3ZHOA

X-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVOPROTEIN WRBA
publication title 1.2 A Resolution Crystal Structure of Escherichia Coli Wrba Holoprotein
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zhoA00
4QOHA 6NULA 1FX1A 2ZKIA 5LBTA 4ZVKA 1XYYA 1YCHA 2OHHA 1H66A 3OWHA 3R6WA 1RLJA 5LBUA 5FX2A 2QX8A 3FJOA 1QR2A 2R97A 2GSWA 3B6JA 1CZRA 4YAOA 3FNIA 5F4BA 3O2NA 4N82A 1QBGA 3KAPA 2HPVA 1H69A 3TEMA 2HNBA 1DXOA 1SQSA 5NLLA 4GQIA 4Y9UA 3KAQA 4M0CA 2X2OA 4CETA 3GFSA 2Q62A 2M6SA 4HEQA 5NULA 2BF4A 2V5UA 4QOFA 1DX9A 1C7FA 4C0XA 1AKUA 2XOEA 3GAMA 5B3KA 5LJLA 3NHUA 3NHYA 1AHNA 3OWXA 2OHJA 4S24A 2M6RA 1SG0A 5LVAA 3B6KA 5BUCA 1ZX1A 1T5BA 2R96A 1AMOA 3NHSA 4NULA 3HA2A 3LCMA 4FGLA 3G5MA 4GI5A 3OX3A 2Q9UA 5F12A 4ZVLA 1QRDA 1CZOA 3NHFA 5B3LA 2Z9BA 1KBOA 4ZVMA 1KBQA 4LAFA 1RCFA 2RG1A 4DIKA 1TLLA 5F51A 1ZWKA 3ESXA 2QX9A 2A5LA 3NHWA 1FLVA 3W79A 1QHEA 3NFRA 4PU0A 3EYWA 3K20A 1YCGA 3ESYA 4DILA 5TGZA 5EA2A 3O73A 1CZLA 1OFVA 1ZWLA 5FA6A 4Y7CA 1NNI1 4U7GA 1J9ZA 3W7AA 4FX2A 2FOXA 3D7NA 2BPOA 4PTZA 4YAWA 3ZHOA 4QOGA 1XYVA 5FUQA 2X2PA 1YCFA 1J8QA 4LA4A 1FUEA 3FW1A 3OX2A 3NHPA 2V9CA 1FLAA 3QE2A 3KEGA 4H2DA 4R81A 1XI2A 4XDGA 2FZVA 2QMZA 1BU5A 3OJXA 2BZSA 3K1YA 1RTTA 1CZNA 1YOBA 4XDHA 3GFRA 2N1MA 4FGJA 3S2YA 1B1CA 3N39C 2ARKA 5A4KA 1T0IA 2FX2A 5LLDA 2D5IA 1YRHA 3OJWA 4PTYA 4H6PA 3U7RA 3RPEA 3W77A 1J9GA 3LT5A 4ZVNA 4YQEA 3N3AC 2B3DA 3NHLA 1XT6A 1AG9A 3HLYA 2QWXA 4LTMA 1AKWA 3HR4A 1YDGA 1AZLA 1WSBA 3F90A 4QOEA 4N9QA 4C76A 3UXHA 1BVYF 3L9WA 1CZHA 4YAUA 1DXQA 1E5DA 2AMJA 5JROA 4YAFA 5ULLA 3NHKA 1CZKA 4GR9A 3UXEA 4J8PA 1TIKA 3TE7A 1YKGA 1OBOA 2FZ5A 3OVMA 4C14A 3B6MA 2FDXA 3QFRA 3FX2A 1OBVA 1AKVA 3QFCA 4YALA 3U7IA 2V5VA 4ESEA 3KLBA 5LMCA 1D4AA 2QR2A 3L9XA 3P0RA 2MTBA 2Z98A 1CZUA 1AKTA 1AKRA 2KQUA 2FLVA 4U7FA 1D03A 1JA1A 2W5UA 1FVXA 2OYSA 4ICIA 2FVXA 4FGKA 1FLNA 3GFQA 2WC1A 4LTDA 2FAXA 3F2VA 2MWMA 2BN4A 3N3BC 4C0WA 2OHIA 3B6IA 3F6RA 4QOJA 2BMVA 1FTGA 1VMEA 4OXXA 2MOKA 2HNAA 1WSWA 1JA0A 2KLBA 2F1OA 3NHJA 1V4BA 3JSXA 5EMNA 5LJIA 2Z9CA 4QODA 3FVWA 2QX6A 3ES9A 4N65A 4LTNA 3F6SA 1FLDA 4U7HA 1I1OA 2MT9A 1D04A 3SVLA 3NHRA 1AKQA 4F8YA 2Z9DA 4CF6A 3W78A 4NLLA 4Y9RA 4HS4A 4BMOB 3EDOA 2QX4A 3TZBA 5EAIA 2FCRA 2XODA 1X77A 3NLLA 1RLIA 3OX1A 2QMYA 3ESZA 4D02A 1GG5A 4BMPB 4DY4A 4QOIA 1F4PA 1C7EA 1J9EA
chains in the Genus database with same CATH superfamily
2H59A 4QKQA 1DIGA 1UMBB 1GQ2A 2ZTUA 4MS3B 3EMKA 2VPQA 3N2ZB 3EVZA 1D2RA 1VZ3A 2LCFA 2EFJA 1L4MA 1ZY2A 2Q1YA 3M49A 4H7FA 3IUSA 1LDYA 4R98A 4AJOA 2QQ0A 2UUBB 2RC6A 3O95A 4K9KA 4Q18A 2JD1A 4K9QA 1JEQB 1YCHA 3IHWA 1TLFA 5AUNB 3R5KA 2GTIA 2IT1A 1DEHA 2BL4A 4Z8YA 1XEFA 3VO1A 2W0SA 5TMPA 3PHJA 1UUFA 2WFLA 3IAHA 3KEMA 2BKXA 4QNMA 1QG0A 3S1LA 2GHIA 4D57A 3KQNA 3P9ZA 1UPTA 5T3UA 1Z4PX 2YWHA 4R1PA 2BR5A 2H7XA 1PYDA 2JBAA 1TKAA 4X3PA 2FWMX 1Q1NA 2QG6A 2WA2A 5KJEA 3L6CA 4JSRA 3UJ3X 4FFPA 1E18A 4JLWA 3TLMA 3JQCA 3N58A 4JYPA 1WQ1R 2GSWA 1GV1A 1F4LA 4N7BA 3UMFA 5C35A 1U0JA 1XNQB 5TIIA 1KMCA 1D2GA 1EX1A 4WCFA 3AIIA 1G3QA 5AK0A 3E7WA 3CYFA 4IHAA 4RH3A 1QZ3A 5HOQA 3DLHA 1T5DX 4WNAA 2PAAA 1NC3A 3PQ3A 3DKRA 4Y6SA 4P33A 1KI8A 3ICPA 1QC5B 2JLZA 2R60A 4G0QA 3V1NA 4BLPA 4QL3A 1MU0A 2O2IA 1PGQA 3Q10A 4OI4A 4XM1A 2P79A 3THWB 2YASA 3DUWA 4XQGA 4PSKA 5LIRA 2I2WA 3GHYA 4XGIA 5CIWA 4ZU6X 3BXPA 3RJZA 3Q9LA 1YE8A 1OXVA 4J0EA 2WP0A 2FW6A 5FNVA 5JARA 2ZCJA 1EFDN 3K70B 2X5XA 1HF3A 3CIOA 3HYCA 3TM4A 4R1LA 1IB6A 4MR9A 2YYYA 2A0KA 3GHHA 5DW3A 3B70A 3H0KA 1Y8CA 4KRXA 4EGCB 3BRWD 3ND8A 1PWYE 4E13A 1PKEA 1P2SA 1KXJA 5HQ3B 4KZKA 3P20A 4A2QA 1OX5A 3GRCA 3CF0A 2OCGA 1S5PA 1T5SA 2F4NA 2P6UA 3FFWA 1E0KA 1OZ0A 1I7LA 3GV0A 5HDBB 3T5MA 3QX3A 1Q0HA 2HL6A 3H3XA 3M4JA 1H2XA 4RSMA 2O3JA 4RVDA 3T8YA 4GNRA 2I7XA 1TQ8A 4JZKA 3Q9UA 4KSCA 1M2EA 2HO5A 1JYSA 4D9KA 1G6Q1 1L7MA 4FZVA 4RTMA 2K5UA 2IITA 3FCAA 2COKA 1YVEI 1AA9A 3R20A 2H3EA 2D1QA 1E66A 1MDFA 2F1KA 3RC2A 2VTBA 3ASVA 3B3QA 1DBVO 2Q7OE 3O93A 4LISA 2VH2A 4UXJA 3LX4A 3RT9A 3BXOA 2C42A 4A9AA 2HWYA 1AB5A 4OMCA 5T4EA 5IRCD 2D2VA 2QM3A 3SQMA 4COKA 1KDPA 3OU7A 1T9GR 1A50B 4B3XA 5AKHA 3DDWA 2FMTA 4KUGA 3H2BA 2AS0A 3VU9A 1PDOA 3AEKA 3EVFA 2PJUA 2VWHA 2C4HA 3CUVA 1XF1A 2BMJA 3THYA 1XZDA 1XZQA 3GT4A 3GLSA 4ZO7A 4CF3A 5E9JA 1IMOA 1NP7A 2W2TA 4Y30A 4KPGA 4RTSA 3Q6IA 1AE1A 3KYCB 1M8FA 1DL5A 1GCAA 1TI7A 5KU1A 5HSGA 4UU1A 4FYWA 4P83A 3AVTA 1IHUA 1RZRA 1B43A 4MV5A 1E61A 2Q6LA 1MTOA 1WXWA 3E53A 4HDOB 1D4FA 3QMWA 1A97A 1LX7A 1K7SN 5E4TA 4KXNA 1HQYE 3PQ5A 5TF4A 2A14A 4ZHSA 4ZJZA 3TZKA 1Y98A 3LPAA 4INOA 3PX2A 2EX0A 3GQBB 3ISTA 3PE6A 5BR7A 2XF2A 1RZRD 2JLRA 3NP7A 4ITUA 3EXEB 4B7AA 1UPAA 2EW2A 3HLKA 3RFXA 1OXMA 4DMLA 1Q11A 1ZO8A 1K2VN 1MCZA 2VKQA 2WTUA 1K7CA 1XCJA 3ZXIA 1V8ZA 1Z4JA 2QTBA 1BXRB 2AQIA 1XTBA 4Q4JA 2XD9A 3DZGA 5B3LA 4IVRA 5IFKA 1DEKA 1I8TA 2XI4A 3M89A 4K26A 4QUIA 4ZT2A 1E2KA 3I2IA 1KBQA 4JS0A 3C2QA 3KKEA 3ZK7A 5FOSA 2J1LA 1E8DA 1F9EA 3AONB 3NDBB 2ZTLA 1LC0A 3IQGX 1Q7GA 4Q1AA 2AW5A 1E3MA 1XZAA 1U3CA 4UVEA 3WE7A 5CXXA 3EFHA 2ZUEA 3F5FA 5CIQA 5I9LA 1KP2A 1GRCA 2V59A 1RPZA 1TCBA 4MTCA 3I83A 4NNPA 3WDMA 2GPYA 5TMEA 3SHWA 2Q5OA 1FLVA 3K2IA 4DA7A 3H97A 1X7ZB 4LPSA 3R23A 3DAPA 4TKZA 2CBZA 2CN1A 4IOMA 4DLLA 4LGCA 1H5QA 2QZZA 5JDCA 4MEJA 1JSRA 4XPZA 1AK9A 3ESYA 2W2OA 1JT9A 5FULA 1OPXA 3M6FA 5C7IO 3B82A 3P0FA 2QTHA 1HTTA 3K2QA 1IQRA 1R0CA 3TQCA 1T6YA 2C9OA 2HJWA 3W5IA 4MYTA 2ZSAA 3NEPX 4BX3A 4HNUA 3VMFA 3UW1A 2QPTA 1SHLA 4FR5A 5BQ5A 2W4IA 2BCEA 1ND6A 1UODA 1Z29A 2G5CA 3ZIAD 2ZVDA 3G13A 4LYDA 1LZLA 2KB0A 4Y7CA 4Z9XA 4DKJA 3W7AA 3LQFA 1FJ2A 4N3NA 4NU8X 4AYTA 1EFKA 1L4HA 1R2QA 3WIDA 3X2SA 4C2BA 2XQFA 1VXOA 1G0NA 2WTXA 3A10A 3BHJA 3LHIA 3P9CA 4UUNA 4BN0A 4R69A 1P4JA 3KB2A 3DC7A 3OCXA 4F2GA 4OHFA 2EJVA 3TQTA 1P44A 1OUMA 4D9IA 3I05A 4DDUA 2GDZA 5ICMA 5LSAA 4BNUA 2NGRA 5EWMA 5LR6A 4X9XA 3KVNA 4IQFA 4B73A 1EGAA 5HIMA 4JYZA 3WLPA 4BMZA 3U44B 1NBIA 4G0MA 3UB4A 5JC1A 4RPCA 1PZXA 1BKDR 3NWBA 4W5NA 4BP8A 1OLUA 1TCAA 3U60B 1KYXA 1CQPA 5EMLA 1I4LD 5DASA 4RFVA 1BXGB 3AOEA 1GKKA 2LE0A 3E70C 2A4KA 2NU6A 4G1BA 4GDMA 2EJUA 1W73A 3IBCA 2P3OA 3UA4A 2WWVD 4ZREA 4BYMA 2OB1A 1YZNA 1SJ9A 1I2ZA 3L8GA 3LHKA 1FRZA 3PPYA 2ZDQA 3R1IA 4ALKA 1H2HA 3U4QA 2BBTA 2GHTA 2ZBFA 1UKZA 4R81A 1LBSA 1XI2A 3JVDA 1XXHB 4G1MB 5AJXA 3VSAA 1NVEA 4KWIA 3WWYA 2JVIA 5MFPA 1BDMA 2EBHX 2FYTA 3EIHA 3H9GA 3GLHA 1LW6E 4GOKA 4KODA 4O5AA 4YRJA 3A6JA 5IZCA 5SV2A 2WAXA 1RQGA 1Q1QA 1S96A 1CEQA 1W52X 2R5WA 3AFIA 3HJGA 1XJQA 3DGFC 3O8DA 4WI1A 5TF0A 3V7NA 3C3PA 3PNKA 4FGWA 4IJ6A 1CUWA 1MQSA 4PTLA 3G2IA 2BEUB 1ZN9A 3H5OA 1ABFA 4G8CA 3ILSA 1AGPA 2YVUA 2ZIVB 3QITA 2XR1A 3AVUA 4IH9A 2OGUA 1B1CA 3N39C 5EYPA 3TOZA 4AROA 3FTNA 3FOCA 4QBFA 1D2HA 3I6YA 3II6X 4WV3A 1BJKA 2I4OA 1ZN2A 2QTRA 3HYNA 3IP6A 1G7RA 1MAWA 2B9VA 3B1FA 2QNBA 3M6LA 4MA4A 2ID4A 2XWQA 3NJ4A 1P2BA 5A0TA 2OV3A 3X1XA 2QL9A 3QGMA 3TIVA 5T3YA 3GLKA 4UHCA 2BMWA 3ZUGA 4NICA 3EZGA 1L5WA 4KBYA 1U2PA 3P32A 4ZVUA 2F43A 4RE6A 3D9QX 4WBSA 1OZAA 2B2CA 3HCFA 1UBLS 5BORA 3LT5A 3U6BA 2UZ0A 2LTAA 1NYQA 3BE6A 1AHPA 4OQDA 1V7CA 4UBLA 3T95A 2XKAA 2PKRA 1EUQA 4RZIA 1UXGA 4ZCTA 2XWSA 1CQIA 3DTYA 3ESBA 1OHHD 1DMSA 4LRUA 1Y3CE 3G0IA 3OBBA 4KYTA 1KOLA 4LY0A 3CF4G 5CT8A 4AKHA 2FE4A 4Q1FA 4HX9A 5HNKA 1MOQA 3HB4X 2XCLA 2Q4DA 1WU8A 2VZEA 3WWOA 2P78A 4AZ0B 3O94A 1W5EA 4ZU3A 1R8XA 1BFDA 2QWXA 1EHIA 1FS5A 4UW9A 4B40A 4GEKA 2R2AA 1RQXA 4ALMA 4HBGA 2XMBA 4PLCA 4R1QA 4EAQA 3A6LA 3A11A 5LB4A 1G8KA 2GF9A 4EKEA 1PNQA 3D0OA 5LA6A 3FNRA 1CVIA 3R2JA 1MHTA 1J0EA 4KYUA 1TVEA 4M1WA 4JUDX 1T4GA 1FB5A 2CB0A 3MOGA 1FYXA 4EO9A 1E4VA 3N6RA 5GADl 2J3LA 1DIAA 3NTXA 3ZK9A 2BJVA 3CLSD 5ULLA 3E9QA 4L27A 1ZYUA 2QY9A 4P4SB 1QHHB 1Q1EA 4L6CA 2HSWA 2RAFA 3L0PA 5FPHA 5GMOA 2G25A 5KIAA 1CRWG 2AFHB 2JI9A 3N53A 3MD0A 4KE8A 4UE2A 1R7RA 1ZJWA 4JI5B 4D79A 5C37A 3AL2A 3VR4A 3C87A 3EMDA 5FNVF 2HX1A 4KVFA 1HI9A 3U1TA 3UPDA 2GF0A 4FHEA 4U9IS 1QDLB 1PCXA 2CUNA 3DVQX 4MITA 2EHDA 2CLEB 3KSUA 4OF4A 3U3ZA 4C14A 4DARA 2ZVQX 3K0FA 4GH5A 1YZGA 2VOJA 2O6HA 3NWPA 3GAFA 5AKLA 2CFCA 3VR4D 1W85B 1UF9A 3QE3A 2FUEA 2W6JA 4L15A 4DTIA 3HG7A 2QW8A 4MUKA 3DD5A 2PANA 4B43A 1E5TA 2V5VA 4NOLA 2Z6QA 2O2SA 3ANSA 1ADFA 1IPHA 4HAIA 3P7MA 3MMNA 3QEKA 4QUDA 1BC5A 2QF7A 4Z7JA 3CNEA 4ZMRA 1G5RA 1SVKA 5KYYB 1L4EA 4BVLA 5ABPA 2HU2A 3EGDA 1GTL1 2X5KO 3WZLA 2O3QA 3CH4B 4UQPA 1AKRA 1I9CA 3RSGA 5K45A 3IAM6 1JA1A 1PNTA 4FMCB 5HR5A 2V7VA 4R84A 4YXFA 2F4VB 2IJGX 5E6SA 2YJGA 2FVXA 4L4XA 2OSVA 1ARZA 2WC1A 3ZYZA 4L16A 4XM2A 5HJ7A 2MWMA 3L04A 2X5JO 2NADA 1GEGA 3KL2A 4ZYVA 5PNTA 10MHA 2X9GA 2RB4A 3BSFA 4I1OA 5M2QA 3JQFA 3HB5X 1UWVA 3C8HA 5G1PA 4LF8B 4I55A 5TQ0B 1US8A 3J7TA 1OLXA 1Y34E 3F6RA 1J2RA 3K9QO 5BQXA 4RTOA 5JSZA 4GMHA 4X94A 1WXIA 3T35A 1K86A 3OQIA 2GBGA 3NBQA 5JLJA 3E05A 2NVUB 4EL0A 4TKVA 2R4TA 5FPPA 4RVSA 5FI5A 1LI4A 1UMBA 2JCSA 1B00A 4B82A 5DH9A 1ZAYA 1SXHA 3QVLA 5ICEA 3D7RA 5DHRA 3K1TA 1JZSA 3QM1A 3IUMA 2C88A 1QH8B 2YUTA 2I6SA 3A6HA 1PQPA 1ZMRA 1C7QA 3WK8A 4WCDA 4ZVQA 5F2KA 3GC6A 5H4HA 4UHFA 5AW8A 5EUCA 3F78A 3NS7A 4NBUA 2WQ6A 1ULAA 1IPEA 2ETVA 4R6WA 1VL6A 1FQKA 4I4LA 2A1UA 1Q14A 4U7HA 4GLOA 1CS4C 3EF1A 2C82A 1JKIA 1WU7A 2GX6A 1U7HA 2GZMA 3QFSA 4Q3CA 1TJ5A 4B3MB 2VYND 2VN8A 4YWJA 1SXJA 1RRVA 2L42A 4M7OA 1I7DA 3GD5A 2UUAB 2Q28A 2QMOA 1SUDA 2J3MA 1ZGAA 4F9EA 3TW0A 4AYXA 3PUJA 4QBHA 3JZFA 1LTKA 3GRAA 3L8MA 1P7PA 5A4FS 3EY9A 2P2CA 4PPNA 5SY6A 4GBGA 3GJ8A 4LJLA 2W11A 1UKBA 4UAGA 5H70A 3TQFA 1ZU5A 4DSOA 5KTMA 3B1YA 2HT6A 5DTRA 4D4GA 1KPIA 4IGIA 2R1UA 2FCRA 4KRFA 2YFQA 2YN0A 3GJRA 3R8XA 1JJIA 1TW2A 4DA6A 3WFIA 1Y9EA 2QVBA 1ZK4A 1N36B 4OX9Y 5CFZA 4PC2A 1E1NA 3BXXA 2OK8A 1Z0SA 4ODIA 3THWA 3W5AA 4JWTA 3E2MA 3K0CC 3SGLA 3ESZA 2BGWA 4J16A 3PL1A 4J1QA 4JHLA 2C3PA 4DIFA 5DNDA 5F64A 2BF7A 3F2IA 4KIWA 4NJMA 5ERGB 1OH8A 4ARIA 4OB6A 4XVHA 5E7MA 3K16A 1GR1A 1QRUA 2J87A 1QHSA 1OAKA 1ECLA 1T35A 1TD9A 1XTSA 1YOVB 1FPMA 2ZRGA 2Q3DA 3GJ7A 3ENWA 4RQAA 2ZTSA 3D8SA 2CMFA 1PQUA 5FL3A 1XG5A 2HF2A 3IOYA 3JQRA 5FOXA 2IYWA 1GEEA 3ONEA 1XFDA 5K3EA 1S2GA 5HS6A 1CUZA 2BUCA 1XKTA 3HR8A 4KQJA 3O0DA 4OJKA 4QOHA 4ENPA 1L3CA 3DCIA 4JYMA 3E9RA 2C84A 2G72A 2F9LA 3VR4H 2OBYA 1VHQA 2C03A 3CUUA 2OC4A 3L7DA 2CXSA 1N2CB 1GZ6A 3R5JA 4JKOA 4FJ1A 1R0BA 1P5FA 4ZRNA 3LC2O 4FXPA 1B73A 2D59A 5TJ9A 2QJTA 1Z4IA 3QHAA 4JIMA 3DDCA 4LFCB 3ER6A 3W9YA 5EVJA 5GIOE 4FZ3A 2JFFA 2IYXA 1E3DA 4K0RA 1AS3A 1P7ZA 2ZE6A 1TM2A 1C2TA 4M54A 1UPCA 2VAPA 3Q2KA 5AYVA 4P3NA 1B16A 1XMSA 4L57A 5B4TA 4FWTA 4N0PA 2ZYAA 3GXOA 3AIKA 3WLSA 4HDSB 3Q5DA 3RTDA 2OBLA 1T8SA 2Q0XA 3K9WA 4NBKA 5LBUA 3VSBA 4Q1VA 4F1JA 1A88A 3H13A 4DLSA 4DXHA 1Y8RA 2QX8A 3HRKA 1RR6A 4I81A 1N78A 5JH7F 3IJEB 4R1OA 1QGDA 3KDSE 4C3OB 4O3FA 3ZQUA 2CNKA 3WWCA 3MUNA 4LF4B 1E2UA 5B1EA 1TT5B 4ZK2A 1FSZA 4U5QA 3NVMB 3KV1A 4XX0B 3ZVMA 1WLYA 3K6RA 3KUUA 4WY2A 1YDMA 4RACA 1XNRB 5HUHA 3W3AD 1O94C 2VJQA 3NC4A 4AJJA 3ML1A 2CSXA 3VPDA 5F1PA 2FWBA 3LH5A 3AUFA 4H7KA 2VEOA 4NU5A 1CTQA 3E18A 1MFPA 2B82A 3GP3A 3L6RA 5B3JA 2BEWB 5H3LA 6LDHA 2HNBA 1G9SA 2I34A 3ADPA 3B5EA 1YRWA 3C43A 3FYSA 4JN6B 3CKMA 1DKOA 3GU3A 1G5TA 1LV7A 2WJIA 4EHAA 1WXQA 3G5AA 3EG5A 5D5QA 3X1MA 5KU7A 1DOZA 2VT6A 2YYSA 4WW0A 5C1BA 3N74A 4KNYA 4NP6A 3E22A 4GQIA 5FV4A 2WIDA 1ADCA 2C5HA 1DDGA 2EJTA 3LKDA 1S2DA 3KS9A 4M3NA 3GZTB 4D97A 3U3DA 3R76A 5IT5A 4RA9B 3D8RA 1H4SA 1Z18A 1Q1GA 2HZBA 2ERXA 2WW8A 2ATIA 3GRZA 4QQNA 2IE8A 2OQIA 1WJGA 3PFGA 4M8NE 3HLTA 5K2MA 4IHQA 1SOMA 3VHRA 1VKZA 2VAWA 3NBKA 4XJVA 2WF9A 3OEHA 5LQNA 3E9MA 1YJXA 2OILA 1VLLA 4WOKA 4IJQA 1P61B 3L7LA 2FSUA 3TTSA 4M87A 3SY8A 1X7ZA 2Y6VA 2V8BA 3GAMA 2GARA 2D06A 3T5BA 4E22A 1U2QA 3IEKA 3KXPA 4LDZA 1CP3A 3OEHD 3W5DA 2OCKA 2XVAA 1IBRA 1J0DA 3FUCA 3NHYA 2A0YA 3Q85A 3GQVA 1YI1A 3CW8X 3G2LA 4I5FA 4M1MA 3V7UA 4KUHA 3RCBA 3C5VA 1CRLA 2OD7A 5CYGA 5EUBA 1BAPA 1XVVA 3H9JA 4LXUA 4V3BA 2WAYA 2VDKB 5D7BA 3UJ8A 3G5TA 4QD3A 4X66B 1IEXA 2CUKA 5HIJA 3CT4A 4L9AA 4AKGA 2ZRPA 4AJEA 2GS9A 4CEHB 2PVCA 5HE8A 4AN4A 4ARVA 2VDWA 4Q9IA 4GQBA 4ZYUA 4D9HA 1D7AA 2XMPA 4JQYA 3RVSA 2R8EA 3RVBA 1XTZA 1MAVA 4OQYA 4IDPA 1X7WA 3CJRA 1H6AA 5KNLA 3VISA 1T0BA 4JX8A 3OM8A 3NGXA 3O4JA 5LPNA 1VLQA 1QG4A 4W9NC 1WX1A 3NT2A 4ZN6A 2V6GA 1HO3A 3WOHA 5A05A 4RF5A 1R4MB 5IJWA 5J23A 1E69A 1QTRA 3G0GA 4FI3F 4NMMA 4DG8A 3E03A 2GXSA 4TRJA 5KOIA 4OSEA 5EXDA 2QR5A 3OP4A 4LV8B 4QPJC 3QFTA 3WNZA 2CMHA 1OLSB 3H5AA 1DAIA 1TZBA 1UBEA 1HL7A 4HVLA 1UAGA 3DMGA 5E6RA 2Q3EA 1P9WA 5FKJA 5TQ2B 4DREA 4OO3A 2P9CA 2QAGA 3IEIA 5G4KB 1VA5A 3BGDA 4C0JA 3E0QA 1T1JA 1CF9A 3TS1A 1ZVVA 2OUIA 4ND4A 3IPRA 2HRZA 3C97A 3DVAB 3Q7SA 4IOJA 5KSOA 1MB3A 2QJOA 2D1RA 1KEVA 5FI3A 2CWWA 2FG7C 3OG9A 3K4QA 1CHDA 1ID8A 4TLCA 3QLVC 5FLXA 4F72A 4KXMA 4X24A 4E88A 4D8WA 1ZN8A 4GXTA 2JJ1A 2XDAA 2HY7A 2JAHA 3UWPA 3Q3GE 1IXYA 4Y3UA 3O7WA 3AU9A 3D6TB 2NPIA 1Z8HA 2CLOB 5D85A 3TLXA 1HM5A 1Q7EA 4CN8A 5TE9A 1QHGA 3M0EA 4JJ8A 1NN1A 4MHSA 1VECA 3ZCSA 1AVTA 1HH4A 1ZM3A 2XEDA 3AP2A 3HBFA 3K4PA 4N01A 4Q7LA 5GV8A 1YRBA 3WQRA 4YRNA 2C5FA 1M1YB 4BNVA 1UDBA 2QJFA 3ZH2A 1BFKA 2V03A 3QTLA 2WV9A 4FDMA 5E9AA 4OU4A 3FSGA 4HLCA 4GQAA 4ZO4A 2GZDA 4ZHQB 3KETA 3O73A 4ZJUA 5LOVA 3LUJA 2HM7A 3LNCA 4NARA 3PKIA 5I4BA 2GD0A 3SDZA 5K0NA 3SLGA 1B6SA 3LK6A 4GPEA 2C1EA 3LZDA 4W5JA 2WPDD 1K92A 1J6UA 4KQHA 4PV7A 4X95A 4MMZB 3T5TA 3AF4A 3PF9A 1CJSA 4PRLA 1C3VA 3EDCA 4TM7A 3R9IA 2VHYA 2E2WA 1PJ8A 2EERA 2IYZA 4G5OA 3SS7X 2WP8J 3V4VB 5KTKA 1DADA 4U2BA 1KEZA 2FSHA 3I58A 1ZDMA 2FOXA 3FPKA 4EWLA 1X38A 3SDSA 1X15A 2AJDA 1GY8A 3CIFA 1NSYA 4BNZA 3MWJA 1VPEA 2DWUA 4UU8A 1Z39A 2DPGA 1CR2A 3WDLA 3ZHOA 4AP6A 1X39A 2F3PA 1R18A 5SICE 4AZ0A 5CXSA 2P5TB 3ZJ4A 2QD3A 3BC1A 3NALA 2WMOB 1GKUB 3H4IA 3G2KA 2FEMA 3AF5A 4IXDA 4U2EA 2V0CA 4D2IA 2QBYA 4A36A 2VP0A 4L9WA 4N03A 1MC1A 1KJ8A 3CEHA 3D4LA 3D5TA 3ZWBA 1FZQA 1Z2DA 5A5GA 1RMTA 1YBFA 2MSKA 4C6RA 4CI0B 2C4WA 3FCUB 2PR7A 4JL8A 3MWYW 1XN4A 5J40A 4CTMA 2RAPA 3WMXA 1YASA 2J5RA 1PEYA 1FC0A 3OPYB 1Z6TA 2OKCA 1XZKA 3DZCA 1OC4A 1SUAA 2B35A 3PI6A 4XD2A 3TTUA 2BISA 4A1OA 3D1LA 3Q7RA 2IWHA 2VJBA 3S27A 4DXAA 1LGYA 5JAUA 2XBUA 3ZC3A 2QXUA 2VNKA 3RG8A 3TK1A 5BVGA 1JECA 1KEWA 5KINB 4PYKA 3MSCA 2OFXA 3ADKA 1ZCFA 3BYZA 1JHVA 1CZNA 1RJWA 3AW9A 3DL0A 3FFTA 3IMGA 4GPIB 2VPPA 2PS3A 4HDNB 3A4NA 6YASA 4AAYA 4KK4A 3QPVA 3WA6A 3HCDA 3AERB 5T41A 3I01A 2PKQO 4CLHA 5H68A 1WDTA 4JT9A 1J7KA 1E98A 2IODA 2CD9A 4MS4B 1L1RA 4K6CA 1Z26A 1E1CB 1G3MA 2JBWA 4D6YA 1XTJA 3NBFA 4H9GA 1SIOA 4OX9B 1RP1A 1ZNZA 3DQPA 5IX8A 2PUVA 4C7OB 3OTIA 2E6UX 1A8HA 2PKYX 3X1ZA 2BGLA 1YS4A 5KYYA 2H2HA 4OXQA 3R7WA 3ENVA 5IC5A 1F12A 4AUMA 1A4IA 3L0SA 1U0RA 2NXWA 4M1QA 2BFOA 1SZDA 4W82A 3TOXA 2ORED 3VDQA 4NAUA 2Z8YM 4HWRA 2ZI5A 4EB8A 1H22A 1JL3A 3D3KA 1W76A 3QKSB 2Z5LA 3A58B 3H11A 4HDQB 1VL5A 2DY1A 2Q3HA 1QO0D 4MA5A 4P32A 5EFOA 5TGTA 3RGGA 1NYLA 1MO4A 3WJ1A 5C7LO 1D07A 1XK7A 1U7OA 1MJNA 1ADJA 1R8SA 1RPNA 2QHXA 4D9EA 5MDHA 3TQRA 1OW3B 1QIKA 1E3IA 1J25A 1GPAA 1R6VA 1UJBA 3C14C 3P8ZA 9LDBA 4YDHB 5DF1A 5AI6A 1DMRA 1NT4A 1WW8A 3ENZA 3LKZA 4ACBA 2VQ3A 3F6PA 5U4QA 4QWWA 5J4KA 4IEFB 2ZK7A 1XMIA 4BMCA 3KPWA 3SR3A 2X0DA 2ODAA 1EFUA 3RE1A 3GD7A 4HQ0A 3R7NA 3T94A 4HH0A 5CFPA 5KPJA 2ZTMA 3KDPA 2Q8QA 4PS0A 4DRZA 3CINA 3HVIA 2JASA 4FCWA 4GC9A 1O5OA 4RHEA 5HP4A 2AYZA 3TO5A 2PFSA 2Z2YA 5CDSA 2RCNA 4MARA 3GLHE 3W4KA 5LQMA 4NI5A 3PRKE 4MWZA 3WC4A 4CEJA 2UZIR 4WEOA 3DMYA 3NYQA 2VYFA 2R68A 3KOWA 3VR5A 1PJ4A 5H0IA 1N0IA 1TIKA 4RMHA 3V4ZA 1YKGA 2CVQA 3SXPA 4ZQBA 5CVCA 1O6GA 4KB5A 3WQSB 2C8VA 4II2A 4LZLA 1UIRA 2QPLA 5B7QA 4M21A 1YB5A 3L0OA 3RIXA 3QFRA 3HJRA 5IXJA 4RIEA 1K2WA 1YAJA 4AMUA 1PDWA 4BZZA 2Z1MA 2PWZA 3TOSA 3A14A 4BN4A 3VNUA 3PQ8A 4HI0E 1NMSA 1PWXA 4IEEA 4DM7A 4YALA 3ZKAA 4II3A 1ORHA 3I8OA 5L7YA 3HXQA 4Z9YA 2YWEA 2RFLA 3EW9A 4IDAA 1WA5A 3E3NA 2PMCA 1EA5A 3DTVB 2C92A 3VI4B 4I50B 4CFYA 4E70A 1Z08A 3O4IA 5DCLA 2BDTA 5I5GA 4YXWA 3QA9A 3WGOA 2CFTA 4F5DA 2IPOA 2NO6A 4A3SA 2PD6A 2BRUC 1FP2A 3VUFA 4ZYTA 4G0XA 3IUNA 1UEIA 1MJGA 1Q22A 4IWYA 4F1KA 1M6VB 1NVDA 3ND9A 2PUWA 4XQCA 2B9EA 1HQDA 2GHRA 2ZYUX 3K1AB 4NIMA 4ZYYA 3CW9A 4RGBA 4RDXA 1DWOA 1PR9A 3UC5A 1NXXA 4L8WB 3F2VA 5KJFA 3QKTA 2CFIA 1EFRD 3QV2A 4LNAA 4NR0A 4C76A 3OIFA 4LVUA 4Y2HA 1N5KA 4DW8A 2ZYDA 3K8OE 1R0LA 1X7DA 1YOVA 5BSKA 2YV2A 1RQRA 3F3MA 4OHMA 1CEEA 2MR6A 4M9UA 4IUYA 2XNDA 1V7ZA 2UZ1A 3OLCX 2WF5A 4FFSA 1M76A 3C4QA 2MYTA 1FYDA 1N75A 2JFPA 5K0BA 5BV2P 1KIMA 1IY8A 2CL0X 2WNSA 4OHRA 3NHJA 4UTOA 4X64B 1TQHA 5AI4A 3T7KA 4CKBB 4CNBA 1JHYA 3FRJA 2XNDD 4RJLA 1FJGB 4UZSA 1Q20A 3HHEA 2B21A 4FKBA 5EP2A 5SZHB 3UG7A 1P1HA 2FZ4A 5ALYA 5CDTA 2GJ8A 1K68A 2AK2A 2J45A 1C9JA 4LHEA 3FB4A 3ER8A 5KEIA 1BTOA 4GLBA 5FXMA 2UYYA 3O8QB 2ZSIA 4MUJA 2Z9CA 2WJGA 2GWRA 5FTJA 3ZV6A 4YYZA 4R2IA 5I8PA 1YJAA 1C8KA 2ANBA 4H27A 5IKEA 2BFNA 4C4ZA 4RULA 4IX1A 5ALJA 1FLDA 1UWCA 2OXRA 1D2MA 2DWQA 3N0VA 1KORA 4TMKA 4A92A 1X0VA 4V1CI 3L4BC 4S12A 3RIEA 5U9CA 2FQYA 1TA9A 3W6UA 2CD7A 4X7PA 3O7MA 2O2EA 4ITVA 1UZMA 2VJLA 3G89A 3GDHA 4OV6B 5ICFA 3WLMA 4E03A 4WLFA 5B1HA 2EWWA 5B12A 3MYYA 4GE0A 4EO4A 2B1IA 1B8VA 1T1IA 1IRXA 1AGYA 2GESA 3CZPA 3KJIA 2W98A 3OURA 4NOJA 2WLTA 4DWJA 1KDRA 4K8OA 4UTRA 4B17A 4CKWA 1MOZA 5GZ6A 1WQ3A 1I5OA 2D4HA 2EF0A 1NASA 1IK6A 1LH0A 3BAFA 3F5MA 5CH5A 2XWBF 4LDQA 5J9FA 3DG9A 1UK9A 1M2KA 1XZIA 2NYVA 3BK1A 4FN4A 3VOTA 2XGGA 4OMFG 3NUZA 4DMUB 2ZJOA 3G9UA 3NV7A 1U90A 4M1YA 5FWYB 3E1KA 3PC8C 2IPXA 4M83A 2PK3A 4ZVTA 3UT5A 4EY3A 4OH1A 1KF0A 3COYA 3JW8A 3PXCX 4FX5A 4BVKA 2Q41A 3VGJA 2C7QA 2D8MA 1YZTA 4YYEA 5FCDA 2DR3A 2ZLBA 2CLFB 2LUOA 3JWPA 3SMVA 1D5WA 3UMRA 3PQ7A 1CIPA 3CX3A 5HKKD 4ND5A 5KOHB 2XYPA 2NYAA 1JHQA 2AEJA 4LC9A 5LM3A 3JAMA 4QJ3A 1UWKA 2UYQA 4FDLA 3P52A 5JAMA 3K71B 2F8LA 2JHFA 2PU5A 1M2HA 3N8HA 4DHWA 3EZXA 4KGZA 1IN6A 3SZUA 2CBGA 1PV1A 4CM9D 1YVPA 2Q2WA 2VWQA 4NG4A 4DQXA 3IAEA 4LWOA 2H4YA 6NULA 3E3OA 1W44A 4YMTA 1I2BA 2YXNA 3ISJA 4JB0A 4IFEA 4PSDA 1DAPA 3KYDB 1T8RA 2AOTB 4O8ZA 4WKCA 3H2JA 1RVDA 4JH0A 5CPBA 1W49A 2I67A 4EB6A 5IWCA 4G9GA 4ARCA 5GAJA 4JD5A 3DAGA 1OXKB 1CR0A 3MOIA 4BP1A 4JR0A 3ZWKA 4F4JA 1LW7A 1WWKA 1D2EA 1YCDA 3MJHA 4CR8A 2PUBA 3A3NA 1P6UA 4YT4A 1IM5A 4ZQFA 2FEWB 2D3WA 1Z22A 1ZD1A 1TC1A 1IG3A 4BRSA 4QRIA 5ENVA 4FGZA 4D4MA 2O8NA 4HNQA 1RLJA 1M8GA 2A3RA 2P4QA 1WUHS 1WMEA 3JPYA 1U0SY 1JEEA 1TQDA 3B7GA 4JX9A 1TO6A 1UPFA 3KYJB 1TZJA 3OIYA 3WGJA 4DXDA 4K88A 3U19A 2D13A 4CR7A 1DC3A 3F46A 2B78A 3CHYA 5DBGA 4DV2B 5DPMA 5CLIA 2QXTA 4MP8A 3MRSA 1V3TA 2E4YA 1TGVA 2BTQB 3D81A 2ZVJA 3MGCA 4C5AA 2GN6A 4ZZ3A 1NBHA 3LO8A 2NV0A 4BGVA 2OBNA 1G8JA 4MJ3A 1Z9BA 3DOHA 4CKWB 4CEHA 1E1YA 1QF9A 1ZLYA 1EE9A 1J0BA 4RD3A 1EK1A 1ZJ4A 3ILHA 1YQXA 2BMAA 4ZDWA 4IVNA 4YQFA 3VH3A 1FSPA 2VR1A 1OB5A 2M1XA 1U2DC 1KH1A 3GAZA 3UAVA 2ZWMA 3K09A 3TEMA 3OHPA 4EZIA 1B3RA 1YGPA 5DHAA 1R4MA 3JZAA 4IINA 4A8HA 2DLNA 3RSSA 4YT2A 3HZRA 1JX6A 5DGCA 3UUWA 4MA0A 3UO8B 2YZKA 2HGSA 5T67A 1GFWA 2ZZMA 2R44A 4YMWA 1KQOA 3DHEA 3GK3A 4O8CA 5E3IA 5MF6A 1TKCA 5TQ2A 1ZCBA 5FEMA 3UH1A 4C0SA 2R00C 4RH0A 5ALEA 1H3NA 2GBFA 5DX0A 4CDNA 3P9PA 4A4DA 7GPBA 2PSFA 4LF9B 3ZKWB 2GRJA 4RFSA 3VKWA 3OA2A 1J0XO 1W6UA 4IXNA 3WLLA 1Z45A 4LBZA 4E1BA 1EFAA 2IDJA 4ZI5A 4JSYA 1A8UA 3TTYA 4DR1B 4MB6A 2BAGA 3H8JA 4GECA 4P2GA 2IQIA 1NU6A 4PVCA 5DW0A 5TNXA 3CR8A 3WGZA 3N2GA 1WSAA 5JV5A 1QNFA 1BQEA 5JNUA 1LDNA 2IELA 3EEBA 4K3VA 5KX5A 3LD9A 4NFYA 1ZD9A 1RRCA 2HXSA 2G8NA 4MKZA 1CPYA 2G0NA 1RPJA 4KXFB 4NVRA 2IYVA 2Q3BA 3CC8A 1VYVA 4G5FA 3W1VA 3ZHUA 1HR0B 5JISA 4YP0A 5AIAA 5SY4A 4ENTA 4M37A 2HXGA 4I2VA 1V1MA 1YQTA 4GYKA 3ZVRA 4ENVA 3ZXXA 1HE2A 3WRXC 3UK7A 1XALA 1UMCB 2F62A 2X8JA 3B6KA 3N07A 4MGZR 2W2LA 3BS4A 1P1FA 4I1UA 3U7HB 3A1UA 5EXSA 2B8JA 1ZX1A 4Q01A 4X1YB 1L5HB 1DKPA 1OTXA 2R7AA 1T5BA 3DTTA 4YJ3B 5EZ5A 3BAZA 2O2DA 5G0SA 4ARZB 4U8HA 1NI4B 2W00A 3DL7A 2EKQA 3EVBA 1XEXB 3ENNA 3R6GA 4IXWA 1VTKA 4B5KA 1KETA 1RSZA 3TLJA 5ADVA 1XF9A 3T5PA 4LQ4A 1KE2A 3V33A 1QLJA 3OMWA 1MRSA 4NE9A 1YQGA 5BVHB 3ZTYA 3G0OA 721PA 3LIIA 4N8EA 1ZIXA 3FPFA 2A5DA 1NLZA 3SJCA 4ETIA 3ODPA 4RIIA 4XFKA 2PX2A 1PHRA 2WJPA 3OX3A 5AVVA 4WZAB 3VVCA 4LNUA 1NUHA 2GBLA 2QTTA 3WKBA 2HFKA 2ZDHA 2GD1O 4I4TF 4BLWA 3QU5A 3LWDA 1CZOA 3X1YA 4OHPA 4DQDA 1IZYA 3CLVA 3HP1A 4KE7A 1HOXA 3LHFA 4HNHA 3NM6B 4DMRA 4LXHA 4Q4AA 2W6MA 3SQWA 3HJFA 1NVKA 3BJIC 1ZR4A 3NMUF 4LZJA 4RTLA 4CFZA 1NONA 1U2SA 5F9MA 4TL6A 2NLOA 4BEWA 1GADO 3EGXB 3I61A 5B37A 2VXBA 2GPAA 5JAIA 1KAHA 3A4LA 3BM5A 2QTVA 3RYHB 4B2PA 5AM2A 2GBIA 1HETA 3IP9A 4P92A 4ETNA 3N76A 1G6KA 1GKIA 3PA8A 4I8IA 2H48A 2CDNA 3CJQA 4FHZA 1W59A 3MJRA 4HDNA 3H3FA 4JUFA 4OREX 3UWSA 3MAGA 2FW8A 2D4AA 3QBVA 2QDXA 4P82A 5D1HA 1C0PA 1T5OA 3ENKA 2PJDA 3T9FA 4YAKA 1SC4A 3AL0C 3RFVA 1GUAA 4K1XA 4UTXA 1F0YA 2EIXA 3KTAA 4QOSA 2XUPA 2PGOA 2XUQA 3HRIA 3KXLA 2F00A 4HGNA 5GP1A 2Y3IA 1T91A 3VU1A 3WLFA 1VGQA 4H17A 1MC8A 5EJFA 2C78A 1Q7TA 5BNFA 1TUGA 5P8WA 2JIDA 4QBGB 1NVBA 1WP4A 3X3HA 1IQPA 1P4RA 3NTRA 3HVKA 1MF7A 1LK0A 2ZSJA 4FYHA 5DM1A 3CVXA 3DDHA 4UEKA 1HNZB 4IVPA 2XBMA 1YZLA 1VCHA 3W06A 2RSLA 1G6HA 2ZYHA 1J0CA 4LYAA 4C7KA 4WKPA 1J97A 5HFNA 1U1IA 3CKYA 2LWIA 3C8UA 4K9LA 4A16A 3S1SA 4DV6B 1FFCA 3SZMA 4CM3A 5KQRA 3ZD6A 1NRWA 4JDUA 1YFLA 1ZUWA 3IO5A 1JVBA 1G7CA 3IA2A 1O0BA 2E4VA 1UC5B 4PHTA 5KNCH 1QP8A 2YTZA 3DYIA 1SEPA 4MIKA 4CKXA 1ISSA 1K6IA 2N47A 2QRQA 3O3CA 3QBTA 4GOOD 3NI2A 4ZP1A 5FJIA 3W9UA 5FUQA 4YFYA 2ZRQA 4UNNA 1YCFA 1SU4A 3QI2A 3P71T 3FM9A 1UCFA 3DNMA 1PT6A 3F4BA 4G5QA 4RENA 5JYBA 1CDZA 3PIRA 2WABA 1ODKA 3HYRA 1QHIA 1TKRA 5FB3A 3TFOA 3QX7A 4YRZA 2LP4Y 1UBGA 1X6VA 3KKNA 4L4ZA 1RQ7A 2PGNA 5EQJB 3L6OO 1EVYA 2B6HA 3QBJA 4NZOA 4YCSA 4ZZIA 1A04A 1PJTA 4B8ZA 1TJ4A 3R5XA 4MB0A 4C21A 4DLKA 2FRDC 1FYFA 4QX6A 4DQVA 1PL8A 1R9NA 3HB7A 3RU3A 3CZRA 1EGMB 3MA0A 4BASA 1KYTA 2AIRA 3ET5A 3PUIA 3F4KA 4XOUA 3DA8A 4I0WB 2HA0A 5DNCA 1QIMA 4JU9A 5H9VA 1AMUA 1KU6A 3O1IC 3RRFA 1JLSA 1YE5A 3N86A 4HAZA 1VSVA 1YDHA 2BD0A 2FJ0A 1SUIA 3PNYA 1FOEB 3ZHVA 1FL9A 3KKZA 5CYPA 3A2KA 4ZFNA 1ZXXA 4MI3A 1RTKA 1EVJA 1PTJC 1NNUA 4ZV7A 2EU8A 1JQ3A 2CFRA 1WR8A 3QENA 4H7JA 5B7NA 3F3KA 1THTA 4HYEA 3FPSA 5A4JA 1YKSA 2I4RA 2ZRKA 3LPDA 2ZQZA 2QU8A 4ZPJA 3WLRA 3PF8A 5LLDA 4YV0A 2YFKA 3LQ1A 1UH5A 3GH1A 3OIGA 4BB6A 4HDRB 2IS2A 1KNQA 3ZCQA 1Y5MA 3SXUB 1U4NA 2IHVA 3QVJA 2COEA 3L2OB 1PZMA 4TXHA 1BEZA 5D84A 2PL5A 1WUKS 3NKFA 1E9VA 4KO1S 3DTVA 1RQNA 2ZJAA 1BH6A 3G2HA 3IIIA 5EIBD 4JP1A 4C9BA 4M53A 3PSHA 3K6SB 4FZRA 2RC5A 2FDCA 3OHMA 2O3RA 3EE6A 4XASA 1JTEA 4H6VA 3LXMA 4CKZA 4HQNA 5DHTA 2GAAA 4I3FA 2A92A 4YQEA 5DMXA 3JYQA 1M6VA 1QZUA 1Z47A 2POQX 2VF5X 3ESRA 4PZLA 4CLRB 2C9MA 3K1AA 3RJ5A 4AURA 1AF7A 5IJ0B 3G2QA 2D74A 2FMUA 3OJXA 1I3KA 5AM5A 4ZVVA 4EHNA 3GEIA 3R8FA 3V42A 4BRWA 4BX2A 2P7HA 4CR6A 5IG2A 1QQAA 3AFOA 5C1PA 3UN1A 3HS3A 1DHRA 3KFVA 5K0GA 3H1BA 4RTPA 1VCIA 2XA9A 2YXDA 1V48A 4GR4A 3GEPA 2P35A 5SYAA 1AU9A 4EMUA 3O4GA 5DZSA 4UE6A 1EZZA 3IRUA 2AZTA 2GEJA 3EOZA 3GRKA 4M89A 2BHNA 4BO2A 2IS1A 4JP5A 2DX7A 4PC6A 4BJ1A 1XZMA 3F90A 3K8YA 2HIHA 1SUEA 4HQFA 2IEGA 5TVKA 4DG9A 1L6RA 1WUIS 4F85A 3V1YA 5AW5A 3AUXA 1CZHA 1OVMA 4QQRA 3P27A 3ZJYA 1EVZA 4IJMA 1HL3A 3FMPB 3PI7A 2XXBA 1NZFA 2PVPA 4A27A 3WQQA 4PF1A 4D46A 4UVDA 3LT1A 1JQAA 1ICEA 4HEA1 1AZTA 3SBOA 4B7XA 2VTVA 3EEFA 4N5IX 5HCUA 1BMDA 2NZ8A 4XCXA 3UUFA 5KVQA 1ISMA 1GTZA 3O8QA 3RYFB 2PMKA 1REQB 221PA 3AP3A 3D8BA 4UEQA 3ZDRA 3ZQ4A 2YOHA 5BXYA 5HQTA 2VNIA 3WYGA 1XCPA 4EEXA 4WE3A 2O0KA 2FZ5A 4UZFA 5JJCA 4N49A 1BWQA 2DSTA 2VDNB 2FDXA 1NE7A 2J32A 2VJNA 3HCEA 2FE1A 3KT8A 4H7IA 4MGHA 4WINA 1JIIA 3Q0TA 4GR5A 4JUIA 3A9RA 5FHQA 2QZSA 3SBDA 5SYMA 1TPZA 1ZVQA 2B2NA 4ILKA 5I9MA 5U1PA 1NPDA 3ETLA 5DBOA 1Z4MA 1XL1A 3EWIA 4ESEA 2WR8A 2V45A 4UNRA 5B7PA 1JMVA 1FSSA 3SIRA 1JB1A 3MWFA 2HRRA 5EMMA 2J6HA 4HFMA 3QOXA 5ECWA 2IBMA 4IUDS 2BKVA 2IGTA 1SN7A 1EEXB 2WZDA 5F2EA 1ZICA 4BNLA 2R8OA 3PGJA 1GNQA 4J0DA 4YJGA 3BBPA 4OYYA 3KNZA 1GCUA 4TS4A 2XGMA 4EGJA 1GAQA 1HNWB 2Y8EA 3B1VA 1C7RA 4M86A 3VNAA 5AKKA 5DLDA 1LK5A 2CC2A 5JMOA 2XBLA 1FDRA 3BX1A 2B1RA 2PYDA 4JGIA 2FPKA 4M8LA 1Z5ZA 4RD0A 3L8YA 3IR5A 5H80A 2FWIA 3GO4A 1G59A 2DPMA 3L4SO 5DXAA 1E6KA 1LQTA 3OD1A 4EF5A 4O33A 3DZJA 2H54A 4Y2VA 5J4YA 1SD5A 4O4HB 1JFFA 1IQ0A 4OP1A 3RUPA 1YS7A 3ZD9A 4EG0A 3R5TA 2L18A 2RGBA 5KOHA 4L95C 1XQ6A 5JLAA 4FHFA 1IN8A 1R12A 3SFTA 5KYNA 4J29A 5LZ4A 1D0SA 2OOSA 3VZRA 4KJZA 1W0KA 2DPHA 2IYQA 3NKLA 3BF7A 4RVOA 4Y2GA 4DDTA 1Z74A 2VWPA 2W83A 3W8RA 4U9HS 2FPMA 4FJ0A 1GQFA 2AJLI 3KR2A 2GEUA 3QE4A 5EJEA 4L4UA 1I0IA 3W9SA 2MOKA 3KZOA 4ZYLA 5A4MS 4PGFA 2CSUA 2F1OA 2ZS8A 4FXOA 5T5QA 1W0KD 3AVOA 4KO4S 1O57A 4DLBA 3FAKA 3C74A 3OZBA 3PV0A 3MJSA 2B4QA 4AFNA 4AO8A 4DT1B 3QYAA 4IMRA 4OGWA 1PW5A 3P2OA 2BGKA 2ZE5A 1N25A 4JLAA 3A28A 3KFXA 2VIIA 3T3IA 1N3BA 3DE5X 2QX6A 4N65A 4LTNA 4OI0A 3SP1A 2Q6VA 4POAA 5H1YA 3JWHA 5GTDA 1ZEMA 4PSCA 1CY1A 3CPJB 2AN1A 2M2IA 3DV2A 1D04A 3QELB 4HXEB 4PN7A 2WU0A 2VF2A 3ROXA 3W7BA 2OLEA 3EX7C 4HR7A 2IF0A 4NJEB 3PNLA 4DCNA 2EZUA 2FW7A 1E2QA 2ONJA 2QQFA 1F5NA 4Z99A 2I7DA 3TTTA 5A5EA 5LNK1 2GD2A 1OIWA 2Y9MB 3W34A 1C8BA 1AS2A 4GO1A 5EE5B 2X0RA 3G8BA 1VMIA 2BTQA 2VK2A 1UK7A 4BFTA 2DHEA 3PNSA 2XT0A 5CBPA 4MINA 1EKXA 2A9RA 3TXYA 1LRLA 4LC1A 4D3SA 1X77A 4RM3A 1G7TA 1SU8A 5B1SA 1M72A 3IELA 1N34B 3GEDA 1Y1TA 2W2QA 3AP1A 4HNTA 3RC1A 1IOZA 2E21A 3AWDA 2QVZX 3A6EA 3DE3X 2XE7A 3UB3A 4CQJA 4ZVRA 3HMKA 2DERA 4LOLA 1IBLB 2PRIA 3SYNA 4PYOA 3F7NA 1OH7A 1FU4A 1PJ3A 1P6XA 4PXSA 4F7WA 5I7SA 3PC8A 4B9EA 4ONEA 2O0JA 1CRQA 2X77A 2AX4A 4JBLA 2UYCA 3U31A 2ZUTA 2IPAB 2G4VA 5DMHA 1EINA 2CHGA 1HDIA 1U6IA 2FPIB 2NUAA 2OVFA 1ISHA 3HFJA 3NDPA 4FYIA 4MV6A 4Y7DA 1C7EA 3EBPA 1YF3A 2ABWA 1T25A 4HG2A 2XB6A 3WIEA 5H02A 3D6UA 4DNQA 1PJCA 2NUPB 3C3YA 4IHKA 3V1LA 3PRHA 2G4LA 3A9CA 3AKDA 1EUDA 1FX1A 3CWCA 4AJKA 1JLLB 2G1AA 4FC7A 4EJSB 2DKOA 3SHVA 3F96A 1V7PC 1ZI9A 2N75A 4I14A 4IR7A 4QVKA 1P18A 4HT3B 3OPXA 3S6JA 4JJ7A 4KIFA 4OI1A 1NULA 1IAVA 2P4SA 1RNLA 2H1CA 4KIUA 4TTPA 5CDFA 5LIPA 4X54A 5FLEX 3LUGA 5T7BA 5EJGA 3G5LA 4OBXA 2A30A 4PLYA 2FR0A 4EB0A 2YZNA 3CEAA 3I72A 3ZV7A 2EW1A 4IG9A 8OHMA 2WWRA 2AYXA 3Q8WA 4NMXB 3EF3A 3H04A 1E3SA 1OGYA 1GGNA 1NE2A 1I6WA 2D0PB 3PWZA 3DFMA 2QTMA 3M81A 1RXEA 5K6AC 1GAEO 2DC1A 3IEPA 2PXXA 1JJBA 3RARA 3NP9A 1T4BA 1EXVA 4BE4A 5JTUA 1KWGA 2P6MA 5BSRA 4AJNA 4DIUA 1A5TA 4FSHA 4DRXB 4AS1A 1QONA 1JU4A 2NO7A 2O8BA 3EZ9A 5KWJA 5CTAA 1M10A 5F4BA 1KAOA 2AG6A 2PMWB 3JATB 1C1XB 4ZI7A 1SKBA 2PZFA 4HADA 5EP4A 1T8WA 5FYDA 4ARZA 2HTFA 4EKYA 3OE7A 4KZPA 2EIHA 2W2NA 4B4OA 3BULA 5ALDA 1V8PA 2GEVA 3H1TA 3LXXA 2QY6A 2MSDB 4RHFA 1C9EA 4CV1A 1H69A 5BVHA 4RLQA 4BX8A 5ENZA 5HKBA 1ZJYA 4L3WA 2Y66A 4JQSA 1Q1AA 3AF0A 4MKIA 3MTQA 2AJBA 3DEHA 3UV7A 1ZRMA 2FPRA 2JGIA 2QVYX 3Q41A 4WZAA 5DM4A 3I2KA 4EGAA 4Q3LA 3GCZA 3CURA 4ZYWA 2P2ZA 4I66A 1BKYA 4L5IA 3JZDA 4HY3A 4U00A 5AK4A 1XGKA 2LNDA 2X4IA 1KRWA 1NI5A 4U2KA 4XTCS 4J2TA 4QE3A 1XWIA 1XUOA 2FMFA 1K3TA 2A7QA 1BVUA 4RK0A 3I28A 4N1AA 5CURA 3EGXA 3VA7A 1ZSVA 1DDIA 1Y0BA 1ONOA 2FPPB 2YIVX 1AHIA 5DBFA 3ECAA 4PANA 1USWA 4GF5A 1EVKA 3B60A 3NASA 5K0FA 5MN4A 3LCCA 1SOAA 2BUAA 1ZK1A 1IXSB 1MPXA 1SMKA 4RD6A 4TSRA 3GCGA 4Q12A 4H7DA 1U7TA 2WF7A 1B7GO 3NONA 2F1RA 1C0IA 4HEA6 2IPNA 1FBTA 4H08A 5DWDA 5T6MA 3W5HA 1AV6A 4FMDF 2CYBA 1JQJC 3PUWA 3T9CA 4PVDA 2QM8A 1U7ZA 1KVUA 2WHEA 4INJA 5IW8A 5C46F 5TPZA 2UYOA 2Z6AA 2YXLA 1RYHA 2OHOA 4IS3A 3QU4A 4KQKA 4LI3X 1YTUA 5GGXA 1E2BA 4DIBA 3PLRA 1DU4A 1T2VA 2ZJ7A 3EGEA 5ILQA 5K8IA 4YRMA 2DYKA 4IBOA 2AC4A 4ZQGA 2Y1XA 2GK4A 5DP1A 2YWDA 3M1IA 3QG5A 1KJNA 1CUAA 1EDBA 3SFVA 2CXRA 3U39A 2MSCB 3FB1A 2BI8A 4RS4A 2QAJA 4C3VA 1SHZA 4EZBA 4MW7A 4DRYA 1E7YA 1R6TA 3QXJA 2HW8A 4HUJA 1LDMA 4NONA 3MPOA 5BSMA 4B6GA 1QHFA 4OXRA 4EY5A 1U2RA 3RS7A 3RFTA 3FSEA 3K96A 4QYIA 4FGLA 2W8BA 4RYDA 4EG3A 5CEEA 5AO9A 3EG9A 3HUDA 5L4SA 2FFHA 2JJMA 3AJRA 3OUZA 3ADCA 1GJRA 2HB6A 2V6MA 3TAXA 3AQIA 4ZWNA 5F12A 3FIJA 3NW9A 3CRVA 5AK5A 3H1AA 5IHPA 1JHDA 3ZE0B 1S9DA 2C3YA 2I3DA 3KZNA 3NHFA 3OZDA 2FDRA 2FPWA 2FV8A 5DK6A 3JU3A 8LDHA 5LQCA 4O08A 3TOVA 1GCOA 2IW1A 3NJ8A 4IH4A 1DJOA 2BMDA 4DSUA 3GI1A 3T4PA 4BLQA 4YRKA 1Z2CA 2WYHA 1I0ZA 2YY6A 5TGDA 3ZDXB 4D3XA 1WPQA 2V7WA 1JUDA 3VNRA 3MWDA 2HH9A 5IHXA 3HUFA 3AFGA 2AFIB 1ZN7A 4W8GA 5ILOA 2HA7A 4M9RA 1FMLA 5JPCA 4CM8B 5AW2A 1DKUA 2KWIA 1EUCA 2BEVB 3AWIA 4Q37A 5F51A 5FUXA 3EGOA 4PWZA 1XRJA 2PMEA 3GMDA 3JQQA 3ZGXA 2OHFA 3IPCA 4R54A 3TLEA 2I54A 5EIWA 4ZCQA 5GJCA 4D9CA 1H4TA 1G21A 2J85A 2AG0A 3VZQA 4MP3A 2E5WA 1R50A 3BB1A 3G0CA 2H06A 3AETB 2F90A 1TOAA 1CB0A 3R4VA 4D92A 4YUXA 4GOMD 1P2GA 1UMDB 3ZJUA 1FVOA 2AG8A 3VPCA 2GT1A 3WNVA 1H0RA 2XEXA 1MAAA 4HDRA 2FZGA 1NL3A 2ZAOA 4O4LA 3IP3A 1WEKA 1UJ6A 1C80A 1HEYA 2J9GA 4MVWA 4YRDA 2YC2C 3SXUA 1I6KA 2XKJE 2G80A 1GA4A 3PEEA 1D5CA 4J07A 4QT0A 4X8OA 4WBNF 5A3VA 3N2NA 2DFNA 4RKFA 4CVNA 3EZFA 2ZCUA 3S8EA 1N8NA 4U7PB 1VCOA 1SUBA 1NUAA 4HLUA 4JXKA 3BL5A 2ZUCA 4FD2A 3D3WB 5LFAA 3VNBA 1HC7A 4EL5A 2RI1A 5K8VA 5CEJA 3OZSA 2XUGA 4G6ZA 3ASYA 5F3DA 5DGTA 3AKZA 2QRKA 3G8DA 5IJ0A 4LWPA 2VLIA 2G08A 1KGSA 3RHFA 4WLOA 3LA6A 4QOGA 1R0SA 1Y63A 1NA5A 1WPXA 2EWVA 4KV7A 4RMIA 3T61A 2GGSA 4AUNA 5JI2E 2Q3MA 2Q5QA 3LBFA 3SSOA 3W5BA 2I7VA 2WT4A 5EWLA 3UBTA 1J8QA 3U9SA 1QF7A 2ZRCA 3F8WA 5BXQC 4WAUA 5JNVA 1AUOA 2IE0A 3EULA 3EW7A 5MN5A 2XNKA 3DE2X 1T6XA 1J2UA 2PKEA 5L3RA 4Z7NB 4DC1A 1QU2A 1CEYA 3WRYA 4BPBA 1IG0A 3LRTA 3L8HA 3O21A 3NORA 4G4GA 4NCHA 4AMVA 1AURA 4BVHA 1UADA 2FEPA 4Z54A 5DGHA 4KQEA 3S2IA 2HUPA 3QPAA 2HYDA 1XZEA 4YLEA 1VJCA 1YRQA 3E9EA 2ZU6A 3ZDYB 2DULA 3S8YA 2ZPAA 5LWHA 5JJ5A 3CZ4A 1Z3CA 2H1SA 2O23A 3C6KA 3DZBA 2FZKA 3VH4A 3KVRA 4FFBA 5HMMA 1U2GC 2WE8A 2W8ZA 1REQA 3DD1A 3ANMA 4BMYA 3IBTA 1XRRA 2WYVA 3PXBA 3AJEA 2C59A 4LZZA 1PI3A 4UVHA 1LLCA 3QOYA 4Z1MD 1O3YA 2ARKA 2O19A 1SBZA 5A4KA 1KZYC 3HI6A 1QKIA 5K3DA 4GMKA 4ID9A 4L9RA 1JMKC 1P74A 1TM4E 3C39A 3MB8A 4NENA 4Q3DA 5L3VA 1O95C 2WM3A 4M99A 2GRUA 4BQFA 2ZJ3A 2VP2A 2VYQA 4UBOA 4WZBB 3RWOA 1XDDA 2PUAA 4RZSA 2JEYA 1VE5A 3OJWA 3W6OA 3L01A 5KWEA 4RWZA 4MQLA 4CMKA 3SJ7A 4OK6A 4AYWA 2I9KA 4CMJA 1KS9A 3TIXB 2V54A 1HZZC 3GLFA 3U40A 2J9YB 1ZSNA 2ES4A 1H3EA 4RGVA 4CIVA 1FRVA 2C5LA 3W5UA 4QGGA 2OTCA 2XB9A 3MJVA 4DMKA 4P5EA 1MVNA 1O54A 4BO5A 4WLUA 3OJOA 4BEJA 1NRJB 5AMXA 2XMZA 4CI9A 3WBKA 3M6MD 4I1VA 3BEOA 5EZYF 1F3LA 1ZK3A 5I9TA 1Q50A 2ROQA 3NHLA 4G26A 4KMSA 2PLFA 4IZ6A 4ESOA 4F2WA 3H83A 1YA8A 4YC7A 2OO5A 1QVRA 2Q27A 5EE9A 4BO8A 3HJTA 1J99A 3HLYA 2YMQA 3LW7A 4O1HA 2VPWA 4KC0A 4IWNA 2EL7A 4D3ZA 3EIXA 1MJGM 2NACA 4FYVA 4IO1A 1FJXA 4K9RA 2M32A 1C9NA 2WJYA 5C5IA 1SBCA 4KITB 2P9ZA 3NPMA 4HNAA 4MVJA 5E95A 1NGSA 2RB5A 2PJZA 4MKXA 4DM3A 3ONNA 3HY6A 3H8VA 3TUZC 1HDYA 3FFBA 4JVMA 1ZD5A 5TR9A 3TQSA 4AY2A 3VU3A 4RLHA 2QI9C 4RL6A 5J2UB 2WUDA 2OFOA 4EQ6B 4ZI7F 3RYCB 1H5NA 4MVJD 3I37X 5ER6A 4YAFA 2V0GA 5I51A 2V74B 1NMQA 2V97A 2YJ4A 3IP8A 4H59A 3USZA 5A3RA 4DT1A 3AFNA 4YJFB 3WVNA 3SYRA 1C81A 1MMFB 3ZQJA 1RM0A 1ZIOA 5REQA 1WOYA 2R4QA 1I4OA 2QL6A 4B31A 4JXXA 4X7RA 5C8ZA 5AW9A 4OA8A 1SHTX 1X3SA 3DM5A 1S3IA 5BOVA 2HRCA 3KQSA 3ZJ5A 2N1BA 2VF4X 2QN8A 3HADA 4DBLE 4EIWA 1A9OA 1SULA 3OC6A 1SM4A 1Y1LA 4MMYB 4LHXA 3A6GA 1LFDB 2FH5B 1U04A 1IUOA 1Z36A 1UP6A 2CVHA 2JIOA 3OOYA 1RQ2A 3KB6A 4KQIA 3PNMA 4A2PA 5TX7A 4YCCA 1GZVA 4LE1A 2VHEA 3WKDA 4OY3A 4A2WA 1L4KA 4QYMA 4ZTBA 4L85A 1NSFA 2HQ1A 3DUFA 1B4DA 4QELA 4BXOB 3P0RA 1SCUA 2GNPA 2VPZA 2BHLA 2Z98A 3I53A 4KFTA 4X8MA 1CRZA 4U2FA 1XFAA 4IS2A 4Y2YA 2JD2A 2FMIA 1RWPA 3MINA 4Z9FA 3U0BA 5FBRB 1Q7BA 1V5WA 4M46A 1JHZA 1E9SA 5HG0A 4K28A 3EIEA 3W5JA 1U3GA 4Z4GA 4QLBA 1SU6A 3THOA 5CX1A 4RKRA 3DHYA 2H3HA 2FSIA 4MWBA 3TSYA 4A1FA 4JR2A 1ONBA 1X1EA 3QY9A 5FEUA 1IATA 2CMDA 4YMSA 3LPLA 2BGMA 2VP5A 5ARBA 3R77A 4J94A 2RGWA 1HX7A 3JYHA 1ZGGA 4RPHA 4CJXA 3ME5A 4YRBA 3UJNA 4YJHB 4G23A 3O3MB 2VVTA 4LDAA 3FA2A 4GGOA 4EPXA 5K0SA 5C4IA 1VHLA 4FSDA 3BB4A 4EA9A 2HNAA 3JYLA 4KXXA 6ADHA 4IYJA 2MSLA 2AMLA 4NKRA 3LKBA 3IAXA 3JQEA 3NV9A 4IILA 1ZONA 2OA0A 3SR0A 1KDTA 1Z0AA 2R7NA 3LCRA 1PHPA 3LL7A 4B8WA 2V1XA 4EJSA 3QG1A 4HZIA 4PZYA 4MAFA 4D43A 3VC3A 3WK4A 4YP1A 3ZV4A 5EMNA 3QEBZ 2B0JA 4AF6A 3F9CA 4U7DA 4JJKA 3DV9A 4DADA 3RKSA 2MSNA 3L0BA 3T0GA 3A1EA 2JFOA 1DBPA 1CT9A 2Q5JA 4KXLA 4MVJP 1KFKB 2KBFA 2FR8C 5GONA 5IT4A 3HDJA 3A26A 3T5GA 3KAKA 1AUXA 5A9SB 3GLGE 3CWQA 1QJCA 4FN5A 3KWMA 2BBWA 5A7GA 3MT7A 3GRRA 2HIGA 5JBNA 4ADSG 2Z9DA 5D6NA 4M76B 2BUBA 1WIWA 4UNQA 3LF1A 3S68A 2O0LA 1VSBA 1YC2A 2WU8A 3DHVA 2RHGB 3WHIA 3N2IA 5IKMA 2XYHA 4YT5A 3FTFA 1LRJA 3H2IA 3L0IB 4PE5B 5KC8A 3DOOA 2H2IA 4GS5A 2CXOA 1AUVA 4TWJA 2QVGA 3WYEA 5HRCA 2HA6A 5M29A 3AG6A 4DEVA 1N2ZA 3TTWA 3UMYA 1QM5A 1JWAB 1W5FA 2HN9A 3Q7QA 2RKBA 3ABZA 3NLLA 2YXBA 3V2GA 3WKAA 2P2DA 4UQOA 4JVNA 4WL0A 3WWZA 4EY4A 3OX1A 4D0LB 5JDIC 2A9FA 2G9UA 3FDZA 4PNHA 1XD2B 2PBFA 4BAUA 5F23A 1P0MA 3LUBA 4EI7A 3B9RA 4MVJH 4B35A 2JFBA 4X1OA 1IZ7A 4QDKA 5EIHA 3ZDFA 4I1SA 4FBLA 3HKEB 4UAUA 4TYYA 2ZJFA 1FFHA 4A0RA 4UDOA 2Q5EA 1VKNA 3OLWA 5KHOC 3ANTA 2NU7A 3WTBA 4BMPB 1I2MA 3Q72A 4NCJA 3B1XA 4OIFA 3TGWA 1RHJA 3TEFA 2ZJYA 3Q11A 4WWHA 3SZOA 3DMHA 2BFBA 2ZPTX 1XC7A 3OIVA 5I4CA 5AJHA 1GRRA 1D4ZA 1X13A 1BYUA 2C4KA 1RXYA 2VDMB 2XDWA 1FFGA 5TC4A 4QA9A 2MMGA 4DOMA 1NXVA 3KSDO 3BXZA 5KQPA 5LWQA 4FFDA 2C07A 1TFRA 2JFQA 4R7ZA 2YRWA 3W8FA 3OSUA 1KOGA 1O1YA 4UULA 3ZEAA 5LBTA 2WIGA 5BN3A 3KR1A 5ESWA 1DC4A 3IHLA 2VO1A 4HMOA 3U26A 3HDQA 5BWMA 4O2BA 3BFPA 1DOHA 3NHAA 3UMSA 1KYWA 4Z49A 1ZD2P 1Y80A 3EIFA 2IH4A 2CMKA 1LNZA 1G8MA 4G4JA 1A5SB 4TM8A 3T9EA 1W9MA 2H2AA 3HXLA 1B76A 3MCUA 4JENA 4MUAA 5C8YB 5JASA 2D7JA 1BMTA 4RVGA 1JVSA 3GFOA 5TVGA 4F4UA 3R6WA 4DZTA 3PX7A 2CCGA 5AM4A 3ZYCA 1RWXA 2AD1A 1UJ5A 1AKMA 1QTQA 1R3DA 4US0R 5KUTA 3R9XA 2XE8A 2GCIA 3DVLA 3D4IA 2Q5IA 3UJDA 1DUSA 4H60A 4HWPA 4ATNA 2JLXA 4G5GA 2ZVPX 4LRSB 4O4IA 3SZRA 2JH3A 5BN5A 5BO5A 2YJZA 2FGKA 4IAOA 4LJ8A 4DV1B 3L6DA 5EIEA 5THQA 1JT2A 1WZUA 1PP4A 1XVAA 5A62A 2C4VA 2JCXA 3WV5A 2Z0MA 2GMWA 2NZJA 4UAVA 4I99A 3GN2A 2BMFA 2X58A 5E9QA 4BNKA 3CTPA 2OMKA 3MVEA 4IX9A 4CV2A 1QIEA 4CE6A 2EFDB 2AOVA 3QF4A 3Q3EA 4BQOA 5D3ZA 1UDXA 4YONB 4DAOA 1G2QA 1LPOA 4MQUA 3UHJA 2XSZD 4JJ4A 4TWRA 5KNBA 3UK1A 5ED4A 2WKQA 4NNJA 4XSGA 4C78A 1ZD4A 1XKXA 1I9GA 3AYZB 4DA9A 3LP8A 3OLXA 5AQEA 1N92A 4F5WA 5JD6A 3IOBA 1EHYA 2P67A 3WGYA 4L22A 3LVFO 3CPEA 3HBAA 2A67A 2JFHA 4ZOBA 3VTAA 1JNXX 1XTRA 3E82A 1NN0A 3EB9A 3DZKA 3Q8MA 1GPWB 2GJ4A 2OV6A 1Z38A 4J4TA 1JIQA 4WKNA 1LXCA 3IIMA 4EHIA 1CU1A 1X1DA 4A73A 3FLMA 2ZWIA 3A1DA 3Q40A 2DT5A 1NVAA 3ZCUA 3T7TA 1SOWA 4LVNA 2GJ9A 4CETA 4KP7A 3CEMA 4S04A 3LZ6A 3ZDBA 5KHLB 1PR3A 1SIWA 3QI7A 1VP9A 3DWIA 2BKAA 4BO7A 3ZI7A 4EGFA 2PXHA 2VUSA 4U3JB 2PV7A 2BEVA 1DX6A 1SWVA 1M54A 2A5YB 4H77A 3ZCTA 4U5XA 3BD7A 3IE1A 2WSSA 2Q46A 2Y68A 2ONKA 3OECA 1HNXB 3BERA 1VL1A 2O50A 3FIUA 4B6RA 2HNKA 4S1PA 1OBFO 5CVEA 4RKWA 4EFDA 1L7EA 4GMGA 2W6NA 4YMUA 3MCVA 3TBHA 2YJTD 4DLRA 1TD1A 3IX7A 3P9IA 3TWOA 1V16A 1SVMA 2UU9B 4B80A 2ZJ1A 3CG4A 4O2LA 4QECA 4FFVA 5L3QA 1A77A 1KYVA 3LNTA 1LPNA 1ZISA 1E3LA 2G88A 2GOYA 3GP8A 1NIJA 4MVJF 4IFIA 1UMDA 1SAYA 1ZK0A 1U7UA 4FS3A 1AQNA 4C2UA 3BQNB 3UGKA 1HORA 3DWFA 2VZ8A 4LE0A 4N76A 3PU6A 1U9IA 1V8OA 3IUEA 1Z68A 2FY8A 3TLZA 1E6MA 2GXUA 3GJ6A 3ICVA 4OHVA 5JEDA 5CT6A 4OBBA 4HAVA 3ZE2B 4KWTA 5IFLA 1USUA 2F67A 4QUGA 1G5HA 3U16A 1H2BA 3IHTA 5CB4A 4KACA 1FUUA 4HZUA 1KGDA 3I42A 3RJTA 1YB6A 3S2UA 1LF0A 1M2VA 1WCYA 3D3WA 5DLPA 4HFRA 3L49A 4EFMA 2WOOA 4TL8A 3UHAA 1FTYA 5KYWA 4U2CA 1JF8A 3NEJA 3AUSA 1TAUA 4JUAA 3SJZA 2A5JA 3BHNA 1YZUA 2PD4A 4TPKA 5CJ2A 1WNFA 4AXBA 2JGMA 4FFNA 1W46A 4I9NA 4KLNA 5FBLB 3RT7A 1UXKA 4Z2YA 1SQ6A 1YS6A 2F1HA 4L7VA 1SC3A 2WHXA 4ZT6A 2Z09A 3UUEA 4LOHA 2ZIXB 4YX9A 3FVTA 4O4JA 2XXAB 1GG2A 4C89A 5F5LA 4DJ5X 1J33A 1EU1A 1MFZA 1RRGA 1XBTA 3B7WA 4JBXA 4QVGA 1U1GA 3K5IA 1QAQA 4HOYA 5D6OA 3BMCA 1HSZA 3JX9A 2IC5A 1WBJB 5JQGF 2PCJA 3KKKA 5DRTA 1GSAA 3WZMA 1JILA 2AOWA 2J31A 4RADA 3TCXB 4YCMA 1RCTE 4AIIA 5CA0B 2BFDB 3F6BX 2CE7A 1ZWKA 4RTNA 1N9KA 1IY2A 5TT1A 3NHWA 3QYFA 3JD4A 3QE0A 3S28A 3VYTB 1QB8A 4BJ6A 2WMNB 4XWOA 1HMYA 1A8QA 4TUYB 1DZ3A 3LYAA 4G63A 2HA3A 3H9UA 1W5SA 2EG5A 3EHDA 1R74A 2B4AA 2H9IA 5I4IA 1CFZA 2I78A 3GLVA 4XYBA 3QHPA 2VWGA 1I7QB 1HRKA 4EVQA 3IURA 4FDAA 4YUVA 3DOFA 4DILA 5AW0A 3E5NA 2C5SA 3EVGA 5TGZA 3D3QA 3U7FB 1SRRA 1RI5A 2C54A 1TAHA 2RDMA 3LSTA 3EZ7A 4LBWA 4R51A 5IVIA 3EVDA 4UUQA 3H1PA 5CM9C 3FCSB 5EUMA 1FDTA 1RJGA 3HN2A 1K75A 2HQBA 1QH1B 3A9UA 1IY1A 5KNBH 4CL3A 4EKGA 1GPNA 1LLFA 5IAKA 2D2FA 1E59A 2HUNA 1N2BA 3E9NA 3JQBC 3FAZA 3HXMA 3S2FA 3PWSA 1QB7A 3W2HA 2H5EA 3HCBA 3STWA 2YV5A 4AJIA 3QLEA 1P1RA 1HSOA 2H0QA 5ALOA 4FR0A 2R66A 4MKRA 5FPSA 1GL7A 1K6JA 5IJAA 3BILA 3ECCA 4QHYA 4K6MA 3AEUA 2BEJA 2WRZA 3LYLA 4MQEA 1E2GA 3DFFA 4Q9LA 3ZLTA 4YAWA 3C41J 1JAHA 3V8EA 1KTIA 2Q8NA 4X62B 1NW4A 5JAOA 3DBLB 4WJZA 2OXFA 3EZNA 1W25A 3JVVA 1VIAA 3HNPA 2ZOSA 1N6LA 1K88A 2PRKA 3NFYA 3RC7A 2UVPB 4FP9A 1U6JA 2LDXA 5HILA 4N9QA 3PEYA 2DP4E 4DQ0A 1LPPA 1EDZA 2FQXA 4IV8A 4O02B 4G9BA 3U13A 1KQPA 2ZWAA 3TX2A 1T6ZA 3V7FA 4AY5A 2D1TA 2R1TB 3QPWA 4DGSA 1KI6B 3SEAA 4NMLA 5J2UA 1WS6A 1D3AA 2OCBA 4EW3A 4L28A 2WLSA 3TNYA 3KEGA 4EQ6A 2RK4A 2DR2A 3EAGA 5CGQB 3EODA 1RACA 5LL6P 1BU5A 2PAFA 5F7ZA 3V1KA 4NECA 2VJCA 3VR3D 1QMGA 2ECOA 1F2UA 4LZOA 1N0UA 4BWGA 4ZT3A 4CZ2A 1UPUA 2AC7A 2BZSA 2PM8A 4ZRDA 1JR6A 4J0CA 4LG1A 3QOWA 4QPNA 3QUQA 2Y4NA 1QMPA 2G17A 3R24A 1T13A 1Y3BE 3F9RA 4ZOLA 2JDIA 3EIWA 1W36D 4F86A 2PUJA 2A35A 1M6YA 4LCBA 1O9BA 1KJZA 1YC5A 1C3LA 2QLNA 3AC0A 3DL2A 4EGQA 4PNEA 1Y6JA 1OCEA 1ZAKA 3KTFA 2A86A 4L3VA 4OGFA 4OP3A 3GPLA 5IPFA 5A1TA 2D7CA 3E2IA 2OXCA 3I5UA 1XTTA 4Z8XA 5H7XA 1Z6ZA 1MRNA 1W19A 3FTPA 1E99A 2JFUA 2JL1A 4TZ6A 3DYBA 3Q9NA 2IQ5A 2IY7A 1FXUA 4A23A 1KA9H 3UK2A 4MO9A 2CNDA 4HVCA 4C1BA 1NM5A 1PR6A 3T1QA 4EW2A 2Q0QA 3BJRA 4CIXA 2J07A 5AVQA 1U3WA 1IM2A 2FI1A 4GDFA 2Y76A 2CFSA 2RHBA 4W5HA 4KPUB 1EVLA 2CNWA 4JJZA 4JCOA 1BMQA 1U3TA 3C7DB 3PDIB 4FYYA 4B87A 2OT3B 2X23A 2V7PA 3UXMA 5DU2A 1HZZA 2QSZA 3RS0A 3TIFA 5IWAB 5BT9A 4ZIRA 2KYRA 5I7HA 1JXQA 5CJPA 4PLHA 1XKQA 5JE8A 2BY4A 2W6QA 2CNWD 2VFAA 2B7BA 4L0DA 4UTZA 4J3NA 1FW6A 2ZJ0A 1H2ZA 4YCBA 3DE4X 5JSUA 4IDFA 2IEIA 4DG5A 3PWKA 4JYCA 3UAXA 4C6TA 1YZHA 5BUZA 2ZB3A 4O4IF 4L0QA 5HBGA 2RGNC 1AK1A 1JDTA 2A9VA 2PWAA 4NESA 4ZOAA 1VL0A 4F21A 5IAAA 5ALQA 2YNMA 2RAUA 4NMHA 2JAPA 1MO3A 1NR5A 3ITEA 4MRVA 5B6PA 4HSEA 3MTJA 4W5TA 5JY1A 2ZULA 5CIYA 1C9MA 2H85A 4FGSA 5IF9A 2IYUA 5C8VA 1M7BA 5CD1A 3OFKA 2XZOA 4IV0A 2YNMD 3CN7A 5TS3A 4DV4B 5A6SB 2ZREA 3JVEA 1S3SA 4QGHA 4EM6A 5IJ9B 4EP1A 4RK1A 3DMTC 1IVYA 3VFDA 4DJEC 2X6RA 2FXIA 2JFYA 2P2YA 1OY1A 2O4UX 4MYHA 4C2AA 3EVAA 3GL9A 1SUWA 1NHGA 2ZIZA 3D8HA 3IEUA 3MUFA 2BKEA 2RHMA 1ULZA 4E14A 2WAOA 3D7MA 4D8VA 1NW9B 2OCDA 5EP3A 4AO7A 1HFJA 1CUFA 1ZQ9A 5AOAA 3WHPA 1XCOA 4AG5A 1OA1A 3GOHA 1D4OA 1DEOA 1H05A 1T2FA 4WOCA 3WB9A 3KJEA 4L9SA 3GR6A 3GVXA 2VH5R 4UOZA 4Q93A 5K3FA 1G4UR 2HBQA 5KOJB 1YZYA 1GRQA 3M6IA 3LX8A 4HPXB 2XQKA 4Y9TA 3MQFA 1KMHB 1QVWA 1Y6QA 1TDJA 2DTEA 5HTKA 2PKXA 3AF2A 3T4XA 1FQWA 1P45A 4XWYA 4OK3A 3AT1A 3RVJA 1ENZA 1ICIA 5IF3A 4J0HA 1NI3A 2QENA 5DSTA 4AVYA 2J9ZB 4GT1A 4RK5A 4Y1RB 3NRCA 1NP3A 2C58A 2VHJA 3DBVO 5ARDA 3EC2A 1GAJA 1M2OA 1ODSA 1O94D 2V7QD 1SHUX 2ZT7A 3AGQA 3BWBA 4KVZA 2BN4A 4OQNA 4ZQHA 4DJFC 2WWXA 4V0MA 3R0XA 1COWA 2V6FA 1NW7A 4YI5A 4YP6A 2XGJA 4L76A 1B93A 1Q7CA 5KYTA 1YUMA 1Q0ZA 3KZCA 4QDJA 3E3AA 2E9SA 4MYUA 5J63A 4MVJE 3VH1A 2IXDA 1O6CA 1FTGA 2R85A 2Y6UA 3H84A 1BFUA 1JHOA 4TV9F 4FEEA 2JRCA 1YQ9A 4YMIA 3U3KA 2EGGA 3ZW7A 4YRIA 2GUGA 1X8LA 1UL1X 3GJYA 3K9LA 3QQPA 2KX7A 2OXEA 4IOLA 4M1ZA 1II0A 1YL7A 3M1YA 2BZGA 1PYGA 2QUBA 3H4MA 3JSXA 3MOSA 3VZPA 5FUWA 3USCS 1MDBA 5KSYA 4NAHA 5I9BA 1VCNA 1IHPA 4YDRA 2ZAYA 3WX0A 3NX4A 4JLDA 1QG2A 1W0JD 2ZYWX 4PC3A 4QFDA 1ZUD1 1WABA 3OT1B 1VPDA 1CJBA 4O29A 5CLQA 5I3ZA 3ODGA 2VDOB 3GW8A 2XRMA 2IOHA 2IZ1A 4B4KA 5AVUA 2P9FA 3ES9A 1RRPA 4ER0A 4N0DA 3WRYC 4G0YA 3FOZA 2NT3A 3BDIA 5EJ2A 1SB8A 4JI2B 1P2TA 3H2YA 3KELA 4O4JF 2P6NA 1G66A 1QGUB 2HF9A 3MM4A 4CQMD 1R9GA 4YLGA 2FR8A 3H8SA 4C7VA 2R6CA 3C1OA 4JP2A 4C4XA 1G19A 2ZRMA 1QAMA 4JEUA 4CU2A 1A27A 2A8YA 1VIVA 2V9PA 4NMWA 3UBMA 2RGUA 4A8JA 4PAOA 1AKYA 4D9MA 4DM4A 2B36A 3JQAA 1HE5A 4HQOA 3O4FA 4OQQA 5ERXA 4BMOB 4DZZA 2ZIAA 5D3MB 3GNLA 2FGJA 1DT5A 3V3TA 1PLLA 1ZRNA 3IAFA 2WWGA 4MVCA 5EHIA 3VR1A 3ZHTA 2WJVA 1WG8A 4PFSA 4V24A 1H2EA 2BDEA 4QPZA 3KAJA 4S1NA 3NBYC 3OZRA 1XMVA 4HV4A 2P90A 4OM7A 2P69A 1IHYA 5AKYA 5IDYA 3EOAI 5T57A 2LV8A 1IZ9A 3E7PA 1SA0B 1PD1A 3RU2A 4P86A 1UK6A 1YULA 3LBAA 4OUDB 1OI4A 4S1OA 4MJXA 2PRZA 5DSXA 2JKVA 1VE1A 2DWOA 521PA 1TZMA 1L5KA 2HPAA 4Y0VA 5BYBA 2PZEA 4P08A 2I6GA 1O58A 2WJ4A 3UW3A 1GFIA 3RUAA 2FG6C 4NPHA 3BDAA 3FPGA 5CA1B 2VYVA 1BDBA 4KL8S 4LSWA 4QICA 4EVIA 4C0QC 4GKVA 4LQCA 1PV4A 4Z0TA 5JWRA 3AUTA 4QOIA 2X0NA 1QIJA 5D8DA 4ZTZB 1MJFA 1X80B 3D4OA 4DFDA 4MICA 2GM4A 1X7YB 2HJGA 3S2GA 1OU4A 1X14A 4LEIA 1J9EA 4PRYA 3O92A 4X61A 4KXWA 1NR1A 1RJFA 3GJTA 1R6DA 4OHZA