5KAPA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-(4-(phosphonobutil)hypoxanthine
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
159
Chain Sequence
TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 45
structure length 159
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kapA00
3DEZA 1P17A 1I5EA 3MJDA 1DBRA 4X44A 3O7MA 4FYMA 5HIAA 5JSQA 5IPFA 2JBHA 4JITA 1R3UA 3OZGA 1G2QA 1MZVA 1QB7A 1U9YA 4PAWA 1VDMA 1Y0BA 2C4KA 1TC2A 1V9SA 4RACA 5EUCA 5BQOA 1UPUA 1OPRA 2H08A 1OROA 1A96A 2PRZA 4M0PA 3S5JA 1P19A 1I0LA 1ECCA 4LYGA 4MB6A 2FXVA 2EHJA 1GPH1 2DY0A 4RQBA 1P4AA 4PFQA 4P3KA 1ECBA 1D6NA 2WNSA 1DKUA 1A97A 3KB8A 1QCDA 1A3CA 1FSGA 4P84A 5ESXA 4RV4A 1WD5A 1HMPA 2E55A 3LRTA 2JI4A 1JLRA 3GEPA 2PRYA 4P80A 4P83A 1BZYA 4P82A 1BD3A 1A98A 1ZN7A 4JLSA 5HKLA 1Z7GA 1NONA 5E38A 4F8EA 1BD4A 2XBUA 3G6WA 1UPFA 2JKZA 1XZ8A 4RADA 4RHUA 1G2PA 2H07A 4KN6A 2P1ZA 3ACDA 4RHYA 1ECGA 1O57A 5KAPA 4S2UA 1XTUA 4LZAA 4QYIB 1VSTA 3ACBA 1JLSA 5BRNA 4QYIA 1PZMA 3OHPA 3M3HA 1ECFA 1L1RA 2YZKA 3H83A 1GRVA 3MBIA 1QCCA 2PS1A 4M0KA 3N2LA 1P18A 3NAGA 3QW4B 1QK5A 4RANA 4RHXA 5JV5A 2GEBA 4RABA 1NULA 4LYYA 4ZFNA 4QRIA 1W30A 4RQAA 5K51A 5KAMA 1VCHA 1AO0A 4X45A 3LPNA 3DAHA 3HVUA 1U9ZA 4WN3A 1UFRA 2H06A 5IAOA 1STOA 1TC1A 4WMLA 3EFHA 1XZNA 2IGBA 4P81A 4IJQA 5BSKA 3ACCA 4RAOA 1G9SA 4P86A 4Z1OA 3DMPA 4M0UA 3GGCA 2VFAA 1ECJA 1G9TA 1DQPA 4LZNA 1J7JA 1YFZA 1DQNA 1QK3A 2AEEA 1A4XA 1HGXA 1QB8A 3GGJA 1OREA 1I13A 1CJBA 2HCRA 1LH0A 1QK4A 1I14A 2JKYA 1I0IA 3OZFA 4OHCA 4RAQA 5BQPA 4RHTA 1ZN9A 1IBSA 1A95A 1O5OA 1XTVA 4TWBA 1L1QA 4LZOA 1ZN8A 1XTTA 5ESWA 1DKRA
chains in the Genus database with same CATH superfamily
1RC0A 1Z22A 2DPGA 2X0DA 3IXMA 4YRFA 2EDAA 5TLSA 4K3UA 5IZCC 3FPJA 2VF7A 3ZXUB 5C4MA 1YQGA 2A1TS 3BAZA 1FPQA 4C88A 1E6LA 1L9XA 4BX9A 2J4DA 3B1YA 3P9XA 3HPQA 5JASA 3HI4A 4EITA 4DR2B 1L5KA 3AETA 3Q40A 3HHPA 2RKOA 1LX7A 5E2AA 4JUBA 1HYBA 5C80A 3U7EB 4YHBA 2Q1SA 4RELA 3UGKA 4PHHA 4DQUA 5BV2P 1I7SB 1XJ0A 4TL6A 2DR3A 4E32A 2UV8A 2EAUA 3WKBA 5A5DA 2QP3A 2RHHA 3KEQA 4PN3A 4LV5B 3USZA 1SR8A 3N39C 4YMHA 4C6SA 4BTLA 3OF5A 3ZVNA 5ED0A 3UA4A 1YIDA 3T3OA 3KJFA 1RLJA 2VT6A 221PA 1XCJA 5CT4A 5I9MA 4RMIA 1ORWA 3CUEF 2Z43A 1B8VA 1ND5A 4G1FA 4UU0A 4GW3A 4Y2SA 2V7PA 4UBIA 5EJ2A 4PC7A 1G5RA 2CZCA 3M5DA 1R4MB 4QOJA 3VR3D 4BRSA 2J5BA 2BH2A 4BKPA 2PZJA 2XMPA 4DJFC 4HYYA 5LD2B 1X8KA 2BGNA 3A1UA 4QE3A 4XVQA 1LVUA 1E5DA 3PFHA 5L45A 2XB6A 5B57C 2XCQA 4ZALA 4Q9DA 1MABA 1UEIA 4BASA 3FHOA 1L5SA 3FYUA 5ULLA 1XZQA 5IJ9A 2ZI3A 4B31A 2JB9A 3DDUA 1V71A 1FUYB 2IQ5A 1JGTA 4P3PA 3AM1A 2G4LA 1CUDA 4KN6A 5C8ZA 5DPMA 5K0SA 3CG0A 3FB4A 3E9EA 4TRNA 4YAEA 1XRLA 2BGGA 1K9VF 2D2FA 2QMEA 2XKAA 1NN5A 1JG2A 3EASA 1YRBA 1F7VA 1SC3A 3STYA 3FZGA 3I3OA 4TLBA 5I51A 2JVIA 1PDVA 2VXOA 4AI6A 3P71T 2RB5A 3DF9A 3KFXA 4IO1A 1L3BA 3IALA 2CL0X 4MW9A 3WR5A 4J7AA 4UFPA 2MWMA 1FIUA 1JL3A 1KMCA 2GRUA 1UBHS 4TLDA 4B71A 4EVSA 3OQOA 1LZKA 5ALGA 2GB4A 3JAWA 4M37A 2Y71A 1TM1E 2PUJA 1TMOA 4BCCA 3ZXYA 1R1DA 5IBRA 2F9FA 5H4GA 1EJ0A 2HHAA 1LW7A 2OKGA 2P9TA 5FQOA 4ER5A 2PSFA 2VWGA 2YJ6A 1TFRA 3E81A 3RS8A 1ODJA 3VR2D 4NEQA 1DELA 4X95A 4H16A 3W5UA 1QE3A 4MPJA 2OV6A 1SXGA 3MOSA 5J4HA 5JQWA 2OZEA 5FTWA 4NENB 1VE1A 5G4KA 1T1RA 2ZTMA 3COZA 4AM8A 3G5TA 4F3NA 3CT6A 1W88A 5JXGA 2EFEB 2Z3ZA 3UMCA 2VPIA 1UPTA 4IQFA 4X94A 3MIIA 2PE5A 4F3KA 3L05A 4QX6A 4FNOA 3I0NA 4AJ1A 5KBYA 1WF3A 1CQIB 4MW6A 1ZL0A 1FFGA 2DZDA 2OCBA 3P2JA 3RPEA 3INRA 1XDWA 1RJGA 5FNZA 1HLGA 1I5EA 3VPXA 1P5JA 4CV1A 3QITA 3ND9A 5REQA 2PTHA 3TR5A 4P54A 1JWLA 1N8KA 3GRYA 1QUFA 4PLHA 2OLKA 1OXXK 4FZ3A 1NNUA 2OO5A 4D4IA 5KWJA 1CUEA 3L46A 1YFJA 1F1BA 1HLPA 4XQ9A 4LPKA 3WICA 4MVJP 4CM9D 2ODTX 4M9XA 3QJ5A 3K2EA 2OBLA 4FHGA 1U65A 4OLAA 2K7FA 4PGGA 3EWNA 2YMLA 1EGMB 1FYWA 2C4KA 1Y5NA 3P4UA 3VSDA 3GJRA 1CRPA 4TKUB 1XE3A 3ZWBA 2OM6A 3FRJA 5C51B 4C4OA 5B2EA 4ODIA 3JQ7B 2VF5X 3A4YA 1UKBA 4KQ6A 5IDQA 1HZZC 2QB5A 3D8BA 4BLTA 4E51A 3CSSA 4I4NA 1SULA 3OBBA 3HSSA 3PTLA 4P35A 3OBIA 1IQUA 2B6NA 4RY9A 2R9VA 1SWWA 1AE1A 3PVSA 5F1KA 5L3SB 3KQHA 1IEXA 2DBZA 2EZ4A 4KWHA 1T9CA 3ZK9A 2KLHA 1QCDA 1I3LA 1ISSA 1K68A 1QNLA 2IUUA 1JFLA 3TLGA 3L4BA 1XTPA 4ZHQB 1C2TA 4Y2JA 3JQAD 4LCBA 4ZOLA 3GRAA 2PT6A 4ZTBA 3I2IA 3P9CA 1R6VA 1SCIA 2AQIA 2JIBA 4MGKR 4F4DA 3CG4A 1XHLA 1AKMA 1KQ3A 5CJJA 1PG2A 2I7XA 4MQFA 2OB1A 1HEIA 1KJWA 3HUDA 4TGLA 1WUHS 1XKLA 1CDDA 3O4VA 4YDQA 3JD1A 2ZDGA 3TRKA 1QR6A 1WBJB 4IIHA 3D64A 4S1NA 4N47A 3SSMA 3KZKA 1WSBA 4RHYA 1I32A 4WKCA 4IWXA 5C34B 5CA0F 3LDUA 1XO1A 1HDOA 2JIPA 4NAVA 4MVWA 2C4TA 4F1WA 1S8NA 1UM9B 1ZRHA 3UW1A 3AVPA 1L4UA 4KKVA 1MNQA 5JZVA 4A16A 2AXQA 2IIPA 4KU4A 1K88A 4YAJA 3ZCSA 3WZMA 4FLMA 2F4VB 3IAUA 3OIDA 1ZMOA 5EZYF 3H04A 1BMFD 4RV5A 5LWHA 1KOJA 3Q8LA 1MB2A 1C0EA 2H4YA 1PQ4A 1JYSA 1XJQA 3NHFA 2OXCA 1SU7A 4E09A 4IUCS 4Q37A 2GH1A 3UICA 2W2OA 2ZTHA 1GZ3A 1R64A 4BGEA 1PS8A 3LFUA 2QUKA 3SXJA 1E61A 2INGX 3DAHA 3WO1A 4CTMA 1WKBA 5I4CA 1YR7A 3IAM1 4BNIA 1L5ZA 2C2WA 2LGJA 5GQSA 1G5PA 5WRFA 1L4NA 1C81A 4HSGA 3CRW1 2ABWA 2QYOA 1MGOA 1A9OA 3THSA 3UXMA 2FW6A 5I3CA 1XC7A 3H5AA 3UOAB 3OVMA 4I1SA 1QQ7A 4JGIA 4QU5A 2V7XA 4R68A 1QRTA 3UAGA 4C4SA 4OH1A 2OZLB 4UD2A 3VYSB 3ZZ1A 1XDDA 2GYUA 3BGWA 1MVOA 2VEDA 1ND6A 4TX1A 2FLKA 5GP1A 1WW8A 3EB9A 3K6RA 2RHJA 1E0SA 3V2HA 2RCYA 1YH3A 1VYVA 2X3UA 3PT9A 3ULKA 1EBFA 3LPMA 4BAZA 3ZCPA 4BIIA 4CNBA 1KIMA 4DRYA 3OZFA 2YIDA 3R3WA 2BGKA 1OC2A 4R9VA 1JTEA 3OF2A 4RKRA 1E3TA 2ERCA 4QICA 4XWYA 5JG7A 5DO9A 1NX9A 1P1FA 2Y1CA 4YROA 4L50A 1OBFO 1D2CA 3ICPA 4EUSA 3CNLA 5TQ0B 3JWGA 1MIOB 1GPKA 3WP1B 1KO7A 3IDZA 5DVZA 3OTQA 3PUVA 4IW3B 3EVTA 1LLQA 2ZU6A 1PKEA 2AI1A 4IKPA 1QO0A 5SY4A 1E2HA 3UTDA 4BVKA 5BYKA 1SAYA 2R00A 2D5CA 3CLKA 5K0TA 1OSNA 3QFFA 4URVR 4A0QA 3TZQA 1UAAA 1LB1B 3GGPA 3CZAA 2IXDA 3OA2A 1RC8A 5D00A 1VDMA 2IIVA 4D1YA 1ZUNB 2QP4A 4HN2A 1TUIA 2I62A 3L1VA 4DG9A 4PC1A 3F8TA 3TDKA 5K6AA 3LOPA 4L57A 2IYEA 1RQ7A 4OMUA 1QFSA 3X2EA 2MINA 2WIGA 2XEDA 1KY5A 4LJ6A 4X65B 1DC8A 2CUTA 2HV8A 4BXOB 4U2FA 4JY7A 3QVGB 2BUCA 1QLHA 3ECCA 4ADSG 1MTZA 3VI4B 4DYDA 4ZOBA 2GLXA 1DEXA 3WMWA 4RZXA 2OP0A 3CNBA 3GLFE 3G8YA 2CT8A 4U0KA 2GILA 2P2YA 2ZPTX 5KDOA 1CS0A 2IXGA 2ARKA 4NHEA 1NKTA 2FZGA 2M98A 3BB1A 3VJRA 1RRMA 3OZSA 2D4HA 2VSOA 5FWYB 2WUGA 1HXHA 1KYQA 1VL6A 2FSVC 2FWPA 5JC1A 3BH7A 2I71A 1S0UA 4CEHA 1Y1KE 2QUHA 4HTAA 3VZPA 2X5XA 1IVYA 3A58B 1U1GA 3PNBA 1CY4A 1D5WA 1IBKB 3SQNA 1LW6E 1P2VA 2XDWA 3WBKA 3D3NA 3OY2A 3UW3A 4D4HA 2VHCA 2BFBA 4M1TA 4HMQA 3TJMA 2G4VA 1M6NA 4AZ3B 4ZREA 2ZJ7A 2R8XA 5E3JA 4EZBA 1KDTA 4O6VA 1O96B 2P69A 3LKBA 3PR3A 3HLYA 4DV6B 3B9PA 4NMMA 1DS6A 1JLSA 3IR5A 4NP6A 3ZIAA 4BQIA 3HACA 2NXNA 2JNWA 1KFCB 1NBMA 1UDXA 2CUZA 3IXQA 1EHYA 4BNVA 5C8XA 3KOOA 3EVNA 3EIUA 5M5BA 2X1VA 4J4TA 1L4FA 4OO3A 4BAUA 1FDVA 3HI6A 4I4TF 3DVRX 4KNVA 3AKDA 5I01A 1KK1A 1LC0A 3IDFA 4TV9F 3T8YA 1WUIS 4HDNB 1EBUA 1QIIA 5B4VA 1HNXB 1IFXA 5JADA 3AONB 3TOVA 1JEAA 3JQ8B 4R7GA 4IIJF 1N7GA 2YYZA 3ZDDA 1N0HA 1ZBDA 3R44A 1X77A 3FSEA 1WY7A 3RV3A 4R81A 3KU4A 4Y1RB 2XY4A 3DGEC 5DK4A 4HN4B 4U3JB 1L0BA 4F85A 2P1DA 4TXJA 1L3IA 1RYEA 2JLWA 3FKSA 5D7BA 5DULA 4D2IA 2IQIA 3URMA 3S2SA 3UFXA 5JVDA 1SXPA 2PEZA 1Q3TA 4IVPA 5JH7F 4AS2A 3D2CA 5BVGB 2IHBA 4F3TA 4UTVA 4FCCA 1WW2A 4HO1X 1C7JA 2JK0A 3MFYA 1RYDA 1NQTA 3LX6A 4KRGA 4LF9B 1UK7A 3EYAA 1ATZA 5AJHA 1QO7A 1NUPA 3FOEC 4FYXA 1J0AA 5EIBC 1XA3A 3HB0A 4G37A 2AHRA 4D25A 3G2LA 3I5YA 2EJVA 3DZFA 1RI4A 1FMFA 2BEJA 1ZXXA 1PR2A 1PV2A 3I39X 4K9MA 4P4TA 3H7AA 3HJUA 4P36A 2B7BA 1FFCA 3AHDA 1CUJA 4QDTA 2HO4A 2VP4A 2A5JA 1XZGA 1DBQA 2R6FA 3HZRA 4JDUA 2VF4X 3EQZA 3OE4A 3B7PA 3AKZA 1ZVQA 3LC7O 5CM2Z 3S2IA 4D41A 4CQNA 4LF8B 1QTNA 1A4UA 1Q2XA 2YHIB 3KSRA 3PC4A 4POOA 1WB9A 3OETA 3JYQA 1N7IA 2A0XA 2ZBPA 3HADA 1IQPA 2W37A 1YS9A 3ET4A 1H66A 3E3NA 2HNBA 4RVDA 4TWRA 3SZGA 4YREA 1IWBB 4BE7B 4LTDA 1HK7A 4OK3A 3CUKA 3AJ8A 2GJSA 2Q1YA 3N0RA 4TS9A 3E23A 4ASUA 1NR7A 2W0MA 3RARA 3S1SA 1BCSA 4BC1A 3K96A 3B6ZA 5ALOA 3E2MA 1MJNA 4V2IA 4RK6A 1RFLA 1LI7A 2BFMA 3FDIA 9MHTA 3IUMA 3TDNA 4TT3D 3KALA 1UPFA 4MUMA 2VHWA 4CFYA 1DVRA 2WJ3A 3E3MA 4R51A 5FUVA 1W47A 2ZI4A 4ZZ2A 1TT5B 5ELLA 3BFXA 4BOYA 2WHEA 5LB2A 1RZUA 4JYCA 1HDIA 5DJ5A 5ALUA 4BC0A 5AUNB 4LF5B 1MORA 2BFNA 3TXYA 1AJEA 1M6WA 3UV3A 5FULA 4L4RA 4BP9A 5IFKA 1NVUQ 3O4HA 2EDCA 1PG5A 3OE7A 2QAGB 4DDMA 3R75A 3M3HA 3EBPA 3H3FA 1KMHB 1UZUA 2PPLA 3F98A 3SYRA 3RUEA 5A4MS 2FCRA 4KYVA 4UHHA 3T6KA 1IUPA 3VPDA 2YZMA 1WS6A 3MB8A 4QPJC 1A8HA 4TS4A 4KPEC 4J75A 1CU1A 1DKLA 5FOWA 3HDQA 4I3FA 3T5TA 5K5EA 5KHLB 1T13A 2Y4NA 2BP7A 3HP7A 5FJIA 1S4QA 5MDHA 4GI1A 1OFTA 3DBIA 3HVUA 2GEUA 5KYGA 2FA9A 4CYMA 5CBPA 2IWHA 1ZWKA 1XZFA 2ZYSA 1DC4A 3SHVA 5FEMA 2B35A 4XYMA 2IX9A 4LG1A 1ITZA 3GRUA 3KZNA 3VU3A 5F7ZA 3HCPA 1Y9AA 3ND5A 4P38A 1AQIA 3LWBA 4U9UA 1SBCA 4FB5A 3GEGA 1LCIA 5D3MA 4J9UE 1DARA 3GJXC 1UBCA 1WNTA 2F3PA 1Z29A 4BRZA 1MVLA 1E7QA 1PZXA 3B5JA 3GRKA 3MIZA 2A9JA 4J43A 3OX2A 2CXSA 1T0PA 3LVQE 5FPHA 3OCJA 3WJ2A 1JJVA 4LZLA 4XQEA 1I6MA 3E61A 1E1DA 5K0CA 4AX8A 2BIFA 5KOYA 4FYMA 3CNQS 3GB9A 1XEFA 1XD8A 3EISA 4ARUA 1TTTA 2EZUA 5DNDA 1W7AA 3QNMA 2R5WA 2Y76A 3L1JA 4G9BA 5IVHA 3OZGA 4PEVA 3DBHA 1CUVA 1T4CA 2IS1A 1YKSA 1Q0TA 1JDBB 1PWZA 2QYHA 3T9AA 2L18A 3C7TA 4B6QA 4CIWA 4FNGA 3K92A 2F67A 1DLIA 5CYPA 3T7IA 2Q2WA 1BHQ1 1D8TA 4EPTA 4X8OA 1R5NA 5JCOA 1RXIA 2UUAB 4O29A 4GDMA 1AS3A 1W581 3OWXA 3M89A 4JI2B 2IIQA 2W6OA 3DL0A 3D31A 3LL4A 2C99A 1PBNA 2A0UA 1GLNA 3CXRA 4MGEA 2JIZD 3IT2A 2ZB2A 1KERA 5HK9A 1GQQA 4TYQA 2G5GX 2BWJA 3N75A 5AR1A 1ORDA 1J8FA 4O08A 5D6OA 1NATA 1Q6YA 4L15A 2GAOA 1F2DA 2HHCA 3EZYA 1MKYA 1R4MA 3GRZA 1NV8A 3ZGXA 1X0VA 5LLTA 3UJNA 1IM2A 1Z5OA 5FFNA 3SX2A 2KE5A 1H6BA 3R7WA 2BHSA 3PXGA 3D3QA 2H5EA 1YB5A 2V65A 1S4MA 4N3GA 2XSZA 3G6WA 4CF3A 4F96A 1XZPA 2Q1WA 4FIDA 5I6DA 4JUIA 4JLBA 4JC8A 4F84A 5JNWA 3W2EA 1FTWA 3WK5A 1E8DA 4LV8B 4ZVVA 1RZRA 4DDHA 3OFJA 2A9PA 1J2EA 3WXMA 4GLJA 2F8SA 4LWOA 3EZLA 4Q82A 4UVHA 2R6JA 5AOAA 2A5LA 5ALLA 421PA 3O9ZA 5DNCA 1OGYA 3AM3A 4AW9A 4C7OB 4G1MB 1P2DA 3U37A 4LF7B 1P18A 1N1DA 5A7FA 3HCBA 1GITA 1MJFA 4I3GA 2Q28A 3PZBA 3RD5A 1FUUA 3JWEA 4FYHA 3SEZA 3VHLB 3BJRA 1I2ZA 4H1VA 4R9RA 1P3DA 1ZSNA 4N54A 2P65A 5KEIA 1P61B 4JS0A 1MOPA 2V8BA 3GEDA 4DGSA 1F2TB 1FFHA 2QRVB 3G0DA 4YIHA 3GLQA 4HFRA 3BJIC 1GYPA 3IAS1 4B3DA 3ENKA 2TMKA 1N2GA 3MTEA 3OZBA 1GPWB 4HYQA 4LQCA 4CUJA 3A0UA 1VM6A 3EVCA 3Q85A 4H0CA 1YBMA 3V1UA 4AG5A 2IP4A 2PS3A 3BMQB 4BKOA 4ESOA 3KR2A 3QLVA 3P9SA 3GZJA 1H3FA 1P2UA 1SBNE 5L4LA 2ZJ8A 5CLGA 1TLFA 3TW6A 1D04A 2NO5A 3U3JA 2UUPA 2WY2D 2PS9A 3CVVA 3BD8A 2FFBA 2XVMA 2DJIA 2V0CA 5ANRB 1W8IA 1H22A 1N5KA 3F8WA 4TYPA 4XM0A 4EPXA 5C2JB 2H1HA 3G0GA 2HDNB 3RRXA 1SGWA 2HCFA 3EOBI 3NM5A 3VM6A 5T3UA 1JDZA 5A6VA 4M8IA 2P7IA 2PZKA 4O4HA 3W5BA 1EQAA 4BP1A 1Z08A 1P17A 4X8MA 1XB2A 4AKTA 4JN6B 4AY4A 4J8PA 2QPOA 3ZK8A 3PQ8A 5CDYA 3TQTA 3V8MA 3AH8A 4RS4A 4F8JA 4LBZA 2PX5A 4UVDA 4AAYA 4EB8A 3RVPA 3K20A 2C59A 4JJEA 4KAAA 3HYCA 3FB1A 2VYQA 4L3VA 2CNKA 3QWAA 3AUTA 5DI3B 4UM9B 2R6GA 4TZKA 3RRNA 2PWZA 3HYLA 3NEYA 5L53A 2OK7A 4TKUA 3VOSA 2B98A 1AHNA 2IOFA 3E82A 3N8GA 1TCCA 5DM0A 5CCDA 2PUWA 2FMFA 3FUUA 1X9HA 3GLHB 2C1XA 3L0IB 2O23A 4MEJA 5IEBA 4HLQB 1S9HA 2P6OA 4L9AA 4OXRA 3O3MB 3WSVA 2DXIA 3F74A 4M7WA 1VJGA 2HQRA 1MEEA 4JWTA 1W36D 1JHZA 2GFIA 5JC8A 4KTTE 2UDPA 1PT6A 5HOEA 5J43A 4F91B 1O03A 5EVJA 3K16A 1D6MA 1XTRA 4WKPA 1P4RA 3WB2A 3UKJA 4ZJYA 3P8ZA 2PCLA 4V1CI 2HU5A 1RHKA 4ZHQA 3P2KA 3VU1A 4D8YA 1N5IA 2JZCA 1ANKA 3AEXA 2UZ1A 5BV8A 3IKMB 1NC1A 2B3TA 2Y2UA 4QVKA 1PVOA 1XYYA 2BJVA 3AJEA 4UC0A 1D6SA 1NZDA 1RLMA 1PL7A 2XWSA 4CLOB 4CJXA 2P40A 1X86B 3DM5A 3K1JA 1CR0A 4UM7A 1KARA 2IXAA 2X8JA 2KWIA 2Q0QA 4Q12A 1DWUA 1FX0A 4QDXA 4DSUA 2C54A 3QVVA 2JJYA 2YYYA 3LWDA 2I6QA 4I55B 4TROA 3VPGA 3WC4A 1LXCA 3CF2A 3FPLA 3IBGA 3LI2A 4OKNA 1P31A 1KFBB 3BH6A 3M83A 4P2BA 1N77A 3GL9A 1FA9A 3EC7A 4GZ6A 1CIJA 2Q6OA 1BAPA 4RQTA 5SY9A 5BXYA 4ZVKA 1SUIA 3ADPA 3EXEB 1EK5A 4YAWA 2JCYA 4O2RA 5IMSA 2J3HA 4DDWA 1RYZA 2W2TA 1VG1A 3ILVA 1YULA 5FI1B 4WQMA 3VVMA 3WIDA 1QWSA 3DVSX 4EO4A 4RABA 5JAHA 3E27A 3UBTA 5AW3A 2VJQA 4KXFB 3SC6A 1KE1A 2XCOA 3IPXA 2ODQA 3FTDA 3K5PA 5LQCA 3U4QA 4LVNA 3WRXA 1T9KA 1W4BA 4TTIA 4TMZA 2GN4A 1CUUA 3L7MA 1JF8A 4K7JA 3VPHA 4ALJA 4DA7A 3TL6A 4FMCB 3WV5A 5CA0A 2HWYA 3R7LA 4AYXA 3SR3A 3I5XA 1JR2A 3BWDD 4C21A 1V95A 4Z4EA 5JAIA 3NNSA 3RLIA 4OQPA 2G77B 2Y93A 2XCRB 4OA8A 2KJQA 4DJAA 2JJ1A 1FK8A 3H2ZA 4IF6A 4Y9UA 2GS9A 1E2PA 2EZTA 3T95A 5IHPA 1K7SN 4HDKB 5EZYA 3EDQA 4H1TA 4WLUA 3HY3A 4CBVA 4YRKA 1WXQA 4RM2A 1G6OA 2P3QA 1J20A 3E1SA 3I1JA 4OYYA 3SFVA 3Q6NA 4QM7A 2BT4A 1JT2A 3DDNA 5CAEB 1T6NA 4RGQA 2IOYA 4YQYA 2FDCA 2CMDA 2MSEB 4ND8A 1I5RA 2I1LA 2JAOA 5E4TA 3M6XA 5HRCA 2NVOA 4D0SA 5TQ0A 4LQDA 2AKAB 1N2CB 2A3RA 1OX4B 2YNMA 3AINA 1IOWA 2KQUA 2CL6X 3DTVA 2P4SA 4H08A 4PLFA 4ZI2A 2ALJA 4RY2A 1YOBA 1M1XB 1XMSA 2DCMA 4P5DA 3QBJA 4ZC8A 1HI9A 4D3ZA 1X1TA 3FD8A 3AR3A 1D4AA 1NI5A 1CNEA 1G42A 2J1LA 4HATA 1BRMA 1NU6A 2H16A 1KR2A 3KIPA 4MMXB 1X7YA 2J32A 3EEYA 1MF7A 2ADOA 3EGOA 4Q03A 4UOZA 1X1AA 3NHMA 1DRJA 1GUYA 4OFBA 3KTAB 2Q9AA 4GSYA 4U7HA 4PRZA 2W6ID 5D86A 2PVSA 3P9NA 1ORHA 1SUWA 3E58A 5LQJA 4RMGA 4EB6A 3DE3X 5AM3A 3KWJA 2QVBA 2VJMA 3MFQA 3RJTA 3GP8A 3IX7A 5CDFA 4D02A 3QVGA 1U0TA 5KNLA 3NO4A 3OOWA 1KJNA 1M2JA 3SG0A 2EV9A 2BEVB 2JA1A 1XU9A 5FNVB 4YR7A 3CTMA 1GG8A 1O5TA 2GN0A 3PU6A 3OE5A 1E9SA 1NJSA 1DINA 4IQ8A 2NO7A 1YB1A 4B6JA 5KTPA 2GZ2A 4CIXA 3TO5A 1KSJA 2XXBA 2A5GA 2BE7A 1EESA 4OHVA 3PWKA 4OI0A 3IXLA 1X7HA 2ZE5A 4LYEA 2CLCX 4GP7A 5E7MA 2ZWPA 2QP9X 4G0YA 3FN4A 1A04A 3F1LA 1XZ8A 5CUQA 1ZD2P 2BDUA 3CX3A 4N8DA 2OYSA 2ZIUB 3OEHA 5F1YA 2F6RA 2R48A 3SNHA 5J58A 2ZLBA 4Z4FA 2QRNA 1HC7A 4HI0E 3RHSA 1UJNA 2VCHA 2J9YB 3AR4A 3TEFA 4Q16A 2X41A 4YJKA 1HA3A 1Z0DA 3O2JA 3VJLA 1XDBA 1Q91A 3EVBA 2ADFA 2ZBGA 3KZMA 4MQ5A 5IBCA 5A06A 1Q95A 3I6MA 3MD0A 3NJ4A 1PVDA 1QH9A 4ZAXA 3UYLA 5MN6A 3DT8A 1L5GB 5TF0A 1O0SA 5I4BA 4LVUA 3FFTA 4AVYA 3ZN2A 1SUSA 3IMGA 4JT8A 4QYXA 5JY1A 5FLEX 3TM4A 4I4IA 4GRIA 4EB0A 3D8SA 1NP6A 2VPXA 4FX2A 3KRTA 5AKIA 5GV8A 3SK0A 4BQFA 1UDAA 2FPPB 2GLTA 3ML1A 4IJ6A 4UJ3A 1AGRA 2X8LA 4XWGA 5DM2A 1BE6A 4EKYA 3NQ41 1O6GA 4IJVA 3LLUA 4NK4A 2JLRA 1DAPA 1D2RA 1T0JB 2H2HA 3JYOA 5IAOA 1HDEA 2PZMA 4KBFA 4JXKA 4Y1RA 2B3DA 5FTKA 3D8HA 3G2IA 4I50A 4GWGA 4NCXA 3FDJA 4DIDA 4IHKA 4KVGA 5TY0A 1W48A 1IZZA 3WYBA 1FP7A 4MVCA 2CBZA 4P5EA 3RTBA 5IM4F 1XUOA 3G0HA 3FPSA 4TSRA 1GPDG 1SWVA 3KZVA 4YJ2F 4YXWA 1PRYA 1A4XA 2HX1A 3RQSA 3ICOA 1JR3E 1CETA 4LRWA 5I7EA 5JT1A 1YOVA 1IB6A 3IVRA 4RSMA 2UZAA 1R0KA 3CURA 1S01A 2B1JA 2PYZA 3UJ3X 4IIJA 3BRWA 4F1JA 3W1VA 4J4BA 1VKRA 2ZSJA 4LY3A 3PIRA 2GTPA 3NW9A 1Y7LA 4HCJA 1CJVC 1DKRA 4IG9A 4EDFA 5ADUS 2V6GA 3JQFA 3PKZA 1MX9A 4MI3A 5BMVB 2BHNA 4WXYB 1WMEA 3EMBA 5DXAA 4ACBA 1YZVA 4ND1A 4HUJA 1VCNA 4R8LA 2OB2A 4PZDA 4B33A 2PMKA 4ER6A 1A76A 2VHTA 3O4IA 4YS6A 1QAQA 4KQMA 5JH7A 3RT1A 5AW0A 3I2HA 2NO4A 4C7XA 1T5SA 3AY0A 3VNAA 2DQKA 4P34A 4QOHA 1SMKA 2X9QA 1TZCA 4G5QA 4LHZA 5CJPA 5ADHA 6ABPA 1PG0A 2XYVA 2BVNA 1EJ2A 5P21A 3SQLA 4CG2A 5IEJA 4YBZA 2HW8A 4IMIB 3IP3A 4QYTA 1XRMA 3MTDA 5FP0A 5KC9A 1YBHA 1EMDA 3EVEA 3L84A 3EGEA 4PX9A 2FN9A 2ZFUA 1A7UA 2P75A 3Q2OA 1N4DA 3VAYA 2KB0A 2QBYB 1D0SA 2OCAA 4CFZA 2BUBA 2H1LA 1ZINA 2OESA 3ZS8A 1B8NA 5LA6F 3ZEAA 1IHDA 4ATNA 3WYEA 1P74A 1RXVA 3CNEA 4ISCA 1DTWA 5EL0A 4LOLA 1QAMA 4Y2RA 1JFVA 4IHJB 3GXOA 4FIZA 2DBYA 4L5IA 4F5YA 4IS2A 3TXXA 4BYGA 3F6SA 1JLRA 3F1KA 4Y6LA 1ZIOA 3H2KA 3HCCA 1ZXBA 1R8YA 3JRXA 3MSCA 4P7KA 3HXKA 2EEZA 4JR1A 1JG6A 1L6RA 2HU8A 1FTNA 4U2KA 1QFXA 4G5OA 4KMMA 1KQGA 5SYAA 4C08A 2GVDC 4S04A 1NONA 5KQMA 1K27A 4Y6QA 4CRWB 2ZVDA 4OVKA 4LI3X 2HY7A 2JHFA 2RARA 2X7JA 2YVAA 4UAGA 4BEJA 1NUUA 1HE5A 1T3ZA 2O3QA 2BGWA 3LVRE 3C4VA 1MUUA 3K9LA 4EMSA 3GC6A 1L7DA 4AJLA 2QMYA 3G68A 1T35A 5BPFA 2FX3A 3FKJA 4QOSA 5CYOA 3IB6A 3JZMA 3WRYC 1PWYE 3QTLA 1E6CA 4CG0A 1NVVQ 4Y2QA 3LS2A 4C4PA 1Z0ZA 5AW4A 1KMHA 1MG0A 1QK5A 4TTAA 1AUQA 3A11A 4RHXA 1FMJA 5IN4A 3AF2A 2OCPA 4TUYB 2NPOA 1E8NA 3ANNA 3WLTA 2FPIA 3B2NA 3UH1A 4KRFA 5JJLA 4Q0MA 2HK8A 1KZ1A 4L8GA 5E1MA 3G0BA 2Z6AA 3RC2A 4YRGA 1LC3A 3U80A 2HMYB 1STOA 2ISCA 1DQZA 3O8QB 4UTZA 5B58T 2OZPA 3HDJA 4N3NA 3CLSC 1GYRA 2JDIA 3QKUA 3AG5A 1MB3A 1ZH4A 1NASA 1SHJA 2Y1WA 3HB9A 4J3JA 4MVYA 4MA0A 5T3YA 1I10A 5EKUA 1DKOA 3DR3A 3RUPA 3DEAA 2OSVA 1MB4A 1UXGA 4GOJA 3P9QA 3OEEA 1JHOA 2R1TA 2BPOA 1YI8A 1GLGA 1FXSA 3B8EA 2H3HA 5FA5A 3LCMA 2CV2A 2HHJA 1W34A 3GNLA 4DLUA 3O93A 2DBRA 1D0IA 1FUKA 2X42A 4L85A 4RVFA 5CFRA 2ZREA 4EGAA 4MI9A 1UPCA 5J59A 1E62A 3RVLA 1P4HA 1Y8QA 2WM9B 5EZ5A 5EP3A 3TNYA 4EHIA 4DXAA 3ZIDA 1ZR2A 2X23A 3OIFA 1IJFA 1M74A 5CEEA 1KAQA 4URZR 3V8RA 3TJRA 3NIGB 2WB2A 1NOIA 1EDEA 3GUYA 4H0NA 3NWPA 3DC7A 2IYYA 3IOBA 1L4GA 1UWKA 1GNSA 1YB4A 1A27A 1G3QA 1H42A 4KPGA 1E5VA 1Z83A 2NSHA 5CLIA 5AJTA 1ISJA 3V55A 3RVMA 4Y1GA 4YQZA 1HFKA 2PGIA 2PX6A 1DMRA 2DWQA 2M6KA 2GHQA 3BRSA 2GA9A 4EKEA 1DDOA 2JGJA 1NYQA 3K53A 4FI3C 5BNWA 1NBOA 2BJWA 2ZJ0A 4QXAA 1IY0A 4JKOA 5KPDA 1XCPA 2QNRA 4MR9A 4QLOA 5TARA 4H6VA 1GCGA 4QIHA 4UNIA 5AVVA 3D6NB 2XQGA 3K32A 4M8NE 5EP1A 5EPEA 1PUJA 5A9SA 5M2QA 3UMMA 2P78A 4MW4A 2EP8A 5FB3A 1S2OA 2CD7A 3HYTA 3HWX1 3VC2A 1AB6A 4R1QA 4FP9A 4OIMA 3OX4A 3U2QA 5ES3A 4H4EA 4OQEA 2CLSA 4PSUA 1Q1EA 1QIEA 3MINB 3RYCA 1Z2OX 3UOWA 2NZYA 2A9KA 4YR9A 3ROPA 1XP5A 5BOVA 3JATA 1CX9B 1GEEA 3EN0A 4Q01A 4RZUA 4MQUA 3L3BA 4WFKA 4BO3A 3Q8KA 3UMJA 1R6BX 3ZVMA 4FCTA 4DCTA 1HKHA 4MV9A 2QUAA 1YBVA 2H00A 2WF8A 3MILA 5GJWC 2PMCA 4B7CA 3EQ6A 5JYCA 3ADCA 1QXSA 2FZEA 1GHTA 1B8UA 4FDVA 2BTQB 2GO7A 4KHZA 1Q1BA 4ZO4A 4F1KA 3FKSD 3TNJA 2H31A 4WXPA 4PS1A 2X4GA 2JLZA 3D8UA 4LZPA 4K9PA 4HNQA 4H60A 2XX3A 3L4KA 1FUIA 3FI0A 1RKUA 2I91A 2EKQA 4KPYA 3R40A 1DIAA 4JJGA 4M0KA 1CUBA 2WVJA 3LL7A 4C7OA 3RNOA 3KQSA 4KXMA 3WLEA 4GBMA 5TPZA 1KEPA 2IGTA 3WK7A 4PYOA 4BRUA 3G8DA 3UV6A 1AGPA 4TMFA 4JUDX 2E4UA 1KK3A 3I9V1 4JH0A 2QR5A 3RJ5A 1C29B 1FL9A 2DFDA 1CLUA 4KIWA 1IQ0A 5I8ZA 2JBAA 2QG6A 3L8HA 4B0OA 2UYCA 1I30A 2QGFA 3GP3A 1YL7A 3L8YA 3VNSA 3MS2A 4PLPA 5KUTA 5LP6B 1G8AA 5CGZA 2QL5A 2C5SA 2QRVA 1BXRB 3R3VA 4KQIA 5J4LA 3C8DA 4TQUS 1T8RA 3EEBA 4JBIA 3I6YA 3QHPA 3GJSA 4HUTA 1YRLA 2AFHB 3LO8A 1WDTA 3IULA 5K3BA 1HYGA 1LGYA 1Z68A 5FLKA 1O1YA 4PQGA 4URUR 2R44A 4A23A 3T4XA 2OE2A 4QQFA 5LOVB 3TQCA 1CQWA 9ABPA 1QTQA 2JL1A 1ZO8A 2D0DA 4V0MA 3UHFA 3QU7A 4ZMRA 1VG0B 4J0GA 1KBQA 1SJ9A 2E18A 2H17A 2LKDA 2R87A 3AI7A 3EGWA 1KKUA 3LFHA 3WFJA 1Y4DE 1NBIA 2I3ZA 4QSHA 4DL9A 1H69A 1XHFA 2XKBA 4P3NA 4OATA 4ASUD 1YQXA 4HGQA 2X2PA 4WN9B 5ILQA 5DGDA 2WFAA 4UVGA 2O7VA 2XKJE 1XD2B 2GD0A 4DNOA 4OI1A 1CE8B 2VBIA 4Q1BA 3SDSA 2ZJFA 1YDGA 4ZIRB 1MO2A 1C1YA 1UBSB 2DUJA 3O2NA 2WF5A 3DOHA 3QJGA 1BHSA 1HRDA 3VX4A 1ESZA 2ZUDA 4WFQA 1NC3A 1MZVA 2H4JA 5TX7A 2BN4A 1JTVA 2IYXA 4JJ6A 3NBUA 4MXDA 1PT8A 2FLWA 2RHTA 2MTBA 1FLDA 2JJ2D 3ENZA 2ZB3A 3AESA 3EMVA 4QELA 1SHUX 4A6XA 5KCZA 2IDZA 2Q7XA 1TCBA 2RK6A 2BBTA 4X90A 4DZRA 1B6TA 2YWEA 3QYJA 5CVDA 2GFHA 4JFAA 4UCFA 5FOUA 3RVOA 3REGA 2CL7X 3TQOA 3OE7D 4GFDA 4QYWA 2QQ5A 1VMEA 1T15A 4N65A 5IJAA 4NEHB 3H9BA 5DB4A 6NULA 5EUMA 1NXOA 1RWOA 5ILOA 1P5FA 4MVJI 3DNPA 4D9FA 2B1GA 2QTTA 3QX8A 4BGUA 5H8WA 3HDGA 5EJ7A 2XB8A 1E3IA 3WWYA 1IWPB 4IXWA 1PW7A 1MVNA 4MMZB 2OQRA 2EBWA 2EJUA 3RC8A 2IXFA 2OAEA 4KUHA 2CVPA 3ZHYA 5I7HA 2XXAB 2Q3MA 3KFLA 1J5PA 2AC4A 4FDTA 1H9BA 2EQ5A 2ZYRA 4BB9A 2KW5A 2GF2A 1LNQA 3BMOB 1RW4A 4X60A 4HGPA 1F4LA 3HGTA 2YOGA 4P7FA 3VZQA 4RKFA 1SELA 4WOKA 5AVTA 5ALWA 3ZE2B 1P1IA 4YPOA 2WKRA 4FJ0A 5HF8A 4NCNA 1YMQA 3EYWA 4R1MA 5F9HA 1SB8A 1VPEA 3EQ8A 2F3QA 4KOAA 4MKIA 1Y1LA 4BLSA 2I2FA 4WKOA 3NTXA 5LJIA 1JLLA 2VNKA 4NCHA 1UT5A 3EXEA 3NTQA 4NBTA 4P0TA 5CT6A 2TMYA 4AZVA 5JWHA 1GTJ1 1NW9B 4EARA 4ZK6A 4C03A 1Q7TA 2ZOSA 4MUJA 1B3BA 3LBAA 4MUHA 3D59A 1ZMXA 2CF6A 3ILSA 1FFEA 3IEIA 1B93A 1NOKA 3NIFB 2BF4A 2B37A 1Z4IA 4GXQA 1XU4A 3PGA1 3AGPA 4K1LA 1PWEA 5HQTA 1B14A 2WZQA 3G0CA 2JH8A 4FYKA 3TZBA 1T3SA 1Q7CA 3E6AA 1UBEA 1LJLA 3G0IA 3L77A 2FOIA 4FD3A 1GSHA 2GNAA 3OTGA 1CNFA 5AI4A 4UXHA 2L17A 4QFDA 1LZLA 1XQYA 3FVWA 4MR7B 5AYVA 4LEIA 1IG3A 1BJTA 1GGMA 2X2EA 2XUJA 2GHTA 3AJRA 3E84A 4FXOA 3VDRA 1Q0LA 2Q27A 4PZZA 3VMFA 2YOHA 5TGZA 2NADA 1YVPA 4V03A 3FSRA 5J2TA 3QF4A 4IIEA 5EEGA 2EBUA 3AFIA 4HDKA 3RBXA 1EUQA 1GYQA 1XXHB 5G0VA 5IF3A 1HORA 3PXXA 4D9EA 2YX1A 5J5AA 4LMPA 3K0FA 3GCDA 4Y6OA 3ZH9B 1NBHA 1TZBA 4OYHA 2G7MC 3HJAA 4DLNA 4CF7A 1FP6A 3RIEA 4MGIR 4NCKA 3MGGA 2XV1A 2TMDA 3F2IA 2GK6A 1ZU5A 4MPPA 5F51A 3RVJA 1V5FA 4B46A 3KTDA 5CFOA 1OVGA 1H0HA 2WJZB 3ZWVA 2R0QC 1Z4NA 1JZSA 3NEPX 4RU1A 1CJMA 1HE2A 1GDTA 4UE6A 3EH2A 1Y89A 1OX4A 1KR5A 4II7A 4XUCA 2I2XB 5IC6A 5KREA 1VE9A 4TMYA 2DRIA 2RGNC 4DDTA 1TM5E 4M88A 3PFIA 2GCNA 1ZSVA 4HAVA 3CM0A 1XZHA 3VR5H 4CF5A 4ZEOA 4DRZA 4WTOA 3TG2A 2IOFK 2XCSB 1UZLA 1VP3A 1K1EA 1UBTS 4TL8A 4B1FA 4M9UA 3A6EA 4D4JA 2GYWA 3GDFA 4DKJA 2WJ4A 1XA0A 3KXKA 4YH1A 2IYUA 3LSYA 1OFVA 2JLXA 2NQ8A 1XVUA 2VUIB 1KDOA 1O4VA 1FYDA 2SKCA 3VZRA 2A30A 2F3RA 4FX5A 3BZWA 4Y9DA 4LDRA 3B60A 1WW3A 3EC2A 2IU4A 2J6IA 2PNFA 5ESXA 4YPVA 4J91A 1GILA 5AHRA 3R2JA 3VR0A 4JWKA 1JQKA 3ASZA 5AM5A 1Z26A 2NG1A 3JWPA 1P7CA 1FLAA 1VMDA 1N9ZA 2I6GA 2PX3A 4DUYB 1M83A 3BB3A 3GMDA 1XQXA 4R8SA 3LKDA 2Z2KA 2R5FA 1NI4A 3B9QA 1H05A 5DI9A 3FWPA 4CN9A 2VPPA 4BIMA 5AI5A 3HB7A 3IDSA 1PQUA 4U00A 2DFLA 3U1VA 3YASA 2DFVA 2JEZA 3PDIB 4BFYA 1ZAKA 3R4VA 2VTBB 5KTRA 4HRXA 4N9WA 1YHZA 3SP1A 4BFZA 2WAAA 4EA9A 4FILA 2G25A 1LK0A 3HJHA 4L16A 3SFZA 4URYR 1JSLA 2WFLB 3MW8A 4DLZA 3DYIA 1WULS 2QXYA 1EHIA 3VR4D 1OYWA 4XLLA 4YDHB 5K3AA 3QUQA 3PHGA 4XSVA 4B35A 5JAPA 3JYLA 4U7WA 1SVMA 3LQKA 4PZUA 4RANA 3D0OA 4YAOA 2ZR7A 1T9ZA 4JX8A 4N3BA 2OORC 3HR8A 3U1TA 1PYOA 2AS0A 3Q0EA 1DEHA 5F2EA 4YHHB 4W1RA 1C30B 3L8DA 3HL4A 2C5BA 5C53B 2CZQA 3O3OB 1L5MA 2C2ZA 3QBVA 3QIVA 4ZMSA 1HYEA 4R1NA 3KLMX 3RT7A 3P0HA 1U2GA 2XMCA 4DQXA 1RQXA 4P0PB 2BOVA 2GM9A 3GUCA 3U4HA 3ICVA 2QJFA 4ZYUA 2ZJYA 2EATA 2GAAA 1PT5A 1PR1A 2B36A 1AQYA 4FTWA 4MWTA 4ZT2A 2VP6A 2I76A 2NVBA 4E1AA 4XJXA 2O20A 5DLEA 4DHWA 2ZB4A 3GUUA 2RHLA 3QMVA 1I4DD 1EGQA 5MGBA 3IRVA 4YRAA 6ADHA 1XVVA 3AIKA 3QTTA 3FPGA 4HX5A 4U39A 3DCIA 4AU1A 4CM7A 3H99A 4ZEVA 2NUTA 2ZBQA 2EKZA 4ESVA 5TMPA 1T3LA 2DECA 4O4IB 4AY3A 1AKNA 4QPPA 1YJQA 5ESRA 1VE5A 2X19A 2FPSA 1ZCJA 2RGWA 1I3OA 3NGXA 4INZA 2ZRBA 5GWXA 2Q21A 1ADJA 1P75A 2X7XA 1U5CA 3INGA 3EPRA 4J0IA 4RZIA 2A88A 3DL2A 2OYRA 5A9RA 3L1IA 1XPUA 1L1QA 1G20A 4XIGS 3FCAA 1KBOA 4DLTA 4HC4A 3LT5A 2VATA 1VCMA 2BMEA 2X0IA 3N0VA 2X2OA 4HNUA 3PHBE 1L4BA 4XXHA 3PGJA 4X44A 1WO8A 3FR8A 2EF1A 1WHTB 1FDUA 3CNNA 4B73A 1ZR4A 3HSYA 1Z5ZA 1P73A 5JCXA 5BN4A 3BX1A 4TTTS 2WICA 3VPFA 4YJ2A 2Q5HA 2AX3A 2CUNA 1AGXA 2DUUA 2E9SA 2J5QA 4RY8A 2JFNA 2XJ4A 2II6A 4Z7OB 4G8DA 2E5FA 1TKCA 1UPUA 5KJ1A 1IXKA 1CUCA 1OWLA 3AR6A 1Z2CA 5TT0A 1HSOA 3B1KA 5HWSA 2FPOA 3ESYA 5KSYA 1J4AA 2I6XA 1BKYA 1DJLA 5AJVB 1HKUA 2IZZA 1NHWA 3LWZA 4JGGA 3M4NA 4DQLA 2QBYA 5EPUA 1JU3A 5H3HA 2UYYA 1MH9A 1YTLA 2HF9A 4R98A 2Y1KA 4CMIB 1KRXA 4EPWA 1LK5A 1WXFA 4LOIA 4XLZA 1ABBA 1QGAA 4Q93A 3A36A 5JATA 4OQFA 2V6FA 3N6RA 4DCUA 1GFWA 3VVCA 4QOFA 3OPXA 1OI7A 4MKHA 3U48A 4PICA 1S5PA 4NPCA 1EP9A 1G3UA 1TKBA 2OHJA 4BNFA 5HP4A 1QHSA 3ODPA 3BGOS 3P9PA 3NDJA 1J2JA 2Z9BA 1R8JA 2R79A 3NX4A 3QU9A 4ETMA 4ZVRA 2J31A 3N8NA 3FF1A 1CC1S 1P0QA 1ZLXA 2EYUA 4NH4A 4RA6B 4MK4A 2G1KA 2O19A 4HVLA 4FCWA 1Z06A 4EY8A 2W22A 1G8JA 1E4OA 3H8JA 1EDBA 4Q05A 4C01A 3FTCA 1PR4A 3RDPA 3ZDEA 2WD8A 1WIWA 4CTNA 2ZRKA 3HUEA 1FXUA 3B89A 2JFHA 3U4IA 3OQBA 2GEDA 3M7IA 1ZOSA 1LDEA 1PHRA 4U6NA 3DHNA 1MX1A 4DWWA 2CDRA 1S6YA 4QTXA 5FPPA 3UJBA 1TJYA 5BUQA 1YQDA 2RONA 2XF2A 4Z3KA 1BMTA 1PR3A 3ZBPA 2LR0A 4P6VF 3E9MA 2YXBA 1ZD8A 3WBJA 1GZ7A 2W70A 2OV3A 3T7SA 5IWCA 4PZAA 1O08A 4MW5A 3GK3A 2BCEA 2WWHA 2ZWMA 1Z4OA 3RS2A 2PLWA 1W96A 5BWMA 4NBNA 3A1DA 4NE9A 1DKQA 1SO8A 3DTVD 3VSBA 1RHQA 3SU8A 2P0YA 4ONEA 2QN2A 5LZ4A 1Z12A 3O8QA 3R6WA 4A8PA 1E3WB 2YWBA 3UMBA 2GCEA 2YRXA 1PW5A 2OAQ1 2Q6IA 4OQXA 1MFPA 3UT5B 1F6WA 2O0KA 3AU9A 2PXCA 3JY6A 7REQB 3B5EA 3KUUA 3S5UA 1QVRA 5FTLA 3ZH2A 1AUVA 1FMCA 2C7OA 2BLLA 3I30X 2EFJA 3TB6A 1CD5A 3VISA 3D54D 2HL6A 2P4UA 2BELA 3ILXA 3LK7A 4XYLA 2AFIB 3MTGA 1G21E 1EWVA 4L51A 1QYRA 1NQUA 5H9WA 1OI4A 1QS0B 4IMPA 1NN0A 4OXKA 2CFSA 3LUCA 5DMXA 4CTJA 1K8QA 2QM3A 4GE0A 4MWEA 1ELOA 1N7HA 1QV9A 1U28C 4D96A 3I9MA 4DE5A 1UFVA 1CUWA 2PH7A 2N0SA 3H5WA 3PL5A 1D1TA 2DSTA 2LIVA 3AUFA 3IDAA 1V26A 2ZR8A 3O7MA 2QVGA 3QY9A 3PR1A 1F6BA 1P72A 2PXXA 5C5DA 3X1WA 1JDVA 1EVJA 2HDOA 2XGMA 3DBVO 4WOBA 4JITA 4ECEA 1DO8A 1UANA 2G88A 4B80A 3E3AA 3I2FA 1Q15A 1FQKA 4OHXA 4BTEA 4UEJA 1TO1E 2ECKA 3NHAA 1BXKA 5F64A 1CVLA 4WXHA 1WQ3A 2HA0A 2OV1A 1B6SA 3IOMA 2FMKA 3WYAA 2QXUA 3OEHD 4CEIB 3EFOB 4RKWA 1LBIA 3RB8A 4CI0B 3V3TA 2QD5A 1HDCA 1SUEA 1Z47A 1AGYA 2DQ4A 3KKNA 4A73A 4OLFA 3NYWA 2ZBDA 1UFOA 1FNSA 2WK1A 3BK1A 2CLHB 4OGFA 1N5MA 3DE1X 1LTQA 2BFOA 4PWZA 2G7ZA 1X8LA 4RENA 2HJ9A 3GP5A 4QPZA 5IM5A 1ECBA 5F9MA 5CM8B 1NVMB 3HYSA 3RVDA 4I8IA 5C3MA 1YT5A 5IDVA 2V7TA 1U94A 3ZD9A 2FRDA 4WV3A 3EJWA 4DIMA 3KXIA 2QZ4A 1N57A 2J07A 3BSWA 1CG6A 2C4MA 4FINA 5LPNA 1ZG3A 4JLSA 3UV7A 3MINA 4PLZA 1P2GA 5JBQA 4LRTB 1KRHA 3D4IA 4NARA 3DAGA 2H18A 2XTAA 5LLDA 1G1AA 3ZHCA 2HQBA 2JVJA 1SVLA 4YI3A 4FZVA 5AK4A 2O48X 3IKLA 4QC2A 5JWOA 5FJJA 4OUDB 3EQ9A 4LMRA 1SG9A 2V1UA 2ONKA 1EFHA 2QVCA 1MHTA 3WLFA 5K4AA 3FH0A 2DH5A 1LSUA 4GOLD 3AR5A 5G4LA 2AGVA 1XPOA 5I9BA 3BGIA 4HDCA 1KZ6A 3LZCA 3G2MA 2P9EA 1T10A 1I7QB 2WHPB 4GMKA 1P0CA 3M2TA 5KNBA 5KTOA 1Y37A 3AK4A 3ROQA 3QW4B 3HO8A 3CLUD 5DFAA 1BEUB 4GRAA 4ZVOA 4BLWA 2E2WA 5LFAA 1J56A 1K66A 2PD6A 5AMXA 5DLYA 2CXUA 5C1IA 3P5BA 2D7CA 2Y67A 1JDJA 1VMKA 2O5RA 4LBWA 3VSCA 3WK8A 3HB4X 3RVRA 3JS5A 1QP7A 5HX7A 2ZYTX 1UXHA 2X22A 3ETHA 4W5QA 2Z3VA 4W1SA 1LSJA 4KXLA 2FFQA 1GUZA 2TRSB 2HLDD 3UXEA 3GA7A 1DT5A 3FOWA 1BXRA 2XYGA 4MNTA 4NMHA 4CM5A 2B1IA 4TRJA 1CZLA 1RYFA 1TA0A 1URPA 2J3IA 3M6FA 4DLXA 3UMSA 4Z1OA 4ZKEA 1N0UA 3DZHA 1C1XA 4XRRA 4N0MA 3ECAA 3ZLUA 1RAHA 1O6FA 1MAWA 4AO8A 2ZS9A 1SUDA 3DWEX 5LOVA 4OB8A 1U4SA 1GY8A 1Z0FA 4M22A 4QJ5A 3GRVA 1U2PA 1QRRA 1TVKB 2P41A 4D80A 2VAVA 3EBOA 1QQ6A 3B5IA 3E9QA 4RAQA 2IF2A 3SF0A 1OILA 3KVOA 3MK31 4R2LA 4AJPA 1Y33E 3QX3A 4TYMA 3IJEB 4OHYA 1DO2A 1K6JA 3PIDA 2WMOB 2PJUA 2Z1NA 3TAHA 1YU9A 3TNFA 1RWWA 4UQPA 3Q9SA 3THXB 2PGDA 3H0EA 4UNRA 1OV6A 3GG9A 1JEJA 1XD2A 3CF4G 4LJAA 4AS1A 5F3RA 3NJRA 4EKDA 5GTDA 2WRZA 3T1TA 4ZIRA 3R3XA 5U4XA 2YQ4A 3DAOA 5CW1A 1U6JA 4ZRDA 3B1WA 4G0NA 1DNPA 2D3TA 3UFBA 4ZICA 3CN7A 2CNWA 1F5SA 1SBQA 1VSVA 1ESNA 2CD9A 4HFMA 5FOXA 3MCTA 4J6EA 5T6BA 4C0LA 3H5OA 3N8KA 4S2EA 4WY2A 4UEOA 3TKYA 4GDFA 1P7PA 3GDOA 5IG2A 4R9NA 1Y42X 2WR8A 3C3JA 4PQEA 5K3DA 2Q2VA 1SBTA 3F3KA 1JP7A 5SZKB 1V5GA 4C76A 1UK6A 1K0FA 1Q84A 2IYAA 4EA6A 1DJOA 4YMTA 1RQPA 3T15A 1GGVA 4L27A 2JGDB 1E59A 2X9NA 1CYEA 1MAUA 5CK5A 2VDPB 3O2SB 2HN9A 2YN4A 1WD5A 3FVVA 4LJ8A 2H9AA 2IA5A 2WSBA 3UIEA 4Z1MD 1XJWA 1FU8A 1SG0A 4R2JA 1Z2PX 3U7QA 5EXPA 3R9IA 3I04M 3R9KA 2A33A 1N4AA 1CCWA 1I1NA 2NV6A 5ECGC 3UK2A 4RMNA 3PG5A 1P62B 1IQRA 3L7CA 4MWDA 3QG1A 1VB5A 1KAGA 4DA0A 3FYUC 4BLUA 4XD7A 1EZ1A 2CXXA 2C5FA 2PLNA 1ES9A 4GKKB 2Z8YA 2VUHB 1IN7A 1DC3A 1NLFA 2YDYA 3IJPA 4HLUC 4IDEA 4L5JA 4LIPD 4LYJA 4OB7A 3T3GA 3BMOA 4F3CA 4W9MC 5KAPA 3CINA 4K6KA 3QUTA 4XJVA 3TZ6A 3GQVA 4Y8VA 2AA3A 1WEHA 3T1NA 5FEUA 3O74A 1GAXA 4B7XA 1J9GA 1K8RA 3MMPA 5MGNA 2HLNA 1ZEMA 4HR7A 1K86A 3AR2A 2Q49A 1LNSA 2C5AA 1REQA 4QBFA 3R6TA 1RCFA 1T5BA 3CPEA 1B8OA 1NULA 4QSMA 3A6ZA 5KWSA 3SHOA 1UOOA 2V4UA 1P39A 2QUIA 3ABOB 3PYXA 5K51A 1R74A 1PGNA 5TF4A 4YQFA 2MMGA 3ZNQA 4EI2A 3NTVA 4E30A 1W5EA 3GN2A 1Y81A 4GPIB 1KOLA 2IW1A 2UVQA 3OKFA 1U4NA 4MRMA 5IZCA 1Y34E 4AUKA 5J4KA 2DUWA 5KZMB 3K0SA 4NQZA 621PA 2XXJA 3SSOA 2EW8A 4M1YA 1T9DA 1ZL2A 3CCFA 3O84A 2YWXA 5G2OA 4YV1A 4U8HA 5KMGB 4QNRA 3S8EA 1THGA 1UUFA 1OWMA 1B0AA 3L40A 3QM1A 2WG1A 3O0DA 1BQ3A 2ONYA 3EPKA 4JP5A 4MR7A 3NASA 2PMBA 4YY3B 3K15A 4JQZA 5DN6A 2XTJA 3PPIA 3OC0A 1G8YA 4ARZB 4ZVPA 4IZHA 1UJ4A 3AY3A 1DIRA 1HEYA 2GPBA 2QN8A 3D4OA 4MTLA 5FUWA 5UKDA 3QYAA 4MDHA 4RD1A 1PT7A 5EUQB 1SU4A 5EQFA 2BGLA 5C46F 2BEWB 5FTMA 2NYRA 3MGAA 2IZOA 3PXAA 4LZOA 5ITZB 1ZJ4A 3H5RA 5IJ0A 1DBSA 1THTA 3N2NA 1TDJA 2GZ3A 1V2GA 3Q7QA 2X8BA 3BBLA 4OGWA 4DV3B 3ASVA 3EVDA 3KJNA 4K1XA 4LX8A 4FMDF 1TVEA 3RTCA 3MT0A 3C14C 2VP0A 2PGNA 1KI7A 4W5HA 4BB5A 1SH7A 1ZC4A 4ZV4A 9GPBA 1S3FA 1T2NA 1QHFA 2JBHA 2IRWA 2OO5C 5SICE 5MFPA 4EPYA 2D1SA 1A71A 4JBNA 4CZ2A 5JCJD 4EUFA 2IH2A 6YASA 3OMWA 1IG0A 4X7PA 4DIOA 2G6BA 5INTA 2WAYA 1M8JA 3HDYA 4PSAA 4JP1A 2PZAA 5CGQB 3B3FA 1UIRA 2IS6A 1OROA 3MTBA 5LU8A 4F56A 3L06A 4U4AA 4ZJPA 2HB6A 2QMQA 2O2YA 3MRTA 2QENA 5A3SA 3HA3A 4CVNA 1GPH1 4RJJA 5MFZA 3A10A 3TECE 1DAKA 2QTVB 4BE9A 2VTKA 2EHDA 1V8ZA 4LJ5A 4NYMQ 1SXJE 4RQUA 5H5JA 4TLAA 3QFRA 4OXQA 3DVLA 4XASA 5FIUA 1JDTA 4ED9A 2I1WA 2Y68A 3GJ3A 1CPYA 2P79A 2PR2A 4RV4A 5D3KA 4DNXA 3U6KA 2EL9A 4BWYA 3AHEA 3WLPA 3L4BC 4D82A 2ODAA 2JLVA 1RM0A 1XDSA 5TPZD 1NLZA 3ZJTA 1NYLA 1YC5A 3G89A 1J39A 1A98A 1M6VB 1OIVA 4M99A 3RK0A 3ZWPA 4U6SA 1X3SA 4HDRA 4F5DA 2RHWA 4Q66C 1DB3A 2O2ZA 2ZCVA 3LUKA 3V4LA 4XX0A 2D7JA 4OAPA 3R0QA 4F38A 4YV0A 5BUCA 2ZR0A 3K9HA 4K86A 4BLVA 5HKBA 5JS8A 2C77A 3MLBA 2N46A 1PFKA 2OCDA 4YT5A 2M2IA 2QRHA 2JCXA 1XTSA 1XLVA 5F2OA 3VGPA 3NDBB 4BZXA 1SC4A 2WD7A 2ZRDA 3UCEA 1W94A 4GOXA 2HAEA 4ZYZA 2GJ9A 4HGZA 3S70A 4CU2A 3MXOA 3N8DA 1ZIXA 4PBRA 5C18A 3MWEB 4H9GA 4PZ9A 1MQ9A 1RQGA 1TEZA 5BNFA 1WBBA 3LLMA 1E66A 3VOTA 4A2PA 2ZUTA 3RS9A 1JV2B 3A8TA 4WZAB 3CX8A 1GFSA 5CXQA 3SXPA 2ZRLA 2G3YA 2ZUFA 2XZPA 1OAKA 2KPOA 1R66A 1ZQ1A 2H1RA 5I7SA 1C30A 2OCXA 4MS1B 5ILGA 2I4OA 2M1ZA 1F8UA 3EIFA 1UH5A 1Y8RB 2LWIA 2D4AA 1JFFA 5HFAA 1TF7A 1XKTA 2Z08A 3AEUB 3DVAB 2FPUA 3G8BA 3OJLA 3ONWA 4JOBA 3U56A 1SBZA 4B5LA 1SC9A 2CXOA 1ECLA 1W29A 3CB2A 4TKZA 2Z2ZA 3QV2A 1I5OA 2O8BA 3T06B 3VHXA 1SXJD 1V9LA 3RYHB 5TE9A 2WG0A 1NP7A 3EWSA 4RWZA 1AB5A 1B26A 3F96A 2YMMA 4PZ0A 4X54A 2HGZA 2QX7A 3D4NA 2JFFA 3H6HA 2I6TA 4YGYA 2C7BA 3I1FA 4FWIB 3C98A 2IPLA 4PYNA 4Y9SA 2AEFA 5CG1A 4IH4A 1EXNA 1Y3FE 3LF1A 2FOLA 1V8FA 1HZZA 4UREA 2X0EA 1QZ3A 4PAMA 3U3XA 1TIBA 2JW5A 2DQYA 1SKBA 3BXXA 3KB6A 1FP4A 4G89A 4BPRA 3G49A 2FSSA 2DLNA 3IE2A 1NP3A 5CVEA 3S1LA 3SZUA 4UHJA 2WFZA 3DEZA 3IFSA 4UHEA 2OECA 3UCFA 4US1R 1L5YA 1XRNA 2M6SA 4ERXA 4D9CA 4LXHA 5F7XA 2HUPA 4I46A 1M2EA 4D45A 3D9QX 3U19A 1XN1A 3ZDYB 2PRIA 1ZRNA 4M98A 4PO3X 3K2BA 4B3TB 4Q3LA 1VJ0A 5EJAA 4DJTA 2Q7OE 3I42A 4J3FA 3VKUA 2B5VA 1AUPA 1NMXA 2XZDA 2J3EA 4X0EA 5FYDA 2H7CA 1ZU4A 2HQSA 2HRBA 4W9NA 5J3JA 2HPVA 3T7EA 4KPUB 3UB2A 4EQZA 4F71A 4D0GA 2UXDB 4MJXA 1CV2A 1CK4A 1WCIB 3ZDXB 1DKPA 3C6YA 1I2MA 4K87A 3ZVLA 4BVAA 4ZU6X 3OPYA 4UCQA 1YJ8A 3OQHA 5EJ4A 3ZU5A 2OVFA 4LDJA 2G04A 3PQCA 2O54A 4BGVA 2NO6A 3HV0A 1KP3A 2FRVA 3P27A 4NU5A 2JEYA 2FFHA 1M67A 1VJRA 5IJWA 1M33A 1WB6A 2FZLA 1AZWA 2FHPA 1OXBB 3GJ4A 4N12A 3FPBA 4QBGB 1H9CA 5JNVA 5EXTA 4EY4A 4A3SA 3B2EA 1RVDA 1EFPA 5E7QA 3SM9A 3D0RA 3MB5A 4FONA 5AXDA 4DARA 1PUIA 1DO0A 1J99A 1OWPA 4C87A 5BPHA 3FBTA 4L4UA 3EH1A 3K09A 1J2TA 3HJFA 1W5BA 1T4MA 1VXRA 2H65A 4Q6BA 1KWGA 3IDOA 1TOAA 5B6JA 1OTHA 5IUKC 4QVIA 4MDEA 3OECA 2WC1A 4TYYA 3BE5A 3VNVA 1Z8HA 3DAYA 4JMPA 3BXOA 2A4MA 2PX0A 4Z7NB 2WMYA 3ESRA 4UJ5A 4JI0B 2PEYA 2QQFA 3MJTA 1PNQA 3MYYA 4RTPA 2RJOA 4XFDA 5JBIA 4CLHA 2IUSA 3DJFA 3ER8A 1BN6A 1N2OA 4MWSA 3U44A 4L76A 1DE0A 5KX5B 1WB4A 4E11A 3FPFA 4OQMA 4HAYA 2BKVA 3OH8A 4AJIA 4BQNA 1LPBB 3DTYA 3H5LA 3N70A 2H2DA 1PBTA 1V3UA 1LF0A 2GZRA 4TLEA 4AO6A 2HTFA 1Z15A 1ISMA 1NFRA 1TUBB 2ZAGA 4WZBE 3TPCA 4F5ZA 4MB2A 4D46A 5AKEA 1NKSA 4EHDA 3R9XB 2A6PA 1BO6A 1DIHA 5DNAA 1N2BA 4GXTA 5IJXA 5GJCA 4EHKA 5E3HA 4WMLA 4CKYA 1N5LA 3DA8A 3H6KA 3VC1A 1XHEA 3Q5EA 2JH3A 4L3OA 3HKBA 5FO1A 2DSNA 1YUMA 2J30A 1SKQA 1EPUA 1U80A 2CVZA 3KT6A 4I55F 2FK8A 4QU9A 3R7SA 4MWZA 3R7FA 3GLGE 4K88A 3GGCA 1E3WA 2CVHA 3TH5A 2ILTA 1JKIA 3K9BA 3WGUA 5T4EA 4DMGA 3UT5A 4UMEA 4LYDA 1XCOA 3WTBA 1E3EA 1S7GA 3BPSA 2ZRHA 1KL7A 2O2DA 1U2EA 2A9VA 3K6JA 2ESRA 5DYWA 2WE7A 4WVLA 4D4KA 1KY2A 4XR4A 2EKPA 1CJBA 3V4OA 2ZSUA 1RHJA 3D6AA 2I78A 3RSLA 5L9AA 1OYOA 2RB4A 4BU0A 5KYWA 1FYVA 3BHMA 4TMVA 2NUBA 4Z2YA 2LCQA 1QS0A 1ULBA 4MIEA 2H57A 4FYJA 1IN6A 4ZI5A 3AVUA 1AA6A 4I14A 4YT8A 4HGNA 3W5VA 3NC4A 3U4MA 2X5JO 2HQ1A 1ID1A 1RNLA 4Z8XA 4UBNA 3UQZA 4PYKA 2ZZMA 1O87A 3IAAA 1HOTA 2R8PA 4AZ0A 4DIBA 2R6AA 5KYYA 4D6YA 4P4GA 4RKQA 2ASEA 4DV4B 4MV3A 1UMDB 3REQB 2BZ0A 4W82A 5MN5A 2RCNA 3OM0A 2OC4A 5IWAB 1YFLA 3TAXA 2DT8A 4ZYVA 4NH0A 2DUNA 2HA6A 2YBDA 5AKGA 4CEIA 2XOKD 3Q9UA 4UFNA 2IK8A 1WXHA 2YJ5A 4EYEA 1J6UA 3OM8A 3ENWA 5K2OA 3H3JA 5CMLA 3QHQA 1VCOA 2Q0SA 3WKAA 4QTYA 1PR0A 3PGKA 5EYPB 3LXXA 5CCBA 2HDWA 5ALHA 2C96A 3ZWXA 1RP1A 1W5FA 3OURA 5LBTA 1E60A 2OQVA 3SQDA 4AXBA 4XPIA 3PNVA 4XARA 5EE0A 5BW8A 2FK7A 1RU3A 1V16B 1BNCA 1CY6A 2FUNB 1OY1A 2O3SA 2VJPA 4BFVA 3OI7A 4YBRA 2ZIEA 4DLBA 1U3CA 1O94A 2RBGA 5B30A 4LSZA 1JG4A 1XDZA 4EJMA 5CDGA 4P0QB 2X4DA 4QKQA 1MC4A 3L0PA 4OHKA 3WLSA 3ZCTA 5KOJB 1UIMA 4ZDWA 2LZ0A 3M5WA 3R5JA 4M9CA 2O3JA 3K94A 4AD8A 1ZM4A 4O2AA 3V6LA 1XTUA 2MOKA 4KVFA 4WIAA 1KC3A 5TQJA 2PWPA 3CTPA 3E4DA 2J9FB 2GM4A 4NI5A 4OFZA 5EHNA 3IQFA 1G1MA 2VDVE 1JIIA 3SHTA 3LE8A 1AK1A 4IG4A 3UC9A 2GK3A 4GC5A 4WCVA 2WHPA 4L3WA 2HNKA 1S2LA 3WGLA 4L5CA 2HSZA 5D3ZA 3E7FA 4Y6PA 1T5DX 1XEWX 5B3LA 2WYIA 4FGUA 5DK6A 1K9SA 2E6KA 3FDXA 4Q9AA 5HA5A 3H11B 3LPNA 3U61B 2NSDA 4Q1CA 3DB1A 2V1XA 4ISBA 4FQ5A 1X0XA 2YN0A 1OU4A 5ALNA 3IURA 3V1YA 4NJMB 1Z0UA 4P7JA 3AF6A 5T41A 2SCUA 3M9XA 1NKVA 1QVVA 3AV0B 1V9CA 3BIJA 4FKZA 3I2KA 3TPFA 2VP5A 3FCCA 3P32A 1PZEA 4BLQA 2V45A 5CLJA 4YRCA 4WKNA 3TAUA 3EVGA 2ASVA 4F12A 2CMHA 2RAPA 3WIUA 5L51A 3A1NA 1EVKA 1MEJA 3IP1A 4HG2A 1PQYA 4LRUA 5HGJA 5GIOE 5I5GA 1XRPA 2V58A 3F6PA 3P45A 5E9QA 4M21A 5EIWA 1W9MA 5KDDA 4PXSA 2OILA 4MGZR 2PD3A 4FU0A 1CJCA 3OPNA 4BBZA 2K87A 3PQ7A 1P4SA 1U2TA 2NUPA 2C92A 2QTBA 2YICA 4LHEA 4MKRA 4OM7A 4QREA 4DCSA 3NXKA 2ZB8A 4MROA 3JZAA 5K0LA 1LLFA 3NOOA 4CKWA 4LGYA 4IIBA 2BFPA 4NDAA 4OQDA 1S89A 2H7YA 2PGXA 1Z38A 2XMSA 4DG8A 4ES6A 5F2NA 3WBBA 2J0EA 3TKAA 4J6FA 3V46A 4F2HA 3ZZMA 2ONCA 3L8MA 5JRDS 4FM9A 1K08A 3KPJA 1TA9A 3DE2X 4TKMA 2AG5A 3I0MA 4GMHA 3CLTD 3ITDA 3RAGA 3MMSA 2GTIA 1PWHA 4M0FA 1P6QA 1ZIYA 4Z4CA 5EERA 1A96A 4URHA 3N3BC 4MQ4A 4GS5A 3FPHA 2PZBA 3T4EA 4UUBA 3FSJX 1GV1A 1T3TA 3V1MA 2WG2A 4ZAZA 1TO6A 4OX9B 2RKWA 4LKOA 1JZQA 1OVMA 2EARA 1F0PA 1BVYF 2VSXA 2GKGA 5F76A 1RLUA 1NYTA 1UKEA 2IEZA 1U3DA 4X7MA 3WDMA 5BV0A 4DLKA 3BE4A 5BMVF 2Z6UA 3DR5A 4J49A 4D9MA 1K7EB 1TYBE 3GJZA 4QXPA 4Q1VA 6GPBA 5D5QA 5CIWA 3JYHA 3QGMA 1PX0A 4HQLA 3RSFA 2REQB 4Q3KA 2F43A 3PEVA 5I7VA 4BY9E 2EJCA 5ITVA 1AZTA 3QBTA 3SQMA 1TMYA 2P90A 2CBXA 4JXJA 3TD9A 3R74A 1XA4A 2I1QA 3E8MA 3W5IA 4EG1A 3GLIA 4KQXA 3ZG6A 1ADYA 4PG7A 3FLAA 4HS9A 2A86A 1G17A 4EJ6A 2VDRB 2DPHA 2HBZA 2GBCA 3PJGA 2VXCA 4I66A 1KEUA 4HZUB 1QOZA 1Q44A 3U39A 3ACBA 1IDOA 1M73E 4M54A 4DB4A 4US0R 4PO1A 2NUAA 3IPLA 4WL0A 1C1HA 3ZE0B 4DR3B 4N7RA 1NPTO 1T43A 3K4HA 1BIFA 1GRNA 4MWGA 5LBUA 1W19A 3LNCA 5HRUA 3K0HA 2H52A 2ZRGA 3V5NA 1X70A 2FMIA 2PUEA 2WU4A 2ZUVA 1W5SA 1AOXA 3NOQA 3WS7A 3OIYA 2PUHA 2GBFA 2QM8A 4GM1A 4QECA 4UNNA 1A5BB 4WY5A 3U3ZA 3MSXA 4L8WB 5KAMA 4X66B 1SK9A 1QQTA 3N53A 2HMVA 2P5TB 1BMQA 3C3MA 3NV9A 2FEOA 3CW2A 4YAGA 2I4TA 3N7AA 4OLHA 1YUNA 1EP3B 2HIGA 3GOQA 2D1YA 3LLCA 4ZCIA 1JZTA 3S8YA 4I4CA 1RTKA 4DCPA 3EZNA 3TOXA 3V8NA 2C7RA 3PLRA 1YB7A 3C3XA 4JVLA 3S27A 1SQSA 1TXGA 1ZA1A 3I6ZA 3T7CA 2Z4SA 4HBGA 2W6JA 4ESHA 2XAAA 4JJIA 1VL1A 3V97A 1KVRA 3QLVC 1B41A 1KYZA 4Z7QB 5JPDA 3U5ZB 1GL6A 3S44A 4GC9A 4EW3A 1I6LA 4ARZA 1GG9A 3UAZA 1DAFA 2YJGA 2IZ5A 4HGOA 5CB4F 2AMJA 1DDGA 3GVXA 3LT4A 5A3RA 4KJXA 4ZO8A 4Z51A 2ZAYA 5DNUA 5KSOA 1LBSA 1CUGA 2AN3A 3F78A 3MOIA 4EX6A 1Y1TA 1NE7A 1Y48E 4S1TA 3ZU6A 2BGJA 4O33A 4DCVA 4KBGA 1SBHA 2C9MA 3MWYW 2X40A 1DTEA 3K8QA 1UDWA 2ACEA 4Z4QA 4DAOA 3HYRA 4HFJA 1F7UA 5ERGB 3DOFA 3TTXA 1DADA 2VYVA 4FMPA 1L7NA 3B1XA 4Q00A 3BD7A 3CZ5A 4PG8A 5KB3A 1KS2A 1E1RA 4QGHA 4JCOA 4KIFA 5LYJF 3CO5A 4YJDA 5KOHB 1CBUA 1Z6AA 2XGOA 2R85A 3D4LA 1D2NA 3KQWA 3OJCA 3TMYA 5K05A 1O2DA 1KZYC 2V6JA 2CCKA 1FSZA 1R9JA 1XU7A 3TSWA 2VDMB 1K6IA 4PS0A 1DG3A 2VA9A 3PE6A 3KE8A 3TFQA 5CVTA 3UB4A 2PY6A 4AMVA 2ZM6B 2I6UA 1K6EA 2HF8A 4LJYA 1ZNZA 2B94A 2IY9A 3AUYA 3GDWA 4PHTA 2G8NA 3ORHA 1ML4A 4YCMA 1M34B 3A26A 2BSQA 2D8AA 2ERYA 1VGVA 2QQGA 2Z8ZA 4NYJR 1FDIA 1VKOA 3M8KA 2EW1A 1FSGA 3IV6A 3IPYA 4NAUA 4J1QA 2IC5A 3KX2A 3BB4A 4QU0A 4F6CA 2IOHA 2Q1UA 3SQOA 2L69A 2PRKA 3EZ2A 1BN7A 3ONEA 4V39A 1QTIA 2AMFA 1YA8A 2QN7A 1QYWA 3AL2A 3I76A 4G8JA 1YRWA 1KC1A 1NRJB 3Q3VA 1H6AA 3I6QA 1ZCFA 2VBGA 5CHYA 4DM4A 3P9KA 1GPMA 1EIZA 2BV3A 2X1LA 4KR7A 5LXTB 3WZLA 1JHDA 1ZMRA 3SYNA 3ZD8A 2WJHA 4RNDB 2O2HA 2Y0EA 3D7SA 4WKBA 3S55A 3IKVA 3TSZA 4Q3OA 3WSWA 4XJSA 2VWPA 2WIDA 1FW6A 1EP1B 3UJ8A 2WP8J 3VU8A 1FF9A 5ICGA 1O57A 3BCRA 3AIMA 2SBTA 2C4NA 1S1MA 3CVJA 3V8PA 1FS5A 3A06A 3UMVA 1QRUA 3ESDA 4YJHB 2PA3A 4PSCA 4FEYA 1QQAA 3HPRA 2FN3A 2PZEA 1C4XA 1L1RA 2QPLA 2WF6A 3QVJA 5EWMB 3MWEA 2I66A 3RKSA 4D3YA 2Z57A 4WBNF 1PNOA 5B58C 2XRZA 3H84A 2NV0A 1O54A 1HBJA 3HY4A 5A4FS 3EHEA 4X61A 4N9QA 3H87A 1GL3A 5TMBA 9LDTA 2MYPA 1WUTA 4LK2A 4KR3A 3PNKA 4J0DA 3RRZA 3WG9A 3W2HA 4PLGA 2B7CA 2AMVA 1ZNQO 2PJRA 2F8MA 4H7KA 1ZHOA 3KQPA 3WRXC 4BYMA 5BW5A 1E7RA 4H2DA 1K63A 1OIXA 2BFWA 2GTHA 3L0DA 4Y1EA 1C8LA 2WHQA 2X0RA 5EZSA 3AEUA 3DVAA 1SVOA 4W8OA 3ZVKA 2B92A 2R6ZA 1ZP6A 4IXTA 4LRXA 1B16A 4HAXA 2IU0A 1E2MA 1E5QA 4NV3A 3ILYA 4DWOA 1DQPA 3EXFA 2GYYA 4ILKA 4O2LA 4QZVA 1Y7PA 3NMUF 3WMEA 1H8HA 5I5EA 4Q4LA 3QJYA 2NLOA 1Z82A 4GGOA 4WBXC 5FPSA 2XNJA 3KOWA 4IFBA 2HHHB 5KVVA 2WM8A 3DW3X 5AVYA 4F93B 4C43A 4HYEA 1J2YA 4MRPA 1GV0A 1YUBA 4AQDA 2NYAA 2O6HA 3FNBA 1V1RA 5E4JA 1IBMB 4DTCA 2R1VA 3B1JA 5C31A 1TJNA 4DPLA 1X19A 3RIXA 3C16C 4FQ8A 1WP4A 1XZAA 4M87A 1DIOB 4RVOA 4KFTA 3NAMA 5AJYA 2P5UA 3HCAA 4B6PA 3QEMB 1F4VA 4FYVA 3TIIA 4Q47A 3LU1A 5LP6F 3ZX5A 2I0FA 1XVTA 1HMYA 5G0SA 2YNMC 4PIMA 3TQFA 5BXQC 3PVZA 3AOEC 1XROA 3C3KA 4REQA 3G82C 3ROGA 4ZYWA 1JSXA 1SB9A 1XTJA 2Y66A 4HY3A 1ZGHA 4YT2A 1JBEA 2IHYA 2GXUA 1KI8A 5D51S 4IIUA 3W3AA 3TS1A 3SD7A 1ZJ6A 3F7NA 4EI8A 2RHGB 3ELDA 4XD7D 1PYDA 3NDIA 3TBHA 2D74A 2WZDA 3U16A 1WCIA 1K5PA 2PMDA 2YQ5A 1P4AA 3V6MA 4R7ZA 2H48A 1KMQA 3TB4A 2ZCUA 2YMQA 2PKQO 4B3BA 4J7XA 1LPMA 1OD6A 4EAAA 1DTSA 2QTFA 4GRDA 1E8MA 1ZVJA 4QXRA 1J33A 1RKQA 1K2WA 2QROA 2VJOA 3CHYA 1GCAA 1P7YA 2JCSA 3DWFA 3GEPA 4G4GA 4MRNA 3R7AA 2Q2NA 3CRQA 3D6UA 3LP6A 1IN8A 4IINA 5AJWA 4B44A 1YBAA 3BH0A 4TSKA 3K1AA 3OO1A 3TD2A 5U9CA 1EP2B 4CF4A 1GG2A 1E7WA 1RC1A 1MT3A 2I8CA 2YIMA 4NATA 3SOZA 4MKZA 4F8EA 2AZXA 4CEJA 3THYB 1ULAA 2PU5A 2AQKA 2VJBA 1AKWA 5JMOA 4X00A 3EPLA 2GPNA 3GUHA 4E14A 3GIWA 3F5SA 2ETXA 3BWYA 3KQYA 1SBIA 3OTHA 5EA2A 3VMMA 4LZAA 3MTJA 1BX1A 3AUKA 4BWVA 4CKBA 1UJBA 2BZGA 4R2HA 1PZMA 1P1KA 1MDFA 2P3LA 2W90A 3CEAA 1NWHA 3IIJA 5AK6A 5TVKA 4EYGA 3U40A 5ICFA 3SVTA 3WAJA 3TZEA 3Q6IA 5CNIA 1Z7BA 3ZV7A 4OJMX 3TZLA 3ZDBA 4HVTA 1RRFA 1QOQB 2HSEA 4JLVA 4TWAA 2VL7A 3DULA 4ZVSA 1AN9A 3UKDA 3DKPA 3PRKE 4PX2A 3I64A 3ZBUA 3IKTA 2C1ZA 3LMKA 1JJFA 2W2VA 3NHKA 5BRJA 2YINC 1AO0A 5IBQA 3JW8A 2VDNB 4JC5A 3PJEA 4B43A 1TUBA 1IHXA 3PCTA 1LSSA 3UGTA 4BDSA 1ZJYA 2PJZA 4FE7A 3C87A 3T3MB 2OXIA 1VRVA 2JJMA 3R9XA 1QR2A 3ZWDA 1JKXA 2V59A 5KU7A 3GLFB 2I4LA 3ZDAA 2ZUWA 1ZK1A 1R6DA 2JFVA 1NYRA 4UHFA 1UOQA 4AN4A 4F9FA 2EFHB 2PQ6A 2G36A 4ZYYA 4HNGA 2PX4A 3A2KA 4RDIA 3V32A 3DBLB 4K6HA 3R8XA 1RRGA 3IOCA 1CTQA 2G1UA 3B6MA 3RG2A 2Y92A 1SQ0A 2OFXA 3WE7A 5LN1A 2F1OA 3N2KA 2FTKE 2R97A 1PU2A 2HSWA 3AHHA 3CLUC 2DQSA 3ITEA 4IXDA 4NESA 2CWDA 4OHCA 2QYTA 4PYQA 1X7WA 3UK1A 1KI9A 4L1KA 2ES4A 5HTOA 2G0NA 1TPYA 1GKYA 1OCEA 2FZWA 1XNGA 4PINA 2GCGA 3D7LA 4X1IB 2WBLC 2AI3A 4IJWA 3ZJUA 4E3WA 1ULTA 2J41A 1U0NA 2DTEA 3JQFC 3P9ZA 4HQ0A 4GYWA 4ZT6A 3WDKA 3HKCB 3LQ2A 4DREA 1G6Q1 1T1IA 5I7RA 3G3EA 4K05A 1Q1ZA 3CLHA 3DWIA 1NN1A 4JOCA 3WK6A 4DUPA 3C3WA 1ONSA 4IBOA 3ABIA 1SEPA 4WNAB 1PAUA 4EYOA 3WFZA 1DBIA 3AVYA 3RHTA 4MYRA 1O6CA 2J4FA 5AKXA 2OD7A 3L07A 2C4VA 3KP1A 3PUWA 4V3CA 3WSTA 5GMOA 5BQOA 5FAKA 1J1UA 3S1AB 1X7XB 1TPZA 5DE3A 3VH2A 5EP4A 5FQNA 3NBXX 2JFYA 3VTKA 3RGWS 5HR5A 3LXMA 3PNQA 4YACA 4H3VA 4LFCB 4YRIA 2C31A 2R2AA 1MX5A 4LJ7A 4YP1A 1OB5A 4X85A 3MJHA 3DCJA 1T25A 4KIUA 5B2FA 1LV8A 4Q4HA 5C8YA 4B0PA 3JZFA 1EINA 2A67A 1A9SA 4K9KA 4QLAA 5CURA 2HUNA 1U5AA 3OX1A 2V55B 1KK2A 1KH2A 3RFXA 3P0EA 1T6ZA 3P2YA 3WADA 121PA 4PM4A 1WX1A 4BFXA 1NW5A 2LDBA 1XMOB 3NC1C 5HOQA 1EX7A 4MLZA 4KLNA 4J2HA 1V16A 1UJCA 1P0MA 2CFTA 1LFDB 4AMZA 3D7MA 4LECA 4AJKA 3AEQB 4A10A 1CUYA 3RLFA 1WSAA 1DI0A 3Q3IA 2FB9A 2O2SA 4UMVA 4AICA 4REMA 4HS4A 5KOJA 3QOWA 1OPXA 3EG9B 3LPDA 2IKQA 4K6FA 5EVCA 1LS6A 3OFNA 3GPIA 4WWHA 5BQFA 4HQ6A 1XMJA 2XUKA 1E9DA 1O9BA 2VRWA 3NBMA 3VO2A 1GARA 1XD9A 4JHLA 3B6EA 1WB5A 3RBAA 1KEEB 5CB6A 1VJ5A 4CR6A</