3ZHOA

X-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVOPROTEIN WRBA
publication title 1.2 A Resolution Crystal Structure of Escherichia Coli Wrba Holoprotein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zhoA00
5F12A 2OHJA 4PTYA 3U7IA 3NHWA 4GI5A 4HS4A 3W7AA 2Q62A 1DX9A 2FDXA 1AKRA 4BMPB 4QOEA 2X2OA 3R6WA 2ZKIA 3TE7A 2X2PA 2N1MA 4C76A 3W79A 3NHRA 4J8PA 3OX2A 1ZX1A 3GFQA 2W5UA 4GR9A 2B3DA 4N82A 4DIKA 3L9WA 1QRDA 3HR4A 3QFRA 4DILA 2R97A 2FCRA 3GFSA 3P0RA 1AKVA 5LBTA 1T5BA 3EYWA 1FLNA 2QWXA 3NHUA 1D4AA 1AHNA 4FGLA 1YCGA 4NULA 2QMZA 3HA2A 3LT5A 2BF4A 4ZVMA 1JA1A 1SG0A 4LTMA 1FX1A 5LJIA 3FNIA 3KEGA 4LA4A 4ZVNA 2QX8A 2FZVA 3NHPA 3N3BC 3F90A 4NLLA 1CZOA 3OVMA 3JSXA 3UXEA 1C7EA 3QFCA 2OHIA 3B6IA 4FGJA 1V4BA 2MWMA 1CZKA 3FJOA 1TIKA 1QBGA 2FVXA 1KBQA 1H66A 2OHHA 5ULLA 1FUEA 3S2YA 4FX2A 3ESXA 4YAUA 1YCFA 4D02A 3OJWA 3NFRA 2V5UA 5EAIA 1AG9A 1D04A 2QX9A 4XDHA 5F51A 4U7HA 3FVWA 4LAFA 4ZVLA 3G5MA 2FX2A 3LCMA 2A5LA 2BPOA 5FX2A 4N9QA 2GSWA 6NULA 1D03A 1SQSA 1AKWA 3N39C 1QHEA 2BMVA 3FX2A 1OBVA 3KAQA 4YAOA 1AKUA 1CZRA 1YDGA 4QODA 1DXQA 1WSBA 3FW1A 3ES9A 3OX3A 3O2NA 3HLYA 1QR2A 3OJXA 1VMEA 1BVYF 3W78A 3OWHA 4CETA 3NHFA 2QX4A 2RG1A 3TZBA 2BN4A 2FLVA 4ZVKA 2Z9DA 1WSWA 2MOKA 4U7FA 2FAXA 3NLLA 4PU0A 3UXHA 1FLDA 3QE2A 1KBOA 4GQIA 1RLJA 4ESEA 2Z9CA 5FUQA 1CZLA 1FLAA 2F1OA 3ESYA 2KLBA 3K1YA 4H6PA 1RLIA 2OYSA 3F2VA 1RCFA 3K20A 3B6JA 2ARKA 1GG5A 4F8YA 1XYYA 2AMJA 3NHJA 2V5VA 2Z9BA 4U7GA 4XDGA 2QMYA 4CF6A 3NHKA 1ZWKA 2WC1A 4R81A 2HPVA 4OXXA 2XOEA 1J8QA 3U7RA 4FGKA 1C7FA 1J9ZA 4S24A 1FLVA 4YAWA 5B3LA 1AKQA 4M0CA 5TGZA 1XI2A 3D7NA 2M6RA 5NLLA 4QOGA 5A4KA 1AMOA 3OX1A 4H2DA 1J9GA 5EMNA 4ICIA 1J9EA 2M6SA 2Z98A 5LLDA 1FVXA 1TLLA 1FTGA 4QOJA 4Y9UA 1NNI1 4QOHA 3NHLA 5NULA 1I1OA 1OBOA 5EA2A 4C14A 3B6MA 2HNBA 1JA0A 4C0XA 2QR2A 3N3AC 4LTNA 1CZNA 1T0IA 1YKGA 1X77A 1YRHA 4PTZA 5LMCA 2KQUA 1E5DA 3EDOA 2FOXA 4YQEA 1ZWLA 1XYVA 3NHSA 1CZUA 3ESZA 3ZHOA 3KAPA 4BMOB 5B3KA 2MTBA 3GAMA 2MT9A 3L9XA 1F4PA 3GFRA 3KLBA 4HEQA 1DXOA 3NHYA 2XODA 1AZLA 1CZHA 3RPEA 3O73A 2BZSA 1XT6A 5BUCA 4YAFA 4DY4A 1YOBA 3F6SA 2Q9UA 2FZ5A 2V9CA 4N65A 1OFVA 5FA6A 5LJLA 1RTTA 4Y9RA 4QOIA 4C0WA 5F4BA 4YALA 5LBUA 4QOFA 2HNAA 1B1CA 2D5IA 5JROA 1YCHA 1AKTA 1H69A 2QX6A 4LTDA 1BU5A 3OWXA 3W77A 3F6RA 3SVLA 5LVAA 3B6KA 4Y7CA 2R96A 3TEMA
chains in the Genus database with same CATH superfamily
2XYQA 1LI4A 3OH8A 5ITZA 2GX6A 3CUVA 3PDIA 2VDMB 3USZA 2P2NA 4N0MA 5T8KA 1E1YA 1NJFA 3LQYA 1W1WA 4UDYX 4EMTA 5JVDA 2VF8A 2DPGA 1OH7A 2B4AA 4TS1A 3VXKA 4M98A 2QRVB 5DYYA 4YAEA 2PKCA 4K40A 1ECLA 2XZTA 5BRJA 1Z0KA 3KEFA 4OQDA 3FBTA 5TEWA 4DG5A 4ZVSA 4RTMA 1YVPA 3CE6A 1KMHB 3FWYA 2IXTA 1VB3A 2BFFB 1K0FA 3WLJA 1RP1A 2PLFA 4WOBA 1T6YA 3IO3A 3UUGA 4B76A 4P35A 2RCNA 4D99A 3TLGB 4WGFA 1ICIA 2P5UA 5TPZA 3R7WB 5JTTA 3DXFA 1SK8A 1MRSA 3L0CA 2EAUA 4C76A 1SKUA 4DCGA 2G28A 3QF7A 5KSYA 1J5EB 2FQYA 3G7SA 2NP7A 2AUTA 3CT6A 3MIIA 1W96A 4MUJA 1HK7A 2W5UA 4IG9A 5CXQA 4IDAA 4JI8B 3GVHA 3WP1B 5F3DA 3C8UA 3HYCA 4WK6A 1TF2A 1YBFA 5HG0A 4KXVA 2DHEA 3VAZA 3GFVA 3ZS8A 2IU3A 4ECEA 2Q9CA 3L7DA 3GLFE 5HGJA 1QRDA 2WY2D 1XNHA 4GHWA 4HAYA 4UNPA 5FBVB 1O9GA 1CFJA 2AG0A 2XKBA 1Z75A 2FG5A 5ALSA 1ZEMA 5ARCA 4BRUA 2DRIA 4Q9HA 2L19A 2ZQYA 4KLZA 3TB6A 4Q1DA 5DTEA 4BBJA 2H4YA 1PX0A 4OHYA 2Y1DA 3QY0A 4XPIB 5INTA 1TYCA 2GN0A 4J9VA 4S0XA 1DUVG 3KKMA 2ZRPA 3ME5A 1TM1E 1NGSA 1H5NA 2PMCA 3NYQA 4MITA 3O6VA 3A6LA 5BWCA 1J2YA 2GQ0A 3TIFA 1FJXA 3D3EA 4RYDA 3MWEA 1GSIA 1WUTA 2GEBA 3QLVA 1C7IA 4JWKA 2QN3A 4OHBA 1M33A 4LC1A 4UJ5A 4AYXA 4DR5B 4TQGA 2HW8A 1JMKC 1M83A 1U2GC 2GZMA 3AW8A 4OQMA 3ZWXA 8ABPA 2C7QA 4HAOA 4HDAA 3L6OO 3NTXA 4RAQA 1CHNA 1JUDA 4NKRA 3ZIDA 4ZTUB 3QY9A 1KAEA 4R98A 1ZN2A 2XMBA 2ZIZA 4GEGA 3V6MA 4EHIA 2OV2A 3NAZA 3TRIA 4HB0A 1URPA 4OSPA 3ZBUA 5JFOA 4ZAVA 1CUAA 4MV8A 3GGGA 2C2BA 3QU5A 4FT4A 4U4AA 5DI9A 4OIMA 1OC2A 4GUAA 1VHDA 2XYPA 4L0CA 2Z09A 3L6BA 1A4RA 1KMMA 4KE6A 4IM7A 3UGKA 4Z4EA 2BTQA 3CLVA 3F3SA 3IESA 5KVQA 3IOEA 1QDEA 3D54D 4B5KA 5JUWA 2UUOA 3PR1A 3U4IA 2PK3A 5FQNA 3EZ7A 2TSYB 4BVAA 5JSKA 1SH7A 2RGAA 1AUOA 4FPXA 3FLAA 1ADCA 4X97A 3BREA 1K4KA 3PDWA 1QHHB 1WPGA 2YXLA 5DXJA 2HYDA 1F9EA 1YDHA 2P7IA 3LW8A 4Q4DA 1X87A 3BSFA 3CNOA 5BXQC 2DUJA 3O94A 2J3JA 4W1SA 3MCZA 1QQTA 3QX3A 4LW8A 1UK7A 3QHAA 2GPSA 1GKIA 3VR4H 3VVCA 4UTZA 3TINA 4A6XA 3PXXA 4ZOAA 3T34A 4DMCA 3GBSA 1TZ2A 2OBNA 1TZJA 1JFLA 2WEKA 1AXEA 2XNDA 4U2CA 3W8NA 4TT8A 2YWHA 2OZPA 3BK7A 4YJ2F 3RQIA 3LKZA 5C8XA 1JG7A 5KTRA 2ONKA 2ODTX 4GC9A 4HGZA 3CKLA 1ZVKA 5AI4A 1EM6A 4K9NA 3GV0A 5DHRA 3CIFA 4MRAA 3M5DA 5CNJA 3IVMA 1X1TA 4RA9A 5TPWB 5JBQA 2NO6A 4PE5B 5KKCA 2YQZA 1U11A 1A1VA 4Z4GA 1T2AA 3Q2OA 3AUSA 3AR4A 1JH8A 3E58A 4I46A 3JZFA 3E81A 3PQ5A 3QG1A 4KO1S 1Z7BA 1O89A 4BE7B 5BNWA 1JHAA 2WT8A 4CUJA 1WB5A 2RKBA 3O7WA 4CBVA 3W5AA 4WXRA 4YNBA 1GHTA 2HCRA 4AJ2A 3VPFA 1BXRA 3H9BA 3ZLVA 1HORA 3OJWA 4G37A 3JQGB 1Y5IA 2C4MA 5D1NA 3KLMX 1ZSYA 1PG2A 1QZZA 2IZ6A 2G8LA 1I2BA 3I9NA 2A57A 3LCUA 1LWOA 4YI3A 4HN4B 5F1YA 4DMGA 2ES4A 3OEWA 4CMCA 3LYLA 2FFHA 1UJ4A 1U63A 4G0MA 4ASUD 1TJPB 4PICA 4DN6A 4WCVA 1LY1A 2QF7A 1F1JA 1V6CA 2RK4A 4PLCA 1GR0A 4JVLA 4ETNA 2R6CA 5JXWA 1OB5A 4Q03A 2NACA 4OLFA 4B3FX 2FPWA 5JD6A 4LF4B 4G5YA 4TL9A 4B3HA 3ASVA 5CPBA 1ZW6A 4PSVA 1U0FA 2ZB2A 4Z4HA 3OOHA 1E18A 3GZNB 1UQRA 1CDOA 3DS8A 2VZ9A 4HB3A 2TS1A 4PY2A 3T94A 3AV0B 5JQGB 4K2HA 1GU0A 1KKUA 3BK2A 5C8YF 3L6DA 5JV5A 2VPTA 1G9TA 1JQEA 1PG0A 1QH1B 1ZIXA 2ZBQA 3FX2A 2I3AA 1PVOA 4IVRA 4PSCA 1RIIA 2QQ5A 2FXVA 1TMGE 3G02A 4S1OA 2EEZA 1MC5A 1GPLA 1P19A 2UZAA 5EESA 4XUDA 4A8JB 4HVLA 4P82A 3B2EA 5DNAA 3U48A 2J9ZB 2Z8YM 4TYMA 4OX9Y 3E9QA 2FY8A 3K9QO 1CZRA 1YS6A 1ORHA 2ASEA 1VP3A 3IT2A 1PV2A 3Q9LA 3QMMA 4RIIA 3QKSA 4X1YB 4ETMA 3ZCQA 2MYNA 2I99A 3U81A 4C08A 4F3NA 2PGJA 2DG2A 2WIFA 3G0OA 3GD5A 3JQFC 5CDGA 4R1NA 3LUCA 4BBZA 1W2GA 3NEYA 3ON5A 2V6JA 4EUEA 3PNLA 2FR8A 4CM8A 2YVUA 3WAJA 3VNUA 1W0JA 1OTHA 4CWAA 2UXCB 1MJFA 4AAYA 4G0XA 1FP6A 5DGXA 2XBLA 4B2PA 3ICVA 2YXNA 3AIMA 4AN1A 2LKCA 4TLBA 5T7BA 3IVAA 4WADA 3V8EA 1RHKA 1BVYF 3KLPX 3ZWCA 3GCWA 3UJBA 4BVEA 2JAXA 4LOKA 3WV4A 2CHEA 1KZ1A 2IE8A 2AFHA 1KL7A 1SHUX 2W2TA 5LQCA 2DFKB 4JQOA 5LMUB 3KHTA 1OAOA 3CF6R 5M34A 3OQ1A 1G8GA 3LHSA 4JR1A 4FK8A 1SJ9A 1XPUA 2O05A 5ADHA 4ZEOA 2OXCA 1DRWA 3DAPA 4Z1MA 4EH1A 4YT8A 3PWSA 2G9ZA 2O50A 1GCGA 1UPFA 3OFSA 3GJZA 4JR2A 4W8OA 1Y9DA 1BH6A 4QGSA 4CIAA 4CEJB 3C7CB 1CJKC 5GVRA 1AXRA 3AP3A 2V7GA 1NYLA 2JJ8A 3D3WA 3BSWA 5MDHA 5F9FA 2MR6A 4BJ5A 1JN0A 4F86A 4MVJM 4MVJF 1YR6A 5DOVA 3CRRA 4EEKA 2G36A 1CF9A 3COZA 2HIMA 4EL5A 2I1VB 3DG9A 4AUKA 4CKEA 4DRXA 2BDEA 2QL7A 1LDNA 3QYFA 4JBGA 3H9GA 4C4SA 2KLBA 5DMHA 3EG9A 1ISGA 1NVVR 1WVGA 3MJTA 2VJYA 4BN4A 5G0VA 2PY6A 4HXEB 3RSQA 3TKLA 2XZOA 4BMCA 4JS0A 1QGAA 3O4RA 3F2VA 4O2AB 2VXCA 1D09A 3WZMA 3VO8A 1I7LA 2R2AA 5J2TB 2C96A 5E95A 1GUDA 1GG5A 2QXTA 3AG6A 2C94A 1Y8CA 2I4MA 1HRKA 4DXAA 3AYXB 3IV7A 3QU4A 1FNMA 1LLFA 1YUNA 2ZTMA 3BMCA 4LXHA 2CDNA 2RGUA 5IU6A 2Z57A 1U8YA 4LYDA 4G5GA 1NUHA 1RQLA 4U6NA 5KS2A 1QF6A 4PEVA 4UHEA 3SSMA 2X19A 4MP3A 2QRPA 2P6PA 2DKFA 1T36A 1YRLA 1GPNA 2XHEA 3H2KA 1NL3A 2BFPA 3CU5A 4AJPA 1U9IC 5B2ZA 2W8BB 4RE5A 2NU7A 3I9FA 2ZJ6A 1BE1A 2Q6KA 4GNKA 2DR3A 3CTMA 3FR8A 1IMOA 4OXXA 1JPVA 1QNLA 4NU5A 2CUNA 4LJYA 1KF0A 2HSJA 2ZBDA 3D7KA 3KXIA 4IIJA 1XZCA 4OQLA 5K6AA 2BMFA 3OE7A 4NHEA 1RXWA 3TW6A 3UCFA 4Z1MD 3W2TA 1P2GA 4JC5A 4Z51A 5E9JA 4F2WA 4ER7A 4F9EA 4JI5B 1ZMTA 1GEGA 2JI9A 3FF4A 3ORSA 5JCPA 2PWBA 3AUYA 4CTNA 3FHTA 1P2FA 2O07A 4Q02A 3BH7A 4D9JA 4NI5A 5CW2A 4R8SA 4AF7A 3ZDFA 1N8SA 4TKZA 1RCUA 4B5LA 1Y80A 1DUIA 1QGUA 2BGMA 4G4JA 4RPCA 5AJXA 1SK9A 2AWNA 3X44A 2BI7A 4UE6A 2DUWA 2WFZA 3GFPA 2HZBA 4I5IA 3RGWS 4BXOB 3ANMA 2AJTA 3K15A 2MSKA 2O1SA 1FRNA 2AC7A 2CXOA 3HV0A 1L5GB 2Q2OA 3UWKA 4ICIA 3DOOA 2WR8A 3FVVA 1NLMA 1MB0A 2R00C 1BCRA 4UBMA 2GGSA 4YWJA 2GCNA 3BL8A 4BGIA 4DIBA 5E1OA 3DP9A 1XVTA 4V0LA 4L9AA 4RTPA 1MO5A 2RK3A 5EG5A 4BMYA 1U3WA 3K72B 5JSYA 1C8VB 4TS9A 4X1KA 2PO5A 2OK7A 4J0IA 5HCIA 3ZJTA 1GTL1 3M4NA 3QELA 3M6VA 1AUVA 3GA7A 2Q1UA 1MPTA 1VCIA 5KVVA 3TZHA 3LY8A 4AW9A 2ZM6B 2OLKA 4F5YA 2O57A 1N3LA 3ZE7A 3R9XB 4B6RA 2OKGA 4XXHA 4FNAA 3RQSA 4RY0A 3DDNA 2AIRA 3IKMB 1XR3A 4M8NE 3OM9A 3WLNA 3ZX4A 1PSZA 3R3SA 2XQKA 1LJ8A 2DQYA 1JHQA 1I6MA 1ZUNA 1VYHA 1YT5A 2M2IA 2R7MA 3IQEA 4C0XA 1I33A 1EFCA 2VPWA 2PBRA 3NU1A 4YLGA 3F73A 1CR4A 3DR3A 3JQ8A 1E6MA 4EENA 1X8JA 2D7CA 5GWXA 4II2A 1VJ0A 1YRHA 3EIWA 2I03A 3EIOA 1Q7CA 1EDBA 5DX0A 4AL4A 3PCTA 4GDFA 1DG9A 3BJRA 3CCCA 4M89A 4DJEC 1ZD3A 2FOXA 3T3PB 1Y8RA 3AEYA 1P1JA 4RZ3A 1XXHE 4CMBA 1CNFA 2ZZNA 2AMVA 2BFWA 3TUZC 3CWCA 3DTTA 3FG9A 5AXDA 5JBNA 1MKYA 5KKNB 5KQMA 1U4OA 2D1SA 3ABSB 3B7GA 4RE6A 4KRXA 3ZKWB 4C78A 4CKBB 5AUPB 2JAHA 3HJHA 4B4VA 3GFFA 3KSAC 3QE3A 5JDCC 3BBLA 3VU9A 1WXQA 3F4LA 1JIQA 1E8MA 4L74A 2EBFX 2D8AA 4MWBA 5M3BA 1II0A 3PJEA 4LMPA 3HDVA 2C57A 3RPEA 3RS7A 1G6OA 1P6UA 2DYKA 3THXB 2PXXA 5BW5A 4G89A 4YV7A 3FPBA 3VNAA 2O2SA 4IL5A 1J8YF 4GYYA 3CPSA 4MR8A 1WKCA 1DC5A 4LI0A 1L7VC 1KY5A 4QULA 3ESRA 1D1TA 5AM4A 5BUCA 6GPBA 1Z5WA 4GBJA 3NMUF 1HC7A 2NU9B 2QVBA 2Q8PA 2D1FA 1YL6A 1ONPA 1UKVY 1YOBA 2FE1A 2XECA 2GBPA 3ANTA 3ONWA 2ZRLA 1SELA 1WZCA 2Q6LA 5BW6B 3QKRA 3U40A 1W4LA 3FGZA 2Q9UA 3R0XA 3EF3A 4P7GA 2DQKA 1GZHB 2ZWOA 1U2SA 2UZ1B 3KPYA 5TQ0A 2H1RA 1YB2A 2WP0A 4QBKA 1X3LA 3FVQA 1R0KA 3CJTA 2VDKB 4C4YA 1CBUA 2DTXA 3MBIA 4OGKA 4MGYR 2POQX 4C05A 3WLKX 2JLVA 3TQOA 3ZXIA 1M8JA 5CVDA 4KIGA 1SCIA 3JZAA 4NE2A 4R1TA 3CH4B 1QAMA 2CEKA 3DDCA 3ZS9A 3QI7A 4FFLA 4Z7JA 2ECPA 3D3KA 1UBRS 1G38A 4V0RA 5FWAA 5L8VA 3GIDA 5HYVA 2AG5A 2O7VA 1KGSA 2A9RA 3EZGA 2JHPA 3JATA 4R2IA 1TA4A 4BFCA 3E9CA 4X90A 3FYUC 3OZVA 1OZHA 4C5BA 5JCJA 5CNKA 4BX0A 4CL3A 1SCDA 2QY6A 4LBZA 3BC1A 4G63A 1YOVA 1PTKA 4QTTB 1SUBA 3FCEA 4BVBA 1EVJA 1ENYA 4RC9A 4ZOLA 2ZU0C 1NP6A 2GPNA 1X1DA 3WY9A 1SCUA 1FSPA 5KNCD 5LXTB 1JDTA 4AF8A 2A9FA 4XLZA 2QG4A 1JP7A 1Z8HA 1TUBB 3RAFC 2Q28A 3BIJA 1Y9JA 4HK4A 4HADA 4AMYA 3Q98A 3DEAA 1L5KA 4P3OA 3CE9A 1Z68A 1ZMRA 2C9BA 1T4CA 2KMLA 2ZI5A 5BQ5A 1WDLA 3CVWA 3G8CA 3N2GB 2I67A 4Y7DA 5F4BA 1ZD4A 1PV1A 1P29A 2FKNA 3QVTA 4U2EA 2CW5A 1O6ZA 2PJDA 4DR4B 1T5SA 1YJ8A 4QOSA 4URHA 2R62A 4MYDA 5HF8A 1XP8A 1SM4A 1C7RA 2C97A 1YNOA 4L8WB 5E0OA 1G0OA 3ZXUB 3GGJA 2N46A 6ADHA 1CY6A 4IG4A 7MDHA 3PC4A 4DIFA 4RTNA 4GVPA 1KWKA 1WNFA 2IHUA 4YVFA 2WU0A 3JQPA 1VLJA 4C7OA 2XMQA 3BWYA 1I6WA 3MBKA 1LVHA 1T8PA 4MYRA 2AVNA 4KQ9A 2HV8A 5FBWB 1AO0A 5KJEA 1M6YA 4W8GA 3AMVA 4KXNA 4E13A 3WNBA 2AFIE 3LQ1A 2IKQA 3WKBA 2AR7A 1CUGA 1OQAA 2X2OA 4NJMA 3VDRA 1PHRA 4ED9A 2AK2A 4R51A 3HBMA 3A37A 4AJ1A 3G8BA 3OFKA 4JASB 1UINA 2FPUA 1EFRA 1N0UA 5COAA 1K3FA 1X7XB 3CUEF 4KHPB 4TYQA 5IFKA 7REQA 4IJVA 4P4UA 5A7HA 1O5IA 2N0SA 2AN1A 5K20A 5I4IA 1S1CA 5JCJD 1NSFA 2X8JB 1NVEA 2Q7OE 4ZEMA 2PZLA 5CBPB 3A9WA 3KTAB 4PM4A 2LD4A 1JJVA 4DIKA 3P8ZA 2RHRA 3PE4A 4G25A 5LOVA 4GUDA 3QP9A 5ECYA 1EUCB 4PAWA 5AM2A 3Q8LA 2IYNA 4OYYA 4ZCTA 1U8EA 1AGRA 4LECA 3QH4A 5AHKA 3SF8A 1ODTC 3NNSA 2D0IA 1BN6A 1TQHA 4E4YA 3WB2A 4K6GA 3AH8A 3RR2A 3A28A 5JQWA 4NP6A 1YTLA 3QE4A 2Q0HA 3QFRA 2VK4A 5L3VA 2C5AA 4FCWA 3WNQA 1O2DA 3G13A 1T15A 3JARA 5I7EA 2QSYA 1LVGA 2HPHA 1NR1A 4OLAA 1UK6A 1PHPA 3BICA 2BRUC 3DT6A 3AJAA 3DOCA 2GZRA 1BCSA 3KHUA 3LC2O 4DJDC 1UT5A 5C7YA 1J0AA 3MWDA 1A8IA 2C84A 2FNAA 2V1UA 3I73A 2I22A 2LXNA 3QVOA 3P45A 3CLTD 3B3QA 4KKXB 1AGYA 2FKAA 2Q3JA 5I9LA 1NBAA 4FJ0A 5CA0B 1TEVA 4AO8A 5AOCA 4E6EA 4JQSA 3ZU3A 2DEUA 1E20A 1N7JA 2OKCA 2QN9A 1SG0A 4OHWA 1ATIA 4ZOBA 2P3SA 2OYRA 2NZ2A 1YUBA 3CUKA 3SFVA 4RDCA 4PO3X 2H1WA 2BF7A 1IY2A 4QJBA 4Y2RA 1D0VA 1NRXA 4MGKR 1ZZEA 1QF7A 4O2BA 5EMMA 3FOEC 3F8SA 1MRNA 4ZMRA 4MS4B 3ZGLA 2WG1A 3BMQA 4KBGA 4PG4A 3GXOA 2JHCA 3MGGA 4RWEA 2QTNA 1VL0A 3ZGYA 4I99A 1HT1E 1EGHA 1LPMA 4YB8A 1TA0A 2QJTA 5I5EA 1GPUA 2XTAA 2IPLA 2IOFK 4IW3B 1JHZA 4B47A 1BDBA 1WXDA 2QI9F 3SE0A 3HR8A 3WK8A 1O08A 5CEFA 2EQBA 3G2MA 4MCIA 5AVOA 4YT2A 5EUQB 1UKZA 4ESHA 3MD0A 2RC5A 3G85A 1PJ2A 1NVUQ 3KO8A 3LGAA 3T5BA 1EFPA 3QBDA 1KFBB 4CDNA 4E22A 3PXGA 2XNHA 4MQ6A 2YYSA 3E4DA 3PHCA 4N6GA 1AHPA 1ZH0A 1GKYA 3OMWA 1RXSA 3QYAA 1DQSA 1UBFA 2GASA 1KIMA 3GLSA 4K6OA 5LZ9A 3HCRA 2E4AA 4P3YA 4YJHB 4B7AA 4UCXA 4DHEA 1GL9B 4EI2A 2P4SA 2PS3A 1NBMD 5AHOA 4OMDA 4CV0A 2HR1A 3HXLA 4FR0A 2VOEA 4BO6A 3AVXA 3VO2A 2J6BA 2IU0A 6CHYA 3EVBA 3U7JA 1W44A 2WIJA 1Z2AA 5F9HA 4NPHA 1HDZA 1GPJA 2BZ0A 3CZ4A 5HCNA 4C3UA 3R0JA 3KUDA 1QMPA 2FWRA 4MV0A 3ILVA 4Q12A 4ZCPA 2P5TB 3I05A 4UFPA 5LDDC 4GSLA 2WD7B 1XCBA 5IT5A 3EEYA 4M1TA 4KLNA 1D04A 3IAM1 4LJ8A 4C5AA 1IB0A 5D5HA 3A0UA 4NXNB 2AEFA 4YIKA 1C81A 3K0EA 4OQXA 3FKSA 3ZDZB 3H1AA 5A02A 4TYNA 2YZNA 1NVXQ 4KPUA 2P6RA 1ARZA 3IX7A 1YA8A 2VTBA 3FKJA 1B0ZA 1O94A 3AZQA 4L4YA 2P6OA 4ZVLA 1XMIA 2QTZA 2XB4A 3M9LA 4PSKA 4NDZA 1L1QA 1N5DA 3TVDA 2M32A 2OO5C 3ANXA 2G6BA 2Y9PB 4R71A 1B6SA 2P0AA 4ODIA 3I23A 4DDMA 2DSNA 2WUFA 4N5NA 4ZV4A 2HB6A 5H4HA 2BZGA 1W5TA 4TSFD 1DLJA 5HRUA 1E92A 3E1GA 4N18A 3QK7A 2PZMA 5LC1A 3BS4A 3FPSA 3RCBA 3VZBA 4ARVA 4KYUA 2BMVA 4ERNA 2JEZA 1CG6A 2GFIA 2L18A 2LIVA 1NDQA 4ZPXA 5KU7A 3UJHA 2FDCA 3OSZA 3BAZA 4B87A 2QUAA 3N2KA 4I8DA 3A4VA 1E3MA 2DWQA 5T67A 5REQB 4QFBA 5LQRA 1J42A 1UMBB 4N5DA 1C8KA 4WKPA 3DW3X 1KE1A 1FW6A 2BYTA 1EQUA 2B7CA 4JLOA 1P9OA 4JU9A 3C1OA 3I0NA 2ZRFA 1XEXB 2X86A 3PFFA 2V0CA 3KT6A 3OBBA 4TT3D 5C1PA 4Q9DA 3ZD7A 4LMRA 3RK0A 4NU0A 2O48X 5IDXA 4TXMA 3RRZA 1PT6A 1WXIA 2VDOB 5JAPA 3VDNB 3TTTA 3ZIUA 5K3EA 3TX6A 2GN4A 3FOWA 1M1UA 3RTCA 1U8UA 4H7KA 3OWHA 5JOQA 3RYIA 1CUFA 3V8MA 4LXUA 1A7JA 1NXQA 3QG5A 4N7JA 2IEAA 3T7IA 3OSUA 5F7ZA 1IN6A 2H0RA 3WBBA 4ZHQA 4QWWA 5D1HA 1L9KA 1U2PA 2B2XA 4B8WA 1IZ8A 4EPYA 5IUKC 2J6HA 3C4VA 3NHMA 4XASA 2XSZD 5DNVA 2VNAA 2JVJA 3DT9A 4A8PA 1R0SA 3PUYA 2XBUA 1K6XA 1NW9B 3AF1A 3TOVA 3E7FA 3BD6A 3IP3A 3MQFA 1OPXA 3OFVA 1F2DA 5IABA 1E0SA 5KQSA 1KFKB 2P6UA 5JCXA 1OB2A 1QOZA 5ICFA 1O6GA 5IM5A 3CSSA 2JKVA 5D3MA 3M1LA 3U1VA 3DGFC 2ZYWX 2MCFA 4JT9A 4LFAB 4RAOA 1ZM4A 1NW7A 4XD2A 4OFZA 1YS1X 2HSZA 3CKYA 5FFFA 3VGJA 4RL6A 2ZS7A 1O97D 2YWJA 4FE7A 2NZUG 3ODGA 2J09A 3S28A 1Q21A 4OB7A 3JYQA 1VKRA 5IYZB 3WNVA 2OESA 3VPHA 5JBIA 2Q3MA 3EGDB 3V8PA 1FU8A 3CRW1 3GEPA 3N0VA 4NYMR 4UEOA 2I6TA 2CMFA 4JFAA 3U3JA 2D7JA 4ZDKA 1CUUA 3TZEA 3K9CA 2DUUA 2XWSA 1W19A 4HLDA 2XUPA 4LKRA 4ZRDA 4BQNA 4K1XA 3GNLA 1JU3A 3A1WA 2PZ8A 4OQQA 3WKCA 3ZQKA 4BEWA 1ISSA 1HF3A 3IPCA 4F38A 3SHQA 4KPGA 1QH8B 1U0GA 4HLCA 4O4IB 5DK4A 3IOBA 4YV0A 1K0UA 4DS3A 4ESVA 3B89A 4C9BA 3SI7A 4RTQA 1NI4B 4MI3A 3AYZB 5TVGA 4TKUB 1QWSA 3EF1A 2XXAA 3KPVA 1K08A 3COYA 1K5PA 5DN9A 3RS3A 2ORED 2G70A 2GCIA 1Z16A 2QLNA 2DX7A 2GN8A 1IJBA 5FNVF 1V7PC 3QW2A 2VKQA 1XVAA 2AUMA 4X8HA 3GJ0A 4XJVA 2W00A 3LLSA 5LDGA 3D8BA 2XYRA 3TFQA 3IMFA 1RFGE 1XL1A 3AEUB 3FH0A 4O4LB 3A04A 2ICAA 1N25A 1EAYA 1NF8A 5BSTA 1JIUA 4UREA 4W7SA 3UMFA 3PVZA 5A9SB 1NZFA 5IF9A 1I24A 3QTLA 2CVZA 5IM4F 1O9HA 3RVDA 4ISBA 1VIVA 4NPCA 1LV8A 4EL0A 2PX2A 1X92A 1MHPA 2C9ZA 2DFVA 3THWA 1W36C 1R4MB 1J0DA 4QXAA 4Q7MB 1W581 3FZQA 3OX1A 3QYJA 1SXJD 3NORA 2ROQA 4WE3A 3G9UA 2PRSA 2VAXA 3U37A 3T0FA 1T5TA 3R3UA 4D6YA 1XTBA 3GLKA 3ECAA 2D0OB 3AFMA 3Q7IA 4YJKA 1B3RA 1QTQA 4CXMA 1EZ4A 4URXR 3E3OA 1YS4A 2RI6A 1II8B 2VBCA 3NPAA 4L27A 1LZKA 1G5PA 3DXZA 1BGXT 4H16A 4PFQA 4AUMA 5B2EA 1GZ5A 1OLUA 2W0SA 2WWGA 3K0FB 4X71A 5T5QA 4KGXA 5JS6A 4HGYA 3AM3A 1DRVA 1IAQA 2IUFA 1H9AA 1GUYA 4AX8A 2P9BA 4KR2A 1FTGA 1R4NB 2QOEA 2VZLA 4KWIA 3DAGA 4LNHA 3KUXA 1NNI1 1WCIB 4OHVA 4QOJA 4BKQA 4BTLA 4PONA 1L7QA 3D9QX 3G3EA 3PQFA 1YRQA 3RT1A 2H1FA 5BY2A 3DF9A 4IHJF 2ZE6A 3HB0A 3MJCA 3P0FA 3GI1A 2R6HA 4DSZA 4ALLA 4MQ4A 5LNK1 3ZE8A 4ZCLA 5CG1A 4HVAA 4YFVA 4GG1A 4B3TB 4M9QA 4JV5B 4AZ0B 2QLMA 4JUFA 3BWCA 4BTVA 2R4TA 4IDFA 4JBIA 4K7JA 3BVPA 1U5AA 2P9YA 4B74A 1GTZA 1LBTA 2XVMA 4F3TA 1KE2A 1BW9B 5FEUA 4IV8A 4MRMA 4GBED 1G20B 3B7PA 1F5SA 3K09A 4PWZA 3CVVA 3BRCA 1IXRC 1FRQA 4IH1A 4D74A 4ZVTA 3AHFA 5L7TA 2IDJA 2H6EA 2R6FA 4OHPA 1CNEA 3LC1O 4OTZA 4LXQA 4KEAA 4YRQA 2YC4C 5CEJA 4XCXA 4F7WA 1QP4A 2DWUA 3PUXA 3EDOA 3Q7PA 4WUTA 3MYYA 1W7AA 1EFDN 2GEFA 2P2YA 5EHNA 4E94A 1K06A 4HXYA 1GILA 1TJ4A 1QPGA 2PKRA 2ZT5A 3ETHA 3I09A 3FWZA 2GD1O 3DKPA 1FX0B 1VQ1A 3QEJA 4IIBA 1NUPA 2OQVA 5HM6A 2RAUA 3HEBA 1AV7A 4QBGB 3S1AB 1H8HA 4L3OA 2GBIA 2XTJA 5FOUA 4KLCA 4UCFA 3OPQA 2ZJ3A 1Z38A 3K0HA 1XL0A 2UAGA 3FR7A 3TDNA 1FDSA 3UM9A 3ZK9A 3T4XA 4UARA 2FXIA 2OUIA 5CYOA 1CRPA 2XODA 1P4SA 1YB6A 2XA2A 1TZKA 4IQFA 3VHXA 4AO6A 2XUKA 5H81A 2J9RA 2JKZA 3KYBA 4KN6A 3X1DA 1GSAA 1IG3A 2MMGA 3H2YA 1BOFA 3ZIAA 1CE8A 4ENQA 5K9ZA 1EA5A 3ST7A 1MH1A 4KX5A 2GI4A 2ZWPA 4O29A 4BQOA 1CC1S 2J07A 2FZLA 2MIIA 3AWDA 3ZVRA 2VAVA 3K1ZA 4IHAA 2ZB3A 1XRLA 1R0BA 1J23A 3L8MA 2OR3A 4DIDA 2AMYA 2C9DA 3FN4A 3NDRA 4R7ZA 5C1BA 4OBBA 1JEYB 3WNZA 1N8NA 2AG8A 2L82A 4MCHA 2QTVB 1IBKB 2ZCUA 4QZVA 3UUFA 1TF7A 4KO3S 3IKTA 5FA6A 1P0MA 2CLKB 1HXHA 2JK0A 1RLMA 1GLNA 4FZ3A 4JITA 1II9A 2OCXA 2OGSA 1TD1A 5AKYA 4PXYA 5FPTA 4LS3A 4L1KA 2NAPA 4KWTA 3TG8A 2ZIAA 1JIJA 1REQA 2ZRKA 2PZEA 1NQXA 4CCYA 2GETA 2VDWA 4INZA 4QNRA 5K0NA 2VQFB 3I9LA 4MUEA 5TT1A 1WSDA 3TGLA 2O06A 2RHWA 4BV2A 1BO6A 1QAOA 2Y66A 3J80A 4DCJA 2H7XA 5FR2A 1QP8A 1O3YA 3R0ZA 4HQNA 3RIEA 1A8HA 2WG2A 1BRMA 4P1ZA 3D2BA 4AJOA 1FTWA 2J3DA 4FFRA 4S1TA 5DHAA 4GAEA 1WBJB 3VR5H 4C43A 2QX6A 3JWGA 3FWHA 3BMNB 1XDWA 4L5YA 5DLDA 2C4WA 3FCSB 2IXBA 3F71A 4NYJQ 3A2NA 3H18A 3PCRB 4EZIA 1V1RA 2V0GA 3S2FA 2YOFA 1HLPA 4N5HX 3TCNA 3JRXA 4B43A 3I01A 3I8OA 2MHCA 3K05A 2WJPA 3KEMA 3N0XA 3I4FA 4X6YA 5F1KA 1G8SA 2CL5A 3BXZA 3W3AA 4UUNA 3ROFA 3STVA 2OG1A 4FYIA 4MUAA 3W2GA 3WIBA 4YUAA 2J33A 3X3HA 4FHDA 1UBOS 4M88A 4RCYA 4XQCA 3Q4GA 3X1ZA 1NSTA 2IYWA 1PW5A 1ESZA 5KVAA 2FF7A 5KYTA 3ZDBA 3NW9A 2ZSJA 1BVRA 4LJKA 3H8JA 4N49A 4JB8A 4Q82A 1YJQA 2WNHA 3CNNA 5E6UB 4ZI7A 1PIWA 3ACCA 1XALA 3L4KA 5JVDF 4M1YA 2IY9A 4CM9A 2WSMA 3NV7A 4OSOA 3UV6A 3K8QA 1TM5E 4B6OA 2JRLA 4KV7A 1DT5A 4HGOA 2FPGB 4ALKA 2B8EA 3GMDA 2L0XA 4ZYZA 4MMZB 3OQOA 1U94A 1NN0A 1ZS9A 2VHXA 1HFWA 5C3MA 4BP1A 2H16A 4QUHA 5HJ5A 2GO1A 4JAVC 1B2RA 2P6NA 3MJ4A 3H5WA 5K0LA 3TPFA 3KEOA 1DKNA 1S6YA 2ZDGA 2VT6A 3HY3A 3OFNA 4D7AA 5KYXA 5AXCA 3LPDA 3ZOKA 1VDZA 3FTNA 3PQEA 1E2UA 3MCUA 4PHFA 1NVBA 3KXDA 2BT4A 3PVCA 4GR9A 4A15A 3USES 3HK2A 4OGWA 3ZGZA 1DWOA 4DNXA 2CJFA 1Y4ZA 4I66A 4I55A 1VE9A 3GDOA 3QNMA 4HDQB 5JISA 5KQGA 2PRZA 4L8VA 3ZNNA 1AF7A 2HXGA 2NW6A 3H2HA 1RRFA 4HZIA 2R7KA 2E18A 2E3JA 3P20A 3KWMA 3Q3IA 1M6NA 4RMIA 1NLYA 5HK8A 3C24A 3NWOA 5IHXA 1RQNA 5U4QA 1PR1A 1VPTA 3DXXA 1PV4A 1HOXA 1NXWA 1E9SA 2UXDB 1KJNA 2FW0A 1UXGA 5T57A 3F6EX 1HRDA 1QRSA 1PLLA 3HHEA 5BSVA 2C7VA 4HQLA 1P2DA 5IF3A 3MT0A 1P7CA 2I76A 2IDKA 1ADFA 3EVFA 3H9QA 4NMWA 1CUBA 3W3AD 1AKVA 1G21A 2EBWA 2C4HA 3LP6A 2QBYA 5IULC 3G7UA 3EASA 2QV0A 4Q1AA 3LIPA 4DWOA 5JXJA 4ER6A 1XTPA 5B3JA 4W9MC 3EPLA 1YB5A 3IVRA 1E7MA 3ONEA 4BNLA 3GGPA 3MWYW 4X84A 4FBLA 1RWVA 1WVIA 1OA0A 2FQWA 3H1BA 4LF6B 4V0MA 4E3WA 4FYHA 4MPPA 2M6KA 1TEHA 2BEUA 2G6TA 2Y0BA 4RO0A 4Q9IA 1ZAYA 4AO7A 2BF4A 4Y6RA 1QS0B 4GPIB 1Q6YA 4MDFA 5AVSA 3CW9A 3TAHA 5T4EA 5ENVA 1HZJA 2Q1TA 1HFEL 1SB9A 2ZYSA 3PIDA 2P0EA 3FYUB 4BL5A 3FAKA 1UKYA 1NFFA 3N8HA 1NBHA 4GGMX 4GPD1 3QEOA 1VLQA 1X2BA 1IEXA 2DERA 3ZD6A 3QWFA 1NA5A 4URWR 5SV2A 4EKDA 1FC0A 1YGPA 3VR2A 4B0OA 2DJ5A 1LF0A 2Y1OA 2Z3ZA 1E3WB 1E1RA 2QT0A 3AUFA 3TQRA 3MTGA 4PNEA 4B4DA 2YN0A 3UJ8A 4RHFA 1TK3A 2VJDA 4CLRA 4BLOA 3KSDO 2WPDA 3IR5A 3IQFA 3VQTA 3VYUB 3L4BC 4GPZA 4HAIA 4QYSA 4TSKA 4DLSA 5LQNA 5AVUA 1XRSB 5F2NA 4DMHA 2ZYIA 4M53A 3MN1A 2EF1A 1JFFB 1MOPA 3AY7A 4NU8X 3L6RA 2GJSA 2R1VB 2X4LA 4NABA 4KAXA 5D7NA 4A82A 4C6RA 4BEJA 1AQ6A 2JK1A 3RK1A 3STHA 4GLFA 1R8YA 4DQ0A 2C9CA 3KQQA 4R40A 1NATA 1A9PA 3HYTA 3KLNA 3VNRA 2J9FB 2OT3B 4WESB 1X9GA 4WKOA 3WNCA 2C0PA 2X14A 4PPFA 3RYTC 1G3QA 2Q21A 2YN2A 4HFRA 4QJ5A 1IK6A 2ZJ8A 1MNAA 5ALUA 3M33A 5LA6A 1GPMA 5ULLA 4F5ZA 1C9DB 5FWYB 3EGIA 3ZNPA 1RMTA 1XZFA 1GD1O 3FLMA 3DVAA 3RSCA 3ORFA 2BFBB 3VC3A 3VHQA 5DNYB 1EXDA 4EARA 2V7QA 2CXPA 5HQJA 4YDQA 2NO9A 5KTTA 4K5QA 2CNKA 3LCRA 2LZ0A 3ANSA 3OM8A 4CLEA 4RETA 3MGCA 1SU4A 4QX6A 3H5AA 3PGLA 1PR3A 4BQIA 5BW4A 3SN6A 3Q7SA 1J1IA 4URUR 4TUYA 3RYHB 4EHFA 2ZBVA 5F7XA 2EL7A 3TUIC 1RRGA 2DE0X 3BE4A 2O2EA 4DV1B 4XDHA 3P1JA 3FIUA 3II6X 4GM0A 5F51A 2PVPA 3SNHA 2V3VA 3THYB 4KRYA 4L78A 1DG3A 1G2QA 1B8OA 2FMFA 2VQ3A 3K9WA 1OIVA 3HKDA 2BR5A 5IXYA 2CLCX 1AZTA 5B2FA 1QK4A 2OVBA 4Z9BA 1RBMA 3I9MA 1CJUC 5C9ZA 3VR2D 2HGSA 3MUNA 1G66A 1UBNA 1ML3A 3IXQA 4BVGA 1ZKMA 3GU3A 2FP4A 5ALOA 5EHQA 1E1RD 1U5CA 3T5PA 1YZUA 3H13A 1T8SA 4MRNA 5J9FA 1VLLA 1RWKA 5K0EA 5HF6A 1ZH6A 4IV5A 2IDZA 4EMBA 2LP4Y 3RFUA 2YHUA 2A9OA 1CIVA 2JAWA 5BN4A 4GYWA 5B7GA 4YAOA 1BN7A 4TKMA 3RODA 3FGNA 1B41A 3EWAA 2P2GA 3MT7A 1RT9A 4P5DA 2BFEA 3K4HA 3WO0A 3H1PA 5K8UA 1YDGA 4OXKA 2ISQA 1F20A 2PPVA 2WJ6A 3ET4A 3IVCA 4R2HA 4TVBA 4DVGA 5A5EA 1J20A 4Q1EA 3DZHA 4G0UA 4I3FA 3A2MA 2WT9A 3AHGA 1NRIA 4GL4A 3FZEA 2BHTA 4PQFA 4F6LA 1H0HA 1Z2DA 2AJ8A 4G0OA 1XA0A 4ZV9A 1K7XB 3E9YA 1S3SA 2JLRA 2Y1FA 3D64A 3LA6A 4WFJA 3R3XA 3RABA 5BT8A 1MVLA 3EQ8A 4RQUA 3EZFA 4LVNA 4X64B 4MOWA 4IH9A 1ZNWA 3QV2A 2AXNA 1IXKA 1Q14A 4I1PA 4OJMX 2WW8A 4AZVA 2H4ZA 3ZU4A 5B4UA 2DLCX 2W11A 4FEGA 1PKXA 1W94A 1BAPA 1Y81A 1QZTA 4Y6LA 1N92A 1JHMA 4XWWA 2O0HA 2HLHA 2Z9DA 3GNQA 1WSWA 2X8LA 1X13A 4D1YA 5P8WA 3EMBA 1KO7A 1RPTA 3NH6A 3OZUA 4CNBA 3PEWA 3PIRA 2O3UA 3D8NA 2ZB4A 4NH0A 1U8TA 1MGPA 3N2LA 4RF4A 4BMNA 2SCUA 2VEDA 1RIFA 3DEYX 1R5NA 1MJ5A 2OMKA 2OOSA 2Q0XA 3I04A 4HAZA 4JVMA 4Q6BA 3TO5A 2AN5A 4YP0A 2CLMB 3GB9A 3NGMA 1PT7A 2WKRA 4FYJA 3NVMB 2ZFUA 4XIGS 1U2DC 2WF9A 1ZXBA 4LGCA 4ZTBA 1DJLA 3VOBA 4ZFNA 4ZU1X 1XXLA 3HKBA 3VVLA 1G8JA 1FMFA 3B9QA 2AA3A 3GHYA 5CHYA 5GJWC 4AY5A 1FDIA 1YF3A 1A5TA 1TJNA 1X7ZB 3G17A 1RLIA 3B20A 1UBKS 4BS9A 2H51A 3K20A 2REOA 3TUJC 3EYAA 3H9EO 2YFHA 3JVVA 3TEJA 5LYJF 1U31A 2Z43A 3DZBA 221PA 2EZ9A 1DQZA 4FB5A 3WTCA 4ZYXA 1GA4A 2JCXA 3AHDA 4QFMA 2QI9C 3MJHA 3T0IA 2ZJ7A 3WISA 3MOGA 3DVSX 1RJEA 3I52A 4HDRA 1MJGA 5LUBA 5FWNA 4NECA 3CIOA 4R0MA 1KFCB 1R0LA 2DCUA 4ALJA 1DINA 1ZI9A 1TL7C 1FQWA 2ZE8A 4Y2UA 3PVSA 3G5TA 1JPJA 3QJGA 4K9PA 4BX9A 2CV1A 4IWYA 4U6SA 2DLNA 4UTVA 4DHWA 3MS7A 4TWRA 3O1IC 1ISRA 3RUFA 2XQGA 3UMYA 1X8LA 3G79A 4RJKA 1DAFA 4D4HA 1SVOA 4YV1A 4XA8A 3K9LA 8GPBA 1JDPA 3ELDA 5IKMA 1J8QA 1UMKA 3N2IA 1XA3A 2WLSA 2O2DA 5IVDA 4IIJF 3ESQA 1GZ6A 2V59A 1Y4SA 1ZEJA 2G76A 3OM0A 2YWEA 1BHSA 2J31A 4HN9A 4AXBA 1F12A 4I5FA 1NBOA 1WU7A 2QUHA 5FNZA 5BVHA 4GNRA 4RZIA 3IEIA 2KW5A 1E77A 3M6WA 4G23A 3UT5A 1HE5A 2BGKA 2UKDA 3QEMA 4QA9A 4BP3A 3D4LA 4MV3A 2NO5A 5SICE 3RVNA 2H4WA 1EH5A 4ZAZA 1H2AS 2QNBA 1ETUA 2WFAA 2YZGA 4HYEA 4PLPA 5T6MA 1VMIA 3T54A 3SZGA 3U9LA 1NRWA 1YJBA 4ARCA 1YDMA 3H5IA 5LMZA 4W1PA 3WL7A 4RIHA 5G0UA 5KOIA 1KYYA 5EMKA 1R0CA 3HDTA 3KHSA 1RYHA 3SQWA 1E64A 3R40A 4CF4A 1GDTA 3C7TA 1R9MA 1ADBA 3HSSA 2E2WA 4D3DA 2MJLA 2PUDA 5D6NA 4NWIA 3AL2A 1KSFX 1P4RA 1UL1X 3Q5DA 2ONZA 1WP4A 3SR3A 3BJIC 1IU9A 4CTMA 4QOHA 1T91A 4PPNA 3QVKA 1OW3B 1PU2A 4RK1A 5JD4A 3N74A 4XJXA 1SUFA 3IMCA 4YX9A 4G09A 3G0CA 4ND6A 3TDKA 3AVWA 4GF5A 4IKPA 5B3AA 3H2JA 4LNUB 1P4AA 3RDPA 4R54A 1GXSB 1C30A 1TC2A 2K87A 2XMCA 3BCHA 2QD3A 3JAWB 3NEAA 2O0MA 3RI3A 1I6KA 3AUXA 3WK4A 2WDZA 1Y4DE 4OATA 2EZ8A 3RUAA 3ZHQA 1A3CA 2O4CA 1U3CA 5TDHA 1KDYA 4LDJA 3WYGA 1S1MA 4D0GA 1FB5A 3V4LA 4P4SA 4OM7A 2FW6A 2YDXA 3NAQA 3X0DA 1UMCB 4JJGA 1EQ2A 3RWMB 1WW8A 1DRUA 4CKCB 2JFUA 4P98A 2OOKA 4WCDA 2AQKA 3PFWO 4K9LA 1BOOA 4NPAA 3WRVA 3WMEA 3K9NA 4B44A 1DTSA 5CLGA 1SIWA 5E3JA 1DJOA 4UPVA 4GMHA 5L6MB 4EKNB 4JJ8A 1LJUA 2AXEA 4JEHA 3KAPA 2Y8EA 1S5PA 1H6BA 1SCBA 2OG2A 2HMWA 3PXBA 2A0KA 3HJAA 3MK31 2X3FA 1MAUA 4E88A 1MG5A 4KLAA 4KGZA 3A1FA 4JBYA 3H75A 5JWRA 4L7QA 2NVUA 1GGNA 3O03A 1EGVB 1LA2A 3WGGA 3BXOA 3P5SA 5B1HA 1CUEA 1P39A 4KH1A 2E55A 4NDAA 4MA4A 3LMKA 3EWSA 5BXYA 3Q3CA 5HXAA 2PUEA 6YASA 1G63A 1OA1A 1VBNA 3LTEA 1QIDA 3OQHA 4ZT6A 4P4LA 3ROKA 1ZH8A 3RVQA 4E08A 3GJ8A 4IOJA 1HE1C 1E5LA 3WBKA 2HBRA 3WLPA 4S3MA 1U6KA 1TDJA 3MAGA 4DB2A 4JI6B 3P9ZA 2ECFA 2NSDA 3GQBB 4WLUA 2JD2A 4WY8A 3HFJA 3PNVA 1M9NA 4CQJA 3X2FA 1X86B 3FFTA 3D2AA 4JP2A 2XTNA 5DTJA 1N57A 3R5JA 2ZW9A 5IK2D 1AQJA 3TBFA 2V8BA 1ZR4A 3UMMA 2BGLA 3PHIA 3QITA 4LPKA 1A95A 4D79A 3RC8A 4IQGA 3IA7A 3S1SA 4B3XA 3LL7A 3AF4A 3Q5GA 4QOIA 3DHYA 5EE3A 2GZSA 1P44A 4IRUB 5K0ZA 3NHZA 3S7TA 1SC1A 3HA5A 2OAQ1 1XHFA 3QYPA 3BULA 2Y2UA 1T1JA 1V6SA 5KYVA 4PV7A 2ID9A 4KUGA 1DZIA 2ZWAA 3MT9A 1O58A 3CNBA 5KCMA 4B3SB 1CDZA 3DZJA 2XAUA 4KWCA 4PVCA 4BVFA 1O1YA 5KQRA 1A9YA 1UQUA 3DMTC 3PR2B 4UEKA 1C5KA 2IU6A 1ULZA 2AI1A 3T0GA 3A0RB 4WBXC 2EFHB 1G5IA 1STOA 1E2KA 3BWXA 3NUZA 2J3IA 4M1MA 4ZOLF 3TM4A 3WX0A 2ZP1A 1L4LA 1VZ3A 3L7OA 4HEHA 3SEZA 3WLQA 3FB4A 1SC3A 3WJ2A 1OWLA 4E2XA 3TLBA 5A1TA 2YRFA 3UXYA 5EZYF 1LTHR 2I55A 5F5NA 5TE9A 3WR5A 1ST3A 2JASA 1JHUA 2XMPA 4Q4JA 2NYUA 3A70A 5GP1A 5JMWA 3SVLA 3DPSA 2E4WA 1AT1A 3IEVA 2CBZA 4S2EA 1V4NA 1FYDA 2DECA 1A7AA 4BKPA 5KX5F 2XV1A 3FWNA 1E63A 2I54A 4AS1A 4WN9B 2XMSA 1DO2A 3PJGA 5HKKA 5FI5A 1JWBB 3VU3A 1YBHA 4C07A 2ORVA 3K6KA 2AV6A 4PO1A 4V24A 1I1QB 4RD4A 1ZHHA 2FUEA 4DYDA 5KWVA 2H3HA 4R31A 2OD9A 4ZZ1A 4CNQA 2XCSB 2I4LA 3TCKA 1BRTA 2ZAMA 1VDMA 1XELA 2PL9A 3OIYA 4WFIA 5AKIA 8LDHA 1NLZA 3WG9A 4JKOA 2FG6C 3C14C 4HDCA 1CUSA 3VYSB 2V3CC 1GAWA 1AQLA 2GPYA 1H0KA 1E9EA 1LX6A 4GKAA 2FW8A 3LU1A 4BVJA 5DEOA 2F9FA 2ZWMA 2A3NA 4J76A 3EQ6A 3GOHA 3JVUA 1RXYA 3EVEA 1IVSA 1QB7A 1U8AA 1GL3A 3EEBA 3N8DA 4JBNA 3L7LA 4ND5A 3TE7A 1KARA 4QGGA 3H5OA 1OXBB 2IITA 4RESA 4CTJA 2C77A 3SJUA 2ZDQA 1OILA 3UV7A 2ZI9A 1AA6A 2YV4A 1JLLB 4Q3NA 5D7BA 4B4WA 1PL7A 4KO2S 3T9DA 2QXUA 2CSXA 5ESWA 1O57A 4Q7LA 1FF9A 3VC1A 2QUZA 2Z58A 2WTEA 4JQZA 2POCA 1ZN9A 5LZ2A 5H16A 1HYBA 1PUXA 2FUCA 5LOVF 2BSQA 1X7WB 2BGJA 5KWIA 5JSHA 3B78A 2ZJ2A 4ZDWA 1I01A 3ZHSA 1ECPA 2OZVA 4JY7A 1JW9B 2IEGA 1KSGA 2VLIA 4E4RA 4ZCMA 3ND6A 2NXNA 2PKWA 4NZOA 1UBGA 3U0VA 4OI2A 1AHIA 4D0RA 4DXDA 3PEVA 2X7HA 1AN9A 2JAUA 5DX1A 4DJJA 2W8ZA 2WHPB 3BDAA 3JTEA 3UAWA 4GRDA 1YU9A 3UK1A 3KAJA 1QE0A 3I2HA 3G6WA 4L9RA 5I8ZA 2XXBA 2DPMA 1WUKS 1NG1A 3R5SA 2CB0A 4RHYA 3ROTA 4ZIRB 1TM4E 1OLSA 1H9BA 1A76A 4ZZ3A 3D4BA 4C7BA 3NIFB 5JEEA 2VDNB 1DC7A 1D4AA 1S8FA 4P81A 3UWPA 4RTOA 1JTEA 1OIXA 3LQQA 1GEEA 4OYRA 3Q7RA 1I30A 5AW3A 4KXMA 1IE3A 1P80A 5IDQA 1HT3A 3JWHA 4H27A 4NULA 4CU2A 4J4HA 2ZYAA 4MZDA 3ZDEA 4HUJA 3TS1A 4MGHA 3R5TA 5DN6D 1CUVA 1RYYA 2JLYA 2IEBA 1QRAA 3PPVA 2FHPA 3DUFA 1JKMA 4ER5A 1LW7A 1T4MA 4HTFB 4HVCA 5KO2A 4Q6WA 1XJQA 4NOJA 3WGKA 5DISB 1SVIA 4FT2A 1QHNA 1R1DA 1U65A 2PQMA 2RHGB 3JZDA 3JQAB 3IOCA 4O2BF 4TVOA 2CL7X 2FFJA 2D8MA 2DT5A 4WBNA 4W5QA 3EDRA 1BA2A 1UFVA 2JIPA 2P8SA 3FCYA 4QRIA 5CX4A 4FM9A 1DAHA 1QTRA 2IV3A 1JA9A 4C2BA 2FOLA 2R8BA 1PL8A 2NM0A 2WAAA 3HMQA 1LPPA 4V3BA 4B6GA 5BRAA 2OV3A 5HGXA 3KE8A 1D7OA 5JYDA 3AXSA 1NR5A 1SQ6A 1USUA 5IJ9A 1U81A 4RNCA 5ILQA 5HSGA 3CLUD 1QKJA 2OZKA 3I83A 4M1KA 4RV5A 5G53C 3ZWAA 5ALNA 4NMHA 4JYCA 3A31A 5I7FA 3LX6A 2GD2A 1KZ9A 3GELA 3M5CA 1BMDA 3PTLA 2OBMA 3RS5A 2GBLA 4ZO9A 3CNLA 1CR1A 1ZC4A 1J8FA 4MWEA 2Y9MB 1X0XA 2ORIA 5AOAA 4YMTA 3VO9A 4MHOA 2ZJ4A 5KVCA 5KNLA 2V55B 2BHRA 3DL7A 1XNJA 2CLEB 2JGAA 1E6LA 4GVLA 2ASVA 2O6HA 4HYTA 2JLWA 3P32A 2BGWA 3E9NA 3LYAA 3A1TA 4Y6SA 2Y77A 3X1WA 2NV0A 4CDGA 5BR8B 2IYVA 2K2QB 3QXSA 2FPIB 4NEQA 3INRA 3V2GA 2O8FB 3OLCX 4FSDA 4JSYA 2HY7A 3F9CA 3BB3A 1GDHA 2Z5VA 1AK9A 1J2RA 3C98A 2OL4A 5F1OA 1DMRA 4QBTA 4RJLA 4KOAA 1H0SA 3AERB 5DCLA 3KS9A 5D84A 3ER6A 4OGGA 2ID8A 4BVHA 2V5UA 3BSSA 2DKNA 1AG9A 1WG8A 4M37A 4EJ0A 1OAKA 4D9NA 1E1KA 4RWZA 1MZPA 4LY9A 4N5MA 5BP7A 4XGNA 3B8EA 1VSUA 5G02A 1JLKA 4HTAA 1M1NB 4HUQB 4OSEA 2CZQA 1ACMA 2YWGA 4JODA 3UH0A 5BPFA 3G49A 2BJHA 1U7DA 1E96A 2R6DA 1YHNA 1MTZA 1PR4A 4PZEA 3WFJA 1LNSA 1YAHA 4IAOA 2VHEA 4PO9A 4KW7A 3SXUB 2QUKA 4LCJA 3WB1A 2A5LA 5IC4A 4K9KA 4HZUA 3BL5A 3WHLA 1FP4A 3LDFA 5HJ2A 3RTBA 4TRRA 2XGJA 5EQTA 4INPA 1NVVQ 3EXHA 3G6KA 2W58A 1OXTA 1D03A 4KR0A 2Y4NA 2A9KA 3FMFA 4N3NA 4Q3EA 2QT9A 4C30A 1HLGA 3T38A 5AR1A 1TQDA 3U7HB 3WL5A 3PGMA 4PIPA 1CUWA 4BMVA 4E0BA 4RXMA 4EPVA 2ZVQX 5ERXA 1HT0A 2XQJA 1E2NA 1KRHA 1KEEA 1P1RA 4C4PA 3O74A 2JFFA 2D5AA 2OAGA 1T1SA 4F3KA 1V5IA 1QQBA 4PG7A 1R0RE 3I53A 1X8XA 1J1ZA 3VTAA 1AB6A 5CVTA 3OFJA 4JBWA 4AI6A 1U5BB 4P0PB 2W6QA 2RHCA 2PQ2A 3MCWA 4YUXA 4ESOA 1ZVJA 1G19A 3HVKA 5K01A 2Z5FA 3MNFA 5AK6A 2XUFA 1CY2A 1MJNA 1OROA 4RK6A 4TOIA 2EJUA 4BBPA 4WOJA 1KS2A 3I28A 3O92A 4AB1A 3OOYA 3VYTB 1PVVA 2MINA 1QVVA 4G4IA 2V97A 3T9BA 3KVOA 1KHHA 2GBGA 1ACJA 3H2IA 3L82B 3B85A 4KXWA 3DYIA 3RIGA 4BNJA 2VDPB 4XM1A 4DF3A 1JS1X 4MQMA 4JGGA 3NC4A 5K8JB 1M2VA 1MQ8B 2A88A 4PZDA 2WAOA 4E5SA 3OLQA 1SVKA 3TXAA 3TR0A 4FUTA 4B6PA 1P1IA 4MX8A 5AJVB 1KOGA 2WJ3A 3VOAA 4DMMA 3E5MA 1KP3A 1PK8A 3S5JA 3SIRA 4PC7A 2HUPA 4UOEA 4R01A 4ZHQF 3RSGA 3WKDA 5EIEA 5BV2P 5JRDS 1MA0A 1HT2E 2VUUA 2QUIA 4M55A 5DFAA 4PGGA 5LCXA 3ROGA 3GLFA 4NCKA 1WXXA 3WE7A 5CFRA 3KJQA 1BROA 3ZWNA 5C0OE 2R8YA 1UEXC 3BXGA 4RHTA 5I7WA 3B53X 1WF3A 4MWCA 5K2MA 4UU1A 1HL7A 4HBZA 5ALTA 1PQPA 3IYLW 4X95A 4TTQA 2JJ1A 5JSQA 3B12A 4UCQA 2XZLA 3WGNA 3QLVC 1JYFA 4RUKA 2ZPTX 4RGYA 3AOEA 1KI7A 2R6R1 3DQQA 2XGGA 2A1IA 3AW9A 4EUFA 4F12A 3HBLA 3GLIB 1F2TA 3Q8MA 1SEVA 5EXDA 3SVTA 1XTRA 2F43B 4I9UA 3P9CA 4AJ4A 4Q4CA 4H15A 4AMUA 2IHVA 2AVDA 4QUJA 2OYSA 4PYOA 2IUEA 3HDHA 3UTDA 3IVGA 4KMMA 4LFBB 5ADUS 5LU9A 4XOUA 4WACA 1KGDA 1AU9A 5HA5A 3VR0A 4DE5A 4J0CA 3RFTA 1SGWA 1PZGA 2ZJFA 2DBZA 1SKBA 1KYQA 3DDOA 4IINA 4X44A 5G41A 2Z83A 2EKZA 2XGSA 3IXMA 2HF9A 1ZSNA 4LZOA 1KDZA 2NIPA 4ZREA 1V25A 2UZIR 4IH4A 5KCZA 1OVMA 1M73E 3FCCA 3A26A 4G36A 3HYRA 5L3QB 4ZI5A 4UEJA 1G7TA 3R2JA 1HYHA 4HT3B 1LWNA 5A3QA 3JD2A 4K9OA 4JP8A 3KPWA 3UV3A 4YRCA 1HFKA 3DMFA 4JP3A 4M7OA 5BWMA 3RGGA 4LHSA 5GMOA 1U4SA 2N9UA 3GK3A 1DMSA 4WGGA 5JJ5A 4JP5A 1OCEA 5B6PA 1IJEA 4ZCRA 4CG0A 4YWHA 4GLJA 3RO7A 4E5NA 1RC0A 1TT5A 2FQXA 3R20A 4A6DA 1QSGA 3HCCA 4TTSA 1FLVA 2IJGX 4YMHA 3A06A 3VR4D 2HDHA 2OV4A 4P3NA 5CXSA 1OH8A 3KQWA 4ZO6A 1PW7A 2AHOA 2RH4A 3HL4A 2WZCA 4R16A 4F93B 1V7ZA 2QEQA 2WV9A 3PEUA 4MHSA 4CF7A 3BWDD 1P4GA 4TLEA 5CA1A 3SC4A 3ZJUA 3FTEA 1TYDE 4TX1A 4RW0A 3RUDA 3WI7A 2WSSA 3BGOS 3MINA 4QTUB 1AK1A 3O4GA 2PX0A 5JO9A 4RV9A 2B5VA 4LJ6A 4E70A 5LP6A 3QKTA 1JRLA 4O3FA 4H31A 4PHGA 2H54A 4AYWA 2GZ3A 3KOUA 2JLUA 4JI3B 2R5FA 4IFIA 4G0NA 3WK9A 2EQAA 4P6VF 5FBQB 1H65A 2W6OA 5I7UA 3ASZA 1HKHA 2FSIA 3OQIB 4UW9A 1NONA 2GHQA 2XR1A 4Y1FA 4PX5A 2ZOSA 5CT4A 1X42A 2CBGA 2QW0X 4WY5A 3RIYA 2QTFA 4L0MA 3D3QA 3REGA 3SC3A 4F4FA 3RYCA 1DUSA 3U3OA 1MXHA 2Q1WA 3GFGA 1UODA 1YQEA 3VX3A 3QEAZ 3ML1A 1OBCA 1RJGA 2IBMA 4U9HS 2GEKA 1RHRA 4FBGA 3DSRA 1KP9A 2GARA 3L8HA 1T8WA 4NBNA 4A1FA 3J81A 1Y9ZA 1XMOB 3OQPA 4YXWD 1V11B 2HA5A 3OZWA 1DPFA 3I6QA 3NUQA 4KUEA 5CT6A 4MVXA 1Y1QA 3L1KA 3SS8A 1T9KA 5GZ3A 4IIDA 1K9VF 2RONA 4WBSA 3RVSA 3B6MA 3HU1A 3DBRB 2OBYA 4X5OA 4C3VA 3KYCB 1AQYA 3H0CA 3RBAA 5EKTA 2XLBA 1E4EA 1QYWA 2Y6UA 5CFPA 2ZITA 2GRUA 4M2LA 1KI9A 3EC2A 4D81A 3T1TA 3DOJA 3HKCB 1UDXA 4UQOA 4WZAE 3BPSA 4GI1A 4IJUA 4DARA 1Z12A 4QXOA 2CJWB 5FOWA 3ER8A 3AX6A 4RVCA 5H8WA 4MLPA 1HMYA 3AUUA 3HBFA 2QL9A 3M4YA 4UASA 3SKXA 5GOZA 1X38A 1Z6GA 1BFKA 3GARA 3VR1A 5KYWA 2CF6A 2QD1A 3NYWA 2V7VA 1D6NA 2GT1A 3W2EA 2O2ZA 1XFDA 5D5PA 2LTAA 3UMJA 5EHIA 1IOZA 1K97A 1KTVA 2PZKA 4RENA 2CUKA 2MYUA 3L0IB 3G2LA 1RXVA 1VXOA 2WSSD 3K6SA 1RC1A 1DBPA 1SA0B 3P2EA 4P32A 2FPPA 4OP2A 1S96A 1H05A 1C9EA 2MT9A 4TMWA 2FJPA 2ISSD 5IAKA 3IP5A 3DDWA 1OAOC 3V6LA 3C4QA 4YO8A 1DCFA 3PYXA 1PJ8A 1CZHA 1SCAA 3B48A 3E82A 1ZD9A 1CUYA 3OZAA 2QGFA 1PK7A 2C07A 3IXLA 2F9MA 3PJDA 4KODA 1YD7A 4AECA 3BMOB 1XKQA 3BCSA 1RJWA 2W2KB 3USCS 4OL9A 1EX1A 4W5JA 4R2MA 3AVVA 1V2HE 1RYZA 2X77A 3G2HA 5F2KA 4CTKA 2XZDA 3NOVA 4PLVA 2W6JA 2GCGA 2AN4A 1RYMA 4IS2A 1XNGA 3ZTTA 3EPJA 1KETA 1VP9A 1LI7A 5EI5A 1E9VA 1ECFA 2V7EA 5I5GA 3WRYC 1DCMA 1THZA 3L7AA 4XX1A 3RT9A 4TZ6A 1B42A 2YHIB 4D44A 2F48A 4F3YA 3MRSA 5K5EA 1NQAO 1X39A 3QXXA 5CEEA 3EZ6A 3G8AA 3ZWPA 1S2LA 4TZKA 4ACAA 1V41E 1ZGBA 3NOXA 4XWYA 5E3HA 1BSVA 4L15A 5IBCA 4C04A 1GTRA 3SXPA 4MQEB 2IS4A 1RDFA 1IEQA 4EJSA 3KWLA 3DZFA 5L6LB 4XSHA 1GCUA 4BFXA 1ULTA 5GJCA 1JDSA 2P77A 1H8ED 4Y2GA 2HMUA 3TQFA 2Q0QA 3KR0A 4BO7A 1P72A 4CKYA 1LXCA 4EF4A 4WFKA 1C3OB 4QGAA 4PZCA 1KERA 1Y1RA 3DNFA 4MB2A 1JXQA 4L28A 4AJ9A 2P4UA 3MG9A 1M75A 4AJKA 1QNFA 1E3DA 2COEA 3BAFA 4TKVB 3AJEA 3EDYA 2DPYA 3L77A 4EUSA 4UCWA 2O5RA 1RAHA 3CC8A 4XQEA 2PL1A 1GT91 1I3KA 2V7WA 4EITA 4CN8A 5M29A 4V1CA 4J3NA 2G1PA 3GLVA 4MV7A 2A58A 2YXDA 1Q0QA 4D8WA 4IIEA 3OCYA 2RG7A 4C2UA 3BERA 1EVZA 4IXDA 5FWDA 5IJAA 1JI3A 3F6RA 4MGIR 3MUFA 4UFNA 3RS8A 3VX4A 2NU8B 2H2WA 5BSHA 3V8QA 5AW8A 5JSUA 4MB6A 5LVAA 3ESCA 3GOQA 4P0TA 3U44B 1QQ5A 2VYNA 4FQ8A 2FJUA 1U0TA 3KB6A 2FUG6 3LIIA 3AP2A 4ND1A 1AZWA 1C1YA 1LBIA 4YPFA 5L9AA 1ZKDA 1Q7RA 1E1DA 3I01M 1VHWA 1U7OA 4B3GA 4B33A 1U9JA 3PU6A 3UKDA 4KXQA 5D85A 4QQNA 2V4UA 2PL5A 2W6JD 4DVJA 3W9SA 3ENNA 1BC5A 5IH3A 5CBKA 1ZM9A 3ZHBA 5D51S 5I7AA 3ZY5A 3AEQB 2WYUA 2FFQA 1N6IA 1M5UA 1XN1A 3M1YA 3MBOA 5FTLA 5EGSA 2A7XA 3KJEA 5AVZA 2W93A 3ZE0B 4RSMA 1TI7A 1PSWA 4V0SA 1KAQA 1SMKA 1WDTA 2X1MA 2E4ZA 3BFJA 3IPAA 2OLJA 1UT8A 3IE0A 2FRXA 3KZCA 3SK0A 3A3OA 3CY6A 3OURA 2PWAA 1C9JA 3HCWA 1GQYA 3LY5A 4PZUA 2PUBA 3NJRA 1FQOA 4ONEA 1KYXA 2VSXA 2AYZA 2C2MA 3DYBA 4MKIA 4W1QA 4MAMA 1UAYA 2HMYB 4FLFA 5DTQA 5HEKA 1DHTA 4IUBS 3U2QA 2PZFA 1YFLA 2M1ZA 1D3AA 2H8GA 2QK4A 3OO0A 4OG2A 1WXFA 5LB4A 3ND9A 3DM9B 4A03A 1XC7A 2VUSA 1DKRA 1R2QA 5HIJA 3DLCA 2VRCA 2H9IA 3G5AA 3GPCA 3HJFA 1JKJB 1NYRA 4QDKA 3BN3A 1WXHA 2J4FA 1TFRA 1ZICA 1XFAA 1WMEA 4CV3A 3BZBA 2RGCA 3EG5A 4MKFA 1MC8A 2C82A 3URKA 3M1AA 4I55F 4TMZA 4K8RB 1WMAA 4MPRA 3HMKA 3T4UA 2ZJ5A 4FYPA 5LQJA 1RXCA 4EA9A 3KVNA 1FS4A 4Y2QA 4YI5A 5F77A 2EG5A 4EZEA 2XDAA 3EVAA 2I8LA 3QUQA 1Z2OX 1KQGA 1CV2A 4LWQA 5EHXA 2BGTA 1SHKA 2EP8A 1NXTA 2QRZA 1BMFA 4ER3A 3SLRA 3T3IA 1DDOA 2OQ2A 1JR3A 2VYND 1XEAA 1ODKA 4UTOA 2ZROA 1T0BA 4OPMA 3C70A 2PUAA 3L41A 3FF1A 1XDDA 4FYMA 1H94A 1QHXA 3SY8A 2H52A 4ZANA 2YX1A 1KC3A 3G2JA 1HURA 4LYHA 4HLQB 3BIFA 2XVXA 3CHYA 4Y2TA 3VKUA 3DWEX 4L5JA 2B21A 2MSLA 4OQYA 2JAQA 4M8LA 1PNOA 3C3PA 3VDQA 5J4YA 5J2UA 5FUYA 2OBBA 1JB9A 3L1JA 3ZQUA 3EIXA 3Q7TA 5AI9A 4WLEA 1YULA 1XXHA 2LV8A 1B93A 2PV0A 1KPGA 1QKKA 1CUHA 3L7YA 4N40A 4LJSA 2D1TA 1JBEA 1T1GA 2A4KA 2G9QA 3DTYA 4IIFA 3HDQA 4KQCA 2CFIA 3PSHA 4C0SA 4Q3CA 3U39A 3KQHA 1A5BB 2FZVA 5PNTA 3AIKA 4L5BA 1FNNA 2WHXA 1O96A 1EXMA 1I13A 5KSWB 2XUAA 3EIFA 4PAOA 5FNVB 3A32A 5CU7A 5H83A 4UU0A 5DYGA 1L5FA 1YS9A 4DA6A 1AMUA 3ZI4A 3TD9A 1HZZC 2MSWA 3DCIA 4E46A 4F9FA 4YMGA 2BEJA 2DQ4A 3QFCA 4EG0A 3R3WA 4RLHA 2G0AA 5IZ4A 1P7YA 1VGRA 1QIEA 1ZGJA 5DBHX 1Y8QB 4FGJA 4RXTA 3WGJA 1AA9A 2GF0A 3NNDA 3CLSD 1G5RA 3DV0A 4OHRA 3NNNA 5DM70 4KXFB 2C0QA 4HGNA 3CZRA 3UAVA 3FJOA 1S3IA 3LUJA 1WPQA 3OBIA 4F9TA 4HGRA 3R9KA 1RYFA 1ATZA 4OHFA 3I1IA 4NIMA 2CFTA 2DHQA 2X9VA 4JXJA 2FN3A 1LLCA 3ADPA 3D4IA 4LHXA 4MAAA 3EIEA 1F9AA 1FXUA 4ZZ0A 4R1UA 3RANA 4EEZA 5IDWA 1MHTA 4ZJUA 2KBFA 2ZRCA 1YI1A 2Q6OA 2ACWA 4MR9A 4FYKA 5DM2A 1GRRA 1M72A 5LA6F 2OD2A 4Y1EA 2IF0A 3CEMA 1GITA 1XQ1A 4I5DA 4O02B 2XB6A 4KU4A 2IZ1A 4BMSA 1PR9A 4QYIB 2LWIA 4BE9A 3CX4A 3TXXA 4EPTA 4GW3A 4AN4A 2GR9A 1L0BA 2H18A 3RU7A 2RD2A 1TVMA 2I2AA 3DMRA 4WDQA 2BONA 2H3EA 2QX9A 4TV9F 2YIJA 4E1AA 3CXUA 3RUHA 1WHTB 3KDAA 4QATA 2JI8A 1MBZA 1B0UA 1PL0A 3V1NA 3WLHA 2X0FA 4M6WA 4JX9A 3SS9X 3RASA 3BIWA 2JFGA 3O84A 2QENA 3ZPXA 4YREA 4UVIA 3LH5A 1OLXB 1RADA 4IQ8A 3TSAA 2YNMC 4KTVE 3BIOA 4PLZA 1JH9A 1QF9A 4AY2A 4RZQA 1Z6AA 3GRRA 1F4LA 4INOA 3R5HA 5K09A 3IUSA 3VYWA 3A3PA 4OV6B 4GPAA 2Z0MA 4LI3X 2FSVA 4K88A 3CLTC 4CKXA 5JALA 5G0WA 4D5GA 1E66A 2QL5A 1GDDA 3PC2A 4Q05A 3CCFA 4Z6KA 2F4VB 1QIGA 4WL0A 4HPXB 1Y3IA 3H5RA 1M2GA 2ZWVA 1UDWA 1NUUA 2FWAA 4I9FA 3WP0A 3H4IA 3QPWA 3RG2A 2JIZA 3PWZA 4KIUA 4OA8A 2RGXA 1N6HA 4LFCB 2DFNA 2H7VA 1O5OA 1JR6A 1XTSA 4Q3KA 4HDSB 5B6JA 3NDPA 1JWLA 2EGGA 1FSSA 2VTVA 1G6Q1 3O9ZA 3PQ4A 4XH9B 1XAJA 4XPZA 5A04A 5JCOC 3EPHA 3CNHA 4G9EA 5ALKA 2E6UX 4EW2A 3OP1A 4GX0A 1N6NA 1ONSA 2Z3VA 1UBHS 4ZT2A 1JEQA 1WO8A 4L9WA 4DL9A 5TQJA 5FDFA 3DBOB 4G24A 621PA 3B1JA 1VFNA 2AFIA 2JD1A 1YZYA 4YGXB 3CZPA 5CVVA 3RFFA 3WLSA 3NWEA 3BCRA 1MFPA 2YHBA 3B3AA 4MW0A 2W0MA 1NWCA 3EJ6A 1QR2A 1T9ZA 3LWZA 3S3TA 1L5WA 1E6UA 1K92A 2JGDB 1MIOA 2P8JA 1DLIA 3H3JA 3K9GA 4KO8A 4RDXA 4RK0A 5CYFA 3KQNA 1QTNA 1NV9A 4OI1A 1U6IA 3JASB 1OT3A 2PTGA 4U2DA 2CVOA 1V16A 4R2KA 1EWQA 4EB3A 4XEUA 5THXA 3IMKA 2O1WA 3AQ4A 3FDFA 3UYLA 3VNBA 1K6IA 1RVV1 1IBLB 3PHLA 4KQ1A 2Z2IA 1Q0PA 1WCXA 1OWMA 4FQ7A 4TTPA 3V1TC 3N6RA 1UMDB 3ABZA 2BLNA 2BC9A 5T3UA 1E4YA 5C7LO 4TWBA 5HW0A 4IO1A 2HJHA 4ROSA 1FSZA 3FM9A 3A1SA 3T5CA 2VJMB 3PS9A 2C00A 1E2BA 3R6TA 4JXXA 4M86A 4CMAA 2LPMA 4D0SA 5EJ5A 4GQIA 3D1VA 3U5ZB 2WKQA 3H86A 1TU0A 3GP5A 1RLJA 4JSTA 1SOVA 1JQ3A 3F97A 5ESDA 1Q5PA 3WGMA 5KMGA 2Z9CA 3F46A 1KJWA 4UD6A 3U56A 3WV5A 3I04M 1A8QA 2JBAB 3AR9A 3NASA 1CU1A 4FDAA 4IOLA 4D8UA 2A94A 2VIIA 1BX1A 1POWA 1MD9A 4PCVA 4X3CA 3R7DA 1TEZA 1UF9A 4LC9A 1F7VA 1RLOA 3ZBTA 5ALDA 3DE1X 5EWJA 3Q6MA 4R8VA 4LCEA 4OI4A 2RKWA 4H6PA 3EGVA 3H4MA 4MKHA 4DDKA 1F06A 2Q4OA 3COSA 5AW7A 5TQ2B 4UE3S 4FHEA 2GMWA 4OUDB 2KBEA 2O8DB 4Q24A 3NKLA 3ZLBA 1D4ZA 3HRHA 1G42A 4N8SA 3QVSA 3HXMA 3QF4A 3WL4A 1PAUA 4LNAA 4AZSA 1NBWB 5ADVA 4FW9A 2FEAA 1V7QA 3BJEA 1RXIA 1ILWA 1Y37A 4UXIA 4O5AA 3LUAA 2AOUB 2WG0A 3MWFA 2WUGA 2UXBB 2EBUA 3SJZA 1K3UB 2JHAA 4AZ3A 1QQAA 2WB2A 3BK1A 1N1MA 2CVPA 1MJGM 2YFYA 5FL7A 4DNQA 4EY3A 4G65A 1IHDA 5E2AA 2F55A 5EGNA 5IHPA 1FRZA 3T7TA 1YBVA 4URVR 5BV1A 1Y1PA 3L07A 1MAWA 3CR7A 5CT5A 1WBBA 2HPVA 2YL2A 3MA0A 1IC6A 5B36A 2VYQA 5ITZB 1GQRA 3WGYA 2C7BA 3PDIB 2SNIE 3HC7A 4LHVA 2H4FA 3LYHA 3TLYA 3TIIA 1K7EB 1Z0DA 5DCYA 3HBJA 1T1EA 4Y6QA 5JVDB 4DV2B 3DPUA 2XVZA 3RTAA 4F71A 2V1XA 4H59A 2C5SA 1HQDA 5L51A 2PO7A 1GGEA 5BYAA 1EA7A 2Q6VA 1HE8B 3QW4B 3WGQA 4O3MA 2IXDA 1BE6A 4W5HA 4LC0A 1GUAA 1NU8A 4XWOA 2C1ZA 3ACDA 3IV9A 4HLUA 1T5OA 2A30A 3I3OA 3GEBA 2RHTA 4KWEA 5C1DA 1H4SA 2E5WA 3O4FA 3I45A 4CCAA 1NQVA 1NU6A 2HCJB 4PYIA 2Z4RA 4ZXPA 1FP2A 3NTOA 1KJ8A 1K9SA 2IHYA 4AUEA 2FLKA 1A4IA 2HRBA 4UVDA 3FPGA 3WICA 3DJYA 1YIAA 1K5GA 3EC1A 3M5WA 1SC6A 5FPSA 4A36A 2DF8A 4L57A 3UVEA 3W3ZB 4EDHA 5JSZB 4M0FA 1XJCA 1F0PA 5JWHA 1QG2A 1ENPA 3R1IA 4RVSA 4FONA 2EZUA 3FUWA 2I91A 1FRVA 2IRWA 3O2SB 3EVGA 4CDMA 5CD9A 3IODA 2PT7A 2CCJA 3WXBA 1N2BA 3DHNA 3ZZTA 1IB6A 2FZEA 1XZMA 3O8OA 4LPSA 5TXGA 3RH0A 4KPFC 4Q7QA 1KEWA 5G4KB 3ZHCA 4G8DA 1TU3A 1KMHA 3U5TA 1LFAA 1OBOA 1WMSA 3NKFA 1O6CA 2ESRA 1O97C 5JXHA 2IS2A 2CVQA 4F3CA 2Q07A 3PXEA 3GN1A 5FL7D 3QLJA 2OCDA 3VUFA 3ORHA 3L6EA 4YMIA 3P2IA 1Q6ZA 3DBIA 4KHZA 3Q3HA 3TTYA 1X14A 2PPLA 3D59A 2I7XA 4A16A 2YYAA 3KHKA 4MK4A 3GLUA 1A2BA 2QRJA 4UZFA 4Q1FA 3LUPA 2PIAA 4L3VA 4QSMA 5CJJA 4B48A 4EX7A 3HVHA 3TOXA 3M3PA 1SNYA 2G4VA 2ZYHA 1W0CA 2FPKA 3MWEB 4MW7A 4Q16A 5AK0A 5ARBA 2YQ5A 3CEHA 3I42A 4RPLA 1QZUA 3L8FA 2QRQA 2DT8A 3ODPA 3WLMA 4U0KA 4QTXA 2PGAA 4LZNA 3ZBQA 3NX4A 1E69A 1ODJA 3BGWA 1ZK2A 5DXAA 4ANFA 4DT1A 2Z3WA 1J2UA 2ZQZA 1ZISA 2R11A 3N75A 1ZWLA 2XB9A 3AM4A 1KIFA 5HF5A 1WD5A 4KVGA 4GQAA 1ZIYA 2ZYTX 4BMOB 3ZV4A 4K86A 1JG1A 1PWYE 2HDOA 5IDVA 3AKZA 4XPIA 2X3YA 3IPLA 3L9XA 3WGIA 5BVGB 3B1KA 3IP1A 1U7HA 1CPYA 2QZJA 2OGTA 4NAVA 3IT0A 5HKLA 2HA6A 1LSOA 1OFHA 2CKDA 4PPGA 1HEIA 2F3UA 2ODAA 2NPFA 3LUFA 1C8BA 2P27A 4RPGA 1FYVA 3BEDA 1U8FO 4WY2A 3PDJA 2XQFA 4E5MA 4MIEA 1IY9A 1YRYE 2AX3A 4HX9A 2XNJA 3I30X 4QUIA 1YI8A 4BQQA 4Z3KA 5ICCA 5IUNC 3I5YA 4L4ZA 3IEUA 4QJ4A 3W5VA 3I2YX 1EJBA 5FHRA 6PFKA 4KKVA 2JIDA 1SXJC 4A73A 2HTFA 3M70A 1ORRA 1Y3DE 2KPOA 1GTSA 1VA4A 2R8OA 4EKYA 4UOZA 3UGTA 4MH0R 4R0VA 4I3HA 1J56A 2IS1A 2A5DA 2YFKA 3IDZA 4HQOA 1G4UR 4GZLA 1VIDA 3K0CA 4HNRA 3T5AA 1PD1A 3U13A 3BCUA 3JD0A 1YQ9A 3C6KA 3OU2A 4JH0A 4FNGA 1UP6A 1ZCJA 2PV7A 1T1RA 1ULBA 2C5HA 2GAAA 2C42A 3GO4A 5D3KA 5TQVA 3UJDA 4EG8A 4Z86A 4BZZA 4XVUA 1MX5A 3DQPA 3SD7A 4M0EA 3K71B 1C0EA 3WMRA 3N76A 1MG0A 2EW8A 1BXRB 2HTEA 4Q9LA 4Z9FA 5JDIA 4E5YA 2QAGC 1SG6A 2OVFA 3LO8A 1J99A 1ECBA 5DHUA 1LBEA 4LUCA 1BG6A 4KITB 1C4KA 2BHNA 3PEYA 2ODPA 1YCHA 2ZM5A 2BJVA 5CM8B 4QDXA 4WHMA 4KK4A 4JZYA 1Z4OA 1V5WA 3EXIA 3D4OA 1I2DA 1XQWA 2Q1SA 1SUDA 3EZNA 4C06A 1M2HA 1T5IA 1NUSA 1XTTA 1BU5A 2WF8A 2XCIA 1WR8A 5AVQA 2F67A 1JIIA 2CUZA 3JQCA 5F7JA 5TPWA 2VJPA 1RHJA 2VN8A 3K1TA 3LVBA 2J0QA 3D2LA 2JFHA 1NKVA 2PFSA 4BMXA 1BA3A 2C3YA 4HG2A 3WADA 5BQ3A 2O20A 3IEKA 4QELA 1WPXA 1DFIA 2GF9A 2JH9A 3T7RA 4DR3B 4WEOA 2GN1A 5LU8A 2Y71A 4US2R 3BHMA 2DR2A 3T7SA 3WLAA 2OHJA 4R0NA 3UHFA 1EP1B 4Z0NA 4JBXA 2Q4DA 3RFXA 3WRXC 2A9PA 3PEFA 4JIGA 4V0OA 2NZYA 2X4GA 4N03A 2Q8NA 5BQFA 2JGMA 2JHGA 1KO1A 2P2DA 1A0OA 4MRVA 4J0HA 4BFLA 2J48A 4U7DA 5E1DA 2WZBA 1Z8DA 1Y9AA 4PGHA 1GSHA 5EFOA 4O25A 1EDOA 2LBPA 4GI7A 1QZXA 1JI0A 1KFEB 1XZHA 4XM2A 3DEIA 4Z3DA 1T2UA 1XZGA