRA 1ZIPA 3FVRA 3ZCQA 4TRJA 1G5QA 4MP6A 1RYBA 4ZHQF 1C30B 3GA7A 3JX9A 4JEUA 2WA1A 4E6PA 3PFCA 5IUJC 3E3MA 3K05A 3LTNC 4J1TC 4R84A 4QLBA 1NV8A 1RBMA 4RJ2A 4IFBA 2X2EA 2B8WA 1VRWA 3AVOA 2G9RA 4JVLA 3EG9A 3OOSA 4Z4QA 3ZKAA 3P9ZA 4IDCA 1TEZA 1Q50A 3EB9A 3RRFA 1LGYA 1FX1A 2VDRB 1MCZA 1NP6A 5DWQA 3CUEF 4HAYA 1XDDA 2CFSA 2BEWA 4O4IA 1X9HA 1HORA 3IMCA 4GQIA 4RQUA 1WDTA 1SKYE 2XOKD 1J9GA 4OP3A 4OSPA 1N3BA 4PN7A 3MCWA 4QKQA 3K70C 1XRPA 2Q5QA 3IOEA 4L8FA 5A5EA 7GPBA 1RKBA 1WBJB 4BQPA 3SLGA 1OV6A 3ESAA 2Q3EA 4H31A 1ZOLA 5IZCC 3NEPX 1T4CB 1CRQA 4QVGA 5TB5A 3WLAA 1MAUA 1NM5A 2W58A 5KNCA 3COYA 1O8CA 4WNIA 3K4PA 1UDAA 5F5XA 2BFEB 2JGFA 3A4LA 3GLIE 1SZPA 3WYEA 4BU1A 4U7WA 3JD4A 1DCMA 3FRHA 2WYWA 1WV0A 1JLRA 3K6SA 2P9EA 3UFXB 3ANSA 4ND3A 4RKFA 2IJGX 2EZUA 3I34X 3L1UA 4XQEA 1CUIA 3PPIA 1PGOA 3BJZA 4O8CA 3TTYA 4MLDA 4C05A 3M1LA 4FBLA 5JCZA 1GCOA 2HTEA 1OBOA 4KYIB 1SZJG 2VYNA 3TLZA 5IULC 4Q7JB 5E95A 3LK6A 2PL1A 4KHZA 2HFJA 3IIKA 4P3KA 4MW7A 4UU0A 3ZS9A 5L53A 5LOVB 5LD2B 1CT9A 1PFKA 3PVSA 4BQEA 3WLHA 1VJ0A 1LI5A 1XALA 2HSEA 3FXAA 5PGMA 2W4QA 4BTVA 4C2AA 2RHLA 1X80A 3D6AA 4JSYA 2PS3A 3QVGB 4WAUA 1R5NA 3LC0A 5JY1A 2QIPA 1E2FA 3EVGA 5ICSA 4GSKA 2IYVA 3HL0A 1F6WA 3W4IA 1Y7PA 3U9SA 2HRRA 5IAOA 1JWBB 1Y5NA 1I6WA 3CZQA 3GQVA 3VSCA 3V8NA 4BE4A 4DG9A 5MGBA 4RY8A 3BS4A 2OHVA 2B35A 2C0QA 2NVWA 3E9DA 4QJ5A 4EKEA 4AY3A 4KQFA 2ISCA 4WESB 5TQJA 3RNOA 2PYDA 1RIIA 4CMHA 4D6PA 2OK8A 1L5MA 1JKMA 3OF3A 3BIWA 3INTA 2Y1WA 4NNJA 3VSAA 1PR4A 3WYFA 3T5AA 1OLXB 2JB9A 4MW0A 5SY4A 1T9BA 3V34A 1XC7A 3KLOA 4M0MA 1FP7A 2PQ2A 5JCOC 1J8YF 4IXWA 5AUPB 1NC1A 1IHOA 4WKPA 4I1VA 4TKMA 5BSEA 4K9PA 1XXHB 4S3MA 4BUJA 3T95A 2GN9A 5DBFA 3A8TA 3ZCTA 2DLNA 2HEGA 3KD2A 4L8GA 1OFGA 4EPVA 4EG8A 3ETEA 5G0UA 5BMOA 2IEZA 2Z56A 1LNSA 4J7AA 3RSSA 4OI0A 4EPYA 1QQTA 4K9OA 1AQJA 1SHUX 2XB6A 3VAAA 1FSSA 1GKLA 1OIWA 5AM0A 4DIOA 4CEIA 3VUFA 1VXOA 1F2DA 1WCWA 1MTZA 2XB4A 3RCBA 4OU4A 4RAOA 1PKXA 3GRKA 2IBTA 1UZMA 2GZRA 4UHKA 4RK1A 1ICIA 3CN9A 2ZCUA 3QNUA 3HBAA 3KL4A 1XE3A 4M8IA 5IYZB 3FOWA 3E35A 4JKIA 4XCVA 1ZM3A 1OHHA 4X63A 4F4UA 1YVPA 1OFTA 1CZUA 2NU7B 1GZ4A 3BAFA 1UWVA 3NNSA 5TIIA 3TCNA 2FCAA 1HDEA 3VDXA 4C6RA 4DXAA 1Y33E 3WHLA 3PWKA 4HQFA 1V11A 3VNRA 2X4DA 1G60A 1Y1LA 3O7MA 2YN0A 3DTVA 2ZK7A 4NATA 3KB2A 3DP7A 2HK6A 4R2JA 1CEXA 3OQPA 4NARA 4ZZ0A 1LDYA 3CNNA 3MJEA 1T1EA 5TQ2A 1XRNA 2QKYA 4L22A 5DYGA 1CUEA 2CCJA 3E7PA 4EYQA 4J2HA 3QEOA 4TXMA 5E0OA 3ZD9A 1VMEA 4KFRA 4XR9A 1RYNA 1MU0A 4FNAA 2VNIA 3AETA 3BE6A 1KPGA 3NVMB 2IEDA 4GU5A 4EBFA 2VK4A 4P54A 1TF5A 2X2PA 3PGXA 2JLWA 1YI8A 3ILXA 5FNVB 2B6NA 1ZP6A 4YACA 2Q2NA 4JDPA 1BH6A 4QQKA 2YY7A 1C3OB 1DIOB 1QH8A 2A9VA 2NZYA 2O0LA 1MPXA 3LDUA 3WJAA 5SICE 4CM1A 4II7A 2A1TR 4KSCA 3IAM1 4TKUA 2JEYA 4KQXA 3VZPA 4LVUA 1PT7A 4OKIA 1ZOOA 2WWXA 4LGYA 5A05A 4HTFA 4EFDA 2V5AA 3BXFA 3CEMA 1RXIA 2CJPA 1KO1A 1E1KA 4E32A 3M83A 1VL2A 1LSUA 3BMQB 4MQ5A 1FRZA 5DXAA 2XQIA 4DNPA 4EG4A 1CDZA 1VHTA 4AJJA 4K1LA 2BEUA 3N39C 1QX3A 5AVZA 9LDTA 4QU5A 3ICWA 5JH7F 2PANA 2PGAA 3DGEC 4PC1A 5GGXA 2FMUA 5DYNA 2YRFA 2HW8A 4BVEA 4EY7A 1QYWA 2EP8A 3DMYA 3FA2A 3V1MA 3BK2A 3PQ3A 4GI1A 4AWXA 5IRCD 4N8EA 3VU1A 5EIEA 3JQAB 1D1PA 1L7DA 1U3CA 2AUNA 2CFIA 3U4QB 2QOEA 2ZYWX 4FDMA 4MPRA 1AO3A 4GLFA 3AXSA 3A9VA 3NM5A 2XZTA 2NM0A 3HFJA 1VSBA 4FEAA 5JRDS 1XZQA 2YUTA 1XQWA 2NUPA 2YVLA 2XT0A 2RGWA 3JQPA 3EW9A 2WUEA 5A9RA 5JZ9A 4U2BA 5JJCA 2CNDA 1G291 4WY5A 3TTWA 3H1FA 4JKOA 2C2HA 3OCYA 4DIMA 4RJKA 5H4HA 4FMBB 3VPGA 3ZJ4A 5IAEA 3WL3A 2XDWA 4RK4A 4IEEA 3DWGA 1EEXB 3THXA 1TUGA 3DNMA 1XJCA 1UBRS 1Y98A 3DFZA 3EXEB 3KYJB 3QKRB 4V1CI 2QZZA 1OB2A 2ZPAA 1UBFA 2VAXA 5CDFE 4TQUS 3PA8A 2FMKA 3QLEA 4P5DA 2OBFA 1X8KA 3GLFE 1NZJA 3BH6A 1HV8A 3C15C 5EZ5A 1SCJA 4PGMA 1IM5A 1OWNA 2VJPA 3LUJA 5LQUA 4GKJB 3VR5A 4DQ0A 2H9IA 4X8LA 1EVYA 1E2DA 3SZRA 2PZKA 2J87A 1N25A 3V4OA 1GN9A 1WCIB 4HDRA 4D3DA 2YWXA 3VPHA 1A9OA 5FAXA 3W5UA 1Z4JA 4FT4A 3CLUC 4QE3A 2D00A 1T9GR 2UZIR 1VKZA 1KMNA 3NHSA 4MKHA 2I66A 2JH3A 4X20A 4TKZA 3F0TA 3M6VA 5ALLA 2GAIA 5EY5B 5LA6F 3K2EA 2PX3A 1A96A 3UHOA 3HKDB 2C7OA 4UOZA 4Y6QA 3U7IA 3UT0A 2NXWA 4CQJA 3NFRA 3R6GA 1C1HA 2V7QA 5GINE 2J4CA 4N76A 4FB4A 4R16A 2BCJQ 2FRXA 4FYPA 4ZGWA 4X66B 1PG2A 2P2NA 3LCMA 4BQOA 1D5CA 1W96A 1CHNA 1MC1A 2YV4A 3VZRA 5MN6A 3P52A 1R66A 4E0BA 1G16A 1GNPA 2I2FA 4L28A 3VZBA 3H75A 1MEEA 5LBTA 5AVYA 1TM5E 2H48A 2CYBA 3OFJA 5D01A 1V1RB 1R0ZA 1YOBA 4Q1EA 4U5QA 3CUTA 1DP4A 4K8RB 1DBWA 4Z0PA 3ZG6A 1AXEA 2C2ZA 1U8ZA 4GPIB 4L9RA 5LQKA 1ECFA 1NIPA 2OAGA 3ASUA 4QGFA 3TTSA 4P4TA 2QF7A 3KR0A 4J1SA 4YQZA 5AW9A 3ZW8A 3J7TA 4C88A 4EJFA 4L7VA 3U4MA 4YR9A 4DXHA 3C8DA 1W5EA 4P4LA 2GCOA 4Z9YA 4HPJB 4QREA 4RVCA 2C9YA 4RTLA 2YXPX 3VC7A 4EVQA 5AXAA 3EWSA 3QKSB 3BWCA 4J1NA 3VOAA 2ODEA 1DDGA 4NV0A 2OQIA 3WLNA 1HDYA 5A3VA 2NN3C 1WMSA 1UDRA 3BQ9A 4HRXA 4WOCA 4XYMA 3DOIA 1X7XB 4C4ZA 2QR3A 1VCIA 2B8EA 2J46A 3RVQA 3SG0A 4AUKA 2WIFA 4YNBA 3VGPA 1YBMA 5AUQA 1TNDA 1Y4SA 3QI7A 4HQOA 4HYTA 2PL5A 2Y2VA 1VL5A 4P4SA 5C3UA 3VPCA 5BNWA 1GPYA 5I51A 1UBEA 5E2AA 4CIYA 2FEAA 4OQDA 3LYLA 5K01A 4I4LA 4MSUA 3OZVA 1PJLA 2ZSEA 2W70A 1P2VA 2B1JA 3K31A 4KN5A 2WP8J 2EFEB 2FUNB 2LTAA 4N9QA 4TWBA 4B43A 2DFPA 2FDXA 4TV8B 2ICAA 2JBAA 4IH1A 4KLCA 3LS2A 1E4OA 5KVCA 2HHLA 4G67A 4X6LA 2GK7A 3I01A 3FHLA 3U4CA 1KO8A 4BVBA 2PRSA 4J6EA 4BCDA 4CLDA 5I7FA 3FVWA 1FDWA 1YRAA 1ZEMA 4AK9A 1FW8A 3K0EA 2HJ9A 2XE8A 3PEYA 3PC7A 3V80A 2CYCA 1EGMB 3ROKA 1U2DC 3VTAA 2WAYA 1K97A 2CB0A 1EJBA 1S2DA 5IKEA 5KOYA 4OH7A 1A7AA 2CXSA 2I6FA 3WDSA 4RZ3A 1M8KA 3G9UA 3EH1A 5KYKA 3C45A 4QUDA 4KMMA 4OHPA 3T61A 1RQNA 1A2OA 1UM9B 3U5ZB 2OZPA 4EIWA 2O3RA 3OUUA 3KYDB 4R1PA 3O74A 3K35A 5DOVA 5EA2A 4D80A 3BGIA 3M6AA 5CW1A 3L1JA 5ALRA 5EYPB 4IXDA 3JQQA 4O2RA 4OMUA 3FI9A 3W05A 5KWJA 2DUWA 3BHIA 5CEJA 5HZHA 1T1SA 3AEUA 3A1SA 3DV9A 1T5IA 5ADUS 1A8UA 4X93A 4WLOA 4W5HA 2XMZA 1TIBA 1VPVA 1J49A 3I9NA 4G3XA 1JEYA 2F90A 2RAUA 2F8MA 3LT0A 3F6BX 2ZP1A 3PZRA 4JJ4A 3ZVNA 1BS2A 4TM8A 3L9WA 3DPUA 3WGJA 1CYDA 3ZHRA 3CNHA 1K98A 4ND2A 4O0MA 4B3GA 3M70A 3ZYZA 2Y8EA 4MP8A 3IXMA 2GM4A 4FFBB 1BJKA 1WVIA 1YVEI 4W5WA 5ED0A 4B6JA 3GRYA 4DY6A 2X5NA 3SVTA 5DSTA 4KPUB 1COZA 2IYWA 3FROA 1QGAA 1S02A 4I1YA 1U8FO 3JRWA 3NHWA 2X8AA 2B21A 2XSZA 5IBPA 3WIEA 3NW9A 1UAGA 5EXTA 4PIMA 3PCTA 1D4AA 4X6XA 4M1EA 1P3DA 4R9VA 1G2OA 5CA1F 2IS2A 3KKNA 2RHOA 3HXKA 3R4CA 3D4LA 4B8ZA 2ZXUA 1Z38A 5K0JA 1M2NA 3FPFA 3WNBA 2JFXA 3PHIA 7REQA 3F2IA 1KQ3A 1XGKA 1IWBB 3A3YA 5A1TA 3BSSA 3UJNA 3CXRA 4Y6SA 1RJWA 1OZFA 3WMWA 3AILA 1BX0A 1KNXA 4HLUA 1L4LA 4TS1A 2V6FA 4I4IA 4KN9S 3S29A 2EP7A 1R8SA 2WK1A 3K53A 1CEYA 1KYWA 2WIBA 4HX2A 4IINA 4X3CA 2P5TB 3VO2A 4I50F 3PUYA 4XZ3A 1K4YA 4PX9A 1BCSB 3DVLA 1X9IA 1ZK4A 2G71A 1WZUA 3G79A 2A9QA 3RU2A 1Y63A 2V45A 3WGLA 1NNSA 5CB4F 1DQZA 2QSJA 4N4AA 1U11A 1PG0A 3LSTA 1OLSB 2P5YA 2SKEA 2Y0CA 3INNA 4WKBA 3KT0A 2JHCA 2YWGA 1XMSA 4NEHB 3WLJA 2H0RA 5CEFA 2ZJ2A 1CC1S 2RHGB 3MTDA 1KXJA 3Q8XB 2DR2A 2IXTA 4H3SA 1X7YA 2ZBGA 3I32A 4PFSA 3SC2A 1SUSA 2CMGA 3ACCA 3WWOA 3ZDRA 1U3TA 2H2HA 4FFWA 3EFBA 3OOYA 5TVKA 4RA9B 3V4LA 1JNYA 3WLMA 3LP5A 1ECPA 4E5DA 1E2BA 2RK3A 4LYYA 1EUDB 4HGNA 4OGWA 5DRTA 4LC1A 2ZAYA 1JAXA 1RS0A 2A3RA 5FT9A 3UWSA 3K4HA 1ULSA 4I5DA 1X7ZA 3TJZA 2QYHA 5C31A 1IB0A 4I4CA 3IBCA 4ZAYA 3PC6A 3WK6A 1PK8A 5JADA 1E1LA 3A4IA 3UXMA 1II8A 2PT5A 2AQHA 2ZI9A 4UC0A 5KTNA 2YZ2A 3H8JA 2DOKA 3THYA 1T1IA 1TC1A 3CUUA 4A9AA 4MARA 3BD9A 3BGDA 5LQRA 4HI0E 2IZ6A 3EY4A 4REQA 1FEZA 1JDSA 2HSGA 3GUHA 2C2WA 3NVAA 3JZFA 1YCHA 3HFGA 3DULA 2FF5A 2X9GA 4C5BA 5D3MB 5C9ZA 1EMDA 5CURA 5E9JA 3L4BC 2XWPA 4ZEMA 2QRQA 4IQ0A 5KOIA 1ESCA 4LKOA 1OZGA 1N2CA 3FGOA 3HWWA 1HYEA 2A1TS 3K1AA 1W36B 4WDQA 4WXMA 2C97A 4GFDA 3A3KA 2GZ3A 3ORFA 4CKCB 4ZVRA 2VVTA 6GPBA 1QS0A 3B36A 3AMVA 4E3ZA 3PTLA 2HU5A 3C16C 4C4XA 2QGNA 2Y71A 3B9PA 4LIPD 5C3MA 3N86A 1WU8A 1XK6A 3IJ5A 3EX7C 2C8VA 3MLBA 4C04A 4FMCB 1IQ0A 4M21A 3TGPA 3D3JA 3FDZA 1XKTA 4MVJA 3QY0A 2AJ8A 4YJ2F 5A3QA 3QMVA 4CMEC 2ZROA 1XDZA 1ISJA 3QVLA 4IQ4A 3T3EA 2OGWA 5D84A 1LVHA 3GWGA 4TL7A 4Z2YA 1JDUA 2PEZA 2X8LA 2OG1A 1XKXA 1YB4A 2YIDA 4LEIA 4EHFA 5HKBA 1WBBA 1OV4A 3ICPA 5I7UA 1XYGA 1MKYA 4RDXA 3RFFA 3KJFA 2ZIFA 3FOAA 3EZNA 1H4VB 2Z5VA 4U2CA 1T13A 1YFKA 3PNKA 4FBMA 3BT7A 2JG3A 1A97A 3QVWA 4X7RA 2EBWA 3OA0A 3PX2A 4XYGA 1Y7TA 4AC9A 1J20A 3C3BA 2GVDC 1RP7A 2FP3A 1NY6A 2A8YA 4X62B 5H82A 3TF5A 4GOLD 4BNYA 3GQBB 4G0QA 1NI3A 5DTIA 2BCEA 1T5DX 3MB8A 4QGSA 2VSOA 3OZDA 2JAHA 1R2QA 1A5AB 2ZYGA 4UE2A 1O54A 1RJ9B 1UK7A 2C3MA 2X86A 3BF8A 2VUIB 3QX9A 4IGIA 3PXUA 1ATIA 1TIPA 2PH1A 4CODB 1QHFA 1RQRA 2ZDQA 3WGTA 4AJPA 4D4KA 1NBWB 1SEVA 2H2AA 2XBUA 1V5GA 3I04A 5TT1A 2HDOA 3ZY2A 1G6KA 3CZ9A 3MMNA 4U7FA 1AF4A 1G7RA 4DM4A 1UJNA 2IE8A 2PVPA 3CIOA 3IR6A 5FTMA 1PZEA 1QP4A 1W0JA 2A0UA 3PNQA 2LKCA 3RODA 1RW4A 2NZWA 2IH2A 1ST2A 3PUKA 3RIEA 4BOYA 3A4MA 1K8RA 4Y1GA 4B3BA 2E18A 2CLIB 3WFIA 2CC2A 2IC5A 2V9PA 4HWPA 3SYKA 1X38A 3R9IA 3T1TA 1OHHD 2YXEA 5ELLA 4PINA 5TMDA 1MIOA 3JSXA 2BP7A 2YWFA 2YKGA 5CIWA 3M6MD 4C5AA 5AOCA 3C8ZA 4M9QA 3K9NA 1A9QA 4HPWA 3IMEA 2IYNA 4ZU6X 3WK9A 1QSGA 1T9GS 3FPKA 3W0LB 1MA0A 2F1HA 3BE4A 3FN4A 3DTVD 5M3BA 4UW9A 5JYDA 3SS8A 5IEJA 1OH5A 3AR9A 2HGZA 1C3XA 4MJLA 4MHSA 1QC5A 5KVSA 3JWGA 2IGBA 4OCZA 2WAXA 1CF4A 3RVRA 4WBNA 2VOJA 4GWKA 1JTVA 4BGIA 2WTMA 1TCBA 2E21A 2FRDA 2VUTA 3O47A 3QW4B 5FOSA 3MTJA 4QM7A 5CA0A 1JR3A 2VJOA 3BJEA 4OREX 1C0EA 5CT9A 4BLWA 1QHXA 2WV7A 4UMDA 2VSNA 1JSLA 2X42A 3B6JA 3OQ1A 4X00A 1WETA 2F64A 4OTZA 5BWLA 5DLPA 5LMZA 2HWKA 4Q9AA 1W94A 2WJ6A 3FKSA 4WCDA 1Y8QA 2VDWB 3ND9A 4XLLA 5CH3A 4HNHA 5CRIA 4PPNA 3RRXA 3WFJA 3RJ5A 3SSMA 4O5AA 1V8FA 3BD6A 3QTTA 4W82A 3TRJA 3ZQ4A 4DDTA 3H2SA 3I0NA 1CQJB 2GPAA 4HN9A 4KIGA 2R6HA 3G5AA 1NVDA 1W93A 1VCMA 2HLDA 4NEQA 3ASYA 2D5BA 1CEQA 2JLSA 4KB5A 3JRNA 3K8YA 1ZH4A 3FPCA 1PSWA 5AVUA 4ZOAA 2ZCVA 1GY8A 2GTHA 2Z5LA 3TEFA 4LJRA 4ZO9A 3BICA 3I9V6 4M55A 1XD2A 2OZEA 3CT6A 3DOEA 4NDZA 4PQRA 3EGXA 3SC6A 3R5TA 3CLSC 3HVKA 4NZ9A 4OG2A 2QZJA 3RHSA 5DO9A 2ZYTX 5KWSA 1UZLA 4H1TA 2H65A 3L8FA 4BO5A 2CB9A 1GQFA 3RYHA 3DYBA 2GXQA 2YHSA 3ONWA 4FGSA 3JYHA 1N57A 4GPZA 3G02A 2C4VA 4DYHA 5HTOA 2NO4A 4HWOA 5F1PA 4FFPA 1DBQA 1E0JA 4LOAA 3TZEA 4C3VA 4DCTA 2J48A 5FUXA 5A2QA 5LZ9A 2AX4A 2XXBA 5KNCH 3TEMA 3TLXA 3UA4A 2GRAA 3RKRA 2DERA 1B76A 3ZS8A 3ED5A 4G8JA 4FYJA 3SC3A 4UD2A 4JC0A 4H7IA 1KTIA 1ADGA 3CKKA 1QMGA 1EKXA 2R7NA 2P1RA 3GG9A 5J2UB 3T41A 3MBKA 2ZUUA 3MRTA 4G2NA 4FYIA 5K5EA 4NZMA 3HXMA 2EBHX 4XRGA 5KDLA 2VHYA 2IDJA 3WG9A 2PU5A 3GJZA 4N7BA 4LJ6A 1S4QA 4J7CA 4CM8A 4LCJA 1M7GA 4G09A 3ZTWA 4X8OA 1BD4A 4J3NA 5IC6A 2FSGA 1W4CA 2ZWMA 3DLBA 1ECGA 4P36A 4JHLA 1T2DA 1BMDA 2OCKA 3AEQB 2ID4A 4DMLA 2BTEA 1ZN9A 1WLSA 2JBHA 4MTCA 2ENWA 4RTSA 2NO0A 3KSAC 3QUAA 3EDCA 2X3YA 1OI2A 4X84A 4OJQA 3BFKA 2G77B 4JLDA 4RXMA 4J0HA 4UPDA 2DXIA 5D5QA 3PPYA 3VR5D 1NPYA 2ZBPA 3QEJA 2QJOA 4OUKX 5AI9A 1ZM9A 1D6MA 1BX3A 1KAHA 1P1JA 3NUZA 3PL5A 2VPTA 5F2OA 4BLUA 3CWCA 1E0KA 3DR5A 5JT1A 1GO2A 1PEYA 3TZCA 1R4MA 1YRLA 4YIKA 5T8KA 5LXTB 2YQZA 1F1BA 4NMHA 3ROEA 2X7HA 3F7OA 3F2VA 4F91B 4O4IF 4Z0HO 3LGAA 3COVA 1X1QA 2B4YA 1P4GA 3VR0A 4YGXB 3LK7A 3H11B 2V7QD 3L7MA 1L1RA 1YJ5A 4FYKA 4CL0A 5KHOC 2YH2A 1JEAA 1PUIA 1TEVA 3NZEA 4IIUA 3UENA 3IMFA 3NRBA 4P9NA 2CLOB 1WUKS 3EF1A 4QNMA 2PGNA 4TMTA 2ZANA 3GD5A 3GRCA 3X1XA 5K05A 3UMMA 2F3SA 4BNMA 4A0SA 1M2OB 1W4AA 2F9LA 4M9SA 4II3A 3TLGA 4YV2A 5ADVA 2B61A 1QYIA 4GBJA 1WUTA 1FE8A 4YP5A 4DNOA 4YUYA 1CJUC 2QRVB 4G5FA 4B7CA 2UUCB 1M3SA 1N2SA 1E1NA 5D00A 3VV3A 2QM8A 4XSGA 3UZUA 1LPMA 3BPSA 5KSPA 4RYLA 3QELB 1VPWA 2FPKA 3HDHA 4O2BB 2E4YA 4B7ZA 3ILYA 4QPCA 1A8SA 1EB8A 3E3NA 4X91A 3MOGA 1M1NA 4ZVMA 3QOXA 3NAQA 3NB0A 2M1ZA 4Q16A 2J4DA 4KIFA 3NHYA 4KRGA 2J9FA 1EWRA 1R6VA 2ZRJA 4RBNA 1NQUA 1OA0A 3RQIA 3U16A 1JDZA 2G0AA 4B80A 4H16A 1LD3A 4CCYA 1ONOA 4XRRA 1JKJB 2GVZC 3ADOA 3M2TA 1R9JA 1YR6A 3A0RB 1VFPA 3KLMX 2E4UA 4LDAA 4EYOA 2HI0A 2J9XB 3KL2A 2F2TA 4BB5A 1WX1A 1E3JA 5KTPA 3AX6A 1U02A 1PEDA 5CM8B 4Q9HA 5IJ9B 1A2KC 1QKJA 2QJTA 3RVMA 3Q1KA 4OXQA 3MT0A 4XSVA 4ISBA 5DBGA 1SFRA 2H85A 1D1TA 3DAFA 1PSDA 1RXUA 4RHEA 5SZHB 3IQIX 2WJVA 5AO9A 2X5XA 1PLKA 4KUHA 4BP3A 1Y4UA 4M1YA 3MERA 4QTYA 3E7FA 1XDGA 4KXYA 3QEMA 1TYBE 2O6LA 2XOEA 2H5EA 4IX1A 2QMUA 2WMNB 5JI3E 3EF3A 1KDTA 3KD3A 3A4NA 2TYSB 2XCLA 4GR9A 4HVAA 4EL0A 5AJTA 2HL6A 2DPGA 4QICA 1FVHA 4GQAA 1BFKA 2XVYA 2EZ9A 3HU2A 4RPHA 1U3UA 4B1FA 4C3OB 1QRDA 4RDCA 5DW3A 2VDOB 3QVUA 4QYMA 4ZANA 2C2GA 3NG1A 4DSOA 4AZ3B 1WZ2A 3QHPA 2WIGA 3AZOA 4YJ3B 5KINB 2JKYA 2FWAA 5L3QA 4S12A 4JLUA 3T15A 2ZW9A 3VYTB 4B4DA 3OJWA 1QH0A 2QD5A 2UVPA 4FINA 3V7YA 4D8XA 3UPTA 4KXMA 4MZDA 2ODTX 5EJFA 2VIIA 1U8XX 3QVTA 4PYRA 1I2ZA 3NHAA 4F4DA 3C3CA 4ZI2A 3SXPA 2D7DA 1G8JA 4D9KA 5SZIA 1X92A 4R1QA 4YRFA 3H2HA 5IDVA 1IVYA 4RE5A 2IS6A 1W75A 1WCYA 5AMXA 3O4VA 4BFZA 4KHPB 1L5YA 4FKBA 4GL2A 2ZBVA 3OFVA 2C29D 3RSCA 5D7BA 4QXRA 4DLPA 4JT4A 1IAVA 4MQMA 3SX4A 1H23A 4AJKA 2OP1A 3QIVA 1RQ7A 1LX6A 3UOGA 5E9AA 521PA 4TLLB 5AXCA 1ONBA 3V4SA 1IPEA 3D0RA 2FE4A 4C21A 2GZSA 2XSZD 4FMDB 2Y67A 4OGKA 3U1TA 3O3MB 2WSLA 3IR5A 3OKCA 4HH4A 3PVZA 5FTJA 2FW1A 2ZJFA 4E2YA 1RSZA 3WGIA 2NPIA 3HM9A 1GRVA 2AW3A 2G63A 2J0SA 1T3GA 1Y3FE 4XUDA 2FFRA 5FFMA 1RNLA 3LO8A 4L0MA 1AX9A 2FPLA 5DIZA 1GIAA 2YQ4A 3VR5H 3E81A 3ZHCA 1XTBA 3HB0A 4L15A 2ZYHA 2V3VA 2C58A 2I6SA 4KYUA 1N32B 1Y6RA 2K7ZA 3IP1A 3TBKA 2MMGA 5AVJA 3G0CA 2JI9A 4IJUA 4CNBA 1CV2A 5B1DA 2OBLA 5CLHA 1G2PA 1RADA 3CIFA 1I7DA 4FLEA 2AOVA 1I30A 2CHUA 2XE6A 3EVTA 3M34A 4JJEA 5KSOA 3SF8B 3TL2A 3FRIA 1PR2A 3UMFA 3E4CA 4B3DA 3R9WA 1H1LB 1YRBA 3P45A 1GQOA 1B8VA 1TK3A 5ECDA 3DUFB 3FKJA 5EPEA 3RANA 2QI9F 4B8WA 2GT1A 1QFSA 5A03A 2XA1A 3C8HA 3PLNA 3T9DA 3C5CA 4HVTA 3UTDA 1XZCA 2XH8A 4ITRC 3MWEA 3SSOA 3ADBA 4PE5B 1M8JA 4G0ZA 4L6IA 3MIIA 3ODGA 1IQRA 1U31A 2XUFA 1EUZA 4G65A 1RPAA 4NABA 3QEKA 1YQDA 3MWYW 1VJGA 3N2EA 1A9RA 3K1YA 2V7WA 2Q1TA 4PRZA 5JD3A 2XADA 2YV2A 3RSHA 1R7RA 1QK5A 4XX1A 1CUHA 1DBRA 1BD3A 3VH4A 1DKMA 2WPDA 3IH5A 4QPDA 4Y2GA 3TKLA 4B9AA 2R62A 2ZIAA 1P9NA 1NF2A 1EK2A 3FF4A 1Q1EA 2VYQA 3SYMA 4W1SA 3WQBA 5EIBC 4LDNA 1QIFA 5BURA 1GL6A 5L8VA 3BUSA 3MS7A 3CM0A 5B2EA 1R00A 3H1GA 3ANLA 3RC2A 4GOOD 5CHYA 2GA8A 1W85A 4ZIRA 1VYTA 3DUWA 4POAA 4L9SA 2GB4A 2F67A 2UUBB 1Z5OA 2OZLB 4TRMA 4BQFA 2CK3A 3BIXA 1ZCJA 3Q6IA 4XVQA 3G1WA 1FQOA 1ICEA 1HLDA 1JJIA 3F1LA 3I4FA 4MA0A 4YJHA 1SC6A 1CJVC 1K4MA 1JWAB 1Z15A 3C7CB 5KUTA 1D2EA 1M5RA 2FSHA 1SBTA 4TTJA 2W98A 3T7SA 3M3DA 2WM3A 3G5MA 3WMGA 4DQLA 3IAM6 3IAAA 4IM7A 3DTYA 1CR0A 4CTMA 1XMVA 3RARA 1UWLA 2C7QA 1R9NA 3IO3A 3JZMA 3GELA 3HZRA 2PNJA 2O7VA 1NRIA 2RGBA 2VR1A 3KQTA 1SEPA 2ECFA 3I37X 1OH8A 1R12A 2FGJA 4TZKA 2IELA 5EJ4A 3M9XA 3DBOB 1QHNA 2I4NA 1JLHA 4JWKA 4MVJD 4EA9A 4HXGA 3CR8A 1GSHA 3CU5A 4YBRA 1M1YB 3U13A 1NDHA 3V9PA 4EQZA 1NNI1 2C2OA 2BGUA 3T34A 2OHJA 1RMQA 1T0JB 2XZLA 5JQGA 4BP8A 5FJIA 3H05A 1L5QA 2PLRA 3K5WA 4W6ZA 5EIAA 4X24A 1TYZA 2R44A 1R6TA 5DB4A 4NJMB 1SCBA 1YS6A 2WF7A 4I99A 1I7LA 3OPYI 5H3LA 3TAXA 1FBTA 3IVCA 2JLYA 4LXQA 3BMCA 3OIFA 4F6RB 5JSZA 4MV8A 3VTFA 2A5LA 1W4ZA 2GERA 5E4TA 1ZU4A 1KOLA 3QBDA 3UWDA 1U7XA 5LMCA 3AL2A 2B7LA 1BS9A 4OLFA 5AFSA 3NAZA 4RESA 4QBGB 2P90A 3A1UA 3K9GA 3WZLA 1ZOIA 2XITA 3MMSA 2NMVA 1N6IA 3JALB 2NV6A 2CJYA 2C2YA 3A1NA 1R3UA 3N0TA 2NXJA 2R3SA 1JDVA 1N9ZA 4Q37A 4X71A 5AJXA 3LQ1A 4P86A 1DELA 3AU8A 3A9SA 3DV0B 3F3KA 3RT1A 2ZSAA 3V1UA 5BV1A 2ZZNA 1SCUB 2DCMA 3T1OA 3W7VA 2HSZA 4B3TB 4YI3A 2QN8A 3LX6A 2II6A 4G41A 3DWEX 4L0DA 2WVAA 3O91A 3MCVA 2F62A 3Q3IA 3SFVA 1KI3A 4YMHA 1W0JD 3QU2A 4JA2A 1D7AA 1KH1A 1V3TA 2FZKA 2WDPA 3BD8A 3PFFA 4HATA 4FE7A 2G1AA 4DABA 4KACA 3W06A 4A4DA 4FGWA 9GPBA 1E79A 3RVNA 3IUNA 2O1SA 2Y05A 4HAIA 4PX2A 5M34A 2O8DA 2YWHA 1D5WA 1WB5A 4HZUB 4WIAA 1X3LA 4UNSA 2I6QA 4TLBA 4DG5A 3WMEA 5BP7A 2IHTA 5K8TA 2DE0X 1Q0QA 4WVLA 3AF0A 3RGWS 2P3QA 3G88A 1DBVO 2QRGA 3IV9A 4JJ6A 1P7WA 1TL7C 2A30A 3EOBI 1RABA 1TUBB 4PG7A 5BNTA 3FPBA 3VR1A 3TVTA 1SN7A 2AKEA 5GJBA 3N6XA 3B51X 3O2NA 5HDQA 3PUZA 4MICA 4OQMA 3FLAA 4QECA 2XHEA 4XFJA 4FM9A 1VBMA 4U63A 5EIWA 3HUUA 4F11A 1P80A 4O4LA 3UMVA 2MU1A 3I5MA 4ZYWA 3L77A 1QO0A 2Z6UA 1B14A 2WVJA 3N8DA 1F0NA 1JR3D 1T2FA 2QV7A 5KREA 1DTSA 1EI9A 4DB2A 1W1WA 4JVOA 2QVCA 1W88A 1N9KA 3CLRD 2CFCA 3G8AA 3ISVA 2A0FA 4IIEA 3QBJA 3AEXA 5THXA 3FKSD 3PHLA 1GTJ1 5DFAA 4LOJA 4M2LA 1WSBA 3G7UA 1WDMA 5FBHA 4DMRA 2WNIA 3WK4A 3L9XA 3I28A 4YWHA 2AYXA 2G09A 4BO7A 1YQUA 1LF5A 2HLDD 2YMMA 3HU1A 5REQB 3VOTA 4HDMA 2J5KA 3OZAA 2A9RA 5AW5A 3C1OA 3P8ZA 4F38A 2BFFA 4YI5A 4AO8A 1Q0RA 4HQKA 3OZ7A 2R68A 3GFPA 4Q9IA 2QAIA 4OM8A 2EWVA 5JXGA 1JXMA 1SWWA 5K20A 3EPLA 3AQ4A 1PJRA 3ORSA 2C4WA 3CRNA 4LTMA 1Z2OX 4IZHA 3UK1A 4HBZA 3VYUB 4JI6B 2ZRIA 4N5DA 3JYLA 3HXPA 2NQ2C 2P41A 2WSBA 2Z0MA 4KXFB 4UEQA 3HC7A 1P0PA 4CTKA 2P27A 2HCJB 1RWKA 3MXOA 4U9IS 1UBLS 3O0DA 3EZ6A 3JQ8B 4LPSA 5EPUA 3GT0A 4HV4A 4WNCA 1DV2A 3NTOA 1IUKA 5EUBA 4IO0A 4MI1A 4Y2UA 4TS4A 4E21A 4L2IB 4TLEA 1PWYE 5C8YA 2GXUA 3K4QA 5I5GA 4E14A 3KEGA 2F8SA 1M0TA 3QF7A 4LOKA 5AHKA 4ZRMA 5AUNB 1ULUA 3MCAA 4P80A 4D26A 1IIBA 2C94A 4OHWA 4RIHA 4J2TA 5HFNA 4EW2A 1DADA 2VRCA 3IIEA 4CKBB 3UHAA 4ZAFA 1ZAKA 2BELA 3PFHA 1T2EA 3GEIA 1UWCA 4J1QA 4MR7A 3VU9A 4QYXA 3PDJA 3W78A 2OZKA 1AGNA 2XMCA 3FZQA 3LDFA 4X1OA 1WMEA 2UZAA 1YJ8A 3UGQA 2NVUA 4C4TA 1NVGA 4ZT5A 2AF3C 3SGLA 2VJMB 1GT91 3E9CA 3ZEIA 3RWBA 4DUGA 4JZKA 4PGHA 2R7LA 2P4HX 1EZ4A 2R751 1SC4A 1SUBA 2Q41A 1ZUNA 1H9AA 1UMBA 1HZJA 1R6DA 1TQHA 2JD0A 4FFRA 4NZYA 3SPXA 4Z4HA 4PPYA 3DMNA 2ZYDA 3QSYA 5K9ZA 3B1VA 1ULHA 2ZSHA 2HYIC 5F9HA 4AMUA 2XTMA 4DGSA 2QQGA 1P44A 2YMLA 1CR2A 5E4JA 4H3HB 4AYTA 2E0IA 2PXHA 1USKA 4BNJA 2ZOSA 3H5TA 1MOZA 3LC1O 3AJ9A 2GF2A 3MUFA 4XB1A 4ZMRA 2CHFA 2ANBA 1OXXK 3LTEA 1Z4OA 2ODWA 3NASA 1DLJA 4JGBA 4C9BA 3C6QA 5LUAA 4M0EA 3L8YA 1U4SA 4Q4AB 1I6MA 2LCFA 4ZFNA 3NIFB 2VZLA 1KDZA 2W6CX 4EB6B 5LL6P 1RBYA 1S2NA 2BRUA 4R68A 2ZRMA 2Y0PA 2H06A 1WWKA 2XD9A 1YU6A 1OROA 1GXSB 3CRQA 2C57A 4L8LA 2IHUA 4IOLA 4WCFA 3RTEA 3ZWVA 1JS1X 1G20A 5DYYA 3MAAC 3AWDA 1O97D 1E63A 2B8TA 3HN6A 4G56A 1FMCA 3ZEAA 2QL7A 1W6UA 4PO8A 4AZSA 3PIRA 1XRMA 2GPYA 4OI4A 5KTOA 1EXDA 5LP6C 2R6FA 4LVOA 3H13A 1Q0LA 3KLBA 2WFLB 1Q77A 4MIOA 3CE9A 3HLKA 3GJSA 1V45E 4FZ3A 5KYUB 1G38A 5M7EA 2OSBA 5E9QA 4ZMBA 3W77A 3WISA 3FOCA 3TLCA 2HMAA 5CITA 2P78A 1IVSA 1FFXB 1ZZGA 2MDTA 1LPNA 3VR4A 1KY5A 2FX2A 4MVJF 1JG1A 2ORYA 5AKXA 2C9ZA 4B87A 4OBBA 4ARZA 4RF4A 1E69A 1U9CA 3PYLA 3AVWA 2VJAA 2QTVA 2AUMA 4LK2A 3S7ZA 2JFNA 3IT0A 4MS3B 4EJSC 2L2QA 4M1TA 3ENNA 4ES6A 3FYUA 2FZ5A 2I6TA 4FLMA 1LTHR 5IDQA 4MDEA 1Z0AA 2FUG1 1DG1G 1GA6A 4U2EA 5ULLA 4JU9A 5GPBA 4MGEA 1Y7IA 3VV2A 1G17A 4GG1A 5HEKA 2ZPUA 5E6SB 4G85A 3HJGA 3AINA 4YCDA 3T35A 2Q5LA 2REOA 2A33A 3QYJA 3E6AA 4Q4JA 4XM2A 5HW0A 3ED1A 2CDBA 4WZBA 4I8IA 4D8UA 5KIAA 5JTTA 1JILA 3HHEA 3MELA 4UBIA 3V1LA 1PFUA 5FI5A 5KYNA 2G5TA 3ST7A 3HCRA 4NENA 3OZFA 1UBUS 2B1IA 1O9BA 1PR9A 2WE8A 3OIYA 3QYAA 1KK3A 3SHVA 4W5QA 1YVUA 3VJRA 1I10A 4EYEA 3Q3EA 3AFIA 5B7PA 3FE2A 5GQSA 1ZNYA 1VDMA 2NO7A 2V0GA 2GJAA 4KAFA 4YAJA 1SCNE 4UHJA 2RHTA 2LGJA 3BB1A 4ZYZA 4RULA 2FOIA 2Q07A 3GJTA 3HZHA 1FS5A 1PGNA 2MMCA 3AVTA 4XWGA 5A3JA 5CNIA 4UASA 1FFCA 2UAGA 2ZM6B 3WGYA 3ZPXA 1XTPA 4RDIA 3F3MA 2X6QA 2R6GA 3D6VA 3FAZA 1HYHA 2QENA 4UXIA 2C7VA 1C2TA 1NLUA 4A2CA 2QTFA 4RLQA 2QU8A 1JU3A 1V47A 2JFBA 1JE0A 2LWIA 2ZJZA 3D6NB 3KP1A 1PSZA 3LLCA 3OC0A 2BEJA 4RW0A 4YAEA 4UHDA 2AWOA 2VP6A 3H9QA 3IDZA 4YY3B 2R1ZA 3UCXA 5JVDA 1CDDA 3D8SA 2QMZA 2QRPA 1O95A 4YK7A 4CEJA 5ALZA 5EWLA 4BKRA 4F2HA 1Q1ZA 4KDRA 2LVBA 1DSSG 2A9PA 1WB4A 4U39A 1V3QE 3G6KA 3OMWA 4HBGA 1QU2A 5ALOA 3QX8A 4WBNF 2X4LA 3CLTC 1SG0A 1LSJA 4ZQEA 4DR7B 1OAOC 1YULA 1B73A 3QG1A 1YJCA 2P9CA 2W2OA 5CA0F 1AB5A 5KYVA 4GX5A 4R6WA 1LZKA 2QM7A 4PSCA 4R81A 1F7VA 4Y9SA 4B40A 4F9GA 5JS8A 4FWIB 1DRVA 2J3HA 4CG1A 2AG0A 1TCVA 2VWQA 2CVPA 5KTYA 1FLNA 3JQ7A 5CCDA 3UBTA 4JB0A 2C1EA 5E38A 3DEHA 3NTLA 3I61A 4O8ZA 3DGFC 2EATA 1MJGA 4GT1A 1KIMA 2VRNA 3WLIA 3HBNA 3KOUA 3DCJA 4GM1A 1E9RA 4NCJA 2PWPA 2IP1A 1HMYA 5FL3A 2X14A 2PA3A 4YP7A 4MHOA 1ISSA 4TOIA 4XTCS 3KTDA 3UXEA 3MRVA 3DD1A 1JHPA 2PWZA 1F3LA 4BRSA 3O31A 1KZGB 3GBPA 1JT2A 4XD7A 5H5JA 3GGJA 1OREA 2OXFA 2JJQA 4QPNA 1W2WB 1QIGA 2PL3A 1QE0A 2ZVPX 3I6BA 2BZGA 3NTRA 1KL7A 4NP6A 3SN6A 4YYEA 3DBRB 1PZNA 1B1CA 3ENQA 2QA5A 3QOWA 2IY7A 4G1EB 4BBJA 3EBOA 3H6GA 3NUGA 4N5HX 4MLPA 4Y2QA 5KOJA 4PC2A 1BVUA 1U5CA 5DTEA 4JV5B 4FFSA 2O2SA 2SKCA 3NP9A 4QOHA 3I6YA 3SM9A 1JFFA 3FTNA 3ECCA 4I5FA 5IN4A 1A88A 2V4MA 4QGAA 1NJFA 3O4IA 3V4FA 4FK8A 4Q18A 4BQNA 2BEVB 1U0FA 2JA2A 2F48A 3A04A 1EJ2A 3L0PA 2AFHB 1ZFNA 3H0EA 3OWHA 3PHGA 5DGTA 2RE8A 2GHTA 3MVEA 1E3IA 4HAXA 4EUNA 2VT7A 2BTOA 4PZ9A 3A25A 4S05A 1K3FA 4NJEA 2DKOA 3N2GA 4FPXA 3IEKA 1ECJA 1GTVA 3RUCA 1OX4B 1VBFA 4BCCA 4WOJA 2WPDD 2Q5OA 4IJMA 2JZNA 1C81A 4Q24A 3UK7A 3SVLA 2JIBA 2HJRA 1DUIA 2QLLA 3EFOB 1P45A 3L7DA 4S1OA 3NBZC 4YRMA 5K0GA 1VM6A 1E3SA 3TW6A 3ZXUB 2CVZA 4WLEA 1GGKA 1Y1TA 1F5SA 2WTXA 3B13B 4DUZB 4G9EA 2CLEB 2XMBA 5G1NA 3EDYA 2VBGA 4YT4A 1YE5A 5LPNA 5JXJA 2F3QA 2FFHA 3Q8MA 2UZ1B 3A4YA 3GG2A 2BFMA 2CK3D 4B46A 2YWJA 3KQYA 3MQFA 1K7YA 2YX1A 4AJEA 4E03A 3RSLA 1RAAA 1KFKB 5JRJA 4QBKA 4XCXA 3ZXIA 2Z4RA 4FKMA 3PNPA 1OLUA 4R0NA 3T3PB 4RPGA 4E5VA 4GO1A 5EKSA 4PAQA 2BVNA 4I50B 5K0ZA 3A1EA 3PC8C 5BRJA 3O8QA 2ZJ5A 2CHGA 2NYUA 4Q02A 1L8LA 3GB9A 4FD3A 5IZ4A 1RRFA 1TO6A 1X8LA 3UT5B 2EYUA 3JD2A 3GX1A 5F9MA 4JH0A 4AJLA 4QBIA 2PZFA 3CUVA 4DNFA 3HNRA 3WGNA 2H1IA 2CHVA 1IZYA 2P9YA 3NORA 3F3YA 3OLZA 3QX7A 4M0CA 4MZXA 3TD2A 3BZWA 3DLHA 2FZ4A 1WHTB 3CH4B 3FZEA 4RSHA 1TLLA 2R6R1 3ND6A 3QLVA 3I2HA 4BZXA 3W5JA 3DKKA 5HFAA 3KS9A 2OWEA 3QF4A 3G2MA 1TMOA 3G1UA 3REFA 1U0LA 1Q1NA 1MN6A 1WZIA 2XDYA 3QPUA 2FETA 1FS4A 4RF3A 1M2KA 4X6UA 3RV3A 1XWWA 3ERCA 1N5RA 4L3VA 4OXIA 1YTLA 1RI3A 1E9AA 2Y92A 3CRVA 3GL9A 3NM4A 2O4UX 2ZJOA 3LW7A 3Q87B 4L4ZA 5L9AA 1XROA 4KQHA 1ZJYA 4ALMA 2ONKA 4Q4CA 4YDSA 3S28A 3VJMA 1BWPA 5U4XA 1SVSA 2E5LB 2PGLA 1N4DA 1ONNA 3DO8A 2UXDB 5DX8A 3P2YA 1F8FA 1FVXA 3Q5EA 4HAWA 1Q3TA 3D6TB 3UKDA 4AF6A 3STVA 3U3RA 2NUTB 2OB2A 1UP6A 2UYYA 1AA9A 4EJ6A 4G8BA 4TSKA 5DBEX 3WRVA 4CLRA 2L82A 4F93B 1Y9DA 1NT2A 1RQGA 2BD0A 2IF0A 2DFDA 5IH3A 2Z8XA 1RWVA 3V1TC 3GLGE 2YVKA 1NG9A 2IHNA 3GXBA 4HK4A 5GOTA 5EZ6B 3FDIA 3L6CA 1K92A 3RS0A 5J4KA 2XB2A 2C3UA 3SZUA 3EA5A 5A0FA 1SPXA 2Q0HA 2JANA 2VHUA 5TSDA 2I3DA 4UXJA 4ON9A 2BFWA 5CDUA 5JW6A 2OORA 3ICEA 2QD2A 3DHVA 3MT7A 4CF5A 4JJ8A 4QUIA 2XV1A 4ZJPA 3W8FA 1PL6A 4X1KA 5KPDA 5EWMB 4HDQB 3MJCA 3RFVA 5FWDA 4DHWA 3Q9SA 3A37A 4URZR 1D04A 4ER6A 1E79D 1PR6A 1NW6A 2FTKE 5JTUA 3BTOA 5FQNA 2XUKA 4DRXB 3TDKA 3IKTA 4X3PA 4C07A 2CVOA 1OVGA 4GBGA 3PGMA 4UQLA 3X1KA 1S3IA 1NUHA 3CXUA 1H6CA 3ORHA 1B4DA 5DHQA 2GYYA 5AXDA 4QQ8A 2GCPA 4MVCA 1K75A 4AZ0B 5IWCA 1T8UA 2IW3A 1T43A 1FY2A 3P26A 1RM5A 1Q7TA 2FN7A 4UM9D 1B6GA 1L7VC 3KYBA 3I42A 1QO0D 3QE4A 4H9GA 4G0YA 3URKA 2KW5A 3FZYA 3WOVA 4H08A 4YH1A 5G1PA 4WD3A 3RVJA 1P1HA 2HPAA 4F5WA 3EEOA 4AUEA 1PWZA 1GOTA 3THWB 4JI7B 1O7JA 4P58A 4ZV7A 4FN5A 1C1XA 2P3LA 1P5FA 1A3CA 5AJWA 2WP0A 4KAAA 4TKLA 1HMPA 1XZJA 1ORWA 1N6OA 3T7AA 3WICA 2V97A 2ZSFA 2BR4A 1NPDA 2F1IA 1NN3A 2ISQA 4D79A 4ZYTA 3SZLA 4D4JA 1U99A 2CXUA 3E9QA 1P81A 1M6WA 4Q1CA 4MPJA 3VNSA 3QKUA 4QYSA 4BUZA 3HKEB 4EKIA 3Q72A 3D1JA 1LBQA 2D1YA 1G3QA 4YP9A 3I0MA 2HA0A 3I9LA 5C4GB 2XCQA 5B6JA 4LQDA 1UQTA 3HYLA 4UUNA 3ZNNA 2E1RA 4EY4A 4TTVA 2GJKA 3V4PB 4EMBA 5KYWB 1UPXA 2QTCA 2HHHB 1CRWG 2H00A 4YRSA 1OGYA 3V9AA 3UMYA 4Q7MB 3ABOB 5SY6A 3G23A 4E07A 4UFPA 5BYBA 1QOPB 1DBIA 4QVIA 5JYCA 2BDUA 1GGFA 1Z45A 3BYZA 3KOOA 4U2GA 1QIIA 2AK3A 3EXG1 3GR6A 4GHWA 4X7BA 1RI1A 1QDLB 3ISTA 4B84A 2JLUA 4OHUA 2QW8A 2XIQA 3P4YA 1EB9A 4J07A 2CUZA 3I5YA 1PV4A 1OC2A 2RG7A 4ZEVA 5FI0B 4HRAA 2KPOA 1CHDA 8ATCA 1TYCA 2IVZA 3BK1A 1RHQA 2GESA 3KSRA 1KWGA 4CBVA 1JJBA 1RYEA 2F59A 1HEIA 3DEKA 3L0CA 3QU5A 2PWBA 1ENZA 9LDBA 1IG0A 1GM5A 3H86A 1P1BA 1X86B 3L79A 1L5FA 2CNWA 2VRCD 3S55A 5HWSA 1LZLA 2H7CA 1L6IA 1ZC3A 4HDNB 2N42A 4BO1A 3HBMA 3ETJA 1WBDA 2NT3A 3IHLA 4J4TA 1HEYA 4HNRA 1H2BA 2XT9A 1T6ZA 2HJHA 3IBSA 3L0OA 3KQUA 2FUKA 4WZ6A 1EBBA 2RHCA 3R44A 1AKNA 1UOQA 3V46A 2OC4A 4DUGD 2AJLI 3ESYA 1NLZA 5CDTA 1P2DA 3MWFA 4UU8A 4L6CA 2PZLA 5A9TA 3TLJA 4DQKA 1SUEA 1P1IA 5TE9A 2HMWA 2IX3A 2B1RA 1S0UA 1OX6A 3ICOA 4LE1A 3B1FA 1EFCA 3IL2A 3T1QA 1IEVA 1JI0A 2ZTVA 2FHSA 4E30A 3CMMA 4PXYA 1RU3A 4TTSA 5ALSA 3UVEA 5C53B 1UZUA 1VI5A 3D3QA 1FYFA 2Q6KA 4HLCA 1E5XA 3G8YA 3ZVRA 1OVMA 2WWIA 5IBQA 5GJWC 5SYAA 2DETA 2VJCA 1UPAA 3GGPA 3TW0A 2DHQA 3AY6A 2MINB 3RWMB 4X65B 2ESRA 1H94A 3ANMA 1Z2DA 1HC7A 4ZCIA 5M04A 1X1RA 1X1EA 2Y77A 4ZU1X 3B1YA 2GWHA 1GZ3A 3D8BA 3CMCO 1BYUA 4LMBA 1LNZA 3F71A 4A0RA 3KUCA 2KWIA 2P3SA 5CM9C 4JBNA 1FP6A 2QRZA 5BQOA 2XXAA 2A4KA 2FMHA 1JJFA 2WU3A 5DTQA 3ZDZB 4DIKA 4XOUA 4GRIA 4LDPA 3VVMA 1NF9A 3C8UA 3AFMA 3DB1A 4UU7A 3VM6A 2Q2WA 1Y8CA 2AG6A 4TZ0A 5FADA 2YVQA 4H1UA 4BWFB 3D4NA 1YZQA 3CSSA 3G49A 4ITUA 3QP9A 1J90A 1YB6A 2IYTA 2WZQA 1WPGA 2ZGVA 3E7DA 4KW7A 4X1IA 2F8LA 1JHRA 2WJWA 4CIDA 5DHPA 5CJPA 1OFVA 4CKEB 4DGQA 4IHJA 4KNWA 3U17A 1KMHA 1VC2A 4ZEOA 2O8CA 4QJ4A 1XHLA 4GGPA 2WUVA 4H17A 4R8SA 1KI7A 5BW6B 2MSLA 3FNFA 2JGAA 2C2KA 5JD4A 2XYGA 3FTDA 3DLPX 5AM3A 4IYRA 2LR0A 4JVSB 4D2IA 3CRW1 1EHIA 1I4DD 3BMOA 1ODCA 3QWBA 4U4AA 5DMHA 5C1IA 4AW9A 1NURA 3Q40A 4LE2A 5P21A 3G3EA 3RW9A 3VR4D 4CM6A 5BMVB 1K27A 3FI0A 1L5OA 1USGA 3QHAA 1Y4ZA 2RH9B 3QNWA 3H9CA 4W6QA 1HI9A 4UMVA 5BPHA 3GFRA 3EG9B 3HU3A 2CV1A 5JQGF 1JV2B 3WRYA 2WABA 2CN1A 3AESA 5ICEA 4CL8A 3CVVA 3D0KA 4DJFC 5IXYA 3U7GA 1ZRMA 2P6PA 4HB3A 1CJCA 5EXSA 5JHGB 2B78A 2Z83A 4MLCA 3RKSA 3GUVA 1OFUX 1CEEA 4PLYA 2R2GA 4DQDA 2IY8A 2JF0A 2C9OA 2AVNA 4WACA 1LB1B 4E12A 3CRRA 2YN2A 5FOUA 2WWVD 3EDMA 5IAAA 4ARIA 3N8KA 1YE8A 2QORA 1WF3A 1Z0IA 2ONJA 2IYOA 3IKVA 3HCBA 4G0MA 3R23A 4LVCA 3T12A 4HQNA 3WMRA 1YBAA 2QX6A 3DW3X 2NVOA 3L4JA 3PQDA 4FC7A 1G4HA 5DM0A 3EWNA 3W1WA 1KY2A 4Y2HA 3SIWA 1KBQA 3BXEA 3QXJA 3FPAA 3ZH2A 4MPPA 4YROA 5BXYA 1Q92A 3K6SB 4XWYA 5DHFA 2JARA 4Z1OA 4XTRA 1OZ0A 2GCIA 3M3HA 1P4JA 3GHHA 4RE6A 4DJTA 5FF9A 5FYQA 3C5HA 1NN0A 1Y3HA 4ZZ3A 1DX6A 1N5IA 1NJ8A 1U8AA 2RSLA 1NI4A 2WYUA 3LG2A 3V8VA 1OGIA 1GEGA 4AZVA 4EGQA 3IC5A 3L8CA 4L4RA 3INRA 4NQRA 4TLAA 1SKQA 3GUYA 1QIHA 3H8WA 1E5QA 3F90A 1Y8RA 4JJKA 1PEAA 3H87A 3EEBA 2W8ZA 4KITB 5EHQA 1G5FA 3LWNA 3I6MA 4MRMB 3P7MA 3RIGA 4WY8A 4F56A 2QPAA 2ZUSA 1X80B 1FTYA 2QMQA 3FAKA 4FCWA 3OJLA 4TYMA 4UAGA 3GYGA 2Q4OA 4UM5A 3P1JA 3TTTA 2I1WA 1IQPA 5J1TB 2Q1SA 2ZLBA 3GJRA 2PX2A 2IHYA 1O95D 5DULA 4M83A 1IL0A 3GF4A 3ZLTA 3NGLA <