3SFTA

Crystal structure of thermotoga maritima cheb methylesterase catalytic domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
b'VSGKIVVIGSSTGGPRSLDMIIPNLPKNFPAPIVVVQHMPPGFTKSLAMRLDSTSELTVKEAEDGEEVKPGFVYIAPGDFHLGLKAQNGKVFFFLDKSDKINNVRPAVDFTLDKAAEIYKSKTIAVILTGMGKDGTKGAFKVKFYGGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYKIPEKLIELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis response regulator protein-glutamate methylestera
publication title An insight into the interaction mode between CheB and chemoreceptor from two crystal structures of CheB methylesterase catalytic domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 66
structure length 189
sequence length 189
ec nomenclature ec 3.1.1.61: Protein-glutamate methylesterase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01339 CheB_methylest CheB methylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.180 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylesterase CheB, C-terminal domain 3sftA00
1CHDA 3SFTA 1A2OA
chains in the Genus database with same CATH superfamily
2IDZA 5AK5A 4QC2A 4RH3A 2YQ4A 4P4NA 4TSRA 1NE7A 1W5SA 2H0QA 4QL3A 4UQOA 3ZCSA 3RAEC 2OCIA 3A6ZA 4KE8A 5C53B 3KLNA 2V96A 1SEPA 1Z2OX 3A6FA 1R6VA 3DJFA 4YMSA 4K5QA 4BAUA 1GCUA 4MROA 2XRYA 1NQOA 5B3JA 3I6QA 3M3HA 4HWRA 4BNXA 3EHDA 5F1KA 5JAPA 2CXNA 1FFXA 2FFQA 4DREA 5CYGA 3C6ZA 5GZ1A 3HM9A 3PE4A 3AKEA 2QUAA 4XH9B 3X0DA 1OU0A 1NQ5A 1U1DA 4MRPA 3EOZA 5I3ZA 4B48A 1T24A 3DD5A 1M2GA 1SPBS 3P0IA 4E5PA 5LIRA 2XX3A 2P79A 4RABA 1U0EA 2C0CA 3GNSA 2GLUA 3DYBA 4TVSA 3GLHE 4EATA 4X71A 4M0KA 2AOTA 3HU1A 2VP3A 1X1SA 3CKLA 4N7RA 2H16A 3BXFA 1AKUA 1CUXA 1O95D 1KC3A 3KKKA 1Q17A 3M4YA 1KOFA 3O3CA 3R0XA 4PW0A 3PZBA 4CMKA 4TWIA 1KI9A 2V1XA 1JIQA 2PBZA 1TC1A 2DBYA 4LW8A 4QRHA 1VZ2A 1Z25A 3NJRA 1P74A 4TTRA 4D9GA 4BLRA 5CFPA 3VNVA 3SIWA 2WWYA 4MVCA 5BUQA 1C4KA 1XDSA 3F8TA 1EFRD 2LGJA 3K94A 3FTNA 5E7IA 5IAJA 4J0QA 1Q83A 2LCIA 3DAPA 4E94A 1DC8A 1EEXB 4LVUA 1X13A 3W1VA 3DE5X 2C8JA 1OVMA 2CVQA 3G6KA 3I23A 4TOIA 1OH8A 3GGGA 3TSWA 4YTEA 2B1QA 2WUDA 4ZVTA 3IBYA 4HG2A 2Z2ZA 5JRJA 4A23A 2OP1A 3D8HA 4YI3A 2CNKA 4NR0A 4JUBA 4X95A 4JP3A 4MCAA 4CEJA 1IJFA 1PL0A 2C8KA 2IX9A 2O7QA 2WTAA 2Q7XA 3FIUA 3L8DA 1K92A 3KHTA 2JRCA 4PTYA 4RE6A 3T54A 3ZV7A 4BQEA 3U80A 3VA7A 4NFYA 2R86A 1SC1A 1B3BA 3NCHA 2CB0A 4CZ2A 5KSPA 4OQ4A 2SCUA 5ALNA 2BTQA 3U31A 4FTWA 1P0IA 3NONA 4JBHA 1YONA 5DEIA 4TGLA 4A5SA 1ESCA 2FWMX 4QJIA 2VOEA 3IO3A 1EMDA 1SCAA 2N0SA 1DPFA 2FPPB 2HEGA 3NLLA 3KYCA 4NY1A 1C0KA 4G0NA 1DIRA 4FCVA 5EHIA 1W5AA 3GWGA 4ENWA 5MN5A 5ICSA 1G5HA 5ED0A 3VI4B 3LMKA 4F11A 3THYA 3HXLA 2UYCA 3SM3A 1QCZA 2QGZA 3U4IA 3NT4A 1L7AA 4CM6A 1FNCA 2C2OA 4QBIA 1Y1SA 3RNLA 1UKCA 2WE7A 5FBHA 1NFRA 3VHXA 4QNNA 4C03A 5CTJA 1OSNA 3EZ9A 3LPNA 2HCRA 1QRRA 4BLTA 3GZNA 4F92B 2CL7X 1ZU5A 5AHOA 4INOA 2C96A 2AW5A 2I6UA 5IJ9A 1FX0B 2ACWA 4J0GA 1XZAA 3JAWB 2IYRA 1IN8A 2Y71A 1UBCA 3IT1A 5D6OA 1P18A 4EJFA 1JR3A 1VKRA 3ZZ0A 1VQ1A 2D2EA 4FWIB 4WN9A 3NX4A 4BIIA 2COKA 2G0AA 2Y67A 2J7PA 5CLGA 4IQFA 5KKCA 1RWVA 2GHTA 4LGVA 1P62B 4MDYA 3ME5A 4J29A 1ZJYA 2HU7A 4PSVA 3HSKA 4M37A 3U3RA 3GGDA 5CDGA 2I6GA 4EA6A 1EWQA 4BGVA 2YZ2A 3BD7A 3OBBA 1V8PA 5ALPA 1W2GA 3T0IA 2Q3BA 4LA4A 4F4FA 3I04M 1XDBA 2YWXA 5JXGA 5JJCA 1VSBA 3MQ4A 4J16A 1G20A 3D6TB 3VR6H 3ESZA 4YMUA 2P5SA 2OHOA 1KDPA 2W8BB 3FWHA 3K0BA 4MCHA 1H3EA 5JS6A 4R0NA 2O5RA 4I5FA 4RTSA 2IU3A 5BVHA 3NJ8A 3GC6A 2I3ZA 3OIUA 1Y5LA 1BW9B 3EQZA 5ECWA 3BH0A 3ZU4A 5KHLB 5FOSA 3DTVA 2R6ZA 2A35A 2FK7A 4ZV7A 4CV0A 1FMLA 4QA9A 1VIMA 2C83A 2PIDA 4IFEA 2W98A 3L6RA 2B8EA 2QG9A 4TQGA 4CR6A 1DBWA 1RQGA 1G66A 4MUNA 3HKDB 3RYCA 1FP1D 3IE1A 1AF4A 1YB6A 1C9NA 2ZE7A 5IEJA 1YVPA 4JBNA 3WX0A 3DNFA 1NMEA 2B2XA 4NFLA 3UV7A 1KU6A 3CINA 2FZ5A 2JLWA 1DO0A 2HT6A 3U1VA 4M6WA 1N33B 4KIGA 5C4GB 3UHJA 3OA0A 3RODA 2AEFA 3D1JA 4ZCIA 2XUOA 1PLJA 3F3KA 1I1OA 3NGXA 4B4DA 2EFCB 2CBZA 4YV7A 5EMKA 1NULA 3LLCA 1O6CA 4DR5B 2QT0A 1U7DA 5JANA 2YQ5A 3VTKA 2G4VA 2IQ5A 2E49A 3G7SA 2V6IA 3UKJA 1QHIA 2OTCA 4O8ZA 3SPXA 3EPPA 1SIUA 2FVYA 4QTTB 4D4KA 2XA1A 3H2BA 2ZYDA 3VI3B 4YT2A 3Q1KA 2NTNA 2G5GX 2IYWA 4CT5A 3TTXA 4DV3B 1VTKA 3ID6C 3QEJA 4I46A 4DDMA 4O6VA 2XPCA 1NKTA 1VHQA 3LBNA 1XD9A 1PP4A 1J7JA 4MOWA 4RSHA 5SZKB 3LFTA 1RQLA 1IL0A 2EDAA 3SE7A 4B9EA 3IMCA 4KO4S 3CLUD 2JJ1A 5FTNA 4PNEA 3ZVMA 2OUKA 1JA0A 3A2KA 2O9JA 2D54A 1VKNA 4KVZA 4K03A 4U7GA 5CVJA 3HZRA 3P45A 4AM8A 4TV8B 1Z88A 4EGSA 1SA0A 1GL6A 2BFFA 1T3TA 2C78A 2CXPA 2PT6A 5K0NA 2I2WA 5K3DA 3RVOA 7ABPA 2QG4A 4MV3A 3IAFA 5DPMA 5IT9A 3E5HA 4YDSA 3CO0S 1O2DA 5JDCA 2JIMA 4JX9A 3LDGA 3D31A 3NB0A 2R8ZA 2XIQA 3COVA 4JP5A 5AR1A 1RPJA 1T4BA 1YFLA 5JADA 4KLNA 4DF3A 1NSFA 1BS1A 1K7SN 4NG5A 1RWXA 3P7MA 4UMEA 4ND8B 3WQBA 2YVKA 2O0KA 1XRSB 1DAOA 3MAAC 3IXQA 1FZQA 1TYEB 1NF9A 3CKYA 1QHGA 2AQIA 3A3YA 1AKRA 4DHWA 4ZZIA 4UEKA 1DRJA 3E22B 2W4MA 2FPKA 1P17A 1Z2DA 2HYDA 4LV5B 2XECA 2XCOA 3LM8A 4G07A 4RKYA 2O8EB 1MA0A 3SVLA 2QQ0A 3D3QA 1S9HA 3L79A 1EP3B 4KC0A 4PGHA 4D42A 3HR8A 4GSYA 2WD7B 3CRRA 4WASA 4DCCA 2VS1A 1R64A 3L1UA 5KNCA 4P4SB 4R2XA 3ON5A 5HE8A 4N7JA 2Q8QA 4ZYLA 1YULA 2V74B 2V0NA 4DRXA 3TBFA 3BM5A 3L0YA 1IBSA 2DR2A 1DC5A 1NSYA 5FL7A 3V34A 4BLSA 4L8VA 5CYOA 4FMBB 1FIUA 2QTNA 4MYDA 4CKWA 1GTSA 1NJGA 3TLAA 3C6KA 1E7YA 5DHSA 5K51A 1V6SA 1HQDA 4C87A 1MVLA 3WJ1A 2AC7A 1EK0A 2FEXA 4FFSA 1EUYA 3HXTA 1WCIA 1V39A 1ECCA 4HBZA 5FUWA 3UCXA 2GEJA 2VSNA 1K08A 4MPDA 4EGCB 3TG8A 4F9TA 4CQMD 1ADFA 2AZ4A 3ZJTA 3VSEA 1H2HA 1U5CA 4L8YA 3U4GA 3D8RA 2VHJA 3HP4A 4HJXA 5BRAA 1PZXA 3UMMA 1FP2A 4NENA 2L82A 1P2DA 3AEQA 3NYIA 2HLDA 1XZIA 4WUTA 3RIYA 3DZDA 3WKCA 1U8FO 1XTBA 5DM0A 3WNCA 2EZ8A 4XYGA 2PD3A 2B1IA 3RHTA 4ZMBA 1K8XB 3IDAA 2M6RA 5EUQB 3SK0A 1IUPA 1E1CA 4MWBA 3LUKA 4RD6A 3AXSA 4W63A 5FUVA 3UUWA 3W6ZA 3EPKA 1I5EA 2QPTA 1JFRA 2PD4A 1V8DA 1VKJA 2D62A 3AIOA 3DV0B 5DCYA 5EJ9A 4Q3CA 1DX4A 1SK9A 2CVZA 4RM2A 4EA7A 1CUSA 4F6LA 5IJAA 4WIAA 4KSBA 1ODCA 3ZW8A 3VTZA 3WO1A 4GOND 3QU5A 2E18A 3HWX1 5BV8A 4AJIA 3CFYA 5CCBA 3S1LA 2K2QB 3I0ZA 1NNI1 1EB8A 5AHXA 4KMMA 1YAJA 1GKKA 2OMKA 2FRVA 5F52A 1UXOA 2X42A 3H8JA 4CEHB 1Y7PA 1F6WA 3R8XA 2BLNA 3MUEA 4WKOA 1F51E 3VH1A 3F5QA 4B34A 3BILA 5TV2A 1NPYA 4I1SA 5HG0A 1ZNXA 1J0XO 1OYOA 3LL4A 5EMHA 1KK2A 4CUKA 4OXXA 2CXOA 5JFOA 1OBHA 2V6GA 1YMQA 3QPDA 3U9SA 2CE7A 4HNRA 3EGXB 2W2KB 1U0TA 3DL4A 1V5IA 3D3JA 4U2KA 3T5DA 3SKXA 1C3XA 3T7EA 4BL5A 4DUYB 1NNLA 4L95C 4IW3B 4BMXA 5KSYA 4UAJA 4UHCA 1OYWA 2QIPA 4BYMA 3QIVA 4XCVA 1M2KA 4R7TA 2YWHA 3B9RA 3D81A 3NDIA 3NGMA 4YRCA 5AI9A 5ALZA 2SKCA 2PJUA 2XB8A 5THXA 3KQOA 1RVDA 2XADA 4LCJA 4RBNA 4WKCA 3T8YA 2IEBA 1ONOA 4UTRA 1CVLA 4QNMA 4PRLA 2BFAA 821PA 4Q4HA 3K1TA 4YRKA 1E5VA 2Y66A 3LWBA 5A5VA 3TQQA 5CFZA 2HK8A 2ZDQA 3OEYA 4A2QA 1M2VA 1UWVA 2OBYA 3PUYA 3HYNA 3S8MA 1WM1A 1T4CA 4MW6A 1XQYA 4I4NA 5JFTA 5KYXB 1JXMA 3C3MA 1H8HD 3ZXYA 1CS4C 1NIJA 1DSSG 1GTVA 5DMHA 1W52X 2CXXA 2JGJA 2ZI5A 4R2WA 1SVWA 3W1WA 5AWFC 3ASZA 3VSAA 5K20A 3WAJA 3RREA 1DCTA 4IXDA 4ZAZA 1EFCA 1X8KA 1XZQA 2GBGA 4BNGA 3MJDA 5AVXA 5KINB 1NR5A 4QYMA 1FQOA 1E3DA 3HI4A 3C3JA 2LNDA 4TL6A 3SBEA 5JZ9A 1R6TA 2JJ8A 2VKTA 1ECPA 3IBTA 1QYWA 1Q21A 1UBUS 2GI4A 3JR7A 3QOFA 4IHQA 3LS2A 5T8KA 4IJKA 3MLEA 3RKSA 3IDZA 1YIOA 4Y0AA 3T7AA 2QRKA 2ZJZA 4D0GA 1ZJWA 4B3SB 3ZD7A 3DBHB 4IEIA 3QVTA 1T29A 4GKBA 4IOJA 4L8LA 1E5DA 4OJNA 5JRDS 4MZXA 4TZKA 1OZGA 4DBLC 4RXMA 2NXNA 1DQNA 2YV4A 1VHJA 4YR7A 5KX5B 3V8VA 1Z6PA 1Z83A 4B82A 3DL0A 4OU4A 4EUSA 3RSHA 3KTFA 5EQDA 2VIIA 2ZJFA 1HI9A 2OHXA 3W3AA 4Z3KA 3CZMA 1BN6A 2RHOA 5FPQA 2IYLD 1TGYA 5M5BA 1Q14A 3TI9A 2QG6A 1AHNA 4G0UA 3GZ4A 4F93B 3OETA 2D0PB 4TWAA 4V0ME 2GPBA 4BX8A 3JQ7A 4MQ5A 1XNGA 1FJ2A 1RHMA 1WW3A 3E5RA 3H9UA 3BH6A 3ACBA 4QEDA 2XB9A 3DBRA 5BSTA 2F3PA 2ZQZA 3KTDA 3PBKA 3TDMA 1H69A 4B3FX 4E1AA 1GNPA 2J3EA 2OO5A 3PNPA 3GX1A 5IFKA 1JEYA 3QVXA 4OFBA 2A9QA 4EI8A 4JLAA 2ICAA 4L74A 1T2UA 4MS1A 3DL7A 3HBMA 4AZ0B 1I4OA 4UM5A 1MB0A 3E9YA 3LFUA 1XA3A 3SC6A 5FH9A 1YB1A 3LHDA 1D2RA 1TYBE 1XEXA 1GTJ1 3CYFA 3LHIA 1ONPA 3RTAA 5CB6A 5C52B 3NBYC 1DTEA 5B1YA 2O8VA 2VXCA 2GUWA 3HCAA 4Q39A 4DDKA 4JP1A 4Y2YA 1NN0A 2D1QA 3PFFA 9GPBA 3D8NA 4QUEA 2H1SA 3DBVO 2XYGA 4XD2A 3TPCA 4DB2A 2JLUA 5F3DA 2GF0A 4TQUS 4L5BA 3TPZA 1ZLYA 4MH0R 3DDOA 5FI3A 4ZEWA 1I2ZA 3KU1A 3A04A 1KIMA 4TXJA 3HUDA 3G9XA 3HKEA 4A0FA 2A6PA 4WUVA 5DLQC 3ZBUA 3TW6A 4YDQA 1MCZA 1QTQA 1I3LA 1WUKS 4HXEB 1NP6A 3EBOA 3ZQJA 3L7IA 1J8MF 1NPDA 2YVLA 3IIEA 4WKPA 1Z47A 3T4PA 5HJ5A 1EUCB 2Z2YA 1KYZA 2ODNA 4DLXA 3QVUA 1UIRA 2DTXA 2O20A 1S3SA 3CNQS 5H9WA 5HS4A 1QVVA 4BFVA 4TRMA 3GYBA 4DGQA 3BFXA 4LZPA 1HQCA 3NHLA 3PCXA 1RKXA 2IY7A 5T4HA 5KREA 2WJYA 2DG2A 2AUMA 2FE4A 3K8YA 2RBGA 4YRDA 2JGRA 4LISA 3GFBA 2CBXA 4JCCA 1SCQA 4IIVA 4XYMA 4E14A 3P2JA 2VJBA 4KXYA 3RRNA 1F0KA 1AQLA 1VHWA 3GARA 5AVVA 1LX7A 2WTUA 2P9HA 4MEAA 3AUAA 3F6BX 2GEUA 3IODA 4KZKA 1VMDA 4UEOA 2OXFA 1CNEA 3LBIA 3P9IA 4FLEA 4J90A 3MCZA 5DTQA 2ZUTA 3SQNA 2Q21A 3CLTC 2Y2VA 2A5FA 3IT2A 3AZQA 1PD1A 2D3TA 2JKVA 3QWBA 5CH3A 2CJFA 3T6KA 3ZOKA 1QDEA 3E70C 3FAKA 2UZIR 3G8DA 3TAUA 1M33A 1O8BA 4JZYA 4BVKA 4HDKA 4WHMA 1HBJA 2O6HA 2VHQA 2ZDGA 1S7GA 2P9ZA 1N57A 3LHKA 3R3SA 4J0IA 3ELYA 3ZDRA 5G4LA 4XYEA 4TZ0A 3RUDA 1H6AA 2ZDHA 3DZFA 4I6GA 1HDYA 4BNJA 3MTQA 4Z9FA 4DCSA 2I3GA 3ZWAA 3VR4A 2VZLA 3O21A 1OX4A 2GEKA 5IVIA 1CUVA 1DWQA 1KY5A 3KTAA 2PRZA 1PSDA 2P67A 4AZWA 1FX1A 2ZSIA 1J0BA 2PGJA 4NTZA 4EG1A 2ZZMA 3Q8WA 2BRUA 2IYEA 3KLOA 2H48A 3KYIB 1TAGA 3H3XA 3LDAA 4PBTA 4UUAA 4WNAA 3SZRA 2J08A 4JIMA 3P8ZA 2EZUA 3RJMA 4EB6B 2EYUA 2MR5A 1XAJA 3DBLB 4LE1A 2Q5LA 2D7JA 3VR5A 3G0CA 4GLOA 1E4OA 2GJ9A 4YJKA 2WSSA 2F2TA 1XHLA 3JYNA 1PN3A 1GARA 3G5LA 3ADPA 4KYUA 3DDHA 3HV2A 3FWYA 4LF5B 4LTDA 3ZLVA 5BPFA 2NU7A 1R5JA 4JODA 1NM5A 1RR6A 1YT5A 4XPZA 1MQAA 3RS8A 3G82C 3OFND 4I3FA 3BRWD 3TL3A 2QTVB 2C7PA 1SXJD 4ALIA 2X2EA 1RIIA 4ZOLA 5TMDA 3L3BA 4CM9D 4DV5B 5IMSA 2X8JB 3EVTA 1WXQA 4NABA 3QVSA 3TM5A 3NQ41 1KP9A 2CK3A 4JJGA 3W6PA 1XDZA 3USZA 5KJCA 1C8VB 3K8QA 3V6MA 1ZESA 3LLVA 4LOIA 4X92A 2OG1A 3DP7A 2Y99A 4YDHB 5HOEA 3L0OA 5I7UA 2OSBA 1QGOA 2K5UA 3JRWA 2J5BA 4JFRA 2Y3IA 2VTKA 3K0KA 4OHCA 4YJ3B 3ZOZA 2CXSA 4CM5A 3T7SA 1VJ0A 3UOGA 2Q8PA 3HQ4O 4F4CA 4F3RA 3C5HA 3FYUC 4GUAA 1PWHA 5EYPA 3RC9A 3GFVA 4GM1A 4HEJA 3VX4A 4F1JA 5TPWB 1MO3A 2R5WA 2V59A 2RE8A 2OV2A 1CY4A 1B8NA 4GXQA 4DILA 3QPVA 1M0WA 1G4HA 1Y5RA 2NU6B 3T7DA 1PLKA 2Q45A 3H1TA 1Q95A 2NYVA 2WJWA 1PYDA 1TADA 3VVMA 1Y9AA 3K7EA 3JXEA 1RC1A 2PUFA 1LQ2A 4ZP1A 1NFQA 4BB0A 4MS3A 2WBLC 2DY0A 2HCBA 2F55A 1Z0KA 2VP6A 1GGMA 1KPIA 1O97D 1T25A 4B6QA 2EKLA 3BIJA 4CQMB 1DIAA 1P0FA 3FFXA 3JWHA 4Q47A 5AOAA 3G2PA 3SSMA 2HWXA 2ZSUA 3IQHX 4K9RA 3ZY2A 4KITB 2VHCA 1CZRA 1IEVA 1KEWA 3LQQA 3N2LA 3LZDA 4YXWD 2E21A 4QRIA 1LH0A 2WA1A 4K40A 5BYJA 4D9IA 2AWOA 4MZDA 1YWGO 5B58C 2ZT8A 4RMHA 1REQA 1K8YB 3PR3A 5EPUA 1CIVA 3DTTA 4ZT3A 5JLAA 3RC7A 2ENWA 1MUUA 3WFJA 5T67A 4YT4A 5EJ5A 3TUJC 2DPGA 2CFCA 5KBYA 2J59A 4OI0A 5G41A 4Q6WA 1KO7A 2FSPA 2YY6A 2EL7A 2EBFX 2XMDA 1LDBA 3CRQA 4QQKA 4XGRA 5EIEA 2F3RA 3IAEA 5EINA 1EIZA 4LFAB 4RESA 3G0GA 1Z45A 2BCJQ 2QR3A 1PZMA 1QHYA 1YV9A 1V8FA 4CU2A 1PS0A 1DCKA 2WIFA 4M7WA 4WX2B 4ZV9A 1I7QB 2EBHX 3G17A 1U2RA 2JI7A 2HCFA 2WAYA 4GNKA 1ZK3A 4B6GA 1FXWA 1Z4OA 5K0JA 1G18A 2Y1WA 2RCNA 1ST3A 2NNLD 1C1DB 1MJNA 1QVAA 3O26A 2JBWA 2QZZA 1W19A 4Q34A 2VH1A 5DCWA 3WIOA 4NULA 3WGLA 3I4CA 5BR4A 2W2LD 2ZAOA 1QF9A 2OHJA 2CLEB 1DJMA 2B8NA 1LW6E 4K05A 4FFVA 3C1OA 4PYMA 4UBNA 4CXMA 3BTVA 3H1PA 1MB4A 1JR6A 4R3UC 13PKA 1HOXA 1LK5A 2VBCA 1TK9A 3OZBA 4TYMA 5U9CA 3IIJA 7MDHA 1S1CA 2BI7A 4HWGA 4ARIA 4CDMA 1BWPA 2QLFA 3VR1A 1TECE 3H3FA 1FDRA 3WL8A 5JYEA 4CTOA 2BH9A 5B53A 1CJSA 2I7CA 1DWUA 3AHFA 4FSDA 2XKAA 3LPAA 4LHYA 4ZCMA 1XMOB 1BA2A 3ZD9A 4GP7A 4YP5A 1JGTA 4WPGA 4GD3Q 1UBMS 3E9ZA 1NBMA 1R0CA 1KNXA 1J9GA 4I2NA 3L7KA 4AROA 2ONYA 3Q0TA 1FU7A 3G8AA 3V55A 1V4VA 3UJNA 5DBHX 1CKEA 2H9AA 3KZ1E 3M6XA 1Y48E 4G4SP 1CVRA 1H22A 2PVSA 4OUDA 4MRSA 2BGNA 1XR3A 2H5IA 2HMVA 2DHRA 3PIDA 2J9ZB 3WZ2A 1T9GR 5LZ9A 2GR9A 5FULA 1XPRA 1VHDA 4UE3S 1XXHA 1LS1A 3KKOA 5DW3A 3JSXA 4NNPA 1S2OA 5KYKA 5IKXA 3AHHA 2QD3A 3TG2A 1KC1A 3N8GA 4KPUB 3OLZA 4MIEA 5CXUA 4XFDA 3TD2A 3M1LA 1JIKA 1Y63A 1JU4A 2B25A 4TLLB 3VPGA 2HA5A 4Y6QA 2I7VA 5DDIP 5FTMA 5F1YA 2WHPA 2M32A 1KQ3A 3GD7A 4EW3A 2C2XA 3ZI7A 5IZCA 3ICEA 2FGKA 3Q7IA 2BFMA 2FW1A 4JBIA 3KAJA 1LDGA 3Q7TA 3OY7A 4BX3A 1T8SA 3B7WA 4DNOA 3VAZA 2X4GA 4ABYA 3ICPA 5IKEA 3ANTA 5DHPA 1X7XA 1GFIA 3U4MA 2HRZA 5JG7A 4BO5A 4PM4A 3DFFA 5LR6A 3LTEA 1ZN9A 2PMBA 5CNMA 1F5NA 2PFKA 4S24A 4WESA 5ERXA 5B58T 5LFAA 1NE2A 1QR6A 2BFBA 3J81k 2HFJA 4E88A 2WINI 3BX1A 4K9LA 1A4RA 2JHAA 4YUVA 4P84A 5EIOA 4PF1A 1XZ8A 4I8XA 4PO8A 3H8VA 5LDDC 1T0BA 4V0OA 3ER6A 1ES9A 1B26A 1J2YA 2AR0A 3S1SA 3U17A 2ZIZA 1G9XA 5LP1A 2B61A 1WHSB 3CTMA 1BROA 2RHBA 3FKSA 5JD6A 5HZGA 4ZYYA 2ZYTX 1FXWF 2CDAA 4N40A 1NRXA 3LKDA 3RROA 3V7YA 1DBQA 3M1YA 4D2IA 4JYZA 2IDJA 4EY5A 3QWAA 1SZJG 2P9BA 4ZZ3A 4CCWA 1M1ZA 5F23A 1NG9A 2WWTA 4ZOAA 2FN4A 4A03A 1DOZA 5EVCA 4CL2A 3U48A 1G7SA 4MVJD 5BNIA 3JQ9C 3GLGE 1MABA 1ZGGA 2C5EA 4D74A 1NQAO 1KO8A 2XMGA 3H5AA 4I5IA 4KE7A 4DUGD 1CIPA 2YIVX 3RVMA 3Q3GE 1OLXB 2EJVA 3M1IA 1E4EB 3RUCA 1O96B 2E5WA 4Y7CA 3PJGA 5KYVA 3VYVA 1KQPA 2EX4A 2PQ6A 3ILHA 3MCUA 4KQ6A 2XIJA 3EZ7A 2DRIA 4D3DA 4EI9A 1SPXA 1GDHA 2ONZA 3T15A 4EI2A 2XVZA 5ESDA 2EFGA 3C45A 2GX6A 3I1IA 2NP7A 5DP2A 3L5KA 1EA7A 3S70A 3VJRA 2JRLA 4HDOB 4ZVVA 4FEAA 4QHTA 1M67A 2A0UA 1A8SA 2QKYA 3QBJA 4M9UA 3LK7A 4Q05A 3G68A 4JI0B 2PV7A 5GQSA 3L0DA 2O7NA 2QSZA 3IVGA 3PHBE 5IULC 2NAPA 3HHEA 2ST1A 4KXNA 5D3KA 3UK1A 4I50A 3TIGA 1PNVA 4WBSA 2OC4A 1IVSA 4IH9A 4JVNA 5JECA 2HHHB 2H2WA 2ZFUA 4G97A 3U49A 4N8DA 4NU8X 1ABEA 2Q5JA 1E1RD 1LPBB 1XE3A 2HSDA 3ISJA 3IUBA 1VPEA 3L46A 4QE3A 1NLZA 1OH7A 1J21A 2SHKA 4HLCA 5A62A 3T1OA 4XR4A 4YMIA 2G5PA 2VZ8A 1XRPA 4TTVA 1JZQA 4TLMB 2YZKA 2CUTA 2J9FA 1MB3A 4DMGA 2ZOSA 4OX9Y 1IOVA 1KH3A 2OK7A 2QM3A 2Z9CA 3CEMA 3QEMA 4PZCA 5TR9A 1JMYA 3GVCA 2BIFA 4HQLA 1U3GA 1RJ9B 4RZ2A 1COWA 3IYLW 3I2IA 3VZBA 4BOYA 3H1EA 5C5IA 3GVHA 4QBKA 1LA2A 3HFJA 4FHFA 4G86A 5H3HA 1JKMA 2ZTSA 3MGKA 4NDNE 3WKBA 4COKA 2GRAA 3V6LA 2E5FA 3K1AB 4CCYA 1A2BA 2FFHA 2I3AA 4M8NE 2YOGA 2YW9A 1I9GA 1PVDA 5D85A 4C2AA 1JDZA 4FQ5A 3R7WB 4RVNA 1KVUA 3D4LA 1T5IA 4QDTA 4IKEA 1P7PA 3C3YA 3ZH2A 3ZIAD 3CLHA 1EK1A 2R79A 1RLOA 2PWZA 1RBZA 3F6YA 3WGKA 2HJGA 4L28A 5JZVA 5EJ6A 2QQGA 2YV2A 3HB9A 3CUVA 3ZCXA 4IDPA 2YXEA 1PR9A 2NU9B 1UBEA 2Z2KA 2XB2A 1UAGA 4QASA 1GFWA 2A5DA 2DPXA 4R81A 3TX2A 1KP3A 3PC6A 4KKXB 1XPOA 1EYZA 5HIAA 3B70A 2Q4RA 1BEUB 2Y76A 1JH8A 2J09A 3K0HA 4L4RA 1P7ZA 1MC8A 2G06A 3DOEA 1VHLA 3ZHSA 1US8B 5I51A 1KETA 5CFOA 2ECQA 4OKNA 4I4TA 1SUAA 2JCXA 2MHCA 1XA4A 2QPAA 5GZ6A 4NXNB 4RFVA 3C7KA 1OI7A 5AKGA 1AO0A 2PU5A 4KX3A 1K68A 1KEEB 2VRNA 2Y6UA 2Z1MA 1DX9A 3OJEA 1CWUA 5BV7A 5HKKD 3TRHA 4RSMA 1YDGA 2OLJA 4EPTA 3C5WP 3PJEA 1J6UA 4JYCA 5C51B 1TKRA 2FR8C 3DB2A 5LD2B 5IKPA 3LX8A 1FUEA 1XZNA 4OSPA 4JLMA 5SY9A 3WLOA 3KYDB 3V7NA 3IS3A 3WGHA 1GA4A 4N5HX 3TIIA 3QHAA 1OLSB 3I73A 2A8YA 1ODLA 2ERCA 5JNTA 3IP9A 1OLOA 3B1FA 1I4DD 1WABA 2YHUA 1E77A 2DM6A 4DNQA 4I50F 4EFLA 1L7XA 1IN7A 3DB1A 3DGFC 4X7PA 1F1JA 3I62A 3DLTA 3RV3A 3GLIB 1WMSA 2C3MA 3OC6A 1HFKA 1PEYA 4KVAA 2WJVA 2QBYA 1YQXA 4M1SA 4PSAA 1EP9A 4Q9NA 2VF4X 3IOEA 5IUNC 3OUTA 3ABQB 2YW2A 4K6GA 2YWBA 4A15A 4PLFA 4I6EA 1YBFA 7YASA 3UKOA 4Q1BA 3E2MA 2AVDA 2W4IA 4Q9HA 3WMGA 2XZTA 1EM6A 1O94C 1JYEA 3BBLA 3BHIA 1BHQ1 4NDAA 4TKUA 5CX4A 3V2UA 1KJIA 2G9UA 1ZNYA 1VMKA 1BE8A 1R6UA 2O8NA 1UJNA 1VKOA 4MGZR 4K1XA 1HLDA 5EGSA 1L7EA 1NASA 1NT4A 2Z57A 2IY9A 3BGSA 3N7AA 4HHEA 3CF2A 3SEFA 4IF6A 2BR5A 1ODTC 5ENZA 4PC7A 1XEWX 1OHHA 3OE4A 3KQKA 1H2FA 1PT8A 1ZH0A 3T0FA 5CEJA 3QYAA 3WGNA 1H2BA 3MF4A 3NRJA 1KS2A 2CL5A 2YWJA 3VPCA 1UBHS 1J2TA 1UKBA 1VJRA 3CURA 4FYPA 3UA3A 3WS7A 3LT2A 4HEQA 4PTLA 2PGNA 4HGNA 3VDQA 3Q8LA 4D4HA 2HK7A 5DBEX 1QH8B 3IGFA 3K2IA 1T5DX 4O4JB 3GNTA 2RI1A 4KO2S 5E2AA 4MUKA 4MDHA 2ZBUA 4G63A 4HDSB 4MP6A 3K09A 1ZJ6A 4RCVA 4X97A 4ZTBA 1YRLA 4MUYA 4KOEC 2WABA 4PXYA 1CUFA 3VRHA 1CJMA 4IEEA 1JQDA 1D8AA 1AOXA 2XNHA 3EISA 1RCFA 2A1TS 1EJ2A 1SUPA 1WCYA 5CJPA 1JPVA 4I4TF 4DSTA 2VYNA 2UV8A 2ZAIA 4UNNA 4C05A 3GVXA 4B2LA 3O3NB 4FD3A 3A14A 1YE5A 1XZJA 4BLOA 2Z9BA 4KQHA 4F2HA 1HG1A 4HNUA 4O2BB 4INZA 4P34A 3KSZO 1QYVA 3ET5A 4U8GA 1A3CA 1SHTX 3EZFA 4YJGB 1NLFA 2PX0A 1WW8A 2BJHA 3AYZB 4BRZA 1UIMA 2FZGA 1M1YB 5EZYA 2HREA 1P2GA 4ZTUB 1IBCA 3RG8A 3HJTA 5JSZB 1UC8A 1ABFA 1NQXA 2H07A 3AM5A 3SHFA 3THXA 2EGGA 1RDFA 3MLBA 3DS8A 1VE9A 2ZI3A 1FPQA 1U80A 5CB4A 3LUDA 3RJTA 3J80A 5E4FA 1AUXA 3ZGLA 3QNWA 4D9MA 1GTG1 1XQXA 3L8FA 4L4ZA 1TJNA 5LXTA 2NG1A 2P3SA 3HKCA 4MP8A 3CRW1 2QTLA 4DCVA 2HIGA 3ESYA 1NAHA 4P3YA 2NUAA 2WSMA 3F6EX 4AICA 4ENTA 2W6PA 4M0DA 1E61A 2OKCA 3BERA 2CHFA 1J2UA 3O7MA 3QU2A 4RZ3A 4ARZA 1ILEA 2R7AA 3DL2A 3WYGA 4BX0A 3ZWDA 4CIXA 1Q7TA 2DU8A 4HI0E 2FQ1A 5JO0A 1L6IA 4H15A 2ZE6A 3SQOA 1CE8B 2TECE 2ZJ6A 1GLVA 4LRYA 4V3BA 4B85A 2HU2A 3HJFA 2XTZA 2C4KA 2R84A 4GRDA 1NMXA 2QN6A 5I7HA 1KJZA 4RPIA 2X7JA 1WD7A 4M0LA 1V5GA 3LG2A 2WJJA 1P3JA 1TYAE 3GLUA 1F2TA 4I1VA 5HA5A 4HNGA 1E8DA 4J7XA 1J24A 4OQLA 1KYWA 1OTXA 1RI5A 4F4IA 4LFBB 2FXIA 2LDXA 1PEAA 4HF7A 3QENA 5JNLA 2E1RA 1B6RA 1XLUA 5JU6A 3U1BA 3GFGA 5JNVA 1O0SA 1XQ6A 1ZK2A 4GWKA 4UVHA 1SFRA 3KJNA 3HLTA 3BK7A 2GN9A 5DLDA 2DUMA 2JEOA 3M82A 4HFJA 2QB5A 1HNZB 2D0OB 3EFOA 1NVAA 2FP3A 4MKZA 1YO6A 1BQ4A 1TJ3A 5E6UB 8GPBA 1C3VA 3L07A 3VC7A 4NPAA 1PJSA 3JU3A 4D8VA 1ECLA 1LVUA 2X22A 1HZZA 3K5HA 3NP7A 4HGRA 4QUBA 4M0FA 4XR9A 2F3TA 5KVCA 5DI3A 4EM6A 3ND9A 2O4UX 1RHUA 1RZ3A 2PX2A 1AZSC 3WGQA 2HCJB 2V58A 1JDTA 4CM1A 3EMVA 3E48A 1X7DA 1ENOA 1D04A 3EXHB 2J30A 1Y33E 4LI3X 4C04A 2EHDA 4I55B 2XQJA 1EESA 1HYHA 4RD0A 4DTIA 2Q28A 4N54A 4QXAA 3L7YA 5HZMA 2FKNA 3P2OA 2PJRA 4BX9A 4KH1A 1QIGA 2O2DA 1XMIA 4PS0A 2VHUA 3ZZ1A 3TJRA 5LQRA 1MXFA 4CV1A 4Z3OA 3FGPA 1O9BA 1XVTA 2HGSA 1Y4ZA 2FPLA 4E0BA 3ZGXA 2HN9A 5A03A 5HIJA 4ENPA 5J4VA 1M2OA 1ENYA 2NXJA 5EZYF 5FAXA 1PI3A 1UJ5A 3EFEA 5JC1A 4BLWA 4LJLA 1GKUB 3D6HA 1U9IA 2UVPB 1I8TA 2AZTA 3DYIA 4RD2A 1JJIA 5HW0A 1QHSA 2D59A 5HDQA 3IH5A 3Q3JB 2GD2A 3BKXA 3L2OB 3T5GA 2JASA 3WFIA 4BFUA 4DG9A 5B7PA 5CB4F 4U9IS 1RQXA 1ZOPA 4I08A 2B7BA 3R0VA 5LXTF 3RABA 4AG5A 4UTPA 4JJAA 2ZU6A 5HKBA 1IEWA 3BAFA 3ORQA 1VBNA 2H2DA 2QAGC 4BMNA 5KVAA 2PLRA 4GP6A 2D4HA 2CMGA 4BNUA 2WJAA 1GRNA 3NIBA 2UZ4A 2I87A 4EECA 3GUZA 3A10A 2XV1A 4EYSA 1GG8A 1X7GA 4XWGA 1E3TA 1E6CA 1LNSA 1DUVG 1YIDA 3RB8A 2DHEA 3DFMA 2E2WA 3QYFA 3MPUA 4H9GA 3I4FA 4U2DA 4ZOEA 4MVYA 4ZQHA 1NIPA 2G17A 3KKNA 3D3EA 3X1ZA 2PN1A 1Q0HA 2UYGA 5CIWA 2IL1A 4BNIA 3JAKA 4C1BA 1SVIA 1GU7A 4LMPA 1CG6A 1U9YA 2CYBA 3NV9A 4FI3F 1VJTA 3F6SA 3DBOB 4MVJM 2XXAB 2R7NA 1P1BA 1GSOA 1I3CA 3PE6A 3RHFA 1IN5A 5CR9A 3SAJA 2PMFA 5KYGA 4HYYA 2QF7A 3HN6A 5LLTA 3ANYB 1M2HA 1RQ2A 1E18A 3M89A 3NGLA 4IQ8A 4DR1B 1JUDA 2C3YA 2H57A 1DQZA 1FUYB 2QYHA 4KMRA 5HKOA 5EHZA 2UZAA 1LXCA 4CUZA 5EG5A 2UUPA 4EZEA 5C8YB 3DOJA 1X7ZB 2XE6A 5E7MA 2WYIA 1R9GA 4KB5A 2D00A 3MT8A 3MGCA 2GPTA 4J2OA 4RPLA 3S29A 1EWYA 4W6QA 3K0FA 4PX2A 4KDEA 1AY0A 1B41A 1PYGA 4NMXB 3ZCPA 5BR1A 2X19A 3UF0A 2XOKA 2AG8A 2WNSA 1ORDA 3S5JA 2G1PA 4ZVMA 2PNFA 3JALA 5IVPA 2A3RA 4UHFA 3DEKA 4Y1GA 2IHBA 2EW2A 5CT5A 4FZJA 2AD1A 2F48A 4UBMA 2TMDA 5TARA 1UZMA 3C5CA 4Z99A 3EBLA 3WYDA 4DRZA 1WE2A 1WWKA 1JLLA 4NAHA 4MB2A 2XMBA 4NOMA 2CVHA 4EGQA 2BDTA 3EA5A 4X44A 3H2JA 5A4MS 4BKPA 4N8SA 4NOLA 4PG7A 4QDKA 4YDRA 4EEKA 3OLCX 3FLEA 4ICIA 1E9VA 1K7EB 1T0JB 2P78A 1I0ZA 5J2UA 1GG9A 2LCFA 2RH4A 3DE1X 1H6CA 5K0TA 4UFPA 1D1QA 1MJGA 2JI8A 2NO7A 1JYSA 4B8WA 2BY4A 3G0BA 4MW0A 2NSJA 4ASUA 3PSHA 1UEXC 2MSKA 4C4ZA 3GF4A 1W581 4I19A 1AF7A 5LQMA 3W4KA 1QUEA 2JFQA 1KKLA 2DBRA 1Y0BA 2EEPA 5DLPA 3TCXB 2QPLA 5COQA 3V1TC 4JLDA 2ZCUA 5E3IA 2GJ4A 2XUIA 1U3TA 3I76A 3OA2A 4B40A 5L3SA 2P3LA 1CP2A 3C3XA 1TVKB 1Y3IA 2BKLA 3M9WA 2BFOA 3Q87B 4GEGA 1HWYA 4MR8B 3TVDA 1V71A 4C2BA 4DJDC 5IVKA 3M2TA 2VPXA 4NL4H 1VE6A 1W29A 2B82A 2XSZA 3DNPA 4WAUA 2DXIA 5L7WA 1UJ4A 4BO4A 4OHBA 1ZITA 1IOWA 5JROA 3I45A 3PFWO 2O4CA 4URZR 5B2EA 4FHCA 4F8YA 1QP4A 3CIFA 3ZHXA 2ORIA 5AVRA 1DAGA 3FB1A 5E2BA 3DMYA 4U7FA 4EY8A 5KTNA 2OGUA 4QQFA 4YAEA 2ZJ4A 3UJDA 3G7NA 1SWVA 5KVSA 3Q6IA 3EWNA 1ZGAA 3RFXA 4DYVA 4PAWA 4RGBA 2FQXA 1QVWA 4YFYA 1ZD5A 3K70C 2C00A 4L7QA 1YJQA 1THZA 3G2LA 2Q5IA 4O4IF 4RZHA 4KAFA 3BVPA 5ARDA 3R7DA 2F8SA 2A1UA 1ZS9A 3H7AA 4J8PA 3LC2O 1BMFD 5CDFA 5HIIA 3I2KA 2ZJBA 4BXOA 2KPOA 4WADA 2EERA 1TZ2A 1KSFX 2PL1A 3STWA 2DH5A 4ZD6A 3RSQA 3WWCA 5HRAA 3STYA 3QYPA 3ZQ6A 2OB2A 4BN0A 4L3WA 5JVDB 5AVKA 2VRCA 2GNOA 1SIBE 3T3IA 4NCKA 3H9GA 2REOA 4K9NA 5TMBA 1IYZA 4NONA 4CCAA 5BPHA 3U5TA 3MWYW 4ALNA 3LKBA 3TDKA 5CVCA 1HETA 2Z98A 3L7JA 5LBTA 2VBFA 2WPNA 2XJ9A 3ACCA 4ZEXA 1SO8A 3PFCA 1WAMA 4ZDWA 4REQA 1T9BA 2QORA 2YV3A 4J1NA 4LJ4A 4RHFA 4ZO4A 2IV2X 4N76A 2C4WA 4IDNA 4YMLA 4HN2A 5FORA 4TXLA 4YT5A 1Z0JA 4G23A 4TTIA 4PFKA 2FU5C 4CNBA 4F8JA 3DG9A 3HJCA 2NTJA 2JGDA 4TZTA 2YNMA 1ZH2A 3GLTA 4FR2A 1P31A 1EWTA 3DLCA 3RAFC 2BL4A 3M6WA 2ZJ1A 2CDNA 2WWVD 4NEQA 4C43A 4F3KA 3NBXX 1Z7WA 3HDGA 5J2UF 3ETDA 4OI2A 1NF2A 1H2YA 1CEQA 1WJGA 1XNJA 4CLXA 2WWRA 4YRLA 2P7IA 1PVVA 4NEHB 4KRYA 4D4MA 1B8VA 1VE3A 2Z5VA 1B8OA 3LTNC 2IZOA 3PNYA 1FJGB 3TPFA 1E3LA 3Q8MA 2APJA 4FNAA 3TRKA 4ESOA 5BNTA 2PX5A 4W9NC 4J3NA 3V4SA 2IHJA 2QP4A 1DE0A 3FUWA 1V1MB 1J4AA 2YIMA 2GHIA 3NAGA 3AEUB 2PY6A 3FYHA 1TLLA 3MVEA 5CX1A 1K1EA 4L0CA 3VMFA 5KDDA 5BMOA 3H2HA 3QUCA 3P9QA 1EIWA 2XCSB 2HRRA 2AK2A 5AW6A 3GLGA 1EFPA 3DAYA 5LN1A 3RUPA 4D25A 1A8HA 1MDFA 1EVEA 3B60A 3TIVA 5C9ZA 1QDLB 2PIAA 3KG2A 4ZT7A 4B3IA 3NH9A 4YGXB 4J7CA 3OURA 1EXNA 4OKSA 2FLKA 2O50A 1PV4A 3UH0A 1K3TA 1H4VB 2NO0A 3EGDB 3I2YX 3O2SB 1RMTA 4M53A 4OHMA 5EWJB 5KYWB 4KQCA 2AMVA 1PV2A 3FCSB 4XOUA 5IJ0B 4R2KA 2PH7A 1MAUA 4QODA 2EVWX 1R8JA 1OASA 2XYQA 2FPWA 3UWKA 1YK1A 1M7BA 2JFWA 4MKHA 1XCMA 5SICE 1G9SA 3ZKAA 4GPIB 2W43A 3EGOA 3ICCA 4EX6A 5BMVA 1EK5A 1V43A 4AKSA 3KDPA 3RBXA 5BSMA 4DA8A 3IMKA 4Z6KA 1KMCA 5G3YA 5J4LA 4PICA 4I66A 4LK2A 4Q3LA 3KEGA 3E0QA 3T7TA 5IXJA 2F1OA 1JEAA 4HFNA 4PLGA 4RQBA 1GQRA 4WK0B 3W9YA 1RAHA 1C8LA 3TNLA 1YR2A 1VBMA 4TMZA 3IBFA 2W6IA 3PVSA 5D5HA 1AVTA 2CB9A 1RAAA 3B5IA 3BTUA 4OI4A 3IUPA 1L5FA 3CZQA 5F12A 3S40A 5ABPA 2OBFA 1QP8A 4G6ZA 1Z34A 2H1FA 3LPLA 2H2HA 5KOJB 4NK4A 2CFRA 4XVQA 2R25B 3GT0A 5B3JC 1Q1ZA 5M3BA 2GA8A 2Q0HA 1UOPA 3H9QA 1ISHA 1HNNA 2J3IA 5BT8A 2NU8A 3D6VA 2ZB8A 5FADA 3TI7A 4MMXB 5B3KA 3TR5A 1WDKA 4PYRA 3ZIDA 2R9VA 1QG4A 4U0KA 4G8JA 4ZGWA 1JMVA 1JSZA 3PWTA 3UJ3X 3Q98A 4I5GA 3I0NA 3V1MA 2RARA 3PDIB 1GAXA 3PC8A 4ERNA 4GBJA 3OPXA 2JD2A 8AT1A 1F7VA 5I4CA 4FC6A 1GGJA 1S2LA 1KAQA 2PT9A 3PQ8A 4ZEOA 4B73A 2P2GA 2W6CX 3SYNA 2FMTA 4MGHA 3NPAA 2QTZA 4F3CA 3CMMA 1V3QE 2GEFA 5KPDA 2ONCA 1HX7A 1DJOA 3AKYA 1N75A 1YJAA 2ID7A 1LC3A 4RIGA 4IIJB 4S3MA 4M9ZA 5EP1A 5HCNA 6PFKA 4MUIA 2XXJA 4A10A 2QZSA 1ZN8A 1TJ4A 1PV1A 2XD4A 5SYMA 4L4SA 3ZU2A 3AGPA 1X94A 1TRHA 3N2YA 3AEKA 4JT8A 1CQPA 5NLLA 2OQ2A 1QQBA 4YJHB 3WICA 5JMWA 1XKQA 3KPYA 1X7YA 3E9RA 3WB9A 4QX6A 4ER3A 1QTIA 5TXGA 3QOXA 1W94A 1XDDA 2CKDA 1UANA 2VUUA 3DMTA 3GD5A 4JB2A 3R9KA 4MIOA 5IWCA 4MI9A 4YRFA 5ALVA 1QIJA 1R50A 3BKWA 4UPDA 5A0FA 3QE2A 2Z4SA 3ETHA 4ERXA 1N36B 1E7QA 3UTDA 1RHRA 1EFAA 2B1JA 2EW1A 1OYYA 3WDLA 1JAZA 2QL6A 1CQZA 3AF2A 3AOEA 1P19A 1IHDA 3HN7A 5LYJB 3A6PC 3A6KA 3V3KA 1Q50A 3MJHA 1Z26A 3FPBA 2IXBA 3T7KA 4ZDJA 1Q1NA 1VL5A 3RUFA 3SI7A 2XUHA 5BMVF 4UDYX 3ER8A 3GIWA 3ORYA 2AXQA 3MHTA 3ANNA 4ZU1X 2B78A 4Q3EA 2OQIA 2VAVA 3V8BA 5KMGA 2X7XA 4LHWA 2DUNA 2PUWA 1V16A 2W9XA 1LJUA 4H1VA 4PX5A 5IBCA 3RS3A 1JJFA 4KSYA 3Q3VA 2HZ7A 3PLNA 2BF7A 4UARA 2F00A 2WD8A 3CONA 4BV2A 5AM3A 1QOQB 3VDMA 1Z5OA 4XXHA 5KHAA 4ML3A 1V9CA 3LX5A 3V4RA 1VCOA 4H17A 4MGYR 5JH7B 3H2KA 3GLKA 4P81A 5JW6A 1CR0A 2ZYUX 5IAEA 1I7PA 2HR1A 4DQDA 3QVJA 4MRMA 1WY5A 5DT9A 1O6GA 1Y8RB 5K0SA 4I4IA 2I66A 5DGTA 5HRCA 5BN4B 4B3JA 1YB2A 4FJ2A 2WAAA 1TCUA 2QUHA 2ZJ5A 1NAIA 5KNCH 4AG6A 4ON9A 1KAGA 2IZ6A 4Q7KA 4U5XA 3EEOA 3K5PA 2P91A 2GZMA 3K9BA 4OL9A 5B7QA 5ALQA 4B3RB 2HSJA 1J0AA 5B2FA 5C5CA 3RS0A 4KFCA 3PNOA 4PYQA 4JYAB 1Z8NA 4O1MA 2X6TA 1WULS 3KWLA 1X1QA 3UAOA 3FFTA 1RRCA 4ZQEA 4AXXA 5FBLB 2ODTX 4NIMA 5A71A 1OLUB 3CLRC 4KODA 3N1UA 3DUWA 3MQFA 4LNHA 1XHFA 4CWAA 2HWYA 3AR4A 1QJCA 3CW2A 1JB1A 4TM7A 1XGKA 3PYLA 3S7ZA 3TE6A 2X0FA 3W78A 3ACDA 2JC3A 3AVVA 1MX3A 1O6BA 1Z73A 4C7OB 2V5VA 1YS6A 1WBDA 5L7YA 3OPYA 4IS3A 2ADFA 2BAGA 2X4DA 3VUFA 3DZIA 3RQSA 1W96A 1MV5A 1UCFA 4QPJC 1I36A 3EXAA 1GYRA 2OBNA 3P94A 2ZB2A 1E3JA 3JD3A 4L2IA 3ZTTA 4EJ2A 3UMFA 3DHYA 5KTMA 3ZX5A 3RFUA 3KPJA 4MWZA 5DJ5A 5DSTA 3R9WA 1T0IA 1O7JA 1W47A 1B42A 2H7YA 1USIA 3MD9A 4RF4A 3IURA 4C0LA 5F9HA 1L8AA 3OBIA 3HJHA 3ODGA 3OKPA 1XC7A 1OI2A 1FRFS 4NBNA 5CH5A 4DOMA 2C7QA 3IVCA 3HYRA 2P75A 2IS6A 4B3HA 4AJ1A 3URMA 3KOZA 5FUMA 1ZAYA 4RETA 1ORHA 1QGUB 5ALRA 1U0JA 1L3CA 1EHIA 3ZCVA 3AERB 1UOQA 2GERA 4AN4A 3VR6D 2C42A 1TK3A 2OV6A 2VK4A 3FNIA 5DRYA 1K0UA 5LQDA 4KI0A 1A97A 5HCIA 3RNOA 2ZE5A 3GROA 5JS7A 2CSXA 4B5LA 3KVNA 4HLDA 1N1GA 1FCJA 4EVQA 1KKMA 1QSGA 4DVGA 3NH6A 2QRMA 5A9SB 4PFJA 3BIXA 1D1SA 3PHLA 5BSFA 4WBNA 4B31A 2ERYA 1F8UA 5AW4A 3LQYA 2I22A 3OQJA 5CVEA 1MOPA 3KJGA 4DY6A 4OGWA 2AC2A 4JQCA 2WYUA 4NOJA 3PTZA 4NK5A 1Y98A 2D2VA 2ODQA 2PMWB 3A6DA 3MW8A 3JQ8A 2A5GA 1OXMA 5E3JA 4CN9A 4IM7A 5FR2A 5KDOA 1OMOA 1QV7A 1DIOB 3W7AA 2RB4A 3GK3A 2K7ZA 2W4QA 4FK8A 4CMHA 1W75A 4PLVA 2NIPA 3JQGB 1V1RB 4NZOA 4PR3A 3SDZA 4OOEA 4ETNA 3P9RA 3OQHA 3V33A 2VYVD 2JFNA 3O94A 4D8YA 5KAPA 3TEJA 3JY6A 1A82A 1BGWA 1EBUA 2D5AA 1NUUA 1NOJA 3NOOA 4IOKA 4D79A 4P22A 3GJRA 3PVCA 1PUXA 3HVIA 4Q1CA 4RDCA 4ZVOA 3ICQB 1DWOA 5F33A 3UJ8A 3FUTA 4OQNA 3VXKA 3PDWA 4MAFA 5DH9A 1LPMA 4IGEA 1PF7E 5CM8B 4ITVA 2I4LA 4MYUA 3TLBA 4RGYA 2XVXA 5TPZA 3VBCA 2PUEA 4FYXA 5EIBC 2I2AA 4JOSA 3OQMA 3ZCQA 2QN1A 1RKBA 2BFPA 4HZUA 4XQEA 1RBMA 5LQSA 2OD7A 4OXRA 3QA9A 3Q9LA 3QPBA 4Z3DA 3S6JA 1NVVQ 1WUJS 2QNRA 2JJMA 1CZLA 4O5AA 2X0EA 4MXDA 4D3FA 1K4MA 2AYYA 4QPDA 1DTWB 4IXTA 2WG0A 1YC5A 3GDWA 1FNNA 3N28A 1FP4A 4LDZA 1NF3A 4M7OA 5JAQA 3TAXA 1QHFA 4TRRA 1NX9A 1QP0A 2VNSA 1PJ8A 1T91A 4NHEA 3VZPA 1VA5A 3A1CA 2F1KA 4Y2VA 4LTNA 1NW8A 2AMLA 2WK1A 5BWMA 3W3AH 4RKFA 2F1RA 5JBQA 4Q4JA 3U3JA 2ZW9A 1BVUA 3LD9A 4NC9A 4QTZA 1ZCZA 5JMTA 2BMAA 2R68A 2C9CA 5JNUA 2AJCA 3L49A 4EJ0A 2FX3A 3BE8A 1Z6XA 4AMBA 1OBCA 3L8GA 1EVKA 1VI6A 1DIHA 2W2XA 3O82A 4GM0A 4OQZA 4Q9JA 1CR1A 3IR7A 1L7PA 4QD3A 1LK7A 4CT0A 3KZOA 4GBED 1GNQA 4I8DA 5ICEA 1HMPA 3QUAA 1YR1A 3GR6A 2RBEA 2B7LA 2G82A 3KDAA 4WSOA 2VVTA 3SE0A 2V5UA 4IXWA 4E5MA 2HIMA 4N4AA 4TVKA 2HLNA 4WBNF 1LDNA 4L9RA 5ER6A 4F2DA 3EWAA 4H1TA 5CFNA 3OE7A 3HP1A 4YRBA 5IANA 5K6AA 1C9EA 5AKKA 4BP1A 3OJOA 3IX7A 1I33A 2EKQA 2AXEA 1IUNA 1BVYF 1JHDA 2NZWA 3G13A 4KGVA 3MD0A 3WL7A 4P93A 4F86A 4OBXA 3DAFA 3E5MA 4AZ3B 1Q1QA 4EY7A 4YJ2B 2BMVA 2Q5FA 4HDRA 4J4TA 5CHEA 3UMJA 1NVWQ 1YSCA 4CVNA 3ZDZB 3E8XA 4EP1A 5TT0A 3U4DA 1J00A 2D1SA 1KI1A 4LJ6A 3PX2A 4OMCA 4A8JA 1AKQA 3VPHA 4B5KA 3LKZA 3QKTA 5J1SB 4ID3A 3IB6A 1GGNA 3D2CA 1PR1A 5KCZA 3WGJA 3HDVA 3V97A 1X6VA 3E9MA 3ZHBA 2HUNA 2C4UA 1OKKD 3P0HA 1DU4A 3ZH9B 3P5BA 5IAGA 5A6SB 3T7JA 4L0QA 1FRZA 3H2IA 5JD5A 1KEUA 2FUNB 3LCCA 1L5NA 2B35A 1V2HE 2DOKA 2CZQA 3OZFA 2WU1A 2WV7A 4LVNA 4HNHA 1JF8A 3OTGA 4UUQA 2CLIB 5BN3B 2UZ1B 3JTMA 3D6UA 5FA5A 2R8XA 2PH5A 4OH7A 4DIFA 4L85A 2D0IA 3IERA 3K6JA 3OD1A 3RHZA 3KC2A 1UMBB 1NJ1A 4H0CA 3RPEA 4XX0A 3T5MA 4LCBA 4K9OA 2PKEA 3C1TA 4FX2A 3VH2A 3PIRA 1YRHA 3A1FA 3EIHA 3ORHA 5DIZA 3VAYA 3WWDA 4XSGA 5FYQA 4Z4FA 2XZPA 2AJ8A 4FGLA 1PSZA 2INGX 5DLYA 4EDFA 3L4JA 4RM3A 3K1YA 4EW1A 1YZVA 4FDLA 3GRPA 4M9XA 1IOZA 1MOZA 3D4PA 4EPRA 4P5DA 4IKOA 2J9RA 4P82A 1ISRA 1T9DA 5A9TA 1AUQA 3HZHA 3KFVA 4Y6SA 1IM5A 1UPBA 4JELA 3MYRA 4KQGA 4EG5A 4JS0A 3SBXA 2C5BA 4I4CA 1QF7A 3ZY5A 3EVEA 5BYAA 5JAUA 3F7NA 1NMQA 1NXVA 1L8QA 3D7KA 3LVRE 4MR7A 2QRVA 2WTEA 1YKFA 5DYTA 1MEJA 2GF2A 1TT5B 2ZWVA 3BQ9A 2KX7A 3F78A 2CLMB 1FTNA 4I9UA 5EXTA 3UC9A 2PA3A 4JASB 3VR4H 4Q4CA 5BOSB 5C3MA 3Q9SA 5DM70 4C3ZA 1JQKA 1LGYA 1ZA2A 4IHJA 4QG7A 3LDHA 3B38A 4FEYA 3FPKA 2QM7A 4HB2A 1Y1KE 4RIFA 5A1TA 3CVXA 4HLUC 3IUMA 4FBLA 4A2CA 2F1HA 1PKEA 2PLAA 4LUCA 3UB4A 4IJ5A 1QQ7A 4X8LA 4F9EA 1UZAA 5DM2A 2ZWOA 1TVMA 2FMXA 3MWDB 4OUKX 5T8KC 1SKQA 1WF3A 1ZL2A 3HCBA 1WP9A 1OQAA 1M5TA 3VR5H 1WPQA 1RWBA 2P2LA 4CM4A 2GLTA 2G70A 4XFJA 5E4JA 1R7RA 4ZT6A 3BFJA 5ALJA 2QY6A 1RZRA 4JLOA 2AZXA 1JFTA 4EYOA 3WLHA 1GNTA 2IW1A 2E87A 4ZGGA 5LIPA 3W8DA 2WZQA 2ZSJA 2BUAA 5B6JA 4UPVA 4RORA 3PX7A 4LHZA 2ZSBA 1HEUA 2B36A 4LWQA 1QJ4A 2AFIB 2VPTA 3AWDA 4MVJG 3G2QA 4Z9XA 3LXMA 3OHPA 5CT4A 3DZCA 2AA3A 3MA0A 3T1TA 4W5QA 3T9FA 3WQRA 1TL7C 1QH0A 3C98A 5JI3E 3T3NA 1BWRA 3AINA 4HY3A 4MUXA 4N0MA 3OZUA 1J70A 3JQCA 5A5EA 3OI7A 2HEIA 3MS2A 4E5DA 2OO5C 1LRJA 2OENG 1W48A 1D2EA 4OH1A 4DJTA 1DT5A 5K45A 1ENZA 1E0SA 4DV1B 1XZMA 1P29A 2AFRA 2VNHA 1JT2A 2W6JD 3RTGA 1OFVA 1FFDA 1R0BA 3B7GA 3OKAA 4KE6A 3SC4A 3VFDA 5BN5B 4A0HA 4EHFA 4C0JA 4ZDKA 2B8WA 2QYOA 2R8BA 2QTRA 3JV7A 4JVMA 3HM2A 5E95A 1Y6FA 3RD5A 2J3KA 3NOQA 4GICA 4EAAA 1AM4D 2X4IA 4XARA 4URXR 3WNZA 1Y1LA 4UCFA 4C7MA 1N6RA 2WYHA 5CURA 1DAIA 2JLQA 4A4DA 2PBRA 2MYNA 2MMCA 5JASA 4KGXA 4N6GA 3SQWA 5A4FS 1OFTA 1SBIA 1UXIA 2BFEA 1VSTA 3MELA 4HX2A 3IAHA 4BFXA 2IYFA 3L41A 5BSWA 4Z53A 1JIVA 2RG7A 5J9FA 4MV1A 3B13B 3K31A 3M3PA 3RVKA 1YB4A 1VBKA 1S5PA 4IDEA 5AQEA 2O5EA 3PEFA 1P4AA 4KWTA 1Q0PA 4D6PA 1PLLA 3Q5EA 4NYIR 1JDBC 3WRXA 4TS9A 2I6QA 3AB3A 3CH6A 4YBRA 3LNCA 4WEQA 3ABSB 1LQTA 5BWOA 4P3KA 1RYEA 1E1MA 3G5TA 2ET6A 1D2GA 4B3BA 2ATIA 4NJMB 3JQRA 2QDKA 4FNOA 2RGEA 3DEFA 4IHJF 3R20A 5C81A 1VBFA 2RMKA 1P80A 3L77A 1H1LA 2AL7A 2G0NA 2IBMA 3OY2A 3PZRA 1WPGA 1V35A 4UTXA 1SC9A 1JEEA 2MYPA 4UTVA 1PCXA 3O1LA 4EHNA 3W0LB 2J48A 1L4EA 2B83A 4CGZA 1KE1A 2O2GA 2QI9F 3HYLA 4LDJA 2F90A 3E5NA 3B3AA 4FGKA 4ZOQI 1T6NA 3ZS8A 3RVRA 3JVUA 1Z8FA 3L6UA 3NDBB 1RRFA 3G8CA 5G0SA 3ND8A 1DTSA 2FSVA 3HPQA 2LR0A 1EUDA 4BDTA 3K5IA 2JK1A 5EQJB 4HDAA 6REQB 4KLRA 1V7ZA 3ESAA 4V1CA 3WA7A 1PK9A 2IP4A 4B09A 1Q0ZA 4B46A 4RPCA 1JKJB 3I2FA 3O4HA 5H4HA 3PEVA 3NORA 2ZZNA 1BH2A 4BVEA 2KW5A 3F73A 1N2JA 5CU7A 2WEKA 4FJ1A 4X8MA 1Z4NA 4XD7D 2J6HA 4U39A 2A88A 1OROA 4LZOA 3OQIB 3DJYA 4WFKA 5BSRA 5L3RA 4CN8A 2UXDB 4TMWA 1JSRA 3UUFA 4AWXA 3IJ5A 2VJCA 4DQLA 3KD2A 3ABOB 3UXMA 3UXHA 1QX4A 2C31A 1CUWA 2GZ2A 4NYMQ 3IR6A 1NMZA 4LOKA 3S2UA 4YMVA 5L8VA 1AE1A 5HQTA 3EARA 1D2AA 4MAMA 5AJVB 3UC5A 3PPWA 2BT4A 2DWQA 2PSJA 2AJBA 2V7VA 2VCHA 4D8XA 2B5VA 2JFXA 3HUEA 4TN1A 5B64A 3H1GA 2QENA 4PSUA 3HB4X 3HY4A 3LXUX 2ZQYA 4F85A 2ZETA 1EA5A 1N6NA 1AXRA 1VIDA 5CGQB 1UEIA 1U2DC 4U1RA 3IT0A 1VG9B 2J85A 3GJ3A 1AKWA 4AN0A 2W0SA 1JR4A 3SJ7A 3AL3A 5GP1A 3WAGA 1O1YA 1L1FA 4NSNA 4E6PA 2DT5A 1T9ZA 1OB5A 3IEVA 4DVJA 4A9AA 4II2A 4TV9A 1XRRA 2B9EA 2Z04A 3STUA 4DLLA 1NN3A 2FPPA 3CRZA 1M6NA 1NI4A 3O03A 2I71A 2BV3A 3PDJA 4WLUA 3K53A 4J43A 4ZYUA 1R4MA 2V5AA 1GZ7A 3C16C 4IDDA 1RKUA 3CN9A 3I04A 5K0GA 2Z6AA 1QLHA 2I55A 2MR6A 4EHKA 2CFIA 3AESA 1J5EB 4G89A 2KYRA 5FBVB 4ZT2A 2GCPA 2X7HA 1WB9A 3X1XA 3RVJA 4ARBA 1TA4A 2GXSA 1FX0A 5HFAA 3E15A 5IBRA 4DV7B 4X8OA 5T41A 5B36A 3BXZA 1SVLA 3RC2A 3KVYA 2GEVA 4J9UE 1K5HA 1RWNA 2F3SA 4HVAA 4M1KA 4RAOA 5JSUA 8OHMA 3NTRA 1DO8A 2IOHA 5H80A 1EZZA 5IASA 1HSZA 1LWNA 4JJIA 4G09A 2H2GA 4R83A 5K0FA 4MYSA 2BCEA 1YBMA 4LK3A 3TLZA 3ZBTA 3ZQUA 4QOIA 4D6YA 4QBHA 2HSWA 2ZJAA 4BLQA 2SNIE 1YI0A 1I3KA 1CHNA 1P60A 2FF5A 3ZHQA 2OCAA 3MGBA 3WHKA 1TA0A 2QTTA 4FCTA 2Q3JA 4HPWA 1OH6A 1MHTA 4X64B 2PRIA 2A9KA 2RGXA 2O0LA 2W8BA 2ZYIA 1WZCA 3T5PA 3L93A 5ALYA 3QXXA 1WXIA 2PQMA 3BMOB 5BSEA 3P9ZA 2FK8A 3F0TA 3EZYA 2O05A 4R01A 3TFWA 1C7IA 1B0AA 1O89A 1M8FA 3P19A 4CLOB 5GZ3A 2V0GA 1JDNA 1UJ6A 1UBJS 4QFDA 4H6XA 4GAEA 3WGZA 5CFLA 4HEA6 4RSRA 4E22A 2HF8A 1ZD3A 3K6SB 1LJ8A 1T1SA 2ZSDA 3A1VA 3I32A 3J7AC 1VPWA 4ZAVA 3KOWA 1GQFA 1LBTA 2AFVA 2PZEA 2XODA 4MQFB 2RG1A 4D8TA 3WZMA 4X94A 4R2IA 2HGZA 3LQ1A 1I7LA 4MNTA 2QL7A 2D5CA 3BQMB 5EEGA 2VJAA 4AIRA 5CFQA 1MLDA 3H6GA 4KQXA 4MW1A 5GMOA 4RZIA 2R6DA 2UKDA 4LV8B 5JY6A 2HDHA 1OZ0A 2JCVA 1SUEA 4KO8A 5B6IA 3X2EA 2VHYA 4BWVA 5KUTA 4IIHA 3AFIA 1P7YA 3ASYA 3ONWA 3LA8A 4TV9F 3E58A 1XEAA 5FBWB 1ZHOA 5LA6F 4L8WB 4OLJA 2OORA 2O2YA 3M5WA 3P26A 2ZBRA 2V7GA 4BN5A 5P21A 4PLTA 3I05A 4KJXA 3V4LA 1UKYA 2YTZA 1X19A 5EWMA 1E9DA 3PQ4A 1O54A 4NJEB 5L4LA 4AP9A 1P1JA 2AR9A 3ONNA 2MOKA 4GPTA 4FHZA 2FH5B 2VT3A 3BXEA 1QZUA 4QWMA 1YZHA 3KYJB 3F74A 5BYKA 1AGNA 1OA1A 4W7IA 1SOVA 2YWGA 4N6OA 1YASA 3HKBA 5F76A 2BHRA 4GDFA 1E9CA 2ROQA 4DYDA 2YN2A 5CLHA 1F3OA 2HO5A 4TV8A 4DM7A 1RC0A 4B71A 3GAFA 4YCNA 1C2TA 2HPHA 3MN1A 3LWZA 3QH4A 2FFRA 1EM8B 3KJIA 4CV2A 1R27A 1H2RS 5LWQA 4O08A 4QARA 2CZGA 2Q7OE 3C6QA 4LDQA 3FGNA 1SC3A 3A27A 4ER5A 1V1JA 2QN8A 3KZXA 3FBGA 1N5MA 3EAQA 3NANA 5IYZF 4FYYA 3T41A 2G7MC 2I7DA 3ZWBA 3IPLA 5JTUA 4EJ6A 1CUIA 3VV3A 2CE2X 5CT8A 3AONB 3FVTA 3CC8A 2G9VA 4O0MA 5F5LA 5LOVA 1C9KA 1T2EA 5DHAA 2OAEA 2XTNA 3S55A 3CLVA 2J33A 3E22A 1OV6A 1LLFA 2XMRA 3O75A 4EG6A 1GG5A 1BAPA 4Z4IA 3NBFA 2O8EA 1GPNA 2EKZA 2RKBA 2YMPA 2CWWA 5DM4A 4XIYA 3AZPA 2ZRNA 2WG2A 2HFKA 4BLUA 2WD7A 1YH3A 3R6DA 4JQYA 1W7AA 3S2SA 3WK4A 2V9PA 2RHMA 1KI4A 3FVVA 3DFZA 3WISA 4P4SA 1D7OA 1SVSA 2NV0A 1RJEA 1SRRA 1Q1AA 2WPDA 4G84A 3D2AA 1Z8DA 1ZEMA 1J33A 1ZY2A 3I6YA 4OK5A 5IARA 5F2KA 2V3CC 2I0FA 1RLTA 3HCOA 2NO1A 5K8CA 4IG4A 5BQPA 2PZGA 1SOWA 2GNPA 2BDEA 2G3YA 1NQVA 2KI5A 4HX9A 2PUVA 4UEJA 1U0FA 4XLLA 4RV9A 3AYXB 2V9ZA 3R3JA 4ND1A 4D4JA 5MF6A 1P2BA 2D2IA 4OCZA 1GFZA 2QLNA 2FN7A 3QLUA 5DNVA 5JNRA 4DWWA 2PBFA 2XWJI 5FWXA 2Z8YM 3A11A 3GO4A 4M83A 5ILGA 5A3JA 2O2JA 2GBIA 3TJMA 3ZU6A 4UDOA 1A9XB 4B80A 5C7LO 4P53A 5J2TB 1IZ0A 1I5OA 3WP1B 3P0JA 1C8BA 1T5LA 1JHUA 1Q5PA 2QN9A 3VU0A 1RAIA 2XF2A 3Q3IA 4ZGBA 3UN1A 1ISSA 4I81A 4HMPA 4CT4B 1OXTA 2O8CA 2PQ0A 4XWOA 5K8JB 1L5YA 3PGKA 4D0RA 2QTGA 1UBRS 2FPUA 2R1UA 1KJQA 3LUFA 4IH1A 1D09A 5EGNA 3UCFA 4CF6A 1XA0A 2XR1A 3GRRA 4K2AA 3KT6A 2IYUA 4G0OA 3HU5A 3DV0A 2J0EA 4GI3A 2CXUA 1TQ2A 2DLDA 2DJIA 3V2HA 4ND7A 3W8RA 2KWIA 4WNIA 4RVGA 4Y2UA 1D0VA 2WW8A 4HFMA 2WJGA 3FYUB 4TV8F 4PCAA 3KSUA 5TEWA 2YMMA 5CLIA 1SOUA 3ZVRA 3LT1A 1K9VF 2ZT7A 4RF3A 5HVNA 5I8ZA 4YCLA 3UWPA 1PZHA 1TUIA 3NC0C 3PUZA 3B1ZA 4GS5A 2O52A 5U4QA 2C58A 3PJRA 1ZP6A 5AK6A 4BV9A 1EQ2A 2ZUBA 4HPXB 221PA 2GD6A 1MB2A 5IDWA 1RTTA 2P9JA 2XTAA 3PLRA 5JHGB 1ND6A 1U7XA 4PSCA 3LX6A 2GN6A 4AY6A 5T64A 4B3DA 4E46A 3HBAA 5IN4A 3W6OA 1M6VB 1L7VC 4R1PA 1R4NA 2J3HA 1MORA 3RU9A 4DMCA 5LOVF 4P38A 4ZC1A 4RHTA 3AUXA 3W06A 1A2QA 1W76A 1DJQA 2E6UX 4CDNA 4J4HA 4P5EA 2DC1A 2EX1A 3BRQA 4M1EA 5JNWA 1A4IA 1VPVA 3DT9A 3R3YA 4I6JA 4TUYB 3REFA 1V7QA 3GLIE 2R66A 1T0UA 2ATVA 5ALKA 3G0HA 2G0TA 4HXFB 5F98A 2E5LB 1EAYA 1NZDA 2BGTA 1NBWB 1JYFA 1PS9A 1RWPA 4N9QA 2JIOA 3RI3A 4D9HA 2VDOB 2DHDA 4HGOA 1EP1B 1HFJA 2BEUB 2GARA 2IYAA 2JFOA 4J1TA 4LZJA 3DA8A 3V32A 4IZ6A 5KYXA 1B15A 4JI1B 4E1VA 2JDID 5JDIC 4RVCA 4N47A 2HRCA 1B8PA 5KQMA 1JBQA 3FNQA 3RC1A 1Z39A 1N3LA 4R84A 1QH1B 3ETEA 4WFIA 2NVUB 3UT5A 4QDZA 4W7SA 3IKTA 2QX8A 1WB4A 1T5HX 4O4HA 4D9NA 1MA3A 1UP6A 1W1WA 4XOIA 2OGWA 4XIIA 4B76A 4ZV4A 5K03A 4NV3A 2CV2A 2WWFA 1ZC4A 3DOCA 4JX8A 1CR2A 3LBYA 4P6VF 1U31A 5B7GA 1U1IA 3E0XA 3WLRA 4CKBB 5FJIA 1NVMB 1DKRA 1TB4A 1XTVA 3Q15C 5DYIA 1KZ7B 1UBSB 2VDQB 4FMDB 1GPKA 2W2PA 4H7KA 5KX5A 3DEJA 1TZCA 1M76A 4MUJA 4YAUA 4EMTA 4EG7A 3TZLA 4OEHA 2OILA 4H4DA 1Z7GA 1U2ZA 1XNQB 1VSVA 4QHSA 3N87A 2JHGA 1SULA 3THRA 5CW2A 2D7CA 4B3GA 3GDFA 2JAQA 4P3OA 4RCZA 5DTEA 2CJXA 3UANA 4LXXA 4B17A 1ENPA 1W0JA 2O8DB 5KYYB 4RHEA 1EWKA 3VUEA 4QZVA 4CLDA 1Q16A 2JIZD 2VTVA 2YXBA 3NOVA 3QELA 4TS4A 2YASA 4MLCA 3M3DA 1QIHA 5AVUA 4ZVUA 3OX3A 3D1LA 2ZUFA 2H4WA 4QATA 5EP3A 2XNDD 3MRSA 3PDHA 4F2WA 1VG8A 1A5BB 3KHUA 4YRTA 2DQKA 5F1PA 5I9LA 2XUZA 4AZ0A 2X76A 1W4RA 2ODWA 1XF1A 3GN2A 3PR2B 3RIGA 2XRMA 2GBFA 4HWPA 3O3MB 1KXZA 2SKDA 4IMRA 5ENVA 1S2DA 2WUGA 3DAOA 3LZ6A 1DG1G 5CBPA 2NZ2A 2CNNA 3W05A 1JIIA 4YRMA 2GZ3A 1AS2A 4GOKA 5DEOA 5AI0A 3INNA 2HMYB 1JE0A 2CMKA 5EWLB 1SQ0A 3WLTA 3NFRA 1OU4A 3O0DA 2Y6VA 4JWKA 4M9RA 3S2YA 3WDMA 2I5PO 4HL6A 5KWSA 2VXYA 2GPJA 1Z0SA 3L0CA 1PJQA 2OCBA 3M5PA 5KOHB 5IBPA 2YXLA 1KNQA 5CVUA 3O2JA 4LYYA 4IQ0A 4YAIA 3AILA 2JZNA 3WYBA 2VDKB 3IULA 1GRQA 4YAKA 4QAJA 5CYPA 2Q0QA 1EUCA 2QL9A 3COYA 1Z2EA 3KDSE 4X6UA 2ECPA 5HWSA 3KAPA 2J0VA 1XHEA 4CQJA 1SB9A 1XCPA 1SHZA 1UZLA 3LRTA 4NECA 1U8EA 1U8TA 4UHJA 1Z0UA 2G1UA 2O3RA 2X5KO 4RSGA 1C50A 5J23A 3PCRB 1ZMRA 3ED1A 3N07A 3OZEA 4O4HF 3WIBA 4W1QA 5B4TA 5KWEA 1J0EA 5AVWA 3JYQA 5LL6P 1RPNA 2WMOB 3IVRA 4V0NA 3TLEA 1BYIA 3OOJA 2JIPA 3QFTA 2QYTA 5BY2A 4EW2A 2CXRA 5IFLA 1AQ6A 4QO8A 1O77A 2WM2A 4PTZA 2DPLA 5ISMA 3BWVA 3PIIA 3T1VA 5ADWA 1BOFA 4J94A 4MW9A 1BOOA 3LL7A 4FLFA 1L7RA 2ZWIA 5KX5F 2Y1KA 2HWWA 3DWFA 5ULLA 3U7RA 3KUCA 1J20A 4JVOA 1BMQA 4E2WA 2IYNA 3SR4A 1OW3B 4AS2A 3GW8A 1KFEB 4KQWA 5HRUA 3LHFA 3TGWA 1N1EA 3O38A 5HFJA 1KBQA 3D5EA 2JH8A 2ISSD 2Y0CA 1GPH1 5F1OA 4DCMA 2JZOA 1ZGZA 3LCVB 2O8FA 1XQ9A 1UM9B 4W82A 4QPZA 4DIOA 3QFCA 2OG2A 2FWIA 2V0CA 2A4KA 3FNRA 4EGJA 4IVNA 1H2ZA 1Z4KA 1ODSA 5ESXA 2Z3ZA 4GKAA 3DDZX 4NICA 4JI5B 4HV4A 1XRJA 4C4AA 3TB4A 1NUTA 1PJ4A 4EFKA 4J9VA 3WC4A 1I5RA 5A5GA 4XASA 2O2SA 2ZI7A 2H1VA 2W7TA 3EVBA 4PQYA 5F64A 3EEQA 1OBVA 1X8XA 3WZLA 1CUYA 1RFGE 1YR7A 4MVJE 5FP0A 4C88A 4GVLA 1RABA 3DBLA 3FYSA 2H4HA 2HHAA 1JL3A 4AMZA 2BFWA 2REXB 3DMFA 4G65A 2GPSA 3KOMA 4IJQA 3CLUC 3D2LA 3LT0A 4ZCRA 1A69A 3IV6A 1PEDA 4FGSA 1TW3A 4W1PA 1TFUA 1UQTA 3A4NA 4MCJA 3ZN2A 5A02A 1N1DA 1UXKA 3ONDA 3ZCUA 2IJGX 3U2QA 2CDRA 2QTVA 2PAFA 2OYRA 4PEVA 3ZHVA 3DR3A 1KJNA 1NPTO 4M0CA 1YA4A 1Y42X 2X8JA 3E4DA 3KAKA 1KSGA 4WZAB 5MGBA 2JLAA 2XI4A 1RMQA 4INAA 4D7AA 2IS4A 2PYIA 1WKVA 2X13A 1YAHA 2VHTA 4NH4A 5DX8A 1I1HA 2P8JA 3I3SR 3ADOA 4JJ6A 4RY0A 5B30A 2AXPA 3OJXA 4LNUA 3CW8X 1KTVA 4ZAFA 4RMGA 1LW7A 4R1SA 4QGGA 3TEFA 5IXSA 2POQX 3RYIA 3BSWA 1POWA 5BNFA 5U4XA 2ACVA 2V4UA 3OCCA 4ZVSA 1HT2E 1JAIA 4U2GA 4JI6B 3PE3A 2P9CA 2IYXA 5HQ3B 4KQKA 1RRKA 4EFDA 4GHWA 1YRAA 2YCLA 1EXWA 3FTCA 1SXGA 2YJ4A 3U1TA 3VOTA 4C0WA 3MOGA 1IJKA 1LBSA 3PWKA 3F6RA 4W1SA 4X54A 4PPNA 3FVRA 1UBFA 4RW0A 3GQVA 5FLEX 2FLWA 1RI3A 4KFUA 1N5LA 2Z83A 3IDQA 1T4MA 4ZA2A 1VXOA 5M04A 2JLXA 4BC0A 4DC9A 2Q99A 3DMGA 4MX8A 3RWBA 1U9IC 4UD2A 2EP8A 3TKAA 3TWOA 2BBTA 3E9CA 1E6UA 1JR2A 3A9WA 3M2PA 3R2JA 4JC5A 1IBLB 1MRSA 4IZOA 4ND4A 1HA3A 5GM2A 4PLZA 2FSHA 4RPKA 1QG0A 4Q01A 2J3JA 5FNVB 2BMEA 3U7QB 3IHLA 3PRYA 1YHNA 2AQKA 3AR9A 4RF5A 1VL0A 4UVEA 4DXHA 4HBGA 1PX0A 2IY8A 1IY1A 2XUFA 2XA2A 2N47A 1K7FB 4LSMA 1ADYA 3RSCA 5M7EA 4NF2A 4ETIA 4B87A 4UDNA 2ACKA 2CHEA 2OZKA 2W71A 4ZK2A 1NKVA 4K6CA 4B79A 4JBYA 1Z06A 4D02A 3CT6A 1RRGA 2VA8A 2XAUA 3GCGA 3NIDB 1SMKA 5C1BA 1PWZA 2X9LA 3ZBQA 3KZNA 3DVLA 4EKDA 1KOJA 1L1QA 4UOZA 3LOPA 1N77A 2H9IA 3GJYA 4F04A 3GPBA 1RCUA 4L0DA 1KORA 1HT1E 2GPNA 3H42B 3PFGA 5AI6A 4PXAA 5DB4A 3C1UA 3LYLA 3GA7A 1YR9A 2A5JA 3RF7A 3PEWA 2IF0A 3G3EA 4JB3A 2I65A 1IEQA 2BEKA 3CISA 2EG5A 1C1DA 3BL8A 3HDTA 4PE5B 1IBKB 2XBUA 3EPRA 3MTGA 1B6SA 2E3JA 2W2TA 1LDMA 1C9DB 3B6EA 1CQWA 1LVHA 3Q0IA 5KS2A 4GYKA 1RZUA 1BDBA 4PANA 1NN5A 3HGMA 4Y98A 4CIAA 4BEVA 2ORWA 1JQEA 4F5ZA 4K9QA 2NP6A 2R00A 3HXKA 1K7CA 2OB1A 4KV7A 1K88A 1NURA 1AHHA 2NZXA 3QF4B 2AF4C 5FFFA 3SSNA 1Q1GA 3MM4A 1E9EA 4ANFA 2FAXA 2Y9MB 4GE3A 1K86A 1KPGA 2QE7A 5IJXA 1AUVA 3DMPA 5FT9A 4HUQB 2XKBA 5DZSA 4Z0PA 1NR1A 1R5BA 1V5EA 4G5SA 4BRUA 2WB2A 3FPAA 3UG7A 4DDTA 1D7AA 2ZJ2A 4KXMA 1M74A 5JEDA 1WIWA 2C0QA 1II8A 4B3CA 3TE7A 1Q2UA 2AFHA 5EUCA 4RTKA 4D0NA 1EE2A 2OZLB 2BFCA 3KLBA 3PUJA 4AT1A 4DN6A 1RHKA 2OFXA 1LLDA 3FFWA 5AVJA 2DJ5A 1Y8QB 2EYQA 3RE1A 1OJLA 4C6SA 3BWXA 5E6SB 5JMOA 2QTCA 1NVTA 2GTHA 4OI1A 5F9FA 1I6WA 1P4JA 4G36A 3CLKA 3KKMA 2QP9X 1H2EA 1LBIA 1JDVA 3IVMA 3KT3A 2VDWA 3VH3A 5TQ2A 4Q3KA 3VZDA 4A2PA 2PS9A 5JO9A 1LV7A 3L0ZA 3OZCA 2O2EA 4E11A 1BDMA 1FYFA 1R5OA 3MOSA 1R66A 3RVSA 3TAHA 3HVHA 2CNWA 4BRSA 2RIPA 3R3VA 2C2KA 1YQGA 3CNEA 3NKFA 5LKAA 5TS3A 4B81A 5G0VA 3WO0A 4UQPA 2Y1XA 2H7CA 2J4CA 2PWBA 3KJEA 3QVVA 1TQ8A 4WECA 4S1TA 5CAEA 2X8WA 2ZUCA 4HATA 5DXFA 1HE5A 1KO1A 3TRIA 4US2R 2OHHA 1G59A 4CGYA 3ZYZA 3TTWA 1MW9X 4IFIA 2VXOA 1GV0A 2IC5A 3H11B 2GH1A 3IOBA 2X1HA 4MA5A 3OAAD 4M4SA 4AMUA 1T8TA 3V4OA 5K7SA 5DO9A 4PONA 2ZTUA 3QVGA 4ER7A 5DN9A 2E4YA 1RJDA 1W88B 1OWLA 1G4UR 5EIFA 1A27A 2PGAA 1MAVA 1ZK0A 3B3FA 2EDCA 2Z5GA 3GRCA 1KI6A 4HTFA 3BD9A 5DTJA 5GM1A 4BCCA 4LG1A 5BV1A 4MIYA 4AQ7A 4LYDA 4MLDA 1QQTA 2QAIA 1EBBA 3I9V6 1BE1A 1K9SA 2VUHB 5I9TA 3D3KA 3ETCA 3TINA 2ZUUA 1ADJA 1HT0A 1AHPA 3Q85A 3BT7A 1UF9A 3M5CA 2ONKA 1QGAA 4EYGA 5H0IA 1D2MA 2WT4A 1VP3A 1ICEA 3P71T 4AWAA 2DBZA 1RJGA 3B7PA 4L57A 1B6GA 4LBYA 4XVCA 1Q57A 4NV1A 3I39X 1B23P 1Y8AA 4MARA 1YR6A 1OLXA 1YE8A 4QLBA 5DNYB 3AVWA 1O96A 1XLVA 1GT91 1JU9A 4HH1A 3U3XA 1BVHA 3BWBA 4HS9A 4UEQA 3W4IA 4EW6A 3EX7C 3FYTA 4DYHA 3LVFO 3O2QB 4AJ9A 2BEWB 4CG0A 3N2KA 3ZBPA 2POCA 1Z0FA 2JK0A 3TD6A 1E8NA 1NZJA 3BDIA 4DQKA 1DHTA 2H08A 2ZXFA 3IHWA 5FA6A 1N92A 2WF9A 2G67A 4DJEC 4HSEA 2ESRA 4E2XA 1O0CA 4LY0A 4AURA 3VZCA 3VJLA 5K0BA 4Y1RB 3B1VA 3KBOA 4M88A 2AX3A 3AUSA 1WCV1 4M99A 3GV0A 4D0SA 3E35A 1NVUQ 1ZVKA 5JCZA 4WT7A 3OM1A 1MV8A 3AFGA 3W5CA 2O07A 2QP3A 4A1OA 1P7WA 4JGBA 2I2DA 3NOXA 2R1VB 3KRTA 3L4BA 1YI1A 5EJ2A 1MJHA 3DDNA 4D99A 1XZGA 3P96A 4ZO8A 4X3PA 5E9QA 1UZNA 3DXFA 4CL8A 5FKJA 2J0UA 2REBA 1AU9A 4JMPA 4OA5A 5GINE 1CERA 4DSNA 4H3SA 5BW8A 3H5LA 5HF9A 4W99A 2BFNA 1E3MA 3ORRA 4LJAA 5CDYA 3UPTA 2CSUA 1TLTA 3ZE7A 3CF6R 4D26A 2EKDA 3HJUA 4GEKA 4IQ4A 4YP1A 2QX4A 4AZSA 1LPSA 3KQVA 2OXTA 4BIMA 4ZHSA 3OT1B 3QY9A 3AJRA