5KAPA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-(4-(phosphonobutil)hypoxanthine
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
159
Chain Sequence
b'TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
molecule tags Transferase/transferase inhibitor
source organism Trypanosoma brucei brucei
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
total genus 45
structure length 159
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kapA00
5HIAA 1ZN7A 5EUCA 1D6NA 1G2PA 2JI4A 1G2QA 5IPFA 4RHUA 3N2LA 2HCRA 1ECCA 4X45A 1O5OA 5ESXA 1DKRA 1WD5A 4RANA 1I0LA 1QB8A 1DQPA 2C4KA 1ZN8A 3DMPA 1XZNA 1DKUA 1OPRA 4LYGA 4RAOA 1QCCA 1CJBA 1OROA 3G6WA 5K51A 4RHYA 2JKYA 4F8EA 2GEBA 5HKLA 4RABA 1W30A 4QRIA 1BD3A 1L1RA 1O57A 3KB8A 1I14A 1QCDA 1Y0BA 1UPFA 3GGCA 1I5EA 1PZMA 1FSGA 2JKZA 1A98A 1UPUA 2WNSA 4LZNA 1QB7A 4RAQA 5E38A 1DQNA 1U9YA 2E55A 3H83A 3GGJA 1YFZA 4JITA 1ECBA 2VFAA 4PFQA 4RHTA 4PAWA 4RQBA 1ZN9A 4WMLA 4LYYA 1G9SA 1P18A 1VDMA 3O7MA 2H06A 1A96A 2PS1A 4P81A 1JLSA 3DEZA 4X44A 1VSTA 4P83A 3ACCA 5ESWA 5KAPA 2P1ZA 1P19A 3ACDA 5BQPA 1J7JA 3NAGA 5BQOA 1G9TA 3OZFA 4QYIA 4WN3A 4RV4A 3LPNA 1IBSA 4P86A 5IAOA 2YZKA 4JLSA 4MB6A 4P82A 4S2UA 1Z7GA 3M3HA 1XZ8A 5JV5A 1I0IA 1QK5A 1P4AA 3ACBA 4M0KA 2XBUA 1QK3A 4LZAA 1U9ZA 1XTTA 2AEEA 1HMPA 3OZGA 5BSKA 1V9SA 1XTVA 1TC1A 4OHCA 4M0PA 5BRNA 1I13A 4FYMA 4RACA 1LH0A 1QK4A 1UFRA 4P80A 1DBRA 3S5JA 2PRYA 5KAMA 4RHXA 1ECGA 1A95A 1R3UA 1AO0A 4M0UA 3OHPA 4QYIB 1JLRA 3QW4B 4TWBA 3DAHA 1STOA 4LZOA 3HVUA 1ECFA 2H07A 2FXVA 1NONA 4RADA 3MJDA 1A3CA 1GRVA 4IJQA 1P17A 2JBHA 1A4XA 2PRZA 1A97A 4RQAA 3LRTA 3EFHA 1BZYA 4KN6A 5JSQA 1XTUA 2EHJA 2DY0A 4ZFNA 1MZVA 3GEPA 1L1QA 1OREA 4Z1OA 4P84A 3MBIA 1BD4A 2IGBA 1TC2A 2H08A 1HGXA 1NULA 1GPH1 1ECJA 4P3KA 1VCHA
chains in the Genus database with same CATH superfamily
3UA4A 4AICA 4BO8A 4LJKA 3KPUA 3AHJA 4CDMA 5A3JA 1W49A 4OQNA 4QL3A 1BYIA 1SM4A 3BHIA 4GBMA 1WCXA 2HCRA 3L49A 3LAWA 3M4NA 1YBFA 2YTZA 4MCIA 3I2IA 2HJWA 3BAZA 3AOGA 4UZEA 1EFAA 2NQ2C 3NUQA 2ERYA 1RXIA 1S02A 2XAAA 1CF2O 1FDIA 3V1MA 1EUCA 3VXKA 1YR9A 1GPKA 1X1RA 3GRUA 4DLNA 2IV3A 3DMRA 4CE6A 1UT5A 3I64A 1PZGA 4OKIA 4OLJA 1UBJS 1P4RA 1YE5A 3SF8A 5L7TA 3LH5A 1K88A 2QPOA 2DKFA 2PUWA 2B37A 2V45A 1FW8A 4WACA 2EEZA 1Q1NA 3LK7A 4DB2A 1SCUA 3N2KB 1Q77A 2IYLD 1Q11A 3KEQA 2WOOA 3JWGA 5TE9A 3RU7A 4BWFB 4CF3A 4DGQA 5KYTA 3L0OA 2PBLA 2D3WA 3PHGA 1VL6A 3HZHA 4BO4A 1AQUA 3WGHA 1IBCA 4ND6A 2C92A 5DO9A 3R9WA 2ZYVX 5H3LA 1DAKA 2VT7A 3MOGA 2FI1A 3DM5A 3OMLA 1WWKA 4G1BA 2EL9A 3E3MA 4JBIA 2R751 3A6LA 1SBCA 1XTKA 5HFJA 4BO6A 4E5KA 4QFMA 3OQHA 2ADFA 2XXBA 4GUDA 1G16A 3WC4A 4DNOA 3CQ9A 2MINA 4KVFA 4NONA 4PTYA 2OFWA 4Y2YA 4B8ZA 2W0MA 4YV1A 4FS8A 2GXAA 1X9IA 3LUJA 1ZEMA 4P1ZA 4EHLA 1YRWA 3BIOA 3L6BA 4IYRA 2ON6A 5E2AA 2Z98A 3IJ5A 4DABA 4DBLC 5CA1A 1U6JA 3B70A 4I1YA 5JXJA 1OY1A 2GM9A 4GR5A 4QU0A 3MF4A 3RR2A 2R4UA 4EW2A 2JFFA 2OMKA 1O6BA 4WI1A 2B2XA 4HDNA 1BU5A 3SKXA 1D04A 1LWNA 2DFNA 1J9GA 3AIIA 5HIJA 3VYRB 2D1FA 3BMNA 2P5SA 1OYWA 3OM9A 1SXJB 3VX3A 3ROPA 2NXCA 3D4NA 3GFPA 3U4HA 3U1BA 1P7VA 1LCIA 4QXOA 2Z9BA 3RIMA 1L5YA 3ICEA 5AOCA 1SC4A 4WSOA 5H0IA 2V58A 3ZNOA 4BQRA 3GBSA 5ALDA 3LLCA 5H4GA 4JKOA 4FFBB 1MB9A 1HEYA 2BJHA 3KKLA 1QLWA 1MC4A 3BHNA 4OQDA 4DPKA 4JV5B 4OB7A 1NNUA 1YR8A 3AR2A 2VTEA 1Z6ZA 4IRXA 3TW6A 2WVAA 4W9NC 3I5MA 4QDKA 2X19A 3OI7A 3WK4A 1XPRA 1W1UA 2PS9A 3AZPA 5KOJB 1N9KA 1I4TD 1YQEA 1ZH6A 2W8BB 3C3PA 4G36A 1IAVA 5BO5A 4L76A 1GYQA 1M8KA 2C9DA 4RVDA 3WLQA 4BKOA 5HNKA 2R6AA 3DNFA 3OCXA 1E1MA 1FYXA 1K3UB 2H7YA 3DBRA 3MXOA 4ZO4A 1T4CA 2KX7A 1FSZA 2VRCA 3WLOA 4ENQA 1L4UA 5M5BA 2ZIAA 1QP8A 3W2TA 3G9QA 5BVHA 4HGYA 2ZSIA 4BTVA 3HKCB 3PGKA 4DMCA 3U4DA 1LBSA 1K6JA 4HDOB 4URWR 5TV2A 4W1QA 3UJ8A 2OAEA 4UNPA 1UXJA 2CLMB 1X77A 5TT1A 3OX4A 4REOA 3B1YA 2JCGA 3MUOA 2PG3A 3DBVO 3NHFA 2CHQA 4ZANA 1MV5A 4B3TB 3I9V6 2ZQ5A 3ILVA 4JIGA 4ACAA 1P9OA 3PFHA 4UEWA 4DXDA 3CX3A 2BEWA 1E1KA 5JC1A 1LNQA 3KXKA 4ON9A 2XKKA 1ODJA 2EBFX 4QTYA 1CUUA 2OD2A 3CS3A 3IIKA 2OXIA 5CA1F 5AVTA 3DBOB 1AC5A 2OZKA 3QYPA 3UFXB 4MYRA 5EKXA 3G8YA 1SK9A 2ZB8A 5DN6A 4B6PA 4BNNA 4PLWA 1AHIA 4HAYA 4QBHA 3H5OA 3PX3A 4I46A 3K0CA 3ND5A 5L3VA 2N3ZA 1COWD 1ODIA 3PD0A 2AI1A 5TMEA 5FTWA 1Y5LA 1QCZA 3PYMA 3QXGA 4B79A 1Z6AA 3F73A 2NYAA 3GLKA 4RWZA 2B25A 1MJHA 3NQ41 4RNCA 5FH9A 1R6VA 5TNXA 1EX9A 2BR3A 3ISVA 1IONA 5LA6F 1T2VA 1QGYA 3AR8A 3EULA 3K31A 2P7IA 2ETVA 1GZHB 3GMTA 3MCVA 1X80B 4IIUA 4TVOA 4XUEA 3SZRA 4NFYA 4LV5B 2AHOA 1JEDA 3RUEA 2LWIA 3IOMA 2WWHA 1QCDA 5JXGA 5JALA 4RA9A 2NSJA 1QO7A 1PZMA 2YBDA 4J1QA 2QSUA 4Q7LA 4BHTA 3AF6A 1C81A 3OZTA 4R2WA 3UF0A 1DADA 3IEUA 4EHHA 5J1TB 3OZVA 4NENB 1X0VA 1F7UA 4ONEA 3GRRA 4MO9A 2PX3A 4FBLA 4E46A 2IUYA 3IIMA 5CDSA 1YU9A 2I0FA 3JD2A 3OE4A 5A4JA 4C4SA 5CDGA 3JW8A 1RYZA 4FILA 3DKIA 4XVHA 1S3SA 2AYXA 3GRCA 4HX5A 4MAAA 1Z07A 2RJOA 1XCJA 3KDPA 3P8ZA 1ZUHA 3H42B 5KVQA 2DQYA 1D5CA 1AGPA 3W78A 1W7AA 4FJ0A 4G5RA 1Y6ZA 3K2EA 4M7WA 4UCWA 1SZJG 2A1TS 1RXUA 2CKMA 1NBOA 3RJTA 1N2JA 4GOND 2GPAA 5EQDA 3SIRA 3VDQA 5BSEA 4EVQA 2VSNA 3U4CA 5JVDF 3LK6A 1V26A 4ZN6A 4D3ZA 2XQJA 1Y3DE 1IOZA 1OV4A 3W1VA 4X92A 4Q7KA 5IC6A 3DD5A 4BV8A 4NJMA 5K4HA 5DYNA 1AKEA 3FLAA 3WLLA 3GLVA 1OXUA 2I62A 3ZHSA 2BEVB 2GUWA 1G5QA 1KKLA 2BEJA 3EXHC 3MK31 3M49A 4H3SA 1YF3A 3HV2A 4CV0A 3GD7A 1J39A 4TQ9A 2QN8A 1E3LA 4L4RA 1L7NA 3A10A 4FCTA 2VTVA 4TXLA 4IYJA 4MQ4A 3TNJA 3CONA 3D31A 1QGAA 1T8UA 1FLDA 3RUAA 1G2IA 4TLDA 5DIFA 3TE7A 3AJRA 3U17A 1ZINA 3UJNA 4PG5A 1TO2E 3AUKA 3UUFA 1GNPA 1ZNWA 1KI4A 1I3CA 4KE7A 3WYDA 5IU6A 3PQ2A 2XGGA 1QC5B 3Q98A 3DE2X 3VOSA 2IU0A 1N77A 1A2KC 4B2IA 4AUKA 1VKZA 3NWJA 2R1VA 4G9EA 4I14A 5I01A 5HCIA 2UVPA 3L8DA 4CU2A 3HXTA 4AWBA 1PGPA 1CUXA 3WGYA 4CM9A 1GZ5A 4Y1RB 1EI9A 4WGFA 2QNIA 1KEUA 3WBBA 1E6EA 1LNSA 4NHOA 4HO1X 2D6FA 3TRHA 1WDWB 2JCXA 4MS4B 5IMSA 4M9UA 4RTRA 3EVFA 1MO5A 3KUCA 3DCIA 2XA1A 4X7PA 3REQB 5CG2A 2G82A 5ICFA 1C4KA 2JFBA 2HXYA 3HL4A 4CBVA 2CCKA 2QK4A 2NO4A 2AV6A 2BW0A 1QOPB 2PXXA 1TJNA 1U2GA 4AVYA 2PZGA 3JAKA 1ECPA 2AFHA 1BJTA 2BONA 4OG2A 2RIPA 4Z0PA 1FZTA 1V71A 3INNA 4UPVA 2FW8A 4WE3A 3V32A 2VDWB 4X54A 3RVDA 1JG4A 1W5TA 4AJJA 3MQFA 4RJ2A 2O1XA 3ZOZA 4ZPXA 5JD3A 2JJ2A 1FTWA 3HU1A 2E7ZA 4HDMA 2I4MA 5CXXA 3ONNA 3V7UA 1OKKA 5DCUA 2ZI3A 4V0OA 2VDOB 2BKLA 3D5QA 1EFRD 3INYA 2RSLA 4D9GA 4YT2A 5GWXA 1LJ8A 1UKAA 1GV1A 2ECPA 2AE1A 3MAJA 4AAYA 1U4SA 4D0NA 5TVGA 5K99A 4YV0A 3U3KA 2JLRA 5GM2A 2Y4NA 2COKA 1UQUA 3SSMA 3ZHOA 4FD3A 5CAEB 3H6HA 2AJLI 1IJEA 2RE8A 4FKZA 4P7BA 4QVGA 2O0MA 3BCHA 4G0YA 4UBLA 4HVTA 2OHOA 3CE6A 5DGCA 3C6KA 1G42A 1A98A 1NQVA 1QVAA 4MR7B 5HK8A 4QT0A 5AVWA 2Y0DA 1NOJA 1HDOA 3H75A 3GUHA 4LDQA 2Y2UA 3CFYA 4WMLA 3ET4A 3ZWMA 4DIFA 4I1RA 5JEDA 4EPWA 5JD4A 2ZWOA 4E4TA 4WL0A 4QM7A 4EB6A 1DTWB 1WSAA 3L5KA 4YCLA 4PNZA 4DEXA 1XNHA 1JI0A 2C58A 1FNSA 1N6KA 4AO8A 4RFVA 4HB2A 4PAMA 3PRHA 5C18A 2QRUA 2AH5A 4ER7A 1RWVA 3V4LA 1QS0A 4RS4A 5IW8A 4QPCA 4KFCA 1TQDA 2VPXA 1UT6A 4QYSA 3ZNQA 4BBPA 1LSJA 2RKBA 2YZKA 3G9TA 3OQPA 2QMOA 4MKIA 1P1KA 4DLRA 4H9GA 2GZAA 3L8EA 5JNLA 2OLKA 2X0KA 5HZHA 2GARA 5K0ZA 1E4EB 5CJ2A 4WLOA 3UMJA 1N2OA 5L3ZA 3GJRA 1I36A 1KORA 1XK7A 1JKJB 4H18A 3M34A 4F9GA 4AUEA 3ZHTA 1TIBA 5DI9A 1F06A 2YH2A 4IUBS 4ZEXA 1DL5A 5B3LA 2G9VA 3KD2A 1M6EX 3QXHA 5P21A 4FMCF 2NMVA 5DK4A 5E7JA 4KDCA 1GAEO 2NT3A 3RVBA 3UJ7A 4CKCA 2I1QA 3FN4A 4EDFA 3I9LA 4ZT6A 1XZKA 3S2FA 2JIZA 5ICEA 1KXZA 1FYVA 1DGQA 1EEHA 1R4MB 4UU8A 1G5PA 3L93A 2ZRCA 1KZ9A 3MMPA 4BQFA 3S2GA 3PR2B 5TGZA 2XRFA 2OOKA 4PR3A 2B98A 3TTSA 4BQSA 2IOYA 5HJ5A 4Q3OA 3E7XA 4I5DA 5CJJA 1SN7A 3MJDA 4NZPA 2W2XA 3W2IA 2FR8A 3LVFO 2PO7A 3GGGA 3I2YX 5AYVA 4ES6A 2ZI5A 4N40A 5WRFA 4K0RA 1L4LA 2ZU0C 4N39A 5F64A 3ZDFA 1ZJ4A 2JLAA 3HZZA 5GPBA 5J2TF 1GCUA 3I1FA 4GI1A 3SN6A 2D7CA 3K30A 1PK7A 1GT91 5JTUA 3H2ZA 2D2IA 1I3OA 3EIXA 3IO3A 4JL8A 4OL0A 4HH3C 5JSZA 1KEKA 4ZMBA 5CFMA 4ZV4A 3VH1A 2WF6A 4HQ0A 4M9RA 3WVNA 4ZQIA 4B3GA 3JR7A 2K7ZA 2CVOA 3EYAA 4JP1A 4UPDA 5DV9A 2BFEB 2CLCX 4NG5A 4MHSA 1O1YA 2ACEA 2M2IA 3G7SA 4TZTA 3RTAA 3U3XA 4FB5A 5BYKA 4PQGA 1OH8A 1LPNA 3GGOA 1YS1X 4LX8A 1JYFA 3OJWA 1CUWA 1G8AA 2PKYX 2G0AA 1ATZA 1V6AA 3C98A 1H6DA 1LK0A 2CFSA 2DFTA 2Z8YM 3GLFE 2JLVA 4Y9RA 3UAYA 3QXCA 1XSEA 4PHHA 1YU6A 1E6KA 3A7EA 3W7VA 4OHWA 4CMAA 1XVIA 1RYDA 5DI3A 3N6VA 3RGGA 2H5JA 4Y6OA 3G6WA 1KKMA 4MB0A 2CN1A 4RZ2A 2I91A 1WMFA 4OHPA 2O57A 3CLUD 4GWLA 4U0JA 3TB6A 1V25A 1P1BA 1W48A 3C6XA 4NXNB 5FADA 3FGNA 4WA8A 5ILGA 3RSLA 4C4RA 1DLJA 2RBGA 3DOOA 2G4CA 3AM5A 1KYWA 2A4KA 1N9GA 2JCYA 1MAVA 1K6MA 2F3SA 4LZNA 3T4XA 2BFBB 5I3CA 2ZRNA 2PM8A 4QIHA 4D57A 1X7XA 3TL6A 3AUTA 1QKJA 1ZD9A 4ABYA 3KL2A 4KGZA 5J2UA 2PUAA 2O8CB 4OKNA 1K68A 4RSMA 2IHUA 1ZNXA 4ROTA 4W7IA 4HDKA 3O73A 1Z4LA 2QVLA 3LUCA 3PE4A 4LRWA 4B7ZA 1B93A 3E1KA 2D2FA 3AFOA 2QTMA 3ZHUA 1XMOB 5IAKA 5B6JA 3TCXB 3VC2A 3F1LA 3IHKA 1GKKA 2Q21A 4N5HX 5HFNA 3PP8A 2R4TA 2ZIXA 3UMSA 1L3CA 1FP2A 3OJLA 3N76A 4EBBA 1UKCA 1R6TA 4LY0A 3H97A 1ZGHA 3L6RA 4EM6A 4UE3S 3OZAA 1IM8A 3RS8A 1M67A 1RRCA 1I7LA 4HFMA 4QOJA 3A6FA 1W36D 3T3NA 4FUTA 3RYTC 1OH6A 3FLMA 2IPNA 4ZYTA 4G1EB 4CDGA 4W5RA 3I42A 2ZG6A 1T34A 1A72A 2B5WA 2H1FA 2XQVA 3GLTA 3UAXA 1ZK2A 5JNRA 1WW3A 1GGMA 2YQ4A 3F9CA 1SG0A 1CY0A 2XVZA 1R9JA 1RPTA 3QWAA 2PH7A 3ROMA 1IAQA 1NU8A 2Q9AA 3DZHA 1L0BA 1SUSA 3W3ZB 3ZHYA 3DR5A 3M81A 4IDEA 4DSUA 4EHAA 2WHEA 3OQBA 1M2EA 1XRSB 3CZAA 4H7DA 2FPLA 4TVKA 1YTUA 5FWXA 3WLJA 1A04A 6Q21A 2I7VA 3JQ8B 1MB0A 3OMWA 2WP0A 4BUJA 1ZD1A 2HZ7A 3QWBA 3ZVLA 4WERA 2C5HA 4IDHA 3MAGA 4URXR 1YC5A 1FJ2A 2WJAA 5J5VA 4PVDA 3BFJA 4JB0A 4Z4GA 2V3WA 1WQ1R 3K0SA 5KTYA 1R0KA 4DNPA 1S2GA 4CL0A 3BRQA 2Z2JA 1RI1A 1PI3A 4MZDA 4RV5A 1T2CA 3CA8A 5AESA 4PYIA 1L5LA 2GPYA 1BXRA 4XIYA 1J0BA 1PFGA 1ZLYA 1UH5A 3TAXA 3PC8C 4BO9A 3A05A 3FHJA 2EQ5A 3JD4A 3LCJA 5AHOA 5HS6A 4EFKA 3QMMA 3BAFA 2AOUA 1N2ZA 1UBCA 3STXA 3RTDA 3WGJA 3Q4GA 4QQ8A 3OFKA 2YJNA 1Z0SA 3EQZA 5FT9A 3GX1A 4KR7A 5LMNB 1VXRA 5BSGA 1N2CE 2EKDA 3PUWA 1SVUA 2CK3A 2GDZA 4IXNA 4PC2A 4PICA 2A30A 4QASA 4AJHA 4EG7A 3K6SB 3FI9A 1CF9A 3GVHA 3RBVA 3VSAA 2OA0A 2MIIA 3M6WA 5TVKA 5C7LO 3OOWA 2IH5A 2Q62A 3MJEA 4M22A 3TKAA 4EW1A 3AUXA 2WWYA 1NKVA 4DJEC 2QZPA 4AC9A 4EY6A 1ND5A 2VHEA 5C4GB 1M2VB 3R44A 2V7PA 1E1LA 4QQRA 1IC6A 2AB0A 1Y0BA 4OVKA 1K3FA 3P4YA 2EP8A 1RI2A 2D1RA 2WKRA 4UAVA 4ENVA 1RXVA 2OORA 4BZWA 1SIUA 2VJDA 3MBOA 1BJRE 5IFLA 1NUHA 3HA5A 5JCOA 3RFFA 5A0TA 4HNGA 3MTDA 2H1OA 1BXZA 4CQLB 1A8PA 4HX9A 4LQDA 5G1PA 3WO0A 3TRJA 4I9UA 2NNLD 3SJCA 1B42A 3TBFA 2YMLA 3Q85A 5E9JA 5ES3A 3W5SA 4J0GA 4V02A 1ELOA 1IFXA 3D54D 3I23A 1IN7A 3PIRA 4ZGBA 2UYYA 5EAIA 1XWFA 3O4FA 3UAZA 1RPJA 1D2EA 2F3TA 2WDZA 2ECFA 3DDZX 2JHCA 1VYHA 2YHUA 3A8TA 4FMCB 1V9CA 4GICA 3RIXA 4ECEA 3CNOA 3H8WA 5ALFA 3PEYA 1PP4A 3V5NA 4R05A 4O2BF 5HCNA 3D7LA 1S89A 3B85A 4INPA 1P91A 3GQVA 3UC5A 2CXRA 1TK2A 2HA5A 2VDVE 3GO4A 1K4MA 5H3HA 3Q11A 3VPCA 3WLRA 4N41A 4UM7A 1T1GA 2IYUA 3E9NA 4WT7A 5E9QA 2F3QA 2YHAA 4DQVA 8AT1A 4PN7A 2YZ2A 4KBGA 3PJRA 1PSWA 3GEEA 3PV0A 1U9ZA 3ILYA 5BSFA 1QG2A 5AKLA 3T1QA 2ZUDA 3DXXA 4GMXA 2O2SA 3O92A 3JZFA 3AR3A 3OF3A 3CRNA 4JEMA 3TRDA 1PT7A 3GRFA 2YX1A 1Z2OX 3GLHA 1B2LA 2BEWB 3HYLA 3TLBA 3PQ4A 1IDN1 1SKAA 1RADA 3LF2A 4RSGA 4WXHA 1G18A 4GYYA 3RASA 5EIXA 2Q5CA 4M8KA 1JN0A 2D2XA 1C7ZA 2DY1A 1U0LA 5J2TB 3U6KA 3BIWA 3D8NA 3EXAA 4FT4A 2FW0A 2CL0X 2OG2A 3UICA 1O7JA 5IN4A 5C35A 4JT8A 1UPAA 5CFNA 2FRVA 3HVUA 5E7IA 3KPWA 4PAGA 3SLKA 3EDYA 4ARAA 8ADHA 3IEVA 1SUIA 2BFDB 2O2XA 3P0IA 3R0VA 4MW2A 4CL3A 2J3EA 4FEYA 1E8DA 1HT2E 4KO4S 1XQWA 2GN6A 2ZETA 2GCOB 4DIDA 4L51A 1JPNA 2PH1A 4X20B 2BBWA 3HGTA 4ZV7A 4DJTA 2J3DA 1XCPA 3BM5A 1I4OA 2XMDA 4KN6A 5EE0A 4CUJA 4IILA 4CODB 1RM5A 3DQZA 4PZPA 4TOIA 1BHQ1 1OLXA 1QUEA 2AQ8A 2QE7A 1J2RA 3KZVA 2I6GA 2VLBA 3HYRA 1PHPA 4RA9B 3AVOA 5L4LA 1UDXA 1BN6A 5LCXA 2I6QA 3E8MA 1XZCA 4M1SA 1IVYA 2X8JB 3LM8A 4HNTA 3MYRA 5AI5A 2J46A 3K70D 5THQA 1S2LA 2O2HA 2NU8B 3TRIA 2QTWB 1XZDA 1OWOA 2WAAA 3EJ6A 3Q40A 2YUTA 2J5RA 3B36A 2X0DA 3V6LA 1R6AA 2EVWX 5GTDA 3EVNA 4RTMA 2HYIC 3T41A 3DE7X 3IJPA 1GSOA 4R2LA 3F0TA 3WKAA 4OHUA 4XH9B 4ACBA 4HLCA 5FHRA 3SXJA 5JMTA 3R8FA 1XZJA 2MSLA 2ACKA 4N4AA 5BT9A 1KDOA 2C8VA 5ALPA 2H2IA 4DQ0A 1W5SA 1E18A 5LJIA 4EQ6B 1NJ6A 1QBGA 2P79A 4KOEC 4ZYUA 2YW9A 3ABZA 3S0JA 3GGDA 2F1OA 1QHSA 1MPXA 2KQUA 2WNHA 3MNFA 4EO9A 5AD1A 4R1MA 5D1NA 2GHIA 1MEJA 1TYAE 2AZDA 3CINA 1DG3A 1JUDA 2WKPA 2IP1A 1FLVA 1K7EB 3QJYA 3QRWA 2ZRPA 1X94A 2YV2A 2PZ8A 1X3SA 3Q3IA 4GZ5A 3C8ZA 2APJA 4HK4A 3H1TA 2BUBA 1LV7A 1LVHA 2R7NA 4KSBA 2GESA 4Q82A 1W4ZA 5J5CA 3T9DA 5E4JA 2H57A 2PN1A 1Y3IA 1VSTA 5EIHA 5AR1A 2IODA 5B4TA 1P5RA 2D13A 2KLBA 5EXTA 4ENRA 2P4EA 5IC4A 3EUFA 2WJ3A 1JLLA 1RQPA 2QDXA 2QVXX 3HR8A 1GSIA 4F86A 1E0KA 5C5CA 2W2QA 1JSZA 4MWTA 1ZMXA 3RVNA 4NQRA 1B0AA 3AONB 4P6VF 4US0R 5JYEA 4AN0A 2I4TA 1QRSA 1TKCA 1E2EA 1KDTA 4JAVC 2IPMA 1CNFA 2I3GA 2I4IA 5KNCH 3NGLA 3QFHA 1W0KA 5B36A 3ZCUA 3OZGA 4KRYA 4DV2B 3O8DA 2G80A 3PCXA 1RRKA 5ALRA 2HB6A 4JUBA 4DR6B 4G0PA 5CB0A 3OC6A 4N5MA 4W5JA 1G7TA 3FTPA 1YDWA 3VTAA 3ILXA 3KOZA 4UD6A 2OKGA 2ZJBA 1WHTA 4JX9A 4YP1A 5KWJA 1JFLA 2RIRA 4LKRA 3V6MA 4CMKA 2Y6UA 4XWOA 5AW1A 2ZJ8A 1XFAA 3DZDA 2WD8A 3DGFC 2J48A 2EZ4A 3FFXA 3NEPX 3P27A 4RIEA 4BWYA 4F1JA 1SIBE 3E48A 8GPBA 4AECA 4C7MA 1O8CA 2HDWA 1YI8A 1RCTE 5FPSA 1UDRA 3DFZA 4DLVA 3GAMA 3KUKA 5L3SB 1NV8A 1UC5B 2JH3A 2P2NA 4AJ2A 3V8PA 3HM2A 3E2IA 3V8MA 5E2BA 1H3FA 2XNHA 1DUVG 4TMVA 3ZWNA 2XCOA 4OXKA 3QXJA 3PQ8A 2AEFA 1LRLA 2IELA 4KR0A 1Y3HA 2WQ7A 1YAJA 5CX4A 3T5DA 1KETA 1OBVA 3GMIA 1JIJA 2AXQA 3K5IA 4MJ3A 3WRYA 3GLIA 3ESAA 4ABTA 1H1LA 2YIJA 2FVYA 2X22A 3MTAA 3PT5A 3VPFA 4HV4A 1W5EA 3ESDA 1Z5UA 4LBZA 4F2PA 3G82C 3QEBZ 3KHSA 2AQHA 4BV9A 1B8OA 4C3VA 1UAAA 1T3SA 2ZCJA 4GNKA 4WNAA 4JOSA 5E0OA 4CR6A 1XRNA 1I32A 3EGXA 3SXUB 3B9RA 3MGBA 5BURA 2WKQA 3NOQA 2OGUA 5IT5A 1XTPA 5JYCA 1JHYA 1E0JA 4HUQA 3F3SA 1SCKA 2HHJA 3K9HA 2A0WA 1KFJB 4B9EA 5ECWA 3Q3EA 4EX6A 4F4DA 3R3ZA 3T3OA 3PC8A 4JJAA 4ZMSA 2UYGA 3RS0A 4A16A 1JQ3A 1RHJA 2WM2A 5FOVA 1HTTA 2W6MA 2HBRA 3I2FA 1Z7BA 4RM3A 1IXSB 5BRAA 5CFOA 3N7AA 2PPLA 1TU0A 2RGYA 4X6YA 4AB1A 1NPDA 3V4SA 2ZUFA 3HRIA 4QPPA 5BUSA 2VTKA 4HR7A 4O2BB 5LIRA 1WV1A 1Z9BA 4C89A 4HH1A 5C1PA 3C4JA 3M1AA 3SZUA 1CDOA 2JA1A 2WTUA 5FR1A 3DL4A 1JGTA 3KYDB 1NZFA 3BSYA 2VDLB 3I61A 2ZYTX 3GFSA 4D41A 2W70A 5DSZA 3R9XA 2GDJA 4QKQA 3L7OA 1OTHA 2CYCA 2OHJA 4EQZA 2O06A 4U02A 2QENA 2VP5A 1L5GB 3U60B 2R8YA 1CSEE 4IVNA 3ZKWB 2GBLC 3EAQA 1CTQA 2G72A 1W5AA 1U0JA 5CTJA 3EIOA 2WPDA 3CLRC 4TTIA 1BHSA 1X1EA 5D2CA 3ZS9A 3ZQJA 1W1IA 1HDCA 5COBA 1JIKA 2GZSA 1HE1C 3T3EA 1GXSA 4GOKA 3IDSA 4L9SA 4UDNA 3VZBA 4W9RA 4FOPA 3C3BA 1HSZA 5A2QA 3KOUA 2ZBRA 1XMSA 4ETNA 2HWUA 2I6UA 3COPA 4ZRNA 1U8TA 2QM7A 5CPBA 5KS2A 1TQ2A 3OWHA 4QELA 4K6HA 1AX9A 3ANSA 3PFWO 3AZOA 4GDMA 1SCJA 5IS2A 1JG6A 1YO6A 2D5IA 3AETA 1GGHA 2XD9A 3T7DA 5JS8A 4ARZA 2Z5FA 2PRYA 3R4CA 2R1VB 3RHSA 1X9GA 1I1HA 2HLDD 4PSVA 1CDZA 4XJVA 4Q24A 4K6GA 1QIGA 2FG6C 2JI8A 2CJPA 4CV2A 4IGFA 4G26A 8LDHA 1J99A 5GJWC 2GEVA 5LZ2A 1G55A 4RORA 1Y3FE 3A4IA 3M4XA 4L4UA 1GNQA 5AIBA 5K09A 2QLLA 2QG9A 2WJYA 3KXLA 1F4PA 4RA6B 3IX7A 2Q8NA 4AQ7A 5KB3A 2CV0A 3IKLA 1UC9A 3B6EA 3HG7A 2XGSA 3JZDA 4GRIA 5BP7A 2FFQA 5ALHA 1SPXA 2ZWAA 1ZICA 2EG9A 3S1SA 4FE3A 2FOXA 3G1UA 2HWKA 4P31A 5LU8A 2CHVA 1U0RA 4KI7A 1KP2A 4IFIA 3GJSA 3OKCA 4ZXFA 2WTAA 3VKFA 3CUYA 3X0DA 3ZJYA 5FEUA 1L7VC 1L8AA 3U80A 1NP3A 5I7FA 3A3OA 3T5BA 3QIAA 2DE0X 1RCUA 3CWCA 4Q3BA 5KZMB 1AQNA 4C08A 5A3VA 1RJGA 2YYYA 3AHDA 4NZ9A 3CISA 1I1NA 2IPOA 1YDHA 1I3NA 2AG8A 2JGAA 3AHFA 5AOVA 4DAEA 3O7WA 4NTZA 3WL5A 4BLPA 5KTMA 2GYUA 2IZ7A 4JYCA 3X1JA 5KVAA 1EVJA 5AW9A 1F7VA 3UMRA 1DKRA 1P1IA 1JB9A 2XAUA 3UXYA 2HF7A 3O8OB 2ZIUB 5HEKA 3WZLA 1XAIA 2RH5A 3MJFA 4IO0A 1ZJYA 4JGGA 3ZKAA 3W5HA 4GKKB 2E82A 4HRXA 2HO4A 1GDDA 1NMYA 1PL6A 3GLFA 3DT9A 3CVUA 1KYVA 3T3IA 5CD9A 2ONJA 2JIDA 2DG2A 1U2QA 3SJZA 4RZ3A 4Q19A 1UOQA 2DUMA 2Q2WA 2QTGA 1E5TA 2P9CA 4G9GA 1VJRA 3P2EA 5EIAA 2HNBA 3U3MA 3GT0A 3SQNA 3URKA 4UQLA 4LJ7A 3LG2A 4U2GA 3X1MA 5BR8B 1R27A 1NI4A 3HB5X 1ZVQA 2Q2QA 5HF9A 4B4VA 1N8SA 4DUGD 2HRZA 2VFAA 1V5WA 3D4LA 1T5DX 2L18A 1RE0A 4PZCA 2NUPB 4M38A 1XC7A 4WY2A 4RIHA 5EI5A 2HBQA 4RESA 3VU3A 4BYMA 1WQ3A 2I7CA 2Q6KA 2B4RO 2VP4A 2W11A 2XYHA 2XWJI 2ZSKA 3C97A 1M6NA 1N1MA 1F0PA 3CLTD 4NSNA 4Q9JA 3W6UA 2JLUA 3EVGA 1SUCA 1HT0A 3KE8A 1KJYA 4MW4A 3PVSA 3HDYA 4RULA 5DHPA 1CQIA 4K3UA 1WRBA 4ND2A 1K1EA 5T57A 4ENWA 2EG5A 4M0DA 5MGBA 2XUJA 4M9ZA 4CCSA 4PZEA 2QJTA 2AN1A 4QRHA 5DHAA 4RF5A 2RHRA 5T6MA 1ZH8A 2BKVA 4C9BA 1ZMBA 3MJVA 2Z5LA 1GFWA 1PNOA 2R6CA 1MUUA 3E9DA 3NX4A 4KIFA 5JHGB 1WHSB 3C0KA 4YRRA 3SC3A 4E88A 2P8SA 5AVJA 5F98A 3PNOA 1H0SA 1WBBA 1W9HA 3OBIA 2VJAA 4I50B 1U2DA 1XU9A 2QUKA 2F7SA 3O3CA 1QGDA 2XRMA 1G7CA 1E0DA 2FMIA 5DTIA 2EZUA 2PFKA 2RONA 1FOEB 2XWQA 3HLKA 3NWPA 2ZYHA 1L4MA 3T61A 1BDIA 1UQRA 4P53A 1KDVA 1BXRB 1PGOA 5DRYA 1H23A 1XCBA 1MKYA 5B1DA 3W2GA 4C07A 1II8B 1TJ3A 1YIDA 3EW7A 3BFVA 4WKNA 3KKNA 3B3JA 3I4FA 4ZALA 4BCCA 3OPXA 1Z74A 3I5UA 4PAOA 4RVOA 4MKXA 3IUBA 2AOUB 3L8FA 2PUVA 3NIWA 4FE4A 1R5JA 4JODA 4MX8A 4PZLA 2O2JA 3HCCA 1QE3A 1H4SA 2JFOA 1YJAA 4J16A 1II0A 5KJ6A 1J1UA 1STOA 1QIJA 1V1MB 4ZODA 1CF4A 3VNRA 1AQJA 1S9HA 1K9VF 3H1GA 4U7HA 3OJEA 1QVWA 5TF0A 4B48A 5GONA 2B35A 5LYJA 5AIAA 2X0RA 1LVUA 2RGBA 3P97A 3CCFA 3IS3A 4B44A 2I6FA 3O8QB 4R7GA 5KJCA 1T2DA 1E6WA 3A3NA 3VR3D 3N2EA 1SIWA 4MI6A 5DVZA 3W9YA 5KTTA 2J9ZB 1TA9A 4OLFA 6CHYA 2FLKA 4BB5A 4AP9A 1V1RA 4LTMA 1M76A 1TFUA 1W0JD 1Z47A 4GIBA 5DBOA 1DEKA 1N57A 3RIEA 1E89A 1OFVA 5F2NA 3MJTA 4L5AA 3JYQA 2Z4RA 4M8LA 5C34B 2AR0A 1T3GA 2VUUA 3HVIA 2CCJA 5FOSA 4IPTA 4DSZA 2G4LA 2P9JA 3C24A 1GTSA 3R7BA 1E61A 4AYWA 1YVEI 2PRIA 3AV0B 3FX2A 4MDHA 2N47A 2XUAA 4A82A 4CKEB 4LF4B 2HA4A 5JLJA 2K6GA 1B0PA 1KQOA 1U63A 2ZYGA 2CLLB 3R7SA 1VMEA 2J5KA 1PR0A 3WQHA 2PWZA 4DT1A 3MAAC 4E09A 1TUEA 4KAFA 1OWNA 2PQ6A 2BSAA 2OD7A 1LDYA 5K0LA 4DFDA 4HFJA 4DJAA 4J94A 3MELA 4R1QA 4BB6A 4YJHA 2AW5A 1C0LA 2P27A 4RGQA 5IWAB 3J7TA 4I6JA 4BIIA 2ZJZA 5D3ZA 2P0EA 1QNLA 2A3NA 2B36A 3DFKA 1YVDA 2DQKA 2MHCA 1XYGA 1MC8A 1V11A 3HZOA 1KZ7B 3QX7A 3REOA 2CT8A 2XKAA 3MTQA 2H4YA 4L4SA 1UKVY 2Q6OA 5BV7A 1KA9H 2NZ2A 3H5NA 4YJGB 3H9EO 1R0WA 1Z0IA 1AUQA 3PGXA 4M7PA 4ARBA 4BCBA 3TLCA 1IY1A 2YV4A 2PUEA 1XNJA 4M60A 4HCJA 2PS1A 1T4GA 3HDHA 1FA9A 2P1ZA 4UKDA 4J90A 4AJ1A 4RJTA 1X1BA 2HAEA 2JFXA 4GDFA 3M82A 3NEYA 3Q3HA 3DG9A 4LZLA 4M9XA 1NG9A 1EVEA 1I01A 1DZ3A 2O8NA 3QKRB 2Q7OE 1RLUA 3C6BA 2PKQO 4JLSA 3E84A 2WEKA 4MHOA 2JW5A 4AJIA 2PWPA 4MXDA 5E4FA 4YJ3A 2YKGA 1PV1A 2OCIA 4FZRA 3BRCA 3LL7A 3EVAA 3U13A 1JI3A 1H22A 3IT2A 3KJNA 2DUWA 2VAWA 2FEAA 2D62A 3VRHA 4MA5A 2WVJA 1JPJA 3D4OA 3LCCA 4XPIA 1DARA 4KP7A 1C3JA 2UUBB 4YMWA 3HXMA 1ACJA 3S5JA 4EKNB 4EP1A 3M6MD 4CLXA 1JE1A 2GEKA 2OV4A 2OXRA 3ZV7A 1DCMA 3KHKA 4F7DA 1GTZA 1PJBA 4NCIA 4EJMA 1A9RA 4DL9A 2X3UA 1AGYA 2YZMA 1BX0A 2EFEB 2KLHA 2WDPA 3P2KA 2X9NA 1K86A 2PX0A 1U11A 5E1DA 1H69A 3M9LA 5FD8A 5FTKA 3SI7A 2HXSA 3VA7A 3PEFA 3O4GA 3QBTA 4QPZA 1M8JA 4EX7A 4V3CA 5AJHA 2PGLA 2HCJB 3A9UA 4MPRA 4F56A 3OQOA 1EM6A 2W6IA 4ALJA 2AFIB 3F6CA 4PG6A 2I54A 2O8CA 2HGSA 2XRYA 1NQWA 3FDZB 4XKJA 1KFKB 4DA0A 1G291 3B5EA 4IUYA 3LTNC 1SG6A 1K5HA 2BEUB 1WZNA 2QQEA 4TKVB 2OG1A 3CH5A 3O93A 3QWHA 1OH7A 4U39A 1T9HA 4MLDA 3GLHB 1OXSC 2M98A 1HZJA 3QFTA 2HQOA 4J4HA 1ECJA 4C05A 3RSSA 5IJ9A 3EFBA 5LP1A 5DHTA 4P4LA 2GERA 2FPGB 1PKXA 3TM4A 1CFZA 1YGPA 1QX3A 3PB3A 4N6OA 1HURA 1W35A 4G1CA 4O4HF 2OYCA 1HFWA 1P3Y1 4B3BA 4ZCRA 1AE1A 2L17A 2ODWA 4PIPA 4FCVA 3Q5EA 2CLEB 2CYBA 5EJGA 3EGDA 1XXHE 4YCSA 4CCYA 4XWWA 5HX7A 5REQB 3MCZA 3WGLA 3G2PA 4YJ3F 4LQLA 1WZIA 2JAHA 2X1MA 2Q9UA 3O91A 4D9EA 1EFDN 3E81A 4M55A 4KRFA 4FX5A 1ZRHA 3IXMA 1K92A 1RWOA 1PYGA 2A92A 2PZBA 3HGQA 3ISTA 2O50A 3AB3A 1LU9A 4DLPA 4R9RA 2XLCA 4E6PA 3C7DB 1FYDA 1VI6A 3S1AA 3V48A 4DCMA 4D5EA 1L1RA 1IBKB 3DE5X 2C8LA 2ZJ3A 1JFSA 4NF2A 3V4RA 4DCGA 4ZJZA 4Q4DA 1VQ1A 3C2QA 4LHYA 1UBTS 1QIDA 3HFRA 3GPIA 1NSTA 4MV7A 1P61B 1GTJ1 5DW0A 3VQTA 4DDHA 4LXHA 5ALVA 6YASA 3IV9A 1Q0ZA 5FWXB 1RYFA 2XITA 4H27A 4MEJA 1E3WB 3M5DA 1KZGB 3TVTA 2LVBA 2QN2A 2W4MA 4B85A 1CPYA 3B52X 1VLZA 3OZRA 4NR0A 2OSBA 2PZFA 4GM1A 3FFWA 1O97D 3ZQKA 3R0JA 4V0MA 2R6ZA 5EGSA 3SR0A 3T7AA 2OB2A 1E1YA 4X8HA 1EBFA 1VMDA 5KOHB 1BHO1 1BA2A 3ZH2A 2RHBA 2UZ4A 3R8XA 1D9XA 3FMFA 4P4TA 2FZEA 1T1IA 4FN4A 3FSGA 2Q5OA 1AK2A 3GLQA 3GT3A 3OA0A 4HFNA 4A9AA 4E3ZA 1F4LA 1Q17A 4BGEA 4B8WA 3RKRA 3LL4A 3AG6A 2P90A 2QN1A 3K9GA 2C00A 3S2SA 3PITA 2G1PA 3CIOA 4NCJA 2MJLA 4B3HA 4OK3A 4KIJA 2CXXA 3QYFA 4ZC8A 3RODA 4E0BA 2ZE8A 4QSHA 1Y8RB 1N8KA 1PJQA 3IT0A 5BSKA 1V3UA 2FLWA 2G9QA 3V8QA 2A9OA 4P35A 3NH9A 6PFKA 2PAFA 3U37A 2CJWB 4DGSA 3NYIA 2YYZA 3RF7A 4AF6A 4EEZA 3KYBA 4MK4A 1NN1A 3FWZA 4F4IA 5L3QA 2I4LA 1UFQA 3FXAA 5EIBD 1K8XB 3CO0S 4LDPA 2WE8A 4MDEA 5FUMA 5JJ5A 2QZJA 3NU1A 5LA6A 1LV8A 2E48A 1HZZA 1QRAA 3E7PA 2JI6A 4BFZA 2NADA 3DT6A 1SA0A 3E5RA 3T7CA 4UBOA 3UB2A 3DLAA 3WGKA 3UK1A 1LK5A 4GOJA 3O6VA 1KJ9A 1XP8A 4FC6A 3FZEA 3KDSE 3OIUA 1ECFA 2FSSA 3BBLA 2QD5A 5T3UA 4QOGA 5L6LB 1IATA 3EQ7A 5GZ6A 3VX4A 1Y3AA 4A0GA 5ELLA 4HUQB 5K6TA 3KAQA 2QXUA 4KLAA 4L50A 1T15A 4GWGA 2H92A 4M7RA 2CUNA 3I37X 3MTBA 1K06A 2DHEA 2X9VA 4XQEA 3HWWA 3RBXA 2MSCB 1GA4A 3WX0A 3AM3A 3OCJA 5IVPA 4JU8A 3U4QB 4YRNA 2FUG1 1APBA 2IX3A 3INRA 5A5FA 3JWIA 4I5IA 4M1MA 3IMKA 3OIVA 4C0BA 2KPOA 2WYHA 1Y7TA 5FWNA 5JISA 4K05A 1LS6A 5AUNB 2EKQA 1SO8A 4MW5A 4MIYA 4KZPA 4XX0A 1UP4A 2P35A 1DBQA 2VNAA 2ORYA 1TKBA 2AQKA 3DEKA 2B3DA 4GP6A 4RD4A 1S96A 4ZXPA 2BGWA 2NSDA 4LWQA 4CM8B 5EZSA 1E63A 5C7IO 2FQQA 3QVLA 1Q3KA 3ZVNA 3OZ7A 3OICA 2PL3A 4AJOA 4R68A 3L4BC 3U4IA 1P4GA 3PNVA 5IWCA 2C4MA 3ENZA 1T13A 1E7MA 1PT5A 4R8LA 3ZDBA 2C5GA 4HRAA 4RAOA 5AKHA 4F1WA 1V41E 2BHLA 3S8MA 1Z8NA 1NVWQ 3HK2A 4IL5A 5A6SB 1IL0A 3K94A 3QX3A 3Q1KA 3LX5A 2OL4A 4LOLA 1R9MA 2MT9A 1JNYA 3FPKA 4Z9YA 5JDCC 3TEMA 5AW7A 4F11A 2H4WA 1RAEA 5KWVA 4YAFA 2W2VA 3QZUA 2QE7D 1E2GA 3KKKA 1MQ9A 1QPBA 2AG5A 4RKWA 2QI9C 4A1FA 4HLNA 1SU8A 1HC7A 1ISJA 2YJ5A 4PVCA 4YQFA 2IZZA 4ZCTA 5LKAA 1RWBA 3L1IA 3OKPA 4JVNA 2AX4A 4EZEA 3AERA 1GOTA 1Y1PA 2NT4A 2PV0A 2RGCA 3M6FA 2YFQA 3UV6A 4YMTA 3R8CA 1GU7A 4I55B 3EVCA 3QNWA 2DWOA 1JLLB 1SZPA 1ORIA 4A8TA 2VLIA 1BVYF 3OT1B 1E6MA 4MRNA 5ALKA 1BKSB 2GKOA 3ONEA 3RBZA 3NVKI 1X92A 2C5SA 2I29A 3BWVA 5B7PA 5AVZA 4OCZA 4ILEA 1PN3A 4MVYA 3JY6A 5E1OA 4A4DA 5CA0F 5IZCA 3ZD9A 1N6LA 4XDHA 3ZLTA 5DBEX 1XRRA 3KQVA 4M0CA 3SQXA 4UFNA 221PA 1HA3A 3UB3A 4PWZA 1KSJA 3FR8A 4BX2A 3GZNB 4PSAA 1G20E 4YMSA 1S7CA 2AZTA 2VYNA 2V1UA 4W1PA 1FS5A 3USZA 1V9SA 1L5WA 1VA5A 2CLFB 1UADA 1RBMA 2JI9A 4LZPA 3KQQA 3GHYA 2GLXA 1DAGA 4I7EA 5E6RB 1NAIA 3HDGA 4B3RB 1M83A 3BRWA 4NV3A 4KV7A 5LR6A 4EIWA 3A2KA 4NDAA 5FBRB 1FP4A 1RZUA 4OK6A 4GM0A 2DOKA 1C9JA 1L7OA 5DEIA 3ZLBA 5KYXB 4WK4B 1Y9AA 3KKEA 5CLGA 2BZGA 2OQIA 1XN4A 2YY5A 2HNAA 3C5VA 4IO1A 1H2AS 2IYEA 2XY4A 5FNVF 3RNOA 2V9CA 4LJ8A 1NRJB 1KQNA 4HUTA 5EFOA 4I1PA 1SEPA 3M4JA 3I6YA 4NY1A 3E9RA 4ISCA 1KY3A 3A1UA 4O4HB 1RJ9B 4CG3A 3IQZA 5E9AA 4DTCA 1QH8A 2FEPA 2R8ZA 5EXEA 4LFBB 4ROSA 3H1PA 1U2TA 3PC4A 2BHNA 2X40A 3COZA 1DAMA 1RSZA 3IPYA 2B7BA 2EX1A 2H16A 2P6MA 4Y2XA 16PKA 1H2ZA 3GP3A 4R8RA 5EA2A 5GONF 2VVTA 4JUCA 5CIWA 4JCOA 3TBKA 3WDSA 4A0FA 4EG1A 2RGRA 2ODTX 2DWPA 4IINA 5AW5A 2ZRIA 2NUPA 4KPFC 2F90A 2BF7A 4RC9A 4LNHA 2XZTA 4G4SO 1I24A 1LRJA 4K2AA 1XLWA 3H9QA 1X7HA 4MW6A 4PC6A 3VDXA 3OQMA 3AVTA 3Q12A 2C57A 4IQ8A 1Y9EA 4ND8B 3S28A 3FOBA 4X7RA 1EDDA 2V1XA 4C04A 3M5WA 3FDFA 1E3IA 1PNVA 3D5EA 5DFAA 4NOJA 5K8LA 3IDQA 4G89A 4YH1A 2WWTA 5K51A 3TLJA 2JD2A 4MITA 1OW3B 1VHDA 2ODEA 4OHKA 1W29A 1OX6A 2AEMA 3DWEX 3ENNA 4Z53A 1W46A 4OM7A 2BAGA 3NHWA 1Z8DA 1Q19A 2GTIA 4XW2A 4BVKA 1OZAA 2VXBA 2GM5A 2YJZA 1NVVR 1NYLA 4NAVA 3Q8WA 3UJHA 1ZIDA 3KQKA 4XSHA 2WINI 4L85A 3R0XA 5KDLA 3N7UA 4BNKA 2W6ZA 2WSIA 3KSAC 1KAQA 4OI2A 4XWTA 4ZZ1A 4MLZA 1T5TA 3OE7D 5GMOA 3FCXA 1V8PA 3NCHA 1I3MA 4X6UA 3NP7A 5CNMA 5C4IA 2TMDA 4XXHA 4DDUA 1Z3CA 4FNGA 1IEXA 5J4YA 1ZIOA 3DFIA 4C4ZA 4R71A 1P44A 1D4FA 2WM3A 3IIEA 3L0BA 4N54A 3IFSA 4J2TA 1WM1A 5H7XA 2FWRA 4P22A 1U2PA 2RH8A 4N01A 1R10A 4PTZA 3WNVA 4J6FA 5JYDA 1ESEA 4ZEVA 2WG2A 3TZBA 5BV2P 1IZ0A 1J0XO 3THOA 4B74A 2ZBFA 1HRKA 1E6CA 3ZE1B 3F6YA 3TEJA 3QVJA 4KAXA 1J42A 1C9MA 3EPRA 1T9DA 4KO2S 3DDUA 3KJIA 3CNLA 1C9YA 1XTVA 4KLZA 1VYTA 4XOUA 3BMQB 3OPVA 1TI7A 3AI7A 1I6LA 2WB4A 1PJ3A 5AP9A 1EYZA 1WXIA 3JZMA 4G25A 2GN4A 1G6HA 1OZ0A 1Y6RA 3FZQA 5DB4A 4YCNA 4CXMA 3KOMA 4TYPA 4Z86A 5JZSA 2K7FA 2F1JA 4IJWA 4JSTA 2XZOA 3OVMA 4DF3A 2ZEJA 4GGMX 4M0UA 2VZLA 4AXBA 1QS0B 4ZCQA 5BSVA 2I5PO 1CUJA 2NZXA 3EC7A 4AFNA 4K9NA 4EVIA 1KDYA 5B30A 1GLGA 1DWOA 3HKBB 3T34A 2YNMD 4NZOA 1H4VB 4A23A 4D80A 1QRUA 2OZEA 4QARA 1KKUA 2JLCA 3FNEA 1EVIA 2A59A 4Z9BA 2FZKA 3OJFA 5HRUA 1A4IA 5HZGA 2J33A 3GNQA 3LX4A 3N7TA 3TMKA 4MICA 1VL0A 3PKJA 2J3IA 2CMHA 1V7PC 2OAP1 4FGJA 3GJ5A 3NGXA 1KWGA 1WB6A 5JIBA 2EOAA 1JDJA 1FE8A 2XMSA 3AESB 4HL6A 5CNIA 4KRXA 2IGBA 3TLXA 3WKDA 4DMUB 4L8FA 3PFIA 2IX9A 5L6MB 1R4MA 1TZJA 1PYOA 5I5EA 3SYKA 2XYQA 1JFFA 2IQ5A 1T4DA 4IIGA 3LYHA 2POQX 4PSCA 4YI3A 3K4HA 1HYHA 4ZOLA 3UUWA 5DXAA 2AFVA 1TQ8A 1YE8A 2C78A 1IPHA 2DTDA 1G17A 2PRJA 3HEBA 4YQZA 3VR3A 5B7QA 1NJ1A 2Q0QA 3VAZA 3FNQA 1LA2A 2WU4A 2FDXA 1W0JA 3EY4A 4RJJA 4G0VA 3R09A 1MC5A 3EDCA 3G7NA 2Y8EA 3D3NA 2QX6A 2WPNA 2BMJA 4ITVA 5AHXA 3EXG2 4Z49A 1G64A 2IV2X 2IYXA 3R7LA 3TL3A 2YXDA 1WXDA 1DRVA 3CWZA 2SBTA 1IN4A 1V9LA 4Y2TA 3WLAA 2C95A 3H9BA 4O4JF 4G86A 1USVA 3WIUA 2PZKA 4GLFA 4NG4A 1O4VA 3LCVB 2W4QA 3L2OB 5I3ZA 5JYBA 4C6TA 1JLHA 3K1ZA 3D3JA 1WOYA 3FF1A 5EN4A 1TL7C 1F2DA 5FFMA 3L8ZA 4HAUA 4K6KA 4PGGA 4BQOA 3THXA 3JYLA 5CA0B 3QXXA 3BJRA 1EP2B 1SOWA 5FX2A 1RQLA 1F60A 2H1SA 1JB1A 1FTGA 3MILA 5A3SA 3O26A 1T2NA 5JI3E 1IEQA 3BXXA 3K5PA 3S8YA 1M5TA 3UMBA 2Z2YA 4KR2A 3S68A 4Q3CA 4P3XA 4U2KA 2NTJA 4C0KA 2NYRA 3W1EA 4ENUA 3TR6A 1QZ3A 3KQMA 4D6PA 3EYWA 2Y1OA 3PCRB 2ID4A 1D4AA 3T1OA 5DSXA 3IAS6 1M34E 2Z57A 3CTPA 5CX1A 1DT3A 1JL3A 1OAOC 2OV2A 3JYHA 3STHA 2XNSA 2LIVA 3P9KA 4ODIA 3SQDA 1P2TA 2G40A 4JVSB 3FM9A 4OQEA 2FMFA 3K0BA 4GO1A 5ED0A 2FSGA 4MW1A 3QFCA 5ILQA 1ZSVA 4URUR 3QE3A 1JLKA 1MABB 2YC4C 5SY9A 1LPMA 2XTJA 4BKQA 2WG0A 1M7HA 1BG6A 3SZLA 1B4DA 1PV2A 5BMVB 1ZRNA 1L6IA 3VGPA 4R1OA 4FSXA 1D7OA 2QP4A 4IZIA 4DLYA 3K8OE 3GNLA 5FNVB 2OO5C 3I4CA 4WPGA 5JJIA 1E9RA 1YBAA 3VTFA 4CZ2A 3GFRA 4URVR 3KCNA 3DEIA 2XQKA 3PPWA 3RTCA 5C7YA 4E94A 1WO8A 4Q9KA 1O94C 1FX0B 1XZLA 4Q1EA 4PV7A 4CV1A 1AMUA 2ZWMA 4C0HA 3K1AB 1BMTA 1QHFA 3HMQA 2G9RA 1DKPA 2Q5IA 5D1HA 1GVNB 5EYPA 1WG8A 1XP5A 3WIDA 4CHGA 1XAGA 2HV8A 3DAHA 3HY6A 5GONB 1W8IA 3RSOA 2C7OA 2GBPA 2IZ6A 4C01A 3ORRA 3CJTA 1YONA 1SKYE 3NR2A 4QYMA 2ZFUA 1EJ6A 2OBBA 4Q3NA 4BO3A 4QM6A 4MUYA 3EFHA 2FSUA 2QX4A 4L5YA 3H7AA 4LZZA 1Z63A 3GFQA 2Y0CA 3UTDA 5ALWA 2CGEA 1TCAA 5KNCA 4F38A 1D0SA 2RHJA 3KLMX 2LV8A 2A0FA 3BCUA 2F48A 3OM8A 3EXIB 3PUZA 2COEA 1PSDA 1Q0PA 1ZX1A 2JIQA 5AKXA 4Y2JA 1CY4A 4Y6RA 4YN3A 1ZGCA 1XQVA 2IXDA 2YWCA 4KOAA 2R00A 2FPIA 2I2CA 2PCJA 4MWOA 1JA9A 1H1TA 2A7QA 3FUWA 3N2LA 5TMDA 3R6GA 1Y9JA 1J33A 5FP0A 3SR4A 4C7XA 3N28A 1IB0A 5G1NA 1U0FA 3MGAA 1FXSA 4DVJA 1DQPA 1PBNA 4WV3A 4MGHA 1WMEA 1NM5C 4ZV9A 2ZZNA 1OCEA 5BRJA 1ZHHA 2FGKA 2I7TA 3DO6A 1JEEA 5EE9A 3VH3A 2X7XA 2ZRDA 3NXSA 1HYGA 3ZGYA 2DULA 2GTPA 3QKWA 1H0RA 4DNQA 1XNGA 3LTEA 3CZPA 4RELA 3NDPA 4ZRMA 3N74A 3VVLA 2JIPA 2QLFA 1XXHB 1YZ3A 4P2GA 3G23A 1G4HA 1NUQA 2C9OA 1L7EA 4QPDA 3QBJA 3D4BA 4OHFA 4UU0A 3RFCA 3W8DA 4XJTA 4A0HA 4HHEA 3L4BA 1NL3A 1U81A 5F2EA 5JXIA 1T4MA 1PK8A 4LZJA 3WZMA 4AMUA 5BXYA 3F5QA 4YROA 4US1R 5FTMA 5IDXA 2EP5A 2ZB2A 1RKUA 3ZY2A 1RLMA 2WI8A 2B0CA 1CUVA 4E5YA 5CB4A 5KQPA 1A96A 2OKCA 1LSSA 3L04A 1OB2A 1SBQA 4JJKA 3TSCA 3ZE6A 3LBYA 1GRNA 4GSLA 1A0OA 4EUEA 5A0VA 3SJBA 1CRQA 2F8MA 4RPCA 9ABPA 2XTZA 3KT6A 1LDBA 2LKDA 3B3AA 2VHVA 4XWAA 2A1UA 2ZRHA 3OSZA 2O8EB 5DEOA 3Q7TA 4NCAA 1F6BA 3ET5A 5IAOA 2PX2A 5KPDA 3U4MA 5I9TA 1FUIA 1CUAA 1AF7A 1AKRA 2BLNA 3VZDA 4EH1A 5M04A 2R5NA 6ABPA 4OO3A 1JR2A 3BSWA 2AMYA 3TVDA 4ARSA 4BTLA 2BE9A 2OM6A 3U7HB 1D09A 4LOHA 4C6HA 1Y9DA 2WHYA 1QGED 1Y1QA 3D8SA 1CUIA 3ADOA 1D1TA 3L7AA 1YRBA 2IHYA 2WA1A 3DYBA 3OOYA 1O5IA 3FOEC 4KO3S 1TAUA 1U1FA 3DUFA 4D8VA 1QG0A 1FZQA 2I2XB 2YICA 4DT1B 5C3MA 4CL8A 4M37A 3EGIA 3MCWA 5K0TA 3FSGD 3QPDA 3OIDA 1X42A 3Q2KA 3NTUA 1L7QA 1Q6ZA 3Q87B 4L9WA 1V7CA 1XE3A 1HE2A 2ZTLA 4CG0A 5FIUA 2ZM6B 1GQ2A 2XQGA 4NPCA 2QZZA 2AHRA 4WVFA 1WTCA 3JWPA 2YZ7A 3OT4A 1UZUA 2VUIB 5AI9A 2WMNB 4F6LA 3R9XB 2ZI6A 4NFSA 1E1DA 2FPPA 1OYVA 2A1IA 1ZGBA 4Z99A 3VHXB 4BDSA 4BCDA 5A2GA 2ZIZA 2GEUA 1ZOIA 5U1PA 2I67A 1J49A 2HU5A 3WFZA 4BAUA 4GBED 1IBLB 4JEUA 2Q1TA 4REMA 1M0EA 1EFHA 3IAHA 3K35A 2Q0XA 4N12A 2P3SA 1ZMOA 4OUKX 4YACA 3TK1A 1VP3A 1QFYA 4IH4A 4U0KA 5IKMA 1UC4B 3RK1A 8ATCA 4OI0A 4CDRA 2JBAB 4I9HA 1Z5WA 3NIDB 2WLTA 4L8WB 3RUFA 4D25A 2HH9A 4IVQA 4Z1MA 1S6YA 1QIKA 1MORA 4YMHA 1QDLB 1HEUA 1GPWB 1GGKA 2XEDA 4UAGA 1QZUA 3RJ9A 1ZJJA 2H65A 4DCNA 4MDYA 2EJBA 5CHYA 5LKRA 3L7JA 3W3AD 4DMFA 3OO0A 3KSDO 3JALB 3RUPA 2GRJA 4XD2A 1I1QB 4IIJA 5KSYA 3SVLA 3R6DA 1ZGGA 3MFYA 3JD1A 4O2AA 4BZQA 4BX9A 4WCFC 5T41A 3G5LA 5FPYA 3HLYA 5K3AA 4J43A 1PLJA 1N5LA 4E70A 2ECOA 3FF4A 3H2YA 4YUYA 2HU2A 4PX9A 3B2EA 2E4VA 5BPHA 3CX6A 4XUGB 5LP6C 1B16A 3M8KA 1AZWA 3B1KA 3D6UA 1GSAA 3R75A 1SC6A 2OUKA 1X8LA 3QLVA 1GARA 3FUVA 2W6ID 1OXKB 3N0WA 4ETWA 2FU5C 1A5SB 3M6XA 1PEKE 4NE9A 1NRXA 4XLLA 1P9LA 1UPCA 2O2GA 2P3LA 2V9ZA 2GOYA 3LIPA 3QY9A 5EZYA 5LZ8A 4B43A 4DWOA 1M0WA 2OFPA 1YRLA 1XBTA 2QD2A 3DBRB 4IS3A 4PY2A 1SURA 2WU8A 3GGJA 3TFQA 1C7FA 4F91B 4TYNA 1QXSA 2W90A 4PAWA 4RHTA 3QI2A 3HO1A 1KO7A 1EX6A 3K5WA 2M9MA 3RU9A 4HSEA 2CVHA 3ROEA 2HDHA 4BQIA 1KPHA 2EBHX 4CI0B 1TCCA 4KXYA 4TLAA 5AHWA 3WLPA 4S2EA 1J07A 1ZW6A 3Q6IA 2MYNA 1H94A 3CURA 4JB8A 1MG5A 4QWWA 4DIBA 1PDVA 3TPZA 4YNBA 5DN6D 2BFFB 2AI3A 4Y6SA 4DQUA 3X1ZA 4J1TA 3RVSA 4Q02A 5M29A 3JASA 2EKBA 3WMGA 4I6GA 4YECA 3EPKA 4I4CA 2DX7A 2ZULA 4J6EA 4RV4A 2JHPA 2OHFA 4QTTB 3WWCA 5L4NA 1D0VA 2I8LA 4RL6A 3KWJA 1QHHB 1W85A 1LX7A 4IDFA 4TT3D 2A5YB 4MW7A 1I3KA 5A7HA 1YI1A 1PL7A 1Q91A 3AO0B 3ZD6A 1MX3A 3SDZA 1C4WA 3QKSA 4BO5A 4KQJA 1FPMA 3U48A 2NSLA 3RS7A 4D4MA 5K45A 3JS5A 3BGWA 3AFHA 4OHCA 5A71A 2EJTA 3L7YA 1ADJA 3MD0A 4BE7B 1T1SA 5ALEA 1LH0A 1Z6QA 3TLKA 4GQBA 3R41A 4EEXA 4HLUA 2WOJA 3GVPA 3NHAA 4KNVA 4E5VA 4EF6A 1NTOA 1PR6A 1R74A 5F1PA 2FETA 5G3ZA 4EKGA 5CCEA 1QPZA 3KQSA 3VO1A 2JBAA 1F17A 3HV0A 4K26A 4E1BA 5KSOA 2G6TA 3M7IA 5JADA 5P8WA 2H5EA 1E5LA 7GPBA 2J3HA 1TJ4A 1I3LA 2C42A 2VF5X 3FZYA 3KJZA 1URPA 3T3MB 1UEJA 7ABPA 4MHTA 2W6NA 4RHCA 5CT6A 1DKOA 2EIXA 3NHYA 4DWWA 5C46F 4NBKA 3FPLA 3F71A 1Z2DA 4IJQA 1OFHA 2VSQA 4D8XA 4YY3B 1NVBA 4QVIA 3U4QA 5GJBA 2WWRA 5FUBA 1SKQA 1Q92A 3BRWD 3LHFA 3RYIA 1K75A 1EDEA 4NU8X 1FMCA 3EVTA 5H59A 4B6RA 5LVAA 1UP6A 1CNEA 4L0CA 1DAOA 3QNMA 2TS1A 3S2ZA 1BKYA 1MPTA 3QNUA 3UUEA 4Z1OA 5AJUA 1DU4A 2F4VB 3M6IA 1CBUA 1GKYA 2W37A 2I22A 9LDBA 3Q7PA 1C8KA 4HJXA 4BB0A 4WZAB 1LFAA 4OSOA 3D59A 4JKYA 1EVQA 3V8RA 2OCPA 4YWJA 2O8EA 5EJ9A 4UHFA 4UHCA 2JH9A 2MDTA 2VYFA 1E1RD 5E4TA 2B4QA 1SRQA 1LI5A 2B82A 4MYTA 4Q05A 3B1JA 4KPYA 1G5TA 2ZLBA 3JVVA 4FE7A 4F5WA 1W4RA 1TU4A 3IUNA 3O83A 4G4IA 3L18A 2DFLA 5LWHA 1ZN8A 4LIPD 2R79A 3OCYA 3QEMB 2A33A 3LY7A 4IHAA 5DHUA 1ID8A 1CEEA 1RJWA 1TM5E 2CNLA 1Y48E 3C16C 3I09A 3IIJA 3K0KA 4KWIA 2F4NA 1Y1KE 2P9TA 1Z38A 3I9JA 5CT8A 4REQB 4GQAA 3EOAI 3EMBA 3W7BA 3G13A 1T35A 3HQ4O 5AW4A 1OX5A 1PFUA 4IHJA 4WXPA 1JQDA 2B4YA 5AUQA 1TEHA 3BMNB 3ZWXA 5DX0A 4JJEA 1Z4IA 2IXTA 4IV8A 3KKQA 5EP2A 1SUEA 3K70B 2YN2A 5DM0A 2WWFA 4OFWA 1YZKA 2H54A 3I4LA 3FKJA 1PJCA 2J31A 5JATA 3IE1A 4J0IA 3KETA 2ZREA 3AIKA 1EFKA 1PS8A 4RCYA 4B3XA 4KE6A 2H06A 1I2BA 1VJGA 1PNRA 2BT4A 2GM3A 2QN3A 4BMSA 2P4UA 5EWLB 1M2OB 3WTBA 3OH8A 5JSUA 1QV6A 1HBJA 3E0XA 2VWQA 1ACMA 5F7JA 3SC6A 2GN2A 3DJFA 3ER6A 4BJ5A 2QBYA 1X1AA 4UARA 4MGIR 5FI5A 1Z3IX 1LB1B 1B74A 2BGNA 2HMTA 4S0XA 1ABEA 1XZ8A 1Y4DE 2GNAA 2O2YA 2VK4A 4G0QA 1USUA 3LI2A 2O8DA 2ZZKA 1ZAKA 2Y0BA 1T0UA 1XF9A 4K03A 2GPJA 4QJ4A 3NDIA 3TOZA 3WLNA 2ZUBA 4D5GA 1EXDA 2BMDA 1DUIA 1Y7PA 5JPIA 3O74A 2HK8A 2A9QA 4GG1A 2PKXA 1NNLA 2QL5A 1K8QA 1ZRMA 2CXSA 3BDIA 2CSUA 4OV6B 2JATA 1C3OA 1MFPA 3MINB 4ALIA 2DEUA 1O87A 4N3NA 2OCXA 2XVAA 2YCBA 4EA8A 4WJLA 4W99A 5KYXA 4YUAA 3T5TA 1AM4D 4OB6A 1A9QA 3DHWC 3L1VA 4KQEA 3P7MA 1BOOA 1RYNA 5NLLA 1UIRA 4J4TA 3QX8A 1FYWA 5AVSA 3Q41A 1X6VA 2VA8A 4FFSA 1RPAA 2YJGA 2REQA 3CPHA 3WIVA 2PR2A 4OJQA 4CIBA 3VPSA 2CF6A 1GDTA 1NJFA 4JYBA 2FSFA 3ES9A 2DMRA 3BCSA 3LUBA 1QV9A 3FDXA 1JDBB 3IHTA 4NEQA 3E2MA 3BSFA 4F9EA 4UTVA 4TSFD 3W5AA 1TPYA 3GG2A 3ROQA 2HJRA 821PA 3Q0TA 1A2OA 1HYEA 3INTA 4YLEA 4AJ4A 4Q9LA 2BJWA 1XLUA 5AVVA 2A5FA 4XDYA 2YNMA 3OEHA 3THWA 1KAEA 1LDGA 4KN8A 5J23A 4UNIA 2G71A 4IR7A 1A9XA 4PO8A 1LJUA 4FDVA 1XKLA 4AG5A 2R9VA 2J1LA 4O4IF 4Y0NA 3EZLA 3PXUA 4K2HA 5B3KA 3ZY5A 5FBLB 2VS1A 5F9MA 1UZLA 5KIAA 4J0EA 2GAOA 4F2HA 1BROA 3ZGVA 1SOUA 2H8GA 3IA2A 3L0SA 4U7TB 1U7DA 1ZPDA 5FOQA 2FZ5A 1AIPA 1MRNA 1ZQ1A 3ZE9A 1E2KA 1HG0A 1KK0A 2VHXA 4PPGA 1W4LA 4DM4A 1N9ZA 1AVTA 1UC8A 2HJ9A 3TZQA 1XD8A 2A9RA 4B3FX 2IIBA 2P5TB 4RTOA 1KC3A 1P0QA 5E6RA 2ATVA 3IGFA 4YPVA 1H3EA 2RAPA 3WXMA 2BIFA 2P6NA 3NZEA 4N65A 5AKKA 4GFDA 3ZVMA 2IZ0A 1Y4AE 2NO1A 3CEMA 1I4DD 4YBRA 3LDUA 3QJGA 1BE8A 2RC6A 4QQFA 2IYOA 1LQ2A 2BMFA 3V7NA 3S2UA 3OM0A 1LBEA 1Y9ZA 3COSA 2Z1NA 2DPHA 4RWEA 2BHSA 3F8WA 2PX4A 1QANA 2QW0X 4YJ2A 4NABA 3HJRA 3NKFA 2CD7A 1OKKD 1NOIA 3ZXYA 5KPJA 3KWFA 3VOAA 2GLUA 1XLVA 2GAIA 2WJ6A 2AJCA 2QRVA 4ASUD 2WSMA 3CGWA 3FOAA 4DAOA 1B26A 1REQB 1Z2EA 3BILA 3BWBA 4M8NE 5ERXA 4CM3A 3WWYA 3H0KA 1QR6A 1UMBB 4IS2A 3FKSA 3ND8A 4RKQA 4Y30A 1NT4A 2ZRAA 4K6FA 4KR9A 1NLYA 2GPWA 1QC5A 2G09A 5IAAA 2SECE 3PSHA 1RT9A 3HWRA 4WOPA 4DDWA 3AU9A 3S1LA 1KK3A 2PDAA 1WQ4A 3ZC3A 1ENOA 4EHBA 4HQNA 4KG7A 3I92A 3MUFA 2C9YA 2EAUA 3DAFA 4D4LA 3UUGA 2FK7A 4M2LA 3BYZA 5ANRB 1JTFA 4Z9XA 1TEZA 1Z4KA 3G6KA 1Y5RA 4KFSA 3WB0A 4RBNA 1L5HB 4GKVA 1DBWA 1Q0LA 4RVNA 4CFZA 4CQNA 1ABFA 1XMPA 3RYHB 2WPDD 5AKYA 3WDMA 2INGX 3AVXA 3QMVA 4ND8A 3CMMA 1CJKC 2WTXA 3LQYA 2WSBA 4IZ6A 1HM5A 5AJTA 3V9AA 5KNBD 5DNDA 4A92A 2V7BA 3TR5A 4EPTA 1G21B 1VLQA 2V7QD 3FYUB 3NJRA 1OB5A 4KR6A 1DMRA 1IUPA 1CY2A 3OHPA 4QUIA 3IPCA 4NOKA 1V8DA 1SKBA 5IJZA 1VIYA 1PD1A 4S1VA 4YYEA 5AVXA 4NE7A 3RHFA 3U1TA 3R3VA 4LMBA 1E62A 1MP0A 1QZTA 1USGA 4RHEA 4CMCA 1ZD3A 1WHSA 5ADUS 2G0TA 3U49A 3GB9A 3TSAA 2VDPB 4PC1A 3DTVB 2JPDA 1TAQA 2QROA 4UUAA 4M9SA 5DW3A 5M3BA 1MN6A 1QAOA 4TSFA 3P9RA 2CW5A 5J2UB 5BWBA 4C1NA 4HTFA 4M9QA 3B8EA 1HWYA 2OZPA 1FP1D 3YASA 1UWCA 3C70A 1XUOA 1TRKA 4HXFB 1WETA 1YZLA 1YA4A 1A8HA 5T7BA 1NYQA 3TXXA 5K0SA 3UT5B 3PXDA 4L9RA 4FYYA 4WNIA 2Q7DA 2B0JA 1SKYB 1T5HX 3G49A 2FF5A 3GXBA 3O21A 1RHRA 5GIPE 2CUKA 1G20B 1AK9A 2ZIXB 3T7RA 4WY8A 2XE7A 3NATA 5ALYA 3Q2IA 1XDZA 2RKWA 3GOHA 3QFFA 4QEZA 2O3RA 3WIOA 2PJRA 4G56A 4MVJD 3RVMA 5ISMA 4YQEA 4OGGA 3B9BA 1OLUB 4G8JA 2XA9A 3RWOA 4EY3A 3UWKA 3WG9A 2GHQA 1E1QA 2A0XA 1U3TA 4A8PA 5CIYA 4KUHA 4UBMA 2XH8A 4C88A 1OVGA 1EWTA 4BFYA 1P33A 4MRAA 1IN5A 1FVOA 1L4YA 1WUKS 1ZI9A 2NTYC 4U3JA 5B1HA 1T0HB 4GBGA 5JUWA 3DB2A 4J0CA 1HTBA 4OX9Y 1SXJE 2HEIA 2Z2IA 3QA9A 3ORYA 4HPWA 4DVGA 4MWSA 4BLUA 2Y71A 4MOWA 4CMEA 3CIFA 2RGNC 1GPJA 3C85A 4LDRA 2JKZA 1CHNA 3GEIA 4X63A 4BNTA 1GGJA 2XKJE 4RNDB 1U3GA 4UHKA 4XI9A 1W4BA 3RS5A 2AD5A 5EMHA 3JQ8A 3BGSA 1BH6A 4OP2A 1DNPA 5PGMA 4KN5A 3WWEA 4UNNA 4DY4A 1LLQA 1U0HC 2ZKIA 3UGKA 1D8TA 1MG0A 2R25B 3E03A 2YWHA 5A9SB 5CFPA 1K7XB 2J3LA 3K9NA 1ZHFA 4QG3A 1UBOS 3KL4A 2NP7A 2BKUA 3VC1A 5KAPA 2PSJA 1N1DA 1JAHA 1RRGA 3VYVA 2B21A 4FR0A 5CT4A 2YVUA 3U9SA 1DO0A 3LNTA 4AO7A 4LQ4A 2H59A 5IBCA 2ASEA 1HFJA 2AC7A 1YK1A 1E5XA 2Q3BA 3D1VA 3EW9A 2ISCA 3E8XA 3OU6A 3P20A 4LJLA 2V5AA 2VZ9A 4U2FA 4HYYA 1SBZA 1UK8A 2GD2A 3UHJA 2KBEA 3TJRA 1TD9A 2AVNA 5EQFA 1P1FA 5CMLA 4EW3A 4EKIA 1U9CA 1QGOA 1C1XB 2AC2A 1JWAB 2GJAA 3G2HA 1QK3A 4KFRA 4FD2A 4ZOAA 4EUHA 4DJDC 4UULA 2O6HA 1HMPA 1N1GA 1SFRA 2J3JA 1EUDB 3MS7A 3AF1A 5D86A 3V8NA 5BWMA 4DR2B 1W75A 2FRDA 2GWHA 3I0MA 3JQCA 4Q03A 5GZ1A 1UXKA 2ZWIA 1VHTA 3EA4A 1CIVA 4MIKA 5J2TA 1EFPB 3IQFA 1NBMA 3C6ZA 2FQXA 4L0QA 4TLLB 3PFNA 4V0SA 2EATA 3EEFA 1USWA 1FSSA 4MQEB 1F6DA 3QKRA 1M2VA 3B7GA 3PC3A 1MNAA 1M7BA 3VVMA 4MKFA 3Q3JB 2RAUA 4QX6A 4O2AB 3UAGA 1U8AA 3WLFA 5E3HA 1AKMA 1FNMA 2ID9A 1A76A 2BH2A 2W00A 2QN7A 2NX2A 2GLTA 3AU8A 3C14C 1W0CA 5EL0A 1B6SA 5CBKA 2R6GA 1PGNA 2GBIA 5AM5A 1R5NA 3MWGA 7REQB 3PZRA 2BTQA 1OI4A 3N53A 3ZWKA 2XTNA 4IF4A 4CLDA 4H35A 3A6GA 4ZOBA 1R6BX 3I30X 1QMPA 3N70A 4J3FA 2M6KA 2QVZX 1T8WA 3LE8A 2X2FA 4P2BA 4ER3A 6GPBA 2Q07A 4KL8S 2JEOA 4JQYA 3B53X 1WDLA 5AKJA 4F84A 1R6DA 2P9BA 3DNPA 1WXXA 1VJCA 1H0HA 2Z4TA 4QSMA 3HXQA 3EAFA 2XMZA 4Q9HA 1P77A 1Q20A 2G28A 1BMFD 5CD1A 3LQ2A 1ONNA 3R24A 1Q2UA 1NUTA 3QU2A 3J80A 4JLDA 2YOHA 4FEEA 1FP6A 2D0PB 3NYRA 4Z8YA 3GH1A 2XYPA 1I6WA 3NHPA 2OE2A 4FJ2A 4LRTB 4B7UA 2F3RA 1AUXA 1T8SA 1U3FA 4HB0A 4LRXA 1N25A 1RW4A 4RTJA 2ZBDA 1R8SA 1YNOA 2FQYA 1ITZA 4QUHA 2AZMA 5E95A 1A9SA 3F74A 1VIAA 4H6XA 3AEUB 4GMKA 1BGXT 1RRPA 1XCOA 2HD4A 1DJQA 4JJ7A 4PX3A 3E6AA 2J08A 3VJLA 1JU4A 5IUJC 3C5CA 3TLMA 1OLSB 4XLZA 3WGGA 3TUZC 2RFLA 3UCEA 4MR8B 2ONKA 2PSDA 4GLOA 3WOHA 5EWMA 4HVAA 1JSLA 3L7LA 1Z16A 3GLSA 1QTRA 5FJJA 3U39A 1ZIPA 2J9FA 1HMYA 4B3IA 1XRPA 2B9VA 2R6R1 4ALMA 4B5KA 1KF0A 4EMBA 4XGKA 5LYJF 3EVEA 2DETA 1F1BA 2XB8A 4TV9A 4HEJA 3UCFA 4R2MA 4KI0A 4AG6A 4E1AA 2CK3D 4NATA 4OQMA 4EJSB 3MHPA 1B0UA 2W6JA 3H0CA 3NHRA 3RLIA 5IUKC 1G5HA 2NZJA 2ZE5A 2ZSAA 3DAOA 3K8YA 3NHUA 3AGQA 3WIBA 4BC1A 1KTVA 4I66A 4R5MA 3UKJA 3FROA 5SZJA 4GSKA 4AUMA 1V45E 1DEXA 3A31A 5BQOA 1U1EA 4OQQA 1U7XA 3WB1A 5TQ0A 4CNBA 2YOFA 4ZICA 4OHVA 3KVOA 4JIMA 3SX2A 4W5QA 1ZW1A 2ZPUA 2FWJA 1RI3A 2W0SA 2Z9CA 3MWLA 5F12A 1NLZA 3ZDCA 2XNCA 5JS2A 4F04A 4K88A 2UZIR 2AL7A 3E4CA 1J22A 2C0PA 2EX0A 2IHJA 3FFBA 3FMVA 4U9HS 5BNTA 1E3WA 2ZI7A 3SOPA 3T9BA 4YLYA 3NHZA 3VPHA 2Q1SA 1PR9A 1ZK4A 2V54A 4X93A 5DBHX 4IWXA 4M1ZA 4Q47A 4GSYA 3ADBA 2Q50A 1N2HA 4DR5B 3N39C 5IAJA 3D4IA 1SAYA 4FU0A 1KY2A 5LQSA 2RAFA 2Z04A 1WKBA 3IA7A 2EEPA 4Q4CA 2WIKA 3IILA 3WYAA 4GE0A 3WBJA 1MD9A 4Z4IA 4L22A 2HUNA 4MLPA 4XYMA 4LK2A 4JROA 4XFJA 3O2SB 3AJEA 2PGNA 3O84A 1VHJA 1X1TA 2FEXA 3LBNA 2ZYAA 4BFVA 4A2QA 3VNVA 1M5UA 1W76A 2HJHA 2P65A 2YN0A 3RC1A 5AT1A 2RI6A 1XVAA 3GAZA 4NZYA 4JUDX 3ICOA 1CR0A 1SD1A 2QLMA 3T0GA 3ESQA 5A4KA 5HPYB 2BD0A 4DIOA 3RC3A 2GD0A 4B87A 1EB9A 4FX2A 3W8EA 3GH3A 4C0QC 5AM0A 3W5UA 2OBNA 1EK1A 3LZ6A 5KKCA 4YO7A 4EABA 5LUAA 1SC9A 3LOQA 1G8PA 1JHMA 2OXCA 2OZLB 3EPPA 3NKVA 1RKVA 5LA6B 2I7XA 1QF6A 1OWLA 1PUIA 2FPUA 3C8UA 1K4YA 3MPOA 5F4ZA 5KYVA 1XCLA 3BH6A 3G9XA 1KQFA 2PXHA 3LF1A 1TIPA 1NVUQ 1GIAA 3FTNA 1GUFA 3ONWA 1CP3A 3F6PA 4YTEA 3GLIE 1ZD8A 2ETXA 4INOA 4NFHA 2JGIA 4U9IS 3G0CA 1N2SA 4GZ6A 1PDWA 1DV1A 4AYTA 1M2FA 3KPVA 4B17A 1Z13A 4KMRA 1DFIA 5ITZB 1ORVA 2PV7A 3D8HA 2P40A 5JAQA 4YT8A 3TPCA 3S81A 2ZB3A 3AIMA 5DYYA 3WMWA 4DXHA 2DVMA 1LQTA 5JFOA 1BWPA 2R6FA 1GQFA 1CY8A 3HBMA 2BDUA 4QHYA 1GAQA 3N2GA 3GLGB 4Y18A 1IEVA 2ZRBA 2QLTA 3E5HA 3OFSA 3QE4A 4Q4JB 4YMIA 1X8KA 1DPGA 5FA6A 3VR0A 4HZUA 1DC3A 1KJ8A 1VRCA 4CT0A 2HA0A 4UVHA 1DIBA 1U9IA 1ECBA 3NT5A 3VHQA 2Q5JA 1N33B 2PGDA 2XJ9A 3E53A 3B1ZA 3CMCO 4EVSA 1CQPA 3I8OA 3I9OA 1M1UA 1QLHA 3WWOA 3IKTA 1LDEA 4BFUA 1DIHA 1RIFA 3OX2A 2YMMA 4LWOA 1XMVA 3B6IA 4LJ4A 2TMYA 5CM2Z 1GN9A 5G41A 4NYIQ 4BNDB 1XPUA 3ACCA 4EKDA 1P1HA 1GTRA 1R0YA 1V8ZA 3UMGA 1W93A 3M89A 2OECA 4LSWA 1EE2A 2YMQA 3I12A 4MKGA 2HMUA 4U1RA 4WIAA 3WKEA 3LLSA 2VF8A 1ZCFA 2Z83A 1W73A 3A1FA 3QOYA 2PKCA 5FLXA 3L1JA 1CUHA 4TL6A 2AIRA 2PUCA 4OJYA 5FUWA 1JJAA 3PKIA 5C5DA 3GZ4A 1F8GA 1XZAA 3IPRA 2F17A 2G5PA 2R00C 3DOCA 2LDBA 4I55A 4L7VA 4NFLA 4R9VA 4BNVA 2DTEA 2GBCA 3A37A 3I2HA 2HMVA 4WTOA 3WK5A 3ZK9A 2TRSB 5A4AA 1SXGA 2V6BA 3E9MA 3IV7A 2FZCA 2OENG 4QHSA 3IR7A 3H11B 2OILA 4UVGA 5EERA 2PQ2A 3AH8A 3OWOA 1R3UA 2EJCA 4U6QA 3TM5A 1B6TA 2C3OA 4UXJA 1YE3A 1TW3A 4LN1A 2Y9PB 4L75A 4QUAA 4Q3KA 4ZOQI 3R3HA 1QFJA 2E4AA 1E3DA 3F5DA 3C3DA 3OEYA 1KAHA 3FPAA 3L6OO 4K9KA 4DKJA 3K15A 4IG9A 1RAHA 3P9PA 1I30A 4G1FA 1Z2AA 2Y0EA 1K7CA 3BA1A 4TXMA 5FI1B 4NXMB 4MNTA 4OQYA 5JPDA 1R4AA 2HPAA 3F7OA 2E6UX 5J63A 4JQSA 1IXYA 2HJVA 5AI6A 4CM6A 2H2DA 2PRSA 5JCZA 1JEQB 2AEJA 3R5TA 2GN0A 2O4UX 1TADA 1ZWLA 3NBUA 3SYMA 5DTQA 3TEFA 5J59A 4CMIB 3LKDA 3MWYW 1YOBA 3KZOA 1FUUA 1IIRA 3NYQA 5DULA 3EXEB 2PZLA 3AV3A 4PAQA 1Y8AA 5JRJA 1L5SA 3AY6A 2VSXA 2PSEA 2VPIA 3F6EX 1HGXA 1CVRA 4QA9A 5DMHA 3NIBA 5IKPA 1UUFA 4IXMA 2JRLA 3M4YA 3PXAA 3Q7IA 4JLOA 1MW8X 1YA8A 3O9MA 1NE7A 3T4EA 4KVAA 1OT5A 3CH4B 3VHLB 2NO5A 5TS3A 2C4TA 3EHEA 4FR5A 4EB8A 3SBXA 5HKBA 5CVEA 5BQFA 4H1VA 5CYGA 1N6OA 3OTWA 4L4YA 2QY9A 4M0LA 4ZHQB 4J0DA 4G8BA 3QF7A 1CZLA 4US2R 5JFTA 1KGSA 5J4VA 2GZRA 5BSMA 1TD1A 2XVXA 4RK1A 4S1OA 2G08A 4EYSA 1DWQA 2ZIGA 4G9BA 1BQ4A 1VKJA 2ODAA 5E9WA 4EARA 3A6PC 1LJLA 4R4JA 4H0CA 1T1RA 4IVPA 1GLNA 3V2UA 1EUYA 3VU8A 5KINB 3K6KA 1EG2A 4D46A 1WCIA 1O6FA 3KB8A 4FS3A 1FB5A 3WKBA 3FYDA 2XWBF 2QQ0A 2QDKA 5FB3A<