3ZHOA

X-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.2 A Resolution Crystal Structure of Escherichia Coli Wrba Holoprotein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FLAVOPROTEIN WRBA
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zhoA00
2V9CA 4GI5A 2Z9BA 1T0IA 4C76A 1ZWLA 4DIKA 2QX6A 4H2DA 4XDGA 2ZKIA 1AKVA 3QFCA 4J8PA 3NHKA 3P0RA 1XI2A 1X77A 1ZWKA 2MWMA 1TIKA 4N9QA 3OWHA 3SVLA 5B3KA 1F4PA 2V5UA 3KLBA 3OVMA 4C0WA 3NHFA 1KBQA 4U7GA 3NHJA 4ZVLA 2WC1A 2FAXA 2FLVA 2HPVA 3KAQA 4Y9RA 4YAFA 1OBVA 3K1YA 1B1CA 5EAIA 2X2PA 4OXXA 4N82A 5EA2A 3S2YA 1AKRA 2Q62A 4LTDA 2BMVA 3O2NA 4Y7CA 5B3LA 1AKTA 4F8YA 1NNI1 1FLNA 3NHPA 2QWXA 1CZUA 5NLLA 1XYYA 4ESEA 1YRHA 4ZVNA 1DX9A 1AKWA 2OHIA 3B6IA 4CF6A 5EMNA 2FVXA 5F4BA 5LMCA 1D04A 3KAPA 4ZVKA 4YQEA 4GQIA 1CZOA 3HLYA 2AMJA 3NHWA 4NLLA 5TGZA 1YCHA 2QMYA 3JSXA 4DILA 1AKUA 1SG0A 1RCFA 3FNIA 3L9XA 1RLIA 1SQSA 1CZNA 4FGJA 1J9EA 2KQUA 1J8QA 5LJLA 2Q9UA 4LTMA 1YOBA 4FGLA 3TZBA 4LA4A 4Y9UA 2QMZA 3NHYA 1DXOA 4N65A 4PTZA 5LVAA 1XYVA 4GR9A 3GAMA 3D7NA 3GFRA 2MOKA 2QX4A 4FX2A 3W79A 4U7HA 4QODA 1WSBA 4PTYA 1QR2A 4FGKA 3EDOA 3EYWA 1FUEA 2W5UA 4BMPB 4PU0A 2Z9DA 3W78A 1ZX1A 2QX8A 2R96A 1FLDA 3B6MA 2D5IA 4ZVMA 5FUQA 2Z98A 3TE7A 1T5BA 2BPOA 5F51A 2M6RA 4D02A 5FA6A 2FDXA 3RPEA 5BUCA 1AMOA 2FX2A 2XOEA 3UXEA 2GSWA 2N1MA 1J9GA 3F90A 1OBOA 3FVWA 3OWXA 3QE2A 4YALA 4QOEA 3TEMA 6NULA 1J9ZA 1FTGA 5LJIA 5F12A 1GG5A 2A5LA 1FVXA 2QR2A 3NHRA 3B6JA 1QBGA 1QHEA 3OJWA 1FLAA 3ZHOA 3U7IA 1AZLA 1V4BA 3NFRA 4LAFA 4YAWA 3F6RA 5LBUA 2OYSA 5JROA 2V5VA 3N3AC 3F2VA 3G5MA 3U7RA 1CZKA 2F1OA 2FCRA 3ESXA 3LCMA 3NLLA 3W7AA 2HNAA 5A4KA 4QOIA 3F6SA 1CZRA 4BMOB 4ICIA 3L9WA 3R6WA 1YKGA 1BU5A 2R97A 4QOJA 4YAUA 5LLDA 1D03A 1H69A 1RLJA 1VMEA 2FZVA 2OHHA 2Z9CA 3UXHA 3N39C 3GFSA 4CETA 1XT6A 4LTNA 3FW1A 3NHSA 2ARKA 5FX2A 2B3DA 4NULA 1FLVA 3O73A 3FX2A 1AG9A 1JA0A 3FJOA 4QOGA 3KEGA 5ULLA 1CZHA 1KBOA 5NULA 1BVYF 3OX2A 2RG1A 1AKQA 2FZ5A 3K20A 3LT5A 3OX1A 3OX3A 1TLLA 4M0CA 2X2OA 3OJXA 4HS4A 4YAOA 3W77A 2XODA 4DY4A 1JA1A 2BZSA 3N3BC 1CZLA 2QX9A 1WSWA 1C7EA 1QRDA 1YDGA 3NHUA 2M6SA 2FOXA 3QFRA 2OHJA 4C14A 2MTBA 1YCGA 4QOHA 3NHLA 4U7FA 3B6KA 3ES9A 3GFQA 2HNBA 1AHNA 4R81A 4S24A 1E5DA 4H6PA 1I1OA 4XDHA 1D4AA 2BF4A 3HA2A 2BN4A 4C0XA 2MT9A 1OFVA 3ESZA 3ESYA 1YCFA 4HEQA 1DXQA 3HR4A 1RTTA 5LBTA 2KLBA 4QOFA 1FX1A 1H66A 1C7FA
chains in the Genus database with same CATH superfamily
1C1DB 5B7GA 3RS4A 4B8YA 2TYSB 3AOEC 1G9XA 3IHWA 4RTSA 4N3NA 2UYYA 4MB6A 1Z7YA 2JKVA 4BFCA 3C0KA 1E3MA 3LF1A 3ZI7A 2PLWA 2Y9PB 4NVRA 1OWNA 3TVDA 4HZIA 4BUCA 4B5KA 3KU4A 3L40A 3DPUA 5JLJA 1Z7GA 1HYBA 4A0FA 2DAPA 1LQTA 1NBEA 1E7MA 1UZUA 1QB7A 3WYGA 2FLKA 2H1HA 4X3CA 4F8YA 5L4NA 4Y6OA 4HNVA 4R9UC 4BDTA 4INPA 3R5HA 1U2SA 3G8AA 4IS2A 3TZKA 1EM8B 1ZXBA 4B5LA 3WGLA 1HQYE 2R7NA 1JDBB 3EC2A 3AHIA 3KQYA 4K6CA 2E82A 5ICSA 2ZUDA 4DCCA 4EA7A 1A4XA 3ZZUA 4OM7A 1WCYA 3BWDD 3WA7A 1V5GA 1YBAA 5LYJA 4ONEA 3H4IA 3MEQA 4UU0A 1WDMA 3MTAA 4C01A 5L3SB 4MEJA 2RJ3A 2GHTA 3N0VA 2PCLA 2I3BA 3KUDA 3OFKA 3QYAA 4UNPA 5DFAA 4H77A 1C4WA 2GDJA 1UMBB 4FX2A 3R7FA 4UTVA 5CIYA 1ZK1A 3Q5GA 4YROA 4FGKA 4CQNA 3TI9A 2H1SA 1OYYA 2WQ6A 4EQ6A 3B3FA 1U0RA 2Q29A 5TJHA 3IT2A 1KQ3A 1K8QA 2QA5A 1T5BA 2ORWA 5J2TA 2FPPB 2RGRA 1GEGA 1G3UA 1DQRA 2J7KA 2I9PA 1ISPA 1D2EA 1VB3A 2PS3A 3DLTA 3NXSA 4ZCSA 5KTYA 3K9HA 2Y0DA 3RFVA 4E2XA 2WM8A 5BN5A 1Q1EA 4R1MA 3TL3A 5JNLA 2VRWA 4P3NA 3RHFA 3T95A 4UVDA 1SZPA 2GGSA 1NI5A 1U0OC 1Q0RA 1T3LA 2ECFA 2AMFA 1RVV1 1V47A 4PLZA 3OQIA 2XUJA 2RHRA 3FZQA 5L7YA 3N8GA 1O94D 3FSRA 1ZGZA 2A94A 3MSXA 4O4JF 4UVHA 1FRVA 3H3JA 4G6ZA 3RUIA 4X20B 2NLOA 1XRQA 4LC0A 4N6OA 4QTYA 2VT7A 3VC2A 4B32A 4XOUA 5ISMA 2L2QA 3RIHA 4CV0A 1F8FA 1KYTA 2QUBA 2TRSB 3OCVA 2DUWA 3CLUD 3FI0A 3BDAA 4QM6A 1KQNA 2PWYA 1PZXA 5AI9A 1IHOA 4F92B 3GGCA 1PW5A 2P2NA 3USCS 2CK3D 2R3SA 1SXJE 2PCJA 4PGGA 1IBMB 1QQBA 4M1OA 1P91A 1YQWA 1JG6A 1UFVA 4NJEB 4Y2TA 4O2AA 3V8MA 3WBBA 4MKHA 5FTLA 4LX0A 4A8PA 3B1VA 2CNWA 3DZBA 4I55B 1OZ0A 1ISHA 1R8YA 4FSHA 4QO8A 2JIOA 3KQPA 3OT5A 4FHEA 1M2EA 1JE1A 1ZN9A 3N75A 2I62A 1TA9A 1NFFA 4XWOA 5J9FA 1Z0AA 3B6KA 4JS0A 4QIHA 1R8SA 1S8AA 1U9YA 3KZMA 4TTAA 3FCXA 3ZZTA 1U63A 3E5MA 1G19A 4S1PA 2B4QA 3AGQA 2V97A 5ALHA 2B82A 2DQKA 1T5HX 3VPAA 3M6AA 2XAUA 2EP7A 2QXUA 4UD2A 4LFCB 5BT8A 3RW9A 4GDFA 4UBLA 2QW1A 5SY4A 4M4SA 3CF2A 3R75A 1W4LA 2XE6A 5JC1A 4E13A 4L6IA 4PAMA 2RKWA 3F6BX 1LVHA 1PLLA 1CRLA 3HH8A 4TL9A 1ULZA 5J1TB 3NV7A 4F1JA 5ESRA 4CL2A 2QZ9A 3PEVA 1U3WA 4TV8A 4CMGA 2WC1A 4O4HB 3VU3A 3HB5X 5F64A 4BYGA 2AN5A 2CJWB 3K1YA 2XY4A 3DEYX 4WJLA 1QO0A 4IH4A 2BMVA 1YRYE 3HNPA 5I8ZA 4GMDA 3WBKA 3W9YA 5CB0A 4L22A 5JY1A 4R2HA 1JLKA 1N2CB 2R9VA 4L75A 4N76A 5LP6B 1MFPA 4BO4A 2IPNA 1EDDA 1L5OA 3GJRA 5LD2C 1QG4A 2ZWIA 3M81A 2J5KA 2FPMA 4UQPA 3RYCA 4RTOA 1YZVA 2HBRA 2AL7A 2G3YA 4KKVA 2PS0A 5M7EA 3THYB 4O4LB 2ANCA 1KAMA 3AY6A 4LBVA 4RPIA 10MHA 1E2JA 3BXFA 2XGGA 5HR5A 1DXOA 1K3FA 4G37A 3AERA 4PLVA 4HQ0A 2SECE 4YP6A 3TBFA 2WLTA 2VP5A 2PM8A 3FOBA 3P9YA 4JVLA 4KI0A 4UE2A 4YCBA 5G0TA 3ZS9A 5TMPA 1VZ2A 2EOAA 4MEAA 1U0BB 5KQGA 4DM3A 1DSSG 5CIWA 5ILOA 4MV0A 2OYCA 1PJTA 1UK9A 3RVJA 1E2NA 4WBXC 3C1AA 3G59A 1L7BA 4XIJA 2H7VA 3N58A 4ZV7A 1JR2A 1ORHA 4DLUA 3HDQA 4O2RA 5BOSB 2VNKA 2C4HA 1WZCA 1PFQA 2BWJA 3DE4X 4JODA 3OTOB 3ETJA 1E4EB 3IUSA 2CXNA 3A06A 4OQ4A 5JAUA 1EUDA 5HS4A 1E0KA 4L16A 1ORIA 5BNIA 5FBVB 5DOVA 3OIGA 1ZINA 4P3KA 1E2FA 3CLUC 1PTJC 4UVGA 1JU3A 3BJRA 1Y63A 4EARA 3QXSA 5A4KA 5KJCA 1II0A 2XE8A 1QK3A 3U17A 4DA4A 2WYWA 1E4EA 3EUEA 4PFQA 4HX2A 1BXKA 1GZDA 2Z6VA 1VA4A 5AJWA 3UGKA 3EDMA 1CUBA 5E6SA 2W2XA 1XIVA 5HDBB 1T43A 3HKCA 4FE4A 1V25A 4A7PA 2GB4A 3LT5A 2XECA 2V7BA 4KI7A 2D54A 1ZUHA 4IJMA 1GPAA 3FKSD 4X1YA 3P7MA 1XTKA 4NBKA 3RU2A 4B6QA 4GLLA 1YR7A 3DZCA 2OCDA 3BEDA 3QFHA 4FXPA 4DA7A 3VZRA 4P0QB 5ESWA 2RHDA 2NO9A 1N6PA 1B0PA 2WAXA 4FI3F 3JYNA 3C3YA 1M0EA 4LSWA 5JXGA 3A6HA 1CEQA 3JYLA 2YOFA 4IHQA 5CEFA 2ONZA 1OV6A 4NYJQ 4A10A 5HK9A 3QLTA 2XBLA 3OPXA 3FBGA 1YJXA 1ZOOA 2AUTA 2QGFA 1KH2A 2R7LA 4H6WA 1C14A 4MTCA 5KJ1A 4N3BA 1VG8A 3O8BA 3EGCA 2WHPB 2WAYA 3T6KA 2I9KA 4ZEVA 4XDGA 2VP0A 2ZSBA 4URFA 3RB8A 3TQFA 4D4IA 3ZW9A 2A8YA 1L9KA 5DDIP 3BZUA 4X95A 3G9UA 4ZEMA 1T1EA 4PCAA 2BP7B 3FJYA 1SKYB 1CIVA 1G8JA 3FJ1A 2DWUA 5T64A 5HZHA 3HA7A 1IBKB 2ZSHA 1ZL0A 4OP3A 1S2OA 2ZIXB 3NC1C 2NPIA 1QLHA 1VMDA 2P77A 4HDMA 4ID3A 5DM0A 3U39A 4EH1A 4TKUB 2PE5A 4MZXA 1AKTA 1UEIA 1RCTE 1GT6A 3PDUA 4TOIA 3E05A 5H3LA 3AVQA 1OT3A 2FFHA 2QTGA 4UTZA 2Q4BA 1ZUNA 1FE8A 2YN4A 3QU9A 4M1QA 5ARCA 1UODA 3ECSA 4BO0A 1Z0IA 2ZRIA 1HSZA 4MUNA 5H9VA 1QVAA 1VIVA 5EWLA 5B1EA 4DL9A 5GJBA 1LLUA 1GIAA 1Q2UA 1G18A 4NBSA 3RQSA 2WU0A 3I2IA 4UE6A 1YR1A 1AUOA 3GH3A 4LBYA 3F5FA 1YAJA 4KXYA 1T9KA 1ECGA 4H35A 2IYSA 1XEXA 4OU5A 3FPFA 3RS0A 3MJSA 4CM4B 4MNTA 3BCHA 5B2ZA 3PTLA 1GAXA 2Y9MB 3SFVA 5K9ZA 1HBJA 1XALA 2YBDA 3EY4A 1C3JA 1GL9B 2ZYVX 4FFMA 2JK0A 1GAJA 1AS0A 1CDDA 1QJCA 2DE0X 1NUHA 5LQRA 2WTMA 5CEEA 1GRVA 1D0SA 4DLPA 2X8AA 1KEWA 2Q4RA 3OCCA 1Z06A 5DP1A 2IV7A 4MVWA 1TEHA 7MDHA 2NZ2A 1HYQA 2VQDA 3FRHA 2B1JA 4ZEWA 2QSZA 2ZQZA 3QMPA 1AQIA 1FDOA 1FTWA 1QGUB 1DAPA 2WSSD 1FL9A 3OICA 4FGSA 4O4IF 3LTNC 4WKNA 1P75A 3EDQA 1JKMA 4YRAA 4I81A 3W6NA 1S5PA 2PY6A 5I51A 1NQVA 3HC7A 3GAZA 5FHRA 3WYNA 4URHA 1XB2A 2XSZD 3VOBA 1RC8A 4GX0A 1V1JA 4GBJA 5CFQA 2C88A 4UBOA 2OYSA 4WKGA 2QVLA 3KB6A 3TL6A 4LK3A 3VKFA 3TW8A 5FAKA 2HDOA 2C5EA 3R4CA 5KNDA 4FGZA 2AN4A 1JVSA 1U5BA 3EC7A 1J09A 1GSHA 1H6BA 4TZ0A 3M5DA 3ZD7A 3CLRC 2ZUFA 3T38A 2Y4OA 1BU8A 2PKRA 3RVKA 1LPBB 3KKQA 3QWFA 3LYHA 1ZH2A 4HP8A 3NTXA 1HX7A 3DE5X 4TVKA 5EFZA 4B48A 1PWEA 3LKDA 2PLNA 1AKQA 1C9EA 2UYQA 2VATA 4ZA2A 4W7HA 3OT4A 3ROEA 4Q9KA 3RSSA 4CM9A 2DQ4A 5EP3A 4L4SA 4H7FA 3W5DA 4Y9SA 1P72A 4HQNA 2Y76A 1LJLA 3GUUA 3HKDA 2VUIB 3FYSA 4LF5B 4UUQA 3V1UA 1W36D 1XTRA 2HO4A 3QVVA 2IV2X 1EP3B 1SUFA 3AIMA 3SDBA 2OO5A 2W6CX 3LWBA 4QYIB 3SQMA 3AEQB 2QTNA 1E5DA 1GHTA 4BP8A 3DMTC 2Q1XA 3COWA 4KQ2A 3SQLA 1MJNA 1VLHA 1K8RA 4FUQA 5E6RA 3TTTA 1T9DA 5KMGB 4OGGA 5CT8A 4KAXA 2FN4A 2GDZA 2ESRA 1O4VA 4MUJA 1NZDA 1RTTA 5GMOA 3CVOA 3TRIA 3UGQA 3PKZA 4PSKA 5I9IA 2ISCA 5CA1F 2QN6A 4E1AA 2PUVA 1PLJA 2OBFA 5K3CA 2XSZA 3PDHA 1R8QA 3FFAA 3FGZA 1H0SA 3PGA1 1QTIA 2FW6A 4EI2A 1UPFA 5A5EA 1QS0B 4E11A 4MUEA 3ONDA 5AKJA 2KWIA 3LKZA 3KR0A 4JBLA 4DF3A 2AZTA 1FFDA 4KXXA 4NQZA 3VO8A 3E9MA 4DHWA 2QRNA 4L15A 1YXMA 1JHQA 3HKEB 3QRWA 1F8GA 3BFXA 2BZ0A 3TGPA 3GARA 1PVDA 3IKJA 3IQHX 3G88A 4Q21A 4U7PB 5FBLB 5CUQA 3QPUA 3U44B 2Q0XA 4WEQA 1EFVB 2RI0A 1FTNA 2IXDA 2Y6VA 4JI1B 4ZKDA 3DEIA 3H8WA 5DULA 1KR5A 2D7JA 3O74A 4HDRA 2OLEA 2ZJBA 2GWRA 1Y8QA 3AU8A 4KK3A 4D8YA 3U5TA 4CU5A 1BDIA 2XNCA 1LS1A 2ZITA 1EHIA 3NT4A 5AM0A 4BPRA 2XD9A 3HCOA 4B0OA 4CEJB 4YAIA 2BGTA 2EKZA 4P4LA 1NLZA 4NRDA 4RIGA 4OFZA 4B3XA 1UKBA 4F5ZA 1OB5A 3PEYA 1GNTA 4UXHA 4ZZ1A 4R01A 4IEFB 3GLKA 4ZCPA 3E9DA 3ZY3A 4EO4A 1DIBA 1WMAA 4QGGA 2VWHA 3A27A 2KHZA 3FFTA 3UCXA 4PHGA 3OZRA 4OQEA 2Q9CA 3K6SA 3CZAA 4RZIA 5TSDA 1SKMA 4A26A 3HVUA 3ZIDA 3GLGE 2VQEB 2C82A 3G2JA 4RLHA 1KH3A 1YZGA 2HA2A 4RCYA 4QGSA 1DLIA 2WKQA 4L85A 5M3BA 4G1EB 3MD9A 4IIYA 4LNUA 5GPBA 5LM3A 5TR9A 4IJ6A 3G8BA 2A67A 1DNPA 4M3NA 1WEHA 3M4NA 1JG4A 1T4CA 4P7BA 4MUAA 1COWD 3H84A 1X9GA 1INLA 2BUCA 3W0LB 4BTVA 2GLTA 3GWGA 3O03A 5CK4A 1GR1A 3FLAA 3T0FA 1JQEA 2FRDA 3DUFB 2VBGA 3BQMB 1RRVA 4I6GA 2FI1A 4PVDA 1MPTA 3RBXA 3TMYA 2XT0A 1E58A 1NR7A 2DWOA 2X3FA 3DHWC 3P1JA 4Q6BA 2CMKA 1DPGA 1GZ5A 1PYOA 1VE9A 1UBRS 2H5JA 2OHHA 2V54A 1RU3A 2XDQB 4GWGA 3IELA 3MJFA 4KLRA 4QICA 5CAEA 3CURA 3DQQA 5EUBA 3GEPA 3PG5A 1FFCA 1LU9A 1NY6A 3MMZA 3QHQA 1AXRA 1N4AA 1R16A 2R1ZA 1QXSA 1EE2A 1TKRA 2AC2A 3K20A 3OLCX 5HBRA 3TXXA 2E85A 1AY0A 3GT7A 3K9QO 1XZIA 4JT2A 4LRXA 3TX2A 1DRVA 1SBIA 2E1RA 3I62A 4ZQHA 1JDJA 4PRYA 2ZI6A 1WW8A 1XMXA 2DT8A 1FP6A 1MT3A 1C7EA 1GY8A 1ZOIA 2V4UA 3HYTA 1NQTA 3I2JA 3TVTA 2YVUA 2C8LA 5I7SA 1M5TA 1I30A 1J90A 2C3PA 3OZUA 1H4VB 2G9VA 2WJGA 4L5JA 3W7VA 4KQMA 3FLMA 3AVTA 2B4TO 1P1CA 2AV6A 1ST3A 4N5MA 3GL9A 1N8SA 3UQZA 1EVQA 3PC4A 1JI3A 3DZJA 4M49A 1TJ4A 3HB1A 4IIHA 5E1MA 1ATZA 4R6XA 5T6BA 4BNUA 4X6YA 2PSFA 2X7XA 4X45A 3NX4A 4HUQB 4BGUA 1JEYA 2SKEA 2RFLA 4HNAA 4E31A 3VU1A 5KOJB 3AB8A 4OI2A 3U3ZA 1CUGA 3UEOA 1S8FA 2W71A 1FVHA 1G3MA 4I50A 4TT8A 1QF6A 1P2UA 3QZUA 5FWXA 1X9HA 2QMOA 3ZZ0A 4PIVA 3R8FA 1AZSC 1I4TD 1YR9A 5EFOA 4K9OA 3D6JA 1C2TA 3DBVO 3RAJA 3UAVA 2BGKA 1VCIA 3R24A 4DY4A 1IDOA 4DLVA 1CQJB 3K5WA 4Y7CA 1FUIA 1SOWA 1DIRA 1NN0A 2WA1A 2HA0A 1MZPA 2J9RA 1DO2A 1XQ1A 1XP5A 2LDBA 1D1QA 5KTTA 2KMLA 3IAAA 1S4QA 1Q57A 2WDPA 3SIWA 2O8DB 4X1KB 3WL4A 3G3EA 1I3KA 2NSLA 3IKLA 3OZCA 3BICA 3WA6A 3WMWA 4D44A 3WDSA 5EZSA 4UHCA 4Q47A 3VNRA 4EEZA 1ZZGA 4JVSB 4NWIA 2D13A 2QRGA 2QG4A 1MC8A 3EYAA 4INOA 3ZDAA 4JUAA 4KE7A 5L53A 3NDBB 5L95A 4RV5A 3E22B 2VJYA 4X00A 1UDCA 2XKAA 4HEJA 3S8EA 2DLCX 1LCIA 4BB9A 3D4NA 4C7OA 3QUAA 1F60A 3CQ9A 3VYTB 4TTVA 2Y1CA 2WF6A 5J2TF 3FGNA 3DBHA 3IUYA 5AHRA 3O2QB 5TMEA 3L05A 2JGNA 4Y1GA 4PN3A 3FM9A 4N3CA 1PFWA 1GAQA 4QPNA 5LU9A 5FLEX 4O4LA 2UZ0A 4MPJA 4WXPA 1FLDA 4J2OA 4ZGWA 2R6AA 1R4MB 4GP9A 4HXEB 2CMDA 3FUWA 4TXLA 4YJ2F 1H2RS 3JWEA 1BQ3A 2NVUA 3OOWA 5CH3A 2FSVA 2Q8QA 2NU6B 2HU7A 1HKHA 1J97A 5CVEA 5KWJA 3I5UA 3ZK9A 2N1MA 2NUTB 1G5RA 3ABIA 3ZIAA 2B8TA 1DX6A 2DCMA 5FA8A 2YYYA 5BVGA 1EP9A 1DFHA 2E4XA 2PGNA 1OHHD 3IR6A 3D4BA 1M6VB 1ECCA 3GEEA 1AD2A 1T10A 2LNDA 4KGXA 1ZW1A 4IEIA 4HVTA 2ZTLA 5A0FA 1E2KA 2H8GA 3FWHA 4YFVA 1PV1A 2G9NA 2Q1SA 4D3SA 1NW8A 2GBLC 4LZOA 1AHPA 4DCSA 2OGWA 3GZTB 1XVVA 4XRRA 2F62A 1KNXA 3EZLA 3T3PB 3UFXB 3LRXA 3R0VA 4TMFA 4UMFA 4JJ8A 3UK1A 3WHIA 3ZK8A 2PRZA 4MQUA 4FLEA 3SHTA 3WLKX 4G85A 1L7DA 4YIHA 3L0CA 3WLPA 1ZPDA 2PR7A 3K73O 4W5NA 4IJUA 3SBDA 3R9XB 2RGAA 3H2KA 1H6AA 2W8ZA 4RIEA 1XD9A 4MS3A 3R3ZA 1Z5GA 4KTVE 2CXOA 4OYLA 2II6A 3IRVA 4I1SA 1E9AA 2QAIA 4YP5A 1YU6A 3P27A 1GPKA 1KJIA 2W83A 4DCTA 4LZZA 3S0JA 1LTHR 4K3VA 1TF2A 4RELA 5FWAA 3ZKAA 5FLXA 2OV8A 3N6VA 3C8MA 1BROA 4X0EA 3ZWDA 4BLSA 3LYLA 5F77A 2X40A 5DJ5A 1E0JA 1PJ2A 3EJWA 3QMVA 3TRJA 4WRRA 5AOBA 4CUZA 1VC2A 4G07A 4R2XA 2J6BA 2IY7A 3JTEA 1TU3A 4KFCA 3BXZA 1Y5MA 4TTSA 3UK7A 4NJEA 3I5MA 2H5IA 3JATB 5J4KA 1H8HD 4FS8A 3DL4A 1JEJA 1CULC 2VJLA 3M5WA 4M1YA 4KNYA 3R3HA 4C4SA 4EPXA 3TMKA 1R4ZA 2X0NA 1PKEA 3AFNA 3A3YA 3LCUA 3VSEA 2PMBA 1XTSA 3A1FA 3BIFA 2EG5A 2OUIA 3KT0A 3UT0A 3BE5A 4KQEA 3WGUA 5AW4A 1PO7A 2HU5A 3LQ4A 4QHSA 1C80A 4KR7A 1WSAA 3OVMA 1M5RA 4QRHA 1YKSA 1WOYA 1KEPA 2C2OA 5HJ7A 1CY1A 1FFXB 2LVBA 1EX7A 1HFJA 2AD1A 5BSWA 1Y9ZA 3GNLA 2Q62A 2CLOB 3UZUA 1NKVA 1Y5NA 2SNIE 4IRXA 4IDQA 1O77A 3DFUA 1E2UA 3NIWA 3UMMA 4PNEA 2BHRA 3E7FA 4RHFA 3A1WA 1IQ0A 4IQ0A 4CF6A 5I4BA 4W5OA 4YRKA 1NFRA 4O3MA 2EFEB 5ELXA 3HHEA 3V42A 5A7GA 4A9AA 3N2GB 2OAP1 4LHZA 1UKEA 4MVJE 3ROZA 1UP6A 1NW9B 1PF7E 2XBUA 4QBGB 3R7LA 4CT4B 4G0ZA 1UZLA 3W7BA 2VJDA 2PKCA 2AC7A 3LHFA 1JF8A 3AEXA 4IRUB 4MA5A 1ENZA 4MR9B 3I1IA 3VSDA 3ZIUA 2P1RA 2JHPA 2OAEA 1JTFA 2HAEA 3PJDA 2AQKA 4BZPA 3QBTA 1MORA 1ZM9A 3L6OO 4URUR 1BS1A 1XVTA 2QV0A 4FFNA 4YT5A 3UVEA 3MZ0A 3K9NA 1NBWB 4O1MA 4OKNA 4PTYA 5ALIA 3DTVD 4B9AA 1L3IA 4J0QA 4L5IA 5BSRA 3BUSA 1I2MA 4BMVA 3JD1A 2BLNA 1ZM2A 2HCFA 1BDBA 5FUVA 3QVOA 2WPDA 4RVGA 2BSQA 4RJLA 5IH7A 2ECQA 3ZWCA 1GZ7A 2E3JA 4TTQA 4FYWA 2WF9A 1ZJ6A 4OHCA 4ZZIA 1QOQB 1Z4OA 2MYUA 5ELMA 1SOMA 4R0VA 5BNZA 2O2GA 2YFHA 5J2UF 3U49A 3I3OA 4OL0A 3MN1A 1QO0D 3RTDA 2D6FA 3MB5A 4LZWA 5JU6A 2FFAA 1QHYA 5AKXA 9MHTA 3CZ5A 3CLSD 3ESXA 1JR4A 3M6MD 5KNBA 1P2BA 2Y1XA 4ZAYA 2JNWA 1B41A 4EGFA 2G07A 4S2UA 3EG9A 5WRFA 2FEWB 2V03A 3RYHB 1VMEA 1KK1A 3K0FB 4O4LF 1X3LA 4BGVA 1TADA 1NLYA 3A58B 2MJLA 3V48A 1IM8A 5BMOA 2AR7A 3EZXA 4IIBA 1LC0A 3N7AA 5DTEA 2R6R1 2AOTA 2ZJ1A 3RIMA 3KELA 3ZX5A 4ZCRA 1KE2A 3U0BA 4FHCA 3HXQA 1M2OA 1FP1D 3ABZA 1US8A 1D8AA 1ZJYA 4UM5A 1HRKA 3UH0A 2WJVA 1I36A 3H1PA 3KYCB 1POXA 4BO3A 3QNUA 5CB8A 1NP7A 1MC4A 4NEGA 1GV0A 4YJ3B 3IT0A 5AM1A 5B4VA 3HXMA 2QPLA 2PKQO 2QDKA 1KFJB 2GYWA 2Y1KA 4MVXA 5REQB 3AWIA 3ZWYA 1IIBA 2R87A 2RBEA 2ZAMA 3FDZA 4LY0A 3RYFA 3WKAA 3VMFA 2PUAA 1LKZA 1DZIA 1T9ZA 2X5JO 4RANA 5E9WA 2QEQA 3WYEA 4EENA 1EWQA 2IHTA 5AVZA 2O05A 1K6MA 1N9ZA 2QM8A 2J6CA 2QYOA 3SR3A 4C0XA 1HFEL 3MM4A 3W2GA 1EDBA 3M9WA 2J0VA 3PPWA 4XFDA 3NB0A 3R77A 4ZQFA 1CSEE 5LUBA 1FRQA 5THXA 3ZD9A 4JLUA 4LI0A 2ANBA 4CLXA 4F9EA 2B7LA 4DB4A 3OQPA 4ROTA 4X63A 3KPVA 1G6OA 1Y9DA 5B12A 4F4CA 1KC1A 2VR1A 2XUKA 2HSDA 1EQ2A 2PL5A 3DM9B 5ED4A 4XD7D 4DC9A 1EHCA 1KXZA 1UFKA 4G0MA 1FDRA 2Q3FA 4YJ2B 3U4GA 2A7QA 2F9MA 3KT6A 3AVYA 1SBNE 3G02A 4FHDA 4P3YA 2XMZA 4WCVA 2JHGA 3L1KA 2IUUA 1K6EA 4RJTA 1ZI8A 1G55A 3JASA 5ES4B 4ZQCB 2HWUA 2XXAA 5F7OA 9LDTA 1SBTA 2FEXA 1NR5A 2QJFA 1WY5A 1J8VA 4B31A 4NV0A 3BCUA 3FROA 2W6OA 4ZOQI 1FDVA 5FUWA 1XZLA 4RNCA 3A4VA 3A9RA 5TT1A 2FVXA 3AV3A 5IVKA 1IXZA 1NVFA 3AUKA 1RAGA 3D2LA 4TLBA 3T1HB 1ZNQO 4FOSA 4RD3A 4IRMA 5EZQA 3IBSA 4MS4A 1W4RA 1I7DA 4NPCA 1CJTC 4D56A 4FONA 1ESMA 4OG2A 5CP8A 3IGFA 2OD2A 4FGLA 1XK7A 4LA4A 3GROA 4Y9UA 3RQIA 4EW6A 5GM1A 3EC1A 4XUDA 1XZNA 3KTAB 2JFQA 1DE0A 3KFXA 3LUJA 4NCHA 1ODCA 5PNTA 2J4FA 2VP3A 2FSFA 5A5VA 2PH3A 2E49A 2IYWA 5C35A 4NC9A 3X43A 3KZOA 2NU8A 4E4RA 2VJBA 1N2OA 2SBTA 3VISA 5A2GA 1Z4MA 1DX4A 2FX2A 1A04A 4RKRA 1OOEA 4PANA 5CYGA 3L93A 8LDHA 5JDCA 4LCEA 1EAYA 2QENA 3A2NA 2P3SA 1L3CA 3DEKA 3ZVLA 1OI3A 3QNMA 1LDYA 1F2TA 1NQ5A 2GBCA 2W6JD 4WEOA 2KE5A 1THGA 5HG0A 3RRBA 5BSFA 2EVWX 4BVGA 4EHHA 3FPSA 3B2EA 5I3CA 1HE4A 3BMQA 3SEFA 4ETWA 4XWWA 3L8HA 2AMVA 3Q7EA 4OYRA 4CLDA 2W98A 2VXYA 2XV1A 4D9MA 4EG7A 4YR9A 1JMVA 1TUBB 1D03A 1QDEA 4K8OA 4R2MA 4NP6A 2YHBA 4JB3A 2GD6A 3AEUB 5F7JA 2BE9A 2QRVB 2P2SA 1HLFA 1RXSA 2J45A 3JQ8A 2CVHA 3PUHA 4KIGA 4G5OA 2CBZA 1KIFA 2HHLA 3OX2A 3TW6A 2O2XA 3ZD8A 1VKJA 3E35A 5CT9A 4JBXA 4LGMA 3O75A 4JUIA 3S7ZA 5CIQA 4MAAA 5CXQA 3OE4A 5J47A 1SC6A 3NHUA 4CW7A 2C5SA 4L8WB 4J94A 4R8RA 1O1YA 3PNKA 3H2SA 3W1WA 2WJIA 3WRYA 3CIFA 1CBUA 2Q28A 4G5RA 4OK3A 6REQB 4JD5A 3GNQA 1KBZA 2ZXUA 3EFBA 2QSYA 3ONNA 4KFTA 3HPRA 2ONJA 1LRKA 4LQ4A 4A2CA 2J3QA 4RSMA 4BB5A 1JG2A 4KMSA 3FLEA 4KCGA 3W1VA 4KQFA 2QG9A 4FKMA 1LZLA 3QUCA 4ZVSA 1CRZA 2FW0A 5CW1A 2KLHA 1HNNA 4I1YA 2NAPA 3JWPA 2AZDA 3C74A 4BNNA 4FGUA 1TIKA 5DVZA 3K96A 4GOMD 3SJBA 1HZZA 4TSFA 3TCNA 5FOVA 5C81A 4L02A 3PQEA 3FPAA 1ZQ1A 5JMPA 1KBQA 1BOOA 1P2DA 3LY9A 4K0RA 5BW6B 1VG0B 2GS9A 3VMMA 3IUPA 3OCJA 2B6NA 4IAOA 1ACMA 2XNDA 1ZSYA 3JARA 2F3SA 1VHLA 4JYBA 2FP4B 2NU9A 3AT1A 3BMOB 4WGFA 1NAHA 1PDOA 2HQ1A 3VR5A 1AH2A 4KXWA 1E3WB 4UJ3A 3GLGA 4TN1A 2YWDA 1DIGA 1DTEA 1J5PA 1F2DA 1NHGA 2NM0A 2P0EA 2X8WA 3IVRA 4H0CA 3D6VA 4KPYA 4Q34A 2JLYA 2O2YA 4J2HA 4LJKA 4F86A 4AD8A 4E5UA 4D4MA 1K4MA 3CF4A 2H7XA 1V5IA 4G86A 4LOJA 4PICA 3UMJA 1R8XA 1ELOA 1BXGB 1ZGGA 3K94A 3F4BA 1YQ9A 3ZU6A 2UYGA 5TPZD 2YN0A 2FE1A 5KPJA 1JWAB 3PUYA 3HKBA 4RZHA 2BGIA 4DE5A 3VGJA 2IH5A 3W5IA 4BUZA 3TZBA 4NZYA 2B9EA 2INGX 3OI7A 1EBFA 2PXCA 2DM6A 3C43A 4GLBA 1ULUA 1U4OA 1I3CA 3URKA 1I33A 3T1TA 2PAFA 1H8ED 1WB4A 2HJ9A 2PG3A 1F7UA 3FCAA 1ZISA 2ID4A 3T3HA 1PR4A 2DTEA 2OWDA 3GUHA 2XMDA 4MVJA 4KNWA 3AF4A 1J7KA 1NLUA 3DM5A 5F51A 4EMBA 1VKZA 2REQB 3P9KA 2L69A 2ZBFA 4Q39A 4RVUA 1BSVA 3BBLA 4BMDA 4CM1A 3K92A 1Z8NA 2FMIA 4HZUA 2CCKA 4UHDA 1FP4B 4YQFA 2C9ZA 1ZOSA 4JQSA 3RSGA 1W52X 2QR3A 1G8GA 4RQUA 4IGFA 1W47A 4NENB 2B0JA 2JJQA 2IQ5A 1JDTA 2H3EA 3ABSB 5M29A 2GO1A 4G0VA 1BH6A 2JEOA 2HQOA 3I72A 3HUUA 4X85A 1Q1AA 4CL3A 4HPWA 3COVA 1E63A 2CF5A 1T4GA 1I6KA 1PFUA 4LHWA 1A8SA 1Y3CE 4CIBA 3Q3VA 2QD3A 3CCBA 3ZE7A 2VCYA 2JD1A 1RWQA 1NF8A 2HJRA 3HY6A 3MAAC 2XTJA 3DKKA 5DIFA 3KSDO 4IH9A 2IYAA 3PX2A 3L3BA 1EFRA 2AIRA 1WMBA 4LNAA 3HDJA 3TM5A 1BKDR 2WU1A 4C0HA 3DVQX 4FHFA 4RAQA 1RQ2A 2E4WA 3EAQA 4B43A 4E30A 1XMOB 1U3FA 3MTJA 3PDCA 4S3MA 2O7SA 2FPRA 3COJA 1RBYA 2HRCA 2OBBA 4RVFA 3REFA 3UC5A 1JXMA 1P5HA 1ZN7A 2QLMA 2YBEA 3CC8A 4M83A 5KSOA 4L3VA 3A9TA 4PYJA 5LKAA 1BMFA 3KD2A 3W3AH 4ARCA 2OEPA 2AUNA 3EGXA 3ESYA 2XUAA 5FYDA 1SVWA 5BSEA 2OHOA 3LDAA 4L74A 4UTRA 1N1MA 1MIOA 2BMEA 2CD9A 3AP2A 3K9WA 4I99A 1H3FA 4RD6A 1U0HC 1OY1A 4RESA 4XJVA 4MX8A 1IXYA 1O6FA 4JMLA 4NJOA 2H0AA 2JFBA 2XDWA 1FOEB 1KYYA 4NJMB 1YZHA 2WTXA 4IY1A 1M6YA 2O0MA 3BTOA 2J5XA 3GBPA 4NATA 2JLQA 4RE5A 2K6GA 3BCRA 3MWJA 1H0KA 1VE3A 4F21A 2FFRA 2AZMA 3GJTA 4JX9A 4MHOA 3TB4A 4BNXA 2J3JA 3SK0A 4B44A 4OQMA 2RB5A 2XTMA 3BPSA 3O2NA 2UZIR 2GJAA 5BPHA 2GN1A 2PFGA 4OQPA 1EWKA 3WIBA 3WP1B 1DINA 2ZBUA 2NTEA 1GLGA 3IALA 1P39A 5DO9A 4U2FA 3SS9X 3W2FA 5FPHA 2EV9A 4XM1A 5HGXA 1KRXA 2WYVA 2XYRA 1PN3A 5LQSA 4GW3A 3CW8X 4OGLA 5C9ZA 4JASB 5HE8A 2ZR8A 2QMYA 1DEKA 1XXLA 3AO0B 2C96A 3IBYA 5BWOA 4JP8A 3K31A 3RNLA 4OGFA 3UF0A 2BLLA 3IEUA 1K7EB 1XJ0A 4LTMA 3SF8A 3G7UA 1C3OA 4Q4JB 4UFNA 4CXMA 1AC5A 4PZDA 3D0KA 4JQOA 1NVDA 3ILVA 1TO6A 4C2AA 1UJ2A 1N0IA 2VHXA 3NEAA 2ZAGA 4G56A 1E8NA 1Y82A 4PLHA 5ES3A 5FNVA 1PJ4A 2WOJA 4I55F 3RSFA 3AK4A 3N76A 2YWCA 4EHFA 3UJ8A 1L4MA 1NG9A 2K4MA 3TQQA 5AVQA 1L1EA 1JB1A 1KJWA 2QXTA 3D4IA 2FDXA 3LBNA 3L1UA 4PNZA 4WFQA 3O8RA 2GEFA 4XB1A 3I1JA 3HCRA 3IAEA 3RE1A 2ZAYA 3G5TA 2LE0A 2OB1A 1XG5A 3GY0A 1SHUX 3H4MA 2JDIA 4PQRA 1V1RA 1JP7A 4WY5A 2OQRA 1HDOA 4GOLD 4AJIA 4KVZA 2YVKA 4CYMA 2FR0A 3DH0A 1E9FA 3M6XA 1QE3A 4G4SO 1Z33A 2F00A 2C2YA 1Q95A 1R4NB 3ZCPA 3OPYB 4WZAE 3V55A 4ICIA 4EFNA 5C4MA 2CUZA 3B13B 6GPBA 4U2DA 2VDQB 3C15C 3HP7A 4IGIA 3N39C 2JFPA 3U7QA 3OM1A 1LLDA 3TRFA 3HCCA 4LSGA 1KSHA 5FTKA 1ABFA 1J1IA 5JY6A 4WDQA 3KALA 1UC4B 3UMYA 1KEEB 3VKHA 4MGIR 1E96A 2Q6KA 3OTQA 2OGSA 2A0KA 3D8TA 3OZBA 4ZPJA 4DMUB 4NCIA 3ADDA 1KI1A 3QI7A 1U1FA 3KJHA 1Z83A 3PLNA 3W5BA 4G24A 4BWGA 4LXQA 4Y6GB 4KNVA 5DNDA 3PDIB 4MGYR 2XI4A 5ALMA 4HFMA 3RC2A 4XWTA 1PZNA 4ASUD 4ZO9A 3CGGA 2P6UA 1D2CA 1GFZA 4K5QA 5KJFA 3EGEA 1BX3A 5D8DA 2HBQA 3OZXA 4DCOA 2ZGVA 3JQAD 3S2ZA 4ENSA 5BN3A 4WCFC 1KFEB 1ZNWA 3NTQA 4FFBB 4M7WA 2RG7A 2Q27A 5CR9A 2I6UA 4MW4A 1CYDA 3E0XA 2OHGA 2OZVA 5FF9A 2OXTA 2AR9A 1AUQA 1MV8A 1Y5LA 3DP7A 5AHXA 3RGWS 5JRZA 1KTVA 1N1GA 1DB3A 1OGYA 4KUEA 1I5OA 1ZFNA 4MV8A 4RW0A 3U7QB 4C03A 3JQBA 4O02B 2EGHA 2FA9A 1IBCA 3PXCX 4DZTA 2Z4TA 3H3XA 2XMBA 4OO3A 2ZIZA 2P8SA 1NBAA 4J76A 3SJUA 1D1SA 4KQWA 5CDTA 4MDYA 2YDYA 2H7CA 3GLTA 2NV2B 4ON9A 3A6LA 2GD1O 3LUKA 4YV0A 1POWA 4Z6KA 2IIPA 2GUWA 2Q4EA 1EB9A 4HDSB 4UMEA 3VNAA 2R5WA 4PG8A 3ILYA 1Q0TA 4RZQA 2CVOA 1G8SA 1M1UA 3PQCA 3LK6A 3FH0A 2JH3A 3QLVC 1N2CE 1ZR4A 2IS2A 2RGYA 4YRJA 4AY4A 4LJSA 2O7RA 3QKIA 3V4LA 2CUKA 2NXJA 2XXBA 2AW5A 1QIFA 3N53A 2JFNA 4XPIA 3GXBA 1X8JA 1FFBA 1B73A 1GFWA 1RFGE 4KXLA 3SKYA 1JG3A 3GG9A 5LQNA 1K75A 1J24A 1U90A 3JAWB 3MUNA 4I5FA 5T3YA 2WDZA 5KQPA 1F48A 1EGVB 2Q5QA 2C3YA 3V4RA 5IBCA 3NM4A 5M2QA 3IDZA 3U61B 1A2KC 1U0SY 3PJFA 5CVJA 3AEKA 4AJ2A 1C7IA 4NAUA 3K1AA 5CA0A 1W1WA 4M0FA 4E5VA 3T06B 1KOLA 1MJFA 1QQTA 2H9YA 2V3CC 1VBNA 2FEPA 2Y0BA 4UZSA 2O48X 4ZCMA 3N5CA 3KKZA 1SCUA 1SOVA 2A4KA 3OE7A 1VI5A 4JLDA 3BMCB 1X1QA 3FHLA 1OVMA 3GCWA 2R62A 3JVUA 2B36A 3C2QA 5E2IA 5F76A 5JSYA 2PMKA 1QIIA 4U3JB 2PMDA 3T7KA 2IZ1A 2HPHA 1EFCA 4JGIA 1X7ZB 2OO5C 1QBGA 3KJQA 4I6EA 3SZGA 2NG1A 1DTSA 5GY7A 4GDMA 2IOQA 1IEWA 4RD1A 4AY3A 4EG3A 1GQYA 2EDAA 3CN7A 5ARDA 4CKEA 2UUCB 5EG5A 1NC3A 2XHZA 1NNEA 2PSHA 4FKBA 2QL5A 3CEJA 4RDXA 2HIHA 5DNEA 1W4ZA 3OETA 2UXDB 2XVYA 4F2DA 4GZ3A 4HRAA 3VH4A 1KSJA 2DPLA 1J20A 4RAOA 2FSUA 4LXHA 5DRYA 5AW2A 4UEKA 4FN4A 5A2QA 2Q5HA 5BSKA 2P2GA 4K9MA 3FBWA 3QTTA 3AF5A 3D6MA 4NY1A 1YIDA 4HYYA 4B76A 1LLFA 2CF6A 5TARA 3Q87B 3H16A 1KGSA 2A5GA 2X77A 2EW8A 5AOVA 1CZLA 5AKHA 5F5NA 1V5WA 1YDEA 3TNYA 2PIDA 1GPDG 5KWVA 1JIKA 2GVZC 3LNCA 2C59A 3TSCA 3AJ9A 1NMZA 1QWSA 3HR8A 1LLCA 2L18A 4X84A 4EAAA 3JAMA 4C78A 2R8PA 2E87A 1EINA 1E7RA 1RZ3A 2VAXA 1L7PA 2JLRA 1UOEA 4HNGA 5J5CA 1FEZA 2PAAA 4Q9HA 3UY4A 4AZWA 4BZZA 1YE3A 2Y67A 3H42B 4NE7A 5EIFA 3CLTD 2MDTA 2AN1A 1RJEA 1REQA 1OASA 3CHYA 1A7UA 2WG1A 1CNMA 4JJKA 3WXBA 4RSGA 2CXHA 5JW6A 1OKKD 2VSYA 2RHMA 2VUUA 1UWKA 2X42A 2IITA 3OWHA 5B3KA 2D1FA 5CA0F 1AGPA 1I10A 4PAWA 3OIDA 3PNOA 4BP3A 2D0DA 1BTOA 5FD8A 4EB8A 1SPXA 4OJKA 4JK3A 1Q1NA 1HYEA 4MCIA 2AN9A 3BD9A 1G1MA 4PSUA 1KI9A 4O4IB 4PZPA 4U00A 1X15A 4JZKA 2C4UA 4QGFA 1XMPA 8AT1A 2O2JA 3QKTA 2OK7A 4DG9A 3PTZA 1M2WA 3GRVA 4JJEA 1VGQA 3LUFA 1CV2A 4RH3A 1RYDA 2DSTA 4NCNA 1T9GS 3O91A 4RS4A 3MHTA 4REQA 4FIDA 2NNWB 4FC6A 3H9EO 1ZCFA 3KJZA 2IU0A 3T5TA 3OURA 2G71A 4QUBA 2ORIA 4ZVQA 4PG4A 2O54A 4LCJA 3KXKA 2DG2A 3FMIA 2PGAA 5BSVA 8ADHA 1W87A 2Q4DA 2VA9A 2VH1A 2RK6A 3C5CA 4QYXA 1P5RA 4Q1BA 2PZJA 1QRTA 2BH9A 2EX0A 3WXMA 2E0IA 1SIWA 3W5SA 2QTCA 2WB2A 1VJRA 4UOEA 2BONA 3E23A 5EIBD 4G4SP 2C2MA 3WY9A 3RADC 4V0OA 4DR5B 2D74A 4HWKA 1A82A 4Q4DA 3CM0A 1RM0A 4OD0A 4WH0A 3WP0A 1A88A 4LG1A 1BGVA 2GH1A 3BB3A 3EFOA 4MQEA 1AGNA 1IN4A 4GG1A 1NLMA 2WTEA 3ZY5A 4TT3D 1JR3A 3ESAA 4S1TA 1Q44A 3GJQA 2M6KA 4PC6A 1K0UA 2QP9X 5K03A 2WJWA 1N1EA 2FMHA 2MYTA 4FNGA 4KFUA 1BJKA 5DXJA 4KDFA 3LECA 3HB0A 3D59A 3NUZA 3CUEF 1EE1A 3DXFA 1HXHA 2A35A 3O4JA 3Q5DA 5AK5A 3C3DA 1CZRA 2PSEA 2GJSA 1H2BA 2D0IA 2PBRA 4KACA 4UCXA 4A2PA 3H6GA 5MHTA 4ZVTA 4X60A 3GVHA 2GEVA 2Y2UA 4H3HB 3ETCA 2YHIB 3ETGA 2VSNA 3NRBA 1RXVA 4NAVA 1TMOA 4WLEA 3DMDA 1QYXA 3OECA 4LYHA 5F9MA 2NUBA 4BBJA 3UPUA 3PXAA 1BW9B 2ZM5A 5JHGB 3T7TA 3ZJ5A 2Q6VA 1Z6TA 2G1UA 2PT9A 1NFQA 4UMDA 2QPTA 4HXYA 4L5CA 4WZAA 4B0PA 4UPEA 3WJ2A 2ZIWB 2WIFA 1UIRA 3IIEA 5KTOA 3AB3A 4BO2A 1QHHA 4KWIA 2Q2NA 3DD1A 3T4XA 4YT4A 5KI6A 5IT0A 1BA3A 4TLCA 1BAPA 2F64A 4B3SB 3K8YA 4P33A 1JPVA 5BVHB 4D8WA 5JS7A 3X1XA 1G38A 4UNSA 3L7NA 1QE5A 1G20B 1M0TA 1XXHA 3DYBA 2YVAA 3WTCA 1XTPA 3VDRA 3AEUA 1NOIA 1PR1A 2C2XA 4JP3A 2Y99A 4YYEA 5L4SA 2EFCB 2G09A 3IP7A 3GA5A 1G9SA 3DOUA 4HJXA 4OKSA 3KEMA 6LDHA 4EHDA 4BZXA 1KZ7B 3EF0A 5GZ1A 1OFTA 4IO1A 2YXDA 3KAJA 1C3LA 3H2HA 2DPGA 3H5WA 1F20A 1PAUA 1TO2E 3KVOA 1R66A 1U5AA 2BFWA 4AUKA 1EG2A 1RPTA 1FBNA 3CB4A 1Z0SA 2MR6A 2RI6A 1VKHA 4XAQA 2V6IA 4I46A 3EFHA 3TVYA 1AKWA 5IZCA 1ZDMA 4Y30A 4IHAA 3RODA 4CN8A 4IX9A 3M6FA 4D4JA 1DLJA 5JJBA 1UBFA 1PUIA 3GCXA 1XD2A 4LOIA 4FFBA 5HZGA 3F96A 1L1QA 3L9XA 4NHEA 5A3JA 4ENRA 4S04A 2CZQA 4PPYA 1XVAA 1O94C 2ZYDA 3RUHA 4CL8A 4UOZA 4C5BA 4LF8B 4NE2A 2IE8A 2BE7A 1QUFA 1T5OA 5P21A 3OT1A 2IHVA 2JFUA 4HN9A 5I7WA 4AT1A 3HABA 4G8DA 4KITB 1OYOA 4DJJA 1JSZA 4FYPA 1UANA 3UWMA 2R1TB 4OXKA 1TM4E 1WNTA 4LJ9A 1LQ2A 3HSSA 4GSLA 2ISQA 4NICA 4B4DA 3BAFA 2R96A 4D1YA 1MN6A 4NFLA 1P29A 2DFLA 2QVYX 4JOSA 1U6KA 5K3AA 3M3HA 4JBIA 1OLSB 5CVTA 1LW6E 2IEYA 1A2QA 1QIGA 1XRLA 3SC3A 4J9VA 1IAQA 1YRBA 2B1IA 2YWRA 4F3CA 3F6EX 1LBTA 2GSWA 3ETEA 2QYSA 3GRZA 3KKEA 3SYKA 3WV5A 1J9ZA 2BTQA 2ZRAA 1RWKA 3QU7A 1KJNA 4MGKR 3P5BA 4EJSC 4BPBA 1KO5A 1XOIA 4BNVA 1EFDN 1FVXA 3FNRA 3NM6B 2QTAA 4U3JA 4D97A 3JALA 3ECAA 1L4GA 4HB0A 1OHHA 4LYDA 4OK6A 1N6NA 3RIXA 5IDXA 3PUXA 3TMAA 4MLCA 2J48A 5LBUA 1ZA2A 2ZDGA 3R9KA 4BO9A 5KVCA 2XZTA 1LBIA 5K0ZA 4U0KA 2ZBVA 2YCBA 4GOND 5EEGA 2XUHA 4Y0NA 4XUEA 4YRDA 4OY3A 1JSCA 2DULA 3ZHCA 1NHWA 2VHWA 4HAYA 1K7SN 1MX5A 3TTUA 4FJ0A 1QFSA 5B7NA 4PM4A 2QI9F 5EHXA 2D3WA 2EEPA 1UDXA 2QZ4A 2HA4A 3A4YA 1TYEB 3KXDA 3KQQA 4NNPA 4R1UA 4L95C 1E9BA 3M4JA 2Q1YA 5T4HA 4FYMA 1J8FA 2PLRA 2AG0A 4KK4A 3F3SA 3RBZA 2MSKA 4OEHA 1ZUIA 2VSOA 5D7BA 5DM4A 3D8HA 4FU0A 4V0NA 2VDNB 2XZPA 5LUAA 3ZNOA 3EMKA 4P31A 1P0PA 2VK1A 4ZD6A 1UM8A 2F8TA 2RAPA 3R7SA 5ALKA 1B4DA 3SJZA 1IAVA 1XDGA 2GO7A 2OCPA 2PRSA 2E89A 1KDZA 4WTOA 3WDMA 4H15A 3V1KA 1NMEA 3KSUA 3ZY4A 5CVDA 1QDUA 3D2BA 3C8DA 4NBNA 2QIOA 2FZKA 2K87A 3PRKE 3ANTA 3IUJA 2VSQA 2WJZB 4Q3DA 3X1KA 1SCNE 4EP1A 4FZ3A 4UAJA 4PYQA 1KMMA 3P0JA 3BWCA 3JQPA 3ZWNA 1EIZA 4WZBE 4YAJA 1A4IA 1XRSB 2EL9A 5DHRA 2C29D 2WPDD 1G17A 1MOQA 4BFSA 5ITWA 3ZGNA 3ROTA 1C9NA 1J49A 2D1TA 3WB0A 1U7HA 1XLVA 2XRFA 5CURA 5DB4A 1GQOA 4ID9A 2FN7A 2PWZA 2CDNA 5FP0A 4CQMD 5B3JA 3K0SA 4R9RA 1UZNA 2EF0A 3ML1A 2RHJA 4FSXA 4L1KA 3VPCA 2A88A 1FMFA 2QM0A 3C3EA 1NUTA 1GN8A 1A9QA 1V7CA 2V0CA 3EOAI 4QNRA 3RFUA 4DM4A 3GRCA 4OI4A 4OREX 2VPWA 3VZSA 3HLYA 5DOZA 1GARA 2O5VA 1YCHA 4QFMA 1ZOLA 1C7QA 1V96A 3BMNA 4PX9A 2HW8A 1S3FA 5JT1A 1T4DA 2IYTA 4M7OA 2G70A 3EZFA 2I6GA 1QVWA 3RARA 2XYVA 4LMAA 4ZO7A 3DEAA 4NU5A 3V2GA 3U6BA 3NHYA 4TV9A 3QU5A 2AVNA 4BBPA 2BBSA 1CF2O 3UFBA 3OLWA 4AKSA 2X0IA 4ZU6X 1E2PA 3VR4A 2G9UA 4BMCA 5I7HA 2JAHA 3VPGA 3M4ZA 5AI8A 2W8BA 5BYAA 5KCZA 2I3GA 3SNKA 1M8GA 4Z86A 5GONF 2IHKA 2BHNA 1N25A 4MYHA 3VDQA 1YUBA 2Y68A 4EG0A 3LH5A 3HCEA 4N5DA 4PLGA 2Z5LA 4I8DA 1NQUA 1RRCA 3S81A 3P2MA 2EDCA 4IKEA 1TFUA 1NMSA 1WXIA 3ORSA 2YJGA 3GRKA 1XAGA 4DQDA 5JXHA 3K0HA 1NRWA 3RHZA 4PBTA 1ISGA 4LWPA 4R1PA 4BNGA 1C0EA 4CF5A 1I7SB 2JAOA 5JFTA 4RGYA 2E7ZA 4HH0A 3ISVA 4NH4A 1T29A 1X38A 2LRHA 1DHTA 3ENVA 1JT9A 3HRIA 3K0AB 4LRSB 1LPNA 2WIDA 4MW5A 4PZ9A 5C8YB 3BQ9A 1GZ4A 3SHWA 3ZQUA 1X7DA 2YRWA 1O0BA 2WIJA 1ONSA 4GYWA 1JR3E 4LDAA 1AQNA 3T3OA 1Y0BA 2J3KA 1U8FO 1PR9A 2ADMA 2OORC 1JHDA 1T2CA 3JYHA 4RJ2A 5JH7A 2Y2VA 3NKLA 5ECWA 1GV1A 1L1RA 4L4ZA 5BO5A 4L51A 5DTMA 3NJ4A 3GPLA 5EWJB 2JBAB 2JFXA 5GJWC 3ITDA 1P6XA 3ND6A 2ZWAA 5FAXA 5ERYA 1NXOA 3W9UA 3G8CA 1XHEA 2NQ8A 3C8HA 4FT4A 5JAQA 2XBMA 4PE5B 3PLRA 1OD6A 3TWOA 3ZU3A 3DEFA 5DNAA 1KO1A 2NO0A 1QIKA 1C9MA 5BW8A 3MFYA 1GGFA 3ZW8A 2OQ2A 3LC0A 2DH5A 3ORFA 2R2GA 4MUIA 2IUSA 4OMDA 1ZD9A 2QL7A 3OWOA 3P9RA 5CB6A 3W5JA 5HF6A 3JWGA 2PUHA 3W4KA 5J2UA 3G2OA 1TFRA 3WLAA 4CQMA 1IMJA 5FBKA 3QG1A 1CJMA 4ZTUB 1DQNA 1MIOB 4OHXA 2XZOA 3IEPA 3V7UA 3MOGA 1P7VA 5AW9A 5TGDA 3CE6A 4RKEA 4F3RA 3A4MA 2ZQ5A 4AYXA 3W2IA 5CFNA 4CF7A 3TBKA 2XMRA 5C4GB 4QO7A 4RHXA 1NZJA 2P9YA 3E7DA 1I6MA 2D4AA 5LZ2A 2ZE8A 3BWMA 3M33A 3ICVA 3K0CC 4K9DA 4YAEA 3CBGA 1DIOB 1JKJA 1MX1A 5EJGA 5IU6A 1WUKS 2AA3A 1TCBA 1IU9A 1NVBA 1RM5A 1SG9A 1U81A 2Z2XA 1CZNA 3LBFA 1TB4A 4IGEA 5L9AA 1XTTA 2A9KA 1V39A 1VFPA 4EYSA 1AV6A 3PX3A 4Q93A 4UD6A 4ZN6A 3VNVA 3FSGA 2F90A 3HI4A 5JHHB 2OTCA 3IEKA 4LOLA 2G7MC 4MI1A 1U31A 4CMEC 2H1OA 3A1UA 4BRZA 2FPIB 2WSYB 4DV1B 2IT1A 3OZ7A 3RASA 4GX1A 1FUEA 2VG8A 1UINA 4N8EA 4D0LB 5DRTA 5TQ2A 5FI5A 3A36A 4JLVA 3CT4A 3OTGA 3WRXA 2PZMA 3I01A 4M0PA 1DL5A 3AOEA 1J7JA 5IKMA 1GT91 2C7BA 1AQUA 4LJ4A 4N8DA 2QRVA 1UJNA 3D6AA 4Q9NA 5EXTA 1TAUA 4GECA 1VZ3A 1TEZA 2PKYX 2BEJA 3MK31 1QMPA 1FFGA 1Y8CA 2X23A 3AHFA 1ZVMA 1ZRNA 1TT5A 4E2ZA 2GN2A 1HDCA 3DOJA 2EJBA 1Z4LA 3NFRA 4MS1B 1GDHA 1SBZA 3BC1A 1JMYA 1YI8A 2EJCA 4F45A 4QVIA 2GERA 3G5MA 3OQ1A 1MXHA 3NJ8A 3LGAA 3SQWA 1RXIA 1B3BA 3LCCA 5JI2E 4QUAA 1LV7A 4LY9A 3WK5A 4OYYA 1UXKA 3O21A 3IAXA 3CKYA 2V3VA 1FNCA 2ZRHA 1ZEMA 1OZAA 1RHRA 1BMQA 4J3FA 1JLMA 1QHNA 1NUAA 4HGYA 2GZDA 1CD5A 1HETA 3F49S 1DCKA 2OGUA 4MWCA 5L6MB 1CQIA 1FW6A 1USGA 3PC7A 2BM8A 3I9LA 1PL8A 3D3EA 4EO9A 2EBUA 2XH8A 1XEWX 2NU7B 3IP1A 1NKTA 3PITA 7MHTA 4IJKA 1J21A 2E5WA 1UOQA 1DKLA 5TX7A 4HYTA 2XZLA 3AZPA 1IHYA 3QJGA 4YRMA 1P9RA 3NHLA 2P6PA 2EHJA 3GJZA 3K4PA 1SVMA 1AHNA 4RK6A 3A3PA 1E9SA 3TLZA 5JALA 3IULA 4GPTA 3HA2A 4YWJA 4DY6A 4NQRA 4XQEA 3HO8A 3IOBA 2G77B 4LQLA 4X65B 3LVBA 4BNWA 1OXTA 5T8KA 1GQSA 5LFAA 5C1OA 5AW1A 1X70A 1FIUA 2XWSA 3GEMA 1AQJA 2DLDA 4IXNA 5JV5A 1W5BA 3M9XA 4JKYA 3VPHA 4G1FA 4H6XA 3GGGA 3D5QA 2R7KA 4R8SA 4UW9A 1Q7TA 1P8AA 1NOKA 5DYYA 5GONB 1C7JA 1FQKA 3P2EA 1DG3A 4X62B 4QXQA 1KA9H 1ZONA 2ZSAA 3CKLA 4G0XA 2XXAB 1F9EA 1Z5OA 1ZI6A 2FGKA 3AWDA 3IMEA 4LF9B 1OXXK 2PX0A 2PJUA 1MJ5A 1AJEA 4CZ2A 4MMYB 1M2VB 1UKZA 5K8CA 4AS3A 3JYPA 1WD5A 4DLBA 4GKKB 2OKGA 5D3ZA 3MGBA 1RXCA 1YRHA 2A86A 4BOYA 2DKOA 3FTQA 4FYJA 3B6IA 1XD8A 2H31A 1JE0A 5G1NA 2HY7A 4ALIA 1XZAA 1IQUA 5G0UA 3KZVA 5H02A 4E88A 1Y37A 3RS8A 5C8YF 1N1DA 5LOVF 3OJLA 3GAAA 3OQVA 3PYXA 5TQ0B 3DPIA 3PC8C 4J1QA 1Q22A 2N0SA 2VJQA 1NLFA 3FZNA 2MU1A 3O3MB 1KK0A 3WWYA 5HKKD 4Y2RA 1WCIB 2CHVA 1R3UA 3D8UA 4PGAA 2ZIAA 3HUEA 3ZJTA 2J0UA 1C8LA 4MVCA 3M82A 3QVLA 4UTOA 5F9FA 4LMRA 2VZLA 4DNXA 1MOSA 4JITA 1K7XB 1FC0A 4C0SA 3GEHA 1YMQA 2V7EA 3EIHA 3OWXA 4GEKA 4OH7A 5EMJA 2WJYA 1A5ZA 2WT4A 4CMHA 3SSOA 1Z62A 1KR2A 2FZEA 4JVMA 3TDKA 1FMCA 4XGRA 5HKBA 3KQUA 5AW3A 1QKJA 1WLSA 1X3SA 5JAOA 1UQTA 3HSYA 4ILKA 1MTZA 3AVPA 3NANA 2HDNB 1RRMA 3G68A 4D41A 5IULC 1G8FA 3G17A 4QATA 1W1IA 3O93A 2NP7A 1Q0ZA 2B2XA 1TD9A 3GMSA 4FI3C 4YXWA 3BQNB 5AESA 4PG7A 3R5FA 1H2FA 4MGZR 3TZEA 3CUYA 4CNQA 1HYGA 4TT3A 3AR3A 4IQGA 4NEQA 3U5ZB 3OCWA 4V0LA 3TG2A 3R1IA 3PIRA 4DBLC 1UKAA 3UAYA 4IINA 1RBMA 2VWPA 3LA6A 4KWCA 4NZMA 5ALOA 3ZCXA 2ERCA 1WDWB 1N6IA 2AJCA 1U8AA 2J30A 4L8LA 3TJRA 4EHIA 1RIIA 1AO3A 1I01A 1OZGA 2PMCA 3HNRA 2SHKA 1ZHOA 3TR6A 3IESA 4EZIA 3A4NA 4BLRA 3WS7A 2O20A 5C80A 5ALUA 3BFPA 1LK5A 3QV1A 1TF7A 5GVRA 1ZYUA 1EGQA 1TLTA 3T35A 4BJ1A 3EVZA 4MWEA 1BEUB 3GRAA 3GPIA 3JQ6A 1UAAA 3VJRA 5K8UA 4DV0B 4EIWA 2VRCA 2QR5A 3KBBA 1KAQA 2CL6X 1H5UA 2ZSFA 4GI7A 4RCVA 5JSKA 2K7FA 3RKSA 5JBIA 1P3DA 1GUDA 2J0EA 4YCAA 3R3JA 4QXAA 4ML3A 3PCXA 2XUDA 1UQUA 2WT9A 4GNRA 3N2GA 1AX9A 3VYWA 4DN6A 1Z6ZA 4P3PA 1FX1A 2YJ6A 4U02A 1Y9JA 2HHCA 4HSGA 4N0PA 4ZYXA 1W0CA 4YRGA 1BCRB 3LHSA 1Z3CA 5K3SA 1YL5A 3SYTA 1ZUWA 5T6MA 2PYIA 1V48A 1M1NB 2QT0A 2Z58A 3RRZA 2WSSA 4IMJB 1H93A 2ONCA 1I8TA 2CL5A 2G0NA 3VKVA 3ITNA 4LDRA 2P6OA 4Q4AB 4K86A 1OBVA 2I76A 3CWZA 5EA2A 5A6SB 2X7JA 1UKYA 2GCOB 2CYAA 4OK5A 2DLNA 4B45A 4Q02A 4QDKA 4WBSA 3VNUA 2QK4A 4LVOA 2BKUA 3P9ZA 5TDHA 1JRLA 3GLIE 2IPAB 4JIMA 5EJ2A 1AA6A 3G23A 1EGAA 3KKKA 2R00A 4IZOA 4OH1A 1E8MA 4UTNA 4GX5A 4OU4A 1U5CA 4FR2A 2WNIA 3E27A 5T4FA 2MMGA 2OL4A 1EZ4A 2DEUA 2PKEA 5I7EA 1FRNA 2OXEA 2J0QA 3KD3A 3RYIA 3I2HA 1Y3BE 4LVNA 4HTFA 4CG0A 1US8B 3AC0A 1K3UB 3HB4X 3ONFA 3TD2A 3IDSA 1TVCA 4AYWA 1WNFA 5LVAA 3LLCA 4N9WA 1A4UA 3AUFA 5EIAA 2A1TR 3WIVA 2VDMB 2AVDA 4CKCB 3U7FB 2ZROA 3LLMA 4KO2S 3IDQA 4N6GA 4ZDWA 1DC4A 1FP7A 2J31A 5IXSA 3IVCA 3RYHA 1ZX1A 1HOXA 4AZTA 3MCZA 3L7KA 3PNSA 3WGKA 4BWVA 3R23A 4H1WA 2X19A 4C22A 4RKYA 4TS4A 4UHKA 1U2RA 1L5HA 3Q1KA 2WVHA 1VLQA 2JCBA 2EKBA 3G2NA 4G5QA 4AAYA 5JBQA 3HJUA 3AUYA 1VSQA 2ZIVB 3L8DA 4J0GA 2ZUVA 4P5EA 1G0NA 4JLOA 3G0DA 4YQZA 4DPMA 3NHRA 1E9RA 4ZVOA 3MBIA 3CX4A 3SI7A 3IXQA 1KWKA 3I0NA 3MWKA 3ONVA 2GAIA 3PC3A 1AMNA 1Y1RA 1LB1B 3Q7PA 4L0QA 3LHKA 4BNDA 2P4SA 4EG4A 4IIVA 1I1QB 4QUHA 2IOHA 2V5VA 4C4TA 5SZJA 4IZIA 3MERA 1F3OA 3OJFA 13PKA 3E9ZA 4M0KA 4MKZA 4CN9A 3KR9A 1XZCA 3O8CA 1DRJA 2H1WA 2P7IA 4JT4A 1GUYA 3QBVA 4P83A 3C3BA 4XCQA 3LU1A 4FGWA 2FZVA 1UP4A 2F3RA 3FPKA 3I4CA 1MW9X 3MQFA 4CETA 4FD2A 2WHPA 1T6YA 3SEZA 4EYKA 5KTMA 1EK1A 3GLIB 1U8UA 3A14A 3EODA 4UUPA 3AU9A 3LT4A 5DM70 4P4SB 1Q1GA 3ROFA 2IXGA 3NTVA 1W2WB 4EJFA 2IUYA 3ZU5A 5KQMA 1NRIA 3FNEA 4MRNA 4NFHA 5K6RA 3DKPA 3OQBA 3OMLA 4P2GA 2N75A 4GBGA 3REGA 2AG6A 3FPHA 3LTEA 3JU3A 1DRWA 2OHJA 4IOJA 3D6TB 5E2BA 4DZZA 5LWQA 1UXJA 1ARZA 2BMAA 3C16C 3CT6A 3DT6A 3L1HA 1NMYA 1W2GA 2CXPA 3Q9LA 5FKJA 5AXBA 5C8DA 5K2MA 4ZVUA 4LV8B 4D9HA 3DDWA 1ITZA 1FFHA 1VKOA 3AR6A 4M0DA 4URZR 4CR6A 5E0OA 3ZQJA 4CEHA 5DM1A 3U4QB 1ULTA 5IDWA 2X0RA 1A9RA 1W59A 1XAHA 2J85A 3OH8A 5CLGA 3DDCA 5B58T 4Q7EA 5A02A 4GI5A 1A2BA 3HL4A 4PAGA 1MAUA 4LYEA 4QHTA 3HB7A 4XKJA 5F2KA 1SVLA 2GEBA 5T8KC 3LPLA 1EQUA 2CVFA 4YMWA 4AUEA 3HP1A 2ZRMA 2UU9B 2JHCA 1EVZA 1X92A 1IWOA 2CFCA 2R6FA 4U2KA 4U1RA 4QG3A 1OAOC 3M3DA 1E5LA 4UXIA 5IJ9A 1PHRA 1EJ2A 2FPGA 3WL6A 1P2VA 2R68A 4BKRA 3HWSA 3QM1A 1Y7LA 1J56A 1TQ8A 4YQYA 4H27A 3HS3A 4Q01A 2JAQA 1GDDA 1PYDA 1QV7A 2JLAA 3AV0B 4MH0R 4MITA 2IUEA 1JEDA 4W8OA 4D9JA 5KOJA 1B74A 3SCZA 3OHSX 4LJAA 2XNJA 2DZDA 1B6RA 7ADHA 3INRA 1RJDA 3WLIA 3HCNA 5EVJA 2ZETA 3F9CA 1D4OA 1LY1A 4J29A 3T4UA 4MCAA 5FUMA 4XOIA 4YVFA 5FYQA 2EEZA 3KSBC 1MHTA 1E2HA 4ILEA 3OKFA 1TM2A 3HSKA 3PRYA 4UM8B 5GOZA 4AY6A 3MD0A 3GLFA 1RI1A 3I8XA 3JVDA 1USVA 3GUCA 4OJNA 2VT2A 4RHEA 4UU1A 1Q0QA 3DMFA 1AB5A 1QIHA 2DQYA 2Q3BA 5KDDA 2KW5A 3ZCSA 3K1TA 1HZZC 2HXYA 2FR8A 2NSHA 4WFIA 3ET4A 1NJGA 3LWNA 4MYRA 2GXAA 2WF5A 3RTAA 3UWKA 2RDMA 1R9NA 3AHHA 1NBME 4FBGA 3X1DA 1XKTA 3H97A 4TWBA 4POOA 1KTIA 4V3CA 3WMGA 3BYZA 1ZMRA 4D98A 5FH9A 1NW6A 3UV7A 4YRNA 2YFYA 4ZXFA 1KU6A 3LDFA 4PXSA 1ZJJA 1KPIA 4ND4A 1M6VA 2YKGA 1PJ8A 4HWSA 1GG9A 1ODJA 1NX6A 4MICA 5JMOA 3ZDBA 3CEMA 5CA1B 4ARIA 1DQZA 3OIFA 4D9GA 4M99A 4E22A 2JKYA 3N8NA 2CD7A 1P7YA 1HSOA 1R15A 2IKSA 1UAYA 3AL2A 1BHJA 5U1PA 3STTA 5IJZA 1E4VA 3IODA 3V4ZA 1HYHA 3D2AA 4YB8A 1L8LA 4N47A 1LSSA 2XB8A 2ZJZA 2F4NA 3BORA 5IPFA 3D6UA 4OLHA 4L57A 1M34E 3DZIA 3A25A 1Z6YA 3CUSA 4E5NA 3ZV5A 4DDKA 2H4XA 2GWHA 1OXBB 3C6XA 4BQIA 4B3DA 2Z04A 3NTUA 1TIBA 2PEZA 1YVPA 3N2YA 3I5YA 1GSOA 3THWA 5JJLA 4R2JA 3MCUA 5K0GA 3R6LA 4YPVA 5DWVA 4RKWA 4YYZA 5LDHA 1Z4NA 1J42A 3H9QA 2CNBA 1JXAA 4LVUA 1HZJA 4NKRA 4KMMA 2AKEA 2DFTA 4M2LA 1W9HA 1OV4A 3IMFA 2A3NA 2D2VA 3CISA 1HQDA 4MW9A 5F5XA 5K45A 1C2YA 3TUZC 5CYPA 4PWZA 1WMDA 3DGEC 5JZOA 4HWPA 1XN4A 1PD1A 3IOEA 3ZLVA 3UMGA 1YV9A 1YCFA 2YS6A 1GO2A 3TUIC 2QS9A 3EMBA 1P33A 1VSVA 2EIXA 2OFOA 3EAFA 4EDHA 1WVGA 4XQCA 1SB9A 2YS7A 2R44A 5E1BA 1QP7A 3TQSA 3EA0A 1FVOA 2ODPA 2G6BA 3QFCA 4P35A 3KQNA 2X41A 3OMWA 4JA2A 1AXGA 4JYCA 2GCPA 4N9QA 4WBNA 5CBPA 5FNVF 4YXFA 2XNHA 3O83A 2UZ3A 1PDVA 1Z2NX 1IUNA 5AYVA 2UZ4A 2H16A 4BGDA 1TMKA 3HKEA 4Q4AA 2V9ZA 1NF3A 1NOJA 2J9XB 1Y6FA 1SOAA 3KUKA 3S2YA 2A4MA 1NJ2A 4JVOA 4R1NA 3IERA 1J0AA 5EJ4A 4QLOA 3PHJA 2WIBA 4KL8S 1W94A 4PXAA 1A96A 4ESEA 3FPBA 1QKKA 4BXOA 1QS0A 1A9PA 3IIIA 4PG5A 1BCRA 4EG6A 1KQFA 1WZ2A 2G36A 5A62A 2HXSA 1SC1A 1WTCA 1DPFA 4J7AA 3X2EA 3OUTA 1H2EA 3CWCA 3B9BA 2ZB7A 1QM5A 2EBWA 1FNNA 2XXJA 3DXZA 3IBTA 5FL7A 2V65A 4XARA 3SF0A 3AVVA 3EXFA 1SK9A 4LISA 4LWOA 2IIQA 4B6RA 1HFWA 2VH2A 2WUGA 7REQA 5KQLA 2AB0A 4L5BA 2BMJA 3Q9UA 1RHJA 2VDLB 2Z30A 3PRJA 5H1YA 2YV1A 4MV6A 4OAQA 3WK6A 3OU7A 5ERXA 3GLIA 2P5UA 1X8KA 3NGLA 3G6KA 4D92A 3L1JA 3S70A 4N48A 2DHDA 3F7TA 2IP2A 4FFSA 5F9HA 5BWNA 1EESA 1QANA 3NG1A 4DV5B 5HM6A 2VF4X 1OI7A 2GPYA 5CDFA 1XF9A 5JD3A 3RS2A 3IEXA 3H5TA 3VHQA 4JJ6A 3LFTA 5JPIA 3H8VA 3H9UA 1I6WA 4JDUA 1R0BA 3F90A 1JFFA 2XA2A 3K5PA 4YALA 5C34B 3RVDA 1QP0A 1KZ6A 4D4LA 5BW5A 1NSFA 3RIYA 1KFBB 1BJRE 2O52A 3WJ1A 2BTEA 2YDXA 5KSZA 1MRZA 3C1TA 3SS7X 1JYEA 5ICGA 3RS3A 3LHDA 1JKIA 1KP2A 1OFUX 1WHTB 3U7IA 3VHLB 1M9NA 3PGVA 4R71A 4AKHA 4BFUA 4ER7A 5U4QA 4F11A 3S2SA 4Z7QB 2XCSB 2BW0A 4KDEA 3W6PA 2O3JA 3ESQA 2GN4A 1GNLA 4DQUA 5DMXA 5T67A 1CR1A 4HNRA 4M0UA 3MUOA 4US0R 1BFUA 1JHZA 3CR7A 4JP1A 3VDMA 6ADHA 5ADHA 3LHIA 4BFYA 1C1DA 1RLUA 2FWMX 1LF0A 2ZT5A 4JMPA 3B12A 4OB8A 5JS1A 2X0EA 1QGOA 1QONA 4H1UA 1UBNA 3WZMA 4JGGA 3PJRA 1ZJWA 1XNRB 4BKMA 4KYVA 3ZCQA 3OD1A 3FNQA 1ZL2A 3SFZA 1SKYE 3TUJC 2VH5R 4HDRB 3KCNA 2C83A 4CM4A 1WKVA 3BE6A 4DKJA 1OLUA 1XEXB 3H9CA 3ILSA 4GE0A 2XW6A 4DG8A 4EA8A 5TLSA 4U2BA 821PA 3U56A 2OE2A 3WGZA 3TLEA 1GZ3A 1YQTA 2M32A 2XWPA 5MGNA 4JQCA 5AVRA 1AXEA 2GBGA 1YE8A 3O8NA 2A0FA 4F4DA 1UCFA 3ZE6A 1UPXA 4Q1DA 2CK3A 3LVQE 4JENA 2IDJA 5KYWB 1IEQA 1CHDA 1WHTA 3JRXA 4D43A 1BXZA 1I3LA 1X2BA 1EG7A 2AX3A 2P5SA 2QUHA 2XGMA 5EKTA 2QI9C 1OYVA 3P0HA 2TMGA 4UCWA 4XA8A 2ZLBA 1G21A 4AY2A 3C6KA 3RS5A 3TOSA 4EPYA 2BFEA 2PKQP 2WF7A 1HEYA 3CV3A 3IV6A 5AM3A 3R44A 3WTBA 4A15A 1P1RA 5BP7A 4TSFD 2VCEA 4RJJA 2FE4A 4A8JB 4KMOA 4JR0A 1QBKC 5KOHB 2IEGA 2YINC 5AIBA 4P2BA 1DO0A 4MK4A 5BN1A 2D2XA 2YXNA 1THZA 1MG5A 3JQ7A 4ZVKA 1LSUA 1U0TA 2Q6LA 2WU3A 1K0FA 3GPDG 3EHDA 4KXNA 4C0BA 4AX4A 1VPWA 5JPCA 1OIXA 4ARVA 1DOAA 5CJJA 1QVRA 1XZFA 3AKEA 1LGYA 4N54A 4QUDA 1ODKA 1QOPB 4Q3OA 2PMEA 4TTPA 5A1TA 2NVOA 3JQEA 2XT6A 4TV8F 5CT4A 3U1TA 3W5HA 1R5NA 2EQBA 1J06A 3GHHA 4PX3A 3VZPA 1NAIA 4JLBA 4DRYA 5G40A 1BD3A 1DBWA 1G8MA 1T5TA 2RAVA 2Z5VA 2RGGA 2CW5A 1V5FA 2QP3A 3B6MA 2YQZA 3EWIA 4L73A 1S2GA 4P08A 1SIUA 5IKOA 2ZCJA 1SHJA 1IONA 4WESA 3TW8B 4HGNA 4DCVA 5I9BA 3UKJA 4DLZA 4BQQA 1R88A 3GLFE 2LBPA 2E37A 4G65A 4KLZA 1VSUA 1LDMA 2AG1A 2V55B 2G4LA 2JGIA 3T3EA 2IRWA 1D0VA 2VPZA 1U4SA 4MUXA 3UMSA 1GKKA 4X3PA 1AZLA 2HWWA 2A1IA 1GR0A 1TM7E 5F1KA 1GPNA 1KVUA 2DFVA 3E4CA 1WXXA 1QH8B 2O2EA 3BJZA 4KQHA 4A8TA 1XCBA 3SJAA 5LBIA 1Y8AA 1EVIA 2V4MA 3OHPA 1PVVA 1QHFA 3EXHB 1OCEA 3H18A 4DLYA 3QXCA 4U2GA 3P9NA 1BHO1 4CTMA 3SJ7A 3VH1A 2NUPB 1GU7A 2J0UB 4CF3A 1G5FA 4O2AF 4QU9A 3DMHA 1V7ZA 1YVUA 1LLQA 2CXSA 1LQUA 1UK7A 2C8KA 3MF4A 2CZCA 4YGXB 3AUSA 1VDMA 1DVRA 2AR0A 4K6GA 5TQ0A 4ABYA 4ZO8A 1XJ5A 5EWMB 4E7PA 4WIAA 1Q0PA 3PE6A 2B1RA 3TN7A 2AUMA 2XE7A 3GFVA 4O08A 4OBEA 2ZSJA 4OMCA 1CJBA 8ATCA 3D8NA 3BH6A 2C7GA 2FETA 3F71A 1TJYA 3QF4A 4Q03A 2C31A 3Q0IA 3WHKA 4IHJF 4B75A 4MV5A 1XTIA 4BN5A 2ZBQA 1G41A 1TUEA 5EP2A 1QQ5A 1AQYA 3I8SA 2HNBA 1R3DA 2ASEA 3L6RA 3OMXA 1M34A 4I8XA 1SVSA 4XDHA 1UBGA 4PTLA 3AW9A 3QP9A 1OAKA 4R3NA 5C51B 1GNPA 3AX6A 1JKJB 2J9YB 3DLCA 1NQWA 4N0MA 3DHNA 1TEXA 2YHAA 4EGCB 3HDYA 5CNIA 3WGHA 1M1XB 1AK1A 2GESA 4B71A 1ZC3A 2HT6A 1BE6A 2MINB 4PZEA 2QX6A 3V34A 3GMIA 1SB8A 5FOUA 1FRFS 3GF4A 1U8TA 5SY6A 1O6BA 1VPDA 2VP6A 1RWBA 4XM2A 4EKGA 1WA5A 4XVQA 2DMRA 1GADO 1MABB 1OPXA 2HU2A 3Q6MA 4WY8A 4OLBA 3QLUA 4X5OA 2XWQA 2ZYUX 1MMFB 5ALNA 2RIRA 3S2GA 1YOVA 3I2KA 2J5RA 3D1VA 5CFMA 1YBMA 1F0YA 5C5IA 1XVIA 2A9FA 5LB2A 4B3RB 1OW3B 3LQRA 4NCKA 4XD7A 3SBEA 3FMVA 4R51A 2B9VA 2RGCA 3KUUA 1NRJB 1SU4A 1HUQA 1XA0A 2Y1WA 4ZT2A 4EL0A 5J2UB 1P7ZA 4B4WA 3SPXA 5KJEA 2J32A 3G2QA 2B2CA 3KRTA 3AFMA 1QO7A 2HTEA 3PICA 4L3OA 4QDUA 1VB5A 2QMHA 3OZGA 5IBPA 4BV3A 2JFWA 1HT3A 4ZICA 3CLSC 2QQGA 1JHVA 2AD5A 3NWBA 5GZ6A 3UCFA 1FYFA 1EFPA 4C4RA 1FSZA 3PBKA 3PXUA 3SKVA 3ZR4B 3ANXA 4EVIA 1EUCB 3R9WA 4UQLA 2V0NA 5COBA 3EPPA 4KXFB 1NXPA 3S27A 4Z7NB 5HJ2A 4Y6RA 3GUZA 2L82A 1E6WA 1KQGA 3C4QA 3PHLA 3ZCTA 3AESB 4RJIA 1NU6A 2QX4A 3IQXA 4EVQA 5JWRA 4XLZA 3ZH9B 2EKLA 1V3QE 3LA8A 1QZ3A 2AQIA 5AVVA 5H83A 4I55A 1V1MA 3DFMA 2DU8A 2D5IA 4KYTA 5BRNA 5FUQA 2PL1A 2YJTD 4G8BA 1Z6PA 3F3YA 3FYDA 3H5RA 1FYXA 4YLEA 1GG2A 3IOYA 2W2OA 4PPQA 3AR5A 4PONA 3FYHA 3LQQA 3R8XA 1N2GA 5EE5B 1LK7A 4WVLA 1RAFA 3VR2A 1XZBA 1SUWA 2EFJA 1IOVA 2L17A 2C9MA 5C8YA 1W36C 3KNZA 5CLLA 3ZHOA 1WMEA 3R5TA 3MINB 4Z3OA 3MILA 2NPOA 3FTDA 4HEA1 5DM60 1H94A 2JZOA 4FYXA 2FCRA 1Z5PA 3GRFA 4GZ6A 5H59A 3USZA 3ZNPA 2I7TA 4NNJA 1RRGA 2JASA 4V0SA 1RJ9A 1R9MA 1FRZA 4GMGA 5F1PA 3BCSA 4KPUA 3C97A 5HVNA 2PFSA 2JIMA 3MJ4A 4GBMA 1ETHA 2FPIA 2AI2A 3U16A 1M10A 3IEIA 2A1UB 4XGNA 2LIVA 4YR7A 4PVCA 4P80A 4CEIA 1MOPA 2X9VA 3HFJA 3KFLA 4CR7A 4X71A 1Z74A 3TGWA 1IPHA 1CF9A 1T6NA 1M66A 4DCUA 4EQ6B 4DMMA 4CCYB 2C0CA 4CM6A 1RPZA 1SD2A 1ZXLA 4IM7A 3RBVA 2UZAA 1L6RA 1G66A 1SH7A 1YUMA 1WSWA 3BHMA 3NOXA 4LI3X 1JPJA 4NS1A 4V24A 1JIQA 1BVRA 1WR8A 2XRMA 4GO1A 1XNQB 1F4LA 3D7KA 3BIWA 2O19A 4DV2B 2JANA 3ZHTA 1RYYA 2PIAA 3BDIA 5G4KB 1TKCA 1XZQA 2QE7D 2W6ZA 2DBVO 2ZDQA 5C5CA 1DAMA 2VP2A 1T3SA 1PNQA 2I87A 3KWLA 2IIVA 3WNZA 2IZ7A 1WMSA 1T1GA 1BWSA 3MG9A 3ZEIA 2ZZKA 2OD9A 2GARA 3KHTA 4CODB 1J8DA 1G3QA 2VNJA 3ACDA 3K09A 4LYYA 4N4AA 2AXQA 3B3GA 2IEZA 4V0KA 5AK3A 5JH7F 2HMWA 3LC7O 1OTYA 2RBGA 3KOUA 2EGGA 4FYYA 3RC9A 2BJHA 4V03A 1FMLA 5SV2A 5L3QB 5KNCA 4Q1VA 3WLNA 3KKLA 3HDTA 1YNOA 2NACA 4YJGA 3FDFA 2Y0CA 4XE5A 1NUSA 4P32A 1D1TA 2QTRA 2AMYA 4PPNA 5LZ4A 2QD4A 4G1UC 3CMMA 3RVPA 3LL4A 5KYVA 4DDTA 4HHEA 2OP1A 3AJAA 5DGCA 4ZJPA 1K6IA 2YWXA 1IC6A 1KZYC 2JZN