3ZHOA

X-ray structure of e.coli wrba in complex with fmn at 1.2 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
b'AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVOPROTEIN WRBA
publication title 1.2 A Resolution Crystal Structure of Escherichia Coli Wrba Holoprotein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zhoA00
1V4BA 1AKWA 1H69A 1FLDA 5F51A 3U7RA 1SQSA 1QBGA 2Q62A 1OBOA 4R81A 3B6KA 1D4AA 2FLVA 3W78A 3W77A 1TLLA 1CZLA 2AMJA 3K20A 1CZUA 3SVLA 1AKRA 3G5MA 1AKTA 2WC1A 6NULA 4ZVNA 2ZKIA 1TIKA 1AMOA 4N9QA 5F12A 3ESXA 1XYVA 3F6SA 1D04A 1RLJA 4LA4A 3KAQA 2M6RA 1FLAA 1WSWA 3OWXA 1SG0A 3TE7A 1YDGA 5TGZA 1JA1A 2X2PA 2HNBA 3FJOA 3ES9A 3OX3A 2F1OA 1XT6A 4D02A 4F8YA 4J8PA 4CF6A 3JSXA 5JROA 2FOXA 2Z9BA 4FX2A 3OX2A 2FVXA 1AZLA 4BMOB 1YCFA 3P0RA 2GSWA 2BMVA 4NULA 3R6WA 3K1YA 4YAFA 1FTGA 2Z98A 3OJWA 2D5IA 3F90A 2Q9UA 3L9XA 1VMEA 5ULLA 3N39C 1YRHA 1QRDA 3LCMA 2BN4A 4QOHA 3NHRA 3EDOA 2W5UA 4N82A 2QX8A 4PU0A 2MOKA 3NHJA 2X2OA 5FUQA 4NLLA 5LVAA 1I1OA 4LTMA 3HA2A 3GAMA 4FGLA 1AKUA 2OHHA 4FGKA 1BVYF 4U7HA 3KAPA 2QMZA 2B3DA 2KLBA 4H2DA 3U7IA 1T0IA 4QOGA 1QR2A 3O2NA 4FGJA 3D7NA 4GQIA 3L9WA 5EAIA 5LLDA 5B3KA 1CZNA 4XDHA 3W7AA 4LTNA 4QOJA 5FA6A 1J9ZA 1AKQA 1YCGA 3NLLA 1C7FA 3LT5A 2KQUA 1CZHA 1YKGA 4LAFA 1FLVA 4OXXA 2FZVA 1XI2A 1DXOA 4M0CA 1YOBA 1AG9A 4C14A 4YAUA 3TEMA 4ESEA 4PTZA 4DY4A 1FX1A 3GFSA 1RTTA 1FUEA 3B6JA 1J8QA 1H66A 2QX9A 3KLBA 5NLLA 2ARKA 3NHPA 1OBVA 3B6MA 4C0XA 1FVXA 1ZWLA 1C7EA 4HS4A 2BF4A 5LMCA 2QX4A 1RCFA 2FCRA 3GFRA 1CZKA 1DX9A 1QHEA 5EA2A 3OVMA 1CZRA 1NNI1 2FZ5A 3TZBA 3GFQA 1X77A 3OWHA 2MWMA 3NHYA 4PTYA 1T5BA 3B6IA 2OHIA 2QWXA 4C0WA 4ZVKA 3ESYA 1DXQA 1YCHA 2FDXA 2FX2A 2R97A 1J9GA 3QE2A 2Z9DA 4C76A 4YAWA 4GI5A 3N3AC 5B3LA 4ICIA 2HNAA 3ESZA 3F6RA 1KBOA 4DIKA 5A4KA 3ZHOA 2XODA 4QOFA 1WSBA 1GG5A 4QODA 5F4BA 2BZSA 2R96A 3UXEA 1JA0A 2FAXA 3HR4A 2OHJA 5FX2A 2RG1A 3NHLA 3FW1A 5LBTA 4XDGA 5LJLA 3KEGA 3HLYA 2V9CA 5LJIA 4N65A 2M6SA 2Z9CA 4QOIA 5EMNA 1D03A 1AHNA 1OFVA 4QOEA 4YAOA 1E5DA 3NFRA 1FLNA 2OYSA 2MTBA 3O73A 4Y9UA 2QMYA 3FVWA 3EYWA 3N3BC 1AKVA 2MT9A 3RPEA 4ZVLA 4CETA 2XOEA 4GR9A 1F4PA 1XYYA 2V5UA 3OJXA 4ZVMA 4BMPB 4DILA 2BPOA 3NHKA 4YALA 3NHWA 4S24A 3OX1A 1BU5A 3W79A 1RLIA 2V5VA 5LBUA 3QFRA 1ZWKA 2QX6A 3FNIA 4Y7CA 2QR2A 4YQEA 2A5LA 4H6PA 1ZX1A 3QFCA 1CZOA 3FX2A 4HEQA 1B1CA 3NHUA 4LTDA 5BUCA 4Y9RA 3UXHA 3NHFA 3F2VA 4U7GA 2HPVA 5NULA 3NHSA 4U7FA 1J9EA 1KBQA 3S2YA 2N1MA
chains in the Genus database with same CATH superfamily
2KB0A 4N5LA 3WXBA 1Q6ZA 2AQ8A 3V4PB 2OESA 3TTUA 2CGEA 3USES 3RI3A 3SR0A 1SQSA 4UPVA 2R7AA 2WDPA 3U7RA 4XARA 5HBRA 5B53A 3VC1A 1OZHA 1HT2E 2D3TA 2O8FA 3AF2A 3IAFA 5AHOA 2QPAA 4DG9A 4B3RB 3B38A 4RGBA 3S0JA 1X2BA 2WSYB 3OCYA 3FOFC 3CRNA 3C6QA 1ZNQO 4QTXA 4W9NC 4NEGA 3VZPA 4E7OA 5BYAA 5DH9A 5JD4A 1Z0DA 3IPXA 2PX6A 1E9EA 3BD9A 4KQJA 1U2RA 5B3AA 3U13A 5HK8A 3GNTA 3NIBA 1G5PA 2QXUA 4JU9A 4ARAA 5LL6P 1U7OA 2V65A 8GPBA 1RCUA 5EEHA 2ID9A 5L3RA 3D7SA 2PANA 1W4CA 2C1EA 5DTJA 1JILA 4L8LA 3QXXA 1V26A 2IZOA 1V71A 1Z8FA 2C1XA 3OQBA 4ZQEA 1SVOA 3RWBA 2FF7A 1JVNA 3QQ5A 1U9IC 4DLLA 2HCJB 1DBWA 4OJKA 2WWVD 3VKWA 2X77A 4II2A 5LKRA 4AVYA 3L7YA 3RS2A 1NGSA 2GRAA 5FI5A 1XEXB 3B1ZA 4Z49A 4Q39A 2R68A 2NUTA 5BSFA 4WSOA 3H83A 3HPRA 3MJCA 1BVRA 4E14A 2ZUUA 2O3RA 2QTVB 3GP5A 2FSGA 1D8AA 3QPDA 4J16C 2VPWA 1Y37A 3OJCA 1YHNA 1G8FA 3PUYA 3IMFA 4HWRA 4WMLA 1B6SA 2I2BA 2NU8B 4BNMA 1S3IA 4MCHA 1P0QA 4BCBA 4KLNA 1VCMA 2VJNA 3U3JA 5J2TB 3DV2A 2Z6QA 3KJEA 3RBAA 1U94A 4R5MA 1G9TA 5CEFA 2I6FA 4RH3A 3UMCA 3P0HA 5B3JA 1M2HA 4MLCA 4YRTA 1FDIA 2B30A 2GZRA 2O8DA 1VBKA 4JQOA 5TE9A 4MAAA 1P7VA 2XVMA 3OIFA 4YRKA 3ZCUA 4BY9E 4BDSA 5GQSA 4IUYA 4H7KA 3L46A 4AX8A 2AE2A 1Z8DA 3WHPA 2YMMA 4KV7A 3GLFA 2IWHA 2H3HA 1Y8QA 3C6YA 2QV7A 1USGA 3NFYA 4ARBA 4KQIA 3ON5A 1YQXA 1EBFA 1JPNA 1PSDA 2HMSA 3LRTA 2FUG1 1Z0KA 1IWOA 2DSTA 4Z4QA 2VHYA 2ENUA 4ENWA 2BFEB 1AV7A 2WTMA 4GGMX 5BXQC 5K6TA 2SNIE 2FOXA 1ADYA 2I91A 3M83A 4N0PA 4YUVA 4HVCA 1XJQA 4JBWA 1FQOA 1JSZA 5LYYA 3SZ3A 2J7PA 3KJQA 2GQ0A 4GGOA 4TL6A 1T8YA 1AZLA 1M7GA 2FWRA 2YFQA 4BMOB 4ERNA 1EK1A 2WIGA 2HSZA 3GDHA 4N3CA 2HIAA 3UG7A 3P96A 3FOWA 4UHDA 3RYFB 1O95A 1M0WA 2HBRA 2ZQZA 3I04A 5JASA 2J3DA 4CDGA 1DJLA 3V4OA 5EJGA 1A4XA 4JB8A 1YE5A 3OZUA 3TZHA 2PE5A 1IZ9A 1FYVA 4KPFC 5BY2A 1XVIA 4RV5A 4TYQA 2M98A 1KVQA 1KY3A 4F6LA 1RXYA 3PQ3A 1O77A 4IOJA 1XRMA 2YWJA 5JZSA 2HUPA 4X63A 1KERA 2VBGA 1WJGA 4MUFA 2GKSA 2QMOA 2PH5A 3ZXSA 5HZMA 2C4WA 1QIHA 1RJDA 1ZH6A 2HK7A 3HY6A 2ZSJA 4YRDA 1E79D 3UHOA 1EWTA 4GKBA 4DWWA 5BR7A 1RWKA 1VL2A 3H4VA 5TPZA 3NIWA 4US2R 2GCOA 4HQLA 5CCXA 1QYCA 1AKNA 4DANA 2WAMA 1L7BA 2HA2A 4KE9A 2YMPA 4P7FA 3V00A 2YW9A 3U7GA 1EIWA 1AN9A 5AK3A 1V37A 3ABSB 3E7WA 1I2ZA 3QF4A 4HUQB 4D9FA 4DPLA 3AYXB 1IOZA 1XZGA 1YDHA 1YMQA 2B6NA 2QE7A 1YS6A 1EK0A 2WD7B 3AIKA 1Q7TA 2YV2A 3ETJA 2X7XA 4J1QA 2WHRA 5E6RA 1G66A 4UJ3A 3ZI4A 1Q1QA 4Q9JA 1K8ZB 3ZI7A 4L8YA 2ZYIA 1QYRA 3D9QX 3KYBA 4G5QA 4HI0E 4WADA 2E4XA 2Z8XA 1YS4A 1Y7PA 1OC2A 1W9HA 3CT6A 1BKSB 1WZCA 4HJRA 3EY4A 4XQEA 3O83A 2ZRFA 1V35A 1UWLA 1M33A 2ROQA 3D0KA 1S2DA 3FN4A 1M73E 1UEIA 4EJSB 1EFPA 1GZ4A 5GP1A 1TYEB 3CF4G 4DR6B 4ZXPA 3UWDA 3NDBB 1MABB 1VIYA 2HDOA 1E2EA 1BMFD 1E5QA 1NVFA 2J45A 3DHWC 3Q72A 4PX9A 4BTEA 1VIAA 4RM3A 3AW9A 2EC5A 2E1PA 2VSXA 3AJ9A 1ND6A 4U6SA 1BFDA 1QBKC 4GW3A 4Y6PA 5LDDC 1V9CA 2JIRA 1WKBA 1EBBA 1LBHA 2JLBA 1NUHA 2NXCA 4HSEA 2VWGA 4MRAA 4TQGA 4YFVA 3U1VA 3VBCA 3VUFA 4D3ZA 5LQKA 2G1PA 1TI7A 2Q7DA 1B76A 3M4ZA 3UGJA 1BE6A 3K2EA 1QFXA 4GX0A 3JALB 1KMNA 1PT6A 1FXWA 2P6MA 3OZRA 3T3HA 1R4NB 5BSWA 2QSZA 3IE0A 1XMQB 5J40A 3EQZA 16PKA 3IIKA 4JZKA 5E2IA 4GQIA 3HFSA 4AT1A 1D7AA 4B83A 5KB3A 1DX4A 3SS7X 5LP6B 1FIUA 1CKEA 4HB3A 3GFOA 2I03A 1T3HA 3SFVA 1UMBB 3WHLA 5AVRA 4ZD6A 1Y1QA 3BZBA 1IZYA 1E2FA 2AEEA 3UV7A 4Q05A 2CL0X 2NN3C 2P27A 1O7JA 3KYCB 2J6CA 1KVUA 5EOVA 2C98A 4C7OA 4QU8A 4YP1A 1ZXBA 2DQZA 3QKRB 4C20A 4FFLA 1QZUA 1VJ0A 1T0UA 3IFSA 3NJ8A 2P11A 3DHVA 5J59A 5T3YA 4BAZA 4M88A 3F8WA 1FNMA 4OA8A 2HCRA 4M2LA 1UANA 2X23A 5JD3A 5I9NA 1OI7A 1EIZA 1U7HA 3NLLA 1M75A 1QU2A 4L6IA 5DIFA 4QLBA 2V7BA 2VWQA 2JA1A 4L5CA 3ECAA 3K94A 1IQPA 3QUCA 1E7SA 1G2PA 4RCYA 1C8VB 4Q3KA 3KQKA 5EFOA 3GRYA 3UPUA 2PQ6A 4PRKA 2OCYC 4QGBA 1MJGM 2HIGA 3HB5X 3M33A 1LU9A 1ZMRA 1Z34A 3FFBA 4I4IA 1F8GA 1P74A 1T5HX 1UK9A 4R41A 3L7MA 3KSMA 5COBA 1Y1LA 4GX1A 4X20A 1ZZEA 1ISHA 3L0SA 1V2GA 1B3RA 3V48A 2WWFA 2Q28A 4CT5A 5CFOA 2EW8A 4KMMA 3VR4D 1O5OA 1VZ2A 5HK9A 3CY6A 3WIUA 4EABA 4FB4A 3B5JA 1R00A 5IT5A 1W36C 1G60A 4MWBA 4EI8A 5CAEB 5A4JA 5C1PA 5HCIA 4WK4B 1L7PA 1TC1A 3KXIA 2WG1A 4RQBA 4KREA 4CQMA 1CUXA 2VYFA 4E94A 3QNMA 3KWFA 3O47A 5CT4A 2ZVJA 2VTBA 3VKVA 2XYHA 2BFCB 3UTDA 3A31A 2HMTA 5JNRA 2P6RA 5ALRA 3O8BA 1XWIA 1Q0UA 1SCKA 1Z45A 3A37A 3FGOA 1E99A 4RWZA 4XZ3A 2AK3A 4JSYA 4UZSA 1J0DA 1Y8RA 4BKQA 3AUAA 3SBXA 2IX3A 3K6SB 2I5PO 1N34B 4AZSA 3JARB 1UK8A 1H2YA 2QX9A 5JJBA 3VR6A 3JAKA 2ARKA 1PAUA 1YVUA 3KVRA 2WJJA 4C4RA 2NZJA 1PQPA 1G21E 1NQ5A 2XAUA 1NMZA 3E8MA 4EEZA 1JU3A 1JAHA 3H2SA 1LH0A 1RS0A 1ZVJA 3V1NA 3TAUA 3ZJ4A 2C97A 3GJ0A 2XDQA 4L9SA 4FYVA 1JTVA 4DV5B 4N48A 4M0EA 2XZLA 3LI2A 4FJ1A 1VRCA 4TGLA 3PUJA 1PG2A 1YZ3A 3L8HA 1EQ2A 5TMPA 3KSAC 1FDVA 3HXKA 4RD1A 2VTEA 3HYRA 3JZFA 4M1EA 3T9EA 1R15A 2A5YB 4INOA 4PRZA 4BRSA 3ER6A 3Q3IA 5HS4A 1Y82A 2WKPA 4GLFA 4TV8A 2ZE6A 3JYLA 2OQVA 4B44A 2ZQ5A 3GA0A 4OHCA 3WQRA 2C8KA 1JG6A 1N5LA 2QTZA 4TTAA 4UAUA 3STHA 1U8EA 1TMYA 1TPYA 1D07A 1IHDA 1U31A 1YJXA 3K0FB 2EYQA 5KNDH 2YMLA 4B6QA 1VJTA 2X5OA 1U02A 4XVUA 4JX8A 1SPBS 3TRHA 4K9OA 1FDOA 1JH8A 2EKZA 5BW8A 3UHAA 4ILKA 2O2SA 4CLOB 4BE9A 1CETA 2IEDA 2JFGA 5EERA 3OHMA 4Z4EA 1G3QA 1HUQA 2AOUA 1ZN9A 2YNMC 1CY1A 1PTJA 4PBRA 3L1HA 1SD2A 2PFGA 4XPIA 1F2VA 1EDZA 3MOIA 4OIMA 1VL0A 1CV2A 1JJFA 2IY7A 3GUCA 4JYCA 4IXNA 4FJ2A 1E5XA 1KBZA 2BISA 4PTYA 6LDHA 2H29A 4Q1EA 2HI0A 4DLPA 3WK9A 3LSTA 1OXMA 1V6AA 4O59O 5EC8A 3ABQB 3I4LA 2XPCA 1UCFA 4RHXA 3JQFA 3R3WA 3BD8A 4NY1A 4OHPA 5DTRA 1IQRA 5CITA 1TQ8A 3PE4A 1I3MA 4WKBA 1I8TA 1ZD2P 4I6GA 5TGTA 3OT1A 1HYGA 1PDOA 4HNRA 1FFYA 3U9SA 1RJFA 4Z9YA 3THRA 5KZMB 4WE3A 1JDUA 4IHQA 1DC3A 2HJRA 2YXLA 4K6HA 5B2ZA 4LJLA 1ABBA 4R8VA 2R97A 1J9GA 1UXGA 2Q8NA 5IAGA 3ZVLA 1VCIA 4EX6A 1KTVA 1Z4LA 2IYPA 1ZUD1 2GRUA 4EY5A 2ZYWX 1XN4A 3RAPR 1NVWQ 3RS8A 3RFVA 4ZICA 2AR0A 3UUFA 4RTMA 1QH1A 4OQNA 3RF7A 4BV9A 4Z51A 4ICIA 4ZRMA 3RK0A 2XQFA 3HFGA 5GAJA 3CVXA 1U5AA 1XCJA 4TL7A 4KK3A 4CKXA 4EENA 3X2EA 2GTIA 5TB5A 5K4HA 3EZ9A 2AJTA 2QTTA 3LNTA 4EVQA 1LLCA 6AT1A 4HL6A 1JHAA 4PFQA 4RIEA 2BBWA 1V9LA 4AJEA 3E82A 1MPTA 3SN6A 2YOFA 4C3OB 4F2HA 2BZSA 4ZVTA 3BJRA 5C52B 1XZCA 4F6RA 1JA0A 2G28A 2VK4A 3CN9A 1DHRA 4Z9AA 2GBLC 4W5JA 5I4BA 2EGUA 5IZ4A 3PITA 1ZA2A 1L3BA 2BM0A 2WUEA 1TUEA 3HKEB 1CFJA 1Y34E 2QUAA 1JDZA 4TQUS 1UK7A 1Y89A 1L4HA 3K9GA 3TQRA 2V55B 3EXHB 4ZMRA 4B3TB 1WP4A 1YQGA 4WXHA 3NUZA 2OLEA 5J2TA 2YVLA 1F0YA 2BTOA 1SKQA 2H18A 2V5AA 3HEBA 3PQ5A 5CH8A 1QM5A 4OHXA 3V8BA 5I7FA 2NOAA 3K16A 1G4UR 1G20B 3Q9SA 4IDOA 3ZEIA 4IS2A 4NONA 3RKSA 2R3SA 1AHNA 3LPAA 3HNRA 4NV3A 3S5UA 4EZBA 3U4QA 3V55A 2EKPA 2EX1A 2G63A 3MLBA 3MYYA 4V3CA 3IOCA 3DGFC 4TV9A 1B3BA 2XBLA 1K08A 1PJQA 2AB0A 2P68A 3FUVA 1NW9B 2I4MA 3R20A 1DPFA 2JLUA 4ZMBA 5G4KA 1WNTA 1Q0QA 2QMYA 1H4TA 2Y0EA 4DLUA 1YK0A 4FI3C 4R7ZA 5AHWA 5GV8A 4R01A 1P4SA 2IU0A 4FNGA 4BASA 3F96A 4DA4A 1AK2A 1CUSA 3AJAA 2EJVA 2Q0SA 2Z3WA 1FMJA 4RE6A 4MXDA 3VX4A 4A03A 3HCAA 3MWDA 2I1LA 2QQGA 4MW2A 4PSUA 4QJ3A 3SF0A 5BYKA 4L07A 4CETA 1GZ6A 4RF2A 4M22A 2CNWA 3G2NA 1J22A 3I9MA 3WJ7A 3NT4A 4ZOCA 3O9MA 1AQLA 2GKOA 1W88B 2A30A 3K0HA 4Z99A 2OXEA 3QFFA 2BH2A 1EX7A 1D0SA 4BCCA 4YACA 1YR7A 1X7GA 2FMFA 3CXUA 4X71A 4NC9A 1Y8CA 3HCCA 4I5FA 1D8TA 2YJ4A 4OBEA 1GU7A 4Q9LA 4NBVA 5TT0A 4CI9A 5KAPA 1XAHA 1P4AA 3KHSA 4C1BA 2QTFA 1JNYA 1NUQA 1ZYUA 3BKWA 2ATEA 3M89A 4BVFA 2UAGA 2V7EA 3I9KA 4CVNA 2D5CA 1YTUA 5T8KA 1FW6A 4I4LA 3FKJA 2W42A 2V5VA 3DA8A 2IUUA 4ER3A 1HYEA 3LFUA 2VJPA 1UKYA 4HYYA 1BH2A 4UUNA 2D54A 4J0JA 4AM8A 4QTYA 1C30A 3BE8A 1TDJA 2G1UA 5TGDA 3MUOA 1A8QA 1CDOA 3BZWA 2QR2A 4HUQA 4G23A 4RK6A 3BMQB 2H7XA 2WV7A 5DRTA 2JF0A 4BFVA 3Q7EA 4CUZA 3ADDA 4IV8A 1ADJA 4DBLE 4JT9A 4JA2A 1Z63A 2O1SA 2RKOA 1IDN1 2D00A 3QMPA 1KYQA 4XFKA 1SQ6A 2P62A 3GLIE 4D96A 4KJXA 2HYIC 4PZPA 4P92A 4P4UA 2JCXA 2FWMX 2QN8A 3OX4A 1W6UA 4NBWA 3R23A 1M83A 4JGIA 3SXJA 5IPFA 7MDHA 1SXHA 2XYQA 3A1TA 3EQ7A 1H2ZA 2BUCA 2PR2A 2XJ9A 2YV3A 3T06B 4EJSA 1IZZA 2YDYA 1Q95A 2XI4A 3DDHA 3OP1A 5JQGF 1ZK3A 3A05A 4MYRA 4S1NA 1KE1A 4ZWNA 3RYHB 3UXHA 4IEIA 4N7MA 3INRA 3W34A 2XXJA 4G9GA 2A9RA 1OIXA 4ZQIA 5T4HA 3EXIB 3CLTD 2JKVA 1H0RA 3JATB 3A1FA 4XM2A 3AJDA 1FFEA 1QGUB 1JT9A 4E4YA 2WIKA 4PHCA 4ZHQB 3B1XA 4NOJA 4RIFA 3OQIB 1HO3A 1AGRA 5LZ5A 3FMGA 4JLUA 5H3LA 3RTDA 3ZCVA 2QLJA 4ZEMA 4FS3A 4BNWA 4CLRB 3D3WA 4QYTA 1H2WA 4DF3A 3VNUA 5DBOA 4NVRA 4CMAA 4CEIB 4U39A 1P3DA 5FUWA 1WMDA 1U0LA 3E70C 3VGPA 4B40A 4F9TA 5FLXA 2C2MA 5LP6A 3BTUA 5H0IA 4L5IA 2XIJA 3FOZA 4HDRB 5TEVA 4FMBB 4PHHA 1FQJA 3OCCA 4K9SA 4S35A 4E3ZA 4MP8A 1GFZA 3TW4A 4FHCA 4F3TA 1YBFA 2P9ZA 3V3KA 5EJ4A 5HQ3B 1BXRA 3BFPA 1JE0A 2IDZA 2HD4A 2PVCA 4OI4A 4DNFA 4YQFA 1JJAA 5KTMA 3P20A 2D74A 2WFZA 4MRMB 5BV1A 3JD2A 2QN9A 1DC8A 1LPSA 4KZPA 4NPHA 3W1VA 2G5TA 4EA8A 2OO3A 1XVAA 4OHUA 1NXOA 1OBFO 2W6CX 2DZDA 2ZBQA 5LMNB 4NBTA 3PLRA 5ALKA 4TSRA 4TWIA 3SXUA 4RJLA 2XTNA 2QAJA 2C5FA 1PCXA 2ASVA 4DR5B 1WZ2A 1NYLA 4MARA 4DSZA 1WVGA 5ALWA 1DAIA 2XNDA 1U6JA 3O92A 1QPGA 2QKYA 1FRQA 1D5CA 3GRUA 1J7JA 1EPUA 2DY0A 2JGFA 1YFJA 2H4HA 4BB6A 2CD9A 2GVZC 1EWKA 2TRSB 3SQOA 1E32A 1SIOA 1M2NA 4B6FA 2CXHA 2QT0A 4ALKA 3DE2X 1NRJB 4M37A 4XQ0A 2WKQA 3SJZA 3R3UA 4JJ7A 2QMQA 4R0NA 1PQ4A 5HQJA 4RJ2A 4BC1A 3C6MA 3C85A 4RAQA 4BNFA 5FDFA 4OGKA 2C9BA 3N28A 3R41A 5FI1B 1DQRA 221PA 2XNKA 1J0EA 5BNFA 2BFCA 1M66A 4H4DA 3BGIA 4KP7A 4Q3OA 2WA2A 3DUFA 3ES9A 1SC6A 3LQKA 4H7FA 3UIEA 3A9SA 4A0FA 1NQUA 1F8XA 3UC9A 1FDTA 1Z29A 4X8MA 2N47A 4RPIA 3TAXA 4JELA 2QLTA 3HR8A 3SDSA 3WMGA 5D86A 4U9HS 4AY6A 2KWIA 4ZODA 2FF5A 2OGSA 4HXYA 3BB3A 4ZANA 1JZSA 2Z4SA 3E2MA 3F2IA 2PZFA 4OIFA 4XJXA 1HDXA 3RT7A 2CMFA 1YZGA 4LOKA 4LYJA 4FPXA 4YUYA 4YIHA 1RXWA 5EXPA 1L1RA 2V98A 1QHXA 2IW1A 1G8MA 1UPBA 1X7DA 4OI2A 5IASA 4QUHA 1SU4A 2AFHB 2CE7A 1MXHA 3NBAA 5JR3A 3VSBA 2Q4BA 1P2SA 3DE5X 4DV3B 1EM6A 1JF8A 2CXOA 1U2ZA 3DOFA 3LLUA 4ENSA 1X87A 4QHTA 2H4YA 3IP6A 3OOYA 1T2EA 1NX9A 4F5YA 2YVKA 1RQXA 3OHSX 2J1LA 2H1RA 4PAGA 5D84A 3I6ZA 3OLWA 3X2FA 4TM7A 2BGNA 1KQFA 1GPYA 5HKOA 2E1RA 4RZQA 5JCPA 4KR7A 3U4IA 3K0FA 2FPRA 5CCBA 2Z95A 4MITA 5DXAA 4CMGA 3JPWA 1NV9A 1A96A 2RAFA 5ETJA 5PGMA 3W6OA 1CR2A 3BS4A 1IBLB 1LW6E 4DV6B 2GA8A 4PWZA 4BNZA 3JU3A 3LJKA 4D9KA 4CLOA 1QU3A 4MQ5A 1EVLA 1MC1A 3SEFA 4YRAA 2G4VA 1H2AS 2II6A 3WKEA 3W5AA 2BYTA 4WOPA 3R9XA 2FETA 4BFUA 3Q41A 4UVIA 3BCRA 2I3DA 3H4IA 1L7QA 2JIPA 4TZ6A 3FNGA 3PUHA 3WZLA 3PEUA 4OL0A 3AEUB 1E3EA 3OOJA 2FEAA 2EAUA 2B35A 3G9ZA 4PX2A 3V8QA 4K28A 3RBXA 4KFCA 1P1KA 1PW5A 1LJUA 4CCSA 3CRVA 4LJ8A 5IYZF 3T1OA 2FZKA 3IUSA 4JROA 2CDNA 1QNFA 3RSOA 5CX1B 4BQNA 4G2TA 5D3MB 4FMPA 2FPIA 4B9EA 3ZDBA 3EZ2A 2RGUA 2M6KA 2ZRNA 4C30A 1GG2A 1A4IA 4GZLA 4UBIA 2R8BA 4RHYA 4OJQA 4BNHA 4CDNA 2BTQB 2PXAA 4EI9A 1MOSA 3SQXA 1TU4A 3O4JA 4AWBA 3FPBA 1JQEA 1Y5RA 2BFWA 4EPVA 4FDVA 2QEQA 1T5OA 4OAOA 5BWOA 4N0DA 5EHQA 4KH1A 2DVMA 4UNIA 5F35A 3T3GA 2JGIA 1L7VC 1WZUA 3NXSA 4UFPA 4Z0HO 2DY1A 1C4KA 1FEZA 1E1YA 1X80B 1ISFA 1AS0A 1R18A 2QTMA 2ZWIA 3ZE1B 4RVFA 1PBTA 1J0AA 4GMHA 4J4BA 2GYVA 4FKBA 4B4VA 2OORC 1JR6A 1L7AA 2CCJA 1U8ZA 5HKKA 5CBKA 3PYXA 3JYQA 4EW1A 2EEZA 2C20A 2IYYA 3GLUA 3CSSA 4JBLA 2JANA 1KTIA 4WXRA 5JAZA 3L84A 2E6KA 4KMSA 1WRBA 4GPIB 4HAIA 4FYIA 1MBZA 3FXAA 4FYKA 4IQFA 5BSRA 1E0KA 4YFYA 3WK6A 1P5JA 1WCIB 2C83A 3WWZA 3BSFA 3FOCA 1XPRA 5IVKA 1MX5A 4R71A 1THZA 3PKJA 3HCPA 3HKEA 5IRCD 3AO0B 1W5BA 4HZUB 3B9PA 4YRJA 2J3QA 2YIVX 1LRJA 2QUHA 3VHXA 2E0IA 1WXGA 1U0NA 4JDUA 1YD7A 4X60A 1W46A 1W5TA 2DPMA 3WDLA 5DX8A 4P0PB 3G2JA 4YUZA 2VAXA 5I48A 3GJZA 1G20A 5JW6A 1W76A 1GAJA 2TMGA 1IZ7A 2ZS8A 2OFOA 3UK0A 1PJ8A 3AR6A 3HUUA 4DSOA 2QUBA 1MHTA 1F12A 5C4IA 3P45A 4B0OA 4QQNA 1QK4A 3NTLA 4FFBB 3R09A 4MV6A 5K0EA 2PLWA 4QHSA 4GLBA 2YS6A 4FEYA 1YKGA 2XWJI 2QY6A 3RBVA 3IE1A 3LK6A 1FYWA 2CDBA 1F8FA 2D4HA 2HLDD 2ZYAA 3I42A 3QVKA 2GZSA 2EBHX 3GR6A 4UE3S 2HXYA 3CLSD 4AYTA 5JZOA 1FY2A 1H4VB 2C7BA 3HP7A 4BJHB 2C0QA 2O4CA 1N2BA 3H8VA 2ZSDA 3L1UA 3ROZA 1Y4ZA 1DXHA 2QN2A 4Q4HB 4YRQA 2V74B 3PT9A 1EWQA 3RCBA 3FGZA 4KPYA 3RTEA 2FX3A 5JNUA 3UGQA 2PRYA 3SSAA 7YASA 1WW8A 2F3SA 1B1AA 2GA9A 2NVWA 4PZCA 4TTRA 3TKLA 2M6LA 1TAGA 1TECE 4P7JA 3V4VB 3RFCA 2IH2A 1TJPB 2G1AA 4PAQA 2HGZA 2F3RA 2P7IA 3QELA 2UVPA 3H99A 4CCWA 1P0MA 2WIDA 3IEIA 1UOOA 1H66A 1MD9A 1X8XA 3C3EA 2AC7A 4OU4A 4FBGA 4I9FA 2JNWA 5DM0A 4ZMSA 2IXDA 1DDOA 3HMKA 3SNKA 5F3DA 4F04A 1J8YF 3IBSA 4PRYA 1TE2A 2IYTA 4E13A 1NOKA 3CEAA 4YJ3B 4GFDA 4PG6A 1OC4A 4COOA 5H83A 4BQPA 1UJ2A 4DIEA 4OQDA 2I2XB 4GSYA 4F4FA 2VNAA 5BSTA 2F9MA 1OA1A 3GA5A 2JDID 4UM5A 5CA1F 2KSQA 2QZ9A 2F3TA 4QM6A 1Q5PA 2AJLI 5HVNA 1E8DA 2QRLA 1SIUA 1VKJA 4FYWA 1G6Q1 3GFRA 1YIOA 2J3MA 3C3CA 3PHBE 3FDIA 3T35A 2QNBA 2AN3A 3ZK9A 1CZKA 1Z4KA 2CNDA 3PR2B 3D7KA 3QWAA 1J39A 5J2UF 3DEYX 4XSGA 1DO0A 2NTEA 2VHWA 1L5GB 3TZQA 1C9NA 1ETUA 4WJZA 1SB9A 1VQ1A 3UJ8A 1OAOA 3GLSA 2FZ5A 3KBBA 4P82A 1P2TA 4FNOA 4W7SA 2QG6A 3HN6A 5EP3A 5FBZA 1CIVA 3I6IA 2FEMA 2ZRLA 1DHTA 2EBFX 3WOVA 3V6MA 1G0NA 1C4WA 2BFFB 2JATA 3PGXA 4MVJD 4ZAXA 1DBRA 4OXIA 1IY9A 4EYQA 9LDBA 3QTTA 1NR5A 3DZHA 4NCIA 3TR5A 2FWIA 3WYBA 3HBMA 5CXUA 4A8JC 1PSZA 4BNDA 2WHPA 1HT3A 3DO5A 2XMCA 5KWSA 4H1TA 2PUBA 3D54D 2MJLA 1N9ZA 2JH3A 4ZHQA 5FWNA 3L0PA 1YV9A 1V96A 3FKSD 3OQIA 4ZARA 3W3ZB 2EGHA 1XLWA 3FB1A 1PS0A 3CA8A 1IH8A 1ID1A 4CLRA 4EYOA 3RS0A 2RHCA 4OJNA 4CEIA 1PVOA 1TM2A 1X19A 1Z6AA 2WINI 3E0XA 1DAOA 3AZQA 5K09A 1RRFA 3BMOB 4HDRA 4HQNA 2FHSA 1NZDA 5ILOA 3NETA 3EOAI 1Q0ZA 1SRQA 2ES4A 4QYMA 2DLDA 2QTGA 1U9JA 1KS2A 2BZ0A 1Z08A 1V2HE 1ZHFA 1ZIPA 2VEDA 3GEPA 3NDPA 3QG1A 4KKXB 4BMCA 5HQ3A 4EMSA 3LLVA 4BMZA 1CRPA 4MRMA 2NU9B 4D8UA 1S3SA 2R47A 1PD1A 1XALA 4ZEVA 1KBOA 1VLQA 3RG2A 5MF6A 2Y92A 4ZAVA 2ZS7A 4TTIA 1E1QD 5B6PA 3OA0A 4K3UA 3ZTYA 3GYBA 4X1YA 1DAPA 2B1JA 3FSGA 3OQVA 4HQ0A 4BNLA 3FE2A 4ESHA 5LMZA 1KYXA 3H2BA 2V4MA 4WERA 2AMYA 4BP9A 1DAFA 2XTZA 3HDJA 5DNAA 4CMKA 1VDMA 2ZITA 3TL6A 1XDZA 4KQHA 2OXIA 1QGOA 4TUYF 2NT3A 3FCEA 2ODTX 4FFNA 2OBNA 4LKOA 4P4LA 3VAAA 4LHXA 3A11A 1IEVA 4JP5A 3KQMA 4LISA 1JHZA 2OG1A 4DQUA 5DBGA 1W0CA 3RG8A 4EA7A 3SZLA 2BFMA 1TCCA 2H85A 3U4DA 1P19A 4NYJR 2VOEA 4BNTA 4Z4IA 4HRYA 3V2IA 3MF4A 1QSGA 3GRCA 2EHJA 1JR4A 1QC5B 1FP2A 2ZRJA 5CDGA 1L1QA 1PT8A 3C8UA 2OCXA 4K40A 4IIBA 3OCWA 2HQRA 5M3BA 5BUQA 2PX3A 3AUFA 4JBNA 3W5DA 1FFWA 5K3CA 2RGXA 2CUNA 1SKBA 5A62A 2H11A 3B82A 2QA5A 3EUEA 4QE3A 2X7JA 4D98A 1AXRA 4I14A 4PS1A 4M1SA 4CG1A 2C29D 2DSNA 1TT5B 4I1RA 5KINB 1CUZA 2GJ9A 1XVLA 4MUGA 5HJEA 1OTHA 2AA3A 2RHLA 4Y2QA 4CGZA 4BLTA 1IN7A 2FLKA 4KO1S 5F1YA 3DAHA 4G0OA 1E5TA 2Z5FA 3ZYZA 5JIBA 1AIPA 2CHEA 3M34A 2IGBA 2DT8A 3ZE0B 5MN5A 1WKVA 3EDQA 3LC1O 3ELUA 1F4PA 3OEHD 3NBXX 3TTWA 3ZZUA 1WABA 5IFKA 3T0IA 2J0UB 1U2EA 4BEWA 3I05A 4ZALA 1UMCB 3A26A 3IXLA 1O95C 3WO1A 1Y7IA 2WB2A 1I5EA 1UWKA 2PX4A 3FFTA 5DNEA 1BQEA 4BAUA 1ARZA 3K4HA 1GFIA 1IBMB 2BE7A 3NHWA 3R9KA 3FTFA 2DERA 3OX1A 1UAYA 4XWTA 3RS4A 2QHXA 5C7LO 2O8BB 1CR4A 2QUZA 5SV2A 4RD2A 1SU8A 3AESA 3TWOA 5CEJA 2A9JA 3KL4A 1OHHA 2WT4A 3ZJ5A 1Y3IA 4LE1A 3NMUF 1CDEA 1Z6TA 1G18A 3K0BA 4OQYA 1BS9A 2FR1A 3NTXA 4NCHA 3ZNOA 5IULC 3DP9A 3Q8WA 3IP7A 4NOMA 4QGHA 5CDFA 4GNRA 1NY5A 2ISQA 4ZI7B 3DLTA 4DQVA 1DQZA 1XP8A 3NB0A 4R3UC 5CLGA 4G5FA 2WYIA 5JC8A 3RUDA 1GUDA 3BAFA 4NG5A 1TMOA 5IX8A 4BGDA 2J9XB 2VPQA 1KO7A 2JIZA 3KHTA 4J0QA 5CLFA 4NU0A 3B85A 3UB4A 3FHLA 1BS1A 1UZAA 3GG2A 2QVZX 2JBAA 5AW8A 1BHO1 2WM9B 4ZOLF 5CX1A 2OVBA 3W4KA 3FPGA 1XNHA 3FCCA 5E0KB 3LLMA 2GX6A 4BN0A 3DDWA 3H5OA 3LQ2A 3WV5A 3ZHRA 2FXVA 2XDYA 1JDTA 2XUAA 1ECCA 2ACKA 3COYA 2CF6A 4JI3B 1U7DA 1EJ6A 4GPD1 4EUKA 2JZNA 3RNLA 1V11B 2ZRHA 2RI0A 2DU8A 2FJPA 2PUVA 3WL6A 2ECFA 1TKRA 2C3OA 2JH8A 3F2VA 4U7GA 1RPTA 3TO5A 3WGGA 4PCAA 4K26A 3Q9NA 2WIJA 1YCDA 5KSWB 1XYGA 2HA0A 2PLRA 2CC2A 4TRMA 4WCFA 1IVYA 1XXHB 4HNGA 1Z0UA 1E60A 3HA3A 4PLCA 2XEDA 4K9PA 1E2HA 2H2GA 2R8XA 4BGEA 2O2HA 1P8AA 4ZP1A 2ZUEA 4DIOA 3PXUA 4JLJA 3U3ZA 3UH1A 1PR5A 1DC5A 1W87A 4LCBA 4QXPA 3ICVA 5B1IA 4DLVA 2ONZA 4J9VA 1LF5A 1USVA 3EEYA 1JLLA 4XDYA 3T5BA 1YRYE 4XRRA 3SZMA 3ZU4A 2J9FB 3WNVA 5D51S 2GVDC 2ZBEA 4EHHA 2ZB3A 1GY8A 1MP0A 3JWIA 3KEFA 2PCJA 4NH4A 4HZUA 2DBYA 3L2OB 2H5LA 4LNUB 3SM3A 2G8LA 2HOQA 2OCKA 1UFOA 2ZXEA 4G1EB 3QG5A 4B3BA 5JRDS 3PHLA 2J85A 3WLIA 2JGEA 2X3YA 1SUAA 3FGNA 4ZT5A 3ID6C 4D0GA 3DM9B 4DDVA 4DWJA 3HFJA 1NU6A 2FGJA 3MQ4A 4TT8A 5A4DA 1CZUA 1GRQA 3OOHA 4EG8A 4ZVRA 4DABA 4R05A 3X43A 4B3DA 1RRMA 3GEDA 4L4ZA 3IKMB 3J80A 4JOCA 2BD0A 1TCBA 5CB4B 3P4YA 1GQFA 1LQTA 3BEOA 2NZ8A 2DWPA 4FFBA 5JZVA 4M49A 3DUWA 2HRRA 1ULSA 2WT9A 4J90A 5GGYA 2HJSA 3B1FA 2LTAA 3CXRA 3NWOA 2ZW9A 5BMOA 4NBUA 1KYIA 3R2JA 4E5DA 1CG6A 1QIEA 3EK2A 5CM2Z 1U0OC 2GF2A 2XWBF 1L5OA 3M6WA 4Q4LA 4V2UA 5ERGB 1LC0A 3EBLA 4NJOA 4BHTA 1IY2A 3DJFA 4OHRA 3A2KA 1MC4A 4GC9A 1ACLA 1R0YA 4XGQA 5HJ7A 5BN1A 4G5HA 4L7VA 4HAVA 2B1RA 1P31A 1DG3A 3I09A 3CPHA 4GPTA 3ITNA 5AM4A 2CVQA 4TQ9A 5IAAA 3EGOA 4BWVA 3H1PA 3OCJA 4RNDB 2O2DA 5IBRA 1ZW6A 1O96A 2B92A 3R3XA 3S5JA 2PT7A 1H9BA 1RM5A 2BFPA 2DTXA 5BRJA 2G71A 4IDNA 4EA6A 2OGZA 4U0JA 2DHCA 1HG1A 2I65A 2A6PA 1R64A 3SE7A 1AVTA 2QX7A 3L7OA 3IC5A 1CW2B 3E7PA 3I01M 2PJUA 1QG0A 4KQGA 1L5NA 3S1AB 1YXMA 4AKTA 6PFKA 3B8EA 5EJ6A 4OX9B 1KKMA 3VDNB 4UMVA 3GFBA 4YAGA 2DUJA 5L8VA 4F45A 2AYYA 2QJFA 3BTOA 4ER5A 2IPAB 4QTTB 5KNBD 3VJMA 4L4XA 4GL2A 3LPCA 4MRRA 1QCZA 2FNAA 4LZNA 3AI3A 5AXBA 3W7BA 4CM8A 2ZRAA 5JQGA 2NO1A 3G9QA 2P8JA 3PYLA 1WVIA 2YXEA 1Q44A 3EZ7A 1DEKA 4MYCA 3FSJX 3L7CA 4RXTA 4MR8B 3UENA 1B7GO 1DT5A 1SZCA 2DT5A 4TM8A 1H8HD 1HL7A 2OFPA 3W06A 1HGXA 1RJ9B 1H2RS 4IOMA 3KPJA 1PR1A 3UT5B 2O2IA 3E4DA 4R1MA 1FTGA 1POWA 1XLUA 1ZIXA 2JEZA 2V45A 1OILA 1D1SA 3VZDA 4WKGA 3UC5A 5C8VA 1Z8HA 4YK7A 3KV1A 3AHDA 2CK3D 4FGUA 2IV3A 1YR9A 4HPWA 3SDZA 3VAYA 1DFGA 2QUIA 2WYUA 5H9VA 4Z2AA 3D02A 1SELA 4C88A 2XE8A 2PSJA 2OAEA 3DFKA 4G8CA 4HEHA 4PSAA 3ISVA 3N59A 1HEUA 5FBVB 4PGGA 5EJ8A 4FOOA 4L5AA 1P45A 1J7KA 1E64A 2YX1A 3UWOA 1NUAA 3HCWA 2HK6A 1Y1TA 3OZWA 1SVMA 2NX2A 3LY7A 3LGXA 3GUUA 2BR4A 2AH5A 2BFBA 4FMDB 1EZ4A 5IBQA 5ENZA 2GEJA 4X1OA 1VHJA 3EFEA 3T9AA 1ZIYA 2P2CA 4DARA 4FR2A 3I37X 1PGJA 4HEJA 1KY5A 1KR5A 3IP5A 3JQFC 1SCBA 1ADBA 4IKPA 3CUWA 4D4MA 4Z4GA 3NATA 9MHTA 2HB6A 4TMYA 2QENA 3H13A 4HG2A 3MAGA 2OOSA 2I7XA 4O0MA 4DEXA 3EA0A 1ZC3A 1L9KA 3BB4A 4NLLA 1JKJB 5J47A 2F4VB 3GJ6A 1ZCZA 2P9BA 2QRVB 3ZW7A 5AVVA 2R6GA 3BMOA 4XQCA 2ZJZA 3TQSA 1Z7WA 2BZ1A 4NU5A 1QF7A 3K9QO 4Z7QB 3N75A 1U1CA 1Y7TA 5ANRB 3FA2A 1Q0HA 3BF7A 4B43A 4OGWA 1ZN2A 2NYAA 1NBOA 1V8BA 3AXTA 4L0DA 2C7GA 3ZVMA 1Y8ZA 1Q7RA 2HQBA 1CJSA 3Q11A 5DPMA 1RVV1 2NU9A 5K0NA 1S9DA 3BXGA 5KYXB 4N3BA 4L57A 3FCXA 4BUCA 3FYUB 4ER7A 3DJYA 2O5VA 4KFTA 1YASA 3KB6A 5E4JA 4JB2A 4PZEA 4DOMA 4JSRA 4CG3A 2XTJA 4JP3A 3LA6A 4AMVA 1J90A 1R3UA 1EFAA 1KSFX 2FW1A 4LNHA 2PNFA 3JQAA 1AKYA 1HE3A 5G3YA 4UHFA 3RSHA 1G2IA 3ZZ0A 3ND7A 4C4SA 4DDWA 3DR5A 3EWSA 5DJ5A 4OHBA 3PEEA 2FPGB 5JSZB 2AXNA 1A9QA 3MW8A 4MUMA 1GPBA 4UM9D 4CMJA 5IDQA 8MHTA 3GLVA 2HQ1A 1N78A 1T5IA 2JJMA 1B16A 4RV9A 4HEA6 3H2JA 1XVTA 3DV0B 4I4TB 4R9VA 4W6QA 1YVPA 2G67A 4MI9A 5AOVA 1AMUA 1SN7A 1TQDA 4BB9A 5J9FA 1QVAA 1GUAA 5AI4A 2IYWA 1SQ5A 2I6SA 3QFTA 2GK6A 3H0EA 4LYHA 2Z83A 4UCXA 5K3DA 1SFRA 1B6RA 1WV1A 2ZIZA 4TL9A 3OZCA 3CLKA 2WJPA 1MMFB 3KQNA 4FD2A 1VE9A 2OE2A 2PUAA 2CXQA 5K8UA 2V6FA 2XZTA 3ZKAA 3VJLA 3O82A 5KWIA 1RLOA 1NT2A 1Q74A 2ZETA 4MSUA 4NENB 1YU9A 3UV6A 4BJ1A 5HCNA 3AU9A 6YASA 3SLRA 1KZHA 2F8TA 1TQ4A 1UKZA 3PGJA 5BNTA 1KI2A 4R8SA 2XW6A 4L28A 5C7OO 5IKEA 1RT9A 2OM6A 2ZBUA 2IE8A 3BFVA 2CHUA 1NBME 4PX5A 4DB2A 4CMCA 3E05A 1AD2A 3ZWPA 2C2YA 3QYJA 2G09A 3ZHZA 1K63A 3PFIA 4DCMA 2J0UA 3RUPA 3E58A 1U7TA 3INYA 2PT5A 2PUDA 4NCAA 4EF4A 4JKYA 2NP7A 3L3BA 2W2QA 3C97A 5JXHA 1J8QA 1GKYA 3A3KA 1DCFA 1BZYA 1N2SA 2Q8PA 4I0WB 1PZMA 5FBWB 3E22A 2QUKA 3M1IA 2Y1FA 4LXXA 4ND8A 1TKAA 1C9KA 4B4DA 4AQYB 4CKCB 2I2AA 3VVCA 5IYZA 4KXUA 4MYUA 1LJ8A 2JRLA 2Q3CA 4RVSA 2O8BA 6GPBA 4UDXX 5EWJB 1T9GS 3KLPX 1V7PC 3NU1A 4HD8A 4CLXA 3DG9A 4YP9A 1II9A 2R7LA 2RARA 4JJKA 1HX7A 3AEYA 4CIBA 4H77A 3RAFC 1I9CA 3SBEA 2HPAA 3RM3A 4ZI7A 1AA9A 5COQA 4LG1A 5DHPA 5ENDA 5KTPA 2OPHA 3D59A 1LI7A 1RCFA 2DH6A 2HL6A 3HSKA 4H35A 4EJMA 2IF0A 3PJRA 1OFIA 1XQ1A 1GTZA 3DFZA 2AVDA 4JLBA 2PSEA 2F64A 2BSQA 2C7VA 1I2MA 3K0CA 3E9MA 3RJ9A 2HMYB 1KU0A 1I7PA 1KEPA 3B51X 1F8UA 2WBLC 4CCYB 3TRIA 4F46A 2Y9PB 4KSYA 2DE0X 3MELA 4YTEA 4LF5B 2X2FA 2ZRCA 1GDHA 3AM3A 3JPYA 5EA2A 3UATA 3SYKA 1DBQA 1JQ5A 3HM9A 1NQAO 4A8TA 2RHJA 4QD3A 1R0WA 2V9PA 3FNHA 4HXEB 4WXPA 1I4EB 3PXGA 1SA0B 2PV7A 4MPRA 2B2NA 5SY4A 3OIWA 1SCDA 2I2DA 4HGOA 1FS5A 3N0TA 5E9QA 3D1LA 1EXVA 1DQYA 3UWSA 2VAVA 2FQYA 3HP1A 1JDJA 5D6OA 1A3CA 1CHDA 1J99A 4C9BA 1FX0B 4QGGA 1EVIA 5ALHA 3VAZA 3E3LA 3AL0C 4TMFA 2FK8A 1QRAA 2VSYA 1IHYA 3L0YA 1C9EA 3BXPA 1EFVA 4M6WB 2EW2A 4KTVE 3ISTA 4PC1A 2VS1A 2CVHA 3PENA 3HKCB 4YCAA 3H3FA 4A2QA 2X0RA 4KZKA 4Y9SA 1LDGA 2W6IA 4A7PA 2GN8A 1EHCA 1Q77A 3L7LA 1QV9A 2VNSA 4A5SA 2J9FA 2BEJA 4N40A 1W5AA 3BFXA 1NV8A 5JOQA 5E95A 1AUPA 3IKJA 3P4XA 4F71A 1CIPA 3HB4X 5HHTA 3IJPA 1I5RA 5A7GA 2P78A 2OEPA 4M0PA 4C22A 2BSAA 2Q6VA 5F77A 1JEDA 2DHEA 1KKUA 2VJKA 4C07A 5LSAA 4WCDA 1XAIA 4KQWA 3TMAA 4AG3A 4D79A 3QBJA 1OU0A 5JJ5A 1SXQA 4B8ZA 1X0XA 4MLDA 4AF6A 2W2TA 1YRAA 3WRYA 5KQLA 2DQYA 2PO7A 3O3NB 2VK2A 4HUJA 2Y0DA 3IXQA 1ZM9A 4DIKA 5HKAA 3C3DA 3HABA 4EYSA 2G1KA 2B4QA 3R5KA 1HDZA 5FO1A 3RANA 4BZXA 1NLYA 4YPFA 2GHTA 1WHSB 4A73A 3HU5A 3UK2A 3OBIA 1T15A 1UC4B 2XVZA 1K6MA 1ULTA 3PJDA 3HR4A 1PT9A 1O57A 4L9RA 4Y9DA 1IBRA 2FPPB 1IFXA 1NHGA 4IQGA 1VBNA 3IQXA 4C4XA 3EZGA 2GO1A 5E2AA 2Z2KA 3FRIA 1Q57A 1VYTA 2Z9CA 1E69A 1EJ2A 3CVVA 1PR9A 5HS6A 4QNRA 2ZXUA 4TRNA 1BTOA 2GVNA 2BFAA 2XSZD 5I7UA 4HNAB 2Z8ZA 1HLFA 5E8JA 3U37A 3K9FC 4WZBB 3D8SA 1M0TA 1UBNA 2VDQB 1QWOA 5B6JA 4ZI3A 3Q10A 3RSQA 1QHHB 3KEOA 4JCOA 1BW9B 3OEYA 2KE5A 5CA1A 2DRIA 4K9KA 3BXHA 5F21A 2Z1NA 3M6IA 4EQ6A 2QZJA 2W6ZA 4G86A 2V6BA 3KJNA 1NU8A 2DBZA 4YASA 4P8RA 3SS8A 1FYXA 4QJ5A 3SG0A 5TPWB 3S1AA 3EVFA 1NYRA 1S8AA 2QTBA 2YJ6A 3THWB 3T95A 3PRYA 5HSGA 5J1SB 1G4HA 2OBYA 3ZBQA 2COEA 4W8GA 1UJCA 4L50A 5CLIA 5J2UA 1IM8A 4R2KA 3A1DA 4WK0B 1H8EA 3IQFA 4ZVLA 2R5FA 4C5CA 4DJDC 4R1TA 4LPKA 3WK4A 5ALFA 1GHTA 2A57A 1CQIA 3AP1A 4HN9A 2IUYA 3A6PC 2ZT8A 2XXAB 1KA9H 5TX7A 1UIMA 2DFNA 3TIIA 3PDUA 3AHIA 5K0FA 1Q50A 1QFYA 3DDUA 3DZBA 4PYRA 4CV0A 3ZDAA 3ZWDA 5KSPA 2G9NA 2X3FA 4JQZA 1J6UA 5JNWA 4HFRA 4YV2A 3G1WA 3UT5A 2COUA 1QZ3A 3IUNA 3J81k 2R11A 3CYFA 3LBHA 3ILHA 3GT4A 5KTRA 3MJDA 2DHRA 4AJIA 1AUOA 4BFYA 3E0QA 1C9MA 4RSHA 2CMKA 2EBUA 1OFUX 1PGOA 1XR3A 1ZMOA 3D3QA 2ZYRA 3E3AA 4AY3A 3LUBA 4PRLA 5B37A 2NNLD 4TZ0A 4LZJA 5LBUA 4U8GA 1KJ9A 1OZ0A 5ALNA 4I1IA 5HIAA 1PFGA 1E4EA 2H2FA 3H2IA 2JD2A 3DHEA 4JLVA 2Z43A 1CUCA 2H07A 5F3WB 4NK4A 2D06A 1E1CB 4ZCQA 4NPCA 3RFFA 2QBYB 1RBMA 2WZDA 3WWEA 3DVAB 4FOLA 2WVAA 2OG2A 2VN8A 2FCAA 3KIPA 1WDMA 1VE5A 2DBRA 1H0KA 3Q5EA 1JR3D 4PEVA 1ZGHA 3N7TA 1XV5A 3F71A 1ORRA 4HQRA 3SHVA 4QUBA 2IS1A 2XCRB 1EA5A 2BJWA 4FCCA 3SF8A 4I1PA 1MJNA 3CR7A 4TLLB 1RPJA 3PTZA 3VR6H 5F5XA 3ZD6A 4L2IA 2VT2A 3BSWA 2QRVA 3IDOA 4BNUA 3NZEA 4OFBA 3A2NA 3NANA 5AI5A 4BVHA 1TM4E 1NXWA 5IM5A 4MH0R 3D0QA 1OI2A 3FWNA 1C7ZA 1PL6A 2Z8YM 3E5RA 3EGXB 2XR1A 4PVDA 5YASA 2F1RA 2R5WA 5A3SA 3OZXA 4JP1A 1KJQA 2OSVA 3M5DA 2EJCA 2RB5A 1H2HA 5KYXA 3PQCA 2GJ4A 1V4BA 1DAKA 1Q1EA 1XUOA 2OCLA 2QLNA 3FYUA 2YIMA 3EIQA 3MJTA 4JFAA 1G291 2XDWA 3PNMA 1H3FA 1OJ7A 3NI2A 5T4FA 3OQOA 4V3BA 4RH0A 1TYZA 1G20E 3DTVB 4D4HA 4OYHA 5T41A 1NWCA 2BGWA 1Y3FE 2FSSA 1RHJA 3GVHA 5G02A 1XNJA 2MSWA 4MV8A 3L0IB 4WBSA 5FORA 4O2BF 1KMIY 1IJEA 3IHLA 4G1VA 1ZPDA 4OQPA 3ZGLA 1JYFA 1R1DA 4OSEA 4WK6A 3M6UA 1COWD 1RKXA 4EH1A 5JSZA 1V8DA 4FYMA 3V8MA 4MWGA 4G97A 4OBBA 6REQA 5FL7D 3KDSE 3SVTA 3T9BA 2ZJOA 5KX5B 4YR7A 2ONCA 1MT0A 2NQ8A 4I4TA 1WZIA 2JVIA 4PICA 5KTKA 1G8KA 3IGFA 4TXLA 4M87A 1IWBB 2NUAB 4EZIA 2IZ1A 3QXHA 4JUBA 5J4LA 5JISA 4HUTA 2G1JA 2AS0A 3EQ9A 3PIIA 3UKJA 1KO4A 3H1FA 4K0RA 2O48X 2RJ3A 3AB7A 3D6TB 2EDCA 2JLYA 1J2UA 1T2DA 3PHJA 3GPCA 3TN7A 1SKYB 3OFNA 4GQAA 4JBGA 3MRTA 1GNRA 3P52A 4ZO6A 1JXMA 3V4RA 1QMGA 1R5NA 3D6JA 3WISA 1ZHOA 2XDAA 2X5JO 1D04A 3TNYA 4D4KA 3ADOA 4YS6A 1OVGA 5KJFA 1O54A 1DQNA 4JHXA 2FW9A 3AX6A 3U40A 1JIXA 2WR8A 2G9QA 1HFJA 4FFOA 2VDLB 1DKMA 4LVUA 1M5TA 1N8KA 3W3AA 4Z54A 3UF0A 3AUYA 4BMXA 3MTDA 4DM3A 1DAMA 1ZKMA 1BWQA 4H0NA 1MDFA 5DEOA 2AG0A 4KR0A 4N5MA 3V1UA 2CXRA 4B1FA 1XKLA 1JMKC 2VYVA 3FJOA 4OUDB 1YRWA 2ZR9A 4JVMA 3W9YA 1T3TA 4GOJA 5L40A 2O8CA 1ECBA 2IZZA 1XX6A 2FR0A 3IIJA 4JT4A 4GXTA 4I55B 5LWHA 1MB9A 1PQWA 3F7MA 5BMVF 1Q2UA 2NUBA 2LPMA 1A9RA 4NP6A 1U28A 3YASA 4CKCA 3U7QB 2J7KA 3DDZX 1C29B 4IH4A 4MS1B 4TRJA 4D02A 6CHYA 1SHLA 2ZT6A 1JIQA 3OD5A 4B48A 1SCUB 1AY0A 3P32A 1FE8A 3ANMA 5LN1A 3JQ9C 3UPDA 2P3QA 2ZM6B 3IX7A 3A6JA 1Z5OA 5CEEA 1E89A 4E46A 1CQZA 4KVFA 4Q18A 5D5HA 3ETLA 5H8WA 5GOZA 1ZD4A 3GJSA 4WFKA 4YWJA 3SM9A 1GA1A 4CMIB 2WM3A 3PA8A 4F8EA 4EG4A 1B23P 3L7KA 5JNVA 1QAQA 2MSEB 2ONKA 1NW7A 2VZEA 1Y81A 3FUCA 3LCUA 1RKVA 3ZUPA 2ALJA 2B99A 4DIUA 2TMDA 4Q7QA 2A4KA 2GSWA 3QMMA 1EE1A 4DQDA 2FPUA 2YJGA 4NZPA 3ZCRA 3L02A 5AKHA 4LJ9A 4G1BA 1UPCA 1XMVA 5T67A 4QM7A 3AM4A 1XDSA 4CCYA 2Z6VA 3I1IA 4CLHA 3G6KA 2R6R1 3SQMA 5EESA 3NVKI 1YO6A 2C3MA 4XR9A 3THSA 3TQTA 5H9WA 2ZJBA 4JI2B 3D4IA 3GG9A 1G5IA 2WHEA 3L8MA 3PGVA 5HW0A 3UY4A 1L4GA 3JR3A 3HGQA 5KTTA 5C80A 1MC8A 3GN1A 5L4NA 5C35A 2C77A 4MS3A 3NAZA 4EJ6A 3AEQB 5GJVC 1ENPA 1KSHA 1XTJA 2BM8A 4K87A 3CUVA 5KPDA 3AIIA 1FX0A 2X6RA 1K7EB 2YN4A 3Q9UA 3UJDA 1Z2NX 3G68A 3KQUA 3PHGA 3U7EB 2J4DA 3D31A 3HZZA 2D13A 5CJ2A 2XBMA 4RGYA 1UF9A 1V0JA 5DCWA 4ZVQA 4M6WA 3ZZ1A 1HY3A 1I4LD 1QS0B 3QHQA 4MGEA 3VZSA 2J87A 2WPDD 3L1KA 3WLQA 3LH5A 4KNVA 3U56A 1QO0D 3KYIB 2HHLA 4YBZA 3HKCA 1W75A 3RAEC 5B1DA 1EI9A 1YDMA 1B0ZA 2ZPAA 4TRRA 4AP9A 1A5SB 4LN1A 2W0SA 5BO5A 3EIEA 3U3DA 5IC5A 1OOEA 1EQAA 1E96A 5HBGA 2IXFA 4DB4A 4AMZA 1PZNA 4Y2TA 2JI7A 4EB6B 1XMPA 3OY2A 3GAMA 5FHQA 3U4HA 4I50F 1AKUA 2NAPA 4ZV9A 5H02A 4BUJA 2NO5A 1PT5A 4Z0NA 4MO2A 1P61B 4LPSA 4DM7A 3LC7O 3UUGA 1GCGA 2PS1A 1RQRA 3Q40A 4L8GA 4RS4A 1Z4JA 4E4TA 3K5HA 1BN6A 3MA0A 1IU9A 2G7MC 4EBFA 1PR2A 3GP8A 2LDBA 3C7TA 2QTWB 1M5UA 1T6YA 4BAGA 3CJTA 3ZHVA 1O97D 3W2EA 2KLBA 2BKXA 4NS4A 3BBLA 2H4JA 4ZIRB 1X7WB 1UBLS 3GBVA 1DDGA 3O2NA 2ZI4A 5AM1A 4KWEA 4QHYA 2QM0A 1CS0B 3UK1A 3SHTA 1IJBA 5B12A 3W5JA 5AJWA 3VPXA 3A6FA 4CN8A 3ERCA 4U6NA 4F4JA 3SXPA 4ZOEA 4CYMA 1M54A 1K4MA 2GAOA 4D9NA 3L9WA 3IPYA 4JYZA 1N7IA 4PYKA 1MA3A 1N3LA 4CV1A 1GZ5A 4NZNA 2RMKA 2P1RA 1N0IA 1RE0A 3NUQA 5GIPE 1NP6A 2PD4A 1ZJWA 4JI0B 2H06A 5FTWA 4MYTA 2ATXA 4WOCA 2C7RA 1CLUA 3GJ3A 3V5NA 3HZRA 1EA7A 3IR6A 5KTYA 4WD3A 4HNAA 4GOMD 3A6DA 1COZA 4NFSA 3SJ7A 3U4AA 4H31A 1KI3A 1ODTC 4IHJF 1YBMA 2AFHE 1C7FA 1GO2A 1KQPA 1AHIA 2CHGA 1MB3A 1QYIA 1SUWA 1QHHA 1XELA 1S5PA 2XVAA 1BW9A 2GO7A 2OT3B 2YZNA 4TKLA 2H5EA 1GR1A 1WPQA 4Q34A 2P77A 4PFSA 5LD2C 3NRBA 2Q0XA 4HNQA 2HLHA 1XI2A 1WXWA 4PHFA 1DXOA 3QLVA 1ZNWA 2WF7A 5FD8A 2FPWA 1NJ6A 2WUWE 5TPWA 3FDZA 1VIMA 1GRNA 2DBQA 3FI9A 4J3NA 5K0GA 1EM8A 1G38A 2AG8A 4GDMA 1NQWA 1Q0TA 2QT1A 3AF1A 3DO8A 3ND8A 3IPCA 2I2CA 1J20A 1F8YA 1RQ7A 3ML1A 1XHFA 4AICA 5LQCA 1S0UA 4OATA 1BHQ1 2FFJA 5THXA 3ED5A 1OWLA 1OWOA 3IQZA 4HBGA 5FA5A 2OZVA 1YHZA 1PHRA 1YAHA 3BRQA 2A5JA 3LIPA 3G0BA 3COPA 2XXAA 1VBMA 2CLMB 3GD7A 5F1OA 2H63A 3EZYA 1RTTA 2QP9X 3W5SA 1AH2A 1EEHA 4N12A 2D5LA 4KRGA 1KQNA 4B5LA 1VKOA 2FN4A 4DUGA 2GEVA 3TIGA 1BQ3A 1ZN7A 4GWLA 4BVGA 2ERYA 1WDKA 3N2KB 3DS8A 2IOHA 3GVIA 4TWJA 4W8OA 1U63A 2HZ7A 3RHFA 3JRWA 4AECA 4M89A 4M38A 3DHNA 3KKZA 4G63A 3I6QA 3U3RA 3P9ZA 5C8XA 4MYSA 4RKEA 5EZYF 4JAVC 5I7AA 3GUYA 4PYMA 3NO4A 3U4GA 2DR2A 2B37A 3CCCA 1TA4A 3GEHA 3Q5GA 1A9YA 2FEWB 1GEEA 3D6AA 1FVXA 2F43A 2Q4EA 3FZYA 2VCYA 3KZVA 4IINA 1AT1A 1E61A 4N41A 2HU8A 1I13A 1GVNB 3SZRA 3DB2A 2QBYA 3DF9A 1KH1A 2P4QA 3PUZA 4NMWA 5FUVA 3DVAA 1QHGA 1OROA 1R4MB 2L82A 1P2FA 2IZ0A 3QI7A 3QUTA 1P72A 2AOTB 2DFVA 2X9VA 2C4HA 1CNFA 1RRPA 1U1IA 3CGWA 3II6X 2OAP1 4P58A 4PCUA 3SQNA 5I45A 1GYQA 3ZX5A 1NN0A 3FROA 1XQXA 2X13A 1CERA 4P3KA 1P33A 1N2JA 2VRBA 2YUIA 3QU7A 1FJHA 4HLUC 2JJ2A 1BXGB 2V0CA 3DTTA 4II3A 4MTLA 4ZO7A 1Z2DA 5TS2A 4Y2SA 1ZN8A 1JG7A 4M1MA 3TSCA 3E8XA 5AK4A 3ZLUA 4NDZA 4AL4A 3U39A 4BX3A 3RVPA 2VDWA 5K1ZA 4B76A 4EAAA 4XQGA 3GF4A 4WEQA 4JXXA 1SVLA 3SC6A 1EX6A 3STYA 1RMTA 3L8CA 3OPNA 1ZI8A 1OGJA 2BMEA 2RBKA 1V6CA 3NHYA 4RVOA 3SK0A 1Z6YA 5K3AA 3EN0A 4Z4CA 4Q03A 1XQVA 2YVAA 3FPAA 1MXFA 3KR2A 1S1MA 1MVLA 3V7WA 1T5BA 5B58C 5AH0A 4KUGA 3BOSA 4HFNA 4O4IF 2JCVA 3SSNA 2GZDA 2VHEA 4LVCA 1RVDA 1TEZA 3VDQA 2G80A 5C2JB 2ZCJA 2QN1A 3DE1X 4K9QA 4MQEA 3ESYA 4OJYA 2ENWA 4DRXA 4NJEB 2C2KA 3ANTA 4KO2S 2ZBFA 5HJ5A 2P35A 4U2EA 5CVTA 2FDXA 1Z6ZA 5DBHX 4AJPA 4MQ6A 4N7RA 2HRDA 3OWOA 1MRSA 2CJFA 4XX0B 3EC1A 1T10A 2J30A 2RHWA 2E4AA 2OC9A 2W2MA 3QVTA 4HRXA 3ZGYA 4A5OA 4DEYA 5K8LA 5FBKA 1ACMA 2G9UA 2G6BA 2ZT5A 3LDUA 5E8RA 3ZKWB 3VVMA 2EP8A 3PPVA 5E4FA 4GI5A 5KX5A 1CR0A 2GD2A 3W5BA 3O8LA 2VJOA 4QDOA 2ZCVA 3FWHA 2HO4A 4M9QA 4E31A 4FW8A 4BNKA 1E0SA 1O8CA 4B74A 4I3GA 1YJCA 1E2PA 1EGAA 2XMRA 1EFLA 3O94A 1IONA 4BLVA 3CNBA 3N8DA 4CM5A 3ZLBA 2PH7A 1L4MA 4GL4A 3DOIA 3K6KA 2XOXA 3PG5A 1DINA 4JC5A 2UDPA 5JG7A 3BDVA 1KXZA 2NSDA 5G1OA 4PG8A 1QQAA 3KB2A 3PQ8A 1HDEA 2E5FA 5CB6A 4F5DA 5KYYA 2H9IA 1CYEA 1N6HA 1PLKA 4JKOA 4CF5A 3K8YA 1VFPA 5HM6A 1NAHA 1F2UB 2W58A 4J2TA 4K9NA 3T94A 4DCGA 3ZZMA 1JG4A 1N2XA 1CUDA 3OEEA 4JR2A 3H05A 1ONOA 4M1YA 3R0XA 4KXVA 4PAWA 5SZIA 3T5TA 3VPGA 4DYDA 2QV0A 5AW6A 5EPOA 4XTCS 1PWYE 1KDZA 5KYUB 3OF5A 3BMNB 2C0PA 4JZYA 4ENUA 3RVNA 3WGKA 2G9ZA 2YJTD 4WRRA 3KFVA 2LCQA 3HKBB 1GP2A 4C5BA 4QOEA 1E1LA 3LX4A 1RWXA 3FSEA 5ESDA 2NWQA 1G8PA 3M6FA 2VHCA 1HTTA 4QREA 2MHCA 4FSDA 1D6SA 1ZQ1A 2VSOA 4PW0A 5TEWA 3REOA 1BMQA 3CX3A 4RJIA 4AYXA 1B41A 4YJHB 4YQYA 3QVXA 4XASA 3X1JA 5DYTA 3GBSA 4MS1A 1ZVQA 2BMFA 2O8NA 3RVJA 1SCUA 3U17A 1I3LA 1T9GR 2A9KA 4OYYA 3V7YA 3QPBA 1XTIA 3HM2A 5D85A 3VM6A 2VCEA 1U2GA 3LUCA 2VWHA 1F6DA 1WOYA 1ZI9A 2BY4A 1RXUA 1ZS9A 3ESCA 2FJUA 4XD7D 4LGVA 1SGWA 5KQSA 1JW9B 5JYBA 3Q8KA 3WLSA 4YMLA 3BWBA 5JT1A 1WR8A 5EJ2A 2P2ZA 3KWJA 2FN8A 2H00A 5IU6A 4WBNB 3HJUA 2BPOA 2QMHA 3Q6IA 1PK9A 3VU0A 4WHMA 3W6PA 1NG9A 1N6OA 5BUSA 2QVGA 3KZCA 2IUSA 5I01A 1JFFB 4EMBA 3DE0X 1U0TA 3MBKA 2VLIA 3S55A 2FPLA 3T1TA 1BN7A 3BRWA 2I8AA 3C5HA 3UBMA 4IUCS 3F6YA 3R76A 1R12A 3IBYA 1ZIDA 3BK2A 3R5HA 1VMAA 3WYCA 2UXBB 1DS6A 4WACA 2IUFA 5A0FA 1GNVA 3LQFA 4KFRA 1RLIA 2J67A 3UQZA 3IBGA 4OSPA 1IULA 2P2YA 1XEWY 1DIGA 3V7FA 2WPNA 4LJ4A 1XCOA 2XX3A 1QDEA 1U3UA 4YXWD 3CJQA 2WWWA 1XVUA 4X3PA 5DTMA 2GXQA 2IEBA 3O1LA 2G4CA 5ICFA 5KQRA 3QFCA 3E27A 3EXAA 4AZTA 2VNHA 3TDKA 3UHPA 5ELXA 1RKBA 4V0LA 1KEEB 1DEXA 3D2CA 3K2BA 4OAQA 2P3OA 1RWMA 3V4SA 2IS6A 2QR5A 4Z4FA 1IMJA 3PLNA 3B3AA 4AMGA 1GR0A 3PJGA 4YDRA 4Y9RA 4EB6A 2H92A 4CKWA 2HQOA 3HDGA 4EEKA 1VSUA 2R6JA 3GRKA 4HH0A 2CXPA 4R2XA 2XMBA 3BJZA 1GEGA 1VKNA 1V1RB 3NWPA 4Q47A 4G0ZA 4UVDA 3TNFA 4ZV4A 2Y2UA 3GDOA 5EWMB 5CR9A 4Y98A 4CKYA 1ABFA 1Y3BE 1IY0A 4KQKA 5K8JB 5IEBA 3S2YA 1OWNA 4MIYA 4OMFG 5HRAA 4D99A 5K8TA 2VT6A 1GQQA 3AY6A 1LDBA 4GLJA 2G4LA 3SEZA 5C8ZA 3UCXA 1GYPA 4YYEA 2CZCA 2C2OA 4MW0A 1M2EA 3NORA 2H4XA 4QGSA 1CS0A 4M8KA 1DJOA 1T6XA 5GM1A 3RREA 3SYRA 1UJMA 1GNQA 4D3YA 5JRZA 2PEYA 4HR7A 4OCZA 1AO0A 2WSBA 1I1NA 1MIHA 1B74A 1IUOA 1D4FA 2PD6A 4NNPA 5B58T 1C7QA 1RI2A 1H1DA 2Q62A 2W22A 3L43A 3Q12A 4RANA 3TG8A 1MFPA 2ZLBA 2EJTA 3GARA 4BL5A 2FLVA 4NX2A 2VKQA 3NEYA 3HVUA 4C4TA 4LJKA 2X8JB 1LSUA 3L0CA 4P4TA 4YC7A 4DEVA 1CZLA 2X41A 3G0DA 3O4VA 1KGSA 4MEJA 2Z6AA 1J07A 5CDHA 4M54A 4B4WA 4RTRA 2DM6A 1FNSA 1QFSA 1LPAB 1C0PA 1YGYA 4EKIA 2O0JA 2HHJA 2GPAA 2CUZA 3FBWA 5BQFA 4IQ0A 3UZUA 4FGSA 2UXCB 1E3WB 1NUUA 5K03A 1CVRA 1GRCA 2GAJA 3CT4A 3CUSA 3G1UA 2TS1A 2VPPA 4KB5A 3AU8A 3UJCA 5A4MS 4MWTA 3ABIA 5KVVA 2QU8A 3ZWXA 3AWIA 3IILA 1JBQA 1NNSA 1GTSA 2AMLA 2D1SA 4OB7A 1LS1A 4OQZA 1IG0A 1UXIA 2EG5A 1V7ZA 4KIUA 3RRNA 3ESXA 4DGSA 1LK7A 4MWZA 4U5QA 4J91A 3GJ4A 1UK6A 5E1OA 5E4YA 1CDZA 3MK31 3PXDA 3PHHA 4WOKA 3UJNA 1AF7A 4WGGA 2FEXA 1E2MA 3HLKA 3KU1A 3QFSA 5EVCA 5EJ9A 3BM5A 3U2QA 1XG5A 4FQ8A 4Y0VA 2IELA 1O9GA 5G0WA 4H6XA 1R0KA 3CLTC 3CVOA 1J8MF 2Y8EA 3ICCA 4IZOA 4DLTA 5KC9A 1KIFA 5JAHA 1QF6A 5LA6F 5LQAA 3IOMA 3NYIA 4L76A 3AVQA 1JA1A 2V8OA 3IT2A 1YOVB 2BKVA 4R8MA 1W49A 5FFMA 1NA5A 1ESZA 5TQ2B 5DI3A 1FFHA 4Z7JA 2XRZA 2R7NA 4FM9A 3L5OA 1VE1A 2I3GA 4L9WA 3UXYA 1WL8A 3GJXC 4DFDA 5EKTA 2N3ZA 2XHEA 4RK7A 3FIUA 3RTCA 1DCKA 4ZO8A 5GV7A 5F52A 2A8YA 4WPGA 3PNPA 4P3YA 3UWMA 2C42A 2BFOA 4QFBA 4WXMA 1U7XA 1JFTA 3BN3A 1KI8A 4BJ6A 1T1EA 1XMOB 3A0RB 3JYHA 1KFJB 2JHFA 2YJ3A 4REOA 2ZBDA 3CU5A 2AOVA 4EDHA 2Q2NA 4XR4A 3A4TA 2P7HA 2WJ4A 1M8PA 2P3SA 1TIPA 3LVQE 4QWWA 4BP1A 3BXOA 3HEAA 5GOTA 4E21A 4HLCA 5A1JA 1R4MA 2JGRA 2OECA 1A0OA 3HFRA 3OFKA 5BSKA 3LT4A 2YBEA 3DULA 3LYLA 4LBWA 4P4SB 3JVUA 5C8YB 4IXDA 2KYRA 1AA6A 4FFDA 1Q6YA 1G59A 1Z35A 1XXHE 2G04A 1EE9A 2ZVPX 4BQEA 4B7XA 1T1GA 3VO1A 2OSBA 3QWIA 4TTTS 3ZCPA 1BXGA 1T8PA 1QCYA 3ZE6A 5E7IA 2RCNA 4Q6WA 1DTSA 1RQLA 1T5TA 5H81A 3N5CA 1MTZA 3PDIA 4YV1A 1HKUA 1XF9A 1TVKB 5HA5A 1WUKS 1GRRA 1L4KA 2FQ1A 1INLA 2ZB7A 3L93A 3WMEA 1Y6GA 3DL0A 5AHKA 4BRUA 5EE1A 1ZD3A 1F7VA 2A94A 5JANA 2XUJA 2B20A 1NQOA 4AZ0A 3A9TA 5EZSA 3ORHA 3PTAA 4UE6A 2W6MA 1D5WA 4JXJA 1IXYA 5K6RA 1YZTA 2QVLA 4GZ6A 1L5KA 3WGLA 4F2PA 1QE5A 3E81A 1FXUA 2O7RA 3GLKA 3WLHA 4B3GA 5TF4A 1EBUA 2HA4A 1OYVA 1PX2A 2GSDA 3I6YA 2MOKA 4ZAZA 2YTZA 1JDBC 5HUQA 5T3UA 4INAA 2R8YA 2XITA 5DHUA 5JCXA 1X0VA 2A33A 3A2MA 3NX4A 4QJIA 1GVHA 2ZYVX 3B3QA 3TPCA 3C16C 3AVXA 3R24A 1KYYA 4XX0A 1DZ3A 4TSFA 3W2HA 1H4SA 5JCJD 3PKIA 4E1VA 1OLUB 3GGGA 5CLHA 4P4GA 1VMIA 4QKQA 1AOXA 2P65A 3OZGA 4NARA 3FPLA 3ZKWA 4AROA 4E1AA 5WRFA 2YZKA 2AW5A 2BVNA 2MSCB 1MV5A 4OG2A 5FPHA 1FJXA 4G4SO 4DXHA 4H2DA 3FUTA 3I6BA 3Q8XB 3W2FA 5TRTA 4R1LA 4W1QA 1UZUA 2H48A 1J70A 2E37A 3JR7A 1CJKC 1M1YB 1S2NA 4KDCA 2GEUA 4RPCA 1H1LB 4FQ5A 1WB9A 4MVJM 2GILA 3RHSA 5ICGA 5AXAA 1CF9A 4GYJA 1CZNA 2J3LA 3RIXA 5B3KA 5I7RA 3F97A 1OXTA 4URFA 2M9MA 2BLLA 3SJBA 4OREX 5BMVA 5KOYA 2PJZA 5IG2A 3HL0A 4MQ4A 3FVRA 3W5UA 4C6SA 2FG6C 1KC1A 1JHYA 5ICCA 1MGPA 4ETNA 5AW4A 1TC2A 2EKBA 3F46A 4QU5A 1RM0A 2WWIA 1YE8A 4HVLA 1T6NA 1X2EA 2BJVA 4B3FX 3U7HB 2Q0HA 2Q6LA 3HKBA 3SZOA 4E2WA 5HG0A 3IIIA 1X1EA 2BJHA 3OTIA 1W4RA 3H86A 4X1IB 3V8VA 2J8ZA 3QUQA 1R16A 3LAWA 4KEAA 4R83A 1VTKA 3PNVA 3BH0A 2BCEA 2I71A 4TMWA 3BJEA 4FONA 4PYOA 4NJMA 4N5HX 1RNLA 4N8SA 1QX4A 1SIWA 2JAQA 4P84A 3N0VA 4LW8A 4I8XA 1YQTA 4L4RA 1I33A 1DRUA 1PWEA 5CHEA 2QYTA 1Z5WA 2AG1A 2B4TO 5AK5A 5EXEA 2ZCUA 5TMDA 3V42A 5JADA 4Q9AA 3DDOA 2M1ZA 4B7AA 1S2IA 2Q4OA 4L6CA 2IHVA 2IXBA 3WIDA 3ESAA 4FBLA 3PNKA 1L7OA 1AO3A 4ZT3A 5KJEA 4LYGA 2YYZA 3DEZA 3KNZA 1I6WA 2J09A 4MKHA 1OMOA 3GCZA 4ON9A 4UHHA 1OE0A 3GFSA 4UUPA 3GWZA 4G85A 4EVSA 4F3CA 4C7VA 4ZTBA 1QOZA 3VO2A 4KG7A 1NUPA 1G1AA 4DJ5X 1BGXT 5K05A 1XTZA 3T3DA 2GXUA 2IIBA 1X39A 3DBOB 3DOHA 1WHTB 2W8BB 3FZGA 3K6RA 1XDBA 1YR2A 5EZ6B 4DTIA 1FFBA 4FDAA 5EUCA 2R87A 4IHKA 5FLYA 3KYJB 1VLMA 1EFRA 3OIGA 2GZMA 5ER9A 4DCUA 4UUOA 4O29A 4KSCA 3LHDA 2V8BA 5DYGA 4HP8A 4YCNA 4MW4A 1NKTA 3IEVA 4AXBA 2UZ4A 3QKIA 1Z3CA 2I33A 4HS4A 1BFUA 1XJ5A 1XZPA 1RQ2A 2F1JA 3RD5A 5CJJA 2UZ1B 4I50A 4HV4A 3UMSA 4H7EA 5IUJC 3CLHA 4QGAA 3FTQA 3C39A 1LGYA 5I47A 5DU2A 3EG9B 1K8XB 1OI3A 4TXJA 3REQA 5FTJA 1NIJA 4LRTB 3OUZA 1FTYA 2QTRA 1KEEA 2O07A 4GI3A 2QLLA 4O63O 4CQLA 3L8FA 3QVGB 2WIAA 1NSFA 3ORSA 1MAAA 2XUQA 3PCXA 1E7QA 1I80A 1O2DA 4J75A 2Y76A 3QEJA 4RMNA 4YCDA 3SFZA 3FPSA 3N2LA 3BICA 2Z5GA 4NIMA 1ZUWA 1U0GA 3BJIC 3CLSC 1I51A 4Q4JA 1V1RA 4O02B 4DJTA 1AKEA 2AC4A 5EWMA 1G63A 3UW3A 2HKIA 2A14A 3ZDEA 1E2QA 3BTVA 1UINA 3EVGA 1CUHA 5HKBA 2ZB8A 4YUXA 1X92A 5C3MA 2P5SA 4AUNA 2ACVA 3FWZA 1S1CA 4WZAB 3AR2A 1SVNA 4PO3X 2QJRA 1MCZA 1ZC4A 2XKJE 3T5GA 3ZNNA 4BMSA 2DFTA 3IPLA 1TU3A 1XNGA 4P35A 1GITA 3A7EA 1E3SA 1VXOA 1P9LA 2QN3A 4G89A 2FQQA 3IP9A 3LCRA 3SJUA 3F7OA 4IHJA 1IBKB 4LHSA 4PHTA 3TDMA 4EGAA 3L4KA 1SC4A 1C4XA 1HQDA 1QGZA 1RHKA 4C7JA 5FB3A 3CH7A 2APJA 4EHJA 2V1UA 2QORA 3E4CA 4HDKA 5L3SB 4ECEA 4TKMA 4JH0A 2FE4A 4IYRA 2YHBA 4BVLA 2NYVA 1GWNA 2Y2VA 3VH3A 4DMKA 1H05A 4M7PA 3KYDA 2B5WA 4DHEA 4JSTA 2B0CA 2QP3A 4PBTA 1FUKA 3MRXA 2ZTVA 5H70A 4EMTA 3WNQA 3TL3A 4C0KA 3ZGOA 1RAAA 5IAJA 2OFFA 1QVRA 2R65A 4HGPA 4LHEA 3E3NA 1VCHA 1MAVA 1CJTC 4OBXA 1DQSA 3O74A 4WCVA 3UMVA 3Q8MA 3ZW8A 2VCHA 1RACA 3RVSA 3BRCA 4EGQA 3O75A 2OD9A 2C8LA 1NT4A 1AE1A 1UC5B 1SQ0A 1UWCA 3BXXA 4KUHA 1QIGA 2YWBA 4Q1BA 5EP1A 3WGMA 2Y0PA 3SEAA 2IHNA 2D0IA 5LZ9A 1C7RA 2OHJA 3HJRA 1GNTA 3LHKA 3QTLA 4BPRA 1ZY2A 4YMIA 3I9LA 3VKHA 3GROA 3N07A 5REQA 4B85A 3K9WA 2Y1WA 3DL7A 1ZGGA 2Q07A 2QRHA 4BVJA 1CQXA 2JPDA 3HU2A 3RIMA 3ZQ6A 2M6SA 1N2GA 2Z4RA 3ZDQA 1NFRA 1LW7A 4F4HA 1Q92A 4WY2A 1I6LA 1U8CB 1ZOIA 1OFVA 4AJOA 3NAMA 1DADA 3ASUA 5BV0A 1QUFA 2V7VA 2W7TA 3EGIA 1YOVA 2RHRA 3MB5A 1OX4B 4KR9A 3QX3A 4PSDA 3ND5A 4JI6B 4AZWA 1MAUA 2WMYA 3GGSA 3GMDA 5TQ2A 2ORYA 4BEBA 4Z53A 2OO5A 1YQUA 1M9NA 1KARA 4C2UA 1PJCA 2O3QA 3NC4A 4ZK2A 1H2XA 4R2LA 2OFXA 4D56A 2WVJA 3O90A 1V8ZA 4QYIA 5K3FA 3T1VA 1BKDR 1V16B 4C3ZA 1X1AA 3A06A 1YR3A 5AUPB 3I8XA 3NV7A 4XVHA 4HQFA 3TW0A 3WZMA 4D0SA 3M3HA 3RUIA 2P91A 4OHWA 2CXSA 3MJSA 3RAJA 1ZU4A 4Q7EA 1P2VA 1YZLA 3AYZB 1V45E 1AQNA 1N9GB 1QJCA 4GR9A 1C3XA 3M1LA 1QQBA 1ECFA 1E2JA 1VHQA 1UIRA 3A1WA 1REQA 3QZUA 1WCYA 4W1RA 4EF6A 3W2GA 1AB5A 1DXYA 2X8AA 4PN3A 2C8VA 3GPLA 4RGVA 4HCJA 3X1DA 4C3VA 1ORTA 1EHYA 2EGGA 1HEIA 4K6MA 4NBNA 5GONF 4P4SA 1A7JA 1JAXA 2R84A 4HJXA 5FOQA 1MRNA 2FW8A 2JLCA 3CRW1 2C2WA 4ED9A 3KQPA 4UVGA 4RMIA 1QVWA 1RJWA 4PPGA 4BP8A 3AFMA 4EIWA 1QQ5A 1ZO8A 3REFA 4YT4A 1SXJA 1Z07A 1EFKA 3HRKA 3CNHA 3FJYA 2YJNA 1RABA 3OZEA 2GXAA 4D9HA 4ND2A 3QJ5A 3S4YA 5LU9A 1OWMA 2WICA 2PL5A 1OD6A 2UYYA 1FNDA 1GRVA 1R5OA 3SKYA 4UHJA 2VQFB 1JHOA 1O9HA 1WDTA 4P6VF 2ZIWB 1MHPA 1QAMA 1AX9A 3A6ZA 3EQ8A 4KVAA 4HNTA 5K45A 2JFYA 1LXCA 3AF5A 3KT6A 3OOEA 3UK6A 2IIPA 1PE0A 1JU4A 4H6PA 2AHOA 4E11A 2ZZMA 4KK4A 3AVTA 4DPMA 1KMHB 1PLLA 3ELBA 2PRKA 4NYMQ 4BO6A 1JBEA 2BDUA 4S12A 1UP4A 3VZBA 2J31A 1K5PA 3ZX4A 4C0JA 5K6AC 4HDCA 1C0LA 1AHPA 3HBFA 4LY0A 2LUOA 5BSGA 4XAQA 1SRRA 3OU2A 2GZ2A 2OCPA 3QVJA 5D1HA 3RJMA 3EEOA 3UT6A 4CV3A 1ODLA 1KEUA 1PI3A 3L6CA 3UG6A 9ABPA 1OLUA 2HU2A 1ZP6A 1G8SA 3FCOA 5JH7B 3KEQA 1Y42X 2XRMA 1XZAA 3RH0A 4ECAA 1WMFA 1YKSA 1Z6GA 1JWLA 4NE9A 4LXTA 5NULA 2P4UA 1OH7A 2CL7X 4UFNA 5D8DA 4C03A 3FNFA 1IUKA 1CC1S 1NN5A 4RCZA