3KYIB

Crystal structure of the phosphorylated p1 domain of chea3 in complex with chey6 from r. sphaeroides
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
104
Chain Sequence
SPYNVMIVDDAAMMRLYIASFIKTLPDFKVVAQAANGQEALDKLAAQPNVDLILLNIEMEFLRHAKLKTRAKICMLASELGADGVVAKPSGGELARTMRTLMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative histidine protein kinase
publication title Using structural information to change the phosphotransfer specificity of a two-component chemotaxis signalling complex
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 26
structure length 104
sequence length 134
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kyiB00
4MR7A 4MR9B 4P1ZA 3OLVA 4Z0NA 3QLVC 5FWYB 2FEPA 4YV7A 3LKBA 2JVKA 2QW1A 4RDCA 2FVYA 3H5TA 2GWRA 5PNTA 2JBAA 4KQ9A 1JYFA 2LBPA 4GPAA 4Z4FA 3HZHA 2WMYA 3KYJB 4IILA 1QQAA 2VUIB 1ZGZA 1D1QA 1URPA 1L5YA 3HUTA 4Z99A 2PKXA 3M9XA 1YK1A 1F4VA 4W5TA 1QP0A 1USIA 4KPYA 1DJMA 3A0RB 3M9WA 5BQ3A 3MYYA 1FSPA 1KGSA 5IEJA 1NXSA 2LUOA 5TQJA 3N8IA 2IPNA 4FE4A 4MS3B 4G0PA 3CZ5A 5BRJA 4RK6A 1EFAA 2FMKA 2CD7A 2ID7A 4OATA 4G0XA 2RJNA 3F6PA 5TPWB 5KI6A 1JL3A 3MA0A 5JNSA 5DGCA 3LOPA 4PYRA 1YVUA 2NT4A 3BREA 1A04A 4G0QA 4KZKA 3CHYA 3CRNA 1EWVA 4PE5B 4G86A 5TPZA 2QU7A 1YTUA 4MQFA 2RDMA 3A0UA 2AYZA 1NY5A 1U04A 1DRKA 3HV2A 3IP9A 4WXMA 1HEYA 4FB4A 4EYGA 1ABFA 3EJWA 4HNQA 3R0JA 4MR8B 8ABPA 4ZJPA 1ZHHA 3RVNA 3RH0A 3FGZA 4NQRA 2HSGA 5JNVA 2JBAB 3OLZA 4LE2A 1XHFA 3H5OA 2F8TA 1DCMA 3EQ2A 1RNLA 2R47A 1NXVA 1JFVA 3MIZA 2N9UA 2WB4A 3N0RA 4G0MA 1U8TA 3OQNA 4EY3A 4G97A 3OQOA 5C5EA 4RY8A 2MYUA 1SXIA 3CKMA 3QLUC 1QO0A 2QV0A 3G1WA 4RK7A 3QEMA 3HM9A 4W5RA 4IMJB 1QPZA 3H5IA 5GQSA 1P6QA 1TM2A 1S8NA 5KC8A 3SNKA 2I6FA 3IP7A 1K66A 2M98A 1Z13A 1DCKA 1RPJA 2VK2A 3GRCA 1XHEA 5KQMA 1KRXA 1D2AA 4Q6WA 5HQJA 3RVPA 3UK0A 2L2QA 4RSMA 4G0ZA 2FMHA 1QMPA 3ROTA 1NATA 4N47A 3N53A 3Q41A 3KSMA 3LUAA 5FWXB 2WRZA 5T7BA 4MR9A 3RVRA 1QKKA 3DLBA 1NXWA 4IF4A 1YMUA 2RJOA 5FWYA 4HNRA 4JOQA 3ROFA 4L85A 3M6MD 5KC9A 3A3KA 1PUXA 1UDRA 2PUBA 3TD9A 2PJUA 4TLMB 3CZCA 4F12A 4OLAA 3KYIB 1J56A 4RXTA 2W42A 1SXHA 4LRQA 4YGXB 3EAFA 4F8JA 2YHAA 2PLNA 2A9RA 3O1HB 1K68A 2QR3A 4MS3A 4H3KB 3TX6A 4MLDA 4LDAA 1AB6A 2NUBA 4RXMA 3EQZA 3O2JA 5IUJC 2A9OA 4Q6BA 1ZN2A 3C3KA 3EGCA 2IOYA 3O2QB 1JH9A 3E3MA 5TPWA 1E6LA 3IPAA 1ISSA 3LTEA 5BR1A 4MAAA 2FKAA 3LUDA 3HS3A 3BRSA 4Z4CA 4FE7A 1M5UA 4KFCA 4Z9BA 5CHYA 1L5ZA 3O75A 3NHMA 4HNSA 4O1IA 5JNWA 1OXKB 4EVRA 3ILYA 5IBQA 3H6HA 2JK1A 4QICA 2GX6A 3GYBA 4RK1A 1QQBA 3HO1A 1U2PA 3QLTA 1Z26A 1AB5A 5CNMA 2P4UA 3RVOA 4KRFA 3BRQA 4DN6A 3K9CA 3RVJA 1WETA 2FEWB 3F6CA 4MR8A 3OQMA 1E2BA 1E6MA 2QZJA 1F51E 1RXEA 4ZPJA 1VRVA 4D6YA 1GCAA 2FLKA 1JF8A 1LBHA 3EODA 4XARA 2O20A 3IPCA 3HXMA 1P2FA 3HDVA 5HSGA 3LFTA 4KVFA 4PEVA 3C3MA 3OM1A 2X7XA 5ED4A 1ZGGA 1DCFA 3N75A 4OBBA 3BILA 4DADA 1DP4A 2LP4Y 1QP7A 2B1JA 3LUJA 3TB6A 3D02A 1DBPA 5KQGA 2WY2D 1ZAYA 4EVSA 3HVRA 5HM6A 4M88A 2PE5A 1BA2A 4JA2A 1NTRA 3T95A 4RY9A 3KLOA 3DLHA 4EYOA 2PL9A 1Z2EA 3OO0A 4O5AA 5JNRA 2Q5CA 4WT7A 3LUFA 5FWXA 2L19A 4RXUA 3DGFC 1YIOA 2LPMA 3HJFA 2OQRA 2CHEA 3CS3A 3L6UA 3LUGA 1PNRA 4XASA 2MSWA 1MB0A 3IP6A 2WJAA 4NCAA 3HUUA 3H1FA 4LE0A 3DZDA 1JYEA 4Z4EA 1I3CA 1Z12A 2NT3A 4UHJA 4B09A 4EVQA 2PUAA 4W5OA 2PUFA 3KHTA 1P8AA 4OTZA 3OO1A 5BRAA 2FQWA 1KMIY 3HSYA 2JVJA 1GUDA 2IYNA 3MQ4A 2PUEA 2FN9A 2XDYA 4MRMB 1DBQA 1ZESA 2JVIA 3C6QA 5E3JA 2FTKE 1CYEA 4KV7A 1Z17A 4S05A 4MQEB 5EWMB 1ZH4A 4YRZA 3CG4A 1RXIA 2FLWA 3F73A 1KRWA 3SAJA 2ID9A 2MSLA 3JVDA 1C0EA 3O1IC 3UUGA 1W25A 3IDOA 5T3YA 5HKOA 1RZRD 3DGEC 1IIBA 1DC7A 4MS1B 2QVGA 5FBKA 3VNAA 3GV0A 3JS5A 3CG0A 3W9SA 4JP1A 4MLCA 2QVCA 2BGGA 2FMIA 5IULC 3I5AA 4DQDA 4OLBA 3KG2A 2MYNA 3QEKA 4KQCA 4ZMRA 4OG2A 2FSPA 4N0PA 5EWLB 4W5QA 1SXGA 4EYQA 4YR7A 5B3JA 1TMYA 2IDMA 2M1ZA 4MYRA 2AYXA 4QYWA 4RY0A 4ETIA 1CEYA 3NBMA 4RS3A 3RVKA 4F3TA 1FFSA 4RWEA 4HYEA 3TO5A 1BAPA 4ML3A 3CU5A 4EGSA 4NCBA 3QK7A 4WUTA 9ABPA 1BDHA 2QSJA 2OENG 1LJLA 4JAVC 4JB2A 4G0OA 4YO7A 4LZLA 4W5NA 3FFTA 2E4WA 5CNJA 4TN5A 5TQ2B 2MYPA 5KQPA 3SQNA 3OLYA 4XXHA 3H5VA 2RGYA 3TMYA 4MPTA 1B00A 3O21A 3OMWA 3BBLA 2F8SA 4RK5A 1JFSA 3FFWA 4IGAA 1LBIA 1CHNA 2PAFA 1LK0A 1YS7A 3RVQA 3H6GA 1A0OA 3T8YA 1XWWA 3SG0A 1Z16A 3H1EA 3T6KA 3OLXA 2DRIA 5CNKA 5D2CA 4E7PA 3KLNA 4KREA 3K4HA 2R4QA 3N0WA 1MIHA 2B4AA 3GWGA 3E61A 4TMYA 4S04A 2QXYA 5JS2A 3A10A 2IPMA 1MB3A 1JHZA 4PICA 5KWSA 5JS1A 3LUCA 5TQ0B 1NXTA 3L49A 2J48A 4D74A 2ZAYA 3HK2A 4RU1A 2E4ZA 3D8UA 4RKRA 1APBA 1JFTA 4ZMSA 4KK3A 5DLEA 4MRMA 1YMVA 1YK0A 4Z4HA 1USGA 2MYTA 3S99A 3NNSA 4CBVA 1USKA 2R48A 3CTPA 7ABPA 4XAQA 1RZRA 2IPLA 4MQEA 2H0AA 5EWMA 4XFKA 1Z2DA 3N0XA 3H5LA 4NV3A 3VNBA 6ABPA 2PMCA 4NICA 2KYRA 2GBPA 4P98A 2HPHA 1PEAA 5CNIA 3OLWA 1E6KA 3I45A 3JPWA 2HQOA 3LKVA 4MS1A 3CLKA 1ISRA 4N41A 3FDFA 4XLTA 2JB9A 3JVIA 5GOTA 3KKEA 2E4YA 2HQBA 5FBHA 2V0NA 4H60A 5EWJA 2NZUG 2WWVD 1D1PA 1TLFA 3MM4A 4RK4A 3OMXA 1ZDMA 3QELB 5EWLA 1GLGA 2A9QA 5DTEA 5IX8A 2IPAB 4ZYLA 1EAYA 1GUBA 4RK0A 2PL1A 1JDPA 1EHCA 3H75A 3T38A 4Z4GA 3F7NA 3FFXA 2JCGA 1P6UA 3O74A 4JB0A 3UKJA 1ZH2A 5KQLA 1M2FA 3QLVA 3Q7TA 2GKGA 1NXOA 3HCWA 2R25B 1MVOA 3JTEA 1FFGA 4YP9A 5IEBA 3RVMA 3O1JC 1U0SY 4GNRA 4LDZA 3NNDA 4YCSA 4LE1A 3P9YA 4EYKA 2PUCA 1JLKA 1QP4A 4D6XA 1ZVVA 5TQ2A 2L17A 3RVSA 2LIVA 3FMVA 5B3JC 4G0YA 5F64A 1R8JA 4MS4B 3H1GA 4MR7B 4L4UA 3MF4A 1PEYA 1DBWA 1NXXA 4QYMA 4KK4A 1TJYA 1DRJA 3GBPA 1OXBB 5IUNC 3GT7A 4YS6A 1PNTA 1H9CA 3URMA 3DBIA 1JWLA 1T34A 5C5CA 1JBEA 4Z4IA 1ABEA 1DG9A 5EWJB 4N03A 3I09A 3KTOA 2MSKA 2VUHB 4QPJC 2PUGA 1NXPA 2HJ9A 2P9HA 2WJWA 3MMNA 4N0QA 1ZY2A 3GA5A 3Q7SA 5TQ0A 5I4CA 4RKQA 3O2SB 4Z9AA 1BDJA 1FFWA 1DC8A 3GL9A 1JX6A 3LUKA 4WWHA 5JNUA 2H3HA 3Q9SA 1VLZA 4ETMA 1YS6A 3CNBA 4KMRA 3KJXA 3KS9A 1EWTA 4YWHA 2FQXA 4RV5A 5ABPA 4EUKA 6CHYA 3JPYA 2IKSA 3LUHA 2E4UA 1M2EA 1BVHA 3SY8A 2FMFA 1C4WA 3OM0A 4ETNA 2HQRA 4F06A 2FEKA 1Z18A 2FQYA 2YHBA 4UHKA 1SRRA 1TVMA 3H5WA 3JY6A 3LMKA 3Q7RA 3HEBA 3QX9A 4MQFB 4WXEA 3C97A 1GCGA 2JRLA 3RVLA 1Z25A 2TMYA 1FQWA 1U2QA 3IP5A 4IRXA 4LX8A 1QNLA 5TPZD 2VYCA 3I42A 3NNNA 3QLUA 4N76A 1PHRA 4F11A 2E4XA 3SM9A 1Y1LA 4WZZA 3EULA 4TLLB 3KCNA 2PUDA 2CWDA 3NHZA 3QELA 5DCLA 3ILHA 1A2OA 3G85A 5DKFA 4O1HA 2FN8A 1DZ3A 2L18A 1BDIA 4MGEA 5IUKC 4E7OA 3HDGA 2E4VA 1VPWA 2CHFA 4RZSA 2ZWMA 3QX8A 3QEMB 1ZITA 1SD5A 3B2NA 2A9PA 1D5WA 1MAVA 1LJUA 5TE9A 4YLEA 3Q15C 4JASB 3RQIA 5JNTA 2FW0A 4H3HB 4PZ0A 1QO0D 2GI4A 3N6VA 3CFYA 1JDNA 1VKRA 4Y9TA 1W9HA 4IMIB 2FXIA 1D4ZA 3EDCA 3GBVA 4KNYA 1Z15A 2NZVG 1M5TA 1EWKA 5IC5A 4MS4A 3C3WA 4Q7EA
chains in the Genus database with same CATH superfamily
1OE0A 3P97A 1SHJA 1V9LA 4IDFA 3DMYA 2A0FA 2CF5A 1E2FA 1R3DA 4P1ZA 1MIOB 1Y4AE 4G85A 1FQKA 2G1UA 4EAAA 3KYCB 4QX6A 4QBGB 5FDFA 2LNDA 3JD2A 1Y7TA 2YMQA 3OFKA 3Q8LA 1GQYA 3AESB 4WA8A 1L7PA 4O0MA 3ZHXA 1OVMA 1SU7A 3TM4A 1ADFA 2C9MA 3ANMA 2EFJA 4RVDA 1PFQA 1EUQA 1KYWA 5CYOA 1WM1A 5ANRB 4W5TA 2GK3A 1ONPA 4GYYA 4PNPA 2P3SA 5G0UA 1Q0TA 1DJMA 3WKDA 1E1NA 1QHYA 4RADA 5A5GA 1W35A 3C74A 4OHPA 1V95A 3D7LA 4F5DA 1KGSA 3JSXA 4J7CA 3FWKA 1LTKA 3VC3A 3AY0A 2Z08A 1ADJA 2HDOA 3CZ5A 1ZXBA 2M6RA 1J9GA 2ISQA 2XSZD 1OFUA 4G0PA 4JLJA 4PLZA 4QFMA 3U80A 5JS8A 5HX7A 1EFPA 4GI1A 1R9MA 2BUBA 3NHUA 4Q9JA 2WVHA 1WD5A 1J2EA 4X71A 3WV4A 5CLGA 2NLOA 4I9UA 1SD1A 4RGVA 3GPLA 4TYQA 1AQNA 1YONA 1DMSA 4WOJA 1CUBA 1NMSA 1IQPA 3QV1A 1VFPA 1J00A 3V5NA 2AIRA 2I4RA 1WF6A 2DP4E 3CRMA 2GO1A 4RZUA 5JC1A 4G1MB 4FYMA 5F1OA 3WL5A 2PH1A 3WWPA 5LDHA 3V80A 1NY5A 4LTDA 3HSSA 3JQ9A 5C8YB 5MDHA 3UTCA 2H7VA 2ZTHA 1EVEA 4W63A 1DBIA 2BHLA 5E0OA 2D5IA 3BXPA 3GEDA 1QVVA 3LYLA 2H63A 4YJ2F 4B2IA 3PKZA 3RODA 3ZTYA 1XAGA 2YFHA 4AS2A 3FTFA 3UICA 2EXXA 2WVGA 2PSSA 3OIYA 4Q19A 4CM7A 3SYLA 1D2GA 2ZSFA 1IHPA 3TR5A 4GNKA 4X1YA 1TCCA 4AS3A 2A59A 2HU7A 1LX7A 5DLPA 2A1TS 4Q1EA 3TQCA 5E3HA 5B7NA 3JQFC 2EJBA 2ILTA 2P30A 2B7BA 4ER7A 4I36A 2REOA 3DHEA 1Z4IA 3HGMA 3WBJA 4GRIA 4HDMA 1LRLA 2QTAA 2DTEA 4UD6A 1IBSA 2WFAA 4B0PA 3D3WA 2GK7A 3QLUC 1AT1A 4DGQA 4JR1A 4U0KA 1ETUA 1Q95A 4ZYZA 1NY6A 2DVMA 3MUFA 5JARA 1T1JA 5K6AA 1Q92A 3TZHA 1QO9A 1FRQA 2B9VA 4HZUA 4IEIA 3GRCA 2G71A 5HFAA 3WK5A 3RT1A 1Y9EA 6PFKA 3U09A 5CDTA 3FGPA 3ZE9A 3EBOA 2RGWA 3WFZA 4Z9XA 2G77B 1Z36A 3K5WA 3PQCA 3TNYA 3CWCA 1QKKA 4YCLA 4LW8A 1OH5A 3W6NA 3RYCB 2ASEA 3TK1A 3GD7A 2XAAA 4N39A 3N59A 2POCA 1W44A 2C2KA 2Y1EA 3L1UA 1MNAA 4RHXA 4GGMX 3P0JA 4FGZA 5C8XA 2HLDA 4IJVA 1UZUA 4ZI7F 1PFWA 1T5IA 3A4TA 3MTIA 5EUQB 4XLZA 1Z75A 1I1OA 2NU7B 4EZIA 5EMHA 4OX9Y 3SU8A 3G89A 1E3SA 3I52A 3PC8A 4DCCA 5CXQA 1GKLA 4B7XA 4O4IB 2O7RA 2WE8A 3BFXA 2Q9UA 1ODSA 3GRFA 2A9RA 2H4ZA 3R7NA 4UBMA 2FHPA 4KAAA 2XBMA 1NL3A 2NO5A 4FHGA 4D0GA 5FO1A 4ZJZA 2OCBA 1QONA 1BQ3A 3ND7A 2QVZX 3DMRA 2ZRAA 1GTRA 3IVXA 5CFOA 1CUYA 1KAGA 3E3MA 4IVRA 2CMGA 2EP5A 4PTYA 3THWA 4EKYA 4XQEA 5JNWA 4J6FA 1ZA2A 3OY7A 4Q03A 1YU9A 4BTLA 5I8ZA 4HMPA 2HD4A 1C7JA 4WK6A 3TD6A 3WIVA 2XZPA 2J3KA 4V1CB 1Z26A 1AB5A 4O4HF 3RSGA 2C5BA 2BGKA 1Z5VA 3QFFA 3MBOA 1XK7A 3KQLA 1OGIA 2ETXA 3U4MA 1O1YA 1IUPA 4GXQA 3RSSA 3UMCA 2OCYC 1WB6A 4KEAA 3SD7A 4C6TA 3A1VA 5A1JA 2H16A 1T8UA 2WAXA 2CT8A 1Q2XA 2QS9A 1D8TA 3SEFA 2ZUBA 5J1SB 4C20A 2GASA 3E3AA 4HQ0A 4MPJA 1GNLA 3TB4A 4DJEC 7AT1A 2JIRA 3EAQA 1K7FB 4C0XA 3CPJB 3VNUA 1JALA 4QRDA 3GP5A 1DXYA 1P2FA 1J5PA 3DQPA 3Q7QA 1N5DA 4H18A 1BEEA 4RORA 1NDUA 4B4DA 2E5LB 1EA7A 2V3VA 3JQ9C 3UO8B 9LDBA 4B87A 1V35A 4TM7A 4BGVA 3U3DA 1R0LA 2C2BA 3PT9A 5C51B 1Y3BE 2JEZA 3E9YA 1ZAYA 3EGOA 4UTVA 1BOFA 3AF0A 3L4EA 1LVHA 3ZGOA 5SYNA 4AJOA 2Y92A 5TY0A 4ZMBA 1F5SA 1NTRA 4M36A 4F3CA 1WA5A 2ZRGA 1HTBA 1GYQA 1X38A 2D0OB 5ADVA 2HO4A 4DYDA 3ECAA 4B46A 1FMTA 1UP6A 3CO0S 1E7MA 4KWHA 1U5CA 3SX4A 1ZXXA 2AX4A 3UB2A 3AX6A 5T4EA 1JE1A 3DDWA 2EVWX 1CRLA 2Q3MA 3MGBA 3H3JA 4BVAA 1OB5A 1O94D 2PMWB 4DPLA 3FPHA 1VE1A 2QVYX 2O8CA 2VPYA 2WJAA 4O0LA 2FZLA 2W2PA 3H1FA 4FYKA 2W58A 4QPNA 5E6SA 5K6AC 4LOHA 5ALTA 3EEQA 3WGMA 3V7YA 1AHIA 5DX8A 1IJBA 3DR5A 5FPPA 2Q6IA 1J8VA 5E7JA 5JOQA 4GLJA 2RCNA 2GJ8A 2XNDA 3GK3A 2QRVA 3N5KA 2AXNA 3BIXA 3C3YA 4LK3A 3UENA 1EX6A 3MAJA 1CF2O 3EXHB 3NX4A 4AQ7A 1ENYA 3DYBA 2D2XA 4YCCA 4URYR 5IKXA 3GVXA 2Z5GA 2QG9A 2O19A 3OHPA 1Z28A 3UT0A 2PUEA 1ISGA 2B92A 2FPWA 2GO7A 5CBPA 4PYOA 1LF5A 1OXSC 2A88A 2XDAA 4LOLA 5F52A 2C61A 2Y77A 3HY6A 2C5FA 4GO1A 2F3TA 4KV9A 4M76B 4XCQA 1MDBA 2YICA 3S2GA 3VJLA 1DQPA 1NBHA 5JRDS 5KO2A 4EZBA 2SBTA 3FJYA 3OU2A 1PD1A 4GOXA 4KE6A 4GSLA 5BN3A 4UM9B 4GEKA 3PC8C 4YMLA 3OHSX 4BN4A 5C4MA 1H2WA 1J0CA 1HDXA 1FSSA 3LRPA 2F48A 3AEUB 4BE7B 4M9UA 3MWLA 3LY7A 3HJRA 5DTIA 1CJKC 4UM9D 3OZWA 2P35A 4H1HA 2G4CA 421PA 4TYWA 1YCDA 2PXCA 3IMFA 4N0QA 1H4VB 1D6MA 4A92A 4B2PA 1NTOA 2PWZA 3H9UA 2DR2A 3RS3A 4XJTA 2RK4A 2ZI9A 1XZQA 2XODA 4D3XA 3OAAD 1DELA 1D7OA 1EP3B 4RD4A 3OJCA 3Q3JB 4MYRA 5IH3A 3WL7A 4XIIA 1RQ2A 3TZQA 4M54A 3MGKA 5DLQC 3AVYA 1R00A 1PYDA 4L1KA 4RS3A 3N6XA 1Q7CA 5DE3A 2V6GA 1EDOA 5E0KB 4LMAA 1EFVB 4TUYF 4RQBA 2VP0A 1VHTA 4KUEA 4G0OA 4RLSA 5A4MS 4W5NA 1NMXA 2NQ2C 2ZBRA 5JQGA 4NBRA 3GGGA 1SK8A 4GX2A 3ZIUA 1H93A 1S0UA 1P5FA 2QX8A 4L7QA 3ZDYB 2C59A 2I1VB 4OJQA 5K8LA 1W0KA 3EOBI 4DR1B 3OJXA 3ZBTA 5BVGA 4PXAA 3D8TA 5LYJB 5HDBB 3FDJA 3HDJA 4M1WA 1CR0A 1E4OA 4OQFA 3C3PA 4KWTA 5AKLA 2O4UX 2PUWA 3ZCSA 1KYQA 3WAGA 3R7AA 3IB6A 5E7QA 5LD2B 4IMPA 5IJ0B 1Q1GA 3T1TA 3CX3A 3G0BA 1JHAA 4JVLA 4CR7A 1SRQA 3U3MA 1YMQA 1GSOA 4YNBA 2BZGA 4FHDA 3T6KA 3U62A 2IZ0A 3OLXA 2BJHA 2J9XB 4AD8A 2OXRA 4UEKA 5SY9A 3DOJA 4J0CA 3VTAA 3MMPA 4NENB 2A67A 3GOHA 1BHSA 3BXGA 2B4AA 4HR7A 4NCKA 3E8XA 4U7JA 2AN4A 1IXKA 1D6SA 2Z30A 3JD1A 3V34A 1EBFA 3OM8A 5IHPA 4IJWA 1MG5A 1XSEA 3WDKA 4B3FX 5TQ0B 1RZVA 5BUZA 2IELA 2CBZA 4A9AA 4P5EA 1GT6A 1Q84A 4N65A 1QH0A 4HUJA 3HK2A 4LNUB 2I3GA 1TYDE 3D3QA 2BFDA 1RPTA 3WDLA 1HE5A 1USGA 3TQIA 3S99A 3VX4A 4DLKA 3IHWA 3CTPA 4R2IA 4QWMA 5JMTA 5EVCA 1IUOA 3LXXA 4XFKA 6ABPA 3AETB 4QDUA 4IIJA 1U1CA 3QHPA 2GFIA 1L7BA 1TM3E 2GBPA 4TS4A 4PVDA 1T10A 4YFVA 3A9CA 1U1EA 1L3IA 1T1EA 3P9SA 4JH0A 3EEBA 4CM8B 3M4YA 4PLHA 4M1SA 1P75A 2FSFA 3EGDA 4V0OA 3SQMA 1SBIA 3QFSA 2H07A 4AUNA 3BF8A 3EVDA 2XGJA 4JC8A 2O1EA 1KZ6A 4MDHA 1K7XB 2QTHA 3V9AA 4NAUA 3GJ7A 4ZA2A 2QD2A 4RLFA 4IMRA 5LUBA 1TLFA 2VRCD 1SKQA 3LG2A 2SNIE 1Y3HA 1LTQA 1U02A 4L28A 5KYUA 3ZGYA 3L4JA 1P81A 5EWLA 1AMUA 1M2GA 1W6UA 1ODIA 4AJ4A 1VC2A 1GEEA 1NE2A 2EG9A 1GUBA 3PNYA 3ZW9A 2R8EA 1KI8A 1MFPA 2WSMA 1I7NA 2ZIAA 5CDFA 3H9GA 3KQVA 4PQGA 2QLMA 4OIFA 2Z57A 3AKYA 3R0IA 4QA9A 4NK4A 4K9MA 4PHFA 5EJAA 2I2XB 4LYDA 2BTQA 4OXKA 3RK0A 3ZD9A 1JVSA 2CJYA 3ROZA 4ASUD 1Z08A 2JAPA 3UA3A 5KIAA 5FJIA 2X4IA 3DWFA 4D4LA 3X1JA 1HT1E 4HXFB 3N7TA 4O4JF 4X3CA 1T5HX 2R8RA 2WU8A 4BJ1A 1Q0SA 4EHKA 4EYKA 5BYAA 3BDVA 3FROA 2GN8A 2QROA 4YFYA 3T4XA 5ES4B 5EERA 3KHKA 3NHJA 4GP7A 3PU6A 4DM7A 4J4BA 3QKSA 4J9VA 4QRIA 4S1OA 3WL3A 4P32A 2IH5A 5G4KB 5LQKA 4FHFA 5IUNC 5HG0A 1B0AA 4UNQA 2IH4A 3E1KA 5DM0A 1EXVA 2O2HA 5AVZA 2DHCA 3QW2A 4IO1A 5IVIA 1QIFA 4CR6A 1TO1E 1X94A 1WMDA 1JHMA 1Z29A 1PNOA 2VDMB 3KTOA 2KE5A 5HEKA 1UBEA 3BQ9A 1R4NB 1IUNA 3EDYA 4X1KA 1C7EA 4CN8A 2AC4A 5C4IA 3O3MB 4HB2A 1R4ZA 5KTNA 1X70A 2O8EA 4FN5A 1RHJA 1QG4A 3OE4A 3UMJA 4GXRA 3PYMA 3ZBUA 2C7RA 1XVLA 2BMDA 3P0RA 5KOYA 3WGQA 1RXCA 4B6RA 1QC5A 1VI2A 2AQHA 4YCMA 5BNIA 4JUCA 2G63A 2BMEA 1P4SA 2CHQA 2P9EA 3KLMX 4U6NA 5E1OA 4RNDB 2WILA 3W2IA 1RMQA 3V4RA 2E4UA 4OMUA 4RCYA 3AUAA 4X44A 1GTMA 3KSBC 3K5HA 4OXXA 2HQRA 2Q5EA 1DBVO 4TXNA 1JEQB 1Z22A 4PTLA 1G6KA 1BDMA 1OC2A 2YHBA 3K9BA 3K0AB 1NR1A 4LXTA 4MQFB 4NDZA 1FUIA 4I3GA 5GVRA 1SJ9A 1RLIA 4ILEA 1OYWA 2GBGA 3C97A 3T1QA 4AG3A 2ZBVA 1ICIA 4KHPB 4GYJA 3Q3HA 3AXSA 1SVLA 3G6KA 1J7JA 2IOFK 5J9FA 2E4XA 2IOQA 3W7AA 5IF9A 5KMGA 1DOZA 4OM8A 2G06A 2L69A 4MYHA 4J0QA 4J29A 1YR7A 2PR7A 5FFMA 1BG6A 3PFWO 4RGBA 5F5XA 4N01A 3PCRB 4HFRA 1RJFA 4FP9A 1M0SA 5DDIP 4R8RA 1Y4SA 4CHGA 1LPMA 1RM4A 4EEZA 2HIHA 4P7JA 2HJVA 2OYRA 4HGRA 3SOZA 2CEKA 1DKRA 1DZ3A 3ZGLA 5AVSA 5AHWA 2HRCA 1Y1SA 3R0QA 2PLAA 1JDSA 1QGAA 1JBKA 1Y5IA 2P2NA 3QX8A 1ZITA 1RE0A 4FR0A 4TTRA 3UQYS 1D5WA 1MAVA 2G9UA 5IRCD 4I1IA 4X7MA 4WINA 3BH7A 1NLYA 1PZXA 4R9VA 4EY6A 2GPAA 4NFYA 1AS2A 1Z73A 1DJQA 1U7DA 4I4TB 1UXOA 4P0TA 4EO4A 3T3HA 2O14A 4OHWA 1T4CB 2ZQYA 1B26A 4HGYA 2PPLA 2XWSA 4XUCA 3ASZA 3BN3A 3HV0A 3UK1A 2BZSA 3OCVA 3KPJA 2OSVA 1N8TA 4F46A 3MSCA 4NABA 1DZIA 4UOEA 1QYRA 1ORRA 3LPLA 3H65A 2AEJA 3OT5A 4JDUA 1XFDA 4YBZA 1G9XA 5IHXA 4FWTA 3KUUA 4BZZA 3I61A 3MHPA 2IYUA 2DZDA 4GICA 1KMNA 3NXKA 2GDJA 4B9EA 4FQ7A 3KYJB 4IILA 2E2WA 2JAWA 1CB0A 3HUTA 2AQKA 1PFGA 2ZTVA 3HJTA 4E1AA 3ESQA 4UVEA 1S9DA 1FLDA 2GZRA 2WUDA 4PV7A 1KTVA 2VBCA 3CUKA 1G5HA 3RUFA 4BLPA 3Q8XB 1P4RA 1ORTA 2ZSIA 3RS5A 2XRMA 1EE2A 4R1QA 3H9JA 1IN5A 3O38A 4B3GA 4GZ5A 1YKSA 4CMKA 2XPCA 4EJFA 1IULA 2GCOA 4P58A 2R66A 2HRQA 3W5HA 3MA0A 4K88A 2ZG6A 4B8ZA 1B8VA 5MN4A 2C97A 4FBGA 1ODFA 4MRVA 5HKLA 3RRMA 2D1YA 3NM4A 2CLKB 2J5KA 2ZSAA 1E1DA 3C2QA 3F1LA 1W88A 1WIWA 1XZAA 2NZWA 4PGGA 1EWVA 3GGOA 5HBRA 3ZY4A 3WYGA 4MV4A 3DE5X 3HKCB 1LKZA 5KSWB 4Q3OA 1NJFA 1EM8A 2HM7A 4CKYA 4G84A 2I33A 5ILOA 1I2ZA 1ZM7A 2ZTMA 4PQYA 1UBCA 4YCAA 3CEJA 3KQNA 2PZFA 3SQXA 4YAJA 3K16A 3RVNA 4ZCTA 4K9DA 2I4MA 4N49A 4ENUA 3FGZA 4QQKA 4XKJA 4CDNA 1MG0A 2HSGA 5D5PA 3ZCTA 1MO4A 2WSBA 4QTTB 4A4DA 3NC1C 3N0TA 1PLKA 1SFRA 1SELA 1XHFA 2Q4EA 3IKJA 5D3ZA 3GEGA 1ZISA 1ZMOA 1VIMA 1A9YA 2B1RA 2YCBA 3AJAA 1E1LA 3KD2A 1VMAA 2R47A 4JL6A 3LZ6A 5EXXA 4IIUA 5CT5A 1YRQA 4ND8B 1D3AA 1M2OB 3WWEA 3OFND 4BQNA 2GQ0A 3DAFA 1J5XA 4G97A 2DB3A 2V5VA 3O8OA 4JXXA 1ZINA 1SXIA 2Q3FA 3FE2A 3KSZO 4UDNA 3KT3A 3U7GA 4OYRA 3A4IA 1KVUA 3M3DA 3T54A 1MEJA 2Q4OA 5CDFE 2CKMA 4FCVA 1U5BA 3IAFA 2WZBA 3MWEB 3OF2A 4OU5A 1I3NA 4PBRA 3WSVA 3ZU4A 1IK6A 2J6HA 1C8BA 3W06A 3EPJA 1TM4E 5EIBD 3ZJUA 2VK2A 1KRXA 4DS3A 4JC4A 3MJTA 2R2AA 4EX7A 3A1SA 3OX3A 3OF5A 1K6JA 3N53A 3WZ2A 1ZUD1 3IOYA 2NO4A 3L8ZA 5T7BA 1A9RA 2CXTA 4NCIA 5FX2A 4TS1A 1X7WA 4AXBA 1KO4A 4TKVA 4LS3A 4JJKA 4OL0A 1SUDA 4JJ6A 3EMVA 1WMBA 4ES6A 4OHKA 1TF5A 2BBWA 4R0NA 3VAAA 4YRSA 3G0HA 4MRNA 4DJDC 1FTWA 4HEHA 2JH9A 2P67A 2GNOA 4N8EA 2L42A 3TLGB 4D0LB 3HBJA 4D9GA 3AVXA 3EXG1 1VE3A 2HX1A 2G6BA 1KHTA 1KPGA 2VHXA 3ZY5A 4OCZA 5SYAA 4ENTA 3Q4GA 2XH8A 2HCJB 4QUHA 1R5OA 2IQ5A 5BUQA 3PNBA 1TJNA 4L7VA 3UANA 1E5QA 2D54A 3VPXA 4EPRA 4RTNA 1IBLB 2AXPA 1GTL1 5DMHA 1E0DA 1UPBA 2EG5A 5ILQA 3FM9A 1CVIA 1EVLA 1JU4A 2F3PA 2GRJA 3DC2A 3AKEA 1OD6A 3EGCA 3GLVA 1RBQA 4QDZA 1RQPA 4MAAA 2FZEA 4B3TB 3T3IA 3UG7A 4YAWA 4CLDA 1KI7A 1JQ5A 1PLJA 3PGMA 1KGDA 4Z4CA 4GOMD 5DP1A 2PBFA 3HPRA 1GZVA 4EVRA 4IY1A 5AI9A 5EJ9A 2GAIA 5A0TA 4L0MA 2QPTA 4QICA 5HFJA 1VDMA 1U2GA 2FSSA 3MPOA 3NHKA 4G6ZA 4BJ3A 2B34A 3ZWBA 1V3UA 4OGFA 2FEWB 4GR9A 5DF1A 4YC7A 1Y8ZA 1G21A 2DPHA 3C39A 3O3NB 4FDUA 3A9VA 4KQJA 4MEAA 2CHUA 4E5KA 2P3LA 2FLKA 1JXMA 2Q5HA 4Z6KA 1ZI8A 1PZGA 2IIQA 3EPKA 4O8ZA 3DBVO 3FETA 4UREA 3S55A 3AR7A 1EBUA 2VBFA 4J6EA 3MRVA 3NRBA 4KQHA 5J2TB 2O0MA 1NVXQ 2NO7A 4PQEA 3IHTA 3BRWD 1FDRA 1UBMS 1D1TA 1DP4A 3M4ZA 5DYGA 5ELMA 4N5HX 4UBJA 3KKQA 4PYQA 3HMKA 3O94A 3R4VA 3LPNA 4AZWA 3JQAB 4HAOA 4R9SA 3ZU6A 2IHKA 5I51A 3D6UA 5M04A 2VYVD 5DOZA 3NR2A 1YOVB 1A9SA 1N0IA 2AFIB 3A4NA 3CLRD 3IAAA 3QV2A 1QB7A 4FI3F 4IJUA 3GLIA 1GUZA 3JQAD 3RBAA 4HF7A 2UXDB 3TXXA 1OOEA 2B82A 4HNAB 2GA9A 2JATA 2FPPA 3E3LA 3LUFA 5FT9A 4RZQA 1MJGM 3GFFA 3QKRA 4ZZ0A 4ZVTA 3LNCA 2I87A 2XUGA 4FKZA 2E5WA 4S1TA 2AE1A 1XE3A 3NBYC 3BQNB 4J0GA 4YDQA 2GRAA 3UH0A 2EWVA 4PZ9A 4EMUA 5C53B 3R6DA 3MAGA 2V0GA 1SCUA 2Y1FA 3VTKA 4CG3A 4CLXA 2EIXA 4AYXA 1FPMA 3PQEA 1UMDA 1BOOA 3KDSE 1S2MA 2FMUA 2QAIA 3C5CA 4HQKA 4HEJA 4EA6A 1VGRA 1E59A 3ZJ4A 1KK3A 4HVLA 5HF6A 4AKHA 4W8HA 4IIFA 5HYVA 2UZ1B 3N28A 4MGZR 3L6RA 4WKOA 1W36B 2HYIC 2CNNA 5ALWA 5EZ6B 2NU6B 2R97A 4Z7QB 2JG3A 2IZOA 1FNCA 4QUBA 4KV7A 2A3NA 1UBRS 1Y48E 3T7CA 1OZAA 2IBTA 4HMOA 5E7IA 1DOHA 1L6RA 1W36D 3TQOA 3USES 1W85A 5AM2A 1N34B 1HZJA 2FPKA 4GFDA 1D9ZA 2KW5A 4CTKA 1C0EA 4MARA 1DT3A 2H7XA 3KB1A 1NR5A 5BWBA 3EUWA 3UWKA 1SU8A 5AW1A 3BE4A 4COKA 3F3SA 2O7NA 1E60A 3E2MA 2DQZA 1IQUA 4ZHSA 2Z2ZA 1ZGBA 5BN4B 1MA3A 1YDWA 1G20B 4MLCA 2D74A 4C7KA 2QUBA 2FMIA 2ZB4A 1XJQA 3ZIAA 2FOXA 1IZ9A 1CCWA 1NRIA 2CFIA 3EIHA 3LNTA 4MVJH 4R69A 1RWBA 4ESOA 5TC4A 5B36A 4MCIA 4RF3A 1IN8A 1WHTA 2WTAA 2A1TR 3BEDA 3BGIA 1NYQA 3GEBA 4MA5A 4W1PA 5HA5A 1RWWA 1U8UA 1J2UA 2VTEA 3HFRA 2QPAA 3ADPA 3DTVA 3ILVA 5WRFA 4NCNA 3GJQA 2AJLI 3I23A 4ZV4A 3O4GA 2AYXA 3N2GB 1VPEA 1ZJJA 2QR5A 3EH1A 4KI0A 2UVQA 2Q28A 1ZAKA 1VJGA 3EHDA 3DZFA 3GGSA 4RWEA 3U7QA 4EG8A 2JFNA 1F8FA 1P77A 2ZREA 3GQBA 3QG1A 3DOFA 3QVGA 4BCDA 1E2HA 2OV6A 4FK8A 1MABB 1RAFA 4I66A 2ZZNA 4KSYA 1R15A 2PZ8A 1XNQB 1YQQA 4LFCB 5HGJA 4E5VA 4EY5A 1NLUA 1BZYA 2QD3A 1N4DA 3CB2A 3FFWA 3JD0A 4FMDB 4GIBA 4OFXA 4U7HA 1LK7A 2OPHA 4G37A 3FHCB 3PD1A 5DK6A 4D8UA 4DZRA 4EPXA 4R71A 1T35A 5DN6A 5KSYA 3H97A 3U60B 1KS9A 5SYMA 1BFUA 2QMQA 3HP4A 4E08A 1KVQA 1ESNA 2D7CA 1YL7A 4KWEA 1U8FO 1G66A 1WMSA 3B7GA 3CF2A 1B1CA 2UUAB 4B4UA 1N2GA 5CNKA 4AICA 5J4YA 5BUSA 1Z68A 4OPMA 4V2UA 2O8FA 4OHRA 4CG1A 1BN7A 1IM5A 1MIHA 1T25A 2AXEA 4WZBB 1PGPA 3P9ZA 2QN9A 4DA7A 3CZMA 4B7UA 5T57A 1YC5A 1MB3A 4GD3Q 3WGUA 3R23A 3CC8A 5EUMA 1MD9A 1LSJA 5HR5A 2GA8A 1KKLA 3FTDA 3ONVA 1CUVA 3CE6A 2O3TA 4IOLA 3LT1A 3D8UA 3OOSA 4TMTA 1WPRA 1APBA 3ERCA 5DLEA 1XJCA 1XRRA 1P9NA 4HXEB 4G1UC 3LLUA 1IVSA 1YDMA 3HB1A 3EGIA 1TKRA 4UUMA 4CFSA 4J4HA 3ZQ6A 4DIMA 3FNBA 3KJEA 4GKBA 3RVBA 3L6CA 5IKOA 2UVPB 1KETA 2X7HA 4XCXA 4XYBA 3S5JA 4GM4A 4NK5A 4DIFA 3GUZA 4B71A 1N5JA 1KS2A 4YY3B 5CA0F 3UWSA 1GGHA 2N75A 1L5GB 3ROEA 5CITA 3W8RA 1NONA 5AHXA 2IS2A 2WMDA 1NI3A 3ENZA 4QGBA 3AJRA 2QE7D 5JE8A 2H52A 3I3SR 3JVIA 1UDCA 1P5RA 1QYCA 2BD0A 1IYZA 4IAOA 4JP8A 2HMTA 4WOCA 3S68A 5D6OA 3BB1A 5FUXA 4BMPB 3IQXA 5I9BA 5EWJA 3SJZA 3H17A 3WGHA 2PFSA 2DETA 3FBWA 1FRFS 4URXR 2GM3A 1BC5A 4V1CI 3TZCA 5T41A 1F06A 2XOKA 4RK4A 1LC3A 5JZVA 3N2LA 2IHVA 5J5CA 2A9QA 4XSGA 3NU1A 9GPBA 3FW1A 1DJPA 5HIKA 4TWAA 3WTCA 3B1FA 1G8HA 5DK4A 2I4IA 4KGXA 5DVZA 3AR3A 4RZIA 2Q8NA 4YRCA 1IY0A 3ND8A 2PZLA 3F7NA 4RBNA 3DEIA 3T38A 3VKVA 4TVSA 3SVTA 3AINA 3WMFA 3MD9A 4O2AF 2JLXA 4BRZA 1Y9JA 3MT0A 3E9DA 4ZRNA 4BKUA 2YHIA 5KJCA 1HTTA 4TLCA 4WD3A 2QN2A 1JG3A 1YR3A 4EKGA 4M22A 2VJKA 1REQA 3ID6C 3OTWA 4E3WA 5G1PA 2YKGA 5LB4A 1G2OA 2DG2A 2HLNA 2W6OA 2XDQA 3DV0A 1TW2A 1Q83A 3R9KA 4A91A 2BEUA 2OPBA 5FUVA 4TTQA 2P75A 1TKBA 3IQHX 3MYRA 4IUBS 3WB9A 1ORWA 3PSHA 2WJJA 3ZDFA 2P40A 1N78A 4LXHA 5CVDA 4MR7B 1X1QA 1YQDA 3TE6A 2K2QB 4QXMA 4EJ0A 3IJEB 2NYVA 3GLIE 1T6BY 1GA6A 1XTQA 3DBIA 5FOSA 5JWHA 2VHQA 1L5LA 5CB6A 1JBEA 1JWLA 1MRZA 4PPGA 2E49A 1WZNA 3OPMA 1OYYA 5JANA 2QIPA 1FYXA 1WLSA 3AJ8A 4YACA 3SN6A 1CE8B 1Z6PA 2MSKA 2BEVA 1W5BA 2ZRKA 2ZWPA 5KS2A 5K8IA 2KPOA 3VGPA 3AMVA 4DT1A 4LF9B 1TE2A 4IS2A 1AQUA 2QMUA 2GPYA 1TUIA 4TKZA 1BS1A 5B57C 1DC8A 2RGXA 4XIJA 4E5UA 1KDRA 1WB4A 2BOVA 3V8QA 1RP7A 2HMSA 3P0FA 1Z5UA 2OAQ1 1EB8A 4YO8A 5BP7A 4DV1B 3E18A 5JQWA 3LSYA 3WI7A 5ABPA 1M2NA 2CV1A 3SXUA 3CKYA 1QHFA 4NJEA 5EE1A 1KA9H 1KOJA 3I01M 1C29B 3FVVA 3BXZA 3GAAA 2J6IA 4TMFA 3D4BA 4F97A 1RJEA 2H9IA 4LF5B 3GRPA 2FQYA 5AXBA 4NYMR 1X0XA 3V4PB 1CC1S 1U80A 1A72A 2VP3A 2PXXA 5I9TA 5SZHB 4BKRA 4E21A 1AMOA 4L0CA 2AJDA 1N4AA 1GZ6A 4XYMA 1J24A 3GRRA 1LX6A 1NKSA 3IP5A 2DBZA 4WOKA 1KR2A 5LMNB 3FYHA 2VYCA 2B35A 1M2HA 1YJQA 1UJ6A 1ZD4A 1LSSA 3V42A 2JGNA 3GC6A 4AN0A 1QV7A 3ICCA 1QMGA 3CVXA 4C0QC 2Y1DA 2O48X 1H5NA 2ZBEA 3P9XA 3RASA 4MUXA 2R6HA 2NXJA 4LAFA 3ED1A 3T1NA 2RBEA 2F3QA 7YASA 1XPOA 4DDTA 4YRGA 1RYNA 2CVQA 1JDVA 3HJNA 4ZTZB 1A27A 4F3NA 1EX9A 4NQZA 3L0CA 5AM0A 2ZRQA 3H86A 1P0FA 3C6YA 1NUSA 1C9DB 1ULUA 2X8JA 3KALA 3WFIA 1R4AA 2ZIFA 3YASA 5K09A 3IHLA 4HJRA 4BHTA 4I81A 2J0UB 1KPIA 3CURA 4TV8A 4I3HA 8OHMA 1SXPA 4KW7A 3PWTA 2ZSUA 4GPIB 3DEAA 1E1MA 1QO0D 4KR2A 1JDNA 1VKRA 1Z82A 4HLQB 2PD3A 2QD1A 4KUHA 3ABZA 3EDCA 4UBNA 1MQ8B 3WHPA 1X1EA 4QXAA 3SHOA 1P60A 3LGAA 1RM0A 2NM0A 3LRXA 4YRLA 4KNYA 1ONSA 1ZKMA 3Q2IA 2AWOA 3R5XA 2BGWA 4QJ4A 2JI9A 1UJBA 3B78A 3AW9A 3CN9A 2EBFX 4HV4A 3IPLA 1Q16A 3ZK7A 2QW1A 3QA3E 4XYEA 1IHXA 2DCUA 4MDEA 2GTHA 4MCJA 2YY6A 1RYBA 1ZNYA 1WNFA 1V8FA 1QQAA 1ZGZA 3EY9A 1THZA 4HDCA 4PCAA 1N2JA 1JDZA 1QP0A 1NJ6A 5BN1A 4Y1RB 5BT8A 1GGFA 3CCCA 4PGMA 1T13A 3NV9A 1OZHA 3VHQA 5BQ3A 2LCQA 3N6RA 2DKFA 1S8FA 3V8BA 4YHHB 4WOBA 1H23A 2Y76A 4ZYYA 5LOVF 4BNGA 3LOUA 4RVHA 4AJ9A 4J07A 4R1PA 1MO3A 3DTNA 3FHOA 1F7UA 1ZW6A 3V1UA 1I7SB 3TFOA 2C5SA 621PA 3TECE 1JG7A 4HY3A 3PLAE 4MGYR 1UOPA 5FLXA 1FDTA 4L5AA 5F7XA 5THQA 1JV2B 1Q17A 2D2FA 3B89A 5L4NA 1YI1A 3FAKA 3L6BA 4DG5A 3M49A 2BGJA 4JITA 2DKNA 4G0QA 4GLFA 1EB9A 1D03A 3U3ZA 1OR8A 2QAGA 2ZVQX 3ZWAA 1BH6A 2V7PA 4MHTA 2R6JA 2FAXA 4LJ7A 4UNRA 3OWXA 2OK8A 4JK3A 3KPWA 4OO3A 1VMIA 4LKOA 1PQUA 4IYRA 4BX2A 1I14A 3B1KA 2II6A 3OOWA 1YUBA 1ABFA 3PL5A 3R0JA 1F1BA 3D8SA 1ZJ4A 2W93A 4QGSA 1SA0A 4IL5A 4KBGA 2IU0A 3VJRA 2NUAA 1M2KA 4PNHA 1COWA 3EISA 4BNYA 4KYIB 4LY9A 1J2JA 1ODJA 4NQRA 1USVA 2Q0SA 5G1NA 4RVOA 1NQAO 3LXUX 2GF0A 2P4HX 3DL2A 2FWRA 5CT6A 1CULC 1XD2A 4GEGA 4M1EA 3GARA 2ZSJA 4MUKA 1UDXA 2WB4A 3RNLA 1QTQA 2XKKA 1JXOA 3P9NA 3K0HA 4FNAA 4YBRA 4TWBA 1XRNA 2QGNA 1GQSA 5AVRA 2C83A 1GN8A 1J2TA 1PGNA 1V8ZA 3FCAA 2VO1A 4BZWA 3RVDA 4RK7A 2P4SA 1T1RA 4BJHB 5IJAA 1JEAA 2AV6A 4AJLA 1DTSA 1QU3A 2FSIA 4Z49A 3HRKA 4DY6A 3LS2A 2YRWA 5CD1A 1EQ2A 1YU6A 2XUJA 4Y6LA 3OQVA 4QOFA 4BE9A 1BQEA 2RHLA 3GLKA 3VYUB 1RJ9B 2AR7A 1NFQA 2DPGA 3N2KA 4CFYA 1P6XA 1EJ0A 1K97A 1MQSA 1DINA 4YIKA 2JI8A 4WFIA 1KBQA 1KSJA 5KOHA 2Y1OA 1P39A 4AW9A 2X13A 2ZBGA 4KO8A 3VC7A 4F91B 5COQA 3E22B 3M3PA 1M9NA 4BBJA 1PFYA 1EVIA 4NARA 3VO1A 5FWYA 1PZMA 2HV8A 3TD2A 1FXSA 3HB0A 2A92A 2NZ8A 4YCDA 4L16A 5C4GB 3WRXC 3TW6A 4HO1X 3T7TA 4AT1A 5E2AA 1I2MA 3GN2A 2ZRFA 1NDHA 1Y1PA 1FMLA 2O2CA 3VSEA 5I7HA 1L4KA 4DUGD 1CR4A 1WCWA 3PHGA 3DDZX 4N3BA 1WHSB 2QTCA 4AUKA 2W42A 3ORQA 2FJ0A 4CEJB 3J7AC 4G9EA 1XTSA 4LQ4A 4BLSA 1L7QA 2J9GA 2PLNA 1DB3A 4NBUA 4PO8A 1X9GA 2OFXA 4GZ6A 5EKSA 2B1IA 2NXCA 5IUJC 1OGYA 2CBXA 2JGLA 4BEWA 4PZCA 3N74A 5K8UA 4OXYA 3G0CA 1UADA 4RFSB 3ADCA 2ACEA 3FIJA 2QZSA 1GPBA 2JLSA 5CCBA 4NONA 2FB9A 4DCOA 2OFOA 3OE1A 5JCPA 4ZCRA 1K7EB 1MC4A 3BGSA 4PAWA 1G291 1JAHA 3WK7A 5CFQA 2PAAA 1P2UA 4FXPA 4KTVE 4RZXA 2W2KB 3V2IA 1IBKB 1NIJA 1SCDA 3S1LA 4CIDA 3AFOA 2IYRA 1QGED 1Y7LA 2VIIA 3H2IA 4KNWA 4X92A 2VAWA 4N5LA 1WDWB 4KSBA 1XALA 1T2EA 1TU4A 3BRQA 4M8IA 1XG5A 4Q01A 3C48A 2GILA 3FBGA 5AVYA 1LZLA 3PEYA 1G63A 3L6DA 3M2PA 3NHBA 1A5AB 2QENA 4QPPA 3RT7A 3EZ2A 4KE9A 2MSCB 3S2ZA 4E5YA 3B2QA 1JF8A 2C95A 2E21A 2QAGC 4GMHA 4ONEA 1XFAA 3NT2A 5B3KA 4LZJA 4YJ3B 4ZQBA 1A95A 1KU6A 2ET6A 4Q4CA 3TLBA 3ND9A 2PYDA 2HCRA 4WK2B 3Q6NA 4YRNA 1P7ZA 1YQTA 2VJMA 2XADA 3O73A 3NVKI 4KDFA 3TLYA 1KYVA 2QSZA 3K1JA 2DQKA 1QVAA 3GJZA 4ALMA 1KYXA 1AUVA 4EP1A 2ZCUA 3AWIA 2Q2NA 4NYJR 3A31A 3JQRA 2PE5A 4PAQA 1BA2A 4EEKA 1XVIA 3V32A 1JKMA 2AEMA 5IM4A 4Z4QA 1R7RA 3MLEA 1IY8A 5DNYB 2BDUA 1KEEB 5ESWA 5AKXA 3GGJA 1FS4A 3MJRA 5BWMA 2EJCA 1HEIA 1PR0A 1ZCFA 2B2NA 2K4MA 1QK3A 5AJTA 2XDWA 2OXCA 4JX8A 3SGLA 4AWXA 1DAHA 4ZIRA 3HY4A 2GS9A 3LWDA 1ZR2A 5EIFA 1RR6A 4CEHA 5JCJA 4MIYA 2YJZA 4KQ1A 3G9UA 1WUIS 4TWJA 4RTOA 3MFYA 1X2EA 3U9LA 4N6NA 2OZVA 2DWQA 1YOBA 1HMYA 2V97A 2BFOA 2Y67A 2YJGA 4DRXB 4FS8A 5BV0A 4OTZA 2DC1A 1E7SA 4QDJA 4YLGA 1XEWX 2ZBQA 3IYLW 2JA1A 4NLLA 2IOHA 3BGWA 3AEQB 3FNHA 3FWPA 1XEXA 3H5NA 3AV0B 3FY4A 3P27A 4NMWA 4KQEA 1DBQA 1I4WA 4S2EA 5ALKA 3C6QA 4N0EA 1B8UA 3K1AB 3R5JA 1F3OA 5KSZA 3T94A 4B6QA 1UP4A 1P2BA 1EVQA 2V6IA 4YJFA 3KOZA 3FXAA 2EF0A 3CXRA 3RFVA 3FX2A 3ZOKA 2MSLA 4U7PB 4RJTA 1PHPA 3JAKB 4C7OA 2XY4A 2FSVA 3ZWCA 5EIWA 3GLRA 2PJDA 3U44A 3DGEC 3EIQA 1JG4A 2FPXA 3VKFA 1E1QD 1AVTA 2W6CX 3B53X 2O23A 3K31A 1UK8A 4WQMA 4XM1A 3EVTA 5FKJA 3CONA 1YJBA 3DFUA 3X3HA 2A8YA 3LLSA 3NEAA 3AEZA 1L7XA 2AN3A 3K94A 4WPGA 4HNTA 4MAMA 4KPFC 5I7RA 3TF5A 4TZ6A 2DJ5A 2WD9A 3MCAA 3PNLA 1X0VA 3NTUA 3QPBA 2OC4A 2FQ1A 5B58T 1XF9A 4C7MA 4RTSA 3T34A 1DT5A 4K46A 3I0MA 4LY6A 5BR1A 2FWBA 1XPUA 1RQGA 4MVJG 4NECA 3E5HA 3NBMA 4MVJA 1L5HB 3VI4B 4ZAWA 1QGUA 4B7CA 4US1R 5DGXA 1SVNA 4TROA 5GGXA 1DE0A 3HBNA 5FEMA 2HT1A 2G25A 1WCYA 4MUJA 1I6WA 2QRLA 2WJZB 3ZR4B 3RU2A 5SICE 1CEXA 1ESZA 4HZGA 5BSFA 4LISA 5MN5A 5BSGA 3AM3A 1R88A 2RGNA 2RGYA 1I3KA 1IM2A 3WXMA 2K5UA 2QE6A 3WBFA 4LZWA 4BKPA 3FUVA 4GBMA 1JHPA 4F38A 1PJZA 3C8DA 1ISJA 1IHDA 1X8JA 4FLEA 1M73E 5LU8A 1T91A 4QTZA 2V7QA 5CPFA 2BKLA 5AUPB 5ICMA 1R9GA 3ESZA 3GZTB 2UXCB 4AX4A 2RIPA 2QV7A 4HWPA 2GXQA 1ISPA 1CIVA 5M7EA 1J39A 1E61A 2BZ1A 2DPXA 1T15A 1V43A 2G09A 1QIGA 3DAPA 3H1EA 4EKNB 4ME6A 1ZG3A 5D2CA 2QQEA 3M5CA 2R4QA 3SQLA 3ROQA 3QF4A 2R68A 1T6NA 5KU7A 2HLHA 3SJCA 3E1GA 3JQ7A 2BONA 4QNMA 3SJBA 1L2TA 2I71A 3JAWB 3HXQA 3WIEA 3KQUA 1T2UA 4D8YA 2CMKA 4UOZA 3V1KA 2W2VA 3BE5A 5AESA 3KETA 1IUKA 2E4ZA 1NX6A 4F6RA 2JGDA 2Y0CA 4RE5A 4MA0A 2X2OA 4TTVA 1BYUA 1W29A 3CZPA 2FP4A 5EEGA 2ERYA 3I4FA 2IP1A 1ULHA 1XZPA 1USKA 2QT9A 7ABPA 4XUEA 5ALSA 1F8YA 4BC0A 2NUPA 4K6CA 1EIWA 3PJDA 1SKBA 1DKMA 4DSUA 3EGXA 1U4SA 1EVKA 1GPNA 1R50A 3CUUA 1YR1A 1RVV1 2ZXUA 1UBHS 3I45A 4WY8A 7REQA 4GPD1 5DM4A 2JB9A 2XUDA 4QUEA 4TZKA 1R6BX 1A69A 1GNVA 4AI6A 1QIEA 1T3ZA 3KXIA 3STVA 3GNLA 3H8SA 4EAQA 4JCCA 2YUTA 3A3YA 3FGNA 3ND6A 1E9VA 1POXA 1R4MA 3HP1A 4TRJA 4Y6QA 4YAEA 3U3JA 1SUBA 4M49A 2VATA 1BHO1 4Q4HB 2FSVC 4CKCA 4J1TA 1EAYA 3S2EA 3I8SA 3MFQA 4ZVVA 1XTRA 4YP7A 3LI2A 3GMIA 3OFJA 3GEIA 4RV9A 4F7DA 4IZOA 1CBUA 3QNMA 3RIYA 1L4BA 3HDTA 3D0QA 2O9JA 2W8BA 5KX5B 4PO3X 2D5BA 3HFGA 1T5BA 3TUZC 2GN0A 4LBVA 5JJBA 1FFGA 1EUCB 1U6IA 3WWDA 3O1JC 2JFHA 4LDZA 3SDBA 3W6OA 3DULA 4Z2YA 2QGZA 3L4KA 4X00A 5TV2A 3UIEA 1XR3A 1R8XA 1HLGA 2O07A 4JJZA 1JSZA 5CA1A 3PX3A 1T1GA 4H08A 1BWQA 3PNMA 4KE8A 2BLNA 5BPHA 4HEA1 1EZ1A 4OVKA 2CXUA 2Z6QA 2EP7A 2Q29A 3W5VA 1VKZA 3AWDA 5FLKA 1HNXB 3GBPA 1UXJA 5A9SB 2YYAA 1P2VA 4S0XA 5DRYA 4V0RA 4BB9A 1RXSA 2PVSA 3R6TA 2C4HA 4OFZA 2X8AA 4UZFA 3NASA 1KMHA 3H1BA 1CIJA 3K53A 3K9NA 3O31A 3L7CA 1CQXA 3RSFA 4IGEA 1FDSA 3LLMA 3CW9A 1D2CA 1M72A 1UZAA 2GK4A 4II3A 4N03A 3GN1A 3RV3A 3QUAA 1G3MA 5EUBA 3GIDA 1QZUA 1Y6GA 2V3CC 2RGNC 2EFDB 5EGSA 3CBQA 5F3DA 4UHFA 2DBVO 2FPOA 3MMNA 4GDFA 4FYJA 3Q9LA 2HHCA 5I4CA 2Y1CA 1Z6XA 1BDJA 1FNMA 1TMOA 4NX2A 1CUIA 1GRCA 1PVOA 1O89A 1QDEA 2VDLB 2O1XA 2PD4A 2ZATA 2JF0A 3FDZB 4NE2A 1J09A 2YRFA 1O95D 5L3QA 3QUBA 2K7FA 5HUQA 3A6FA 4UBLA 3GMTA 4B34A 1RW4A 2E82A 3PJGA 4W1QA 4QWWA 1SHLA 1SG0A 2PKQO 3BL6A 5LXTA 1JXQA 2Z8YM 2H5EA 3LY8A 2QB5A 4DV3B 3BHJA 5JZMA 1Y4DE 2CF6A 3E7PA 4CKXA 2JGRA 2X14A 3DR3A 1US8A 3HPQA 3QX9A 4O4JA 5IM5A 1N32B 1TCAA 4F96A 4JYCA 4KQ2A 1YRLA 3V33A 3LQRA 4J3JA 1CUUA 2J3QA 4GI3A 1UT5A 4MV3A 1AKUA 2F9MA 1P5ZB 4FQ8A 1PHRA 4F11A 1C50A 5HGXA 2GRUA 2PMDA 3O84A 3VI3B 3DL7A 5AJVB 2JHFA 4WZZA 5A7GA 4CCYA 5BW6B 4DEXA 2X76A 2YOHA 4UHCA 2CWDA 4BGEA 1NPTO 4I1PA 2XNDD 3UYKA 2O0LA 1NW4A 3WLPA 3URKA 5BVHB 3OQBA 4C0LA 1QIHA 5G3YA 3DUFB 3QJGA 4EI8A 3EFOB 1IBRA 4DQLA 1VPWA 3O7MA 2VWQA 1EEHA 2JLZA 4NZMA 1N6RA 2B30A 2GZ3A 3Q12A 5E95A 2ZT5A 3RKRA 3X1YA 1TA9A 3IQDB 3CB4A 2QRQA 5JS6A 4MVJE 3I73A 2FXVA 3QE3A 5E6UB 1RWKA 1JHQA 4TYPA 3V8NA 1RZ3A 2RJ3A 2YMLA 1IZYA 4QQ8A 4J1TC 1D4ZA 2RC6A 2I4TA 2XUOA 3RQSA 2WYWA 1Z15A 3EVFA 3UH1A 2IU6A 2JHPA 3HZRA 1MJFA 2ZYSA 3FRJA 3NBAA 3FLEA 2VPXA 1C3VA 2C3YA 4Z0NA 2O8DB 3FWZA 4ALIA 1I6KA 2JD2A 3GPIA 3IEKA 4ZQHA 3HCEA 3TQTA 3S8YA 4QSMA 1UKCA 4KQ9A 3FVRA 4P4LA 4FNMA 3VPGA 5K03A 4DA0A 2G80A 2CVOA 3AYXB 3H84A 3KHSA 3B38A 1XVVA 3DOEA 3GZNB 2D7JA 4N82A 4RUKA 3RUDA 1YK1A 3C8UA 1PT7A 2IRWA 4PX9A 1SCAA 1U0RA 1ZUWA 4QO8A 3MYYA 3V8MA 4W5JA 1Z6TA 2I76A 3T15A 4EUHA 4XD2A 1G2IA 4DCSA 3ELYA 3DVQX 2GBIA 4MGKR 4DMLA 1QR6A 4ZU1X 3B3AA 2QLTA 3ORRA 5JSZA 5TSDA 3V00A 3W6PA 2LDBA 1VG8A 1N1GA 2RJNA 3HJHA 4QECA 5DSZA 3VDRA 3IEMA 5DGCA 4RIFA 2VDRB 2RGUA 1YVUA 5A71A 4XSHA 1WCIA 2XCQA 3K1TA 4CU2A 3WE7A 3EFEA 3AHGA 2H4WA 4IVQA 2BGNA 3DPIA 3IAM6 1VL6A 3S27A 4UTPA 5AVUA 1DJLA 1II9A 3RC7A 5TPZA 1R6AA 4US2R 1U04A 5ITVA 2EYUA 4WXMA 3DW3X 3MBKA 3JQEA 4FB4A 1X86B 4YQFA 2C2MA 5EZYB 4EYGA 1NNI1 1KWKA 4O59O 1XDZA 1RYDA 3G0OA 1QYVA 4U6QA 5TEWA 5ALMA 1GTSA 1B8OA 2BF7A 3BFKA 4C7XA 1ILEA 2JBAB 3DEHA 3IQEA 4B5LA 3H3XA 5DHPA 4LE2A 3DWEX 5K20A 1AGRA 1UXHA 1XQ6A 3QWAA 5A4KA 2CFOA 3BICA 1EPUA 4G25A 1TMKA 3EPLA 4PGHA 4KPUA 4R31A 1WF3A 1SVOA 5A5DA 3O3OB 2ZUEA 2MYUA 3K6KA 4RSRA 3H2JA 4AZ3A 1WEKA 2R1VA 4AJ2A 1KWGA 1YDFA 4I6JA 4IMJB 2QPLA 3UJHA 3IESA 1H1LB 4W5RA 2FG5A 4V03A 1JJBA 4LZPA 1V1RA 1B4DA 4BLVA 3QXXA 5CLFA 1L4NA 3EUEA 4P8RA 3OPVA 2ZYRA 2LCFA 3MAAC 2AUNA 3SF8B 4B31A 5KQMA 1HOXA 3EWAA 5KTTA 5B4VA 2CDNA 3MHTA 3DBLB 4PHTA 4NCJA 3H7AA 3IRVA 1QOPB 2C78A 3QVVA 4G0ZA 4I55A 2YY5A 3TL2A 1MOPA 3P20A 4DSTA 3DCJA 4PU0A 4MR9A 1OLXA 3Q9UA 1LPAB 5IFLA 3ZWXA 4IF4A 2KJQA 3VUEA 6Q21A 4EA8A 4HNRA 1M33A 1EWRA 1OZFA 1Q74A 1S7CA 2DBQA 2H6EA 2RI1A 2QF7A 1Y9AA 1K6MA 1UJMA 3H1AA 1JRLA 4FDTA 4J7AA 4DC0A 3F5DA 4YDRA 5M34A 3CVWA 1CJBA 1G8MA 2Y0PA 4DLUA 2J0SA 4TXHA 2SCUA 3T0FA 1YACA 4OGKA 2BGLA 3G1UA 4UAUA 4V02A 1XK6A 2WI8A 4F12A 5EJGA 1Y37A 4IRUB 4WOPA 1Z45A 3KR2A 3TOVA 3EAFA 5DO9A 3OQJA 1L5OA 4OBWA 1Z0JA 1K68A 2JJ2A 2C5HA 2NZJA 3CEAA 3B9PA 3WYEA 1L5VA 3MIIA 3R5KA 1GG8A 1P5JA 1Z07A 2D1FA 2CXQA 4LA4A 4AP5A 1KEPA 1YFZA 3SKXA 1E1RA 4J75A 3SR4A 1TGYA 4EG6A 4IDCA 2IWRA 4I50F 5DI3B 4GZ3A 3ESDA 3HADA 5EP2A 1UMBA 3TNFA 2BFBB 5LNK6 2GZSA 5D8DA 3GUVA 3RS7A 4O1IA 4H9GA 2DSTA 3EOZA 4WXYB 1X8XA 5GJVC 4YLYA 5EZSA 1LDEA 3WL8A 1RT9A 4E5MA 5EOVA 4CDRA 2DE0X 4NU0A 4E2WA 3GFPA 2P4UA 2P90A 3K9CA 1JB9A 2DFKB 2HNBA 4KFUA 2PVCA 4LYGA 4MR8A 2QDXA 3OQMA 4WX2B 3VMFA 5AI4A 2HMYB 1SUFA 2BEJA 3KKOA 3ODPA 2IYXA 1Y33E 1GCAA 1CZHA 1H2BA 1R0ZA 3IKTA 1Q5PA 3IO5A 2ZS8A 3ZCXA 3BFJA 4KU4A 2F3UA 2G82A 1QCYA 4KAJA 2LCIA 3EODA 1QHEA 4P9NA 3RNOA 3U13A 5AT1A 3GLQA 1H05A 3AR2A 4XOIA 5FUWA 5DX0A 3WKCA 1ZGGA 1KERA 1O57A 4P31A 3ACCA 3TJRA 5DGIA 3O3CA 1MEEA 4NEQA 3QJ5A 3WA7A 3AU8A 4R2KA 1TRHA 3THYB 3USZA 3EJ6A 4CODB 4D56A 1DNPA 2C7PA 4M88A 1GV1A 5GONF 1CX9B 2P6MA 3A4MA 3IJ5A 2Y1XA 4REQA 2BELA 5AK6A 3KLOA 2GEUA 1O5OA 4AF8A 4HGOA 1U6JA 1JU3A 3IBFA 4X6UA 3WL4A 3DE7X 2C2HA 4LDJA 4BVGA 4HLDA 2ZSHA 1PNVA 1RCUA 4IXNA 1AUQA 2OFFA 3T0IA 1AMNA 3W5SA 1GNPA 4MOWA 1OFVA 4HQLA 2OQRA 2WG1A 4R98A 1XKQA 3JQ8B 4K87A 1E99A 4L8GA 4QJ5A 1XDDA 2ZJFA 3HUUA 1WY7A 3UUFA 4Z0PA 1XCPA 5JW6A 4KLNA 3WLJA 1NQWA 4BFXA 5A1TA 2BFNA 1N8KA 2DQSA 5K0LA 3SF0A 4B3IA 5CYGA 3DE4X 4PRKA 1L4GA 1XU7A 2GAFA 3R3WA 5KKNB 4TOIA 2LRHA 3D7MA 5I4IA 5F4ZA 5BRAA 4ARSA 3PX7A 2H4YA 5HQ3B 4PC6A 4HAIA 4FMCB 4HDAA 1E3DA 4TN1A 5CJ2A 1QUEA 1N33B 2QP4A 1E6UA 4Q24A 1CJTC 1K2WA 1N7IA 2FN9A 1VJRA 4WV3A 1GGNA 4Y2JA 1AK9A 5HW0A 3DH0A 4M0CA 2YR0A 2I6QA 4UUBA 1LVGA 2Q1YA 4MV5A 5E3JA 4LFBB 1CDZA 3NJ4A 3EYAA 4C6RA 2JLYA 3BHMA 1BMDA 3DBRA 2FW1A 3X44A 5AK4A 1JQ3A 4M1TA 3BJIC 3TXAA 5ALFA 4D8XA 1ECBA 1GQRA 3CNNA 1YE8A 5F33A 3TKYA 5CB4A 2V0CA 3ELBA 4Y2XA 1KARA 5AM1A 2VQFB 2AN9A 1W4AA 5LUAA 3VNAA 1PEKE 2GNPA 5FPSA 2K7ZA 4Y2PA 4UU1A 2CNBA 3VJKA 4F2HA 3IR6A 2P5SA 1MKYA 3C1AA 1TJ3A 1V7ZA 2OECA 3W3AD 1TZJA 4HRVA 4PIVA 4P3XA 5IG2A 1CRPA 2XCOA 2ZW9A 5AHRA 4W5QA 4RA9A 5U4QA 4HDNB 4DRYA 3RUEA 1NIPA 4C4AA 1IOZA 2BEWB 4H17A 4LJ5A 2WP0A 3CBGA 2Q7XA 3L46A 4GPBA 4HWTA 4XR4A 4F2WA 4DLWA 2QN3A 1TI7A 4GXTA 4MWDA 2ZT7A 1C4XA 4XI9A 4X62B 1FNNA 5KPJA 1OLUA 1NNLA 2H2IA 1XMPA 3PXUA 1E89A 2Y2UA 4KQ6A 4DEYA 4G8JA 4MW7A 3FNQA 4CM9D 3DMDA 1FJHA 3F6YA 4KIGA 4ML3A 3ZQUA 1J8DA 1TYEB 3AUKA 1NVEA 1JG6A 4F92B 3IJRA 4WUTA 4XIYA 3RC9A 2QSJA 4KJXA 5LB2A 2I66A 4V0QA 3SZRA 1DWPA 3UT6A 5JCOA 1Z7WA 4ZWNA 4DSOA 1ZYUA 4G1EB 4M6WB 4M7RA 4QARA 1W8IA 1ACJA 3FF4A 2A3RA 4LGYA 3QU5A 3EXG2 3UPUA 4BX8A 3QUSA 2MYPA 5FI3A 1LA2A 1BX0A 4O2BB 4A10A 3TMYA 4YVFA 3AIMA 4M55A 1JDBB 4M9QA 4K6FA 1RCFA 1FA9A 1Y4UA 1A8PA 2GVNA 2OBXA 3G2OA 4GSKA 4IP0A 4WVFA 5D5HA 4BIIA 1YR8A 4QUJA 2A5GA 2ZUWA 2BCGY 5FBZA 3BMNB 5DGDA 1P1IA 1SVUA 4BNTA 1C9NA 2YFKA 3H0CA 1HE3A 4NV0A 4FSDA 4BASA 4F5WA 1WTAA 3DFZA 1C9EA 1DEOA 1KY5A 1QBKC 1TU0A 3AP1A 3IFSA 3TVYA 5CFPA 1EJ6A 1JIQA 2F00A 3UM9A 4U2DA 1TQ4A 4L0QA 2CXHA 4NYMQ 5MN6A 2RHBA 2XQKA 5JH7B 4U7WA 3IXMA 3BK2A 1BE0A 1M6YA 1C7QA 3MEQA 1IOVA 4MUAA 121PA 4PANA 2YBDA 2DLNA 3CT4A 1UUFA 3JQGB 4RQTA 4HAWA 3KWMA 2IWHA 2YC2C 2E6KA 4PWYA 2X40A 4OLJA 3U7IA 4RMNA 4RH0A 5KYXA 2BJWA 4PNZA 3Q5GA 1V8PA 4KQMA 1YJ5A 2JLRA 3AR5A 2EYQA 1YRWA 3I9V6 3X1XA 4HG2A 4EMTA 2PMEA 5JZSA 4RDHA 1FP2A 1XZFA 1R37A 5KNLA 3U3OA 3U31A 5J23A 3CLKA 3GGPA 2QN8A 2SKCA 4YASA 4EOGA 4HNUA 3W77A 1JSXA 5I01A 4FFDA 4ABTA 1OWPA 1O9GA 2NVWA 3QKUA 1DGQA 1W2GA 1XRMA 1NP3A 4HUQA 2AZTA 5EL0A 1U3FA 1GUFA 1SKYE 3BQMB 3PGA1 2E85A 1T8PA 2HTEA 2OXTA 3LP8A 4PN3A 3WQBA 4EWLA 3IB3A 4MKHA 4ZYLA 1QHHB 3FSJX 4OIMA 1I1QB 1SZJG 1UAGA 2LDXA 3PIDA 5K01A 1NU6A 1ENPA 1VLVA 1ITZA 4H1TA 4MWZA 4AMYA 3TGPA 3N87A 4R8KA 3QLVA 4BMCA 2YNMD 1KKMA 1T3LA 1KO5A 1M74A 4DJJA 1AXRA 2I7DA 3W5BA 1K8YB 3BTSA 3ST7A 4MRPA 4P80A 3OP4A 3CZAA 2R9VA 4AY3A 4YT8A 2DT8A 2GAJA 1X74A 4R1SA 4CM1A 1A4IA 1E9FA 4RZ3A 1DQZA 4EENA 1E1KA 1N9GB 2BFFA 2M2IA 1NRXA 3GPCA 4H77A 1HL3A 5EQJB 4DLVA 1OFTA 4F7WA 2EV9A 2CYAA 4B3HA 1PW5A 3BYZA 5CEFA 1HO3A 4AXXA 1WDMA 1XRQA 3KE9A 1E8DA 4CZ2A 2UVDA 2ZK7A 2VRWA 3ZV7A 2WHPB 3B2EA 1FUYB 1QG2A 3PDHA 5IYZB 1IPEA 4DUYB 5KTPA 3F6EX 5DB4A 2GEKA 4M8NE 4I4CA 4E03A 3L2OB 4IQ0A 5JCOC 5K4GA 4P83A 4E12A 3S81A 3BE6A 2JGMA 1U99A 2G1PA 4P4SB 3KZXA 2W2MA 1PGQA 2C92A 3NXSA 1J0BA 2AJTA 3RGWS 2IS1A 1V5WA 3LC1O 3PBKA 1WZUA 4OHMA 4D9MA 3OCJA 3AEYA 4QODA 3UW3A 3GA5A 4FMPA 4AUEA 4ND6A 2N1MA 4KQFA 4TV9A 4IIXA 5AK5A 1FFWA 1Y81A 4GVXA 1GWNA 4LWQA 3H1TA 3TJZA 3UUEA 1LZKA 3R7BA 2BEKA 2JHCA 4ETMA 1EQAA 3B5JA 2CLLB 4BZPA 4KMRA 5H82A 1O54A 4DJ5X 4E4TA 4XB2A 3ORYA 1EX1A 5FL7D 2FQXA 1N2CB 3KEQA 4Z51A 2NWQA 2IKSA 4NJMA 1AKYA 3C3JA 4R2JA 4L22A 1BCRA 1ZSNA 3FFBA 4EJSA 3Q7EA 1UM9A 2GHQA 1CJUC 2V58A 2D1TA 4MYCA 3SS8A 3ZOZA 1GM5A 1CZNA 3K72B 3ETHA 4AG5A 4BFUA 3PFGA 4UARA 3P5SA 5F2NA 4L6CA 5L3SA 4HAXA 5EZ5A 5K1ZA 3VR4H 1M6NA 3JSAA 3OTHA 5IWAB 4Q0MA 2GAOA 2P91A 4YPFA 1QCZA 2GM5A 2YZMA 1ECGA 4PLFA 3GLFA 4XDYA 3GDOA 3OLCX 1OHHA 4NAVA 1UPTA 3FMFA 4JBYA 2GJKA 5ELXA 1ZLXA 4CI9A 4TTPA 4M1QA 2YJ3A 1YE3A 4FKMA 5IKEA 3QVJA 4N5IX 4B85A 2IV2X 4QPCA 1JEYA 1UMCA 1FMFA 1NURA 1RFGE 2B6NA 1KZGB 4MIOA 4WZAA 3K70B 4KZPA 3LTNC 1DWQA 4MMXB 1JE0A 1K6EA 5REQB 2POQX 2ZSEA 2TSYB 5AW9A 4MV9A 1FFXB 1S2LA 3B6KA 3ME5A 2OHJA 3PFBA 3TTYA 2H51A 1I5OA 2WFZA 1JFLA 1BFDA 2IYZA 4FFWA 3QEMB 2D5AA 2GPBA 1T9ZA 1CERA 3BWMA 4NS1A 3S7ZA 1NJ1A 3K4QA 2WYIA 4CYMA 3Q15C 1W6RA 4NF2A 3HYTA 3SYNA 2MSDB 4LVNA 2B25A 4JMPA 4O4LA 4ZQCB 4NDAA 4E2YA 1JHVA 2OK7A 4D46A 2QDKA 3RTGA 1KI6A 5JD4A 3LIIA 4R54A 3BXOA 5FADA 1A71A 1L8OA 2HOQA 2YN2A 2EQAA 4R1LA 1EWQA 3O0TA 4N6OA 3LX8A 1EJBA 4N5MA 4QOJA 1WY5A 5AR1A 5FF9A 1VRWA 3QLVC 1A9OA 5JH7A 3NVAA 3MTAA 5BXYA 4RDCA 5CURA 3G23A 1NP7A 1VYVA 3H5TA 3R3ZA 3RS9A 4IKPA 3ZIAD 3ETDA 3F9CA 1QP8A 3COJA 5A2QA 2QJRA 2N3ZA 3IH5A 4E09A 3HZHA 5J2UB 2W4IA 3A36A 4TS3A 5CX4A 1URPA 3R0VA 1QFJA 2P77A 1XTZA 4Z99A 2F9LA 2D7DA 1O0SA 1QH1A 1Y5NA 3BS4A 5TJ9A 3Q2OA 4UNNA 5KYWA 4BGDA 1HDGO 2V7XA 4Q4JB 4R83A 3DO5A 5DX1A 5H02A 2IBSA 1DDIA 2H0RA 2H1WA 1TMGE 5TQJA 3RUCA 1QNFA 1ZRMA 2QUJA 3C3EA 5LJLA 1NF8A 1NVAA 1B23P 4RK6A 5ALLA 4O63O 3WNCA 1B73A 2CNOA 4OHFA 4ZGWA 3VU8A 5CVTA 2CD7A 3VV2A 2XUZA 2D1SA 2ID7A 3DP9A 1Y1RA 3EWNA 3TPCA 5A6SB 3W90A 3L82B 3CINA 3R76A 4LIPD 4B6FA 5L3RA 4JUBA 2AMLA 2FPGB 1NZDA 3RHTA 3VOTA 4EITA 5BORA 3GUCA 2EEZA 2A78A 4P33A 1KP2A 4P7GA 2CNWD 4PE5B 1JAXA 1O6CA 4MV8A 1TB4A 2QU7A 3B82A 2XW6A 4IVNA 4MHOA 4XEUA 1XZCA 2VC2B 5CK4A 1NUQA 1TAUA 1Y1KE 1NHGA 3IRUA 4DBLE 5AW3A 3HDHA 4R9NA 4C4TA 5DH9A 1OV4A 1CUEA 2P5YA 3K0CA 2QYHA 2WOJA 3I5MA 5IK2A 3FYTA 4MIKA 5EXDA 4ZJPA 1T4MA 3DZKA 5ARDA 5CDHA 3ETEA 4PYKA 2XTZA 1H3FA 5ERYA 2Q9AA 2QTRA 5J58A 4NYJQ 4E15A 5SY6A 3VNQA 13PKA 3RJ9A 4EJSC 3DWGA 1T9BA 4UDOA 1LLCA 5TB5A 2VT2A 1X80B 3LUPA 5HS6A 3TCXB 4DDMA 2QU8A 3B1WA 2A9JA 3KX2A 4BZXA 3AL2A 4L76A 4OLFA 4MUMA 3U61B 5CLLA 2YWFA 4AK9A 3OQOA 4TMXA 3BL8A 4UQPA 1N2XA 2YJNA 1Y8QB 2EIHA 3QFRA 4L6AA 2AB0A 4HJXA 3EBPA 4JEHA 4R0MA 4TM8A 5KOIA 2AXQA 1NLMA 1PV1A 1F1JA 3A1TA 3IR5A 3RUPA 3JCZA 2VNKA 3W1EA 5H59A 3VU9A 1R12A 4FU0A 3B3GA 3IC5A 2W6MA 1Z0ZA 4U1RA 1XA0A 3TJMA 3HSKA 1VLMA 1R10A 1PS0A 3B3FA 1DL5A 1MIOA 2CNDA 4FZRA 1IAVA 3L6EA 4JOQA 2O8EB 5JYDA 3KYCA 1CY4A 4HVTA 2Z8XA 3JR3A 4G4GA 3AESA 1JI3A 3A1WA 3HB4X 3AVPA 1Q7TA 3K9QO 4GUDA 1FTGA 2DPMA 2QTWB 4FEAA 3ORFA 2W0SA 3D81A 3SFVA 4NP6A 3TD9A 4L57A 3FAZA 1E8MA 3KIPA 1P7PA 1X15A 4G5FA 3ZDAA 1OBFO 1KEKA 3PUJA 1AZSC 3U16A 2XSZA 2ZJYA 5TT0A 2YYYA 1XYVA 2DECA 3ZPXA 4YGXB 1V3QE 4LRQA 4Z5XA 2CUZA 4JJ8A 2GJSA 3M4NA 3LQYA 2WA2A 2HJWA 2VJCA 2EW1A 3EQZA 3C3BA 3O2JA 3ABOB 3AXTA 1NC1A 2OP1A 1CPYA 1GDTA 3N70A 3RS0A 4HX5A 2VRNA 1HE8B 1NU8A 1PKEA 4ENRA 4CPDA 1M2VB 5LIRA 3ZC3A 3SZLA 3FYSA 1YCGA 2C4MA 5T4BA 5DTJA 3ZY2A 2B98A 3ROMA 4LOAA 3RWBA 3X1WA 5L45A 4MLPA 2C94A 4BYGA 4LHXA 1D07A 4GPTA 1Z74A 3BE8A 3WIBA 2AG0A 2OUIA 1O8BA 3GYBA 3QYJA 2YWGA 1LI7A 4JQCA 3T7EA 2XXAB 4ZOLF 3KEGA 5CAEB 1OFGA 3D6MA 1N0VC 3L07A 3LSTA 4OGWA 3OF3A 1QTNA 3FR7A 4D42A 3GU3A 2LD4A 1E6MA 3SVZA 1RRGA 5JPIA 1VRVA 5AVKA 4AZTA 4NNJA 4BMZA 2ODEA 2A0WA 4HADA 2Y1WA 3UFXB 4NU5A 4OI2A 3K1YA 1H2YA 1IN6A 4ABYA 3AL3A 1A8QA 4HQFA 5HBGA 4RO0A 5IVKA 3C3MA 4D0SA 1RS0A 1S96A 1GFZA 4OBBA 1R2QA 4EG1A 4UASA 1F6DA 3LC2O 3K0CC 2LP4Y 4PW0A 2C98A 5H7XA 4HAYA 4WZAE 1V5IA 1HYEA 3RSLA 2WY2D 5KOJA 4Y3UA 2GUWA 3FOEC 4NAHA 2PRKA 2HPVA 4CM4B 1N57A 2CE2X 4UVDA 521PA 2QOEA 4U0JA 4L4XA 1VL8A 3NHLA 3M9LA 3KQKA 4N3CA 4P2BA 1CJSA 2JFGA 3F5SA 3D64A 4ZOEA 3IMGA 1ZBDA 2VP6A 4O5AA 1IY1A 1G6HA 2UYGA 5FNVB 3UXYA 3R3SA 5M5BA 2L19A 3D6VA 2BGTA 2LPMA 4GW3A 4UAGA 1EP9A 2H1VA 1QZZA 3TINA 5BSEA 4WCFB 3RYCA 4E4RA 4YI5A 5JO0A 3AF6A 1B3BA 1RP1A 4NCAA 2GFQA 2LVBA 3KRTA 4M60A 3IDZA 2FUCA 4FZ5A 4KAFA 4NBTA 5HIAA 2ZB7A 1U7WA 3D5EA 3VKUA 4Z4EA 4IGKA 5H80A 1WXIA 2NU7A 3GUUA 2KBFA 2YN0A 3AVQA 3WGYA 1GT91 1EMDA 1JPJA 5UKDA 4O4IA 1KMIY 2H1FA 4JI4B 1J25A 4C03A 1RRMA 1UOOA 2PIAA 1UDAA 2Y2VA 1FP6A 1K7CA 4XJXA 1TNDA 2I3BA 4ZVRA 4GOLD 3T4UA 2JIMA 1JILA 4BP8A 2FTKE 2JK0A 4KN5A 4L27A 3ZLVA 4C2AA 4CM6A 5LA6B 1B15A 2J3DA 1K27A 3ZYCA 2Z5FA 5DASA 3PR3A 1UOEA 3MTQA 5IC4A 5JYCA 3MCWA 1GUAA 2XUQA 5H9VA 3LPAA 3F3MA 1JBQA 1PJQA 3HEMA 4K40A 3BM5A 5FUMA 3GXOA 4BNUA 3BWYA 1MV8A 4KWIA 3RC8A 3HCNA 4IHJB 2XNKA 2XMZA 2WF7A 1XTJA 3OX4A 1ULTA 2D00A 2JHAA 1K3FA 3G2HA 2OHVA 1T9GS 4QPZA 4RVUA 5H0IA 4AZ0B 2FEOA 1YUMA 3I6QA 3FPFA 5FA8A 3ZE1B 4YUWA 4V1CA 1PIWA 3S1SA 1GGEA 1XC7A 4CHTA 4OLBA 3GJ5A 1U98A 3SZOA 3PRKE 5AUOB 5AM4A 1KAQA 2WU0A 5DYNA 2B69A 2QL7A 4UAJA 3RSOA 5JFTA 4LFAB 3HYSA 2FSUA 3AJEA 3DAYA 3DG9A 3NUGA 2Y9MB 4H7JA 5GIPE 2XITA 5C9ZA 2GD6A 2Q2QA 3P2MA 1GGMA 3HXOA 1I3LA 4ZZ1A 4JLSA 1P0CA 2NXNA 1BKDR 2DF8A 1BROA 3FUTA 3GELA 2FMXA 5DNEA 3T35A 4F3TA 4UHHA 5EA2A 4AIRA 1O5TA 3QX7A 5KWJA 4PPNA 4BMYA 8LDHA 4KGDA 1N77A 1V2GA 2REBA 3BH6A 3EYWA 2ON6A 4MTCA 1Z6ZA 4P34A 3HCPA 3ZD6A 2XUPA 1K7SN 3VR1A 1V5FA 1KFKB 1U94A 2KBEA 2OENG 4GM0A 4BO5A 4JAVC 2PZKA 4JB2A 4WGFA 4FJ2A 5ALVA 1UK9A 4F71A 4FFSA 2QUZA 3FFTA 3BKXA 3L40A 3KUKA 3LCUA 3UKDA 1TPYA 1MNQA 5TQ2B 2LXNA 3E9CA 3RRFA 3GFRA 4F4IA 4A5OA 1QTRA 4XXHA 5FLYA 3UOGA 3OMWA 4U3JB 2VYFA 3NYQA 5JVDB 1J23A 1E69A 1MU0A 2ZUTA 3ZV5A 3IEVA 3SFTA 5EJ6A 1O94A 5LDGA 3T5CA