5KAPA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-(4-(phosphonobutil)hypoxanthine
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
159
Chain Sequence
TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 45
structure length 159
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kapA00
1A95A 2VFAA 1DKUA 4RQBA 1J7JA 1I5EA 2H06A 1UFRA 4F8EA 4QYIB 3GGCA 4QYIA 1NONA 3OHPA 5EUCA 4Z1OA 1UPFA 1I14A 4KN6A 1A97A 1U9YA 2EHJA 3DEZA 1P18A 1ZN7A 1NULA 1ECJA 1A3CA 2JI4A 2FXVA 4JITA 1AO0A 3KB8A 4RAOA 1BZYA 1GPH1 5IPFA 1G2QA 2WNSA 1OROA 4P82A 5BQPA 1VSTA 3OZGA 4RV4A 1DQPA 5HKLA 2PS1A 1WD5A 3MJDA 1YFZA 1A98A 1GRVA 1G9TA 4LZNA 1W30A 2DY0A 1LH0A 1D6NA 4ZFNA 4M0PA 1G9SA 5BRNA 4RHYA 1ECFA 1QK5A 1XTVA 2AEEA 1R3UA 3ACBA 4P84A 1V9SA 4RAQA 4S2UA 3LRTA 4QRIA 1ZN9A 1QK3A 1QB7A 5KAMA 4P3KA 4WN3A 2H07A 1DQNA 1JLSA 3GEPA 3NAGA 1XZ8A 1P4AA 1VCHA 4RQAA 4TWBA 4FYMA 4X45A 1L1RA 4RHTA 4X44A 1BD4A 4P86A 1OPRA 4RHXA 4P81A 4P83A 1STOA 1P19A 5BQOA 1XZNA 1XTUA 4IJQA 1I0LA 3H83A 3OZFA 4RANA 1Z7GA 1UPUA 1QK4A 1TC1A 1CJBA 2C4KA 5ESXA 1TC2A 2H08A 4P80A 2PRZA 3GGJA 4PFQA 1DBRA 1ECGA 1DKRA 1L1QA 3LPNA 2E55A 4M0UA 1A4XA 1HGXA 3ACCA 3O7MA 1P17A 1QCDA 2IGBA 4LZOA 4OHCA 1MZVA 5BSKA 5JSQA 4RHUA 1QB8A 1JLRA 1Y0BA 1I13A 2JKZA 3M3HA 2GEBA 5IAOA 4LYGA 2XBUA 4RACA 2YZKA 1VDMA 4LYYA 5KAPA 3S5JA 5ESWA 1FSGA 3DAHA 4RADA 4PAWA 1ECBA 3ACDA 2PRYA 1I0IA 4M0KA 5E38A 4JLSA 4WMLA 1ZN8A 4MB6A 1OREA 4LZAA 5HIAA 4RABA 3N2LA 2JBHA 1ECCA 1QCCA 2HCRA 3DMPA 3HVUA 1PZMA 1XTTA 2P1ZA 3QW4B 2JKYA 3MBIA 5K51A 5JV5A 3EFHA 1BD3A 1IBSA 1U9ZA 1O5OA 1G2PA 3G6WA 1O57A 1A96A 1HMPA
chains in the Genus database with same CATH superfamily
3N0WA 2B4TO 3RG2A 3KQVA 4BNZA 5H83A 4KYVA 2C7PA 2NXCA 4P7JA 1K08A 2BUBA 4IEIA 2A84A 1K7CA 2JHGA 2PH7A 2ARKA 3CNNA 4V38A 2GYVA 4AJHA 4LXHA 5THXA 4P31A 4CMIB 2EHJA 5A05A 5A4FS 4RORA 2WM9B 3EIXA 4MPTA 4B6PA 5DX0A 1XWFA 3K9HA 2NV2B 3CRMA 4E7OA 2WIBA 2PZMA 2ZUWA 1E9AA 3H5NA 1D1QA 5D5PA 1BHJA 3H13A 2QNRA 2X40A 4PPYA 3DKVA 1R7RA 3DT9A 4HDNB 5B6JA 3EGOA 3MJDA 3ZH2A 1QLWA 4ZO4A 5EJ8A 3K6SA 2HTFA 2JIOA 3NAZA 1N6PA 5ITWA 4W5TA 4BVEA 3OO1A 3MUEA 4GPAA 4TXLA 2GWHA 2J7PD 2QJFA 3SFTA 3AR9A 1EUCB 2RI0A 4J0JA 5K2MA 1WBDA 3BS4A 4ADSG 2OHGA 3GA7A 3K8OE 3UJDA 3T1OA 4JYCA 4DCUA 2ACEA 2R1TA 2JANA 2FEPA 4BGIA 2BCEA 4AF7A 4ZZ2A 3UJAA 2JAQA 2Q1TA 3AUKA 3ESXA 4C07A 1F4LA 1AZSC 4KDCA 3PQFA 1N36B 2FG7C 4PZ9A 3TIIA 1SVKA 5JCXA 1PWYE 1Z0ZA 1TAQA 4RL6A 4UVDA 4WNCA 5DNEA 1ULHA 1HPLA 5IBPA 4FYMA 3EB9A 1U5BB 2AS0A 4UE3S 4BFTA 2GTHA 1FFGA 4X62B 1PZNA 1QFZA 3IOMA 1S4MA 4PHTA 4ZU1X 2FWIA 3OPVA 3RM3A 4OHFA 5BN5A 4MQBA 2VJMA 3O8LA 3UYLA 1XTKA 2QW0X 3DF9A 1NAIA 1PL7A 3Q3VA 1FP2A 2YW2A 2NSYA 1XPUA 3GRCA 3LH5A 1M0SA 1YZYA 1PW7A 2ODNA 2OCKA 3CS3A 3OLZA 2YYSA 3PUJA 2O9JA 4I5GA 5AKJA 4UDXX 1OYVA 3E18A 1R5JA 5KVVA 1TQ4A 1A2QA 4NV3A 5CDGA 1U8UA 2YMLA 2IA5A 3ASUA 1BJTA 2JJ8A 3OX1A 1S01A 2BM9A 3I92A 3JQEA 4MRMB 4CLXA 5J4YA 2A1TR 4UCWA 1W0KD 4P3OA 4KQEA 5CYGA 5IF3A 5GQSA 4FB4A 2YJTD 3NNDA 1QZTA 2GUGA 1HYHA 2W2QA 3AL3A 2QMHA 3KELA 4UJ3A 4BX8A 3X1XA 4KGVA 2AVNA 4MQEA 3T9EA 4E1AA 5CT8A 1ST3A 3SOZA 4MGYR 1II8A 3DGEC 5KYGA 5JXHA 4B3CA 4HFNA 1GRNA 3A2KA 4K40A 3FSRA 4GYJA 2WMYA 2X1VA 3EDMA 4AQ7A 1IZ9A 1COWD 3U7JA 3I12A 2M9MA 3GLTA 4KAAA 4MB6A 3PYMA 4KBFA 3WLNA 3DVSX 4KQ1A 2RGEA 3UV3A 5J5AA 1GDHA 3E2IA 1AE1A 1DIOB 3KU4A 1YA6A 1IWBB 1FUKA 3BB4A 1MIOB 4NH4A 4EFLA 2JGKA 4EWLA 2ZR7A 3T7DA 1RDFA 1KZ7B 4BMZA 2QTLA 2WJ3A 5AW7A 1TK9A 1CUDA 4OVKA 1J7KA 4F3CA 1IN6A 2Q4RA 1PYGA 2NU6A 1QH1A 3KYDA 2ZB7A 1N3BA 2J6BA 4HB3A 3WYGA 3I76A 2ZJ0A 2D62A 3RABA 3H04A 4IDFA 1UBOS 1T2NA 4Q1FA 3TPZA 4PZCA 1B8PA 1XGKA 3WDMA 2JLUA 1SC4A 1K5DA 3GGCA 3KO8A 3JATB 3HZZA 4MCAA 5DJ5A 4GRAA 1KP3A 1XD9A 4GWKA 4NAHA 1JSCA 5EESA 1A7UA 1CEYA 4YAJA 4BVFA 1YFJA 4EEZA 1P1BA 2EJWA 4IQ0A 4B83A 4UXJA 2ZI6A 5AKKA 5LVAA 3L8DA 4MUNA 4JU8A 1FP6A 1IH8A 3TCKA 4YAKA 4UM8B 1F2TA 3W1VA 2P65A 3IP1A 4EQZA 1JG2A 4I4NA 4OXIA 4C14A 4CI9A 4PXAA 2B8NA 5GZ3A 2PFSA 3WRVA 2RHJA 3EJ6A 5ITZB 1UOEA 5KNCH 4EI2A 4US2R 5ITZA 1DRWA 3IB6A 4XPIA 4ZTZB 1NXVA 3EARA 4O2AF 4CI0B 3W06A 2Y2UA 2YQ5A 4IYRA 4JV5B 5CVEA 2P68A 3G17A 2HWWA 1JSLA 4MZXA 1E1RD 3MSXA 1W76A 1KPIA 1O8BA 3HCPA 5DZSA 2WU8A 3KHSA 1XTPA 1KVTA 4BMDA 3L7BA 4LHXA 1WEHA 1KSGA 4OHBA 1QP8A 5KQMA 3P26A 4EMSA 5LZ2A 1SCBA 5EA2A 4C7OA 2EOAA 3A1SA 3IEIA 2Y99A 4DHWA 5KS2A 3EIQA 2J0VA 3H2ZA 1FYDA 5I8PA 2DWPA 1EVQA 4HZUB 3OC6A 3W5UA 4YUWA 2J3DA 1E2BA 2FWNA 1YDWA 1H3NA 3RSQA 5J47A 4M7OA 2IEYA 4I5EA 1CF4A 2R85A 4QBTA 3OWXA 1RAHA 2V5UA 1XTUA 4IF4A 3FR7A 4Q05A 2QU8A 1HEYA 1OT3A 4BWFB 3U1BA 4CKBB 2C78A 4YWHA 5ALWA 5AW5A 4CQJA 2CK3D 2CVZA 2L69A 4LZWA 5D3MB 1V5IA 2HEGA 3BMCB 4MUMA 2GD0A 4EITA 2ZIFA 2ZT8A 1XMQB 1JZTA 2J8ZA 2P3LA 2H08A 3NHJA 1Q1GA 2A30A 3D3NA 4FMBB 1UXKA 4CKXA 3EPLA 4OV6B 4KVAA 4XWYA 3WLJA 3OTGA 2G9UA 2XTNA 4GE0A 2BHNA 3TKYA 1Y5RA 4XYEA 5JLAA 4EF6A 5BPFA 4TYYA 4GBGA 3DFKA 2YVLA 3LZDA 5TPWA 1Q57A 2FU5C 4JJEA 5DLDA 1ESCA 1T5OA 2QPLA 4JLWA 3IP3A 3TE6A 4CMJA 2WJWA 3LBFA 2CMHA 3C41J 5LZ7A 3A6JA 2Z95A 1EHCA 1BXRA 2P7IA 5CNMA 4K6KA 4AJ4A 3LLCA 4DQUA 4F4JA 2FPWA 3WHPA 1SXGA 4JR2A 4XCQA 4UVGA 5TQ0B 4C5AA 5CGQB 1Q84A 1GCAA 3ZHCA 4Z5XA 4YRDA 1LI5A 2YUTA 1L8AA 3E6AA 3NDPA 3QBDA 4J0QA 4LDQA 4OQEA 1WHSB 3BE4A 3DFIA 3WGKA 5LM3A 4HDOB 1KQGA 1W36D 1QMGA 3T9BA 4AMBA 2WDZA 1OU0A 2BC9A 3MFQA 3KQKA 1F1BA 1JAXA 1K4KA 4OK6A 4B40A 3THXB 4QQKA 3T7TA 1DXQA 1HV8A 2UDPA 2ZUFA 1M6YA 1SUEA 2LNDA 3LVBA 3SAJA 5AI5A 4IHKA 2P79A 3ROXA 5E1MA 1LI7A 3D2BA 1AD2A 3QSYA 3WWPA 3D8BA 3OPXA 1MV8A 3U81A 4B32A 1YOBA 2Q4EA 2FCRA 4IQ4A 2FZVA 5DRTA 1U99A 1HKUA 3GGOA 3R7SA 4DQ0A 3AF4A 3LQ1A 1OE0A 3PC8A 1GGJA 2YC4C 3FTFA 5K0TA 3WIVA 2Z8YM 2H7VA 3ND6A 1AQYA 4QG7A 1RXSA 3I2GA 3H4VA 3AERB 3QUCA 3KQMA 3BGVA 2XT0A 4PBRA 5FL7A 4JOQA 5IFKA 3B9QA 4RELA 4YP0A 1EFCA 1KI9A 5CB0A 1JRLA 3Q10A 2AN3A 2D0IA 2H1IA 1YZTA 3RLFA 2VA8A 1E9VA 3FWKA 2V7XA 3D4LA 1EAYA 1NUTA 1OWLA 4DRZA 1K7YA 2HL6A 5DP1A 3C5HA 1K86A 1LLFA 3MB8A 4KE7A 1NRJB 4CFZA 2A3NA 5TVGA 6Q21A 4TN5A 3N74A 4I3HA 3W77A 2C5EA 3RAJA 3KJXA 2J30A 3LOQA 4C5CA 1KI6A 2C83A 5FOTA 2I6QA 2F1OA 3H75A 3PRJA 2G1JA 2ZCVA 3W5HA 1QP0A 5BW4A 2OB2A 2QYOA 1M5UA 4TS1A 3CLUC 3ZQUA 1LXCA 1BS2A 3UJHA 4EG1A 5KYKA 2ZBPA 4NJEA 1AMUA 1TVKB 1N2CB 3C0KA 5FLXA 5JMTA 3KT3A 1C3JA 4JGIA 3TZHA 2YICA 1VM6A 4A8JC 4RO0A 1GGKA 1Z07A 2YX1A 2ZYAA 2DLNA 1POWA 3I52A 1T2DA 3UB3A 4I50A 1F12A 3Q6MA 3U31A 3TOCA 4EY6A 1TVEA 2BEWB 5LOVB 1I7SB 3GB9A 2QUBA 4WXEA 2D1TA 2Q45A 4J91A 4M21A 2BP7A 2EL7A 3AEQA 4X84A 1N5LA 3UATA 2NXEA 4Q03A 3AIOA 1G3IA 4PZDA 3V7NA 1QE5A 3R9XB 1U0BB 1WXEA 2BJHA 3T52A 1Z9BA 1G20B 3K3PA 3EQ7A 2MSEB 3JWEA 2YMPA 4YRPA 2QR5A 1NOIA 1YD7A 2FEMA 2X4DA 1NBHA 1K66A 1GKYA 1UP6A 3BTUA 2C2HA 2PX6A 1RWPA 3Q4GA 4HAXA 1S1CA 3N2YA 2GTIA 2VT2A 1T4MA 4PNZA 1MX1A 4CQLA 4PYLA 4LGYA 4V0SA 2W2LD 3E0XA 3IQGX 3FB1A 2AJDA 2BRUA 1RYFA 4RTJA 1T9GR 4MEAA 4UHEA 4A2CA 2Y68A 1QCDA 1JILA 1XFDA 4NCIA 4MKRA 2I2XB 3BGDA 3L06A 4GEGA 5SICE 3ZZMA 4KK4A 1VB3A 3UGJA 1F6WA 2AFVA 1L0BA 1PS9A 2ZCJA 5EKDA 3PTLA 1MZPA 3R40A 2Q1SA 1MRNA 5HQ3B 3HCWA 1ECLA 5BURA 5HF9A 2GD1O 1RT9A 2PZBA 4WFIA 1EGHA 1T9KA 5DNYB 1JQAA 5MGNA 2DM6A 2P5UA 1YI1A 4FINA 1G98A 2XHEA 3CNLA 1YDMA 5ALKA 1XEXB 5F78A 3S27A 4HUQA 3GI1A 4ZDKA 2XNJA 2RGNA 4L5AA 4O4LF 3V00A 5J4KA 1OZHA 4JP3A 2G07A 1PJSA 2O2JA 4ITUA 4YMGA 4RVSA 4E5UA 1W48A 3GCWA 5A4KA 2KX7A 4MIKA 2QP4A 6REQB 4Q1DA 4GP6A 3UG6A 2WTUA 4E32A 2R48A 2VF8A 2G0TA 1VJ5A 2WRZA 2C3UA 4JJZA 5FO1A 3THWA 4TL7A 1N75A 3X43A 4JVNA 1Z15A 1KBQA 1LA2A 1YZNA 1EDZA 2F1JA 3JQ7A 4Z9BA 3EGXA 2X4LA 1AB5A 1ENPA 3EC1A 3VSAA 2B92A 5CM8B 5BQFA 1ONPA 1I14A 4EKIA 3IKJA 2IH2A 1Q74A 1ZUWA 1XRSB 4IO1A 4HT3B 2A58A 5H1YA 4F38A 2HU5A 1Z26A 5ED0A 3D2CA 1B26A 1SBNE 1JDSA 2C07A 2YWEA 3ZV7A 2IJGX 1NN5A 1GKUB 3COSA 1O95C 3PNBA 3T0FA 3ZGNA 4HZIA 3UWDA 5FA5A 4PPFA 1TMYA 4JLDA 4UBLA 4UOZA 1I2DA 3S28A 3SR0A 1JFFB 2EEZA 3NI2A 4M1EA 1D0IA 4IXMA 5HF6A 4L8VA 2ZTUA 1B2RA 1AUVA 2YWHA 3LY9A 3TAXA 5H02A 4JMPA 3W7BA 2EJTA 2OPHA 4XGRA 3DKIA 3FBTA 3NDRA 1Y8RB 4AECA 4F9FA 5A5VA 2O7NA 1Y6GA 1JPVA 3L7KA 1ONNA 2VSNA 3SYMA 1RPZA 3IQHX 1KJ9A 1I4WA 2F1HA 3I5XA 3N58A 3O4GA 2VWPA 4KCGA 3B8HA 2C2WA 2I4LA 2R66A 5K2OA 4WACA 3B70A 4TSRA 3RLIA 3THRA 3VR5H 3BD9A 3GLGB 4DR4B 1OAAA 4DLVA 1GV1A 2VJMB 3F3KA 3PGXA 1WSDA 3HADA 4Y6RA 4CL3A 3WB0A 4WJKB 1Z7YA 3DDWA 3CVVA 4O33A 4TRMA 2F8MA 1RR6A 3F5FA 1DLIA 4NK4A 5IYZA 3WJ1A 1HMYA 3FPCA 4TTAA 4KPEC 1P6QA 2JCXA 3L6CA 4YS6A 1X2EA 4IVRA 2GXUA 1NVXQ 1JR3A 3QVLA 5FR2A 2FPGA 1U1FA 2O5RA 1SMKA 2ZITA 1KIMA 1C0KA 3CUKA 1GV0A 3VTZA 2CXTA 2X2OA 2FF5A 2PBLA 4JVOA 3B52X 4EIWA 4WJLA 3FHJA 4F84A 5ILQA 2Q0XA 5LB2A 3ROMA 3H65A 3BJIC 4DNPA 4CIWA 3U7GA 2GNOA 1E6WA 2YJ3A 3KXKA 4IMIB 4UQPA 5F12A 5IZCA 1Q0HA 2IX3A 5GGYA 1TLFA 1N2XA 3S3TA 5BV2P 1ZUNA 3H1AA 4RH1A 4YJ2F 2QHXA 1E7RA 3K6SB 4C6HA 4AMYA 3LPMA 3WKBA 1EFHA 1EFRA 3ROGA 2ISQA 5K3EA 4PAWA 3TL6A 1N6KA 2WUVA 3AM5A 3NUGA 1NUHA 5KI6A 3GCDA 4WRRA 4YRZA 3E7PA 5IVIA 2Y0PA 3ZYCA 4Z4GA 5CEJA 1XR3A 3R5XA 1E9DA 1Z2CA 1TO6A 1E89A 3HCCA 1W34A 3HXLA 3PXBA 4J16A 4R1TA 3NBKA 4WUVA 3H5WA 3ZQJA 3QW2A 4DLXA 1MO3A 2QMZA 2HHCA 2YJ4A 2FZCA 1H5UA 3NPMA 4IH1A 3LWDA 3C8MA 5CVDA 4NRDA 4RZXA 5K0FA 3FYHA 1ABBA 2WI8A 3HDYA 3OPYB 5F4ZA 2VUUA 4DA0A 2HNAA 3MQ4A 3T35A 1JA0A 2W0SA 3R3VA 1B6SA 1A95A 3IVGA 5JH7B 1KKUA 4XX0B 4G5SA 1VL0A 1E6LA 1J5XA 2YASA 3T06B 1VE5A 2A5YB 3HJHA 2VTEA 1W6UA 2W9XA 1LVUA 1J9EA 1E2NA 3ABZA 1LX7A 2RHCA 1OW3B 2PN1A 3IIJA 3TTSA 3IBGA 4RCYA 4EK9A 5I3ZA 3UAZA 5AD1A 4L27A 3GGSA 4IEFB 4YI3A 2BISA 4AZSA 1RWNA 3HU1A 2C1ZA 3ELBA 4OCZA 3IQDB 2WKRA 3K9WA 1P5JA 4Q1EA 5EJ7A 4GQAA 2DETA 1YDEA 4DUGD 5CDYA 4MGEA 2BFDA 2OHXA 1BMDA 2Q99A 2ATVA 2V4UA 5FJIA 3S44A 1TJ3A 1TZJA 3LF1A 4CR8A 2G7ZA 2HQRA 4HDKA 4DF3A 5KJFA 3QLUC 5KKCA 2JGJA 5HK9A 3BHJA 1UBMS 3PGKA 3AETA 1AXGA 4NOMA 4ND4A 1AZWA 4ROTA 2QORA 2RBKA 3M9LA 3OAAD 4LWQA 5HE9A 1U7PA 4L4UA 1M6EX 3DEJA 5T67A 2C92A 5KNBD 3U9LA 2V9PA 2BPOA 1O6FA 1LH0A 3MPUA 2WJ6A 1N7HA 3EIOA 3QELB 2G9ZA 4YAOA 3SLKA 4B4WA 5EQDA 3VSBA 1U0LA 3FJOA 1CT9A 4E09A 1NR7A 5AVXA 2I2WA 1QK5A 4JA2A 1Z17A 4DXHA 3AEXA 4UTNA 3ERCA 4LYJA 3OP4A 2VPZA 3KWMA 2V8OA 2EIHA 4Z8XA 5ETJA 3IPAA 3G89A 4QX6A 1YR1A 4ZVUA 3AP2A 5BXQC 1NNI1 1QV7A 4ZAFA 6YASA 1U0SY 4WLNA 4AUKA 1KZ6A 3MUNA 4U5QA 1NVVR 1PJBA 4D99A 5AHXA 5F9HA 1ZLXA 2FPPB 3E8XA 1D09A 4WLEA 3UMGA 3AEZA 4Z0NA 4YUVA 2QM0A 2JAOA 3A6PC 1EUQA 4GKVA 4A16A 1E2HA 4RFSB 2I6TA 5ALHA 2QMYA 4KR2A 4IG9A 1XE3A 3RYCB 4DJFC 1FVHA 4D26A 3ZKAA 2AZDA 5JRDS 3IPLA 5DFAA 1NQVA 4B87A 1PDWA 4EZIA 5KVCA 2BGRA 3PPWA 2ZVPX 6PFKA 3O6VA 2ZSJA 3BIOA 4GF5A 4D3SA 3PCRB 5C5CA 1Q3HA 4NCJA 3AINA 6REQA 1TK2A 2H29A 1P5ZB 1QMPA 2JHPA 5E9QA 4TV8F 1MEEA 3UMRA 1FDRA 1JHQA 3IUSA 4Q3EA 5FULA 5AXCA 5K0NA 1KETA 5T3YA 2E55A 1Z6TA 4JXKA 3RK4A 3H8JA 2C4NA 3QU2A 1EX9A 3TLKA 5K05A 3SHFA 5B4VA 1ZH4A 3ZGXA 1HDRA 1W85B 3QPDA 4DDVA 1OQAA 4UFNA 4MVJH 5FFFA 5JCJD 5DNCA 1R8YA 4BJ5A 4DWOA 3DMNA 4LWPA 3H17A 1U0GA 4FYXA 2EYUA 3KK0A 3A4MA 2EGHA 1SOAA 4L9RA 4RPJA 5A9SB 2OLEA 3W7VA 5E1OA 1HDIA 3FCYA 4TWIA 2GCIA 4DLNA 2A5DA 5U9CA 3DEAA 3NOQA 3GBSA 3ZHTA 2PXAA 4R1QA 4JYZA 2NZ2A 1MX3A 4BVGA 3O1HB 2CLDX 3LKDA 3UMBA 2HV9A 3I2YX 5TMDA 3TQSA 3VPGA 2JBWA 1FXUA 4ZCMA 1BROA 1EK2A 1B42A 1H05A 1RRPA 1AZLA 1WEKA 2R97A 2QLMA 1ICEA 2ZROA 1G8JA 2LWIA 3BHMA 1AHHA 2WSSD 4TXHA 3EDRA 4B4DA 4DIMA 1B2LA 1BD3A 1DAEA 1XK7A 4I19A 4Z2YA 4A6XA 4RTMA 2FFHA 2ZR8A 3NDIA 4FFSA 3KBOA 4DSNA 2BLNA 2WJIA 2RB5A 2C7BA 3ED1A 1NVGA 5IRCD 1J06A 1RS0A 3R24A 2YV2A 1L7AA 1VHJA 3ONFA 2QQ0A 4WVLA 1LDMA 4AAYA 1N33B 2JRLA 3RBAA 9ABPA 1G5RA 4G0XA 2ZJFA 4G5OA 3DEZA 121PA 1VPTA 3TTWA 3OCCA 4F45A 2M98A 5HRAA 4QO7A 5DEOA 1WTCA 3BSWA 3AEKB 2XZTA 4R7GA 3TW8B 5KTKA 2PEZA 4BO8A 4P58A 3K0CC 1Q77A 1Q83A 1SUSA 3A4YA 2L18A 5FYDA 5E8RA 2FN9A 2EW2A 1KTIA 2B4QA 1AURA 4BV9A 2EWVA 2IZ6A 5LYJF 3HM9A 3PD0A 5KTPA 4A27A 4MVJP 4LSZA 4QSHA 1YASA 4QT0A 1KK0A 1MEOA 4B7ZA 3NVKI 3D3QA 1GG9A 2FPMA 3KXLA 3UOAB 2CJPA 2J0UA 1H1LA 4HEQA 5EHXA 4P36A 2FN3A 1PO7A 4EPVA 1Q7EA 3DT6A 2I2FA 3JPWA 4B3MB 2CLHB 3C2QA 4YIKA 4HVLA 3HA3A 1ZN2A 1E96A 4HRVA 1PG2A 3LYLA 1IN4A 1J6UA 3CUSA 4QTXA 1VJ0A 1Q7GA 3SIPA 4ERXA 1ZR4A 4WKBA 1VCNA 3AF6A 4CEJB 2B35A 2F43A 4JUFA 1YQGA 2H48A 2JFXA 2QX4A 1ZJZA 3D6HA 1SKUA 3V7WA 4COOA 2VJNA 1FYEA 3H42B 1NUAA 4D74A 1YBFA 3KKQA 4YRGA 1PGNA 3ONDA 1HSOA 4TWBA 1E9FA 3A2LA 1CPYA 4FGKA 4B8WA 1LS6A 2IHJA 3JD0A 5C5IA 1KEKA 1PU2A 2BI8A 3MEQA 3BFVA 4P53A 4Z9FA 3PX7A 2VG8A 1ML4A 2JBAB 5EGSA 2IPOA 1XZLA 3HDVA 1YC2A 4BBZA 5ALVA 3K6RA 1VBKA 3GFGA 4HLUA 3CLRC 3PE3A 1U9IA 4FBMA 4MQ5A 4L0CA 5JRZA 1M34A 1ZGBA 3KQUA 4B45A 1T3TA 1GCUA 1QLJA 4NL4H 3SQXA 2TMDA 2Q62A 1E77A 2FMTA 3KL4A 3B2QA 4EW2A 5EXEA 3S7TA 1RRGA 1N6HA 3WTBA 3MJTA 4IUDS 2ZYWX 2WHYA 3F71A 3DTVB 3HEMA 1KY3A 3TPCA 3IYLW 4ZWNA 1QYDA 2EX4A 2EYQA 1I9GA 3QMVA 2NXJA 3BG5A 4DM4A 2CEKA 2GBLC 3BE8A 4BTEA 2QLFA 4TM8A 3BB3A 1MQAA 2F9LA 2G5PA 3VPSA 2XB2A 4XIJA 2QZJA 3QUQA 4FNMA 5CT4A 5SV2A 4LYGA 3TQFA 2Q9UA 3RU2A 1BMTA 3GNTA 1Q2XA 3K1TA 1G7CA 2J87A 4HK4A 1EIWA 1I6MA 3V34A 3VR6D 1DOAA 3VA7A 3KQHA 1JIVA 1NKSA 5BSVA 1TTHA 2EL9A 3G8BA 4H1HA 4K0KB 3PYXA 1OF1A 5AR1A 5AVSA 4HUTA 1UJ2A 4YNBA 4EYOA 4TL6A 3H11B 3W5BA 1PZMA 1T9HA 5BWCA 4ABYA 2JKYA 1BU8A 4FN4A 4ARBA 1SN7A 3NHSA 3IELA 4L4RA 4DVJA 2DTXA 4KPUA 5IH7A 3OE4A 1U9ZA 2IFTA 4AYTA 3BZBA 4CZ2A 3JYLA 3ZDXB 3KYCB 2XDYA 1XDDA 1GGFA 4HVTA 2WYHA 5KVQA 2COKA 4LSGA 5H3LA 2AZMA 1W46A 3PT9A 4Y0NA 3ETGA 3WLPA 1E2LA 4N9WA 2V3CC 1Z12A 1FDUA 4HGZA 3F6EX 4TOIA 3P2EA 1W52X 3D3WA 3IV9A 3PKIA 3JWPA 5LJLA 1P18A 1IBRA 1M1YA 3HC7A 2NTYC 3C70A 3EVGA 2VNAA 4L6AA 4RK4A 3K9CA 4NH0A 5GV8A 2F1KA 3TL3A 2VWQA 1SXJC 3ZI7A 3KHUA 4BKQA 4GGPA 3TEMA 3TLGB 1XZCA 1PZFA 3T4XA 4RJ2A 5TJ9A 5JSZA 1PGOA 3JQFA 2DPLA 1R6TA 2IY9A 2X8JB 4WK6A 3H3JA 1I3LA 5JG7A 2O0KA 4CN8A 2HM7A 4F60A 1NDHA 4HJXA 4MV5A 3HSYA 4I14A 3E7XA 2QIOA 4LC0A 1TM3E 1Y3BE 4GC9A 4LCEA 4WLOA 2MINB 2R00C 3EVBA 1B14A 4M7WA 4E2YA 3P96A 1G60A 2BTQA 1QV9A 1IY1A 2B20A 1X77A 4CMHA 5JC1A 4YRTA 3KHTA 1XA4A 1U0EA 3PXGA 3RSSA 2PR2A 4E5YA 3F6YA 3OBBA 1XMXA 1R3DA 4EO4A 4H35A 1EXWA 5ADWA 3FUXA 4BMCA 3HO1A 2YNMC 2HK9A 3JAWB 3RC9A 3X1YA 4WEOA 3RHZA 2DHDA 4KXNA 3WQSB 2XUPA 3QYJA 1EDOA 3LMKA 1EP9A 3ILYA 3H0EA 1H4TA 4IRMA 3HJRA 1H2RS 3E9QA 4WLUA 2Y1XA 3DUWA 1U81A 3IILA 3MK31 3O75A 1TUBB 4ME6A 1A9OA 1KDZA 3RRNA 3OIDA 4ZIRB 2V0NA 1UEJA 2OGSA 1UIMA 4BFUA 221PA 3DYBA 3T0IA 4YA6A 3AZPA 3ZWQA 3ZHXA 2UVDA 4QPJC 4DQLA 2XI4A 4CNBA 2FEWB 2FPGB 2J32A 3NZEA 3OLYA 2SCUA 4P0PB 2XTAA 1VMKA 4HH0A 3TPFA 4F93B 2D3TA 2R3SA 1D9ZA 2R84A 4XB6B 1EX6A 2P4HX 3UFXA 3T5MA 5JCJA 2VTVA 4NKRA 5AIAA 4R7ZA 4C6TB 1IWPB 4TTTS 2WWTA 3I1YA 1OLSB 4GPZA 1YHZA 5FNVB 4YRQA 5JDCC 5CW2A 2ZS9A 4K05A 4F9TA 1JHZA 5DX8A 3NH6A 4CV1A 1AH2A 5C4GB 2CMFA 1LSSA 2ZWVA 5JROA 4HHEA 4MIOA 1QIEA 2OO5C 4FPXA 4MQMA 3ZIAA 3JQ9A 5K5EA 3NVDA 1CS0B 4FBGA 5EIWA 4P93A 3F46A 5FUWA 4WBXC 4M0FA 3W78A 1YU9A 2D2XA 5HBGA 3FFWA 1EM6A 2OHJA 5GONA 3KVVA 1Y8QB 3F6SA 5IDYA 1HL7A 4XD7A 3TM4A 4TTPA 3DOCA 1I4TD 2XT6A 4PTZA 3CR8A 1N25A 4G4SP 2WWVD 1S9HA 5KYWB 1A2OA 3HPQA 3EYWA 4I36A 4RQTA 3VR2D 1BN7A 5JZOA 1X42A 2GKSA 4HH4A 2IYNA 1IOWA 1BN6A 3D02A 1WUTA 3H16A 2R7NA 1KOFA 3UK6A 5BNIA 1DOHA 1DO0A 5IUJC 3CH6A 3K1ZA 4MRVA 8ABPA 2GJAA 2BFBA 2J85A 1KEWA 5EWJB 3QEMB 1RM4A 2GT1A 2GZDA 1R4NB 2NTJA 4ARZB 3ZXSA 2PL5A 3UMCA 3ORYA 1YZHA 3KTOA 3IAAA 2GK3A 3TZCA 4B6QA 2OPBA 5EIOA 1AQIA 4AUNA 2OMEA 4Q3DA 1HE5A 3F7OA 1O54A 2H3HA 3W2IA 1D7OA 3EC2A 3IV7A 4TTJA 3LQQA 1JU9A 3S70A 5KYUB 2EQBA 2P9HA 1BQ3A 3IAXA 4KIFA 2B4RO 2RIRA 3OLWA 2YVQA 4EZEA 3R5TA 3CCFA 1EJ2A 1RYHA 2QTBA 4JLJA 4OK5A 1WIWA 3HTXA 5I5GA 3FUVA 3HBFA 4WBSA 5JRJA 3CZ9A 1TUEA 2R9VA 1AMNA 2Y4OA 1OR8A 1PZXA 2B7LA 2Q0QA 2VHQA 3DULA 3ESBA 4I99A 1FLDA 2YIMA 4JUCA 4G56A 3WGMA 1X8KA 3UEOA 4Y9DA 5IAAA 3UNXA 3GIWA 1MABA 3SVZA 3VR4A 3WIEA 2HZBA 1Y6FA 3EVNA 1FFBA 1G9TA 5FAKA 1L3IA 3OLQA 3LT2A 1JU3A 2RD2A 1K3TA 4BDTA 5B64A 5H16A 1QG4A 1X7ZA 3QFHA 3B7GA 4FYIA 3TQIA 2AC4A 3L4KA 1FNMA 3C16C 4KFRA 4ZHSA 4MGKR 4K88A 3L6BA 2HJRA 5FOUA 5KBYA 3TD2A 3MOGA 5HA5A 3WFIA 3BJMA 2APJA 4CM4A 1M73E 3ET4A 3BA1A 3H99A 5ECGC 4CIDA 4F4FA 2HWXA 2WJVA 1Q0LA 3W90A 2IZOA 2XEDA 5KAMA 4OG2A 3E3NA 5DGHA 5LMCA 4KEAA 2C77A 4V1CI 3EOZA 3S1LA 2QRGA 2WHPB 5CFPA 2AI2A 4BLRA 1FRFS 3ETNA 1CE8B 3RRJA 2JL1A 4KQFA 4MI3A 3IERA 1VRWA 3LI2A 3AIMA 3V1YA 4ZHQB 4OQLA 5K03A 3OJOA 3VNQA 4KXLA 1G2OA 1M8GA 4HR7A 5I4CA 5EHQA 3PFBA 5AP9A 2G72A 3OE1A 2XSZD 4OB8A 5HE8A 5HIIA 4HAZA 4D97A 5EZQA 3HXTA 2WY2D 2WWWA 3KUKA 1Q1ZA 4LBYA 3O1JC 3VH4A 1ZJ4A 5EE9A 2J48A 4FWTA 4X66B 3VR0A 3LX8A 2FPRA 3RSHA 1F06A 2PH5A 4A0FA 2H0QA 3IBYA 5A1JA 2OXFA 3F4BA 3H1EA 3HLTA 4AZWA 4CTMA 3CF2A 2E1PA 4E2XA 4PM4A 1FK8A 1XUOA 3T41A 4CODB 4YCCA 4MWGA 3RS4A 2CLOB 1I7NA 1N2CA 4XIYA 1GPMA 4H6WA 4KOAA 1ZM3A 3VYTB 1XLTA 5A0VA 4EL5A 5CFZA 1TKBA 4LY9A 5E4FA 3WVNA 3OU7A 4Y2QA 3ZD7A 1KY2A 2OCXA 3FUCA 3PFKA 3ZV4A 1ENOA 1JAYA 1WXWA 2PRYA 1XPOA 1W2WB 2HXSA 1P1JA 1J24A 4JB8A 5CK4A 4TZKA 5HEKA 3VNUA 1GUDA 5HUQA 3W6ZA 4LCJA 2B1QA 2CHFA 4D9CA 4RXMA 3RJMA 1N1DA 4MK4A 1EG2A 3SMVA 3HVJA 4CQMD 4S0ZA 3F67A 3F7TA 1I94B 2X9GA 4I1UA 2C99A 4R51A 1NNSA 2IPNA 3I3SR 1OZ0A 4HAOA 1ZO8A 2I33A 3NT4A 4L3WA 5SY4A 1CR4A 3V7UA 1UDBA 1T5IA 2NT4A 4L74A 5DYNA 1NX6A 3GZTB 1JQJC 5LBTA 3TIFA 3EODA 4H7DA 1XRJA 5BUQA 2F43B 3ZY5A 1EVIA 4IWYA 5I9NA 4JBYA 3CVOA 4JVMA 3GT3A 1X19A 4U2BA 1XZMA 3LDUA 3RS0A 3LUCA 1W4BA 3TSOA 5HUHA 4JI8B 3S0JA 3F1KA 2DUJA 5J63A 1BW9B 4CETA 4GLOA 2OO5A 1A5AB 4LNHA 2WQZA 4PW0A 3V8PA 3DVRX 4MRSA 3OEWA 1DG1G 1ZGJA 3UUEA 3AUAA 1BEZA 1B73A 5K0ZA 4HPXB 2OHHA 1QHXA 5AO9A 1N2HA 3SE7A 4A6PA 3WBBA 2D4AA 3OOYA 4FSHA 2WT4A 4AXXA 4ND3A 3WYDA 5KOHA 2YKGA 3C6XA 4FCTA 3RF6A 4N7RA 1TU3A 1KZYC 3JVEA 4BP8A 4K1XA 2I4OA 3KZOA 5IUKC 1SCUB 2ZYIA 5EE5B 2HH9A 5EC8A 3JRXA 3NHWA 1YC5A 3HXPA 3DXFA 4D3DA 9LDBA 1EZ1A 5GIOE 3PTAA 4Q4HA 2WU0A 2H2IA 2ZRDA 5GV7A 3WWYA 2FG5A 3CF4A 1TM2A 3PWTA 5ALOA 2UU9B 2QT1A 3M6MD 2GEDA 1LF5A 4CLHA 3EQZA 3FROA 2H11A 4GGOA 3S2UA 4X1IB 1JLMA 1RBYA 5HGJA 3DZGA 1X1DA 3JV7A 4MB0A 3LLMA 1WZCA 1OWPA 1UMKA 3QJYA 3PDJA 1JR4A 3D6UA 4Q3LA 4E4TA 1ZHFA 1NSFA 3ZWWA 2FFQA 1JQDA 1J0CA 2H5IA 1M6VB 3CWCA 5AHWA 2I4NA 4F85A 3PK0A 2AJTA 3HGMA 1IY2A 5JCOA 1K3UB 3BX1A 4LHSA 3M83A 5IAKA 3E1SA 3KDPA 4UD2A 3WAKA 5CDTA 1X87A 1VYUA 4ZVOA 4LI3X 1E1CB 4XUDA 1A9PA 4CQMA 3D64A 2REXB 2FFRA 3O0TA 2QD5A 3H5OA 3CKYA 3QXCA 1R8XA 3JQ7B 3AXSA 4PO3X 3RRYA 1X1AA 4KBGA 2QTVA 2PQ6A 4NEHB 2IWRA 3R7NA 2V7WA 4DMFA 3PC2A 4I1IA 2FMKA 1NL3A 1PUXA 2WAMA 2X4IA 2IZ0A 3WYFA 3KEGA 4F7WA 3C24A 4TSFA 3PQEA 4NYIQ 1JAZA 4M98A 1Y1SA 4MVJA 2G67A 5ITSA 3AJEA 9MHTA 1ZJYA 4W99A 2W6QA 3WLHA 4LK3A 2ZFUA 1PR0A 5E2AA 4C87A 2X9NA 4M37A 4XTCS 2M32A 1J2EA 1YFKA 2NUAA 3BGSA 4JLMA 4BL5A 5CBPB 1X74A 1DIBA 2VRWA 3VMFA 1HY3A 1LNSA 1QX4A 3ANYB 3UAXA 1ISIA 3WKEA 1E4EB 1OFVA 1PV2A 2BMVA 1Y5NA 2FPLA 4QREA 7MHTA 2KI5A 3OOHA 1UT5A 3GLFE 1PJ8A 3WRXC 4YGXB 1DO8A 1UK8A 3HGTA 5AKYA 3SJ7A 5BT8A 4LKRA 2AC7A 4JLSA 1J2JA 3AY6A 2PUFA 2X42A 3PVSA 5GM1A 2CJWA 3WGTA 5EN4A 3EZLA 4HTFA 1V4BA 3V1NA 3R0VA 1XZIA 5JADA 3HDJA 3UMJA 1UKBA 3M82A 4I8IA 3BF8A 5AHOA 2E4ZA 3I5MA 1Y8AA 3L18A 4YJHB 5F64A 2OBFA 4B6OA 3UBTA 1ID1A 1TM1E 2O1EA 1Z6AA 5G4KB 4F91B 3OMWA 4GLFA 1OGYA 4FQ8A 1XTBA 4L76A 1R9JA 4EB8A 4EH1A 2H16A 1D8AA 3ZHYA 4KSYA 4OH1A 2ES4A 2NQ8A 4UUBA 4M86A 4OQPA 2EBHX 2UZIR 4ENPA 1WXQA 3HCDA 4RF5A 1PG0A 2JFPA 5FBLB 1USGA 2EKQA 5KTSA 2J6IA 1SXHA 4TV9A 5DHAA 3NBMA 3RUFA 3W6NA 2P3QA 4D8YA 1EFAA 3CN9A 4AP5A 2BGGA 2W37A 3Q9UA 3ABQB 3I23A 1N9ZA 1T8RA 2I7TA 4PFKA 4DWJA 4UTVA 2Z1MA 3T5BA 5ADHA 1ZW1A 1QC5A 1S2IA 4QOFA 3LCJA 2ET6A 2OBMA 4UEWA 1DARA 1ZVVA 4HRAA 3D43A 5AUNB 1M5RA 2XD4A 1MIOA 1XCLA 2O3JA 4DA6A 3FVVA 1GT6A 2IELA 4UHKA 4XEHA 4BIMA 5KOJA 3F4KA 1JDJA 4CL8A 1LZKA 5DHFA 4JX9A 4M1KA 2HQBA 3A05A 4II7A 5CJJA 4QTTB 5SZJA 5DXJA 1U7UA 3CJQA 3C6MA 1WP9A 2AX4A 5GVSA 1JA9A 3CB2A 4B3TB 5EMNA 4W5RA 2O20A 3SDSA 2QAGC 3O8NA 4TRNA 1V43A 2VJKA 3FGPA 3RKUA 2GSWA 3W4JA 4LGVA 4AWAA 1DUSA 3Q72A 1EE1A 1SA0A 4MQEB 4XGIA 1LFDB 1SJ9A 2HAEA 2H7CA 2HU2A 4E5MA 4OM7A 3FNGA 2ZJ4A 4JI6B 3O93A 1Q0RA 1NSTA 5C8ZA 1Q1AA 1QB7A 4L08A 2IVFA 2EU8A 1A8UA 4H3VA 4TV9B 4E3ZA 5M5BA 4Z53A 1XTSA 5GINE 1V95A 1FNSA 1T8YA 4NJMA 4L02A 4OXQA 4KO3S 3FBGA 2OMKA 1XDGA 2XVYA 5C32A 5LQNA 3VR4H 3Q9LA 4CT4B 4UTRA 3HXMA 2VTBB 1T34A 2HYIC 2BONA 2H9IA 4ZZ3A 1CULC 4I55B 3WLIA 5MGBA 3RW9A 3LPDA 2J1LA 3WZLA 2CLMB 4P2BA 4B0PA 5MF6A 1UPTA 2A9FA 1I01A 1C9YA 2R6ZA 4G6ZA 3FMVA 2VYVD 2R00A 4YJHA 2V7QA 1M7HA 3OCZA 3HKCA 5DO9A 2XGMA 2VEDA 3Q11A 1GGEA 5K8JB 2OQ2A 1N5OX 1A04A 2ATIA 4IMPA 5AI8A 4XM0A 1WKVA 2AW5A 4YRJA 1UBCA 4RBNA 1J2YA 1U98A 4X64B 1UBTS 3ANNA 2O05A 1Z63A 2E89A 2I22A 4BRSA 4X6UA 1ONBA 3BF7A 1NI5A 2QUAA 3OCWA 4JOBA 3S5UA 2NUTB 1M1XB 2O7RA 4IGFA 1GCIA 3JYHA 3U1TA 1T13A 3UJNA 1IVNA 1O6ZA 4MYTA 5D3QA 1ZH6A 1KYXA 1DBWA 1ADFA 5DVZA 1I4EB 4GXQA 4ZVPA 3TBHA 5KJCA 1BXRB 3K2BA 3ZGYA 2BGJA 1SK9A 4LGMA 1OAOC 1UM8A 2UVQA 4RVCA 5AJTA 1MG5A 3B53X 3QPUA 2GARA 1Z4QA 3I3OA 2D1QA 1SHJA 3K5HA 3NYRA 5DN9A 5FTLA 5DM70 1VTKA 3M9XA 4BXOA 4CIBA 2OCLA 4DIFA 1YR3A 3DW1X 2VPQA 3H6KA 4O2BF 4IH4A 1KZ9A 2VF2A 1THZA 2AG6A 3G7NA 1AQLA 1RWXA 4GH5A 5DCLA 4UBMA 4E0BA 5JBIA 5L7YA 1EFRD 3DE6X 2J3LA 5EIHA 4B81A 4BO3A 1DIHA 1JR3E 2X23A 2XQVA 3CV3A 3QKWA 4ZDIA 4D82A 3TUZC 4K6HA 5FBVB 1NLFA 1BDIA 1PBNA 4URVR 1N0HA 4H6XA 4BUCA 4V2IA 2CV2A 3MRTA 4NNPA 2WR8A 3CC8A 3WWZA 1ENZA 1F7UA 3QXGA 2VYFA 4PIVA 1VECA 2DUUA 3VNBA 3ZU2A 4E07A 2IIPA 2XADA 4HGNA 1BXGB 3L0CA 2D6FA 4XD7D 3RANA 5IM5A 2G40A 3EE6A 2I99A 5CUQA 3JYPA 1GU0A 3PFHA 2A1IA 2I3AA 2DFDA 2IVZA 3FWZA 3O4JA 4WOJA 5AVOA 2WIJA 5LZ5A 4NU8X 1Q21A 2IDMA 5YASA 2VYVA 3RRXA 1UL1X 1HDZA 1J39A 2R60A 2NZWA 4UM9B 4WD3A 1ZW6A 1U7XA 4WKOA 2Z43A 1I51A 2E4YA 2I87A 2IYYA 5ARCA 3VC3A 3IEPA 5F3DA 3CX8A 3OURA 3G9QA 4V24A 4A5OA 1T6ZA 2KB0A 4QOIA 5KJ1A 3QENA 3GRZA 1I2ZA 2A5GA 3HP1A 2AXPA 4JLAA 3EIFA 1A0OA 1YZLA 3OX3A 1GTRA 1EA5A 2EZ9A 3TINA 4WW0A 4NBWA 2LE0A 2P9QA 4G2NA 2O2ZA 3TTUA 1J5EB 1FJGB 4Q48A 1QK3A 4AZ0A 1G41A 3SF0A 1TX4B 4KPYA 5FHQA 4E30A 1P4GA 4L7VA 3PUHA 1O5TA 3Q41A 2C8LA 4GPIB 9ATCA 1TO2E 3RVLA 3VTFA 3OE5A 4RD2A 1A8QA 2DWQA 2P40A 4RHXA 5B55A 4DRXA 3RK1A 2WICA 4B3FX 4Z4CA 5EL0A 4RK7A 2JLXA 1ODLA 1CUWA 1ZOIA 3G5UA 2PUCA 4PC6A 3CF4G 3I62A 5DTRA 1M8JA 4J1QA 4PU0A 1IAQA 4L85A 4B2IA 3FOCA 3NWOA 1RWBA 4KQIA 2IEZA 1Y4AE 1ACMA 2BFEA 1RHJA 3DCYA 3FH0A 3BOSA 4M49A 4Z6KA 3GJ8A 3EASA 4R1OA 3AVQA 2WZCA 2YWRA 3SBXA 3WL7A 4GMKA 4Y6QA 5DTMA 1E1LA 2P2DA 3OOWA 5L7WA 1R37A 2OCBA 1ZIPA 3EPRA 1NW8A 3GDHA 1F17A 2VZ9A 4N3NA 4DNQA 3J7AC 3ZWCA 1DIGA 1WPXA 5IARA 4BO7A 3G5MA 3DA8A 4FE4A 1LEHA 2GLTA 1ZNYA 3NIDB 1KQOA 1KZ4A 4P92A 2HSWA 1XKLA 4YALA 1KMNA 4U2DA 3HI4A 3L0BA 4UCFA 1HYQA 5COAA 3K16A 3PQ6A 2OA0A 4CKZA 3JZAA 1OV4A 1Z2EA 3PPXA 3AI7A 4G8JA 1NI3A 5CB4A 3K2EA 2E9SA 3AR4A 3OLCX 4ZT3A 3KTAA 3BZWA 4DCVA 1XZHA 1XVVA 1AN9A 1OGJA 3N3BC 1CIVA 4XB2A 4WGFA 1HE4A 1U6JA 3CLSC 3DL4A 1XELA 2PGNA 2WLSA 2Z9BA 3HVUA 3O1IC 4ZVLA 3RU3A 3DPIA 3U5ZB 1IM2A 1ZAYA 5FLKA 2W93A 4QFMA 2MSKA 4UXIA 5CA1A 4P1ZA 1T43A 3P0EA 1KE2A 1J21A 1WW2A 2A9JA 3P9PA 2VHZA 2BR4A 1XQ9A 1K4MA 1M34E 4FMPA 3S40A 2GJSA 3OC0A 4RQBA 5ALPA 3TRJA 3P0HA 4AZ3A 2QVYX 2W8ZA 3INYA 2FNAA 1XIVA 2C0PA 2ACWA 3OG9A 1WXHA 3VOBA 1M54A 4EYGA 1H2WA 3F6RA 4OIFA 4RWZA 1GZ5A 1SOUA 2OM6A 1I9CA 5LD2C 1RPNA 1MPXA 3A0RB 5DYTA 2R8RA 1QBKC 2HRRA 4O0MA 4ZZ1A 1CR6A 1JDNA 2FMFA 1GXSA 2HPAA 2IEGA 2OV3A 3OTWA 5DBIA 4ZGBA 1ICIA 2BGIA 4R9SA 1H23A 2FX3A 3FYSA 5JANA 1L7EA 1JR2A 3M6UA 3FLEA 1TT7A 1Y7TA 2AOUB 1GLVA 3A9SA 4OATA 2C61A 4XRRA 2FYTA 4ZEOA 2ANCA 3V4ZA 4LJRA 4BWGA 2EC5A 4RMIA 3AJRA 1JLKA 3DXZA 2JATA 1L7VC 1YK1A 1CW2B 2AT1A 3JASB 3S1AB 5JEDA 1NP6A 3KTDA 2IHTA 4RCZA 4BNDA 1M2FA 4I4CA 5EJFA 4ZFNA 5ECWA 1N2GA 4H1UA 2B0JA 1YB2A 5CP8A 4Y2GA 3F6CA 3ZIAD 3BZUA 4X60A 2G4VA 1WZ2A 1G6KA 3DQPA 2ATXA 4FHZA 2Q8NA 1C3EA 3OEHA 1TNDA 4II2A 2FWAA 4HC4A 2HY7A 4LDJA 4U02A 4IOLA 3K9LA 5DISB 3K70C 1U2SA 1C7IA 3DUFA 4AP6A 4IOJA 1Y82A 1U2QA 3I2HA 2WJJA 3EHEA 4I81A 2ZR9A 5IM4A 3OQOA 2Z6AA 2FJ0A 3GA5A 3V1TC 4FS3A 4DCNA 1SXJA 3TD9A 2LRHA 1LSJA 3CLTD 4F4HA 4PSKA 5CA1F 4Z0TA 4O1HA 1WHSA 1GRCA 5DHUA 1APBA 1T5DX 2D5IA 2O06A 4NZ9A 2FP3A 1SCAA 2QXYA 3LUAA 2W48A 2ZLBA 4B7XA 4EJFA 2WF8A 3KFVA 4N41A 1R0BA 1JEQB 2OENG 4LWOA 1JIXA 3T1NA 3T4UA 4F06A 3UT5B 1BDJA 2VO1A 4M87A 4R6WA 2MYNA 4OHUA 3JQPA 1QWSA 1R4AA 1BHO1 1UAAA 1YKFA 3KKOA 5CLHA 4PS1A 2IW3A 3A36A 1AKYA 1VYHA 3DAFA 5B2FA 4ZJYA 5J3JA 4HDSB 5DTEA 3TZKA 1YFLA 3W0LB 3ZVLA 2R6R1 3ELDA 3Q9SA 5DGXA 3T7CA 4OXRA 1BG6A 3Q6IA 4Q34A 1WX1A 2CK3A 4IY1A 5AI9A 5L4LA 3BCUA 1ESDA 2OKCA 4KXYA 4EB6A 2IOYA 1QOZA 2JIMA 1F8YA 5DM60 4RLFA 3UO8B 2IHKA 3ZGLA 3H2SA 4DQXA 2PMWB 2KPOA 5GJWC 1GQ2A 1MHPA 2JIDA 3V42A 5DIZA 2ZBFA 4LYEA 1ZIXA 5B37A 3GLGA 2A33A 3SYKA 5D3MA 2B2CA 3VOAA 1U9IC 2IS6A 1TEZA 3EGVA 1DV1A 1NJ8A 3FKSA 1NY6A 1IM8A 2HQOA 5C1BA 2C5GA 2DJ5A 3OU6A 3FTCA 2EWMA 2ZS8A 1RW4A 1T1JA 1CIJA 2VP4A 2W2KA 4C7BA 2Y0BA 2DF8A 3HZHA 4EECA 1CBUA 4GMHA 1T1EA 3U3RA 5EXPA 4FOSA 2JAHA 2IRWA 3ZD8A 1TO1E 4QOGA 1L7XA 2X3UA 3WY9A 1VKNA 3L5KA 3DV2A 1N32B 3CLHA 4TKLA 4DLAA 1PQYA 3BFJA 1DMSA 4RKYA 4PG4A 3SBOA 4TRJA 2HJHA 2FHPA 2C8JA 4LW8A 1K88A 1KKMA 1S8OA 5INTA 1NN1A 3NEAA 3QEAZ 3HV0A 1KMHA 3ML1A 4LX0A 2X3FA 3FJ1A 4D56A 3RKSA 4KR3A 1V71A 3EA5A 4XWKA 2EGGA 2B82A 4RU1A 3RRBA 4X24A 2CFRA 3EDYA 4J49A 1JWBB 3ROPA 3OFND 3F8SA 4AG3A 4B17A 4CYMA 1CUEA 3HH8A 5T3UA 2QB5A 1YJQA 4TYNA 3VKFA 2GLUA 2OV1A 1QONA 4X94A 3ER6A 3DTNA 4HNAA 4W9RA 2VAWA 4JVLA 2O8EA 2FOIA 1P31A 2V96A 3A70A 3CEMA 3LCUA 3BKWA 3SP1A 3QTTA 1NUSA 3VPXA 5DLQC 3B78A 3SHTA 3C6QA 1I36A 2H2GA 3I6MA 2V7UA 1VFNA 4HH3C 1ZEMA 3JWIA 1GA4A 2MYPA 4G41A 1JEYB 4BKOA 2X14A 4LFBB 3OJLA 4NEGA 1N9KA 4NBKA 3GP5A 1FXSA 1GRQA 1MOSA 4HQ0A 4QDUA 3DE4X 4BNWA 3ODGA 2V74B 2C82A 2EGUA 5IX8A 4AJIA 4B71A 2G25A 2YWCA 2C94A 3AKDA 4Y1EA 3CO0S 2B37A 4LNUB 1EH5A 2HWUA 3VH2A 5IBQA 4EKGA 1OU4A 4HVCA 3B9RA 4JH0A 2IU0A 4EQ6A 4BBJA 3Q8LA 5JD4A 1RAEA 3A2NA 1U1EA 4QBHA 4JLNA 2YIDA 1EUDB 3KAPA 4X8OA 2ZETA 1E7YA 3FKSD 2PWPA 2ZRNA 1I10A 4QARA 4WXYB 2VDKB 1S3FA 2IKSA 1T1RA 3FKJA 3FAKA 3FYUA 4FNAA 4QYMA 5LBIA 3PCXA 3AEYA 3TIXB 4G97A 4O0LA 4NZZA 2JZCA 3ZVMA 1ORIA 2XB6A 1QNLA 4KWIA 1P72A 1YA4A 4NU5A 4BQIA 4YP7A 3DZKA 4AXBA 4D96A 3DKKA 1TA0A 3OZRA 5ENZA 2Q0HA 5FBZA 2HLHA 2XR1A 4QYSA 2UV8A 2BHLA 5FORA 3SJZA 3K8QA 4NARA 3ESAA 1RYBA 2IBMA 2XUAA 1VB5A 3DWGA 3JQAA 1ZRSA 1T9BA 1LV8A 5DLYA 1FQWA 1XA3A 2FWBA 1NBMA 2IPXA 5FXMA 2BYTA 2QRMA 4ZO8A 3RVQA 1JFTA 2UVPA 1YIAA 2HGSA 4XXHA 5HTOA 1OSNA 1MOQA 2E3JA 1J1UA 2DFVA 4ZAXA 1W36C 2N0SA 5TJHA 2XXAB 1TVCA 4ZT4A 1WLYA 4CLRA 2PX2A 2EFHB 4V0NA 4DV6B 5DEIA 4DUGA 5CDFA 2Q4DA 3K5WA 3TW6A 2HJSA 1EFTA 1M8FA 4NBSA 4YUZA 2RAFA 3WHKA 1YNOA 3INNA 4J7CA 1V5WA 4FYPA 2X8BA 1GKLA 1XCMA 2VHYA 4B5KA 4JI2B 1XMJA 2FZWA 1DKOA 5BWMA 1OZAA 1Y9DA 3GDFA 4HAUA 5D3KA 1NF8A 4BC0A 4AY6A 2X3YA 4EG0A 1E2DA 1A1SA 2IYQA 3I53A 5KYNA 2JCSA 1ZK4A 4URWR 2AD5A 4F4IA 1HK7A 2NVOA 3OZSA 3PDIA 3KQPA 1PEYA 1W5EA 2YBDA 4FP9A 2AYYA 4H16A 2BBOA 1W5FA 4I1OA 4IL5A 1AKMA 2Q6TA 3KD2A 2DVMA 3AUXA 4JLVA 3JU3A 2J45A 1QE3A 3K1YA 2HFJA 5CTJA 1SB8A 3UCFA 3IIMA 1YSCA 2VUHB 3OHPA 4YCJA 3TYXA 1U9YA 4AT1A 1GOTA 2DQKA 4IV0A 4QBFA 3GLHE 4WWHA 1HYEA 2Q6OA 1E5TA 3ZTYA 4PLHA 2C20A 4C7MA 3I9FA 1YB6A 4DYHA 3PNOA 2WJAA 4FONA 5T8KA 4AYWA 4C9BA 4D9FA 5JDIA 4X92A 4RH3A 1EDBA 1P3Y1 1BE6A 1TT5B 3EBOA 3L8FA 4P4SA 1XT6A 2OAEA 1IONA 5ALZA 5K3CA 5J58A 1Z62A 4RD6A 3IOCA 3NP9A 1DZ3A 4HX9A 3BSYA 2DTEA 4JIGA 3ZUPA 3MQ2A 1IHDA 2EW1A 1ZYUA 4GG1A 1ZS9A 3M3PA 5AW1A 5HG0A 4HD8A 4QJ5A 1D0VA 3CLVA 1DEXA 2ZSKA 4UM9D 5EKXA 2K6GA 3DDHA 3CONA 4CWAA 2ZRKA 1M5TA 3VH3A 2CXHA 3NTQA 4HEA1 4AS3A 3EXFA 1R0KA 2P4SA 3CWZA 3F2VA 2B98A 4QD3A 3X1JA 2PDAA 3NS7A 4N5NA 3MT0A 1UKVY 2X7JA 4IDGA 1F4PA 2CYAA 4KN9S 3RASA 1PK9A 4KQ9A 4NQRA 3W5IA 1VKHA 1YDHA 2KLHA 4FIDA 5AVYA 3M4ZA 3ZHZA 4J8PA 4YRNA 2N1BA 3QVXA 4A0RA 3KB1A 2ZRCA 2VRCD 3MC1A 1E92A 1SBQA 2WVHA 3AV0B 3GFSA 3L4BC 4RQAA 3V2IA 3AESB 3CUEF 3KB2A 2V4MA 4RUKA 4HVAA 2YY6A 3TX6A 1T8SA 4DCGA 2KJQA 2CB0A 4TLLB 4W4TA 3SY8A 3RTEA 1OTXA 3K09A 3CH4B 3PF8A 3LFUA 3KVOA 3GX1A 3HKDB 4ZVNA 3BWDD 3DOIA 3UA3A 1RYEA 5KVAA 2GPNA 1I2AA 1OIWA 3L8GA 4O2AB 3U3XA 4US0R 2WVJA 3PIRA 2W6JA 3U3DA 3UTDA 4NOJA 5L3ZA 3KR1A 4BX2A 5FPKA 3ZCSA 2O8BA 2QWXA 2PX8A 2WQ6A 1CQPA 3KKPA 1XTRA 3EY4A 4C20A 1GTJ1 1WM1A 1QZ3A 2F17A 3HUDA 1Z7BA 1A8IA 3HXOA 2G1AA 3SLRA 2DBVO 5A9SA 3I5YA 4UBIA 1SCNE 1T2EA 4R0NA 2ZUVA 4CKBA 4EYSA 3NXSA 3OQIB 4OHCA 2C00A 1Z3IX 4GLJA 4IGEA 1QB8A 3SEZA 1P6UA 2QROA 5EEHA 1OYOA 1GR1A 3F7NA 2I80A 1FX0B 3LC7O 2PZFA 4WOKA 4KO8A 2DG2A 1RCUA 3FVWA 4D57A 4MKZA 3H2GA 1KDRA 2YDYA 3SYRA 3W2EA 3IGFA 5C1IA 3SSNA 5E7MA 5TPZA 4OLJA 3ZLVA 1IVSA 2QVXX 2PCLA 3IVMA 3EXFB 3QVKA 4Z7OB 4DCJA 4DARA 4IRXA 1F2UA 4MRAA 4UASA 1CY6A 1EFUA 3LZ6A 2XA1A 4A82A 2BELA 5CT9A 1VFPA 5HZKA 1X1SA 3FWPA 2EDAA 4CIVA 2ZBDA 3CSSA 4N03A 2I8LA 4EPWA 1QF6A 1GD1O 2JC3A 5JZVA 1OLUA 4W9NC 1VL6A 1FPQA 1MO4A 4RD4A 2AJCA 2VQSA 1UQRA 3G2MA 1NV9A 3HDHA 4LRYA 5AXDA 3VV3A 4PQEA 2O1XA 1THMA 1VMDA 2J4DA 3MTQA 3OJCA 3GD7A 5G0SA 3CO5A 4LF6B 4GX5A 3BMNB 4C4SA 1P1KA 2I1WA 3EFOB 1ECJA 4FGWA 4YB8A 4X61A 4BX3A 5CFQA 1DP4A 3JVUA 4J0GA 3AFHA 4DQDA 1X7DA 4F7DA 1HQDA 3I37X 3I9LA 3LT0A 2WFAA 4OHXA 1FFXA 2PD4A 3KQTA 4PAOA 3KQLA 2R5WA 1EB8A 3SSMA 4B3HA 4DSTA 3RNOA 4L5IA 4R3WA 3C3JA 1R0YA 4ASUD 2PKQO 4BNMA 1JG4A 3CZAA 3UJCA 3P1JA 4OI0A 1QH1B 3CRZA 4RS4A 2OHVA 4TKUA 4OQZA 3TNLA 4DLRA 2W90A 3PP8A 3QE4A 4Z3KA 1X70A 5AW9A 4OQFA 3FOZA 4KQMA 1QFSA 3Q98A 1Y6QA 3DEFA 5IVDA 1Y98A 4BNFA 2GCOB 4I50F 4U0JA 1RRFA 2EXXA 3EZFA 1WMSA 5CCDA 3T5CA 2QTFA 2AEJA 4DLYA 4HDKB 3CISA 4OM8A 1E0SA 3AJ9A 5AMXA 5FPYA 2RGCA 4YQYA 1EX7A 4EB6B 1X94A 1XLUA 3SDBA 5LIPA 1RI2A 1K98A 1YBAA 1M1NB 3RS5A 2CCJA 4EKYA 2IYAA 4GYKA 4F5YA 1USVA 1JG3A 2QRZA 2WZQA 3RODA 1L7OA 4HWTA 2PAAA 5E9AA 2VKTA 1SRRA 3I01A 4BV3A 5FOQA 3H4TA 4GOXA 4KAJA 4ZOLB 2VBIA 1XYVA 3DB1A 3TECE 3WIDA 3A6KA 4TV8A 1C8KA 1NXOA 2XXJA 3IVCA 5AH0A 3GELA 3X0DA 1ZUHA 2Q4OA 3PEYA 3V8RA 2VDJA 4CT5A 2CB9A 2PZEA 1XSEA 1JKXA 1UZLA 2WF7A 4J94A 3ONVA 2BFNA 1O94C 4PAMA 4OSPA 2LKCA 2VYQA 1PJAA 2NLOA 1AS3A 2C97A 1TYBE 4C29A 1ZXLA 4KTTE 1L4FA 2FRDA 3RHSA 1M1YE 4Y7CA 2PZAA 2W2TA 1UBUS 4BWVA 1ND5A 3TF5A 1YDFA 4N40A 1Q1BA 3EXEB 1UXHA 2GZ1A 1QE0A 4KKXB 4XWTA 5FA6A 3RUEA 4OHPA 3REQA 1XVLA 1X92A 4U39A 1OC2A 2CVHA 2IP4A 3MGKA 3ZWOA 2DB3A 2GFHA 3V33A 4BNDB 1TW2A 3LLVA 4QDJA 3SM3A 2VJCA 4DV1B 3BL6A 2GRUA 1EP1B 4XDHA 3S99A 3LU1A 5I4BA 2G3YA 2Y93A 2C5LA 1DC6A 1NMYA 1T8TA 421PA 1SFRA 4GXNA 4TSKA 2QZSA 2P1ZA 3SK0A 4KQKA 3BBLA 3IAS6 4PLYA 2XD9A 2PLWA 3PQ7A 3JAKA 4J9UE 4NY1A 4KUGA 1SUIA 3L49A 4PLPA 4XGKA 4CM3A 4JI0B 4OX9B 5B36A 5DPMA 1ZL2A 3KALA 4GVXA 5JWHA 5BY2A 4O2BA 1MVNA 3GZNA 4MUYA 3UWPA 1ZHOA 4OUKX 2XCSB 3G1TA 1CJUC 4QQ8A 4DA7A 5B2ZA 4H9GA 4BP9A 4ER3A 2YWGA 5JD5A 3OCXA 2X77A 3HBAA 2F3TA 3I9OA 1ESZA 4K5QA 5HKBA 3UGTA 4FTWA 5CBKA 5T6BA 2Z8ZA 4MSUA 3UK7A 4CDMA 4AG6A 1IUOA 2B4AA 1HLGA 2J3IA 3BTSA 3CZCA 3PUWA 1GAWA 3Q7IA 1EUZA 3RVSA 2VJAA 5KB3A 2JLWA 4U6QA 5DTQA 1K8XB 2Z8XA 2VH1A 3BMOA 5FOVA 3DDSA 4QT4A 1E1RA 1VLMA 2BFWA 2IDKA 3K0EA 3RRZA 1J0AA 3BSFA 1FB5A 1XYGA 4ZOBA 4HWRA 3U1VA 1NUQA 3RYFB 1CZKA 2BFAA 3RU7A 4Z9XA 3HMQA 2B6HA 1NDQA 4HLCA 4Y0VA 4AJ1A 4IYJA 2V55B 3UMSA 3MS2A 5A7GA 5AJUA 2GJ9A 2R7LA 5HS6A 3TRHA 4WDQA 3B3QA 5I7UA 1FLNA 5AM5A 1U63A 2NG1A 4V0OA 3GJ5A 4JJGA 4JVSB 3TRFA 5B2EA 3W5VA 2G6BA 3RVJA 3T99A 1V11A 4YY3B 1EX1A 1PSDA 5KWIA 2R1VA 4WINA 2DH6A 2GO7A 2Q6IA 3UICA 4FDAA 2GH1A 3S7ZA 1YCFA 3DV0A 2HO4A 1R74A 4XUGB 5IZ4A 5HMMA 2WB2A 3A1VA 4L75A 4WY2A 3BDIA 1BX3A 2RH9B 5J43A 4Y98A 1F5NA 2VUSA 1UC4B 2CJYA 4M55A 3V6LA 5C7LO 4LYAA 1EQAA 1M83A 1OH7A 4HUQB 5EIAA 1T0PA 1Z28A 2BF4A 3CSDA 3A3YA 4I8XA 2L0XA 4NG5A 2AMLA 1RLTA 5I01A 1RMQA 1WTAA 2BE7A 2Q5EA 2R86A 3FIUA 4KX3A 4MI9A 2I65A 4PGGA 3CXUA 4WIAA 4MB2A 5G0VA 3WFZA 1N2IA 4DJEC 2XF8A 2PXXA 5IXYA 3R44A 4RQUA 5J9FA 4MPPA 4HSEA 1TB4A 1KS2A 1SIWA 5DW3A 5A04A 2NSDA 3W1WA 1I2MA 1GQOA 4NCHA 4X7BA 1IUNA 1JZQA 1E4VA 2IOQA 5TQ2A 4DIKA 5JD3A 1U1DA 2IU4A 2D2VA 2AOTA 2ZIZA 4FYKA 1YI8A 2C0QA 4HXYA 3G2NA 1GGVA 4H6PA 4KPFC 1BWRA 4J7UA 4LK2A 3DONA 4YO7A 5FNVF 4D5EA 2X0DA 4BQSA 3ZE0B 2E0IA 4HNUA 1KPHA 5BSHA 3PQ8A 3L8ZA 4EFKA 2MOKA 5D3ZA 3EWIA 4Y8VA 5D5HA 4IPTA 3UOWA 2JGEA 2GQ0A 1ZK0A 4S24A 3DS8A 1K97A 2PU5A 2IQIA 1KP9A 1QDUA 1KDOA 2QZPA 1ISJA 1X86B 1KFJB 3KYJB 4Q7EA 1I4LD 4R3NA 3OQBA 4R01A 1Y34E 1JQLB 1JIUA 3O2NA 4HPWA 1GPJA 1XMPA 2VFAA 4XYMA 1YQQA 3UGKA 1WCIB 3UXYA 4DG5A 4Y6SA 1CETA 3AWIA 1CZUA 3K0BA 4BQFA 1OX5A 4QUAA 4HB4A 2ONJA 3TSCA 4BPBA 2WFZA 5EMHA 5F3WB 3UQZA 4JNKA 1WRBA 4MAFA 2WE8A 3QA3E 2J9FB 1ITZA 1CE8A 4JITA 4RYDA 1NGSA 2H1LA 1F8GA 4J0EA 1V0JA 1WNFA 3U6KA 4P82A 3PRYA 4AKIA 1IMJA 5JS2A 4RGQA 3C6YA 3ZDDA 3A11A 4B6GA 5C0OE 2EKLA 1XEFA 2X5KO 5DMHA 5FBQB 4ZP1A 2XGJA 1C7QA 3W3AD 1U02A 4TLAA 1R8SA 4OAQA 3A1TA 3B9PA 4LF7B 3DZJA 4ND7A 1AXEA 4ID9A 3KCNA 5E3JA 1RRMA 3LWNA 5FL7D 3JALA 3ELUA 4XM2A 5FWXB 5CHYA 2B78A 1WPQA 1A7JA 2OGWA 4WI1A 4IR7A 3V2HA 3WLFA 2B1GA 3WWDA 2PWAA 1XTVA 3QVTA 1ZMBA 3S8EA 4OGFA 4IIEA 4CL2A 4ZMBA 3OZEA 3AUFA 3C5EA 1USUA 1OVGA 2E6KA 1J8MF 3DEKA 3OZTA 5EKUA 1SXPA 5JMOA 4FZRA 4OQ4A 3C1UA 2EZUA 2W42A 1A9QA 1NRXA 1ZJJA 4IIYA 2IBTA 3FRHA 3LDAA 1CUIA 3HJBA 2XOKD 3M6WA 5U4QA 1L5OA 5C7YA 2G80A 3PR2B 2AVDA 4H31A 2CZGA 3G5LA 2QPAA 1D2NA 2W2LA 3AB3A 1QORA 4I1PA 2DCUA 4XQ0A 3U4AA 1V8FA 1S2OA 2FPKA 2VK8A 1Z82A 3LBNA 4IBOA 4OHMA 5KYUA 3HN7A 3ZKWA 4F5ZA 1IXYA 1UDCA 2C4UA 4WPGA 3KPVA 4JY7A 1FCJA 3EN0A 1DBVO 3QSGA 1UEXC 4OYRA 3GJRA 1T24A 4YRMA 2ZTHA 4AD8A 1FE8A 3VVMA 2VTBA 2P8JA 2Z5GA 2CNOA 3ISTA 4BMNA 3R9IA 1WQ3A 2XCUA 2QOEA 2DWOA 3E48A 4INPA 3AZQA 3RVPA 5EKTA 3LUDA 4YECA 5JECA 1I1QB 1GN8A 1JLLB 4HXEB 2OL4A 1L5RA 1J25A 2YJZA 4CM5A 2YZ2A 1VJTA 4E13A 4DRXB 4YLEA 1W1UA 3OFVA 5EP2A 4BATA 3AP1A 2DWUA 2MR6A 2C4VA 2QTAA 2ZIXA 2H7XA 1RKBA 4KXVA 5KAPA 4C0XA 4EMUA 1D5CA 4L78A 2NZUG 4BCDA 2YINC 3EXIB 4AX8A 3DG9A 5KWJA 4RTPA 3GMDA 4IX1A 3EQ6A 2BWJA 3UTCA 4C6SA 3KOZA 3X1WA 1JKMA 4LJYA 5F23A 2GBFA 3DMGA 4RABA 3Q1LA 5K6AA 1VSVA 1ZLYA 4HFMA 1L8QA 2D4HA 2VR1A 3I9V6 4NBTA 1P3DA 3MOSA 4QAQA 4ATNA 3OKCA 5J1SB 2HD4A 1M9NA 2WSBA 4DV5B 4L7QA 1FSPA 3FGZA 1K6MA 13PKA 4BBPA 1CV2A 4IIJA 1AF4A 2IXTA 1O8CA 2ID7A 2ZIGA 1WZEA 3V80A 2XXAA 1O95D 1PJLA 2G08A 3IAEA 5CM2Z 4C6TA 5A6SB 2D8MA 1XTJA 1O5IA 5A4AA 1NONA 4M89A 1B6RA 4ZEVA 5JEEA 1U2GC 2EW8A 4OLBA 1KJIA 3VU8A 4XQGA 1N2JA 2REBA 2VP3A 3UWSA 3OF2A 1EHIA 3P9CA 3S8YA 1AQUA 1RIFA 1FMCA 1WOMA 2RGYA 4KRFA 1GQRA 2OYRA 1UMCA 3IUBA 1L5FA 2YVAA 4AJEA 4DNOA 3TDMA 1XQXA 2B1JA 1JBEA 2PJUA 4EZBA 1H1TA 1YMUA 2MSNA 3SSAA 3OETA 3FNBA 2C59A 2XRFA 2UYHA 5B3JA 4JC0A 2A4MA 3AVVA 1EWYA 2ZW9A 4AKEA 2LVBA 1G5HA 3LSYA 4CCWA 3PFNA 3SC4A 1FP4B 1R5OA 2H1CA 3IQWA 5A9TA 5CDSA 1BOFA 4LZNA 3FPJA 1KWGA 4IDNA 4C76A 5J2UF 3LBIA 3GDWA 3BDVA 2R87A 4B8ZA 2OZLB 2G63A 4UNNA 3LTEA 4UDOA 4YPFA 1UZMA 3R8FA 2VQ3A 3OWOA 2GZ2A 5BNZA 3P45A 2ZRLA 4CBVA 2JFBA 3SJCA 2QTNA 3HJNA 5CVJA 1BSVA 4DIUA 3BA6A 1PZEA 3ER8A 4MAMA 1KTVA 1W85A 1H2BA 2GYWA 4CIYA 1MOZA 4ETMA 5LUAA 2Q2VA 2WBLC 4PHHA 4XR4A 5F35A 1JG7A 2ODAA 3ZW8A 3HACA 2CNLA 2PM8A 5B1YA 5KU1A 2CKDA 2Q5LA 4M6WA 4E22A 3F7MA 3GUZA 4JR0A 2JEYA 5AW8A 5HUJA 3LNCA 5JJLA 2ZJ7A 1LJLA 3VJKA 2AFHB 4Y1GA 4LQDA 1W9MA 4J7XA 3QPCA 4NHOA 3L7LA 3NC0C 2KW5A 4OQYA 4RZ3A 3DM9B 2WF9A 3ITEA 4EVQA 3HLYA 3CW8X 3AGQA 1Y4SA 1JSXA 1J56A 2RG1A 1X7HA 4W82A 4CLOB 1C1YA 1GUFA 3OFSA 5A02A 3U7RA 5CU7A 2PZJA 5FOWA 1PFWA 3FRJA 4CTJA 2XUGA 3AG6A 2CL5A 3R6WA 3IUEA 4Y1FA 1MC8A 1E4OA 1L2TA 5M04A 2LXNA 3QQPA 1S3SA 3HL0A 2WM2A 2O0MA 5EPOA 3DO5A 2OGUA 4ZD6A 3KJQA 2GCPA 2WK1A 3PV0A 5G0TA 5GOZA 4A36A 4IINA 3AESA 5JHHB 2X1MA 3HYRA 4QU0A 3NMUF 5B7NA 2A0WA 2GN0A 2XNSA 3BXPA 3FYUC 2VJPA 1WCV1 1ZONA 2HSJA 2ZYDA 2YJNA 4EYEA 1PJ4A 3ES9A 4OO3A 1B6TA 3C3PA 1D1PA 3AP3A 5FTJA 1WBBA 1WV0A 3LAWA 4OB7A 5H3HA 3AL2A 3RGWS 1U2RA 3OCUA 1B8OA 1H2HA 4G0VA 3R75A 1A88A 4RNCA 4DYDA 3ORQA 2FZKA 4R9VA 2ICAA 1G21A 1FVXA 1UKYA 1EWRA 3OZFA 1X6VA 3HY3A 3HRIA 2PBZA 2WKPA 2O48X 3S29A 3OT1A 3O94A 1YRHA 4XSVA 1Z73A 3MWFA 4WKPA 1PBTA 3U19A 3WOHA 4X6YA 5HM8A 3DD5A 1VE9A 2OK7A 4QOJA 1FW8A 1L8OA 1JIQA 3DBLB 4D6PA 1Z3CA 3ASVA 2D5LA 1UT8A 2ZOSA 3CTMA 3DJYA 5AK6A 4D98A 4NAUA 1E3WB 3BTVA 1JKFA 5IPFA 2XT9A 5K0BA 3OPYA 3W8DA 1UZUA 1ABFA 1VGRA 2VZLA 4MW7A 3VDMA 3WK5A 4C0WA 1XZFA 4F5WA 1C0LA 1KU6A 5JNRA 1QRRA 1DCFA 2VPPA 4K8RB 2Q3FA 4CM7A 4Q1AA 2BFCB 1UXOA 3ENQA 2V8BA 2VLBA 1AS2A 3H0KA 3QQ5A 5DM1A 4XW2A 1SCDA 3OM1A 3URMA 2C2OA 5F2NA 1E98A 2GPSA 3HHEA 4GU5A 3TR6A 3DAPA 1NOJA 4DMMA 5CH8A 4RJKA 4DR1B 2TECE 4PRZA 4XDGA 4TTVA 3OTOB 4XYBA 5AKIA 1G9SA 2AYZA 2QLJA 1X13A 1U7DA 3A3NA 1RLIA 3L8YA 1CUGA 1DTWA 4XI9A 1AHPA 2NVWA 1GNRA 1SBTA 5HDBB 3GEGA 1RJFA 4DV3B 2CJWB 4TS9A 1OLXB 4Z54A 4ZU3A 3R23A 3RSZA 4G0MA 1L7DA 2VDPB 4OGLA 1FUYB 1IFXA 1KJYA 3KZCA 4JJ8A 5DSXA 4HO1X 3DAOA 1RYYA 2OP1A 4CF6A 4G81A 4B85A 1ZU4A 3RC1A 2P3SA 3GROA 1DUIA 3IQXA 2XWSA 3WMRA 5CB8A 3WIUA 5LQUA 2VS1A 2YXPX 3JASA 1FF9A 4C5BA 5JSHA 5E0KB 3W34A 1Z35A 3M4YA 1FXWF 1OIVA 4RL4A 1G8GA 5K8VA 1LLCA 4KGZA 4PHCA 2F8TA 4FFWA 3ZWBA 2A78A 2X0FA 3GGGA 3V46A 2CHEA 3OPYI 3Q3EA 3BWYA 5I9SA 1MUUA 4R1LA 3MWEA 1CP2A 1D1TA 4MX8A 4F56A 4EPTA 1E99A 4L8WB 2H1WA 1QTQA 5DT2A 1BYIA 1R6BX 4PPNA 5HW0A 2EQ5A 4XE5A 4WAUA 5EVCA 4Q7QA 3GN1A 3LPNA 4JFAA 5ALXA 5FB3A 3O82A 2O8DA 3MBKA 1COWA 4N01A 3KC2A 3DP9A 4WCVA 1V39A 3WDKA 1AU9A 3QBVA 4O59O 3PRHA 2QR3A 3A0UA 4RHUA 4OLFA 3KYBA 2KS6A 4FJ1A 4MTCA 3C5CA 1LBIA 4X1KA 5C34B 3TJMA 1W88B 2V3VA 3GRVA 3P9RA 4G26A 4Q7JB 3SN6A 3UXHA 4IZOA 3VU9B 4E11A 2O19A 3MJHA 1SXIA 3NQ41 3EZ7A 1U3WA 2OZKA 1CFJA 4X85A 1PX0A 5DBFA 4RSMA 4DILA 4ZK6A 1D5WA 1SWVA 1Q92A 2GRAA 1C29B 1XVTA 1E6KA 2Y4NA 5LBUA 3QBEA 5C9ZA 3DDCA 5DNVA 1CZHA 1J0DA 1GFIA 2O2EA 2WPDD 1FZQA 4IJUA 3ID6C 4MA4A 4PR0A 5EQTA 1AGYA 3E8SA 2MSDB 3ZNQA 2ZJ2A 3LE8A 1IJBA 1ZOSA 4WBNF 2GILA 4JK3A 3RWBA 4WBNA 3PKJA 3AY7A 3NV9A 3UK0A 2QNIA 2WAAA 5KSZA 3PE6A 1R18A 3D6FA 3DOOA 4S35A 4L5CA 3ESZA 2FW6A 4ZTUB 4XASA 4R83A 4C06A 2BGTA 1V4VA 3ZC3A 1A9RA 2VTDA 3UY4A 5L53A 5P8WA 4P2GA 1X1QA 2J0EA 3CIOA 5EFOA 3STUA 2XCTB 1ZD8A 2GD6A 2PLRA 4EA8A 3PLRA 3MBOA 4KXMA 2VNHA 2E4AA 5F1YA 1CIPA 3PL5A 1KS9A 4CRWB 2QPTA 3T9CA 4RFSA 1CDEA 3AOEC 1I1HA 2M1ZA 1UUFA 3G2KA 2JH8A 4HDAA 2CV1A 2AOXA 3ZXIA 4KRXA 3GR6A 3PQ2A 1IMOA 2VL7A 1KR2A 3HDGA 4LRUA 5HMLA 3EZ2A 4WLFA 5AXAA 3QEMA 3QOYA 4LHWA 4DMUB 4ER6A 4QFDA 1QGYA 3AU8A 2ZJ8A 2L19A 3KSZO 1E7QA 3ND9A 1BH2A 4RPLA 1H3FA 2CFCA 1NW6A 2WA2A 5L3SA 1U80A 3JQBA 5JPCA 5AJYA 4AO7A 4Z4QA 2AJLI 4WECA 1P2FA 4M8LA 3FYTA 1H0HA 4F46A 3TG2A 4E2FA 3EXHA 1JA1A 2W6ZA 3A1FA 1OUMA 1VG8A 3KSDO 1VYVA 3KR2A 4D3YA 3O9MA 1NMZA 1AMOA 2PT7A 4P3YA 1T3SA 1IXSB 1GAEO 3NBXX 3PU6A 4IHJA 1OY1A 1ZI6A 4QRIA 3DBRA 1K7EB 3G2IA 3KEOA 3H6GA 1L7BA 2RBEA 3HXKA 4G85A 4D0GA 5K7SA 4P3KA 3WWCA 4BGDA 2R1VB 1KXJA 1ARZA 3A6DA 4X8HA 4EUEA 2FSVC 3LIIA 4I2VA 4M22A 4UBNA 4H3KB 4MVJG 3BGWA 4F3NA 3FDIA 1CFZA 5KREA 1NP7A 3BK1A 3MSCA 4Q47A 4NICA 5E6RB 1XAIA 2I7VA 4NFSA 1QHHB 1TF2A 2GFQA 1GPUA 3FCUB 1ADJA 4QOEA 4W1QA 2JIBA 4UNIA 3S68A 4IJQA 1TADA 1K8QA 2SKCA 1XWIA 4HEJA 1V1MB 3A10A 3GMIA 4JS0A 2GVZC 4RANA 2NNLD 2CXQA 1EHYA 3IEKA 3B5JA 3MFYA 4AL4A 2XQKA 3NOXA 3UHJA 4UNQA 3UK2A 3TM5A 1CHDA 1YS6A 3H9QA 4LMRA 1OTHA 4KE6A 4OJYA 2JZNA 1TMGE 1GWNA 1TAHA 4J4HA 1MXFA 2GZ3A 1QYWA 2P77A 5DBOA 4FR2A 1GL6A 4IEEA 1TRKA 3IKVA 4GUDA 1J0BA 3ACCA 4DL9A 1ZGHA 4J43A 1R6AA 1JEQA 3TLYA 2CLCX 5DTJA 5IJZA 2CLLB 4FDLA 2CCGA 4YQZA 3MUFA 2VRBA 1M76A 5GZ6A 3BWMA 4JUAA 3WLAA 2GCNA 2P75A 2Y67A 3LOUA 4XUCA 1C8BA 2OGTA 3KD3A 2IHVA 1CDOA 3NJ4A 5LB4A 1RBZA 5G02A 3ABIA 1LRKA 1RP7A 3WGZA 1M75A 2UYGA 3PQ3A 4GR4A 3BH7A 4RZSA 4Y2XA 5IVHA 2CXUA 3IUMA 3O3OB 1J07A 4EMTA 4PRYA 3LUJA 2WWIA 1DG3A 3FTNA 3STYA 4E1VA 3C3CA 1MA0A 4YX9A 1TPZA 3PXUA 1PV4A 2AA3A 2QGFA 4BAGA 2E5LB 1PEKE 2O50A 2P9GA 4UMFA 2R6AA 3K5IA 4HWSA 3TLGA 2C9OA 4EO7A 5LP6A 1O9HA 4KIJA 1R50A 3E1KA 2BUAA 4QA9A 4LMAA 3UIEA 1CD5A 1HZZA 4CM8B 1A5ZA 2HMVA 3CR7A 3MJVA 3U7FB 2AEFA 4ED9A 3LXXA 1MHTA 5BUZA 4M0MA 1RLUA 1UODA 3AB8A 3BJRA 4C0SA 3I6ZA 3REQB 4D0RA 2CNKA 3M5WA 3OT1B 2R6GA 4DC1A 4B43A 4CR7A 2J67A 3LDGA 3UC5A 5AVKA 1P60A 2FZGA 1KO8A 2AR9A 3I34X 4QIHA 3R74A 4NK5A 1XEWX 3DSRA 1C1DB 2GBPA 3ICQB 2O3UA 5EE3A 3D1VA 4N0EA 1AQJA 5K0EA 3VO9A 4RX1A 1SCKA 5LYJA 5JXWA 3L2OB 3U17A 4AZ3B 2BMWA 3LO5A 3QE9Y 3DHNA 3G1UA 3LV8A 4LJLA 1G2IA 1MH1A 2BGLA 3I2JA 4R6XA 2EIXA 3EDCA 3ZIUA 2JIRA 2GPTA 1YRYE 1V2HE 1FTWA 2VBCA 4R68A 3TNYA 1WLSA 1J42A 2E2WA 3E9ZA 1JHUA 3CVUA 3SC2A 5A5GA 3I0MA 3ULKA 3KL2A 4LE0A 2X2FA 1IQUA 5CMLA 5COBA 3WWOA 3D4PA 1M2VB 2ZDQA 4PQRA 3O2SB 5LIRA 2Q3MA 3W9SA 4FYVA 1I30A 3PNLA 4J07A