The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
66
|
sequence length |
189
|
structure length |
189
|
Chain Sequence |
VSGKIVVIGSSTGGPRSLDMIIPNLPKNFPAPIVVVQHMPPGFTKSLAMRLDSTSELTVKEAEDGEEVKPGFVYIAPGDFHLGLKAQNGKVFFFLDKSDKINNVRPAVDFTLDKAAEIYKSKTIAVILTGMGKDGTKGAFKVKFYGGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYKIPEKLIELV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Chemotaxis response regulator protein-glutamate methylestera
|
publication title |
An insight into the interaction mode between CheB and chemoreceptor from two crystal structures of CheB methylesterase catalytic domain
pubmed doi rcsb |
source organism |
Thermotoga maritima
|
molecule tags |
Hydrolase
|
total genus |
66
|
structure length |
189
|
sequence length |
189
|
ec nomenclature |
ec
3.1.1.61: Protein-glutamate methylesterase. |
pdb deposition date | 2011-06-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01339 | CheB_methylest | CheB methylesterase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Methylesterase CheB, C-terminal domain |