3SFTA

Crystal structure of thermotoga maritima cheb methylesterase catalytic domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
VSGKIVVIGSSTGGPRSLDMIIPNLPKNFPAPIVVVQHMPPGFTKSLAMRLDSTSELTVKEAEDGEEVKPGFVYIAPGDFHLGLKAQNGKVFFFLDKSDKINNVRPAVDFTLDKAAEIYKSKTIAVILTGMGKDGTKGAFKVKFYGGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYKIPEKLIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An insight into the interaction mode between CheB and chemoreceptor from two crystal structures of CheB methylesterase catalytic domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Chemotaxis response regulator protein-glutamate methylestera
total genus 66
structure length 189
sequence length 189
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01339 CheB_methylest CheB methylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.180 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylesterase CheB, C-terminal domain 3sftA00
1CHDA 1A2OA 3SFTA
chains in the Genus database with same CATH superfamily
2QM7A 4D3FA 4BQFA 1HKHA 1XROA 3A14A 1CR4A 3BQ9A 3MGGA 3PF8A 4PCVA 4XQ9A 3BKWA 2XNSA 3MOSA 4XJTA 4QVKA 2EV9A 1LVHA 2FNAA 3F4BA 1AK1A 3AFIA 3IAM6 3OE7D 2V0CA 5BN3A 1LQ2A 1ITZA 5E6UB 3T4EA 4DNQA 2BLNA 4HX9A 4U5XA 5DTJA 4KRYA 5GONA 4LSWA 4TWAA 1VPDA 4C21A 1GPMA 5JAMA 5A3SA 1VCNA 1EINA 2V6JA 2V1UA 1RTTA 4AUNA 1N1MA 4F6RB 3AP1A 1I4LD 1Z13A 2EIXA 2EP8A 4IPTA 3CSDA 4NV3A 1U90A 5FFMA 2FV8A 1KZHA 1CJSA 1HO3A 3QSYA 3C7AA 1CXZA 2D5LA 2YHAA 4CM4A 4NXNB 1X2BA 3PQ3A 5JANA 13PKA 1J2YA 2VDLB 4BYGA 5HOEA 2BEUA 1SZPA 3EDMA 1T4CB 3A6HA 4G3XA 1N1EA 3DFZA 3WK5A 1GZ6A 3B1VA 3B8HA 1MX5A 3HYSA 4FYIA 1E96A 2XY4A 4WY8A 5REQB 5JSFA 2WT4A 4HQKA 3K6RA 4H0NA 3CCCA 3X1ZA 3AEUA 4QHTA 3PLNA 1K7EB 4ITRC 4B3CA 2HKIA 3MCVA 4G9BA 1P60A 1WF3A 2ZYUX 1P3JA 2ACKA 4PXYA 1V5GA 1AHNA 2FX3A 1D2RA 1X1DA 2B1IA 3LY5A 3MAAC 1GA6A 2UYYA 4EY4A 4CU2A 1EFVA 6AT1A 2JZOA 3ZQ6A 3AU8A 4JLOA 4B3RB 4MPPA 1P4AA 4JIMA 3GCXA 3VYTB 2Q3CA 5D6OA 3HR7A 1G4AE 4D8VA 5HJ7A 4KTTE 4PVDA 3PXDA 1FP2A 3Q5EA 1BD3A 1NPDA 4NBLA 4G1VA 1USUA 2XNKA 1SD1A 3QNWA 3OLYA 4RL6A 4RK4A 3TMKA 1MV8A 2NPIA 4BGUA 4YRNA 4FYPA 1ZP6A 2QP4A 3OKAA 3OO1A 1W87A 1YV9A 4Q0MA 4WVLA 3RDPA 1YR7A 1GQ2A 1UQUA 4BCBA 5HFJA 3KQWA 2B30A 4WUVA 3IE0A 4LI0A 3LW7A 2PFSA 5AMXA 2PS3A 4M1MA 5ITVA 4LRUA 1LTQA 3PXBA 2CL5A 2PSEA 4GPD1 3H16A 4Q9NA 2BFWA 4JUCA 1B8VA 3ZWNA 2IUYA 3A05A 3Q0TA 4CTMA 1T0HB 1UH5A 2J7PA 3JZMA 5FTNA 1XDSA 3LWZA 4ICIA 4WT7A 3R0ZA 1IJBA 5HOQA 5JS1A 3DVLA 3OX3A 2HT1A 3WHKA 5JJIA 5CCXA 1E5XA 2HT6A 3CLKA 1PRYA 2OHIA 3ED1A 3GUHA 1JR4A 4OKNA 1UWLA 1E7WA 1IBRA 3BMOA 1E92A 4UMEA 2ZI6A 5IT0A 1KYIA 4TYWA 3W8RA 4RADA 3PEYA 3E6AA 1JKXA 3R23A 3DUWA 3SJZA 4EA7A 1ZJ4A 1KRHA 2C5SA 4J03A 1M34B 2XB8A 1M2OA 3OU6A 1ATIA 4GX5A 5CB4B 4P7FA 1PJRA 2HH9A 4DWOA 1Y1RA 3C74A 3A9CA 3L7KA 3C6MA 2C54A 1PWEA 2V4MA 3SNHA 1SFRA 1IN1A 1NBME 1YJAA 4PSUA 3A8TA 3ID6C 1EDEA 2P11A 3QELB 2X4IA 3OPNA 4G5YA 1QIGA 1VYTA 2M1XA 2D7CA 4Y1RB 3LVRE 2NQTA 3FPCA 4NCJA 4RGYA 3TLGB 4CTNA 1BMTA 4PZEA 1HF3A 1A50B 3MGAA 2FRVA 1Z4KA 4KQXA 4NZNA 2QD3A 4KX3A 5FUQA 4IINA 1A8IA 2I4MA 2F7SA 1YGPA 2P0YA 4MAAA 3V8PA 1NVEA 1DBQA 5B30A 3C5EA 3LF2A 2YV1A 3AEQA 3QVLA 4M37A 5FV4A 2W8BA 2DVMA 4EZEA 1V48A 3BTUA 5FNVF 3HXKA 4D0LB 1B42A 2RGNA 3BBPA 4EMSA 1RBYA 2NXEA 3A1UA 1HQYE 3E9ZA 2BRUC 5IBCA 3IV6A 4IZOA 3W5JA 1Z2OX 4FVTA 4OHXA 2F3QA 4S0ZA 1RC8A 2FPPA 4MUNA 5MFPA 3L2OB 3OPVA 3GP8A 4A4DA 2C7RA 1XB2A 2O8FA 5LSAA 4KPFC 3WBJA 4PPYA 3T3OA 5CTAA 4MVJM 3CVVA 2OZVA 3OZCA 4OHYA 1LB1B 1SU8A 4PLGA 3H87A 1M0EA 4X1YA 5J2UF 4X6LA 3VNQA 2BEJA 2ZBVA 1Z63A 3K70B 4QTUB 2QSYA 4L4SA 1I1OA 2CLCX 1WV0A 2QA5A 2X86A 3H2YA 4DSOA 1KRXA 1LW7A 3GT3A 3R3UA 1SJ9A 1J8MF 5AXCA 3GT4A 1KIMA 3SYRA 4IXNA 3HBLA 4IFIA 3CISA 4FN5A 4Z3DA 3DDSA 4EHDA 4JVMA 5FYQA 3RTCA 4EELA 2JAPA 2A9OA 3TLKA 4R1PA 1JJ7A 4TMYA 3RJMA 1LI7A 5GM2A 3ZHYA 1QFYA 1NZFA 3KZKA 3K0SA 3O92A 1GVNB 1VBKA 3OECA 4R8LA 3FDFA 3ETNA 4KDRA 4OHBA 1JALA 1QU3A 2C2MA 3RHZA 2H1SA 1DCFA 2B8TA 2X8JA 3RYFA 1UAAA 3GFGA 2FSSA 5BYAA 3HCDA 3WB2A 3B5EA 3I9FA 2GK3A 2JVKA 3HB4X 2AQ8A 1OROA 2BZGA 1I2CA 3GAMA 3L4EA 3FIJA 1TJPB 2OT3B 2AQKA 4PC2A 3R9XB 4TX1A 1IOZA 2ODEA 2RJ3A 4JROA 1DV2A 4HJRA 1QKIA 4I55B 3QY9A 4NS4A 4WJZA 3EVNA 3FXAA 4GVLA 4WV3A 4ZOBA 3GDHA 2D1TA 2Z08A 4YMSA 1WCIB 3G8YA 3DV9A 4DQVA 3TQSA 2IPOA 1S6YA 2TMKA 3LL7A 1T36A 3KZNA 3DC2A 4KG7A 4MVJE 4DCMA 1E1DA 1JYEA 5JTTA 3FOEC 4FYYA 5FO0A 3R9WA 3ED5A 2V6IA 5CFLA 4QTXA 1OX4B 2P9TA 2Q50A 1Q5PA 2O2HA 2Q5LA 3IJEB 3M1LA 1GRNA 4FX5A 4B76A 1RZVA 3W4JA 3O8LA 5KYUA 2XKJE 1ZM3A 1PJZA 3NBUA 1Z3IX 5HBRA 4EF6A 4EK9A 4Y6OA 1F5NA 5CAEA 2EBFX 4JLUA 3W8EA 5KOJA 3WWEA 1HEUA 3THRA 1TJ3A 1E5VA 4OFBA 3WWDA 5FI5A 2J09A 1R8SA 2QRLA 3CR7A 3N2KB 3MS2A 4YTEA 1YCFA 3D4LA 5FHQA 4DLUA 1QANA 3KUXA 4Q9DA 5FL7D 2FZLA 1SQSA 1ORDA 2WNHA 3IC5A 2FP3A 4MQUA 4Q82A 4Y1EA 3EGDB 4YMTA 3EJ6A 3EE6A 4KV9A 5AI6A 4BMSA 2EFYA 3V9AA 4RVUA 2IC5A 3HMQA 2ZRBA 4RPGA 1KRWA 5K0TA 1WU8A 2PWAA 1KY5A 1OVMA 3MCTA 4LWOA 5I9IA 4WAUA 1N78A 3RFXA 4CBVA 4J0FA 4KPEC 2BHLA 4TLLB 3PYMA 3TZHA 4F4JA 3VPXA 2DERA 3EGWA 3BB4A 5DLPA 5CCDA 1X7HA 4U5QA 1SUWA 4A36A 3MWJA 3UJNA 2H85A 3C8HA 2PL3A 2BSAA 1LPOA 3DWEX 2H2DA 1I2BA 1U8AA 2IY7A 1LU9A 1XYVA 1I0IA 3GGCA 1XD2A 1MZVA 5C8YB 4BOYA 1SPBS 1ZM7A 2H2AA 1W25A 4JI3B 3V3KA 4MV8A 2IU4A 1CVLA 1VI5A 2AWNA 4JJAA 4IIGA 1W0JD 1Y7LA 5K4HA 3U2QA 1JG6A 3FRIA 3MWFA 4V24A 3A9RA 3WL5A 4NCBA 1E9CA 3PEEA 5BR8B 2V54A 3EDOA 3IIJA 4K0RA 3HKEB 1V8FA 1S7CA 1JBEA 1UZLA 5I4CA 3N6XA 5KSWB 4KYUA 4F38A 1UKYA 4RSRA 1L4HA 4P7BA 1O95D 1XAJA 1XT6A 3SJAA 5JOQA 2XF8A 1F38A 2M9MA 3TIIA 3EXEB 5B4TA 1WZEA 3ROMA 2JH3A 1Y3AA 3EFOA 4M1ZA 2WJWA 3DLBA 1V1JA 2XMRA 4S12A 1UBNA 2M32A 1EVEA 2ZUUA 4M8KA 1XXLA 3Q98A 2RC6A 4MCHA 5JZOA 4Y9TA 3TTXA 1BXRB 4E2ZA 1H8HA 1QFJA 3KKKA 4KJZA 4J0JA 4GVXA 2HK7A 5JCJA 4MVJH 2DFVA 3PQEA 4LC1A 3I2GA 3KXLA 1G5HA 3TFWA 1OPXA 3FA2A 2IZ5A 4OIFA 4DJEC 3PUJA 1M2WA 1K1EA 3QTBA 2CYCA 3RUAA 4AJJA 5KU1A 1P44A 1WPXA 2G28A 3ELDA 3KZCA 3N8IA 5D00A 5DXAA 3WGOA 4AJOA 2MMGA 5HMLA 3RAPR 2VJKA 4DREA 2BGUA 1PT9A 3GCWA 1E32A 4QBTA 2YHBA 1ESMA 1SHKA 4MIYA 4ETMA 5BV2P 1UBKS 3A3OA 4O63O 2J6IA 3LUBA 2FN8A 2O5VA 3QK7A 5K3FA 3FDZA 1TE2A 3JWIA 3C3AA 4R6WA 5T3YA 4BO0A 2ZAOA 1ZXXA 3O8CA 2VHZA 1T5TA 1W4ZA 4PANA 3IUJA 1H22A 1OH6A 5IFKA 5KVQA 4YMIA 3WOVA 4KMRA 1RYZA 2DQ4A 3A3PA 3NHBA 4GOJA 1FRQA 5CD9A 1ODTC 1GCIA 2X3YA 2VT7A 4EPYA 2E48A 2H7YA 4L2IB 1QVRA 1ZGZA 3V32A 3FE2A 5PNTA 3N5CA 4KQFA 3BD9A 3AVYA 2D8MA 1DRKA 5TMBA 2TYSB 4MVJI 4F85A 2ANCA 3TLAA 3VTKA 2CN1A 2K87A 1IZZA 3D5QA 4IIBA 5EJ6A 3ZI4A 1IBSA 2CNDA 1SKYB 3FVVA 3IVRA 2HQSA 5JSKA 3UHOA 3R6DA 3CTMA 3OHMA 2VH5R 4S1TA 3R7WA 4JBIA 4ZJPA 1QQTA 1A9OA 1QXSA 1J20A 2FE1A 3KSMA 5AXDA 1RAGA 2O8EB 3FNFA 3IELA 1AUQA 2B0JA 2DE0X 3E53A 3DQZA 5JE8A 1ISPA 1JTVA 5T5QA 4BQOA 2WT8A 5T67A 2QUJA 1CY1A 4B87A 2X7XA 3ACCA 3I8OA 2ZP1A 3N7AA 2YWHA 3AHDA 3OCWA 1Z08A 4OGWA 4N7MA 3Q3CA 3QBDA 5JXIA 5TXGA 4RZQA 1CS0A 3ICPA 3BFPA 4YAGA 3CN7A 4R2IA 3I0NA 3FAKA 1TGVA 1Z83A 3U6BA 3UMYA 1WPRA 2PH1A 1GWNA 4G4SO 5H3LA 5JFOA 2F00A 1UP6A 2WZCA 3D6AA 2XQFA 1R1DA 3EZ9A 4OHUA 1X74A 3RTAA 3O4IA 2AC4A 2QK4A 2PQ2A 4IJVA 3LBIA 1E3WA 1IXSB 3GVXA 4J1TC 2Z2YA 3E3MA 1E99A 4OHVA 2ONKA 4AXXA 5JCOA 4DNPA 4R2HA 5CB4F 4MVJD 3SXJA 5EKDA 3WMRA 4S1PA 3OJLA 1VPEA 4QOSA 4PO8A 1UZAA 4L76A 4KV7A 1XMPA 1SOMA 2PL1A 3U4QB 2A57A 2NX2A 4XDYA 2OESA 4CV3A 1L5ZA 1FFEA 4BEVA 4JLAA 3DEYX 3PT9A 2AS0A 3ZY2A 2LGJA 5BRAA 2CLDX 2Q3LA 2YCLA 3KV3O 3E9NA 1KYTA 1KAHA 4MITA 5TB5A 5G4KA 3ZC3A 4GR5A 2POQX 4EFNA 5LU8A 2OBYA 1Z2EA 4CMJA 1RACA 4KH0A 1UL1X 5JCPA 3LUPA 3SQWA 3OY7A 5DF1A 2W58A 2PLFA 2WSLA 3CURA 4LYGA 5ESDA 1ZC3A 5EERA 3HSKA 3VH1A 1K4MA 3ZLTA 4V3CA 4F4FA 3DFIA 3NKFA 3BL5A 1VG0B 3M6VA 3ZV4A 1EVLA 1X9HA 2J3HA 2X8BA 4BEBA 1RKUA 2A9JA 1J5XA 5AJUA 3FBWA 5L3SA 1GQFA 2QJRA 2ENWA 3WQBA 4OQZA 5FQOA 1MEOA 1ZITA 1RI4A 2IKQA 2IZ1A 5TS2A 3TL2A 3KEOA 4NZ9A 2AJTA 3TZBA 3CA8A 5JRZA 4BFWA 1KS9A 5KNDA 1B0ZA 2IZZA 3D4OA 1ADFA 4NH4A 3OQIA 4TQGA 3C6BA 3LRXA 4XUCA 2ES4A 2H18A 2ACEA 5HUQA 2WEKA 1QUEA 1R50A 5BN1A 1BXGA 1J6UA 1YA6A 2D7DA 3HZRA 4EGAA 2B83A 4HWPA 4WZAB 1N6RA 4AQDA 1IY8A 1G63A 4IAOA 2GFHA 2JAWA 2X8WA 1JG4A 4FMPA 1QQAA 4YHHB 1TMYA 3AR7A 2AN4A 2OM6A 4TMZA 2Z6VA 1Y1SA 5KCMA 1GKYA 1Z0AA 2NAPA 4L7VA 1DGQA 3G8DA 1NYQA 3ITEA 3C2QA 4IDDA 4I6GA 1QP4A 4C7OA 1EGAA 3UWPA 1U2ZA 1HFKA 3JQBA 1AKVA 1TTPB 5CPBA 2C7OA 4A6DA 2C77A 3GMIA 3N59A 3ZVNA 1BCRA 1IRXA 2R25B 2X7HA 1C4XA 1GQRA 3QUTA 4OLJA 2ZITA 2IH4A 3LDAA 1QVWA 1JVBA 3VR6H 1KJWA 1QIDA 1X1CA 3F98A 4WXMA 5FWYA 2VEDA 2XMDA 3AVQA 4Z4IA 2X9VA 5JJ5A 3ZWMA 1TLFA 3N8NA 5CIQA 2B3DA 4OMDA 2VAVA 2C2YA 2CUKA 1OZ0A 1T0IA 2YVKA 3B38A 1LEHA 2AG5A 3PNKA 4NF2A 1KI8A 4YV1A 4FGLA 1A72A 1V11B 3E22A 3P9YA 3AH8A 3K9CA 3LX4A 3ZNNA 1W6RA 1MC5A 2OYSA 4MCAA 4IDEA 5A4JA 2YH2A 3KZ1E 1I3MA 1VZ2A 3BWVA 3WYBA 5MFZA 1DXHA 3L6RA 4D45A 3H3XA 3S5UA 5AVYA 1BQ3A 2J41A 2EZ8A 2BEKA 4V0MA 2AEMA 4OF4A 2XAAA 3QE0A 3VZCA 1ORIA 1H6DA 3TAHA 1CQZA 4CJXA 2PLNA 4ND7A 5EE0A 1M0SA 4OG2A 3L01A 4PYRA 3ZTTA 2FF5A 4IRUB 2GN9A 1RQLA 2QSZA 1C7FA 2I2FA 1OH8A 1M2EA 1WCV1 1P81A 4P54A 4AX8A 3B9BA 3K0HA 3PWZA 1ZJYA 2QMQA 2WTAA 4MKXA 4WXHA 2CJWB 1PT8A 3TW0A 3HH8A 5JO0A 3CLRD 1QOPB 3PCRB 2VPXA 5AHWA 1HTBA 4YT8A 4KP7A 3NAZA 4MVJF 1IONA 4E5VA 4R71A 3LW8A 5LQRA 4IGIA 3M2PA 4Y9RA 2IYRA 2PQ6A 3SZRA 3PX7A 3WTBA 2G0TA 1DS6A 4C08A 4EHLA 5I7VA 2QTHA 1EXVA 4TVSA 1H0KA 1PNTA 4ZKEA 1JN0A 1M6YA 2ZJ7A 3NIDB 1A2QA 4B71A 4NCAA 2X9GA 2GN6A 4TV8A 1DP4A 5EPUA 3WNVA 2R8OA 4DCGA 5KQPA 1XZGA 2CFOA 2WJZB 3C3KA 1OZAA 2XWQA 1Q57A 1ABEA 1XHFA 2CMDA 4IGFA 4INAA 4UQOA 2FA9A 2WSYB 4G01B 1UPFA 1ZOPA 2NSHA 3C15C 4IYRA 4LJAA 2QQGA 1HLPA 1PG5A 3I83A 1BIFA 1N34B 4A6XA 4CIVA 3U9LA 1C1HA 3RVLA 3PFHA 5AJYA 4H6WA 1YT5A 3MJDA 3T06B 2J4DA 3QVWA 4OI1A 4CKBA 1ISJA 2XITA 4WFQA 5EWLA 2UUPA 5IP5A 1PS9A 3O4RA 3H2ZA 3RUDA 3DBRB 3JV7A 3K8ZA 1COZA 3FSGA 4KGVA 1AIPA 2XBUA 3UM9A 3OM0A 3VKFA 4LJ4A 4R81A 3EEYA 3K09C 1U8YA 4WZAE 1YRYE 1H4SA 5BYJA 1FRNA 1HYEA 5KOHB 1QYVA 1XQ9A 1BDJA 2RB4A 1Y8QB 5FP0A 1J09A 1GZVA 5EOVA 2OZEA 3EVFA 2ZZNA 1ZOIA 1U5BA 2XTAA 4ACBA 1ZIPA 5ALRA 1JLMA 3IKLA 3E18A 2R1UA 5E7QA 2NVOA 3EAQA 3Q3JB 2PZBA 5KYXA 1U2DC 5K8VA 2O2ZA 4H9GA 1AF4A 4Z9BA 1EVZA 5CA0F 5JSZA 3PICA 1FLAA 2GPSA 1V26A 1Z0KA 4PNZA 1XAHA 1H2XA 2CF6A 1IH8A 4BTVA 5CFPA 2YS6A 4PHGA 3GVHA 2C2ZA 4FGZA 3KG2A 1A9RA 3V9PA 2VDRB 2E89A 3GH1A 3ZN2A 4BKQA 1LWNA 4LE0A 3W3ZB 4YONB 1NJ8A 1WMDA 5ALFA 4D41A 3BCRA 4C0AC 3B1ZA 4GBJA 3LHSA 4YRPA 5KYWA 4GU5A 3RT1A 3FLBA 1Z6GA 2QEQA 3QXXA 2JIBA 3OSUA 4ZT4A 4B79A 3JAWB 2ZJAA 2QAGA 2YY6A 4JR0A 4ZYTA 3AL0C 4FYKA 4XX0A 4F1JA 3QA3E 2P75A 1E6KA 4MLPA 3KTDA 4GE3A 1Z4LA 2QMOA 3N28A 1HDGO 4RPHA 4BB0A 3BXZA 4F11A 2OBNA 4EY7A 1FW8A 1I7PA 3E7XA 4KXQA 3KL2A 3LSTA 3OJEA 2EX0A 1X1SA 2NXJA 3NU1A 4HGRA 1Z0UA 2G40A 3O38A 2ZGVA 4CLXA 1VJDA 1XLTA 2IW1A 3IS3A 5I3CA 4IVQA 3PEWA 3QGMA 2WV9A 4CE6A 1C80A 1Z38A 3WXBA 2UXDB 4DVGA 1QWOA 4G0YA 1SHZA 4FNAA 5DI3B 1W96A 2HPVA 3F9RA 1UKCA 1IJEA 2QX6A 5DBOA 4DM3A 1P75A 1ZNZA 4E5KA 5IUKC 1HQKA 1I14A 1XRLA 2PUJA 2YNMC 3MQ4A 1R5OA 4C6HA 4CM3A 5LPNA 1E3MA 3W1WA 2CNBA 2O7NA 4BVFA 4AZSA 2BHTA 4PAWA 3RU7A 4BFUA 4DGSA 4P4TA 2ZRFA 3A9WA 1EDBA 3AXTA 3QVTA 2P7IA 4WXPA 1VYUA 2GN0A 2AW5A 4HLUA 1TZBA 4TWZA 4M54A 5EZYF 1T3GA 3VZBA 3ZUPA 1QUFA 1W94A 4IDGA 3RVRA 1A76A 2GASA 4Z8YA 5A6VA 1U7OA 4HPXB 4M53A 2C83A 2WPNA 2O1WA 2R96A 4R3UC 1Q1ZA 2GD6A 4AF8A 3VJKA 1RWNA 3JAKA 1FTYA 4PGAA 3A6LA 1V6CA 1CQJA 3CLTC 3MTQA 4JJEA 4ZT2A 1A98A 1SUCA 3AYZB 5JEDA 1ECGA 4JL6A 5C37A 3E48A 3AFHA 3K8QA 3FJYA 1N8NA 1QIMA 4FFBA 4D7AA 2P40A 1A5TA 2V7PA 2ZRJA 2P2ZA 2XDYA 4HWGA 5IKOA 1KQFA 1I7LA 1EFUA 5BRJA 1SHJA 5IANA 2X0FA 1QLHA 4FSHA 5JT1A 2XUZA 3NBXX 3RVBA 2O8CB 3VHXB 1FSZA 3TB6A 1M8KA 1Z8NA 4G41A 4D5GA 1NJ6A 3GLFA 2IZ6A 1LX6A 1AKMA 3QEOA 3QXSA 1YC5A 4AJNA 3M49A 5EHXA 3K9FC 4EHHA 1ZK0A 1KEVA 4JXXA 3LLMA 4L5JA 3UPUA 5IZCA 5CIWA 4GOOD 4GX2A 4W1RA 2Q4OA 1OZFA 4Y7CA 1WAMA 3Q7PA 1JMKC 3MWLA 3EARA 1U1IA 3UJ8A 4PXSA 5DEOA 3RVOA 1CIVA 1H2YA 3HVIA 4R2KA 3WMWA 2X7JA 1JU4A 3FTDA 3BGDA 3UHJA 3ZTYA 3ZQJA 2V7BA 2X0IA 3IAAA 2I4LA 5K0CA 1D4OA 2D0IA 4KPUA 4DQUA 1HTWA 4HS9A 4E3WA 4HNVA 3GRZA 3OOSA 3F9CA 1ESNA 2NYVA 4XASA 1XEXA 3DZIA 4JMPA 4YBZA 3TLYA 1SG0A 4FOOA 3S1SA 2WIGA 3PQ4A 3FSJX 3QENA 4IDBA 1UWCA 3EVEA 4FZ5A 4WVFA 5KTTA 3QX9A 1EUQA 4X94A 4GQIA 1DC4A 5IK2A 3KB6A 5AW8A 1Z4QA 4F84A 2BHNA 1GYRA 1XFAA 3DFKA 1Y34E 2J9RA 4D4LA 3UFXB 1U9YA 2CYBA 3TPZA 4M60A 4D3ZA 1JXMA 1JDVA 3H9CA 5K01A 4DJAA 2NU8B 1YBVA 3KL4A 1I4TD 4JBYA 2VP6A 4TRMA 4P80A 1OTHA 4KYIB 4AF7A 4XX1A 4DM7A 4QRIA 4TXJA 1BKDR 3P4XA 1ZRSA 3TBKA 3LXXA 4TUYA 3H8VA 2F8TA 4FEAA 4Q3NA 3LHIA 2BFEB 1CT9A 4M1TA 2XZTA 4GS5A 4FBGA 2I7CA 2RSLA 1NLZA 3PI6A 4KZKA 1AQJA 2ZTLA 1ZSNA 3KT8A 1OWPA 5DX1A 4Q4HA 5EJ7A 4ZVPA 1F0PA 1UT5A 3UFBA 1PHRA 4I5EA 3NR2A 3A4NA 4N0QA 2VDJA 4YECA 1IY0A 3H8WA 5TEVA 3GLIE 1YJ5A 1TD1A 3LKDA 5GWXA 1XK7A 3N2IA 1L4BA 1GN9A 4QOIA 1ST2A 3OAAA 3C39A 1I2ZA 4PAOA 5DE3A 1G2QA 3D64A 3ETDA 2X8AA 3QI2A 3OZVA 4PNPA 4EMTA 1YF3A 1QRUA 1VMAA 3PFBA 3IALA 3HL4A 3V8MA 2VT2A 1G8PA 3M82A 2TMYA 1K0FA 4XAQA 4KB5A 2JFPA 5EIBC 2CYAA 3TZCA 1G7RA 1YXMA 5H70A 2RGEA 1RJDA 2F43A 5FCDA 2ZM5A 3MPOA 3KUKA 2YQZA 1JDBB 3AZPA 1P74A 5CYGA 3HG7A 4KXVA 1VL2A 4AK9A 4E5PA 2DT8A 5AKZA 3F5SA 3DF9A 1H3NA 3A2LA 3GP5A 3MHPA 1UQTA 1YVPA 2NZWA 2J4CA 5BWBA 4UHDA 1M66A 3W5UA 1E1KA 2CLMB 4ZAWA 1ZOOA 1RI1A 3RYIA 5LOVB 2ZCJA 3D02A 2AJDA 4E4YA 4I4LA 4TKVA 4MR7A 4PZPA 3LTNC 3RUCA 3IAS6 1BAPA 1QYRA 3QQPA 4Z99A 4WBXC 3TEFA 3ZDDA 1R6DA 1A4IA 1YDHA 2IWHA 1YBAA 4BMOB 2BGLA 3HVRA 1V9CA 1VLLA 1J8YF 1XQYA 1KS2A 2JLYA 1GILA 3A11A 5IG2A 4LRSB 2BFNA 1RAIA 1VLMA 1WW2A 3ZS9A 2W83A 1M7GA 1O57A 4E08A 1R0XA 4FMDF 2V5AA 3AOGA 1CWUA 3G2MA 5E1BA 3RS3A 4P9NA 2VWHA 1NQUA 4HH0A 4D44A 1SK9A 2R3SA 1H1TA 3U80A 1CB0A 3M83A 3DWIA 3DV0A 1SQFA 4KI0A 4QPCA 2Q3DA 1DO2A 1IG0A 2JFZA 4HXGA 4IQFA 4QUGA 3SSNA 4C4TA 2QW8A 1D7AA 1SN7A 1FFDA 2H4XA 1KMQA 3BGIA 3G9XA 1YFZA 4QC2A 4F93B 4KC0A 4FOSA 4F46A 2IHYA 1JG2A 2UU9B 2ATIA 2VXOA 3H2GA 3ISVA 4CW7A 4LOHA 2VCHA 4ZT6A 2C4WA 3ITDA 2X8JB 4IY1A 3PKZA 3RYFB 4GKJB 3AYXB 4RGQA 1EYZA 3V55A 2WHRA 1ODIA 1ADJA 1QPGA 2B37A 2GETA 2ZFUA 5DYYA 1EP9A 1QBGA 4QPZA 3EGXB 2J67A 4PG8A 4IICA 4Q3OA 1E1CB 4IP0A 5H0IA 2Z2ZA 3E7WA 4M21A 3VVBA 5HS4A 3F6BX 4RHYA 3T95A 5AOBA 4BLPA 5C53B 5TVGA 3ETJA 4YJ2A 3MCZA 1YAJA 2A7QA 1UJMA 4L8WB 4D6XA 2HRCA 3IP8A 4GKAA 2AB0A 3LX6A 5LIPA 1X7DA 1SC9A 4PO1A 1F48A 4N54A 2P6NA 3ZGYA 5GOZA 3C8UA 3D8NA 1FPMA 3OJ0A 1FYEA 4MYCA 2ZOSA 1OX4A 1M54A 2LE0A 3BFXA 3C24A 2J0UA 1JS1X 2V7XA 1OXVA 3AF0A 1XDZA 4X61A 3T1OA 3A7EA 3I52A 4GXQA 3VZQA 5HP4A 2WUVA 1FXWF 1THMA 3WYNA 2QNRA 3HI4A 4MQFA 1H66A 3TM5A 3T5TA 2DFKB 4OGGA 1WRBA 1UJ6A 2JGDB 2V3WA 2QRHA 5TGZA 1W29A 1FTSA 1N3IA 2RGCA 2VYVA 3LT2A 2FEKA 3A1VA 4F56A 2YHIA 4BX0A 4JSRA 1L5HB 1ZK2A 3AQ4A 4LEIA 3SBOA 2C4TA 3GJXC 4DDUA 5K5EA 4DB4A 2PMCA 1L8QA 3O75A 3TVDA 1KH3A 3EGDA 3UOAB 4BNXA 3F6SA 3H2SA 3LQ4A 4KO8A 2QGFA 1XJ5A 2PKYX 1XQXA 4CHTA 2OCXA 4QJ3A 3U6KA 1L4MA 1ZJ5A 1UFRA 2V65A 1DAFA 3CX3A 3G7NA 1Q91A 4YFVA 1W9MA 3V80A 2H17A 2V98A 3GQBB 4UNQA 3GN2A 2F4NA 2PJUA 3W8DA 2JA1A 1BN7A 2Y1CA 3Q0IA 3F9IA 4ZTUB 3VR1A 5EEHA 3IJPA 1E5QA 3R7AA 3WGLA 5HKOA 1USGA 4MQMA 3GBSA 3J7TA 1T5SA 1VJ5A 1B1AA 3JZDA 1BKYA 1XQ6A 3OBBA 4ETWA 2X1VA 1JHVA 3UK0A 4YRJA 3ULKA 4DEYA 1R0WA 5IU6A 3DVAA 4Z0TA 1XI2A 1TM2A 2O1SA 1SXGA 1XD8A 3D1JA 1MX3A 2V97A 3STYA 2XVYA 1OLUB 2O2IA 4Q9IA 3HFJA 2JFOA 2POCA 3DEFA 4FYMA 2FPUA 4YJFB 5IDVA 5BO5A 4Z54A 3CUSA 1GPDG 3V4OA 4G9EA 5LQJA 5I9NA 4UU7A 5KVAA 5KQSA 2R00A 1VHTA 2IHBA 1U31A 1XZLA 3BE4A 5AFSA 1A8HA 1KJ8A 1V7QA 2IA5A 3ET4A 3U26A 3KVOA 4G0NA 1C7EA 2SICE 1BRTA 4ISCA 2EX4A 3STHA 1G4HA 1L7DA 1Y63A 2V0NA 3CNQS 4LX0A 3EZFA 2ZUFA 1T9BA 2AT1A 1B41A 4U2GA 1G18A 2XJ4A 1CUHA 3NATA 4PCLA 3VI4B 1DKMA 3ABIA 4N6GA 1CZOA 1S2NA 4P34A 5CVTA 1G98A 1E3LA 1M2OB 1VG9B 1XZIA 4HFMA 4OATA 4BJ3A 3JQ9A 4JUAA 1E9RA 1AV6A 4GM1A 1U7WA 3O8OB 1SCJA 1DNPA 4LX8A 5KNDD 3HYCA 5C80A 1L7OA 2ZYWX 1PBTA 1BVRA 2AJLI 4TL9A 1JHQA 3ZJYA 2Z57A 4EZIA 3J80A 2HJRA 3CRVA 3NMUF 3LKBA 1OAAA 1BS9A 3PXEA 3SSAA 3VZPA 3WDMA 1Q77A 3K0EA 3ZHTA 2HK8A 3HXMA 3TN7A 4P7KA 3KWLA 3I58A 3JQFC 4BMPB 4BQQA 3CB4A 4DADA 1K66A 3UATA 5KUTA 4OI2A 1J0BA 3EH1A 5C2JB 1B6TA 3CRMA 1RLJA 2IS4A 2OBFA 2GJKA 3C5WP 4FXPA 1TUIA 1AQLA 3IAM1 4B34A 2G8LA 5KWJA 1KI7A 2IXAA 4GSYA 3V46A 4ZI3A 2YY7A 4C04A 2VJOA 4RUKA 3A1FA 1NBHA 2C07A 3L4SO 4LHYA 4DG5A 1HQCA 3RQSA 4BBZA 1JSXA 3IT1A 1V25A 3S2FA 1FUIA 2PWYA 3A6GA 3EXIB 5AK5A 4M6WB 2Q8QA 4YS6A 5REQA 3U7EB 1Q19A 3RFTA 4X93A 3CW2A 1O0BA 4RYDA 3B20A 3ADOA 1IE3A 4D42A 2VHQA 5A71A 3GH3A 1SBQA 1ZUD1 2XUHA 1PYOA 2P9HA 3AR4A 4RV9A 4F4CA 3RWMB 4YRRA 1M6EX 2QLMA 1QOQB 2A0YA 3I34X 3R3YA 5H02A 3WICA 4FHGA 2PUBA 2YN4A 3S2UA 1IU9A 2HWYA 4EKIA 1HE3A 2ZTUA 3MT7A 3R3WA 1R4ZA 4KFRA 4PCUA 5ALNA 4C76A 4PV7A 4KNYA 16PKA 3RKSA 2R1TA 2V8BA 2XQGA 4NEHB 4RD4A 2VTBA 1GNTA 3R09A 3HK2A 3PA6A 2ZS8A 5TF0A 2YXNA 3T9AA 1UUFA 3QE2A 5ECWA 3OZUA 2FXIA 3DO5A 4MEJA 3W7BA 1TM3E 5AVSA 3T5BA 3EF0A 3SLGA 5KB3A 4BV9A 1O95C 2LPMA 3KS9A 1YKGA 4PX3A 3Q7QA 5THKA 1UEJA 4ALMA 3LG2A 5ENVA 1KERA 1L3CA 2AJ8A 2ZJ4A 4RK5A 5DN6D 1AXGA 1VPLA 4PZYA 4EYQA 3H86A 3TL6A 4DR7B 3DE6X 3FUXA 4YWHA 2C92A 3VNAA 2O0KA 3MSXA 3P2JA 1NF3A 1U8EA 2C1ZA 5A4DA 3INGA 2BUBA 4WL0A 1WU7A 2VP0A 3BVPA 1O3YA 1Y1TA 2I76A 4D4KA 1NN3A 4W5NA 3VNVA 5J9FA 1XTSA 2XMCA 4RKFA 1UMCA 3DOIA 5KX5F 4YRQA 2RI0A 1Z5GA 4ZFNA 3OHPA 3FCAA 4H7DA 4LYEA 2XADA 3GFBA 2PKWA 1AF7A 3CF6R 1IRIA 5FDFA 3CY6A 4ZZ3A 2FW6A 3O0DA 3C70A 4J6EA 4PFJA 5EMKA 3H0KA 4RSMA 3AXSA 4JC4A 3RTBA 4URWR 4MKGA 4MP3A 1BG6A 3N2KA 4BV8A 4M8LA 2FPIB 2OV4A 4IL5A 3HO8A 1GNLA 1FTNA 1DXYA 2R7KA 3UMBA 3VZSA 3ZGLA 1AKTA 4C06A 3GLHB 2F8LA 5JS8A 3O94A 4TM7A 5FPSA 3FYUC 3O83A 5AOVA 3AI1A 4F9FA 4AKIA 1KO8A 1F2UB 2IZOA 3QYJA 2CV2A 3EHDA 4ZK2A 1YQEA 3PQ7A 4MV1A 1SULA 4BCDA 4RVGA 4X7PA 4D74A 1GUAA 4MV6A 3PV0A 4NLLA 1JX6A 3ZJUA 3COZA 1ZO8A 1WB9A 5IBPA 1G20B 1GZ4A 2BBWA 3VU9B 3DAHA 2FN4A 1V43A 4M9SA 5FBHA 3AR6A 3HBFA 4BFLA 1JJVA 2QXTA 2VLBA 1W4AA 5C5DA 1VHDA 4RMNA 2UYHA 3QVJA 2OD2A 2GXUA 1XO1A 4Y2PA 4RBNA 3DZGA 3DYVA 1EFHA 1GJRA 4E4RA 3JVUA 2P8SA 3ZLJA 4X1IA 3O73A 2O0LA 1DRUA 3DSRA 3RBVA 5F5LA 3B7GA 3H04A 4MA0A 4FFDA 3WWOA 1VBNA 3HL0A 2BGWA 5FWYB 4UNNA 2P2DA 1V2HE 1TYAE 2ZVDA 3C1AA 2COKA 3ROZA 4AJ9A 1ES9A 1QFZA 2FSIA 3GMTA 4OHPA 2BH2A 1GRVA 1GFIA 3VQTA 3IKTA 3I6MA 2V7QA 1NNSA 4TMTA 3HJUA 1OU0A 5BSVA 2I6QA 5K03A 3VJRA 1U2QA 2YJ5A 1J7KA 2O23A 4XI9A 1LBTA 2ZTSA 2C78A 4AKTA 2NVWA 4HZUB 3OT5A 3CR3C 5FQNA 3RYHA 4ZI7B 4HXFB 1ZYUA 4NYMQ 1ICEA 2JLXA 1RRKA 1XEAA 2WWVD 1WSDA 3R6GA 2G5TA 3F3MA 4KQMA 5DT2A 5FOWA 3WRWA 2PRJA 1ULZA 1KBOA 3MQFA 2ZCUA 1I1HA 3WL8A 2HL6A 2FLKA 4G5HA 6ABPA 2PT5A 1B1CA 2OE2A 1R10A 3DFMA 3RI3A 3THXA 1MA0A 1E3IA 1N5MA 2VJNA 2NIPA 4U7JA 4HNUA 2C04A 3PC6A 1XVIA 3EFBA 2G9ZA 2IOFA 1CRPA 2CBZA 4M98A 4NYJQ 1ZAKA 1XRJA 5KTYA 1QPZA 1SG6A 1UK7A 3HFSA 1QTIA 3ZEAA 4B7AA 4BV3A 2G06A 3PE4A 4LHXA 6REQA 5DWVA 3K6KA 2D2EA 4QGAA 1TVKA 1JR3D 1IPEA 4YCDA 3Q85A 3GRKA 1E1NA 4X8HA 4Y8VA 5LVAA 2E4VA 2QXYA 3N0TA 1Z9BA 2IK8A 5AI4A 4LQ4A 1P6UA 4R5MA 1BWRA 5KPDA 3AJ9A 4D8YA 1ENPA 4UUQA 1CDDA 5I9TA 5LMNB 1U7XA 2HCJB 3E15A 1NU8A 5CAEB 3OFKA 4EOGA 2QM8A 1HC7A 4TKLA 5LYJA 4YV7A 5ADVA 4RULA 1HL7A 1YFJA 1A97A 1CSEE 2Y27A 4G0OA 5AI0A 3SZ3A 3WGQA 2FR8A 4EJFA 4BO6A 2R47A 3DKIA 3R5HA 1KSJA 3B36A 1PLJA 5FRDA 4CCAA 2X3FA 1AS2A 1LW6E 5F73A 4BNFA 5DYTA 3F8TA 4EW3A 4HGNA 5BT8A 1GCUA 4GP7A 1DKRA 3QVSA 1NGSA 5AHRA 2AKEA 2HO4A 4YP7A 3VPAA 5BYKA 4B0PA 1QP0A 1Q17A 3Q1LA 4DAOA 2H57A 1WD5A 4WGGA 1W59A 4F12A 3H5AA 1L5NA 3FF1A 2XI4A 1TZJA 3E58A 2O1EA 3R7WB 1OHHD 1WDLA 2A1TS 3PPYA 1JQ5A 4C30A 4CT4B 4HUQB 3Q12A 3T41A 2WF9A 1H5NA 2G17A 1QE5A 5J2UB 3KO8A 3KPVA 1KWGA 1KO1A 1T6NA 2NO7A 4GZ3A 2OQVA 2JKYA 2QLBA 3G0DA 3RIYA 2C2OA 3ZY4A 2O2XA 5ABPA 4RKYA 1W75A 1YCDA 2HRZA 4RJKA 5GJCA 2IZ7A 1T9ZA 1XMXA 3GDGA 1RR6A 2D2IA 4FT2A 3WG9A 1CS0B 3ZTWA 4UNPA 2PGDA 3ORYA 2UXCB 5EG5A 3T4XA 4Z4GA 1RQRA 3OOYA 4ZYVA 1BDIA 1AY0A 2QTRA 4ZCPA 5JLJA 4H1TA 2PGXA 1ZX1A 4QEKA 3ZWWA 4D0GA 5H9WA 3EIUA 1UOPA 2O50A 2OMKA 1QIEA 1DTEA 1R18A 2GZRA 2WU1A 1KZGB 1QHHA 1UM9A 3I01M 4KBGA 1D2GA 2DPMA 2EKQA 1V47A 3ENZA 1ZFNA 3FDJA 4TXHA 3Q2IA 4DBLC 1F7UA 4XDHA 1QHFA 3ICVA 4FYVA 2X1HA 1OASA 1FMJA 1WXXA 3E9RA 1TW2A 3HDTA 4JSYA 1NDQA 2CY0A 3ZZTA 3PQ5A 3KSZO 3FMIA 4QICA 5GZ3A 3ZHZA 1CUJA 2XNJA 4FXOA 2WD7B 2VDUE 4LHVA 1OH5A 3PUKA 4YWJA 4N0EA 4IHJB 2H7CA 3KQYA 1YD7A 2IV7A 1UJCA 1PUJA 3I9KA 3MLBA 1B14A 3UC5A 3LHFA 3CZMA 2YMQA 4BP3A 3IR5A 3LSYA 1I5OA 1R6BX 3G9TA 3QEJA 2HA6A 2J32A 4E6EA 4ND8B 5JJLA 3NQ41 3A2NA 4OUDB 4MWDA 5BVGA 1Q1GA 2GZ2A 3QU7A 1O8BA 3RJ5A 3TECE 3AJDA 3BRWD 1QRSA 4CODB 2UVDA 3WJ7A 3QHAA 3JAMA 2PH3A 2JBHA 4I5GA 4W9MC 3DB1A 2PMWB 4FD2A 1R9NA 1VE3A 5H16A 1M8JA 4BN5A 4A7PA 2A84A 2J45A 1DL5A 3GVIA 3SU8A 4PTZA 3OAAD 4QGBA 2DR0A 4YDSA 2I6UA 4MB6A 3VX3A 1USIA 4NNJA 4F71A 4DLVA 5LQDA 3IAXA 5KEIA 2JCGA 1PFGA 4HDRA 5AK4A 1EVJA 1Y9ZA 2E1PA 3OQPA 4KQJA 5HEKA 3WA6A 1ST3A 4BUCA 1ZONA 1W1WA 3IO3A 1R9JA 2GSDA 1RHMA 5ED4A 3SEFA 3KYJB 1CB7A 4Q9LA 4UPVA 1QQ5A 4JJIA 1TO6A 5ARCA 2GBPA 1Y4AE 3ZE7A 3GJZA 3ABZA 1ZINA 3DMGA 1P9OA 1DBVO 1E18A 4K40A 3VR6A 4YRZA 5GIOE 1FQWA 4BFSA 3BCSA 1EFAA 5AO9A 2H48A 5BXYA 1QJCA 4AP6A 1ISIA 5HKBA 5JZSA 2YQ5A 3LX5A 1RJFA 2CHGA 4HAUA 1FDVA 4XPZA 1J0CA 3B3AA 3DTVA 3ZWOA 3V8QA 1P73A 5E0OA 3KVNA 3P9IA 3FWYA 5H3HA 1NXWA 4RZIA 4BZWA 1A77A 2ZIGA 3RVJA 1XEFA 1RBQA 2Z2XA 1GSOA 3U49A 1V8PA 2XMZA 3CIOA 4M1QA 1VTKA 5JNUA 4ND1A 3RAJA 1OD6A 1P5JA 1TCBA 2XDAA 4H15A 5EIBD 2H4YA 5K20A 2WU0A 2PL5A 4QFCA 5ITWA 4B2LA 3H1BA 1YCGA 4N3GA 1QK5A 1WUTA 4HR7A 4PCAA 3MB8A 3IR7A 3UIEA 4GI1A 2VJAA 4XSGA 1FE8A 3KT6A 3VRHA 1Z6QA 2FMUA 3QEAZ 2OGZA 4WK4B 3X44A 3FUTA 1TTTA 3QH4A 4JYPA 1S89A 1A5SB 2H7XA 4PAMA 4Z9XA 1X42A 4RKQA 1FW6A 1XEXB 2C8KA 4UDOA 1BJKA 2QTVA 4E5SA 5G53C 3HB9A 4KN5A 3M2TA 1P4HA 4BN0A 1A7KA 2FN9A 3E3AA 4XGNA 1EMDA 2C5BA 1NPYA 4QBIA 4WZBB 3DT6A 3HO6A 4U6QA 2W4IA 2CHFA 3VHLB 2C5EA 3CBQA 3ML1A 4CUJA 2W4MA 3T4PA 2BP7B 2XOXA 2QR3A 2VJDA 2J3KA 3RBAA 3QKSB 2WIFA 4PF1A 4AZ3B 4NWIA 1Z5WA 1FYFA 1T3ZA 2WNIA 3VU3A 1JR6A 1VM6A 1GFZA 3C8ZA 5G4KB 3WKAA 1N7IA 3L8DA 2H1OA 2PX6A 1CDOA 3AM4A 3OMLA 5BP7A 3FUUA 3GJ0A 1GCOA 3ZW8A 3P9SA 1OX6A 4RLSA 4JT4A 2KYRA 2GD1O 2V5UA 1PT7A 5CUQA 4EG7A 5BSKA 3IV9A 4F60A 1A9YA 3CJRA 1DE0A 2GVDC 3SD7A 2BRUA 2P3SA 2ZUCA 4IG9A 4TT3A 4CF4A 2GERA 4AP9A 5AUNB 5HPYB 1Z7EA 3U3DA 1E5LA 2HJSA 3DP7A 2A1TR 4Z1MD 2W2KA 3USCS 1VB3A 3HCNA 3CTPA 3FHTA 2J4FA 3VDNB 1KEUA 2BCJQ 4PZZA 5A6SA 5EHNA 2W98A 4M7PA 2ZT5A 5HZMA 5JEEA 1A5BB 2IHJA 2P1ZA 4NU8X 3RIXA 4XFKA 1EDZA 5IXYA 1WXHA 3JSXA 3Q1KA 5DNEA 2GJ4A 5CYFA 4A2PA 3QLVA 2XRYA 3KEMA 4JYBA 5JPIA 3WHLA 1XIVA 4IIJF 4H77A 2DCUA 3GEIA 3W90A 3DMFA 5FBKA 2P6MA 2VNKA 1QP7A 4WZAA 2XYGA 1G41A 1GU1A 2ZYHA 4N1AA 4IS2A 4F1WA 3M6XA 2PUGA 3NTRA 2VHWA 3NIBA 1KVTA 2GTIA 3B48A 3CE9A 4OQYA 3V8BA 1ZESA 9ATCA 5A7HA 3QX3A 3I4CA 3ESRA 1XZDA 4QYIB 1CY2A 1SVMA 2KHZA 2Q29A 3PDHA 4L4RA 3VPHA 5HKKD 1ZJJA 3KHTA 1NR1A 4DMKA 3ZBQA 1GZSA 2ZE5A 1JI0A 2BOVA 2CF5A 1R4MA 2Y1EA 4RDIA 4X7BA 4IVRA 1QE0A 1W2HA 5FUWA 2DQYA 1FP4A 3PPWA 1KJQA 4HYYA 3IUQA 4EKGA 1C8KA 1GARA 2IY8A 1OXBB 4DR6B 3LH5A 1NKTA 4RYLA 3TLMA 3AONB 3NAMA 2NU7A 4O2AB 3IDOA 1IY1A 3KOZA 1OZGA 2O2SA 3DOEA 4M0UA 5KKNB 3QU4A 1W1IA 2DTXA 3FOFC 2BKXA 2Q5IA 2VSOA 4GNRA 2XB2A 4JCOA 3JAWA 3A2MA 4ZCMA 1VG8A 1W0CA 3NYWA 5ALIA 5FWXB 1NL3A 3M1YA 3UW1A 1PN3A 2PMBA 3MXOA 4RANA 1RHUA 1KAOA 3K0FB 2Z5LA 1KO7A 2JCBA 2RHGB 4LK2A 4ENPA 1OMOA 2CB0A 1NLMA 2GF9A 1X94A 3SFVA 4OJYA 2DUNA 1U0SY 1WIWA 2VA8A 1D0VA 2I7TA 4LPSA 3TQRA 2XA1A 4FFWA 3EPLA 2UXBB 1K75A 3BH7A 4M22A 4DQKA 3EC7A 4C07A 4ESEA 4F4IA 1SMKA 1SOWA 4NE7A 3KWJA 3JX9A 4LGVA 2OHXA 4V2IA 3GGSA 2I1LA 4LJ5A 3JTMA 1JYSA 1YDFA 4V0ME 1VBFA 1T1EA 2GEKA 4P3KA 1D4AA 1E1MA 2A5GA 5ED0A 2ZI9A 5CFMA 3F1KA 2QRMA 1I0ZA 3HO1A 4X6YA 4R16A 4B6FA 1NR5A 3UGQA 4V0OA 3EGXA 1H23A 2IEGA 3L4KA 3PSAA 2O9JA 4MWCA 4TLDA 1CQXA 2WHXA 3MJFA 3DEZA 1RI5A 2J9XB 5LB2A 1UZMA 3EFEA 5AI9A 5EGNA 1L5OA 2X41A 1M5RA 5JLAA 5F12A 1RMTA 3BSSA 1C1DA 4I08A 2O0HA 3EIXA 3TKLA 2ZI7A 5FUVA 3S2SA 4I9UA 1Y3FE 1YQUA 1H5UA 2VI5A 4HRYA 5L6LB 4IIJA 4RK7A 4XR9A 4DLLA 1TUGA 2C2WA 4Q4CA 2PZAA 3BE6A 3AR9A 2IYQA 2J0UB 3I4FA 1D6JA 5CX1B 1U2EA 1Y8ZA 1E9FA 3TEMA 3WK8A 1LLUA 3H9GA 3RKUA 2AFVA 5L3QB 3KHUA 2JFQA 2TECE 5T4EA 4OD0A 3KR0A 5CDHA 2XNDA 5JS2A 2QPLA 2G82A 2RGRA 2R65A 4RENA 1XTIA 3RRFA 2BKLA 4EIWA 1BYUA 2IIQA 5AOCA 2CZQA 1ZBQA 3AHEA 1EM8A 2C97A 2RHMA 4IJWA 4J2TA 3JQ7A 3CG4A 3H0EA 1KFBB 4HI0E 4OP3A 4PX2A 1E66A 2ZI5A 3S55A 4DQLA 2IBTA 5CFNA 4P0QB 3HBNA 1RRPA 3L7MA 2E4ZA 4WLOA 5A4FS 1ZIDA 4IHQA 3BICA 1R6TA 2IYAA 2OBXA 3EG9B 3L4BA 1NT4A 4TTRA 3UBTA 3PG5A 3M81A 4RWZA 2E0IA 1J24A 1NJ1A 1W76A 4M1EA 3GQBA 1FP7A 1ODJA 5EIHA 2A1UB 5TMPA 2LP4Y 1ONPA 3UT5B 1YVRA 3FDIA 5TQ2B 3W9SA 4XVUA 4DV1B 5E9QA 3GJYA 3OIUA 3P20A 5IW8A 4AJLA 3OTOB 2Y0PA 2REOA 3UICA 2B1JA 3D8SA 4QBKA 1WF6A 3N39C 3M4ZA 1K7CA 4ZANA 4Z1MA 5FBRB 3UYKA 3QY0A 2RC5A 2ZIEA 4Y6RA 5JECA 4YMWA 5BURA 1HXHA 1RCUA 4MZXA 5J23A 4QATA 3RUEA 4LDNA 1NDUA 2N0SA 3AUAA 3H9BA 3I9MA 1P1CA 2EW8A 3JPWA 4LNUA 4F04A 2PQ0A 3AUYA 3ZGXA 4DUZB 2PSSA 2RIRA 1HT3A 4IWNA 2FGJA 4WMLA 5HZKA 2BTQB 2FFHA 4FLFA 2UYQA 4ZVMA 3TGPA 3QPDA 3O1IC 4ARZA 3SR4A 1B6GA 2BGNA 1I3KA 2VO1A 3GUYA 2EHJA 1I7QB 4YRDA 1NVXQ 1XKXA 4OXYA 1IBKB 4W1QA 5H1YA 2KMLA 1OFUA 3FM9A 4YDRA 4ZU6X 2XDWA 2AF4C 1PP4A 3WGJA 3ZJ4A 1ZIYA 3ZE0B 3BC1A 1Q0ZA 2ZZMA 4CI9A 5FOXA 1JR3A 4YQFA 3ZY3A 4US2R 2OHOA 3ZXIA 2C4NA 5BV0A 4QSHA 4RVOA 4G23A 5C46F 1F2VA 4N7BA 3CZ5A 5D3MB 5GMOA 1JAIA 4B4OA 3E3NA 1SRQA 1WL8A 2XQJA 1RQ7A 3L40A 3UWOA 4KQWA 4IJ6A 1X13A 5JAHA 1UJ4A 1HETA 4JBLA 5CXSA 4YAEA 3FNGA 3I23A 4M83A 1JEQA 4X71A 1BFUA 2L17A 1Y82A 3VR2A 5HQTA 1PR6A 1GPAA 4Y0AA 3ZWPA 1GU7A 3ROTA 4DC9A 2PJRA 1DB3A 3S2GA 2FPRA 4M0PA 5HR5A 2JHAA 4YCMA 4OOFA 4LYDA 4R05A 5T57A 5CDUA 1VCIA 2XT6A 2PKQP 3WGVA 3CLUC 3AJRA 2WWRA 2OSVA 1GAJA 3L0PA 1R6UA 4IIVA 4Z53A 4NP6A 4UC0A 3D3NA 1MLDA 3KDAA 4JGGA 5DHPA 1FRFS 4NBVA 2ET6A 1ECBA 1NRIA 4G37A 4IIDA 2O7QA 4WEOA 3IYLW 3ZDCA 4LK3A 5IRCD 4RFSB 2VDNB 4NBRA 1ZHOA 4H1UA 4UTOA 1A9TA 1DFGA 3W4KA 1CTQA 2AG1A 4L5IA 4LE1A 3NJ8A 4X7RA 1O87A 3E2PA 3MTGA 3JQDA 4PC3A 5AK0A 3EXIA 3SDSA 3ZBTA 4DDWA 5CA0B 4NMXB 1QZ3A 1SG9A 4L8LA 3VKVA 2JLUA 4E1VA 1M34E 2ZYIA 1FLDA 3AMVA 4N0MA 4MA4A 1XNJA 3L84A 2ZUEA 1JQBA 3ZDZB 1R6AA 2Z30A 1ZKMA 5L4SA 4FGJA 2CWDA 1N5LA 3TI9A 3UWDA 3WX0A 1NMXA 3O6VA 3PGXA 3N76A 3U62A 3JYNA 4UBIA 3LQ1A 3R4CA 1GRCA 2A33A 3O7MA 3IEMA 1LI4A 3VDXA 1EAYA 3UMSA 1SGWA 4O25A 4QDUA 2VZLA 4NOJA 3WYGA 1X80A 2GM4A 4JQZA 1N0HA 1NOJA 2OL4A 4EHAA 3MYRA 3R7DA 5BORA 5DPMA 3GLGA 1V95A 1T9CA 5TQ0A 2B1QA 1F2DA 4B81A 2FMTA 3VBEA 4BLUA 1L5YA 1NXXA 2DSNA 4JT8A 4FYHA 2HDHA 4DWVA 1KYZA 3MMZA 3JQFA 1GT91 1KU0A 2WB4A 4NG4A 2DKNA 4F6CA 1EX7A 3KDPA 4WLVA 1NBWB 3IIKA 4XLLA 3L5OA 3ZVMA 1DCTA 1KTVA 2ZB4A 5KSYA 2LKDA 4AS1A 4U7PB 2KX7A 3S2IA 4AY5A 1IVNA 1SVNA 1X7GA 1UK8A 2IYTA 2R8BA 2QYOA 3LUHA 4G26A 4FFLA 4JVOA 3WFJA 5EJ5A 5JCXA 4EPTA 3AETA 4CKZA 2FZEA 3CPSA 4RHCA 5DP1A 1X2EA 1QYDA 2RHHA 1P39A 1TZCA 3N70A 4DLRA 3A9SA 1TVCA 2WHPA 2ZIWB 5L4LA 3PRJA 1T9AA 1NXQA 4MINA 3SY8A 3TR0A 4K46A 1Z4PX 1N2BA 2BFEA 4DANA 4DXAA 3FB4A 5G02A 2IE8A 4A0GA 4MRVA 1EE9A 2Q2NA 4G2NA 2C2BA 1P1HA 1OHHA 1PUXA 1ZJ6A 2QMEA 1NBEA 1WUYA 4EG4A 1GL3A 3JWGA 3WL7A 2V8OA 2JGNA 4FP9A 4NBNA 2FMIA 3LAWA 2DQSA 2I67A 4BJ5A 5J4YA 5BWNA 2BDEA 2XSZA 1P72A 2W11A 1I1QB 3KSDO 2IH2A 1IMJA 4WQMA 4IO1A 3P4YA 4PGFA 1MXFA 3A1SA 4WXEA 4FJ0A 3BM5A 4LUCA 5EMMA 1SXJD 4IV0A 2F9LA 1KY4A 2AR9A 3G3EA 3OA2A 4INPA 4UBMA 4DCTA 1ZPDA 2RHCA 1W49A 5I9BA 3S7TA 3VKWA 1A7AA 3DZJA 4BNLA 2AX4A 3DVQX 4YNBA 2GNAA 4COKA 4UCFA 3H11B 3S0JA 2RGXA 1GXSA 3KQSA 1EJ0A 4AD8A 4RV5A 2IOHA 1KC1A 1RS0A 3BAFA 4XYLA 3VO2A 4NJMB 1W88B 1DBPA 2QRVA 4OXXA 3RIEA 3ZI0A 1MB9A 4EW6A 2PS1A 1D2NA 2BAGA 4E5MA 5L7TA 4RJJA 1F2UA 2CBGA 3OF5A 4FS3A 2WFLB 4F2DA 1TB4A 3W2EA 1Y8RA 4F97A 5JD6A 2P4EA 1ADYA 3K35A 4Q66C 2QJFA 5AUOB 1CJBA 4J90A 5E9AA 1ODKA 4JIGA 1XZAA 3V4FA 3WL3A 3RVPA 1SBHA 3M9XA 1UXJA 2O0MA 3FYUB 4O59O 5BNTA 3GGGA 5DJ5A 3VR4D 4BY9E 1TT5B 2AFHB 1KKUA 4MCIA 2GRAA 1E6WA 2C88A 3KUCA 4HQ0A 5HJ2A 5FD8A 2H54A 1DEAA 1WBDA 5KWSA 3DXZA 4YA6A 1NOIA 5JYBA 1N3LA 4BP1A 1J9GA 4NKRA 5GY7A 3C4JA 4NBKA 1XNGA 3F3YA 3QVGB 1PR4A 3C3MA 1AMNA 1AA9A 2LNDA 5DYGA 4A8PA 4H4EA 1AVTA 1SU4A 2I2BA 4HY3A 1ZZEA 2X2OA 3DEKA 6NULA 4H17A 1YMQA 5EQJB 4URUR 3WIEA 5AVQA 1XZJA 1W5TA 1WR8A 3ESQA 3EQ9A 4HXYA 5F23A 2W6ZA 3OZRA 1E9SA 1UMBB 4TWIA 1FVHA 3VR4H 4JLJA 2V59A 1E2BA 4DEVA 4JBWA 2G70A 3VYSB 1TI7A 4HBZA 4MEBA 3PX3A 2EBUA 1B0UA 1RZUA 1EDDA 2L2QA 4YP5A 5EQFA 3L49A 3UY4A 4AF6A 3UJ7A 1OLSA 3DEJA 3IKJA 5A4IS 4CG1A 2H2IA 1K5PA 3P1JA 4EJMA 4KXNA 3B6IA 4Q1DA 2AV6A 3NBKA 4KX5A 4MRAA 2AOWA 2P6UA 2G5GX 4ZVQA 5JW6A 1DRWA 4AZTA 3BFVA 1PJ2A 1IHUA 4ZO9A 2NXWA 3HV0A 3U4HA 3RE1A 3ZWYA 1XRRA 3EVTA 4HNTA 3B82A 5M7EA 4MWOA 3OE4A 2GPYA 2QUKA 3GLGE 5FL7A 3CVUA 3T3IA 1CUVA 5BUSA 1UDCA 3FH0A 3V33A 1F06A 1PTJC 5HE9A 4Q18A 4QFMA 3TLBA 1JH8A 4MMXB 1IZ8A 2PZKA 1Y5MA 4K9QA 4AS2A 4NRDA 2YOGA 3C16C 5E7IA 4EWLA 5CVVA 4O4HF 4YV2A 5EMLA 5DULA 1A9PA 4TXLA 4IOMA 3GIDA 2ECQA 3ZHSA 1YO6A 2G3YA 1WXWA 1N2JA 1SKYE 1OF1A 4HAVA 2XWJI 3F6RA 5IVHA 2EKZA 1N3BA 2AXNA 2P4UA 2CMKA 3T1TA 2GUGA 5E2AA 4A6EA 5LYJB 3WE7A 5BQOA 1WQ1R 1EIZA 1MJGA 4JBNA 4R54A 1GFSA 2BFOA 3JYLA 4HSGA 2MTBA 3EXG1 3ZLBA 3N53A 3S8MA 2RAVA 1OIXA 5B2EA 3TQCA 2RCNA 1SVWA 3GARA 2QWXA 4Q9AA 2OLKA 4NFSA 4BYMA 5F7ZA 1EVYA 1SWVA 3IA2A 2I80A 1SQGA 3AVVA 4E1BA 4PNHA 1VSTA 1W9HA 3NUQA 3GJ4A 4EL0A 2IW3A 4ZEWA 4K9LA 3VV3A 1CZRA 1LXCA 1IQ0A 1DEXA 4A73A 2KBFA 2MSNA 2R1TB 4V0NA 2B8NA 1RYFA 3FGNA 3RU9A 2A67A 2LBPA 4EKYA 5I8WA 2XCSB 2B25A 5BQPA 3V48A 4D9CA 4ZVVA 2JGEA 2VTKA 4ZHQA 2H92A 1XTJA 2JRLA 2ZULA 4RGBA 5CFZA 2O3QA 4WUTA 3TOZA 3T9EA 4MS4B 4CM8A 4IR7A 4HDKA 3ERCA 1UM8A 3OESA 5CK4A 1L4GA 1WQ3A 4B45A 4DY4A 1KGSA 4GRIA 1STOA 4XFJA 1JBQA 2YYYA 1O1YA 1UZNA 2ZKLA 4D43A 5M2QA 4P35A 1RDFA 2VYQA 4OJKA 4K6KA 1EBUA 3OCXA 3PGLA 2Y8EA 1M2JA 3E5NA 2JKZA 4P83A 1O6FA 1QHHB 4HYEA 1C7ZA 2SNIE 1EUZA 1FP1D 1R2QA 4ZZ0A 4H6VA 2JANA 5CG2A 2BFMA 3U39A 1K4YA 4IF6A 2AXEA 4GC5A 1S2OA 4NPAA 3B1WA 1XALA 1YDEA 5EIAA 4R9UC 4PC1A 1JJBA 3UJCA 3MT0A 1IZ9A 4J1QA 3UQZA 1ZOSA 5I7OA 3ZCQA 4DSAA 1CYEA 1NSFA 2GZ3A 4X85A 2GK6A 4TV9F 5H3CA 4ETIA 5IVKA 1U28A 2ZYGA 2FOIA 4GICA 3B70A 3HCFA 1IM8A 2BMVA 1MVOA 3E9QA 4EA9A 5HJ5A 3L0ZA 2H0AA 3T99A 1UBEA 3RH0A 2IYYA 1L4KA 1UP7A 4ES6A 3PUIA 2VK8A 1N33B 2V4ZA 1O5IA 3DJYA 4MV5A 2FPSA 4JYZA 7YASA 1MRNA 2AEEA 3I8XA 3GPBA 2GM5A 3NHKA 2Z8YA 2QUZA 3NRCA 4CDRA 3DR5A 1ZD9A 1U94A 1FFAA 3C97A 5ALTA 4F06A 2Y9PB 3CO0S 1QZTA 3WYFA 1SELA 4WK6A 1E0SA 4QTYA 1LGYA 5GQSA 1WNTA 1QGYA 3LQKA 5KTNA 4OLBA 1Y5NA 5BSFA 4MUYA 1LK0A 4ZJYA 3PFCA 1ZUNA 2ZRIA 4XGIA 2QVCA 5CEFA 3G0OA 1T9KA 1NW4A 4HL6A 1DKOA 4AMGA 1AUVA 5MN6A 3WK7A 2HHCA 4UEJA 3AVXA 2HK9A 1BYIA 1KZ4A 4BQRA 3PQDA 1D09A 3ZH2A 4C2BA 1Q7RA 4UNSA 3ZOKA 2Z5GA 4FT4A 4DIDA 4ZN6A 3K0KA 3HFGA 3DTVB 3IP3A 1YR2A 3N2GA 4Y6LA 4UBLA 1N8SA 5JMTA 5KJFA 3IP5A 1ZJWA 2OK8A 3KQTA 5E2BA 2HIGA 3P9QA 4BBPA 4NENB 5HIKA 1GPLA 1Z5ZA 2FSVC 3SJ7A 1XZQA 2IGBA 4YJ2F 3SVZA 3SZOA 5CXXA 3CQ9A 2VLIA 3UCFA 2W00A 5EKTA 3JD2A 4U02A 1U3WA 5JRJA 2O7VA 4CZ2A 2N3ZA 3OZTA 3Q7SA 3BS4A 1UK9A 2XD9A 1P8AA 4JJ8A 5A9SB 3ADBA 2AZDA 1Z4IA 2QD4A 3BMCA 4L85A 4MWEA 3L7LA 4U6SA 4CFZA 1WOMA 2F6RA 3H5NA 3HB1A 2WC1A 2DFDA 3PVSA 1Y6QA 4PIVA 4D4MA 4J0KA 3L8EA 1J2JA 3ABOB 3FPGA 4L72A 4B32A 5ERGB 2WU3A 4UCQA 1V96A 1XWFA 4URFA 2YOFA 1YIOA 4DLSA 4EYOA 4Z6KA 2W2LA 3OZEA 5HZHA 5IBQA 5DYNA 1YMUA 1YH3A 4R2JA 5JDIC 4UNIA 5ICMA 1OZHA 3VR5D 1SH7A 1PWXA 1VC2A 5JDCA 4UEWA 1Z0IA 4TV9A 4DQDA 1VECA 3BF8A 5KX5B 2O59A 2Q4TA 1IHYA 2X6QA 3R3JA 5ER9A 2QTBA 3NP9A 2GPJA 3PXCX 2J9FA 4FCTA 4TKZA 3U48A 2AHOA 1HK7A 3MUFA 5J47A 1J8VA 1JA1A 4HEJA 3RSSA 2B21A 4N5DA 3L8GA 1IVSA 1RKXA 1OW3B 1OBOA 4ZCRA 4D80A 5EE5B 4O2BB 3K5WA 2H1FA 3O2QB 3HXQA 2R79A 1CJCA 5JNVA 3DNMA 2VG8A 3GIWA 4OU5A 1BVHA 1EWTA 3F49S 2YWDA 521PA 2OV6A 3RLFA 4BATA 5KHOC 1YQTA 1SCAA 4ZCSA 3VOTA 1GGHA 5C1DA 3QQ5A 3ZIDA 5B3LA 2W7TA 1U4OA 3ZJ5A 5FYDA 4C88A 2IT1A 3RLIA 1JG7A 5KMGB 1T2FA 3KAJA 1J39A 2YXEA 1Y1PA 4REOA 2PGIA 3VMMA 2H31A 2H2WA 2HDWA 5EXTA 9LDTA 4AQYB 3PKJA 4XYEA 3VAYA 3TTWA 1H1LB 3JQ8B 2QL9A 5ERXA 3BCHA 4ZREA 4IGKA 3D3QA 4J1SA 1ZVMA 5D1NA 1Z5OA 1BDHA 3C6KA 5D01A 4D56A 1ACJA 5K2MA 5A5GA 4W8GA 1O58A 4JJFA 2JGMA 2K6GA 3VVLA 4D79A 2HHLA 5EMHA 4Q1CA 1XZFA 3CUVA 1M75A 2E4WA 3OY2A 3MS4A 4CQJA 3KFLA 1GPH1 5A1TA 1LQTA 1QX4A 2YMPA 3NHWA 2R97A 3VU0A 1YNOA 3R8XA 3CCFA 1S8FA 3JVVA 3HDQA 721PA 4Y9DA 1HT1E 2A0FA 4O29A 5KTKA 5LOVF 2LD4A 3VXKA 1QNFA 4DV7B 2VRWA 3BDAA 3HGTA 2TSYB 4RHUA 2I2XB 3TDMA 2CD7A 4MJ3A 5EHQA 2HA4A 1SIBE 5HSGA 1P0CA 2IODA 1ZNYA 2QAIA 3HXTA 3SHWA 3PR1A 4N65A 4Q3LA 2FLVA 5D8DA 3UUEA 4ZYLA 4QXOA 2OXRA 2RKOA 4MI3A 1K8XB 3RARA 2XZLA 1TC2A 2D5BA 4Z0PA 3EGOA 1DKNA 4B6SA 3SM9A 4B80A 4KXYA 3K0CA 4WN9B 4BS9A 3G0HA 2G6BA 2P0AA 5GP1A 2FB9A 1X7WA 3HKDA 1EWVA 3DTVD 4FWBA 4JK3A 5HQJA 4EMBA 1PX0A 3WVNA 2WU4A 1J49A 1EFRD 4ZCLA 2GPBA 2WV7A 1FDWA 2O14A 3HBJA 5F3WB 5TSDA 3HKCA 3OT4A 1FVOA 2Y0BA 2FMXA 4ADSG 4D1YA 1LPNA 1DC6A 4LY9A 4TS1A 1LDYA 3JARA 4I4TF 3IP1A 1Z5UA 1RRFA 2APJA 2I78A 4OK5A 1K7SN 2QJWA 4GNKA 4IQ4A 3WQSB 4B84A 5M3BA 4GSLA 2VKQA 2GZ1A 5KJ1A 1V4BA 1WUHS 4BQNA 3KQNA 1XN4A 1E6UA 2PV0A 4RCZA 1H1DA 1NBMD 4R6XA 3RO7A 1X7XB 3RYCB 2P9ZA 4X62B 1MORA 3NHFA 1EP2B 1HPLA 3KEQA 2QMZA 2VSNA 1UPAA 3DL7A 4DUYB 5TX7A 3UBMA 4E70A 2ONZA 4CUKA 3FYHA 1Z07A 3RU2A 5JPCA 2GEBA 3OIFA 1YTLA 2Q7DA 3C3JA 3EISA 1WMBA 4MAFA 4MUKA 1ZDMA 2WMDA 3I72A 3KLOA 1AGRA 3IQGX 3Q41A 1XU9A 4KFSA 4L74A 5GPBA 1XRQA 4EYKA 2BMJA 1QGUB 2VBFA 2GBGA 4IDPA 1Z0ZA 4N3CA 5SZJA 1DKPA 1MOPA 3HI6A 2HTEA 2F1JA 3NBYC 1E79D 2NU9A 4BU1A 4CEIB 1DIBA 1YQXA 2H51A 4W5HA 4B4UA 2RK6A 3JRNA 3OE1A 3R9KA 3T7IA 2VJLA 3D5TA 3D6MA 1W5BA 2PSHA 4I46A 5U4QA 5C8XA 5IWCA 4LF9B 5B7QA 1RRVA 3PGKA 3WK4A 4I3GA 1T2UA 1CNEA 1JJFA 4G0WA 2JFXA 4XXHA 3VR3A 1DJNA 3ABQB 1U2RA 3RSGA 1GUBA 4MICA 3LRPA 1C3OA 4UAJA 5KNCH 2QMUA 5DNCA 2PZFA 1C4OA 1IUKA 3DHWC 2FMHA 2GSWA 2ZQYA 2XTJA 3GMDA 1EFCA 4TTTS 1QMPA 2UZ0A 2ZVJA 1QGOA 2PLAA 2PANA 1L8AA 5LKAA 1ZH2A 2OC9A 2R1VA 4R8RA 2ZAMA 4WFIA 1E6LA 2D1YA 3BH6A 3G5LA 3SQDA 3VDMA 4B6GA 1IXKA 4RELA 3R4VA 3BSYA 5EP4A 2UYCA 1ADGA 3K16A 4UATA 3MJRA 3X3HA 3AY3A 5AJWA 4CLHA 3MFQA 3MWGA 5IDQA 2GZAA 4DJTA 2G0NA 5FNZA 1FMTA 4XLZA 5SY4A 3W5CA 4DR2B 1MHTA 2OBLA 4KHZA 3SX2A 4XWKA 4B35A 2ZRDA 4JHXA 4IIEA 5E9WA 4RTRA 4B8WA 3LIIA 3PNLA 1Y37A 2FG7C 5LWHA 2EFJA 4ER3A 1KZ1A 1Z3CA 3OA0A 2X23A 4CDGA 1JDPA 1OGJA 2GR9A 5C7LO 1H3EA 4X66B 4U7HA 3R2JA 4G25A 4US1R 1PAUA 3QZUA 3PEUA 4DCUA 3GBVA 1S8NA 4MUHA 3R44A 1TD9A 1Z0JA 2HYDA 3L18A 5HILA 1VL6A 2CD9A 3NASA 2IJGX 2WHQA 2CVOA 5TPWB 3FTFA 3C5VA 5HS6A 5DNAA 1IK6A 1CY7A 5EINA 5LUBA 1C50A 3ZU2A 5A3RA 3J7AC 1JSCA 3HN7A 5HM8A 1UBCA 4ZQIA 5I4IA 4G8BA 4RJLA 5IKMA 3K7EA 4LS3A 1T6ZA 2AR7A 5DH9A 3L6UA 3F2VA 1B93A 4HNSA 3QWIA 4PWYA 3LP6A 3S8YA 4J0GA 3Q87B 5F51A 2QN9A 4JQOA 4AZ3A 1Z56C 1DQSA 3JALA 4HOYA 2JIMA 2WF5A 1V8DA 4X9XA 3TWOA 4BASA 1FSPA 2XYRA 3PL5A 3TPCA 5AM4A 2IYPA 3BTSA 1L8OA 3L6DA 4WX2B 1XOIA 2AA3A 3WDLA 4E21A 3D3KA 4PZAA 5LC1A 4GEGA 1I30A 4BUZA 1UWKA 1UIRA 5BVGB 1DWOA 3FKSA 4MV0A 1S2MA 4JOBA 4K26A 3T54A 3UJ3X 4B6JA 1PV2A 3AB3A 2Z4SA 3ASUA 1MBZA 1L5QA 3U4GA 2CVZA 4CCWA 2RAPA 1Z2DA 1CFZA 3AB8A 2QZ9A 2WWHA 4CV1A 1UEXC 3PHJA 3IOBA 4D02A 3DMHA 4ZAFA 3HWRA 1M34A 2PXAA 4QWWA 5DHUA 5C34B 3UENA 1NQTA 2Z3WA 1P7PA 3HLYA 3P5BA 4AYXA 1QGED 5K0EA 2WHEA 3MMNA 1SUSA 5A7FA 2CXSA 1N5DA 1NV8A 4TYMA 1BDMA 1R0SA 4FFPA 5CNIA 2W42A 2BZ1A 1QKJA 3RJ9A 1ODFA 3V4RA 1KWKA 2I2WA 2Y2UA 1JU3A 2WILA 2J5KA 3FPKA 1PQWA 2C5HA 2W5UA 4Q1BA 4R5HA 1CUFA 5GV8A 5HFAA 1XRPA 3I9V1 2IH5A 1PK9A 3R0QA 2DGDA 1V1RA 1U4NA 1S2DA 3QYFA 3TOVA 1MABA 1T4GA 4PQEA 4L6AA 4PZLA 4UEOA 4YRTA 4M7RA 1M0WA 1Q95A 3A28A 1IWBB 1KZ7B 4ZIRB 3X1JA 1YAHA 4BC0A 1NYTA 1CEQA 3CGWA 3LT0A 5IAEA 5IM4A 1FP4B 1LS1A 2QN6A 1WHSA 2JK0A 4E5UA 4F4UA 1JB9A 3TPFA 5FPPA 3MGBA 4BNHA 2WYHA 4CNBA 3F46A 2FX2A 2HHHB 5K3AA 1HRKA 2X9QA 4XYGA 3VH3A 4G8CA 5EESA 3RC1A 1O7JA 1NW5A 2HBZA 1MD9A 2PFGA 8OHMA 3IQXA 5KYYB 4BQSA 1MX1A 3WMFA 2BISA 4GZ5A 3DMDA 3EW9A 3G0BA 3PBKA 2WDPA 1XE3A 4YJHB 1X1EA 4KI7A 1GPJA 4XDGA 1EA7A 3KYDA 5LFAA 1GZ7A 3D4NA 4LOKA 4C0BA 4YRBA 4F3TA 3I0MA 2RAFA 3T7JA 1A8SA 2II6A 1MG0A 4FONA 2NTJA 1F9AA 5C3MA 3B3QA 1OWNA 4EO4A 3QW4B 1EXNA 1P1RA 2HCTA 4GWKA 1ENOA 3OOEA 2ZJ8A 2YBEA 2XMQA 4BBAA 4B2YA 4B3SB 3LY7A 4P36A 4M3NA 3FZEA 4OAOA 4WCFA 4DMGA 1UPTA 3WFIA 2DHRA 4LKRA 3WC4A 1TIKA 1Z6ZA 4WLNA 4LVUA 4JP3A 5EHIA 4FFOA 2I8CA 1WVGA 2DBQA 1ARZA 4GBED 3ESYA 3FIUA 1E3JA 1OV4A 4RETA 5GTDA 1G64A 1Z4MA 2JFWA 5H9VA 2R5NA 1NAHA 1V16A 2VNAA 5LYYA 4K3VA 2VPPA 2FPGB 3TSYA 2C3PA 3HVHA 4ZRMA 3VDQA 4M9QA 4HB4A 3WRXC 2D59A 3JWPA 4W1PA 1VXOA 3SX4A 5IASA 1E3DA 3LLVA 1VGVA 1RP7A 1YHYA 3NT4A 2ZUTA 1YCHA 4FDTA 3S44A 3V42A 1ML3A 2P2NA 5DISB 2XUAA 3G59A 3OZFA 4IIJB 5DM1A 4KNVA 3ON5A 4W8OA 3AG5A 3PA8A 1NTOA 2P1DA 1S2IA 5ISMA 2B1RA 4JLSA 5CX1A 1YZYA 4LCEA 5HCIA 1IBCA 3T3DA 3D54D 2HZBA 1Y9EA 2C4MA 1Q0TA 3U1VA 5H7XA 1Z16A 4AMZA 3GA7A 1OYVA 1VJTA 3K0CC 1IIBA 1R12A 1I2DA 1JHZA 1M73E 3EXFA 3MBOA 4LNAA 5ECDA 4BQIA 4PG7A 3PFFA 2WJJA 2EJVA 3IHLA 2GCNA 3OOJA 3G2IA 2RD2A 1G291 5BQ5A 3I9JA 1KL7A 2VQ3A 2YV5A 1OB5A 5BY2A 3I3SR 2J07A 2F2TA 5EMNA 2PA0A 1T4DA 4HDNB 2BI7A 3KPWA 4Z4HA 4X8MA 1AKNA 2XIJA 3LE8A 5C52B 3CONA 1Z45A 3A10A 3NNNA 3ER9A 2GKOA 4GLOA 5EC8A 1Z8FA 2GH1A 2QL5A 1H2HA 5KWVA 1WDWB 2Z98A 4OJMX 3WJ2A 3MBIA 1L1FA 1R4MB 5M29A 4JB8A 2NQ8A 1Z7BA 2JIZA 3OKPA 3PUVA 4S05A 4NU0A 2PKCA 3WO1A 1K9VF 2PWZA 4R0VA 3DTYA 4JH0A 3KB8A 1AK9A 2KWIA 1MIOB 2PL9A 4OYHA 4I66A 4V38A 2JL1A 5MGNA 1OFGA 5DGHA 2IX3A 4EBFA 3L93A 1PFYA 4RAQA 4PSKA 2OP1A 3VR5H 1W36C 1DQZA 1OGIA 3O21A 3JQGA 1XVVA 1XVAA 1D4ZA 4JOSA 5JNWA 3OQ6A 5KTRA 3V4ZA 3TOCA 4JZYA 3KTFA 4O3FA 1TA4A 2PMFA 4MVJG 4JC8A 5A9TA 5ILQA 3T0IA 4FFSA 2F1HA 3PWTA 4NJEB 4TGLA 4ZCIA 4MDFA 5CP8A 3OTHA 5KTPA 4OMFG 2F8MA 1UDAA 1CDEA 1YU6A 2VXCA 1MH9A 4MPRA 1ID1A 2QLJA 4NQRA 3NI2A 2JLBA 3W5DA 5LXTB 2PVSA 1X8LA 4R7ZA 3BYZA 4HNGA 2Y76A 1ZD8A 3GL9A 2EF1A 1VKZA 1NZJA 2IEDA 2C7VA 4KCGA 1SU7A 3EFOB 5AVXA 4L51A 1OLSB 3O47A 1GRRA 3DNPA 1XCMA 2F1KA 3FRHA 5AW3A 4BVBA 1O94A 4OB8A 5IN5A 3OLZA 4PFKA 4W63A 1HEYA 1WP9A 2E7ZA 1XMSA 4ZPJA 4JWTA 5FPTA 4JI1B 2V7UA 4K8RB 4W5OA 1UOQA 3A4TA 3L79A 5CDFA 3UKDA 3THYA 2B5OA 5GINE 1YA4A 4HAYA 5CNJA 5K0NA 3KKMA 3KPJA 3WLRA 3QPWA 4RO0A 5EZ6B 3MB5A 4ENSA 1OJLA 3RVSA 1YASA 4H60A 2ICAA 4E15A 4G36A 3WP1B 5BN3B 3NOVA 1YACA 3HGQA 2CDNA 1LLQA 2Y4NA 1Q83A 1RJ9A 1VDZA 3M6IA 3OTGA 4E88A 1RKQA 1F0KA 2E3JA 4OX9B 4L02A 1XPJA 3LVQE 5JXJA 1KFKB 4RD0A 4P7GA 2P4QA 3H2HA 4HWSA 4RIEA 2OCYC 1J2UA 4JXZA 2UAGA 1N2XA 1AZTA 3IOMA 3RW9A 1T0UA 1IULA 1JYFA 4O4LF 3FZNA 4Q7EA 3H99A 5L3QA 4E33A 2P3QA 5B58C 1BU5A 4NMWA 3BAZA 5G0VA 5T4HA 5JSUA 5KNDH 2M6KA 1DI0A 4EG3A 1NLFA 2FUG1 2RGGA 1G4UR 3I2YX 3AV3A 2QLLA 1HMYA 1T2NA 3FLMA 4B2PA 2JATA 3SYTA 1EM8B 1NMZA 2Y1OA 4M55A 4UU0A 4FHCA 1G8FA 4YEDA 3TINA 2W6JA 2EJBA 1YJCA 4RXUA 5L51A 3OTQA 4WFJA 3GLTA 2IBSA 3G88A 4IIXA 4AG6A 5E95A 1V5EA 3AEXA 2OXCA 1IEVA 1EE2A 2WF8A 4XCQA 4EYEA 5LNK6 3SIXA 1Q1NA 3RVDA 3VAZA 5A5FA 5LLDA 4B3IA 3RIHA 3HCAA 2EZ4A 3HS3A 3D81A 3H4MA 1DIGA 3CRRA 3RJTA 1EFVB 5AKYA 5JHHB 1JAYA 5HKLA 3V34A 2GQ0A 1OB2A 3I6ZA 1EUDA 1XZHA 2JLQA 2GN2A 2IOFK 2Q8PA 3NTLA 5TC4A 4JLKA 3W9YA 4A0HA 3I62A 3BK1A 4ZHQB 3GUCA 5HA5A 4P8RA 4B3TB 4RS4A 2OAGA 3DMNA 4KQIA 1X87A 3UK2A 5J1TB 2PVPA 4HWRA 3GJ5A 4U2DA 1P1KA 1KK3A 3N3AC 4PQGA 2Y68A 1SC6A 2GCPA 1QQBA 2GBLA 3UCEA 1O6BA 2D00A 2H29A 2Q62A 4FINA 1X7ZA 1YZTA 4E09A 3GF4A 4TKMA 1EFPA 1I7SB 3SLKA 1CNFA 4UFNA 4LXUA 4D3XA 2IITA 4G5OA 2V6GA 4M9XA 2HW8A 1YRWA 5KCZA 4FNMA 2WHPB 4YJDA 5LIRA 3MJTA 1MW8X 1EG7A 2CHUA 3RRZA 2OILA 4DLPA 1V6SA 5LP6F 3QI7A 4QO8A 4EJ2A 1JEYB 4XE5A 4E5YA 2X6TA 2QXUA 5DX0A 2I4RA 3ELWA 4PZ0A 3W4IA 2M6LA 1FSFA 3QM1A 5JD4A 2QW1A 3SXUA 2W2OA 2P7HA 4WZ6A 3WS7A 4BVGA 1IDOA 3I30X 1XP8A 2HBYA 5JUWA 4CMBA 5GAJA 3EIOA 3SF0A 1RCFA 4GL2A 1W4RA 3SQMA 1IC6A 4N01A 2EW1A 3NHZA 3BG5A 4QHSA 2PD4A 1YQ9A 2NZJA 4D9JA 4UE6A 3D2CA 2B82A 2W93A 3NBAA 4TN1A 2YW2A 3ISJA 3KWMA 3HVJA 2IEZA 3PYXA 1KQGA 2H1IA 1JLHA 4R8VA 2QDXA 3WK9A 3KUDA 5CFRA 4RKEA 1BGXT 1M1YE 3QELA 3UMRA 1DX4A 3HM9A 3SIWA 1OFUX 3TLGA 1G3MA 3RHFA 1LPMA 4NE9A 4Q3CA 3HEAA 4NJMA 1W88A 3GNQA 3FUCA 2ORYA 3MOIA 5GM1A 4D97A 4CQLA 2GNPA 2RI6A 2VJBA 1QX3A 3RSOA 2PVCA 3FPSA 1DAHA 4WINA 3W6UA 4RXMA 3FLAA 4D8WA 4UULA 2HRDA 4MTCA 1EBBA 3ILYA 1F12A 3OQIB 4LSZA 4NE2A 1TDJA 4NC9A 4RFSA 2XKKA 2O2DA 4CQNA 1L4YA 1F17A 3EMKA 2FQWA 5CA0A 3VSEA 5KJ6A 4P3NA 4GHWA 1TQ6A 3KR2A 2OO7A 2EZ9A 4RD3A 3L02A 4C7OB 4Z3OA 3Q8LA 3NHLA 3IQWA 3A2KA 1KI9A 1P5HA 1J2RA 1PFQA 4JASB 1KVUA 1XDDA 2J0VA 2Q3HA 3G8CA 4RPJA 4I1VA 2Q2WA 4MW1A 2RH9B 4YRMA 2Q45A 3FSEA 3I5AA 4MQBA 4UARA 3H42B 1K6EA 3CCBA 421PA 3ZW7A 1OLOA 2QLNA 1Q3TA 2QUHA 3MMXA 4F0JA 2OGTA 3T3NA 1DUVG 3HA2A 4G4GA 4E0BA 1XQVA 5C8ZA 4F6LA 2E82A 4XD7D 1C1XA 4KXLA 4LY0A 2AZXA 3ICEA 3BMOB 4WASA 3C4VA 1ZQ1A 3TG2A 2EKBA 2FAXA 2MSCB 1WLYA 2ORWA 1HDRA 3FKJA 1PD1A 4JBGA 1V11A 3C45A 2YIDA 1RQNA 2OWDA 3ETLA 5A9SA 2V45A 1AXEA 2WJVA 3V1YA 1R16A 4KW7A 3G13A 1AGXA 1H0RA 2FN7A 3PHGA 4A82A