3ZHOA

X-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
b'AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVOPROTEIN WRBA
molecule tags Oxidoreductase
source organism Escherichia coli
publication title 1.2 A Resolution Crystal Structure of Escherichia Coli Wrba Holoprotein
pubmed doi rcsb
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zhoA00
3W77A 4QOJA 1FLDA 2Q9UA 1AKTA 2MTBA 2WC1A 3FX2A 2QMZA 3G5MA 2AMJA 3ESXA 2MWMA 5F4BA 3ZHOA 3S2YA 3TE7A 4LTDA 1D04A 3RPEA 2X2PA 3L9WA 4Y9RA 1YCFA 2M6RA 1D03A 2A5LA 2MOKA 3B6KA 1ZWLA 3W79A 4PU0A 3R6WA 2D5IA 2BZSA 3KAQA 3B6IA 4QOFA 3GAMA 2BMVA 5TGZA 4R81A 5LJIA 4Y7CA 2FZ5A 4H2DA 5EMNA 4QOHA 3NHSA 3L9XA 3OJWA 3U7RA 3NHYA 4N9QA 3EDOA 5NLLA 1AHNA 2FX2A 4U7HA 4C76A 1JA1A 1SG0A 1JA0A 1CZLA 4NULA 3F6SA 1BU5A 2HNBA 2R97A 2V9CA 3O2NA 5ULLA 5B3KA 2V5UA 1DX9A 4ZVKA 4GQIA 2M6SA 1AMOA 4C0XA 1YCHA 1YKGA 3OX3A 4GR9A 4YAFA 1XI2A 3FJOA 2FZVA 3ESZA 5LBTA 4YALA 2BF4A 5JROA 5LJLA 4ZVLA 3NHRA 3W7AA 5LMCA 4QOIA 1YCGA 2BN4A 3HLYA 3O73A 4FX2A 2XOEA 4HS4A 1KBOA 3QFCA 1B1CA 4J8PA 3NHWA 4YQEA 4CETA 3SVLA 1QR2A 3TEMA 2QR2A 1NNI1 4BMPB 4PTYA 1RCFA 1AKWA 1CZKA 4CF6A 1X77A 4NLLA 3ES9A 4YAUA 5FX2A 4U7FA 1FVXA 3TZBA 3EYWA 3OVMA 2XODA 1AKRA 4DIKA 3D7NA 3NHJA 1TLLA 1T5BA 2HPVA 3QFRA 4DY4A 4LA4A 3UXHA 3B6MA 2Z9CA 4HEQA 1C7EA 1RLIA 1SQSA 1CZRA 4XDGA 4LTMA 3FW1A 4Y9UA 1CZHA 3OJXA 2B3DA 3OWXA 4C0WA 2QX4A 3N3AC 2FLVA 3W78A 2OHJA 1QBGA 1CZUA 1CZOA 1XYYA 1AG9A 3GFSA 3HA2A 3JSXA 3LCMA 3OX2A 4PTZA 4YAOA 1RTTA 3N39C 3F6RA 4QOGA 1C7FA 3NHFA 5LVAA 1H69A 1YDGA 2OHIA 2QMYA 1H66A 1FLVA 1OBOA 2KQUA 1GG5A 2Q62A 3F2VA 4FGJA 4XDHA 3UXEA 2QX9A 2GSWA 2FDXA 3HR4A 3N3BC 5F51A 4OXXA 3KAPA 4LAFA 1J9ZA 2RG1A 1YOBA 2KLBA 1AKQA 1AKVA 1DXQA 2R96A 3OX1A 3NHUA 3GFRA 3P0RA 5BUCA 2OHHA 1FX1A 1AKUA 1ZWKA 2F1OA 2FAXA 2FOXA 2HNAA 1J8QA 1QHEA 2Z98A 3ESYA 2N1MA 3F90A 3FVWA 3GFQA 1OFVA 5EA2A 1BVYF 1J9EA 2Z9DA 3U7IA 2MT9A 4C14A 4ZVNA 1CZNA 5LLDA 2OYSA 3FNIA 1E5DA 1XT6A 2QWXA 5A4KA 4ESEA 2Z9BA 2W5UA 4M0CA 6NULA 1J9GA 1KBQA 5FUQA 1WSBA 4QODA 2BPOA 4LTNA 1DXOA 1FTGA 1XYVA 3LT5A 4YAWA 1AZLA 5B3LA 3NHPA 1FLNA 1F4PA 2QX8A 4QOEA 3OWHA 5FA6A 3NFRA 4N82A 1FLAA 1OBVA 1QRDA 4DILA 3NHKA 2FVXA 3NLLA 5EAIA 2V5VA 5LBUA 2ZKIA 2ARKA 3QE2A 3B6JA 1V4BA 3KEGA 3KLBA 5F12A 1ZX1A 4F8YA 2X2OA 5NULA 3NHLA 1YRHA 1WSWA 4U7GA 1VMEA 4D02A 4H6PA 4FGKA 1FUEA 4BMOB 1RLJA 1D4AA 1T0IA 2FCRA 3K1YA 2QX6A 4FGLA 1I1OA 4ICIA 4N65A 4S24A 4ZVMA 1TIKA 3K20A 4GI5A
chains in the Genus database with same CATH superfamily
1HE3A 4ZVTA 1DEKA 4C08A 5LYJF 1SVKA 2ZRBA 3OCVA 3NJ8A 3BPSA 1GCIA 1WP4A 3EQ9A 3MUFA 2A7QA 4EZBA 5I47A 3CKKA 3AM1A 3K9BA 3NAGA 4XI9A 4P5DA 5D8DA 3RWOA 5BW4A 1TFUA 3OIVA 1IEXA 4MLZA 2CLFB 4L5CA 2XKAA 4FN5A 2ZSIA 4WL0A 1U7OA 4TLBA 3CURA 3ZHSA 4KB5A 3JQ6A 2HA0A 1P1KA 4CCAA 1C1DB 2OQ2A 2XQIA 1PZGA 5IFLA 1KGSA 3L41A 5DYGA 2EKDA 3EZXA 2VAPA 4ZMBA 1KEWA 4DQKA 1DKPA 1CLEA 2LIVA 3C4JA 1NZDA 1JA0A 3AESA 4RLQA 3ZCTA 1PYGA 4CLOA 4I9NA 1E8MA 3WXBA 2VNHA 3P2YA 3BREA 4RH0A 4RTJA 4OFBA 1KJ8A 3OX3A 1JQKA 1Q3KA 3ESZA 1L5YA 2YHUA 3Q3CA 3GBVA 3QVOA 4LCEA 4PGGA 4ZYXA 3IAUA 2PKQP 1MX9A 2ZDGA 3INYA 4KXYA 4U4AA 3FIJA 2XNJA 1TTTA 4I1UA 2LWIA 5FWXA 4ZQFA 5HIMA 1TT5B 1YB2A 2E1PA 3L7DA 1JVNA 3D8UA 4IY1A 4Z7JA 4X66B 2EX1A 1CB0A 2P8SA 3Q87B 2FETA 5I9NA 5IS2A 1E9RA 1W49A 1XKLA 4IDAA 1OILA 3R7AA 5EGNA 2HU8A 5LQNA 3S1SA 1J1IA 1WF6A 3K8YA 4CHTA 4EX7A 4TM8A 2BR3A 4B32A 3R5SA 1PJSA 1E2GA 3UXHA 1MB4A 2G77B 2UZ1B 3Q3VA 4GO1A 4KDCA 3IIIA 2JEOA 4W5JA 1B26A 3VO1A 4DGSA 4E21A 4OB7A 1XTKA 2ZXFA 2I6QA 2ILVA 2RHMA 1NYRA 4EVRA 1FXUA 1ZVJA 4ZP1A 1K9SA 4NARA 1KL7A 4MDEA 1QNLA 2MU1A 4Y2VA 3WGLA 3MPUA 4BVKA 4RZ3A 4Q12A 1C9KA 2QDKA 4WE3A 4P86A 1C8BA 3RIYA 2C9BA 1EFDN 1U65A 1XN4A 4TMFA 5LD2C 4A36A 3WE7A 1KC1A 1U81A 1NN3A 3AM5A 3BK7A 5ENDA 3K31A 4LXIA 4NK4A 6ABPA 4RGQA 2R48A 1IHDA 5FQOA 1CUFA 3CZMA 3QOXA 5C80A 4IL5A 3REQB 4L4XA 1MA3A 1RZUA 2EJTA 3QYFA 4JU8A 1C0EA 3D6TB 1L7AA 4KX5A 4NR0A 1UQRA 5C4GB 2O2IA 3BL8A 3I6YA 4KRYA 2NQ8A 3VBCA 4L3VA 4M1KA 1ZRHA 2JRLA 2UVQA 3WP0A 3IEKA 4FS8A 5B3LA 3UPDA 3KSBC 2HJWA 4ZGGA 2WVAA 2JEZA 1O3YA 2DFNA 2X7XA 3ZE1B 5KVCA 4C4SA 1YS4A 2ARKA 4YRMA 4F93B 3JX9A 2H5IA 4JCCA 1W94A 1TYDE 3U49A 4AS2A 5E1DA 1SOVA 1MEJA 2B3TA 1YAJA 4HN9A 3V34A 1S7GA 1XZ8A 4Q7MB 5BVGB 4D9GA 3MK31 1FRZA 4FJ1A 2ZRNA 3O0DA 1VJ5A 3U6BA 4LYDA 4TSFD 3S27A 1KPHA 5FI1B 3SR4A 1ZUHA 5EVJA 4D2IA 2R7KA 2GLXA 3DHYA 4LHXA 2R62A 3L8ZA 3ABSB 4ADSG 1JEOA 3DAHA 1UJMA 3GCXA 1J09A 3G0BA 4UFNA 3ZHCA 3F5DA 1ZGJA 2J9GA 2QXYA 5I5EA 1GRNA 4FEEA 5ERYA 2DOKA 4Q1EA 1XZJA 3A4VA 3LBIA 3TRHA 1E3EA 4TQAA 2ERCA 1Z62A 2VQDA 4ZQGA 4FHDA 3F6EX 4PYLA 4A73A 4YQYA 4Q4JA 2HDHA 2HC9A 3T1HB 4B09A 4QECA 5CDHA 2QN7A 4TRNA 4DDUA 2I67A 2VEOA 2JLQA 3MD9A 3QENA 4TS3A 2AN4A 5E6SB 1Y1TA 3OBIA 2RG7A 2EZTA 3ZWWA 3TNYA 2QPLA 2HCJB 4IVQA 4F3TA 4RD6A 4QDUA 4MRSA 3IT1A 1BMDA 3BL6A 1NJ5A 3BMNB 4IIDA 4L15A 4LK3A 3NTLA 1YKGA 1EFPB 4KWCA 1H2ZA 4QHTA 4Y6LA 5FFNA 3I6IA 2YV5A 1M6HA 1J8DA 4HWKA 4ZARA 3TSAA 2G25A 1PCXA 3VR4D 4ACAA 5HZKA 4AUMA 1T9CA 1OYVA 3GWZA 4P3KA 3QEAZ 1K2VN 2FW1A 3U0BA 1ADFA 1YE5A 4ZXFA 2PJZA 2NO7A 5TPZD 1RRCA 1Z82A 3RROA 1MH9A 1KYIA 1KK3A 1DTEA 2AFHA 2DT5A 2RHRA 3QYPA 5ALNA 4IPTA 4X7RA 5L7YA 3H5NA 2PKWA 2LGJA 2ZJ4A 2BGIA 3QJ5A 3NTUA 5ALJA 3ZV5A 2Y4OA 3WRYA 1G7TA 1HMYA 5TVGA 2HJHA 5FT9A 1SUFA 3GELA 4DEYA 5JW6A 1MUUA 3O1IC 3QE3A 3MFQA 1N34B 3O6VA 4OQPA 3UAZA 1UFVA 2ZYWX 1BOOA 5I7SA 4JI7B 2I54A 3LWBA 2JBHA 3DR3A 3EAGA 3IMGA 1JMYA 2JH8A 3JAMA 1RTTA 2CE7A 3S2ZA 4E2XA 3OMLA 1U7WA 4MSUA 3MT9A 4YMGA 9ABPA 2BL4A 5FADA 3T3NA 4XGNA 3O8DA 5EOVA 3IMKA 1YIAA 3QBDA 4JR1A 1NJ6A 2OAGA 4E4YA 4TZTA 2YJ5A 3F9RA 3RB8A 2IYWA 2ZGVA 3F7OA 5GONF 3L0PA 3MWEA 3RKSA 1XLTA 1LV7A 1SBTA 4B44A 2SCUB 3FG9A 4B8WA 2BH2A 1WLYA 2PYDA 3P2IA 1EFLA 3GUCA 1GOTA 4N5IX 2O54A 1NR5A 3AERB 2C7PA 1XNQB 3U81A 1REQA 4KQMA 3F47A 3E18A 1ZJZA 1BJRE 1YHNA 3QLEA 1RACA 2G7MC 4D0SA 1CZNA 1UBJS 5CHYA 2BJHA 3EXIB 4NBNA 1NQUA 4F2WA 3ESDA 2I6SA 4M4SA 3ZDYB 2ZFUA 3KC2A 3QMPA 2F4VB 2HSGA 1ODLA 5EKXA 3ZTTA 4D8YA 5IU6A 3VSDA 3K5WA 2CMHA 3G1TA 4XEUA 2HV8A 4R4JA 2IF0A 2G80A 2ZUCA 5E6SA 1RWWA 1VYTA 2B5WA 4A0FA 2XB2A 3W6PA 5CB4A 1GU1A 4R1MA 1JG7A 3R9XB 3CTPA 3L05A 1XCMA 3F78A 5JD4A 1EXMA 2Q1WA 5BW6B 3OEED 4BMYA 1DO2A 2XWSA 5CFRA 3DDOA 4U3JA 3ZJ5A 3PRYA 1X7XB 4W5RA 5LDGA 1RXEA 4QOJA 5B3JC 3TAUA 4JLPA 4P7FA 2F3TA 3WTCA 2OSVA 4E5YA 3OURA 2XGOA 5SY6A 4HJRA 1SH7A 1CR2A 5F23A 1ZD3A 3WICA 3RYCB 1YJAA 5CT5A 4MGZR 1DFGA 3BGDA 4FQ8A 1WB9A 4MVCA 1SXGA 4N40A 5IWAB 2Q2NA 4MV6A 1WVMA 4IJWA 2QVBA 2VP2A 3PSHA 5KMGA 3RDPA 1W4RA 3E7WA 3P4YA 3QX8A 4HMPA 4Q05A 2V6BA 4D57A 3A32A 3PUHA 4IRXA 1JTFA 4EHDA 3ZC3A 5GIPE 1H2HA 1WHTB 4IUBS 2XCLA 1NW8A 4G07A 4B6RA 3C48A 2VNAA 3WGNA 1ZSNA 4WX2B 1U02A 3F6SA 3NC0C 2P1RA 4UTXA 5LLSA 2BFWA 2XQVA 1H2RS 1SU4A 4L0QA 1JQ5A 1KI6B 2WV7A 5JI2E 1W19A 1NRJB 2QPTA 5CT6A 4BVGA 1P61B 2BFFA 1RIIA 2J6BA 4R9NA 1L4FA 4AYWA 2BOVA 5JH7B 1PWEA 3Q3IA 4KVFA 4G8CA 4CI0B 2R86A 3ENVA 4LRQA 1ZINA 3GJTA 2P41A 2Y93A 3GJZA 4N5NA 2EYQA 2Z3ZA 5EUQB 1B1CA 2OPHA 5IJWA 2ZANA 5E6UA 3W2IA 4D81A 3W5IA 4DQVA 3SVLA 2A5DA 5FBLB 2QMOA 1JKFA 4BMPB 2NNLD 3UJDA 1EG2A 1PFQA 1FMTA 5JSZA 4O4JA 3ZGLA 2CGEA 2R8EA 1FTNA 1HT2E 2ZVPX 2IYNA 1QYCA 4DQDA 1BMTA 2Q3MA 3HB1A 2MDTA 5IJ0B 4WCFA 3Q7EA 4XTCS 2G88A 2J3IA 2XGMA 4BN5A 3EZ6A 1YJBA 1T1GA 3LV8A 3CLRC 4MKHA 4CLEA 2Q4RA 3NAQA 2EEPA 1UDRA 1MPXA 4K9RA 5KBYA 1S2GA 4QOGA 3ZY3A 4XVCA 4GXQA 4QDXA 3VTAA 2WT8A 1QFJA 3CC8A 4XX0B 5EZYA 1R3UA 4MLDA 4C4PA 4UTOA 1I5EA 4E1VA 1P2BA 2XMRA 3BD6A 1CCWA 2IODA 2XX3A 4TM7A 1MZVA 3FFWA 3K0AB 3L7AA 5HRUA 1JHOA 3P0EA 4B76A 4Y2PA 1XFAA 1N9KA 3R0VA 4UQPA 1GIAA 2PMWB 1NKVA 3L82B 3RR2A 2TYSB 4ZAZA 3UC9A 3RHSA 1X8KA 4TWBA 1RXSA 3AJDA 4XA8A 2H2FA 4CV3A 1Y5LA 2FR8A 4O8ZA 5TY0A 4S1NA 2G17A 2D4HA 3OQBA 3KYCA 4NPHA 3AMVA 4EGAA 4C7OB 2VYCA 421PA 4GVPA 4BB0A 4FFMA 1J5PA 2ECFA 5AM2A 1DT3A 2JVKA 1ES9A 1QZ3A 4JITA 1QZXA 3CLSD 4QFDA 1J49A 1Q6YA 4ISBA 4NESA 5HDQA 3B5IA 3IALA 1F12A 1XHLA 2OZLB 1EGQA 4J0QA 2JCYA 4MCJA 4TYWA 3NALA 2GBLC 1F7VA 1E6LA 3ANMA 3OFSA 2B82A 6PFKA 2JC3A 1H6DA 1UK7A 3ED5A 1L7XA 2VYVD 4R6XA 2CV0A 5H82A 3DUWA 3PD0A 4L9SA 1VSBA 5C1PA 5EHXA 3GLHB 4P3YA 3NM4A 2CXQA 3NWBA 1HURA 1XZPA 4TKUB 4Y9RA 4JIMA 2ZB4A 4Z9FA 3B9PA 3W79A 3ZNQA 2JHCA 3V48A 1UXOA 4CG1A 3A9UA 1U1FA 1B2RA 1ORDA 1ECLA 2UUPA 2GH1A 4JJ8A 2O1XA 4L51A 4OFWA 4MKRA 2FZ5A 1ZIOA 4IHAA 2PXAA 5HMLA 1FP1D 3JARB 5DWDA 1U31A 3LHIA 4HV4A 3QUBA 3KVVA 3M6MD 2WFLA 3T3MB 1NBEA 4BO3A 5AJHA 4UHFA 2OG1A 3TQHA 1WPXA 2VF4X 1Z6QA 1JNYA 1XZDA 3FNFA 3IAM6 4GP9A 4LZOA 3I9FA 5AOAA 5HXAA 4QXRA 4DLKA 4GM4A 1VDMA 2BE7A 3T94A 3TQRA 2I78A 5FWAA 1QAMA 5KEIA 4JEMA 1XJ5A 4IKOA 2P9CA 3UUGA 4J0HA 4CTKA 2BP7B 2IGBA 3LRXA 4RK5A 4RACA 2E5LB 4C20A 2QUBA 1XHEA 2CXUA 3ETLA 3DKVA 1A5SB 3DEZA 4CETA 2VUIB 4GR5A 2P2GA 1DKUA 4RJ2A 2WVJA 1YXMA 2UYQA 4BRWA 3T5MA 5DLEA 2ZROA 2DP4E 1JKMA 4A2PA 3AXTA 1N1GA 1MT0A 4J03A 4R31A 5LSAA 3K05A 2JI8A 3A6LA 3V9PA 1TJ5A 3IVGA 4YCLA 4YX9A 3MHTA 4IXWA 4Q7LA 1Q95A 1COWA 1YMQA 4HTFA 5KX5B 4XDZA 2F8MA 2OESA 5A4AA 1ISGA 3U3OA 3E27A 2QTLA 4F92B 2B3DA 1BQEA 2ZVQX 4Q47A 4DB4A 1O5TA 1WZEA 1ZIYA 2JIRA 2RHGB 4B7AA 1QCDA 1XDWA 1X1TA 4LX8A 4N03A 3VR1A 2Z58A 3LAWA 5TV2A 1VM6A 4MMZB 4DC1A 1N9GA 4HAIA 1ST3A 1VG9B 2OC9A 1O6FA 3ENNA 3GVXA 3NBAA 1JQ3A 2OHFA 4PSUA 4RO0A 5EE3A 3DTVB 3P0IA 5HFNA 1U0NA 4Q9JA 3VR4A 1X14A 1QSGA 4LXQA 1NP3A 1PT6A 4B82A 5KZMB 1MRSA 4P9NA 3HU1A 5CU7A 2YIDA 5K8IA 5I6DA 3UFXA 5KKAA 3ZVRA 4DM4A 2GCEA 1C7QA 1Z5UA 2WPNA 3ZY5A 2MMCA 2PBFA 1Y0BA 2NTEA 2C5SA 3CB4A 3F74A 4JMLA 4H1WA 1Z0DA 2J3DA 4KBGA 3G1WA 5FYQA 3WC4A 3ERCA 1QV9A 4BL5A 4CRWB 3WGMA 2ZIVB 4EJ6A 4ZZIA 2A6PA 2BMJA 5K0SA 3RVOA 1SC9A 3UUWA 4AN1A 3B3QA 3RRXA 4P8RA 4JVOA 4ZVVA 5B64A 2OC4A 2W48A 3GLSA 3QFHA 1FTGA 3WIVA 2IOQA 1AK1A 3FNBA 4DABA 5ALEA 3BBLA 5HHTA 4FILA 5LXTB 3AUAA 2O2ZA 4MRMA 5JYCA 5DGIA 5IJZA 3LT1A 4QT0A 2EWMA 4UBLA 1E2HA 2JJ1A 2E4UA 4F9GA 1H6CA 1SXIA 1Z4OA 2I4LA 1FTQA 2H00A 4D02A 1A4RA 3DDUA 3T1TA 5DYWA 1DIAA 1TU4A 2CBXA 5AW0A 2RONA 3ZBUA 3LH5A 1TJNA 3L79A 4MVJF 4TPKA 2PZEA 4CV0A 4M7RA 4MUHA 3K0KA 2DVMA 1EGMB 3B48A 4FGZA 3UV3A 5IC4A 1CEXA 1C1YA 1RWQA 2ZWAA 3QVSA 3BGIA 4Q00A 1B14A 4MARA 4YMVA 2OGUA 3OQ1A 2POCA 1NULA 3PNBA 2B6NA 4JUCA 3K53A 1MO6A 4EKNB 4Q1CA 1VQ1A 4Z4IA 3VA7A 1DCTA 2OHXA 3DMYA 2H7XA 5CAEA 3H2BA 1PFKA 1P1JA 3O26A 3VHQA 4A7PA 4V1CA 1PZNA 4K0RA 3OZEA 2G1PA 2QNRA 3BH6A 1EP9A 3PF9A 2I4TA 4LQDA 2IY9A 5KTYA 3K9QO 2J09A 2PMCA 2NYUA 621PA 1UP6A 1VLMA 3O9MA 2EBWA 1HLDA 4GLOA 2ZUVA 2CXOA 3KJXA 1IG3A 2M6LA 3O82A 1X9GA 1LLDA 2P77A 1BTOA 1F9AA 1BSVA 3G88A 3NPMA 1J8MF 2WNHA 5HTKA 2OZPA 1GCOA 1C9MA 1DRJA 4NAVA 5TXGA 1HFKA 1VPVA 3ASYA 2VT6A 3FCUB 1IDOA 1V7PC 4HVTA 4LZJA 4PLCA 2EFDB 1THTA 4GLFA 4K3UA 2ZKLA 4N48A 1ZRSA 4CKWB 2YHAA 5KQGA 1Y48E 1NM5C 1PZFA 4EF4A 1PR1A 5L4NA 5ILQA 2KE5A 2HTEA 3L6OO 4RIHA 3ORFA 3CF4A 1OH6A 4LMRA 4KAJA 1S8AA 1GRQA 1Z2CA 2UZIR 3CWCA 4YCSA 4KXVA 2AEMA 5I8WA 3NHJA 2Y66A 5G4KB 1JEYB 2DWUA 3B6MA 1EPUA 1U6JA 3WRXA 3FWZA 3J7TA 3CSDA 4XJVA 4OJKA 3IHWA 1ZXLA 2OLKA 1J24A 1NL3A 1QKJA 2OO5A 4NE9A 1ZESA 2OE2A 1N2BA 1J39A 3T1QA 1QQAA 1WPGA 4WQMA 4PAQA 5DTRA 4LVOA 4Y6GB 4UNIA 4QTYA 4MW1A 3IMCA 2PDAA 3DLTA 2B1IA 1OASA 2WU0A 4BKMA 1EZ4A 4FIZA 2GNAA 4IGEA 2I2AA 2H1WA 3TOCA 1VPTA 1UBFA 5JY6A 5F9HA 1IM5A 1Q1AA 5KINB 3PQFA 1PVVA 4NH4A 3SC6A 2DLDA 4KO3S 4FI3F 3M0EA 3LOQA 2XLBA 2GAIA 4H35A 3CFYA 3BF7A 1P4GA 4BYMA 1XQXA 3JQEA 3A3OA 3DT9A 4PYOA 4QASA 5AUQA 3FPCA 2GA8A 4R51A 4ZGWA 4KRFA 3W5BA 3JAWA 2D0IA 2W22A 1A1SA 4BJ3A 5EPUA 2PPVA 1Q0QA 2GZ3A 3DBHB 2ZREA 4C3ZA 1LDEA 3T9AA 2X4LA 3FI0A 5DEOA 121PA 5LZ8A 3MMXA 2YR0A 4RLHA 2GPYA 1Y4UA 1QGYA 4PSVA 2NSHA 2W2VA 3ET4A 3LY9A 3NHLA 2GHQA 4MQUA 1AF4A 2EKPA 1PSZA 3N7AA 3ZBQA 2AN3A 1KI4A 2FLKA 2YZMA 4FFRA 3GLIB 2HN9A 5B53A 2IS2A 1F2UA 2R6HA 5ALSA 3AQIA 1F4VA 4JYBA 5FCDA 4G0OA 5CX1B 4AJ1A 2RHTA 3CU5A 1TVEA 1XKXA 2OXRA 2PH3A 3RIEA 2CJFA 1CTQA 2XA1A 1L7EA 1GNSA 4C01A 2XWPA 1NW7A 1IZ9A 1Y8QB 3AIIA 3M89A 4LTDA 4HB3A 1YR9A 3DO6A 2X2PA 3FPHA 3D6JA 1Y9AA 4DYHA 4NZZA 1TO1E 4WY5A 1W29A 3ZCRA 2ZBEA 2NSDA 2FFQA 4V1CI 3RBAA 4NIMA 1XCBA 3H17A 3TOVA 4Z3OA 2W37A 4KNVA 4RTQA 1OYWA 4C2UA 1GM5A 3PUZA 5DGDA 3H5TA 4HZGA 4KXUA 1IFXA 3C6QA 4CIVA 3WGQA 4Y0NA 4BEBA 1JRLA 4UBIA 4QEKA 3FSRA 5AKEA 3ZDDA 2XITA 4PHCA 2VSQA 1YL5A 4F56A 1WIWA 1I14A 3RK1A 4EBFA 4PZEA 1KPIA 4QOIA 3KHSA 4UOQA 3UWSA 5GADl 2AFIE 1QHHA 1M2WA 1FSZA 2FR1A 4M1YA 2GVDC 5B36A 2DHRA 4D3FA 3VXKA 3R5JA 3EVGA 5L4SA 1ZHFA 4I55B 4QGSA 5DXAA 1X1AA 4ENRA 4OGFA 3NOQA 5E7IA 2OFXA 3WDMA 1X1BA 4FDAA 3JWGA 4LK2A 3WHLA 2GZAA 1M6YA 1R0LA 2MHCA 1LA2A 2QRPA 4JT4A 2IIQA 4WBNB 4WLNA 1HZJA 4ID9A 4E70A 5JQGF 1OLSB 1SPBS 1T3TA 4JVMA 1J2EA 1VIVA 4KN9S 3RREA 5JALA 3AXSA 3QKIA 4FFDA 1YOVA 1E9FA 1L5OA 1RVV1 1EM8A 1RFLA 3AEKB 3LT0A 4G5GA 4KDRA 4M87A 4N5LA 2FQXA 2HMWA 4R68A 4C03A 5CM9C 3TDMA 3ZWKA 3L1IA 5JISA 3FXAA 1KTIA 3HEMA 1XAJA 1YR2A 4NDAA 2FFRA 1L9KA 3EW9A 3ND9A 2BGWA 4IS2A 3UAXA 1D8AA 4BLTA 3TLGA 2RHLA 1FMLA 1BE0A 1A4IA 3LNCA 3JVUA 4FT4A 4PGFA 4WBXC 5CCEA 5K8VA 4C30A 2FNAA 5KWIA 2JLRA 3U4QB 1F2VA 3CR3C 2OHJA 1I3LA 2QORA 2ZDHA 4P83A 4AJ9A 2CVHA 3U4DA 1OBCA 2E89A 4A6PA 3DOUA 3KE9A 2IV2X 4M1QA 5HJ5A 2PUBA 2QZ9A 1DBSA 1NU6A 3TXAA 1NSYA 1GR1A 1ODJA 1VZ2A 4M49A 3KXKA 4MEAA 1TM5E 4GOXA 1Z37A 4D9NA 5KREA 2BGTA 5A62A 3NGLA 5CVJA 4E4RA 4KREA 4EAQA 3PK0A 2WUVA 2JGFA 1JEJA 3T5GA 2VF7A 2VTEA 4X84A 1AKUA 3EPKA 3HCPA 3U1VA 2WG0A 5KI6A 3JW8A 8ADHA 3HXMA 1HEIA 1BVYF 3X1XA 2EF0A 4J1SA 1P31A 3BYZA 4FUQA 4PX9A 3SIWA 2E4WA 4QBHA 3KZNA 3NRBA 1QKIA 2EQ5A 1R6VA 1PLJA 1XXHE 1ZJ4A 3AYXB 1BW9A 3DVLA 4L0CA 4XIJA 1DIRA 1JDUA 2PXXA 1N1EA 3ESQA 3NHPA 3UATA 4M7WA 1EAMA 4Y2JA 3RI3A 1FJXA 1GEGA 2D5AA 3NOXA 4GZ6A 3W1EA 1BFUA 1Y6RA 1FP4B 3C7TA 1IK4A 3NXSA 4ESOA 2DLCX 3F1LA 5KNBD 4OLAA 3HO6A 4RD3A 4QVIA 3UMBA 4MR9B 4KR7A 1O0BA 3CW9A 1ZMRA 4H1UA 5EIOA 3REQA 4Z53A 1TPZA 3LKBA 1PK8A 5IF9A 3ZWOA 2FTKE 3FETA 5ABPA 1WVIA 1MAHA 2C0CA 2X9GA 1S6YA 6Q21A 4MPTA 3KQKA 1T4GA 4BO9A 4CTMA 1KMHB 4XWYA 2RARA 2C4MA 4XJTA 3GP5A 3HM9A 3M6IA 4V02A 1JW9B 3PC3A 2YWHA 5KMGB 1SNYA 4X44A 5B4UA 4UBNA 1L0BA 1LV8A 1HEYA 4F21A 3JD3A 3SVZA 3WQBA 4XGQA 4GNKA 2BV3A 1M34A 2AEFA 3KT3A 4IXDA 4YUVA 3W9UA 5HKBA 2ZVJA 3LQ4A 3O31A 1KS9A 2P67A 3C8UA 2JFGA 3BZBA 2P69A 3QKSB 1YV9A 3R09A 4MV5A 4MQ4A 3W2TA 3ZCUA 4B71A 1OGIA 2ZSBA 3FYSA 2B4RO 1TK9A 1Z0ZA 3HNOA 3L93A 4IDHA 5JWRA 3RJTA 3BJRA 2AQ8A 3VKWA 1H05A 2YQ4A 2ZR9A 4QO8A 1XNGA 2ZRPA 3RIGA 3UOGA 5HKKD 4RQAA 1OZ0A 1UZNA 1X92A 5CXSA 3RV3A 2W4QA 3CRQA 1K8YB 3NANA 3PXBA 4JVSB 1UMKA 4PS0A 3UJBA 2VP9A 3PV0A 3L7OA 1FS6A 3K94A 2O2GA 4OFZA 2PMEA 4MRPA 1P1RA 3U9LA 5HIAA 4UHDA 3QG5A 4CCWA 3EFOA 3TZEA 1G98A 1UBRS 4R7GA 4F3RA 1A9XB 1WUIS 3LU1A 1K6IA 1V0JA 3H8VA 4LZZA 4TLAA 1V8PA 1VCOA 2GK7A 3G2PA 3ZGYA 1F6DA 3JVEA 3OUUA 2D3WA 4RGVA 4FBGA 2XODA 4HAZA 4XAQA 1HE2A 5KJCA 1L8OA 4IJUA 1KIFA 1RKUA 2I7TA 3AEQB 3HDQA 4RYDA 4ZAWA 1TU0A 3EIFA 1WB6A 2HA4A 3WDKA 2JBAB 2OV6A 1JSLA 3MW8A 1JFRA 4G86A 3BGOS 4BNDB 1CDOA 1EM6A 4II7A 4YAIA 4JJKA 3K0SA 4I14A 5E38A 2EQBA 4AG6A 1FTWA 1COWD 3IDZA 4G4SP 4OGWA 1BU8A 3QYJA 1QTQA 3I5UA 1NLUA 2I1LA 6REQB 1EFRD 1ULAA 1OBHA 3DE1X 1DWUA 2TMGA 4ARZA 4CIAA 1A9SA 1ZKDA 2GSWA 3FPSA 3HWX1 2QW1A 1E7MA 3QPDA 3U7QA 5C37A 1G5PA 2ZDQA 2ZRMA 3SP1A 3RAEC 1SVIA 4UE6A 2OOSA 3DMTA 1ECPA 1V35A 2OCAA 2PGXA 4RPLA 5A04A 2P91A 2BIFA 2V7UA 5KOHB 2Q8NA 4JYMA 3ENZA 4MHOA 3SQLA 3OCZA 3CF4G 3RNOA 1KYTA 3R7NA 4RNDB 3WS7A 2GCIA 1Z5ZA 5FUYA 4UREA 4KFTA 5BMVA 2C99A 5L6LB 1H1DA 3TKYA 3L7LA 4IDEA 1JAIA 4EEKA 1LY1A 5LM3A 3RIXA 1GPJA 1E6WA 4KLCA 4KGXA 5LLTA 1XPUA 3X1DA 1WV0A 5JYEA 1AO3A 1I3CA 4AZSA 3RS5A 3C6MA 1XEFA 3KWLA 2H9AA 3N0VA 4LC0A 3D3WB 1EWYA 4DJTA 4DLWA 2D5BA 2WF5A 1D6NA 1EK0A 2FCRA 3N6RA 2WT9A 4PBSA 1IVSA 2I7DA 4P98A 1AN0A 3GJ0A 5H7XA 4DEXA 1J99A 5EKTA 1QDLB 3GFPA 5BOVA 5LJIA 4NBLA 3V7WA 1QQBA 3KQMA 2WC1A 1UJCA 1YZFA 4BU0A 3GH1A 3IDOA 1PYDA 1L8XA 1XKTA 2QN2A 4P2GA 5IFKA 2JLZA 1ZUD1 1D07A 1JSZA 2RJNA 2PO5A 4V0ME 3TR6A 4B3HA 1QG4A 2RH5A 2J41A 3GO4A 5CA1B 3DDNA 2IHBA 1ZR2A 5DHPA 3SYLA 1NSFA 5FPHA 3FTQA 1P6QA 2JAWA 5EWLB 3KQSA 2KB0A 2DPMA 1WCV1 3MWFA 1T8PA 2ST1A 1TQ8A 4DM7A 1SXQA 3A11A 3CNHA 5CJJA 2PRJA 1NNSA 4HRYA 4ZT7A 3TZHA 2DR2A 4LF9B 5D51S 4EKYA 5FTJA 4M54A 1XLTC 2H0QA 4WJKB 3S4YA 1D2GA 1PJ2A 3H1AA 1L7OA 3SX0A 2R66A 3WYEA 1XVVA 3C5VA 3GT7A 5A9TA 1H8ED 3RK4A 1CQIA 1JUDA 3PR1A 4Z7NB 5DGTA 3MWGA 3EA4A 4HVCA 3EEOA 1I32A 3UHOA 2H2HA 2WD7A 1NXWA 5BNIA 3DC2A 2YWEA 1TE2A 3TD2A 1XVAA 3IPCA 1L5KA 1QGUB 5E9AA 4LOKA 2E18A 1KJIA 1SU7A 1FFDA 2FI1A 5A2GA 1R0KA 1UMCA 4YFVA 4NE2A 4OKNA 4I36A 3OHPA 3CKYA 4GX0A 2G04A 5J63A 2Q5CA 4BQSA 4DCTA 4LI3X 3UMGA 3UXYA 3WVNA 1IY2A 1SZJG 4MDFA 1X77A 2OCYC 4L08A 2H3EA 2P40A 3JQ9C 2JDID 3G6KA 4KC0A 3CVOA 3FHLA 2X22A 3QFRA 4JX8A 4UUOA 2BUCA 4Y2SA 1E2UA 1H0KA 4WW0A 5FOUA 1OD6A 4M76B 1FMCA 2Y6UA 3IVMA 4D3ZA 1GRVA 3DWFA 4JKOA 3WSTA 2W2MA 5KYTA 3UMYA 1QUEA 1RRVA 3EA0A 1TI7A 4LN1A 1YTLA 3BRCA 1M74A 3ETNA 4N7RA 3SHVA 3EEIA 5AM0A 2QTCA 4XWTA 5TMBA 3CMMA 4ZI2A 3WLMA 3WL3A 5L3QB 4J90A 1JE1A 4R05A 1OXKB 4LHSA 4MQEB 1SBHA 5KDDA 1QTIA 1MEEA 4XDYA 4CEIA 3BZUA 5GAJA 1RYBA 1B8NA 2Z83A 4DSNA 4KQ9A 1ANKA 2WMYA 3DVAA 1LK5A 2ILTA 2XVXA 2ES4A 3EUEA 1QO9A 2JFOA 2F1OA 2XDQB 4JL8A 4XLLA 1PVOA 1E2EA 1F38A 2F90A 3QFFA 3D2BA 4IJVA 3B1ZA 5AO9A 4YUZA 5K3OA 2P6OA 3EAFA 1GZ5A 3QXXA 2JIDA 3STVA 5BT8A 2QT0A 7MDHA 3AFNA 4JX9A 4RD4A 2NP7A 2AZTA 3DH0A 2B7CA 5AH0A 4CWAA 4OXQA 3EN0A 5I4BA 5FEMA 1LTHR 3EDYA 3GL9A 1TUBA 2VBIA 1GKLA 2ZI7A 3NIWA 4GI3A 5JNUA 4F4IA 4JJIA 4PIMA 3V1NA 2PCLA 5FNVB 4O2BF 4K46A 3T52A 1WETA 1L1RA 2O2CA 4M53A 1AK9A 1HSZA 4GG1A 4RVUA 4FGLA 5F33A 1L7NA 5DXJA 5TS2A 3IJ5A 4L72A 3K6RA 1KWKA 4HEHA 1H0RA 1P1BA 3I1IA 3W5HA 1WHSB 4B3BA 4D4KA 3TH5A 3B2QA 5KOJA 2WE7A 1G5FA 3MB5A 4C5CA 5JATA 1GP2A 1SHUX 1QDEA 4U5XA 4BMDA 4QRHA 1A8QA 4GR4A 2AT1A 4I2VA 5K9ZA 1R15A 2H59A 3N0TA 4ZREA 4GYKA 3PC8A 4NCXA 3FPLA 5IHXA 4PRZA 7REQA 1TZCA 4UFPA 1SC3A 3S2IA 1MKYA 1NMZA 2BDTA 4RFSA 4LCJA 1Z2OX 3B3FA 5ALRA 1XPRA 4K5QA 5DNVA 2C7QA 2Y92A 2FSPA 4DE5A 1FNDA 2O57A 4X1IB 3W9YA 4D45A 4XD7A 2BMAA 1BXGA 2GUWA 1DGQA 1E6MA 4N9QA 4CEJA 3ELYA 4TUYA 4ZCMA 1SWVA 2H2GA 2QHXA 3OCCA 1FRNA 1UDCA 3TD9A 4EB0A 3IC5A 4Z49A 4KITB 4JXXA 4CM1A 4IHQA 3O2NA 4GYJA 2A59A 4U7WA 4MV9A 4OHVA 5FV7A 1HI9A 1QAOA 3WIDA 1GKYA 2OSBA 4C0LA 3IB6A 1QANA 4BZZA 5FNVF 1T34A 5SZIA 4RUKA 3IPAA 3OSZA 3FJYA 4QICA 3JASA 1Z0UA 2Z5FA 4PG7A 2GAAA 2A58A 1L5HA 2IQ5A 3E5HA 3QKRB 4YREA 3H86A 4X7PA 3B2EA 1SOAA 2V7WA 3OA0A 3P32A 1I7NA 1WY5A 3TNFA 4D8XA 1X7YB 4Y1RB 5AM3A 4V0MA 1AKWA 4CFSA 5JJ5A 4IOJA 3KAKA 4YA6A 2YWXA 3QUTA 4P4UA 2VDUE 4PSCA 3N6XA 3K6KA 3PR2B 3H19A 4Q3AA 3TZBA 1AO0A 3K96A 3LPDA 1CYEA 5IWCA 4OMDA 1UWKA 3OTWA 1B0PA 2REQB 2V55B 3H42B 2OCGA 2Q5OA 3L3BA 2J07A 1O03A 1G7CA 2VUTA 4KUHA 2IX3A 2BFOA 1H4SA 1ZRNA 2ZTHA 2VP6A 1P1FA 5BNWA 3V1MA 1ONPA 3R0ZA 4ZVOA 1K6EA 1C7FA 4GPEA 4M86A 3TWOA 4IHJA 1LK0A 2YN2A 1SUEA 1PT5A 4JQSA 1VG8A 1U5BB 1UBSB 2GRJA 5EZ5A 3L7JA 3VH1A 4O4HF 4JDUA 5AVZA 3H2SA 2PTHA 3TZQA 4FS3A 4YJ3A 1O1YA 1NQAO 1YOBA 3N5CA 5CEFA 4NCHA 3X1KA 1URPA 3RSZA 5FJJA 3L7IA 4IEEA 1LXCA 5ADVA 4RHTA 2VZEA 2PVCA 2FSFA 2NV0A 1SCIA 3LCUA 4MQLA 4IJMA 5D1NA 3ZJYA 5C53B 4A26A 4US2R 6GPBA 1J9EA 2NZ2A 1WB5A 3EDQA 3ZWDA 5EHGA 2QJOA 5EUCA 2WKRA 5B3JA 2OGTA 5FOWA 2IYTA 5LQUA 2Q2WA 4R01A 4PZPA 1HLPA 1BRTA 2YVKA 2ZRGA 4FJ2A 4HDMB 4IVPA 1Z88A 3ZH9B 3TTXA 1PNRA 2BFNA 3B1YA 1S1MA 3HKDB 1OXMA 4FNAA 4W5OA 1K3TA 1SKYE 2GILA 4MLPA 3GLVA 4OL9A 1CUWA 2C5AA 2XYQA 3LBYA 4GWLA 5A5EA 5BWLA 1E4EA 3COPA 3DL7A 1FUYB 2XMCA 3G7UA 4G25A 4OHFA 4AURA 2DQZA 2J46A 2SKCA 4GPD1 4HMOA 3IE2A 4WNIA 4CFZA 5LIPA 2PU7A 4BMOB 3UCXA 2A94A 2OG2A 2VTBB 1HDXA 1Z0KA 2DPXA 1MO3A 3KT8A 3Q8XB 4M0UA 2YXBA 4IQGA 3EPPA 5GJBA 2BM1A 1X13A 1J42A 2JGIA 2VJMB 3ACDA 2RJ3A 3EHDA 4I50B 4U6SA 4D9HA 3K6JA 2DPYA 1AKTA 2H92A 4MKIA 4PC1A 1FY2A 1FUKA 1VLHA 1X8JA 4TV8B 3ZNPA 5BN4A 2GD1O 2JIBA 2O3TA 1RYYA 3T3DA 1RPJA 3SHQA 3SDBA 2GBLA 2AZXA 4DARA 1M76A 4FD3A 5CFPA 3THWB 3CINA 2POQX 1FB5A 3TCXB 2QLTA 1YRLA 3KDPA 4WLEA 3N7UA 4GLLA 4GMFA 3UNXA 3D3WA 3HXQA 2IYRA 2XDAA 4B80A 4I9HA 3OJLA 3EWIA 1CU1A 3QKWA 2L69A 3T41A 1GTG1 2H9YA 3KD3A 4WKBA 2QJTA 2ZJ5A 4JMPA 1YVUA 13PKA 3QK7A 1KYVA 5KYWA 2NU8A 5BWOA 2PUGA 1II8A 4MVJA 1EXDA 1Y8CA 5KAMA 1Z9BA 1R4NA 3DAPA 3FSGD 3PIIA 5JAHA 4E14A 1FFXA 1F8UA 2OMEA 1JLKA 1P2SA 3VKVA 4GZLA 1KDZA 2BKLA 5BSWA 3UYKA 1DLIA 4I3GA 2BAGA 3ZD6A 1FCJA 1GRRA 2XRMA 3CLVA 2DHDA 4MS4A 4Z86A 5EZSA 2PTGA 2IYPA 4OAOA 3LX6A 1YBFA 1MRZA 2ZSAA 3P4XA 3HACA 4AN0A 3VR5H 3CRNA 4ITVA 2CMFA 1R4ZA 3DHEA 4KMOA 4ZT5A 3V2IA 1E7RA 3WYNA 2B8WA 4DEVA 5BW5A 1EZZA 2CLDX 3DOHA 5LQJA 4MQ6A 1VL8A 1GPMA 3HNPA 5EJ6A 4NDNE 2HZBA 4ZO8A 2VOEA 2YZGA 4E4TA 3T7JA 4AJEA 4M0PA 4RLFA 3ZOZA 1XXLA 2GPAA 1TLLA 2NZUG 2RGWA 6REQA 1ZIPA 3KJHA 4RC9A 3G2OA 2IUSA 3OT1B 2R7MA 4R1PA 1WUKS 4YAJA 3IUEA 1Y3CE 3T9EA 1NF9A 1G3MA 3RYCA 3DCIA 2F43A 5DM2A 4F2HA 2D54A 3ZD7A 4HAWA 4KPUA 1NASA 2I80A 1TL7C 2SICE 4KYTA 1K7XB 2VHCA 3LWDA 2X9VA 2YASA 1MQ8B 3AB3A 1X7XA 4K9OA 2X1MA 5JMTA 3ACBA 5FB3A 1PDWA 3MIZA 1POWA 4OG2A 2WLSA 2H1LA 3NHAA 3QTTA 2I2FA 2MYNA 1OXSC 2MMGA 1OWLA 3WLKX 2NMVA 3CEPB 3LL7A 4R2KA 3MJVA 1R2QA 2FUCA 3CLTD 2XMSA 1A9XA 1KDTA 2PA0A 2J5KA 4GOMD 1KYXA 1QE0A 4FOPA 1U2GA 2C2ZA 3Q2KA 1B41A 4ARAA 4CLHA 3F97A 4HLUA 2WSSD 4ES6A 3VKGA 2AFVA 2P2ZA 4NQZA 5CVVA 3V8VA 1CULC 3S81A 1RBQA 2VAMA 5H80A 1GNRA 3H9BA 5DCWA 4GXTA 4FFBB 2W5UA 4AN4A 4Z9BA 2QG6A 2JD1A 2RK3A 4XUCA 3O3MB 1NQTA 3QE0A 2J3EA 1QTNA 1P75A 2KBFA 2MJLA 4Q1FA 4PG8A 2C3UA 3F3SA 4MUKA 3LPLA 2GJ9A 4NBWA 2BEUA 1L5QA 3UJHA 2P78A 2JK0A 5COAA 3NDJA 3E9YA 1W5FA 3ZGOA 4ZDJA 3EIQA 4JT2A 4IJ6A 4KE6A 1IN4A 1D6JA 1JAXA 1UINA 3IPYA 1T6XA 1N5MA 2AW5A 1JHMA 2VQSA 3T1NA 4QWWA 3ZDXB 1CDDA 3W0LB 1VPDA 3R0IA 2NIPA 3QVWA 4IV8A 4BGUA 2CV1A 3ZY2A 4EUKA 2FQ1A 3TRDA 3BVPA 2DT8A 5BXQC 5KYNA 3RSCA 1ONOA 3ILHA 4ARZB 1MQ9A 1O95D 3CW2A 2A3NA 1FNCA 4JA2A 4UBOA 2CBGA 4TX1A 4Z8YA 5T64A 1NX6A 3B6IA 2J0SA 3B3JA 1T1SA 3H1FA 4O3FA 3RLFA 3AY7A 1D7OA 3S6JA 4JQYA 4F72A 4HX9A 1T1RA 2QEQA 1TKCA 1IXRC 4HNHA 2AG8A 1P45A 1SIWA 5DTMA 4BOYA 1ESEA 4GMXA 5IKPA 2F1HA 4GZMA 1MGPA 5AVVA 3WFJA 3DWIA 4WXYB 3EZGA 2AJTA 4ETMA 2ZYDA 1IUPA 3GWGA 2VT7A 4G9GA 4FFNA 4I1YA 3AR2A 4F4JA 5EFZA 1GFZA 1R6AA 3IRUA 4M1SA 4N0QA 1EVJA 3VR0A 1DDOA 3EFOB 1AGRA 1W93A 3MINB 4HQ6A 1D2NA 3BJIC 1T13A 1KJYA 3C43A 3CISA 5P21A 1S3GA 3UB2A 4ND7A 1AX9A 3ZDFA 4F5WA 4DCNA 1EE9A 1WKCA 3HM2A 4ZDKA 3H9GA 1Z6AA 2VK4A 4TVOA 3IBGA 5G0SA 4E5NA 4KK4A 2EW1A 4ZYTA 5KQPA 1LEHA 4GVLA 1G41A 4Q7JB 4CL2A 1UXGA 5ITZB 1WTAA 4UE2A 2NPFA 4B2YA 4TV9B 1VL1A 1U2EA 2IW3A 3GGCA 5IJXA 2OEPA 4NYIR 1OIVA 1EK5A 4X3OA 4DRYA 4AKHA 4XKJA 1SQSA 2GPSA 1I2DA 2R6ZA 3D0QA 3FW1A 3N2IA 2OCXA 3L8GA 4FONA 4XVRA 2XBUA 5COBA 2YXDA 3ZW7A 2ZS7A 1SUWA 1XYYA 2NO5A 2P65A 5FOSA 4A82A 2ZJ8A 4YCBA 3GRPA 2PIAA 3AYZB 3RU2A 1IB6A 4B3CA 2V6IA 3FYDA 3X0DA 4IDGA 5B7PA 1XHFA 2OM6A 3WO1A 4JD5A 1I0LA 5CA0A 3L4SO 2DTEA 5DHUA 5HFJA 3E5MA 1VHDA 4KMRA 2IOFA 1A2OA 2HJVA 2W2TA 4F1KA 3CH4B 4ZOLF 4W7HA 4CDNA 1L4KA 4NI5A 3FBTA 3IJPA 1NBMD 4FXPA 4P3NA 5DBIA 4UNNA 2VK8A 3LY8A 2J0UA 2HFKA 2YJ6A 3WYBA 3UZUA 1NUHA 4BQIA 4FMDB 4RTOA 3DDWA 4CMCA 1WBBA 2G0NA 4GDMA 2Z2KA 5FO1A 3TIFA 4RTPA 2Z9DA 3VU8A 3H0CA 3PEFA 4MR9A 3QY9A 3H87A 3LBFA 5HBRA 3SYKA 4WA7A 2JASA 4HSGA 5FA8A 2NU9B 1I7QB 4QREA 1Z7EA 4LJLA 3BMXA 3EBPA 4Y0VA 3MF4A 2XF2A 3DFIA 4QHYA 3HJHA 4L5IA 3AEUB 1EKXA 3CPHA 3MINA 4QDOA 3LWNA 4W7IA 2YBDA 1DBPA 3ZTWA 3PFNA 4HWGA 1UAGA 3F7NA 1TVCA 3OE5A 4IJ5A 2ESRA 5GJCA 1ZD9A 4BY9E 1OX5A 1UEIA 1P7YA 1UK8A 2X2FA 3R24A 4PZUA 1IATA 1SG9A 3UICA 2DB3A 3ELDA 2O8DB 3REGA 5B5SA 1ZN9A 2IY8A 4J49A 2Y1WA 4A8PA 3O2SB 3GZ4A 2I8AA 3EISA 3X1ZA 2BR5A 3MTIA 3IPXA 1OSNA 1D2RA 3OLXA 3LQFA 4H6XA 5EQJB 1FPMA 4G2NA 1W5BA 2IXFA 5FPQA 5DHAA 4FYXA 4TXJA 1A9YA 4WN9A 2R00C 4YACA 4AMZA 1J7JA 1VMAA 1DAMA 4HDSA 2V59A 3RANA 4BX0A 3QY0A 1RD4A 4YK7A 4J3NA 1TZBA 1L5VA 5HF5A 4TL9A 4M36A 4AD8A 3PGKA 2WYWA 3P52A 4R81A 1HK7A 1JQBA 3FHOA 1J1ZA 3CLHA 3BH0A 3JPWA 3KKOA 4FI3C 3H2HA 4INAA 4IRUB 4TMVA 1OOEA 1PNQA 2N46A 4IZ6A 2XD9A 5JJBA 2BZ0A 2YYAA 5JZBA 4ME6A 4TWJA 1UBMS 4MZXA 1KDOA 4EF6A 3GLGA 4R2LA 1GT6A 4V0LA 2GTHA 2Y0DA 4DADA 3CNBA 2HMAA 3GJ8A 2VJKA 1IPEA 3L6DA 5JJLA 1U5AA 3FR7A 4R8RA 1EUCB 2ENWA 4HAUA 4YGYA 4B74A 1JR6A 1PAUA 1PWYE 2HF9A 3GEDA 1YOVB 4UNQA 2Q7OE 1JFFB 3BCRA 4BV2A 2EZ4A 1I33A 3CLUC 4RORA 1NUAA 2PD6A 4RDIA 1CUSA 1M73E 3KQOA 1CRPA 3GFGA 3TNDA 1ZK1A 4LZNA 4P31A 4R2XA 2LNDA 5TQ2B 1LTKA 2YW2A 2AYYA 1IWBB 1GZ4A 4IYJA 3FD8A 3Q9UA 3V8PA 4EG4A 2BFBA 1DWPA 2W6ZA 1QHHB 2DPHA 3ORSA 1RWNA 3IE0A 2ZM5A 5K8UA 3BILA 1WEKA 1NY5A 2CCGA 2Z04A 3BRWD 1GVHA 4YH1A 3CR7A 5BSKA 2I03A 3ODGA 2BRUA 5KYUB 3KTAB 2RGYA 2ZYVX 1A5BB 2HYIC 1JF8A 2J3HA 5KOJB 3R1IA 5ADWA 3SSAA 3IDAA 1KMNA 4A0RA 2VIIA 5BQFA 4B47A 2MINA 4MPJA 1WMSA 3IV7A 1EGVB 4ND8A 2DERA 1O94C 2D1RA 2JAOA 2VTDA 4MIYA 1T1EA 2CDBA 4YVFA 1KIAA 3G0CA 5JZVA 4W1RA 5KJFA 3EF0A 2I4RA 1GPBA 1SUSA 3AJ9A 4RJTA 4TYYA 5DNEA 3RVQA 1Y6ZA 3DF9A 2XE6A 5A4MS 4J7CA 4C88A 1E0JA 3KSDO 4YRKA 2C1XA 3C8ZA 1RI4A 4I1IA 2HU7A 4W5HA 2ZJ7A 5TPWB 3WWYA 3VC3A 1I9GA 3JU3A 1Y98A 4ZOAA 3WGZA 1R6BX 4M1WA 5HRCA 1XT6A 1SCBA 2V0CA 2PEYA 2PK3A 5A02A 1ZH8A 1MIHA 1UOPA 1UPAA 3IQFA 1USVA 4X85A 4D5EA 5EXPA 4EPVA 4D7AA 4L73A 1YGYA 2EKZA 3F6PA 2AA3A 4EQZA 3KXIA 1N5RA 1W4LA 1XDZA 2FPWA 2M9MA 1SUIA 2IUEA 2ZYTX 4HXEB 4JH0A 4Q7KA 2V65A 3QPAA 4NY1A 521PA 1LI5A 1PE0A 3OM1A 3QA9A 1MMFB 4AICA 5JMOA 3AVYA 4V1CB 2RH9B 3PE6A 5J4YA 2VJNA 3IP9A 4M2LA 3RIMA 1RM4A 1VRVA 4N0EA 1ISRA 4YMSA 4YCDA 5LD2B 1U8ZA 4CIBA 3HYCA 3PVZA 4D42A 4Q4AA 1GUDA 2Q9UA 3EGEA 3U56A 5C8XA 4JLSA 1ADGA 2QDXA 1VXOA 1J2UA 3F4BA 3LVRE 4RKQA 5EC8A 3UM9A 4AG3A 5B57C 2JFUA 4R1TA 3L92A 3SDSA 2OUIA 3C3CA 4GLJA 1E7WA 4LYJA 3WMRA 1E2QA 1E62A 1VYUA 2QS9A 2XWBF 1FRQA 1L5RA 2BFEB 3LP6A 1JL3A 3AR8A 5FPYA 4R5HA 5CG1A 2PUDA 1NBOA 1WXGA 3LSTA 1DQSA 1G2OA 1GZ6A 2HZ7A 1XL0A 1U2GC 3IT0A 5D6NA 5DGXA 3LVFO 3RSFA 3ZU4A 1ACMA 1T29A 5JVDA 1LVUA 5K0CA 1KAQA 3A6FA 2R60A 4K86A 3KKZA 4B4KA 1OXUA 1PK9A 1GNLA 1RP1A 1WABA 5CHEA 4IFEA 3LUHA 5JAQA 1I3NA 2DBRA 2FSSA 2LCQA 3TOSA 4E3WA 3SK0A 3CO0S 4G0UA 3G02A 1XA0A 4MV1A 1HY3A 3F5FA 4HH1A 4M88A 4YRDA 3WLIA 4EO4A 3Q7PA 4JBYA 5JS8A 1SB9A 1Z7BA 2J85A 1ONSA 2IEDA 1D5CA 4HEA1 4DV0B 2BN4A 3HBMA 2G6BA 3CX3A 2AOWA 2WTNA 4TKLA 1KBOA 2HCRA 2YVUA 2PVSA 3AUXA 1XTBA 4IGAA 1IG0A 3Q41A 1N9ZA 5IEJA 4FNGA 3AB7A 2XE4A 2Q5LA 2W58A 3ESBA 3UFXB 3ZXXA 4KPYA 1RCFA 1C5KA 1N5OX 2G8LA 3IVAA 4KPGA 1QRTA 3VC2A 1F3LA 1I51A 3E3MA 1ZZGA 3FDIA 5F7JA 4EFMA 2AE2A 3WOVA 4Z5XA 2YMPA 1QH9A 3L0SA 1C7IA 3PKJA 1YFZA 4UDYX 4UM7A 4Y2XA 2Q07A 4XIFA 3ROXA 1FX0B 3W5CA 2UU9B 3FAZA 4YWJA 4IIHA 3K8OE 2X41A 2G8NA 1K9VF 3CPJB 2C42A 3EW7A 5JSHA 4EI2A 2OK8A 4D0NA 1HL3A 4DAEA 5I9LA 2RHJA 1PKEA 2RC5A 5AM5A 4MVJE 3BFXA 4UZSA 3BDVA 4GKJB 2R1VA 4HBGA 1L5FA 1U5BA 1FZTA 1M66A 3UGKA 4YO7A 1S8FA 2VH2A 1TM7E 5B37A 3BWXA 4C0SA 3IEXA 1GQSA 2IU6A 2QY9A 4YWHA 1UZAA 2RE8A 1Z63A 3KKPA 1FP6A 1T9DA 2YHIB 4KTTE 3K5HA 2FN3A 4CKCB 1Q1EA 2DHEA 3F8TA 2PSHA 3O03A 1HTBA 1QH1B 4PLFA 4KOEC 1PP4A 2GF2A 1W34A 2D5LA 3O8OA 4K2AA 2YXNA 3ABRB 4H17A 4LE2A 3F90A 2JVIA 3VPAA 2VOJA 2HA6A 4Y2YA 2VUSA 4H3SA 5F98A 1K8RA 5FBRB 2Y68A 4OQEA 2I29A 2WTAA 3RODA 3TINA 3PXEA 3T34A 2CYBA 3KQQA 5DP2A 3A0RB 2VI5A 5AIAA 6NULA 5F2NA 4AZ3A 1T2FA 3G5UA 1NSTA 5AW7A 1P7CA 4X93A 1XCLA 4MR8A 4MW9A 5FLEX 2C9CA 1CQWA 4NOMA 3LUPA 3H65A 4JL6A 4MAMA 4QU0A 3V4FA 3VX3A 1JE0A 1FLNA 1KH2A 1ZM3A 2OY0A 3V8EA 4X20A 3ZE2B 3LUKA 3EZYA 3JZAA 2GK3A 3MM4A 2CXRA 3CWQA 3LDAA 1DQPA 3PNOA 4FYMA 2FW7A 4C29A 4YCNA 4P0QB 2ATCA 5U4QA 5H59A 2C96A 1E5LA 1P6UA 2HHCA 3C5WP 1SULA 4P84A 4CT4B 4RDCA 3JQBA 4BP9A 2C2WA 5H8WA 1M8KA 1L6RA 3MJHA 2NGRA 2E87A 4CV2A 4IWYA 4G5HA 3GLGE 1G2QA 3FZEA 4YRIA 3H9EO 3TLEA 3UF0A 5JASA 2YH2A 4UPEA 3KTFA 3BX1A 2WSMA 4EFKA 5IJ9B 1R8SA 4BFZA 2JI6A 5LU8A 3IEVA 3GPCA 3LXRA 4TSRA 3A9WA 4XXHA 4FOLA 2IWHA 3D3JA 4V3BA 3BFJA 1JR4A 3V1UA 3RFFA 1GD1O 1NMXA 2CFOA 2C5FA 2QVXX 3SPXA 1ORRA 3IJEB 4QOHA 4NKRA 4RHCA 4XWKA 3AF0A 2DSTA 4Q16A 3A6EA 2G1JA 5C3UA 5EYPA 3OE1A 4QG7A 4TGLA 2CYAA 3W4JA 1JH8A 4MKXA 4P22A 1C3VA 5DTQA 4BNUA 1KBZA 2JFYA 1R5NA 2WEKA 2XUGA 1K63A 1U7TA 1SD2A 2HSWA 3CN7A 2Y2VA 5PNTA 3FJOA 1M1UA 2FW9A 4BEJA 1DJNA 4BV9A 3HYSA 4EDFA 5K4HA 4DJAA 4E7OA 2WP0A 2ACWA 1PJAA 3RF6A 1IDN1 4UOZA 1O6GA 4IV0A 2JARA 4Y18A 1TF2A 1Y1KE 1GV1A 4IZHA 4KAXA 5FAKA 4WY2A 4ABYA 3NHWA 1EESA 3F9CA 2PMKA 1ZM7A 3B7PA 4QJ3A 1N33B 3OQIB 2O2JA 1YBAA 4QBTA 1P5HA 3SF8A 1K6MA 3D2LA 3FHCB 4ZAGA 3S29A 1CZKA 1UBOS 4K9QA 2JLUA 1IBSA 4LJ5A 3R7WA 3MILA 1Q91A 5L40A 1B0AA 2W4IA 1SXJD 5EP3A 3KTOA 1GR0A 3MXTA 1YDWA 5KYWB 2PA3A 4U7PB 4E5VA 1MC4A 5TGDA 3RVKA 1V1RA 3RC7A 5BR1A 4MVJP 1EFRA 1Z0FA 2Q6KA 4DJJA 1YA6A 4UXHA 1XIVA 2APJA 3T7RA 4B0OA 3FF4A 1GXSA 2B98A 2NU6B 2A0YA 2GEDA 4YRRA 3DEKA 1TMGE 3QVGA 1Q0HA 1DPFA 3AU9A 4L9AA 3TVTA 1OT5A 4D9FA 3N39C 4D9JA 2QD4A 1GTSA 2ZIWB 2AVDA 4TTTS 3RLIA 1A04A 2BE9A 2OHIA 1EE2A 3R20A 2P2NA 4MWBA 4J4TA 4IGKA 5TGTA 3CE9A 5F5NA 1JJ7A 3MTBA 4GL2A 4ZZ3A 5LR6A 2Q1SA 1C4KA 4O5OA 3F71A 2F4NA 4Z99A 5JDIC 3BWCA 3STUA 1L5WA 1IIBA 4QXMA 5E6UB 1GZDA 2CNWD 2CZCA 2I6TA 3ESYA 3FPBA 4CMHA 1MAVA 1QM5A 1TM1E 1DJQA 1OFVA 3MTAA 2PBZA 2NUPA 3FIUA 4CVNA 5CEJA 1D8TA 3QV2A 4ZVPA 5JXIA 3RC1A 2CB0A 3EOAI 3W3AA 2ADOA 1Z26A 1AUPA 3DT6A 4UD6A 3KU1A 2SNIE 2ERXA 5JRJA 4ENQA 2DKOA 3LIIA 3SJUA 4DV1B 1BMFD 2CVPA 4EYSA 2PYZA 2QW0X 3OSUA 1OV4A 1WUYA 3OZUA 3P94A 4TZ6A 1WMBA 1YZKA 3FWHA 5CB8A 3LF1A 2HDNB 3INRA 1B8VA 4XE5A 1UXHA 2QRKA 4EFLA 4YV0A 2IHNA 3GZNB 3LC1O 2YOGA 3WKCA 4B4OA 1HFJA 4JOSA 3LZ6A 4EY6A 3OJEA 3GA7A 4UUPA 2J0EA 1AUQA 1FFWA 3RTCA 3WL6A 4K9PA 1W52X 3AKYA 1FYDA 4R2HA 4ZOLA 5EIBC 3ZHOA 4NZMA 1RWMA 4OHRA 1JBQA 3ZW8A 4ARSA 4RVNA 2VJQA 4AYTA 1GPH1 2CVZA 2VKTA 3PNQA 2C98A 3D4IA 4N5DA 3BWEA 2QLLA 3R8CA 1WD5A 2WIFA 4JUFA 3WNDA 1N25A 1YS1X 2JLWA 5E4TA 4AMBA 1B8PA 3EY9A 4BWYA 1GKIA 2CN1A 3UIEA 5TMPA 1Q77A 2EQAA 5K0BA 3GPBA 2ZU6A 3H04A 2P1DA 4M55A 1V37A 1J90A 2WK1A 3TX6A 2CNDA 4QNNA 2OFFA 2HJGA 5EG5A 3VAAA 3OOHA 4LRXA 1LS6A 1PGPA 3V4LA 3FGOA 4V24A 2Y05A 5ESDA 2X42A 2B1GA 3H13A 1DOAA 3NYRA 1N0UA 3IS3A 4DFDA 4TS9A 5HQ3B 2O19A 3E1KA 3EEYA 3WWEA 2QRNA 5AKHA 4CG3A 4UNRA 5JV5A 4CEJB 3QF7A 1K7EB 2FEKA 2ZT5A 2VHJA 4AG5A 4C4TA 3ABZA 3HI6A 4DLPA 1L8AA 1UOOA 3RUHA 3AGPA 5KU1A 2JAUA 4DDWA 1E6CA 4FEGA 2FU5C 4NBKA 4PNHA 2CLCX 3NBYC 3ZCPA 1A9RA 1M5RA 4RENA 3W8DA 1ETUA 3FHJA 3ST7A 4G37A 3KKEA 5BO5A 4KE9A 3BRQA 1ENOA 3L8CA 3DE2X 5KOYA 3SM9A 4F4FA 4FN4A 5B6PA 1F1JA 2AJDA 3OJXA 5K3AA 3Q8MA 2GHRA 2Q5QA 1EUYA 3MB8A 2IL1A 1C3LA 4OGGA 4S2EA 1DKOA 4TYQA 3MGAA 3LO5A 4YYZA 1G20E 2CJWA 2OVBA 3FGZA 3C3PA 1PG5A 1B42A 1HPLA 1PLLA 4IDCA 4UEWA 4XVQA 3RS8A 3TAHA 4QUIA 2PD3A 4YHBA 3ND6A 2X8JB 3ZI0A 3SMVA 4BNYA 5J58A 2IPLA 2D8MA 1VCHA 2B2CA 2GZRA 2BT4A 3T5BA 4YYEA 4G6ZA 1R9JA 2Z2ZA 3FLEA 1PUIA 2DPGA 2O7QA 3LYUA 3LI2A 3RSOA 3P4UA 4FMDF 5BUCA 821PA 3G0DA 3RW9A 5CIWA 2J9ZB 3L1HA 1WHSA 2IU4A 1XVIA 2HPZA 4H18A 4BCBA 4ZPXA 1A8HA 1LS1A 1BQ4A 2FKAA 1HDGO 3KYCB 4C6TB 1KI3A 5KTSA 1TYAE 3I6BA 1IXYA 1U2ZA 3MUNA 2IITA 3E9RA 5CYGA 4URVR 4IOMA 1DAEA 4PFKA 5DHQA 4DV3B 4J9VA 2DKNA 4G0VA 3L0DA 1RRFA 2Z5LA 1MW8X 2H1SA 4TROA 3QSYA 2AWOA 1PQUA 1K7FB 3IESA 3FFAA 3JD2A 4FCVA 4GPAA 5LCXA 3ZUGA 4WZAE 1ZI6A 2FV8A 5KIAA 3W5VA 2E37A 2KLHA 3AVUA 5I4IA 1G4UR 3TK1A 4F71A 2IEIA 4O25A 5SZKB 3QQPA 2AUTA 5DBEX 1YK1A 1ZM4A 1NV8A 1TIKA 3KPYA 4QLAA 5CURA 4Q66C 1ND5A 5KVVA 4LOJA 2R6JA 1T5OA 3DVAB 3JYLA 1XP5A 5DM60 3O3CA 3G0IA 2ZPAA 1C3EA 1XQYA 2ZITA 3NBUA 3VHRA 1U7ZA 1RC8A 3K70C 3HBJA 3MYRA 2WJJA 2GA9A 3DFFA 2PGLA 2BBOA 3LE8A 1VKOA 2OP1A 1WUHS 1JG2A 5D3KA 1YJ5A 2Z2XA 4CM4A 3EEFA 4KV9A 4BQPA 3KQYA 4L9WA 2WDZA 4JR0A 4N6GA 1MOPA 3HBNA 2XV1A 4CMGA 5GVRA 4AY4A 1TM4E 4J2HA 4E46A 2IYLD 3VNUA 5FP0A 2ZJOA 4TRMA 1TLFA 3WOHA 4H3KB 3WLAA 2V7VA 1BAPA 2WAYA 3UWMA 1SCKA 3UANA 4EENA 1OLXB 5U9CA 2DCUA 1QHYA 4IIVA 3A8TA 3IO3A 3FSEA 1YRQA 1G6Q1 1U8AA 3KOXA 2GXAA 2JGRA 3DV9A 3L0CA 3UHAA 4BBJA 3U61B 1N75A 2OBMA 4BZWA 5F64A 4D97A 3UB4A 2VJOA 1QGZA 2FW8A 2Q0QA 1DG9A 2ZP1A 5BNTA 4OHWA 4KFRA 3Q3GE 4MVJD 5G3ZA 4BLSA 3L04A 3RS3A 1E2NA 3COWA 3KKQA 1E9CA 3ZZNA 5BQPA 2G08A 4MS3B 1CQZA 3COVA 5F77A 3FUXA 1CFJA 3TIIA 4DCPA 4V38A 3QOFA 2AMYA 2XTZA 1GEEA 5GM2A 2CLKB 1Z6ZA 2EX0A 2OBLA 1N0WA 2QM0A 2CUKA 1XTPA 4YJHB 5EE5B 5C8DA 2XMDA 2HWKA 2CHQA 1Z73A 2VJYA 3I92A 3IHLA 3S2EA 2C5GA 2Q5HA 3D1JA 4BFLA 2QVGA 3MJDA 4PQFA 1CY6A 3IKMB 3SS7X 1FJHA 1V26A 3DHNA 2XZPA 3FCYA 3Q98A 4J9UE 4Q4JB 2E48A 4MP8A 3AKDA 4PY2A 1QYIA 3THYA 4BVHA 1JHAA 3E9ZA 1UC9A 3O93A 4Y1FA 1TJ4A 3FMVA 5T57A 3VU3A 3QVTA 2XBMA 3VYSB 3HR4A 2VJCA 3G3EA 3WTBA 5JC8A 4G0YA 1KAGA 4ETIA 1AKQA 3H84A 3CZCA 1ZMTA 1KO1A 2L17A 2B69A 4X91A 3ZHTA 2FAXA 2IP1A 3S5JA 2GJ4A 4HWTA 1O87A 8OHMA 3K70B 3R5KA 2VAXA 2GO1A 2IKSA 4P35A 4OP2A 2RGNA 2WYIA 3GRRA 4LYEA 1C0IA 3QIAA 5CNKA 3VKUA 1FMJA 1ZYUA 2F9LA 4B6PA 2LKCA 3SBXA 1E64A 2XB4A 1EM8B 1VCIA 3AEKA 3DOOA 3P71T 3FJ1A 4O33A 5EP1A 2OV2A 4DA6A 4RD2A 4OV6B 3OD5A 4HLDA 3EVCA 5D3ZA 1XQ6A 1RHQA 1ML4A 3FR8A 4UPDA 4NENB 4X3PA 3OP1A 5ALQA 1AHHA 3C3AA 4OHYA 2V5VA 1G4HA 2SCUA 5DYTA 1QNFA 5K3SA 4ALJA 5AVYA 4H27A 1T5LA 4W5TA 3FMOB 3OCJA 1Q83A 1P4HA 2OHGA 2RFLA 2XECA 3M4XA 3ZQ4A 5B1DA 1HZZA 3WLOA 2HCTA 3QGMA 2GYVA 2DHQA 1P7PA 1DKLA 2O1WA 3K72B 4G67A 4AP5A 5DRTA 5E8RA 5I8PA 4U5QA 5EIAA 2IE8A 1NW3A 3MHPA 2XZLA 2ZJYA 3HJBA 5A1TA 4PWZA 1IY8A 3QOYA 1TC1A 4QYXA 1S9DA 3C5HA 4AJOA 1TA0A 4GS5A 2A5LA 3WO0A 4BLRA 2D2VA 2WZBA 2P6NA 1NI5A 3KB2A 3WB1A 3Q5DA 2AJ8A 4EUFA 1WDKA 3QWIA 1V5IA 3OE7D 3RYHA 1N2SA 3SZUA 3EPJA 4NOJA 1UPUA 2PFGA 4JLUA 4M8LA 5DIFA 3EFEA 1VJTA 1NVTA 5BV2P 4M1ZA 4B7CA 4F3YA 2W8BB 1NURA 5FQNA 5EVCA 1VPLA 1I4DD 5NLLA 1GGVA 1QZUA 3ELBA 2ORVA 3SQMA 2EZ9A 1I4LD 3DJYA 4BLUA 5BQ3A 2X3YA 2RGGA 3IMFA 2QTFA 4EELA 2HGZA 1I4EB 2WJWA 2WUGA 2WW8A 1CJSA 1MH1A 3HABA 2C7OA 1E5VA 3WK4A 2Y1CA 4BDSA 4B45A 4KL8S 1Z6PA 3MCTA 1VI5A 2MSLA 2QG4A 3PDHA 2VWGA 1CG6A 1CRQA 5TB5A 3DONA 3ZYCA 3Q8KA 3PHIA 1APBA 4JLOA 4GQBA 3MS2A 2VNKA 3L2OB 4L22A 5DT9A 5T4BA 2M98A 3PHGA 1BZYA 2GPWA 3LX8A 4O4LA 1SD1A 3AKZA 4EG1A 4ZICA 3OCUA 5KTRA 1KSGA 3BUSA 4ITRC 1QC5B 4EO9A 1J00A 2AUMA 3BMOB 1FVXA 4RXMA 4CM6A 1KQ3A 4CT0A 4DYVA 4XVUA 1QP4A 4XCVA 1L5ZA 1Z5NA 3F4LA 3VYWA 4LEIA 2WAAA 2NXWA 3B1XA 3IXLA 1QOQB 2P6UA 4JP2A 3BE6A 3U4QA 1GARA 2QN6A 4CXMA 1GA4A 2IYZA 2EKQA 2HMUA 1V3UA 2YHSA 2VHEA 2XXAA 3SDZA 1XVTA 2NU7B 3UK2A 3QVMA 4B85A 1RQGA 1DX4A 1U8TA 1Q21A 1YA4A 1DQYA 2PSDA 2O0LA 4MCHA 5GGXA 2I62A 3ZHYA 1DAOA 2IUFA 2Q4TA 1MHPA 4MW0A 1H2YA 2BJWA 4KR0A 4V2UA 5K2OA 2HA5A 4H7PA 4YI5A 1TAUA 2NW6A 3LKDA 4GF5A 4PHGA 4F86A 1SKBA 3A9TA 3TTUA 5JNVA 1H8HD 1UZMA 2VSFA 3E82A 4CL0A 4X71A 3A36A 2CW5A 2RGXA 4UXJA 2F17A 2WM2A 4CLXA 3T8YA 3A6ZA 3TTTA 4Q01A 1ZCBA 2VNSA 2O4UX 1KJQA 2MYUA 3B82A 2QI9F 2X8AA 1V4VA 2PFSA 1W87A 5AJZA 4M0CA 1OPXA 1W5EA 1VLVA 4AY2A 5H4GA 4I7EA 1U0SY 3D8SA 3KFVA 3PCTA 4FYJA 4M8SA 1A9QA 4F06A 3A6HA 3W3AD 3OM0A 3A4LA 1E63A 3TRKA 3H5RA 3L8EA 1FUUA 3NEPX 4L5YA 2FE4A 4M98A 4D56A 4IFIA 1QPZA 4YGXB 3RC8A 3QJGA 3PT5A 2QZSA 3PXUA 1D4OA 1T1IA 3HZZA 3KJZA 2C8JA 2BM9A 1JILA 2CV2A 5CCBA 3JTEA 2HY7A 1SEVA 1ZPDA 2HSEA 4PM4A 2GJ8A 2W7TA 1X0VA 4MUJA 4C6RA 4KFCA 2P5SA 2M32A 3UWPA 5CDFA 3I01A 1VBFA 2I22A 4IO1A 2Z3WA 3ED1A 3S2UA 3HB9A 4GFDA 5GPBA 4YI3A 2INGX 4A2WA 1N6IA 1Y3HA 2IELA 2PX4A 1C30A 4FEAA 4PZAA 4YJGA 3GP8A 2BTOA 2A0KA 2VXYA 4DLTA 1NMSA 3CSSA 4KXQA 4P1ZA 2Z0MA 1V9LA 3N87A 2YNMC 3L7NA 3HWSA 3IUQA 4DHEA 3HUFA 4OJTA 4LQCA 1YQEA 3IP3A 2EGGA 3ADDA 1EINA 3C3YA 3I1FA 4ZOLB 1NT2A 1TYBE 3TTSA 1SKAA 3OICA 4DCMA 5LZ2A 2QNBA 3MN1A 2I6FA 2X15A 2NSYA 4GBGA 1YQ9A 1B6RA 1DUIA 1MOQA 4QGAA 2PH7A 1NTOA 1YQUA 2EZ8A 3C0KA 3DBHA 4RMGA 4RLSA 4BV8A 3RFTA 2AXNA 5K1ZA 4NRDA 1KVUA 3OM9A 2Z1NA 4GL4A 3KUXA 5A06A 3CIFA 1X70A 5ELXA 1JIVA 3N2LA 2FP4B 3OPXA 2XNSA 5KQSA 1DCFA 2ONCA 5ECWA 2WWWA 3A06A 4J4HA 4Q9DA 5F76A 4H1TA 3ABOB 2C7VA 3AR9A 5LXTA 2W6MA 3DS8A 3CH7A 1A8PA 4WFQA 3AESB 3KKLA 1VL0A 4ETNA 1GFSA 3WLHA 1UZUA 1K5HA 3OZRA 1YZGA 4QDKA 1QR2A 3DCNA 4NBTA 5H81A 1B6TA 1SCUB 2ECPA 2GJAA 4P7JA 3KVOA 2ATIA 4PLZA 4LGVA 3KL2A 5T41A 2O6LA 1CDZA 2ZBVA 3PDIB 2OORC 4FOTA 3I2IA 1L7VC 4RU1A 3UJ8A 3I2HA 2WIGA 1U94A 3ZVKA 4RV5A 3BHIA 2VWQA 3ULKA 1U0RA 3KOMA 3IBCA 4WGGA 5BRJA 1NG9A 3P5BA 1S7CA 1J8VA 4AJ2A 5GWXA 4IUCS 3P9CA 5CFLA 1N5KA 1QWSA 4M3NA 3C97A 3EGCA 4DV2B 3JSXA 4L7QA 3TN7A 1XD2A 5K8TA 2A0FA 2BYTA 3PVSA 4XLZA 1J23A 1B93A 1A3CA 5D5HA 1TD1A 3HB4X 4FU0A 3K5PA 3NHFA 2LIPA 1QZZA 1NBWB 2EW2A 2C77A 4BX8A 4B4WA 2JD2A 4COOA 3OTIA 2QN9A 3A2MA 4DG8A 1AKEA 3JQAA 3KAPA 1UM8A 3QM1A 1HUQA 4YIKA 4D4LA 1AU9A 3CLKA 4EECA 1CIJA 1PJZA 1W2GA 5JLAA 3FMGA 1N2CB 2ORYA 1CR4A 1E1QD 3PX7A 2DPLA 4HTFB 1CY0A 2ENUA 1JYSA 1PSDA 2GPBA 1UJ5A 3IV9A 5IZCA 4L85A 2WI8A 3VYUB 2RK4A 1ZU5A 2H1OA 4KWTA 1FJGB 1CUCA 3T1VA 5T3UA 5HQ3A 1F1BA 4O1IA 3ID6C 1YJXA 1FFAA 1UT6A 2PD4A 4HDRA 4K8RB 4XCXA 1C4OA 1RMTA 2FPGA 3AHGA 4WIAA 1JB9A 3MJEA 1T36B 1GAWA 1QVVA 2QX8A 1KO4A 1O54A 3KR0A 4N7BA 3H97A 4TXNA 4UDXX 4Q9KA 2HJSA 1FW8A 5AK4A 2ATVA 3FYTA 3NLLA 1Y9JA 2ZI9A 1F7UA 1AS0A 3ENKA 3AF6A 2DFVA 3OO0A 2CHFA 4C2BA 3R3ZA 2QLJA 2FYTA 1UBEA 1RFGE 3U44B 4NOLA 4HNGA 1YZQA 4FC6A 1M2GA 1ICIA 2XUAA 2PH1A 4UVHA 1AD2A 4X54A 5I5GA 3DQZA 3E15A 3CF6R 1NA5A 1KSFX 1X3LA 3A05A 3H5IA 2AI2A 1VG0B 1QH8A 1X1CA 3WLPA 3N58A 3OHMA 4RH3A 5LQMA 1U9ZA 3PJRA 1PG0A 5FR1A 1BKYA 1CUDA 5K3DA 1I3KA 3ESCA 1C3OA 1PS0A 4AZWA 4LG1A 3A37A 5A6SB 2FWJA 2XEXA 1EX9A 3BFVA 1W5TA 3CLUD 2BM8A 2K7ZA 2BR4A 2I2BA 3AHHA 4L57A 4FSHA 2QE6A 3ZCVA 1E89A 4BBPA 2X76A 3GYBA 4TQ9A 1Z74A 4ZJUA 5HRAA 1XSEA 3JRWA 3IP1A 2CK3D 1SWWA 5CH3A 5KNCA 1E79D 1NQ5A 1V3QE 2W0MA 3L9XA 3OY2A 4G09A 4IOLA 4LS3A 3GJ6A 5H3CA 2JL1A 3RNLA 4RHFA 2OCBA 1F17A 4HG2A 4MQMA 3WA7A 1SG0A 5ULLA 1B6GA 3KT6A 1H3EA 1Q44A 1SCDA 4NYIQ 2A2ZA 1CLUA 4RZSA 1T43A 1UKZA 4L8YA 4PQYA 4HNTA 2A9VA 4WKOA 3WGGA 1GQYA 4ZMSA 4NU6A 5K6AC 4IX9A 4WOCA 4BQNA 4UCFA 3LW7A 4DCUA 3RU9A 3GOHA 4HVLA 2QU7A 1IEQA 4O4IB 3WB2A 2QJFA 1H94A 4AJJA 1TVKB 1K2WA 2QVYX 5CFZA 1WDTA 2GCGA 2OZVA 1R7RA 1IZ8A 4JJFA 1O94D 2BKVA 2DBZA 3FPJA 4ASUD 4D8UA 4OGLA 2R6DA 1SCAA 3S55A 2ZTSA 3MCVA 3BXOA 1RHJA 2UYCA 3BMQA 4CF6A 3NFYA 4KHZA 1H4QA 4RVDA 3X1MA 5H9WA 5J2UA 2PRKA 2QE7D 5IUNC 1Q50A 2JLSA 4QVGA 3RJMA 2YWGA 3UO8B 3ZTYA 1MEOA 2SKEA 4UUAA 3A7DA 3JR7A 1GNPA 1RIFA 1Y42X 5T3YA 1SC4A 1U3GA 2GQ0A 4NJMB 3DBLB 4Z0HO 3I5XA 1P0FA 5D1HA 1L7MA 3R3YA 1PDOA 3D2CA 1A95A 1N57A 2Q5EA 2XR1A 3DFZA 5AJXA 1HYQA 2YJ3A 1JLMA 4C7KA 1T6NA 2TECE 4AK9A 4KZPA 1G291 4F85A 3AI2A 4J94A 2X58A 3I8XA 1VGVA 3Q9NA 4WK0B 4X5OA 3OIUA 3SF0A 2CFIA 2F62A 2WRZA 4S1WA 3RD5A 3ZDQA 4EH1A 1DJMA 3OKCA 4RS4A 2YTZA 1U1CA 1UM9B 4LOIA 1KU0A 4QQ8A 4HFMA 1E9AA 1SELA 3CE6A 3BAFA 3FDZB 4BWFB 1LVHA 2JHFA 2UXDB 1FX0A 2FN8A 5JPCA 5L51A 4M21A 4JXZA 5LNK1 1X7ZB 2D7DA 4NCBA 2ZVDA 1EEHA 4HRVA 4WXHA 2QIPA 4BXOA 1WA5A 3IUNA 4CLRA 5K3EA 3BMQB 5ETJA 3WK7A 1E5DA 1N6PA 1I8TA 1F20A 3QLTA 5JSZB 1NN5A 2I34A 2PKRA 5HMMA 3QBEA 3PG5A 1E4YA 2A5JA 1US8A 5C1DA 3H3XA 4IOKA 3QLUA 2OO5C 4M9UA 5LYYA 4CKEB 5EPOA 1QBKC 2VRCA 2XMZA 4MI6A 4IIFA 2V8BA 3AF2A 4EYEA 3NBFA 4ZCRA 2REBA 5FKJA 3OZAA 1JDVA 3G5AA 3N1UA 3T3OA 2FW0A 2FWAA 4X0EA 3TL6A 3LBAA 1E3DA 3EE6A 3JD0A 3PRKE 4Q9IA 1R4MA 4DC0A 5MGBA 5AXAA 1M1NA 3OD1A 2BFMA 5CXXA 5IJ9A 3IBFA 3L5OA 3CB2A 3GLIA 3TSOA 4ZOQI 3SAJA 1JMKC 1JR3A 3OE7A 1T3GA 1F6WA 5DIZA 4EPYA 3TTYA 4Q4LA 3N86A 3DAOA 3PQ2A 2JKVA 4Y6QA 4DHWA 3AHIA 2YJZA 3NM5A 2FK8A 5KX5F 2Z8ZA 3LGSA 2OFPA 3LLMA 2ZE5A 4M8NE 4I3FA 3UW3A 3VO8A 4Z4GA 2BC9A 1NNEA 4GGOA 3IVRA 3KD2A 3NB0A 4OYLA 4L0MA 5TGZA 1IEVA 3AKCA 4OXYA 5TQ2A 2AR7A 5EPEA 1QDUA 3AI1A 3MMZA 4JWTA 5AW1A 1TJYA 4HUQB 4CKEA 4PQRA 5CEEA 2GZSA 1Y7IA 2FPPB 2GN9A 3AKEA 4I4TA 1C0KA 1R74A 3QX7A 3B9QA 2GETA 2C2HA 4EVSA 1Q1BA 1ZSVA 1H2EA 1SBNE 3TZKA 1MIOB 2RGEA 5IHPA 3CA8A 3IIJA 4AX8A 3AEXA 1HH4A 4X62B 4Q4HB 1VC2A 3GJQA 2P3QA 1EZ1A 1KERA 1Z2AA 2F9MA 2ZAGA 3M82A 1O96A 3ICQB 1ZH0A 3L1JA 2WSLA 2RH4A 5BSRA 3DZDA 2H4FA 5DDIP 5FLXA 4TVKA 1EE1A 5IT5A 4PZ0A 2IH5A 1Z5WA 3QU2A 2L19A 3O38A 3EFHA 4UCXA 5FBVB 2B9VA 1JJIA 1SR8A 3ZDCA 1ECGA 2P9FA 3GMTA 3LUAA 1JI0A 3OPQA 4RCVA 2J9FB 1XZMA 3NTXA 2PQ0A 3BIJA 3NNDA 3FWPA 4W7SA 1M1YB 3ADOA 1GO2A 1LSUA 1Y89A 1MQAA 3JQPA 3NYQA 3GT0A 4A92A 5SZJA 3KCNA 2YQZA 5DX8A 1LX7A 2XVAA 4ZD6A 5BOSB 1DADA 4UEKA 2GWRA 3OX2A 3BULA 3UT6A 1XDDA 2KBEA 1HOXA 4LFAB 2E82A 8MHTA 2A3RA 3QI2A 2HQBA 1H8HA 3D4BA 3N7TA 1KMIY 4X8OA 3WAKA 5A4JA 1UUFA 1ESZA 2IF2A 2R8XA 3NX4A 3E9DA 3QV1A 4PXYA 3A9RA 3I76A 4F12A 1X15A 2MSNA 2NACA 1H9BA 1M7GA 2O1SA 2WFZA 3GPDG 5A6VA 1ZXXA 3A28A 1LNZA 5J2UF 1NVVQ 1U9CA 3FVWA 3K71B 4O2LA 3GJ3A 1X0XA 3B38A 3G9UA 1BS9A 1KH1A 4B2LA 1DTWB 4ZVNA 4ITUA 4ZI7B 4RMHA 2CUNA 4BDTA 4ZU3A 2D3TA